4U6JA

Hsmetap in complex with methionine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6jA00
3L7GA 4RGZ1 3TB5A 3RORA 3CB5A 3BIPA 4U6EA 2V3YA 3BIQA 2BHDA 1C27A 2Q94A 5D6FA 1XNZA 4A6WA 1M35A 5CDLA 2GG9A 2Q92A 1PV9A 2GTXA 3IG4A 1Y1NA 4IF7A 4R60A 3PKEA 1WL9A 2GA2A 2BWYA 4FLKA 1WBQA 4IKRA 1O0XA 1XGSA 1WKMA 2BWXA 4Z7MA 4OOKA 5FCFA 3L24A 4FLLA 4RZYA 2GU5A 2BB7A 4ZWPA 1W7VA 3PKBA 1YW9A 1YVMA 2DFIA 4A6VA 3TAVA 2NQ7A 4IDYA 3RVAA 4S2TP 1MATA 1QZYA 4MATA 2GZ5A 2EVOA 1KQ0A 3MATA 5CLSA 5CNXA 2GG7A 2BWTA 4FO7A 1XGMA 1YJ3A 2P99A 4U70A 4ZWOA 1QXWA 3Q6DA 2OAZA 3PKAA 2BWUA 5JHUA 2EA2A 4IU6A 1BOAA 4U6WA 3MR1A 2B3LA 4B28A 4EGEA 2BH3A 2BWSA 4U76A 2Q95A 3FMQA 4S2RP 4IPAA 4U6ZA 3FMRA 5CIKA 3CB6A 5JI6A 2GGCA 2B3HA 2BHBA 2GU6A 2Q8KA 1WN1A 5CE6A 1R5HA 2GU4A 3PKCA 1QXZA 4HXXA 2GG0A 5E5BA 1XGOA 1WY2A 4RZZA 4S01A 1C22A 2IW2A 2ADUA 4ZWUA 3MX6A 4FLJA 4U73A 1C21A 3CTZA 2ZSGA 1WL6A 1W2MA 2GGBA 3FM3A 4PNCA 4U1BA 2EVMA 4FLIA 3PKDA 1R58A 5FCHA 2NQ6A 2GG3A 5CDVA 2GU7A 1JAWA 4JUQA 1QXYA 3IU8A 1XGNA 1YW8A 2OKNA 3BITA 3IU9A 3D27A 2P9AA 2V3XA 1C24A 4QR8A 4ZNGA 2B3KA 1R5GA 4IECA 2EA4A 4U69A 1B59A 4FO8A 4IKTA 2G6PA 2GG8A 2MATA 4IKUA 4PV4A 1KQ9A 4U6CA 4S00A 2BWWA 1C23A 1B6AA 4U75A 4IKSA 2BWVA 2GG5A 4KM3A 1WLRA 4FKCA 1CHMA 2V6CA 4U71A 2BN7A 2Q93A 1KP0A 2EVCA 2P98A 2BHCA 1A16A 1YW7A 2GG2A 3IU7A 4U6JA 3S6BA 5CDEA 5JFRA 2V3ZA 2Q96A 5D6EA 1N51A 4FUKA 1BN5A 2BHAA 2HOWA
chains in the Genus database with same CATH superfamily
3L7GA 4RGZ1 3TB5A 3RORA 3CB5A 3BIPA 4U6EA 2V3YA 3BIQA 2BHDA 1C27A 2Q94A 5D6FA 1XNZA 4A6WA 1M35A 5CDLA 2GG9A 2Q92A 1PV9A 2GTXA 3IG4A 1Y1NA 4IF7A 4R60A 3PKEA 1WL9A 2GA2A 2BWYA 4FLKA 1WBQA 4IKRA 1O0XA 1XGSA 1WKMA 2BWXA 4Z7MA 4OOKA 5FCFA 3L24A 4FLLA 4RZYA 2GU5A 2BB7A 4ZWPA 1W7VA 3PKBA 1YW9A 1YVMA 2DFIA 4A6VA 3TAVA 2NQ7A 4IDYA 3RVAA 4S2TP 1MATA 1QZYA 4MATA 2GZ5A 2EVOA 1KQ0A 3MATA 5CLSA 5CNXA 2GG7A 2BWTA 4FO7A 1XGMA 1YJ3A 2P99A 4U70A 4ZWOA 1QXWA 3Q6DA 2OAZA 3PKAA 2BWUA 5JHUA 2EA2A 4IU6A 1BOAA 4U6WA 3MR1A 2B3LA 4B28A 4EGEA 2BH3A 2BWSA 4U76A 2Q95A 3FMQA 