4U70A

Hsmetap (f309m) in complex with (1-amino-2-cyclohexylethyl)phosphonic acid
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
YRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLMHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the Molecular Basis of Inhibitor Selectivity between the Human and Streptococcal Type I Methionine Aminopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase 1
total genus 102
structure length 304
sequence length 304
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4u70A00
1C21A 2BHBA 1QXWA 3S6BA 2B3HA 1C23A 1KQ0A 3FMRA 3BIPA 2GU5A 3IG4A 1WLRA 2GU6A 1BN5A 1R58A 4IDYA 2HOWA 5D6FA 3BITA 4JUQA 5FCFA 2GG8A 2Q92A 2EVCA 2GG5A 4MATA 5D6EA 1W7VA 4U69A 4U6ZA 4S01A 2GU7A 4EGEA 3TAVA 1KP0A 1WL9A 2BH3A 4FKCA 2Q8KA 2GG7A 2EVMA 3IU8A 4IKTA 2BWSA 2BWWA 1Y1NA 1C27A 3BIQA 3CTZA 2ZSGA 1XGOA 1N51A 1A16A 4U73A 2BWXA 4HXXA 3L7GA 4A6WA 1YW7A 2BHCA 3TB5A 2EA2A 3D27A 4FLIA 1W2MA 4ZWOA 3RORA 2V3YA 2G6PA 4S2RP 2MATA 4OOKA 4FLLA 4FLKA 2V3ZA 3FMQA 4FLJA 2OKNA 2GG2A 4ZWPA 4B28A 5JI6A 5JHUA 4R60A 2GA2A 3IU7A 3RVAA 2BWYA 2B3KA 2Q93A 1KQ9A 2V6CA 4IKUA 4U76A 1C22A 2GZ5A 5CNXA 5CDLA 2OAZA 2B3LA 1QZYA 1WBQA 3CB6A 4IKRA 1O0XA 4PV4A 2P99A 2GU4A 4FO8A 1WKMA 2P9AA 2GTXA 2IW2A 4RGZ1 4PNCA 5E5BA 1YW9A 4ZWUA 3PKDA 3FM3A 5CE6A 2BN7A 2GGCA 2GG9A 1R5HA 2DFIA 2BWTA 3PKCA 4RZYA 4IECA 4FO7A 4ZNGA 1WN1A 3IU9A 4IKSA 2Q95A 1QXYA 5FCHA 3MR1A 2EA4A 2P98A 2BWUA 3PKEA 2BB7A 4FUKA 2BHDA 1C24A 2BHAA 1XGSA 4U1BA 3L24A 1YJ3A 5CLSA 4U71A 3PKBA 1XGNA 5CDEA 2GG3A 1WY2A 2NQ7A 5CDVA 3MATA 4U6WA 4KM3A 2GG0A 1M35A 1B59A 2Q96A 1PV9A 1QXZA 1MATA 1B6AA 1BOAA 4S2TP 4S00A 1XGMA 1R5GA 4U6EA 1JAWA 1YW8A 2EVOA 4Z7MA 4IU6A 1CHMA 3PKAA 3Q6DA 2BWVA 2GGBA 3CB5A 1WL6A 4U6CA 2Q94A 3MX6A 5JFRA 4IPAA 5CIKA 4IF7A 4U70A 4RZZA 4A6VA 1YVMA 2NQ6A 2V3XA 4U6JA 2ADUA 4U75A 1XNZA 4QR8A
chains in the Genus database with same CATH superfamily
