4PNCA

E. coli methionine aminopeptidase in complex with inhibitor 7-methoxy-2-methylen-3,4-dihydronaphthalen-1(2h)-one
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
262
structure length
262
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beta-aminoketones as prodrugs for selective irreversible inhibitors of type-1 methionine aminopeptidases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 88
structure length 262
sequence length 262
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4pncA00
1YW7A 2EVOA 5CDEA 1O0XA 2BWYA 2GGBA 1BN5A 3MX6A 1M35A 4RGZ1 4FUKA 5CLSA 4S00A 5CNXA 5FCFA 4FO7A 4U73A 4ZWOA 2GG5A 4A6VA 4ZNGA 4FKCA 1KQ0A 1KP0A 4FO8A 1WL9A 1YW8A 2B3KA 2GGCA 3CB5A 3PKAA 4S2TP 2NQ6A 2GU5A 2BN7A 4PNCA 5JHUA 1PV9A 2BWUA 1R58A 1C27A 2P98A 1QXWA 1WBQA 2EA4A 3IU9A 4U75A 4U6ZA 2Q8KA 1QZYA 1R5HA 2Q94A 5D6FA 3CB6A 5D6EA 1BOAA 1C21A 3TB5A 5JFRA 3L24A 2OAZA 1XGSA 2BB7A 2BHDA 2Q95A 2BH3A 1YW9A 2GG3A 2GG7A 3BIPA 4EGEA 5CDVA 3PKDA 2G6PA 4RZYA 2GG2A 4U1BA 3RORA 2EA2A 2BWSA 3MR1A 2BWVA 4MATA 2GZ5A 2V3YA 3BIQA 4IF7A 1XGOA 2GG0A 2EVCA 3FMRA 2ADUA 3L7GA 4OOKA 5FCHA 4FLJA 2BWTA 2GG8A 4U76A 2Q92A 1YJ3A 2GG9A 3Q6DA 4U6WA 4S2RP 1W2MA 1R5GA 3S6BA 1JAWA 4IDYA 3IU7A 4QR8A 5CIKA 1W7VA 1KQ9A 4S01A 1MATA 2P9AA 2B3HA 4PV4A 4B28A 1B59A 5JI6A 1WY2A 3BITA 4IKSA 3IU8A 2OKNA 2V3XA 4Z7MA 4IECA 2ZSGA 3IG4A 1XGNA 4FLKA 1QXZA 2BHBA 1N51A 2P99A 1XNZA 5CDLA 4KM3A 2DFIA 4U69A 3FM3A 4ZWPA 1WL6A 2GU7A 1CHMA 2IW2A 3D27A 3PKCA 5E5BA 4R60A 2Q96A 1C22A 4IKUA 2GU6A 4IU6A 4IKRA 4FLIA 3MATA 2B3LA 1YVMA 2MATA 4FLLA 4U71A 4ZWUA 1C23A 3CTZA 4A6WA 2V6CA 2NQ7A 1WKMA 2EVMA 4U6CA 3PKEA 2V3ZA 1Y1NA 1XGMA 4U6JA 1C24A 2GA2A 2GU4A 3RVAA 4JUQA 1QXYA 4U6EA 3TAVA 2HOWA 2BHAA 2GTXA 3PKBA 4RZZA 4IKTA 1WLRA 2BWXA 1WN1A 1B6AA 1A16A 4IPAA 5CE6A 2BHCA 4U70A 4HXXA 2Q93A 2BWWA 3FMQA
chains in the Genus database with same CATH superfamily