4S2RP 4IPAA 4U6ZA 3FMRA 5CIKA 3CB6A 5JI6A 2GGCA 2B3HA 2BHBA 2GU6A 2Q8KA 1WN1A 5CE6A 1R5HA 2GU4A 3PKCA 1QXZA 4HXXA 2GG0A 5E5BA 1XGOA 1WY2A 4RZZA 4S01A 1C22A 2IW2A 2ADUA 4ZWUA 3MX6A 4FLJA 4U73A 1C21A 3CTZA 2ZSGA 1WL6A 1W2MA 2GGBA 3FM3A 4PNCA 4U1BA 2EVMA 4FLIA 3PKDA 1R58A 5FCHA 2NQ6A 2GG3A 5CDVA 2GU7A 1JAWA 4JUQA 1QXYA 3IU8A 1XGNA 1YW8A 2OKNA 3BITA 3IU9A 3D27A 2P9AA 2V3XA 1C24A 4QR8A 4ZNGA 2B3KA 1R5GA 4IECA 2EA4A 4U69A 1B59A 4FO8A 4IKTA 2G6PA 2GG8A 2MATA 4IKUA 4PV4A 1KQ9A 4U6CA 4S00A 2BWWA 1C23A 1B6AA 4U75A 4IKSA 2BWVA 2GG5A 4KM3A 1WLRA 4FKCA 1CHMA 2V6CA 4U71A 2BN7A 2Q93A 1KP0A 2EVCA 2P98A 2BHCA 1A16A 1YW7A 2GG2A 3IU7A 4U6JA 3S6BA 5CDEA 5JFRA 2V3ZA 2Q96A 5D6EA 1N51A 4FUKA 1BN5A 2BHAA 2HOWA
chains in the Genus database with same CATH topology
3L7GA 4RGZ1 3TB5A 3RORA 3CB5A 3BIPA 4U6EA 2V3YA 3BIQA 2BHDA 1C27A 2Q94A 5D6FA 1XNZA 4A6WA 1M35A 5CDLA 2GG9A 2Q92A 1PV9A 2GTXA 3IG4A 1Y1NA 4IF7A 4R60A 3PKEA 1WL9A 2GA2A 2BWYA 4FLKA 1WBQA 4IKRA 1O0XA 1XGSA 1WKMA 2BWXA 4Z7MA 4OOKA 5FCFA 3L24A 4FLLA 4RZYA 2GU5A 2BB7A 4ZWPA 1W7VA 3PKBA 1YW9A 1YVMA 2DFIA 4A6VA 3TAVA 2NQ7A 4IDYA 3RVAA 4S2TP 1MATA 1QZYA 4MATA 2GZ5A 2EVOA 1KQ0A 3MATA 5CLSA 5CNXA 2GG7A 2BWTA 4FO7A 1XGMA 1YJ3A 2P99A 4U70A 4ZWOA 1QXWA 3Q6DA 2OAZA 3PKAA 2BWUA 5JHUA 2EA2A 4IU6A 1BOAA 4U6WA 3MR1A 2B3LA 4B28A 4EGEA 2BH3A 2BWSA 4U76A 2Q95A 3FMQA 4S2RP 4IPAA 4U6ZA 3FMRA 5CIKA 3CB6A 5JI6A 2GGCA 2B3HA 2BHBA 2GU6A 2Q8KA 1WN1A 5CE6A 1R5HA 2GU4A 3PKCA 1QXZA 4HXXA 2GG0A 5E5BA 1XGOA 1WY2A 4RZZA 4S01A 1C22A 2IW2A 2ADUA 4ZWUA 3MX6A 4FLJA 4U73A 1C21A 3CTZA 2ZSGA 1WL6A 1W2MA 2GGBA 3FM3A 4PNCA 4U1BA 2EVMA 4FLIA 3PKDA 1R58A 5FCHA 2NQ6A 2GG3A 5CDVA 2GU7A 1JAWA 4JUQA 1QXYA 3IU8A 1XGNA 1YW8A 2OKNA 3BITA 3IU9A 3D27A 2P9AA 2V3XA 1C24A 4QR8A 4ZNGA 2B3KA 1R5GA 4IECA 2EA4A 4U69A 1B59A 4FO8A 4IKTA 2G6PA 2GG8A 2MATA 4IKUA 4PV4A 1KQ9A 4U6CA 4S00A 2BWWA 1C23A 1B6AA 4U75A 4IKSA 2BWVA 2GG5A 4KM3A 1WLRA 4FKCA 1CHMA 2V6CA 4U71A 2BN7A 2Q93A 1KP0A 2EVCA 2P98A 2BHCA 1A16A 1YW7A 2GG2A 3IU7A 4U6JA 3S6BA 5CDEA 5JFRA 2V3ZA 