1C21A 2BHBA 1QXWA 3S6BA 2B3HA 1C23A 1KQ0A 3FMRA 3BIPA 2GU5A 3IG4A 1WLRA 2GU6A 1BN5A 1R58A 4IDYA 2HOWA 5D6FA 3BITA 4JUQA 5FCFA 2GG8A 2Q92A 2EVCA 2GG5A 4MATA 5D6EA 1W7VA 4U69A 4U6ZA 4S01A 2GU7A 4EGEA 3TAVA 1KP0A 1WL9A 2BH3A 4FKCA 2Q8KA 2GG7A 2EVMA 3IU8A 4IKTA 2BWSA 2BWWA 1Y1NA 1C27A 3BIQA 3CTZA 2ZSGA 1XGOA 1N51A 1A16A 4U73A 2BWXA 4HXXA 3L7GA 4A6WA 1YW7A 2BHCA 3TB5A 2EA2A 3D27A 4FLIA 1W2MA 4ZWOA 3RORA 2V3YA 2G6PA 4S2RP 2MATA 4OOKA 4FLLA 4FLKA 2V3ZA 3FMQA 4FLJA 2OKNA 2GG2A 4ZWPA 4B28A 5JI6A 5JHUA 4R60A 2GA2A 3IU7A 3RVAA 2BWYA 2B3KA 2Q93A 1KQ9A 2V6CA 4IKUA 4U76A 1C22A 2GZ5A 5CNXA 5CDLA 2OAZA 2B3LA 1QZYA 1WBQA 3CB6A 4IKRA 1O0XA 4PV4A 2P99A 2GU4A 4FO8A 1WKMA 2P9AA 2GTXA 2IW2A 4RGZ1 4PNCA 5E5BA 1YW9A 4ZWUA 3PKDA 3FM3A 5CE6A 2BN7A 2GGCA 2GG9A 1R5HA 2DFIA 2BWTA 3PKCA 4RZYA 4IECA 4FO7A 4ZNGA 1WN1A 3IU9A 4IKSA 2Q95A 1QXYA 5FCHA 3MR1A 2EA4A 2P98A 2BWUA 3PKEA 2BB7A 4FUKA 2BHDA 1C24A 2BHAA 1XGSA 4U1BA 3L24A 1YJ3A 5CLSA 4U71A 3PKBA 1XGNA 5CDEA 2GG3A 1WY2A 2NQ7A 5CDVA 3MATA 4U6WA 4KM3A 2GG0A 1M35A 1B59A 2Q96A 1PV9A 1QXZA 1MATA 1B6AA 1BOAA 4S2TP 4S00A 1XGMA 1R5GA 4U6EA 1JAWA 1YW8A 2EVOA 4Z7MA 4IU6A 1CHMA 3PKAA 3Q6DA 2BWVA 2GGBA 3CB5A 1WL6A 4U6CA 2Q94A 3MX6A 5JFRA 4IPAA 5CIKA 4IF7A 4U70A 4RZZA 4A6VA 1YVMA 2NQ6A 2V3XA 4U6JA 2ADUA 4U75A 1XNZA 4QR8A
chains in the Genus database with same CATH topology
1C21A 2BHBA 1QXWA 3S6BA 2B3HA 1C23A 1KQ0A 3FMRA 3BIPA 2GU5A 3IG4A 1WLRA 2GU6A 1BN5A 1R58A 4IDYA 2HOWA 5D6FA 3BITA 4JUQA 5FCFA 2GG8A 2Q92A 2EVCA 2GG5A 4MATA 5D6EA 1W7VA 4U69A 4U6ZA 4S01A 2GU7A 4EGEA 3TAVA 1KP0A 1WL9A 2BH3A 4FKCA 2Q8KA 2GG7A 2EVMA 3IU8A 4IKTA 2BWSA 2BWWA 1Y1NA 1C27A 3BIQA 3CTZA 2ZSGA 1XGOA 1N51A 1A16A 4U73A 2BWXA 4HXXA 3L7GA 4A6WA 1YW7A 2BHCA 3TB5A 2EA2A 3D27A 4FLIA 1W2MA 4ZWOA 3RORA 2V3YA 2G6PA 4S2RP 2MATA 4OOKA 4FLLA 4FLKA 2V3ZA 3FMQA 4FLJA 2OKNA 2GG2A 4ZWPA 4B28A 5JI6A 5JHUA 