1YW7A 2EVOA 5CDEA 1O0XA 2BWYA 2GGBA 1BN5A 3MX6A 1M35A 4RGZ1 4FUKA 5CLSA 4S00A 5CNXA 5FCFA 4FO7A 4U73A 4ZWOA 2GG5A 4A6VA 4ZNGA 4FKCA 1KQ0A 1KP0A 4FO8A 1WL9A 1YW8A 2B3KA 2GGCA 3CB5A 3PKAA 4S2TP 2NQ6A 2GU5A 2BN7A 4PNCA 5JHUA 1PV9A 2BWUA 1R58A 1C27A 2P98A 1QXWA 1WBQA 2EA4A 3IU9A 4U75A 4U6ZA 2Q8KA 1QZYA 1R5HA 2Q94A 5D6FA 3CB6A 5D6EA 1BOAA 1C21A 3TB5A 5JFRA 3L24A 2OAZA 1XGSA 2BB7A 2BHDA 2Q95A 2BH3A 1YW9A 2GG3A 2GG7A 3BIPA 4EGEA 5CDVA 3PKDA 2G6PA 4RZYA 2GG2A 4U1BA 3RORA 2EA2A 2BWSA 3MR1A 2BWVA 4MATA 2GZ5A 2V3YA 3BIQA 4IF7A 1XGOA 2GG0A 2EVCA 3FMRA 2ADUA 3L7GA 4OOKA 5FCHA 4FLJA 2BWTA 2GG8A 4U76A 2Q92A 1YJ3A 2GG9A 3Q6DA 4U6WA 4S2RP 1W2MA 1R5GA 3S6BA 1JAWA 4IDYA 3IU7A 4QR8A 5CIKA 1W7VA 1KQ9A 4S01A 1MATA 2P9AA 2B3HA 4PV4A 4B28A 1B59A 5JI6A 1WY2A 3BITA 4IKSA 3IU8A 2OKNA 2V3XA 4Z7MA 4IECA 2ZSGA 3IG4A 1XGNA 4FLKA 1QXZA 2BHBA 1N51A 2P99A 1XNZA 5CDLA 4KM3A 2DFIA 4U69A 3FM3A 4ZWPA 1WL6A 2GU7A 1CHMA 2IW2A 3D27A 3PKCA 5E5BA 4R60A 2Q96A 1C22A 4IKUA 2GU6A 4IU6A 4IKRA 4FLIA 3MATA 2B3LA 1YVMA 2MATA 4FLLA 4U71A 4ZWUA 1C23A 3CTZA 4A6WA 2V6CA 2NQ7A 1WKMA 2EVMA 4U6CA 3PKEA 2V3ZA 1Y1NA 1XGMA 4U6JA 1C24A 2GA2A 2GU4A 3RVAA 4JUQA 1QXYA 4U6EA 3TAVA 2HOWA 2BHAA 2GTXA 3PKBA 4RZZA 4IKTA 1WLRA 2BWXA 1WN1A 1B6AA 1A16A 4IPAA 5CE6A 2BHCA 4U70A 4HXXA 2Q93A 2BWWA 3FMQA
chains in the Genus database with same CATH topology
1YW7A 2EVOA 5CDEA 1O0XA 2BWYA 2GGBA 1BN5A 3MX6A 1M35A 4RGZ1 4FUKA 5CLSA 4S00A 5CNXA 5FCFA 4FO7A 4U73A 4ZWOA 2GG5A 4A6VA 4ZNGA 4FKCA 1KQ0A 1KP0A 4FO8A 1WL9A 1YW8A 2B3KA 2GGCA 3CB5A 3PKAA 4S2TP 2NQ6A 2GU5A 2BN7A 4PNCA 5JHUA 1PV9A 2BWUA 1R58A 1C27A 2P98A 1QXWA 1WBQA 2EA4A 3IU9A 4U75A 4U6ZA 2Q8KA 1QZYA 1R5HA 2Q94A 5D6FA 3CB6A 5D6EA 1BOAA 1C21A 3TB5A 5JFRA 3L24A 2OAZA 1XGSA 2BB7A 2BHDA 2Q95A 2BH3A 1YW9A 2GG3A 2GG7A 3BIPA 4EGEA 5CDVA 3PKDA 2G6PA 4RZYA 2GG2A 4U1BA 3RORA 2EA2A 2BWSA 3MR1A 2BWVA 4MATA 2GZ5A 2V3YA 3BIQA 4IF7A 1XGOA 2GG0A 2EVCA 3FMRA 2ADUA 3L7GA 4OOKA 5FCHA 4FLJA 2BWTA 2GG8A 4U76A 2Q92A 1YJ3A 2GG9A 3Q6DA 4U6WA 4S2RP 1W2MA 1R5GA 3S6BA 1JAWA 4IDYA 3IU7A 4QR8A 5CIKA 1W7VA 1KQ9A 4S01A 1MATA 2P9AA 2B3HA 4PV4A 4B28A 1B59A 5JI6A 1WY2A 3BITA 4IKSA 3IU8A 2OKNA 2V3XA 4Z7MA 4IECA 2ZSGA 3IG4A 1XGNA 4FLKA 1QXZA 2BHBA 1N51A 2P99A 1XNZA 5CDLA 4KM3A 2DFIA 4U69A 3FM3A 4ZWPA 1WL6A 2GU7A 1CHMA 2IW2A 3D27A 3PKCA 5E5BA 4R60A 2Q96A 1C22A 4IKUA 2GU6A 