2Q96A 5D6EA 1N51A 4FUKA 1BN5A 2BHAA 2HOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7G A;  4RGZ 1;  3TB5 A;  3ROR A;  3CB5 A;  3BIP A;  4U6E A;  2V3Y A;  3BIQ A;  2BHD A;  1C27 A;  2Q94 A;  5D6F A;  1XNZ A;  4A6W A;  1M35 A;  5CDL A;  2GG9 A;  2Q92 A;  1PV9 A;  2GTX A;  3IG4 A;  1Y1N A;  4IF7 A;  4R60 A;  3PKE A;  1WL9 A;  2GA2 A;  2BWY A;  4FLK A;  1WBQ A;  4IKR A;  1O0X A;  1XGS A;  1WKM A;  2BWX A;  4Z7M A;  4OOK A;  5FCF A;  3L24 A;  4FLL A;  4RZY A;  2GU5 A;  2BB7 A;  4ZWP A;  1W7V A;  3PKB A;  1YW9 A;  1YVM A;  2DFI A;  4A6V A;  3TAV A;  2NQ7 A;  4IDY A;  3RVA A;  4S2T P;  1MAT A;  1QZY A;  4MAT A;  2GZ5 A;  2EVO A;  1KQ0 A;  3MAT A;  5CLS A;  5CNX A;  2GG7 A;  2BWT A;  4FO7 A;  1XGM A;  1YJ3 A;  2P99 A;  4U70 A;  4ZWO A;  1QXW A;  3Q6D A;  2OAZ A;  3PKA A;  2BWU A;  5JHU A;  2EA2 A;  4IU6 A;  1BOA A;  4U6W A;  3MR1 A;  2B3L A;  4B28 A;  4EGE A;  2BH3 A;  2BWS A;  4U76 A;  2Q95 A;  3FMQ A;  4S2R P;  4IPA A;  4U6Z A;  3FMR A;  5CIK A;  3CB6 A;  5JI6 A;  2GGC A;  2B3H A;  2BHB A;  2GU6 A;  2Q8K A;  1WN1 A;  5CE6 A;  1R5H A;  2GU4 A;  3PKC A;  1QXZ A;  4HXX A;  2GG0 A;  5E5B A;  1XGO A;  1WY2 A;  4RZZ A;  4S01 A;  1C22 A;  2IW2 A;  2ADU A;  4ZWU A;  3MX6 A;  4FLJ A;  4U73 A;  1C21 A;  3CTZ A;  2ZSG A;  1WL6 A;  1W2M A;  2GGB A;  3FM3 A;  4PNC A;  4U1B A;  2EVM A;  4FLI A;  3PKD A;  1R58 A;  5FCH A;  2NQ6 A;  2GG3 A;  5CDV A;  2GU7 A;  1JAW A;  4JUQ A;  1QXY A;  3IU8 A;  1XGN A;  1YW8 A;  2OKN A;  3BIT A;  3IU9 A;  3D27 A;  2P9A A;  2V3X A;  1C24 A;  4QR8 A;  4ZNG A;  2B3K A;  1R5G A;  4IEC A;  2EA4 A;  4U69 A;  1B59 A;  4FO8 A;  4IKT A;  2G6P A;  2GG8 A;  2MAT A;  4IKU A;  4PV4 A;  1KQ9 A;  4U6C A;  4S00 A;  2BWW A;  1C23 A;  1B6A A;  4U75 A;  4IKS A;  2BWV A;  2GG5 A;  4KM3 A;  1WLR A;  4FKC A;  1CHM A;  2V6C A;  4U71 A;  2BN7 A;  2Q93 A;  1KP0 A;  2EVC A;  2P98 A;  2BHC A;  1A16 A;  1YW7 A;  2GG2 A;  3IU7 A;  4U6J A;  3S6B A;  5CDE A;  5JFR A;  2V3Z A;  2Q96 A;  5D6E A;  1N51 A;  4FUK A;  1BN5 A;  2BHA A;  2HOW A; 
