4U6ZA

Hsmetap(f309m) in complex with 1-amino-2-propylpentyl)phosphonic acid
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 100
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u6zA00
2DFIA 5CDLA 1KQ0A 5D6EA 1QXYA 2GTXA 2P99A 3MX6A 4FLLA 4RZZA 4ZWUA 5E5BA 2GU7A 4R60A 4S01A 3BIPA 2GU6A 3RVAA 5CE6A 1Y1NA 4FUKA 2Q94A 2Q92A 2Q95A 1XGNA 4U1BA 1N51A 1R5GA 2NQ6A 5CLSA 4U6ZA 4IU6A 4IKTA 2BWSA 4FO7A 1XGOA 4U6CA 2OAZA 2BB7A 1JAWA 2B3KA 3PKEA 4U6WA 1BN5A 1WL9A 2P98A 2EVOA 1WKMA 2BWWA 4IECA 3FM3A 4S2TP 4U6EA 4QR8A 2BHCA 1C22A 1BOAA 2GG2A 2GG0A 4IKSA 1WY2A 5JHUA 2B3LA 4JUQA 1MATA 5FCFA 4IF7A 2GG8A 3TB5A 2BN7A 1YW7A 3CB6A 4ZWPA 5CDEA 2GU5A 1WL6A 3BITA 3CB5A 4U71A 1YW8A 2BWTA 1YVMA 2NQ7A 1R5HA 3PKBA 1W7VA 1A16A 2BWXA 4U6JA 2GG9A 3MR1A 3PKAA 2G6PA 1WN1A 4FLKA 3IU7A 4HXXA 5CNXA 4U75A 1C27A 1CHMA 2ADUA 1WLRA 4FLIA 4ZNGA 2BHDA 1KQ9A 3IG4A 4FLJA 1YW9A 3IU8A 5D6FA 2Q8KA 2V3XA 2EA4A 4U76A 1C24A 1KP0A 2MATA 3S6BA 1QZYA 1XNZA 1C23A 4U70A 2GG3A 1QXZA 1PV9A 3MATA 2B3HA 1QXWA 4MATA 3PKDA 2IW2A 4A6VA 3FMQA 4ZWOA 2EVCA 2GA2A 2EA2A 3FMRA 4Z7MA 4EGEA 2GZ5A 4A6WA 2GU4A 4PV4A 2HOWA 5CIKA 1W2MA 4IKUA 4RGZ1 2BHAA 2EVMA 1R58A 1B6AA 4FO8A 5JFRA 3L7GA 1WBQA 2P9AA 4B28A 4IDYA 2V3YA 3D27A 1YJ3A 5JI6A 2Q96A 4OOKA 2BHBA 1XGSA 2OKNA 4RZYA 2GG5A 2GGCA 2GGBA 4FKCA 2BWVA 4KM3A 4U73A 5CDVA 2V3ZA 1XGMA 3Q6DA 3IU9A 4IKRA 4S2RP 1O0XA 2Q93A 1C21A 2ZSGA 4S00A 2BWUA 2GG7A 1M35A 3CTZA 3PKCA 3TAVA 2V6CA 5FCHA 2BWYA 4IPAA 4PNCA 2BH3A 3BIQA 4U69A 1B59A 3RORA 3L24A
chains in the Genus database with same CATH superfamily
2DFIA 5CDLA 1KQ0A 5D6EA 1QXYA 2GTXA 2P99A 3MX6A 4FLLA 4RZZA 4ZWUA 5E5BA 2GU7A 4R60A 4S01A 3BIPA 2GU6A 3RVAA 5CE6A 1Y1NA 4FUKA 2Q94A 2Q92A 2Q95A 1XGNA 4U1BA 1N51A 1R5GA 2NQ6A 5CLSA 4U6ZA 4IU6A 4IKTA 2BWSA 4FO7A 1XGOA 4U6CA 2OAZA 2BB7A 1JAWA 2B3KA 3PKEA 4U6WA 1BN5A 1WL9A 2P98A 2EVOA 1WKMA 2BWWA 4IECA 3FM3A 4S2TP 4U6EA 4QR8A 2BHCA 1C22A 1BOAA 2GG2A 2GG0A 4IKSA 1WY2A 5JHUA 2B3LA 4JUQA 1MATA 5FCFA 4IF7A 2GG8A 3TB5A 2BN7A 1YW7A 3CB6A 4ZWPA 5CDEA 2GU5A 1WL6A 3BITA 3CB5A 4U71A 