4IU6A 4IKRA 4FLIA 3MATA 2B3LA 1YVMA 2MATA 4FLLA 4U71A 4ZWUA 1C23A 3CTZA 4A6WA 2V6CA 2NQ7A 1WKMA 2EVMA 4U6CA 3PKEA 2V3ZA 1Y1NA 1XGMA 4U6JA 1C24A 2GA2A 2GU4A 3RVAA 4JUQA 1QXYA 4U6EA 3TAVA 2HOWA 2BHAA 2GTXA 3PKBA 4RZZA 4IKTA 1WLRA 2BWXA 1WN1A 1B6AA 1A16A 4IPAA 5CE6A 2BHCA 4U70A 4HXXA 2Q93A 2BWWA 3FMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  2EVO A;  5CDE A;  1O0X A;  2BWY A;  2GGB A;  1BN5 A;  3MX6 A;  1M35 A;  4RGZ 1;  4FUK A;  5CLS A;  4S00 A;  5CNX A;  5FCF A;  4FO7 A;  4U73 A;  4ZWO A;  2GG5 A;  4A6V A;  4ZNG A;  4FKC A;  1KQ0 A;  1KP0 A;  4FO8 A;  1WL9 A;  1YW8 A;  2B3K A;  2GGC A;  3CB5 A;  3PKA A;  4S2T P;  2NQ6 A;  2GU5 A;  2BN7 A;  4PNC A;  5JHU A;  1PV9 A;  2BWU A;  1R58 A;  1C27 A;  2P98 A;  1QXW A;  1WBQ A;  2EA4 A;  3IU9 A;  4U75 A;  4U6Z A;  2Q8K A;  1QZY A;  1R5H A;  2Q94 A;  5D6F A;  3CB6 A;  5D6E A;  1BOA A;  1C21 A;  3TB5 A;  5JFR A;  3L24 A;  2OAZ A;  1XGS A;  2BB7 A;  2BHD A;  2Q95 A;  2BH3 A;  1YW9 A;  2GG3 A;  2GG7 A;  3BIP A;  4EGE A;  5CDV A;  3PKD A;  2G6P A;  4RZY A;  2GG2 A;  4U1B A;  3ROR A;  2EA2 A;  2BWS A;  3MR1 A;  2BWV A;  4MAT A;  2GZ5 A;  2V3Y A;  3BIQ A;  4IF7 A;  1XGO A;  2GG0 A;  2EVC A;  3FMR A;  2ADU A;  3L7G A;  4OOK A;  5FCH A;  4FLJ A;  2BWT A;  2GG8 A;  4U76 A;  2Q92 A;  1YJ3 A;  2GG9 A;  3Q6D A;  4U6W A;  4S2R P;  1W2M A;  1R5G A;  3S6B A;  1JAW A;  4IDY A;  3IU7 A;  4QR8 A;  5CIK A;  1W7V A;  1KQ9 A;  4S01 A;  1MAT A;  2P9A A;  2B3H A;  4PV4 A;  4B28 A;  1B59 A;  5JI6 A;  1WY2 A;  3BIT A;  4IKS A;  3IU8 A;  2OKN A;  2V3X A;  4Z7M A;  4IEC A;  2ZSG A;  3IG4 A;  1XGN A;  4FLK A;  1QXZ A;  2BHB A;  1N51 A;  2P99 A;  1XNZ A;  5CDL A;  4KM3 A;  2DFI A;  4U69 A;  3FM3 A;  4ZWP A;  1WL6 A;  2GU7 A;  1CHM A;  2IW2 A;  3D27 A;  3PKC A;  5E5B A;  4R60 A;  2Q96 A;  1C22 A;  4IKU A;  2GU6 A;  4IU6 A;  4IKR A;  4FLI A;  3MAT A;  2B3L A;  1YVM A;  2MAT A;  4FLL A;  4U71 A;  4ZWU A;  1C23 A;  3CTZ A;  4A6W A;  2V6C A;  2NQ7 A;  1WKM A;  2EVM A;  4U6C A;  3PKE A;  2V3Z A;  1Y1N A;  1XGM A;  4U6J A;  1C24 A;  2GA2 A;  2GU4 A;  3RVA A;  4JUQ A;  1QXY A;  4U6E A;  3TAV A;  2HOW A;  2BHA A;  2GTX A;  3PKB A;  4RZZ A;  4IKT A;  1WLR A;  2BWX A;  1WN1 A;  1B6A A;  1A16 A;  4IPA A;  5CE6 A;  2BHC A;  4U70 A;  4HXX A;  2Q93 A;  2BWW A;  3FMQ A; 