#chains in the Genus database with same CATH topology
 3L7G A;  4RGZ 1;  3TB5 A;  3ROR A;  3CB5 A;  3BIP A;  4U6E A;  2V3Y A;  3BIQ A;  2BHD A;  1C27 A;  2Q94 A;  5D6F A;  1XNZ A;  4A6W A;  1M35 A;  5CDL A;  2GG9 A;  2Q92 A;  1PV9 A;  2GTX A;  3IG4 A;  1Y1N A;  4IF7 A;  4R60 A;  3PKE A;  1WL9 A;  2GA2 A;  2BWY A;  4FLK A;  1WBQ A;  4IKR A;  1O0X A;  1XGS A;  1WKM A;  2BWX A;  4Z7M A;  4OOK A;  5FCF A;  3L24 A;  4FLL A;  4RZY A;  2GU5 A;  2BB7 A;  4ZWP A;  1W7V A;  3PKB A;  1YW9 A;  1YVM A;  2DFI A;  4A6V A;  3TAV A;  2NQ7 A;  4IDY A;  3RVA A;  4S2T P;  1MAT A;  1QZY A;  4MAT A;  2GZ5 A;  2EVO A;  1KQ0 A;  3MAT A;  5CLS A;  5CNX A;  2GG7 A;  2BWT A;  4FO7 A;  1XGM A;  1YJ3 A;  2P99 A;  4U70 A;  4ZWO A;  1QXW A;  3Q6D A;  2OAZ A;  3PKA A;  2BWU A;  5JHU A;  2EA2 A;  4IU6 A;  1BOA A;  4U6W A;  3MR1 A;  2B3L A;  4B28 A;  4EGE A;  2BH3 A;  2BWS A;  4U76 A;  2Q95 A;  3FMQ A;  4S2R P;  4IPA A;  4U6Z A;  3FMR A;  5CIK A;  3CB6 A;  5JI6 A;  2GGC A;  2B3H A;  2BHB A;  2GU6 A;  2Q8K A;  1WN1 A;  5CE6 A;  1R5H A;  2GU4 A;  3PKC A;  1QXZ A;  4HXX A;  2GG0 A;  5E5B A;  1XGO A;  1WY2 A;  4RZZ A;  4S01 A;  1C22 A;  2IW2 A;  2ADU A;  4ZWU A;  3MX6 A;  4FLJ A;  4U73 A;  1C21 A;  3CTZ A;  2ZSG A;  1WL6 A;  1W2M A;  2GGB A;  3FM3 A;  4PNC A;  4U1B A;  2EVM A;  4FLI A;  3PKD A;  1R58 A;  5FCH A;  2NQ6 A;  2GG3 A;  5CDV A;  2GU7 A;  1JAW A;  4JUQ A;  1QXY A;  3IU8 A;  1XGN A;  1YW8 A;  2OKN A;  3BIT A;  3IU9 A;  3D27 A;  2P9A A;  2V3X A;  1C24 A;  4QR8 A;  4ZNG A;  2B3K A;  1R5G A;  4IEC A;  2EA4 A;  4U69 A;  1B59 A;  4FO8 A;  4IKT A;  2G6P A;  2GG8 A;  2MAT A;  4IKU A;  4PV4 A;  1KQ9 A;  4U6C A;  4S00 A;  2BWW A;  1C23 A;  1B6A A;  4U75 A;  4IKS A;  2BWV A;  2GG5 A;  4KM3 A;  1WLR A;  4FKC A;  1CHM A;  2V6C A;  4U71 A;  2BN7 A;  2Q93 A;  1KP0 A;  2EVC A;  2P98 A;  2BHC A;  1A16 A;  1YW7 A;  2GG2 A;  3IU7 A;  4U6J A;  3S6B A;  5CDE A;  5JFR A;  2V3Z A;  2Q96 A;  5D6E A;  1N51 A;  4FUK A;  1BN5 A;  2BHA A;  2HOW A; 