1YW8A 2BWTA 1YVMA 2NQ7A 1R5HA 3PKBA 1W7VA 1A16A 2BWXA 4U6JA 2GG9A 3MR1A 3PKAA 2G6PA 1WN1A 4FLKA 3IU7A 4HXXA 5CNXA 4U75A 1C27A 1CHMA 2ADUA 1WLRA 4FLIA 4ZNGA 2BHDA 1KQ9A 3IG4A 4FLJA 1YW9A 3IU8A 5D6FA 2Q8KA 2V3XA 2EA4A 4U76A 1C24A 1KP0A 2MATA 3S6BA 1QZYA 1XNZA 1C23A 4U70A 2GG3A 1QXZA 1PV9A 3MATA 2B3HA 1QXWA 4MATA 3PKDA 2IW2A 4A6VA 3FMQA 4ZWOA 2EVCA 2GA2A 2EA2A 3FMRA 4Z7MA 4EGEA 2GZ5A 4A6WA 2GU4A 4PV4A 2HOWA 5CIKA 1W2MA 4IKUA 4RGZ1 2BHAA 2EVMA 1R58A 1B6AA 4FO8A 5JFRA 3L7GA 1WBQA 2P9AA 4B28A 4IDYA 2V3YA 3D27A 1YJ3A 5JI6A 2Q96A 4OOKA 2BHBA 1XGSA 2OKNA 4RZYA 2GG5A 2GGCA 2GGBA 4FKCA 2BWVA 4KM3A 4U73A 5CDVA 2V3ZA 1XGMA 3Q6DA 3IU9A 4IKRA 4S2RP 1O0XA 2Q93A 1C21A 2ZSGA 4S00A 2BWUA 2GG7A 1M35A 3CTZA 3PKCA 3TAVA 2V6CA 5FCHA 2BWYA 4IPAA 4PNCA 2BH3A 3BIQA 4U69A 1B59A 3RORA 3L24A
chains in the Genus database with same CATH topology
2DFIA 5CDLA 1KQ0A 5D6EA 1QXYA 2GTXA 2P99A 3MX6A 4FLLA 4RZZA 4ZWUA 5E5BA 2GU7A 4R60A 4S01A 3BIPA 2GU6A 3RVAA 5CE6A 1Y1NA 4FUKA 2Q94A 2Q92A 2Q95A 1XGNA 4U1BA 1N51A 1R5GA 2NQ6A 5CLSA 4U6ZA 4IU6A 4IKTA 2BWSA 4FO7A 1XGOA 4U6CA 2OAZA 2BB7A 1JAWA 2B3KA 3PKEA 4U6WA 1BN5A 1WL9A 2P98A 2EVOA 1WKMA 2BWWA 4IECA 3FM3A 4S2TP 4U6EA 4QR8A 2BHCA 1C22A 1BOAA 2GG2A 2GG0A 4IKSA 1WY2A 5JHUA 2B3LA 4JUQA 1MATA 5FCFA 4IF7A 2GG8A 3TB5A 2BN7A 1YW7A 3CB6A 4ZWPA 5CDEA 2GU5A 1WL6A 3BITA 3CB5A 4U71A 1YW8A 2BWTA 1YVMA 2NQ7A 1R5HA 3PKBA 1W7VA 1A16A 2BWXA 4U6JA 2GG9A 3MR1A 3PKAA 2G6PA 1WN1A 4FLKA 3IU7A 4HXXA 5CNXA 4U75A 1C27A 1CHMA 2ADUA 1WLRA 4FLIA 4ZNGA 2BHDA 1KQ9A 3IG4A 4FLJA 1YW9A 3IU8A 5D6FA 2Q8KA 2V3XA 2EA4A 4U76A 1C24A 1KP0A 2MATA 3S6BA 1QZYA 1XNZA 1C23A 4U70A 2GG3A 1QXZA 1PV9A 3MATA 2B3HA 1QXWA 4MATA 3PKDA 2IW2A 4A6VA 3FMQA 4ZWOA 2EVCA 2GA2A 2EA2A 3FMRA 4Z7MA 4EGEA 2GZ5A 4A6WA 2GU4A 4PV4A 2HOWA 5CIKA 1W2MA 4IKUA 4RGZ1 2BHAA 2EVMA 1R58A 1B6AA 4FO8A 5JFRA 3L7GA 1WBQA 2P9AA 4B28A 4IDYA 2V3YA 3D27A 1YJ3A 5JI6A 2Q96A 4OOKA 2BHBA 1XGSA 2OKNA 4RZYA 2GG5A 2GGCA 2GGBA 4FKCA 2BWVA 4KM3A 4U73A 5CDVA 2V3ZA 1XGMA 3Q6DA 3IU9A 4IKRA 4S2RP 1O0XA 2Q93A 1C21A 2ZSGA 4S00A 2BWUA 