#chains in the Genus database with same CATH topology
 1YW7 A;  2EVO A;  5CDE A;  1O0X A;  2BWY A;  2GGB A;  1BN5 A;  3MX6 A;  1M35 A;  4RGZ 1;  4FUK A;  5CLS A;  4S00 A;  5CNX A;  5FCF A;  4FO7 A;  4U73 A;  4ZWO A;  2GG5 A;  4A6V A;  4ZNG A;  4FKC A;  1KQ0 A;  1KP0 A;  4FO8 A;  1WL9 A;  1YW8 A;  2B3K A;  2GGC A;  3CB5 A;  3PKA A;  4S2T P;  2NQ6 A;  2GU5 A;  2BN7 A;  4PNC A;  5JHU A;  1PV9 A;  2BWU A;  1R58 A;  1C27 A;  2P98 A;  1QXW A;  1WBQ A;  2EA4 A;  3IU9 A;  4U75 A;  4U6Z A;  2Q8K A;  1QZY A;  1R5H A;  2Q94 A;  5D6F A;  3CB6 A;  5D6E A;  1BOA A;  1C21 A;  3TB5 A;  5JFR A;  3L24 A;  2OAZ A;  1XGS A;  2BB7 A;  2BHD A;  2Q95 A;  2BH3 A;  1YW9 A;  2GG3 A;  2GG7 A;  3BIP A;  4EGE A;  5CDV A;  3PKD A;  2G6P A;  4RZY A;  2GG2 A;  4U1B A;  3ROR A;  2EA2 A;  2BWS A;  3MR1 A;  2BWV A;  4MAT A;  2GZ5 A;  2V3Y A;  3BIQ A;  4IF7 A;  1XGO A;  2GG0 A;  2EVC A;  3FMR A;  2ADU A;  3L7G A;  4OOK A;  5FCH A;  4FLJ A;  2BWT A;  2GG8 A;  4U76 A;  2Q92 A;  1YJ3 A;  2GG9 A;  3Q6D A;  4U6W A;  4S2R P;  1W2M A;  1R5G A;  3S6B A;  1JAW A;  4IDY A;  3IU7 A;  4QR8 A;  5CIK A;  1W7V A;  1KQ9 A;  4S01 A;  1MAT A;  2P9A A;  2B3H A;  4PV4 A;  4B28 A;  1B59 A;  5JI6 A;  1WY2 A;  3BIT A;  4IKS A;  3IU8 A;  2OKN A;  2V3X A;  4Z7M A;  4IEC A;  2ZSG A;  3IG4 A;  1XGN A;  4FLK A;  1QXZ A;  2BHB A;  1N51 A;  2P99 A;  1XNZ A;  5CDL A;  4KM3 A;  2DFI A;  4U69 A;  3FM3 A;  4ZWP A;  1WL6 A;  2GU7 A;  1CHM A;  2IW2 A;  3D27 A;  3PKC A;  5E5B A;  4R60 A;  2Q96 A;  1C22 A;  4IKU A;  2GU6 A;  4IU6 A;  4IKR A;  4FLI A;  3MAT A;  2B3L A;  1YVM A;  2MAT A;  4FLL A;  4U71 A;  4ZWU A;  1C23 A;  3CTZ A;  4A6W A;  2V6C A;  2NQ7 A;  1WKM A;  2EVM A;  4U6C A;  3PKE A;  2V3Z A;  1Y1N A;  1XGM A;  4U6J A;  1C24 A;  2GA2 A;  2GU4 A;  3RVA A;  4JUQ A;  1QXY A;  4U6E A;  3TAV A;  2HOW A;  2BHA A;  2GTX A;  3PKB A;  4RZZ A;  4IKT A;  1WLR A;  2BWX A;  1WN1 A;  1B6A A;  1A16 A;  