#chains in the Genus database with same CATH homology
 3L7G A;  4RGZ 1;  3TB5 A;  3ROR A;  3CB5 A;  3BIP A;  4U6E A;  2V3Y A;  3BIQ A;  2BHD A;  1C27 A;  2Q94 A;  5D6F A;  1XNZ A;  4A6W A;  1M35 A;  5CDL A;  2GG9 A;  2Q92 A;  1PV9 A;  2GTX A;  3IG4 A;  1Y1N A;  4IF7 A;  4R60 A;  3PKE A;  1WL9 A;  2GA2 A;  2BWY A;  4FLK A;  1WBQ A;  4IKR A;  1O0X A;  1XGS A;  1WKM A;  2BWX A;  4Z7M A;  4OOK A;  5FCF A;  3L24 A;  4FLL A;  4RZY A;  2GU5 A;  2BB7 A;  4ZWP A;  1W7V A;  3PKB A;  1YW9 A;  1YVM A;  2DFI A;  4A6V A;  3TAV A;  2NQ7 A;  4IDY A;  3RVA A;  4S2T P;  1MAT A;  1QZY A;  4MAT A;  2GZ5 A;  2EVO A;  1KQ0 A;  3MAT A;  5CLS A;  5CNX A;  2GG7 A;  2BWT A;  4FO7 A;  1XGM A;  1YJ3 A;  2P99 A;  4U70 A;  4ZWO A;  1QXW A;  3Q6D A;  2OAZ A;  3PKA A;  2BWU A;  5JHU A;  2EA2 A;  4IU6 A;  1BOA A;  4U6W A;  3MR1 A;  2B3L A;  4B28 A;  4EGE A;  2BH3 A;  2BWS A;  4U76 A;  2Q95 A;  3FMQ A;  4S2R P;  4IPA A;  4U6Z A;  3FMR A;  5CIK A;  3CB6 A;  5JI6 A;  2GGC A;  2B3H A;  2BHB A;  2GU6 A;  2Q8K A;  1WN1 A;  5CE6 A;  1R5H A;  2GU4 A;  3PKC A;  1QXZ A;  4HXX A;  2GG0 A;  5E5B A;  1XGO A;  1WY2 A;  4RZZ A;  4S01 A;  1C22 A;  2IW2 A;  2ADU A;  4ZWU A;  3MX6 A;  4FLJ A;  4U73 A;  1C21 A;  3CTZ A;  2ZSG A;  1WL6 A;  1W2M A;  2GGB A;  3FM3 A;  4PNC A;  4U1B A;  2EVM A;  4FLI A;  3PKD A;  1R58 A;  5FCH A;  2NQ6 A;  2GG3 A;  5CDV A;  2GU7 A;  1JAW A;  4JUQ A;  1QXY A;  3IU8 A;  1XGN A;  1YW8 A;  2OKN A;  3BIT A;  3IU9 A;  3D27 A;  2P9A A;  2V3X A;  1C24 A;  4QR8 A;  4ZNG A;  2B3K A;  1R5G A;  4IEC A;  2EA4 A;  4U69 A;  1B59 A;  4FO8 A;  4IKT A;  2G6P A;  2GG8 A;  2MAT A;  4IKU A;  4PV4 A;  1KQ9 A;  4U6C A;  4S00 A;  2BWW A;  1C23 A;  1B6A A;  4U75 A;  4IKS A;  2BWV A;  2GG5 A;  4KM3 A;  1WLR A;  4FKC A;  1CHM A;  2V6C A;  4U71 A;  2BN7 A;  2Q93 A;  1KP0 A;  2EVC A;  2P98 A;  2BHC A;  1A16 A;  1YW7 A;  2GG2 A;  3IU7 A;  4U6J A;  3S6B A;  5CDE A;  5JFR A;  2V3Z A;  2Q96 A;  5D6E A;  1N51 A;  4FUK A;  1BN5 A;  2BHA A;  2HOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...