2GG7A 1M35A 3CTZA 3PKCA 3TAVA 2V6CA 5FCHA 2BWYA 4IPAA 4PNCA 2BH3A 3BIQA 4U69A 1B59A 3RORA 3L24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFI A;  5CDL A;  1KQ0 A;  5D6E A;  1QXY A;  2GTX A;  2P99 A;  3MX6 A;  4FLL A;  4RZZ A;  4ZWU A;  5E5B A;  2GU7 A;  4R60 A;  4S01 A;  3BIP A;  2GU6 A;  3RVA A;  5CE6 A;  1Y1N A;  4FUK A;  2Q94 A;  2Q92 A;  2Q95 A;  1XGN A;  4U1B A;  1N51 A;  1R5G A;  2NQ6 A;  5CLS A;  4U6Z A;  4IU6 A;  4IKT A;  2BWS A;  4FO7 A;  1XGO A;  4U6C A;  2OAZ A;  2BB7 A;  1JAW A;  2B3K A;  3PKE A;  4U6W A;  1BN5 A;  1WL9 A;  2P98 A;  2EVO A;  1WKM A;  2BWW A;  4IEC A;  3FM3 A;  4S2T P;  4U6E A;  4QR8 A;  2BHC A;  1C22 A;  1BOA A;  2GG2 A;  2GG0 A;  4IKS A;  1WY2 A;  5JHU A;  2B3L A;  4JUQ A;  1MAT A;  5FCF A;  4IF7 A;  2GG8 A;  3TB5 A;  2BN7 A;  1YW7 A;  3CB6 A;  4ZWP A;  5CDE A;  2GU5 A;  1WL6 A;  3BIT A;  3CB5 A;  4U71 A;  1YW8 A;  2BWT A;  1YVM A;  2NQ7 A;  1R5H A;  3PKB A;  1W7V A;  1A16 A;  2BWX A;  4U6J A;  2GG9 A;  3MR1 A;  3PKA A;  2G6P A;  1WN1 A;  4FLK A;  3IU7 A;  4HXX A;  5CNX A;  4U75 A;  1C27 A;  1CHM A;  2ADU A;  1WLR A;  4FLI A;  4ZNG A;  2BHD A;  1KQ9 A;  3IG4 A;  4FLJ A;  1YW9 A;  3IU8 A;  5D6F A;  2Q8K A;  2V3X A;  2EA4 A;  4U76 A;  1C24 A;  1KP0 A;  2MAT A;  3S6B A;  1QZY A;  1XNZ A;  1C23 A;  4U70 A;  2GG3 A;  1QXZ A;  1PV9 A;  3MAT A;  2B3H A;  1QXW A;  4MAT A;  3PKD A;  2IW2 A;  4A6V A;  3FMQ A;  4ZWO A;  2EVC A;  2GA2 A;  2EA2 A;  3FMR A;  4Z7M A;  4EGE A;  2GZ5 A;  4A6W A;  2GU4 A;  4PV4 A;  2HOW A;  5CIK A;  1W2M A;  4IKU A;  4RGZ 1;  2BHA A;  2EVM A;  1R58 A;  1B6A A;  4FO8 A;  5JFR A;  3L7G A;  1WBQ A;  2P9A A;  4B28 A;  4IDY A;  2V3Y A;  3D27 A;  1YJ3 A;  5JI6 A;  2Q96 A;  4OOK A;  2BHB A;  1XGS A;  2OKN A;  4RZY A;  2GG5 A;  2GGC A;  2GGB A;  4FKC A;  2BWV A;  4KM3 A;  4U73 A;  5CDV A;  2V3Z A;  1XGM A;  3Q6D A;  3IU9 A;  4IKR A;  4S2R P;  1O0X A;  2Q93 A;  1C21 A;  2ZSG A;  4S00 A;  2BWU A;  2GG7 A;  1M35 A;  3CTZ A;  3PKC A;  3TAV A;  2V6C A;  5FCH A;  2BWY A;  4IPA A;  4PNC A;  2BH3 A;  3BIQ A;  4U69 A;  1B59 A;  3ROR A;  3L24 A; 