4IPA A;  5CE6 A;  2BHC A;  4U70 A;  4HXX A;  2Q93 A;  2BWW A;  3FMQ A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  2EVO A;  5CDE A;  1O0X A;  2BWY A;  2GGB A;  1BN5 A;  3MX6 A;  1M35 A;  4RGZ 1;  4FUK A;  5CLS A;  4S00 A;  5CNX A;  5FCF A;  4FO7 A;  4U73 A;  4ZWO A;  2GG5 A;  4A6V A;  4ZNG A;  4FKC A;  1KQ0 A;  1KP0 A;  4FO8 A;  1WL9 A;  1YW8 A;  2B3K A;  2GGC A;  3CB5 A;  3PKA A;  4S2T P;  2NQ6 A;  2GU5 A;  2BN7 A;  4PNC A;  5JHU A;  1PV9 A;  2BWU A;  1R58 A;  1C27 A;  2P98 A;  1QXW A;  1WBQ A;  2EA4 A;  3IU9 A;  4U75 A;  4U6Z A;  2Q8K A;  1QZY A;  1R5H A;  2Q94 A;  5D6F A;  3CB6 A;  5D6E A;  1BOA A;  1C21 A;  3TB5 A;  5JFR A;  3L24 A;  2OAZ A;  1XGS A;  2BB7 A;  2BHD A;  2Q95 A;  2BH3 A;  1YW9 A;  2GG3 A;  2GG7 A;  3BIP A;  4EGE A;  5CDV A;  3PKD A;  2G6P A;  4RZY A;  2GG2 A;  4U1B A;  3ROR A;  2EA2 A;  2BWS A;  3MR1 A;  2BWV A;  4MAT A;  2GZ5 A;  2V3Y A;  3BIQ A;  4IF7 A;  1XGO A;  2GG0 A;  2EVC A;  3FMR A;  2ADU A;  3L7G A;  4OOK A;  5FCH A;  4FLJ A;  2BWT A;  2GG8 A;  4U76 A;  2Q92 A;  1YJ3 A;  2GG9 A;  3Q6D A;  4U6W A;  4S2R P;  1W2M A;  1R5G A;  3S6B A;  1JAW A;  4IDY A;  3IU7 A;  4QR8 A;  5CIK A;  1W7V A;  1KQ9 A;  4S01 A;  1MAT A;  2P9A A;  2B3H A;  4PV4 A;  4B28 A;  1B59 A;  5JI6 A;  1WY2 A;  3BIT A;  4IKS A;  3IU8 A;  2OKN A;  2V3X A;  4Z7M A;  4IEC A;  2ZSG A;  3IG4 A;  1XGN A;  4FLK A;  1QXZ A;  2BHB A;  1N51 A;  2P99 A;  1XNZ A;  5CDL A;  4KM3 A;  2DFI A;  4U69 A;  3FM3 A;  4ZWP A;  1WL6 A;  2GU7 A;  1CHM A;  2IW2 A;  3D27 A;  3PKC A;  5E5B A;  4R60 A;  2Q96 A;  1C22 A;  4IKU A;  2GU6 A;  4IU6 A;  4IKR A;  4FLI A;  3MAT A;  2B3L A;  1YVM A;  2MAT A;  4FLL A;  4U71 A;  4ZWU A;  1C23 A;  3CTZ A;  4A6W A;  2V6C A;  2NQ7 A;  1WKM A;  2EVM A;  4U6C A;  3PKE A;  2V3Z A;  1Y1N A;  1XGM A;  4U6J A;  1C24 A;  2GA2 A;  2GU4 A;  3RVA A;  4JUQ A;  1QXY A;  4U6E A;  3TAV A;  2HOW A;  2BHA A;  2GTX A;  3PKB A;  4RZZ A;  4IKT A;  1WLR A;  2BWX A;  1WN1 A;  1B6A A;  1A16 A;  4IPA A;  5CE6 A;  2BHC A;  4U70 A;  4HXX A;  2Q93 A;  2BWW A;  3FMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...