#chains in the Genus database with same CATH topology
 2DFI A;  5CDL A;  1KQ0 A;  5D6E A;  1QXY A;  2GTX A;  2P99 A;  3MX6 A;  4FLL A;  4RZZ A;  4ZWU A;  5E5B A;  2GU7 A;  4R60 A;  4S01 A;  3BIP A;  2GU6 A;  3RVA A;  5CE6 A;  1Y1N A;  4FUK A;  2Q94 A;  2Q92 A;  2Q95 A;  1XGN A;  4U1B A;  1N51 A;  1R5G A;  2NQ6 A;  5CLS A;  4U6Z A;  4IU6 A;  4IKT A;  2BWS A;  4FO7 A;  1XGO A;  4U6C A;  2OAZ A;  2BB7 A;  1JAW A;  2B3K A;  3PKE A;  4U6W A;  1BN5 A;  1WL9 A;  2P98 A;  2EVO A;  1WKM A;  2BWW A;  4IEC A;  3FM3 A;  4S2T P;  4U6E A;  4QR8 A;  2BHC A;  1C22 A;  1BOA A;  2GG2 A;  2GG0 A;  4IKS A;  1WY2 A;  5JHU A;  2B3L A;  4JUQ A;  1MAT A;  5FCF A;  4IF7 A;  2GG8 A;  3TB5 A;  2BN7 A;  1YW7 A;  3CB6 A;  4ZWP A;  5CDE A;  2GU5 A;  1WL6 A;  3BIT A;  3CB5 A;  4U71 A;  1YW8 A;  2BWT A;  1YVM A;  2NQ7 A;  1R5H A;  3PKB A;  1W7V A;  1A16 A;  2BWX A;  4U6J A;  2GG9 A;  3MR1 A;  3PKA A;  2G6P A;  1WN1 A;  4FLK A;  3IU7 A;  4HXX A;  5CNX A;  4U75 A;  1C27 A;  1CHM A;  2ADU A;  1WLR A;  4FLI A;  4ZNG A;  2BHD A;  1KQ9 A;  3IG4 A;  4FLJ A;  1YW9 A;  3IU8 A;  5D6F A;  2Q8K A;  2V3X A;  2EA4 A;  4U76 A;  1C24 A;  1KP0 A;  2MAT A;  3S6B A;  1QZY A;  1XNZ A;  1C23 A;  4U70 A;  2GG3 A;  1QXZ A;  1PV9 A;  3MAT A;  2B3H A;  1QXW A;  4MAT A;  3PKD A;  2IW2 A;  4A6V A;  3FMQ A;  4ZWO A;  2EVC A;  2GA2 A;  2EA2 A;  3FMR A;  4Z7M A;  4EGE A;  2GZ5 A;  4A6W A;  2GU4 A;  4PV4 A;  2HOW A;  5CIK A;  1W2M A;  4IKU A;  4RGZ 1;  2BHA A;  2EVM A;  1R58 A;  1B6A A;  4FO8 A;  5JFR A;  3L7G A;  1WBQ A;  2P9A A;  4B28 A;  4IDY A;  2V3Y A;  3D27 A;  1YJ3 A;  5JI6 A;  2Q96 A;  4OOK A;  2BHB A;  1XGS A;  2OKN A;  4RZY A;  2GG5 A;  2GGC A;  2GGB A;  4FKC A;  2BWV A;  4KM3 A;  4U73 A;  5CDV A;  2V3Z A;  1XGM A;  3Q6D A;  3IU9 A;  4IKR A;  4S2R P;  1O0X A;  2Q93 A;  1C21 A;  2ZSG A;  4S00 A;  2BWU A;  2GG7 A;  1M35 A;  3CTZ A;  3PKC A;  3TAV A;  2V6C A;  5FCH A;  2BWY A;  4IPA A;  4PNC A;  2BH3 A;  3BIQ A;  4U69 A;  1B59 A;  3ROR A;  3L24 A; 
#chains in the Genus database with same CATH homology
 2DFI A;  5CDL A;  1KQ0 A;  5D6E A;  1QXY A;  2GTX A;  2P99 A;  3MX6 A;  4FLL A;  4RZZ A;  4ZWU A;  5E5B A;  2GU7 A;  4R60 A;  4S01 A;  3BIP A;  2GU6 A;  3RVA A;  5CE6 A;  1Y1N A;  4FUK A;  2Q94 A;  2Q92 A;  2Q95 A;  1XGN A;  4U1B A;  1N51 A;  1R5G A;  2NQ6 A;  5CLS A;  4U6Z A;  4IU6 A;  4IKT A;  2BWS A;  4FO7 A;  1XGO A;  4U6C A;  2OAZ A;  2BB7 A;  1JAW A;  2B3K A;  3PKE A;  4U6W A;  1BN5 A;  1WL9 A;  2P98 A;  2EVO A;  1WKM A;  2BWW A;  4IEC A;  3FM3 A;  4S2T P;  4U6E A;  4QR8 A;  2BHC A;  1C22 A;  1BOA A;  2GG2 A;  2GG0 A;  4IKS A;  1WY2 A;  5JHU A;  2B3L A;  4JUQ A;  1MAT A;  5FCF A;  4IF7 A;  2GG8 A;  3TB5 A;  2BN7 A;  1YW7 A;  3CB6 A;  4ZWP A;  5CDE A;  2GU5 A;  1WL6 A;  3BIT A;  3CB5 A;  4U71 A;  1YW8 A;  2BWT A;  1YVM A;  2NQ7 A;  1R5H A;  3PKB A;  1W7V A;  1A16 A;  2BWX A;  4U6J A;  2GG9 A;  3MR1 A;  3PKA A;  2G6P A;  1WN1 A;  4FLK A;  3IU7 A;  4HXX A;  5CNX A;  4U75 A;  1C27 A;  1CHM A;  2ADU A;  1WLR A;  4FLI A;  4ZNG A;  2BHD A;  1KQ9 A;  3IG4 A;  4FLJ A;  1YW9 A;  3IU8 A;  5D6F A;  2Q8K A;  2V3X A;  2EA4 A;  4U76 A;  1C24 A;  1KP0 A;  2MAT A;  3S6B A;  1QZY A;  1XNZ A;  1C23 A;  4U70 A;  2GG3 A;  1QXZ A;  1PV9 A;  3MAT A;  2B3H A;  1QXW A;  4MAT A;  3PKD A;  2IW2 A;  4A6V A;  3FMQ A;  4ZWO A;  2EVC A;  2GA2 A;  2EA2 A;  3FMR A;  4Z7M A;  4EGE A;  2GZ5 A;  4A6W A;  2GU4 A;  4PV4 A;  2HOW A;  5CIK A;  1W2M A;  4IKU A;  4RGZ 1;  2BHA A;  2EVM A;  1R58 A;  1B6A A;  4FO8 A;  5JFR A;  3L7G A;  1WBQ A;  2P9A A;  4B28 A;  4IDY A;  2V3Y A;  3D27 A;  1YJ3 A;  5JI6 A;  2Q96 A;  4OOK A;  2BHB A;  1XGS A;  2OKN A;  4RZY A;  2GG5 A;  2GGC A;  2GGB A;  4FKC A;  2BWV A;  4KM3 A;  4U73 A;  5CDV A;  2V3Z A;  1XGM A;  3Q6D A;  3IU9 A;  4IKR A;  4S2R P;  1O0X A;  2Q93 A;  1C21 A;  2ZSG A;  4S00 A;  2BWU A;  2GG7 A;  1M35 A;  3CTZ A;  3PKC A;  3TAV A;  2V6C A;  5FCH A;  2BWY A;  4IPA A;  4PNC A;  2BH3 A;  3BIQ A;  4U69 A;  1B59 A;  3ROR A;  3L24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...