4R60A 2GA2A 3IU7A 3RVAA 2BWYA 2B3KA 2Q93A 1KQ9A 2V6CA 4IKUA 4U76A 1C22A 2GZ5A 5CNXA 5CDLA 2OAZA 2B3LA 1QZYA 1WBQA 3CB6A 4IKRA 1O0XA 4PV4A 2P99A 2GU4A 4FO8A 1WKMA 2P9AA 2GTXA 2IW2A 4RGZ1 4PNCA 5E5BA 1YW9A 4ZWUA 3PKDA 3FM3A 5CE6A 2BN7A 2GGCA 2GG9A 1R5HA 2DFIA 2BWTA 3PKCA 4RZYA 4IECA 4FO7A 4ZNGA 1WN1A 3IU9A 4IKSA 2Q95A 1QXYA 5FCHA 3MR1A 2EA4A 2P98A 2BWUA 3PKEA 2BB7A 4FUKA 2BHDA 1C24A 2BHAA 1XGSA 4U1BA 3L24A 1YJ3A 5CLSA 4U71A 3PKBA 1XGNA 5CDEA 2GG3A 1WY2A 2NQ7A 5CDVA 3MATA 4U6WA 4KM3A 2GG0A 1M35A 1B59A 2Q96A 1PV9A 1QXZA 1MATA 1B6AA 1BOAA 4S2TP 4S00A 1XGMA 1R5GA 4U6EA 1JAWA 1YW8A 2EVOA 4Z7MA 4IU6A 1CHMA 3PKAA 3Q6DA 2BWVA 2GGBA 3CB5A 1WL6A 4U6CA 2Q94A 3MX6A 5JFRA 4IPAA 5CIKA 4IF7A 4U70A 4RZZA 4A6VA 1YVMA 2NQ6A 2V3XA 4U6JA 2ADUA 4U75A 1XNZA 4QR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C21 A;  2BHB A;  1QXW A;  3S6B A;  2B3H A;  1C23 A;  1KQ0 A;  3FMR A;  3BIP A;  2GU5 A;  3IG4 A;  1WLR A;  2GU6 A;  1BN5 A;  1R58 A;  4IDY A;  2HOW A;  5D6F A;  3BIT A;  4JUQ A;  5FCF A;  2GG8 A;  2Q92 A;  2EVC A;  2GG5 A;  4MAT A;  5D6E A;  1W7V A;  4U69 A;  4U6Z A;  4S01 A;  2GU7 A;  4EGE A;  3TAV A;  1KP0 A;  1WL9 A;  2BH3 A;  4FKC A;  2Q8K A;  2GG7 A;  2EVM A;  3IU8 A;  4IKT A;  2BWS A;  2BWW A;  1Y1N A;  1C27 A;  3BIQ A;  3CTZ A;  2ZSG A;  1XGO A;  1N51 A;  1A16 A;  4U73 A;  2BWX A;  4HXX A;  3L7G A;  4A6W A;  1YW7 A;  2BHC A;  3TB5 A;  2EA2 A;  3D27 A;  4FLI A;  1W2M A;  4ZWO A;  3ROR A;  2V3Y A;  2G6P A;  4S2R P;  2MAT A;  4OOK A;  4FLL A;  4FLK A;  2V3Z A;  3FMQ A;  4FLJ A;  2OKN A;  2GG2 A;  4ZWP A;  4B28 A;  5JI6 A;  5JHU A;  4R60 A;  2GA2 A;  3IU7 A;  3RVA A;  2BWY A;  2B3K A;  2Q93 A;  1KQ9 A;  2V6C A;  4IKU A;  4U76 A;  1C22 A;  2GZ5 A;  5CNX A;  5CDL A;  2OAZ A;  2B3L A;  1QZY A;  1WBQ A;  3CB6 A;  4IKR A;  1O0X A;  4PV4 A;  2P99 A;  2GU4 A;  4FO8 A;  1WKM A;  2P9A A;  2GTX A;  2IW2 A;  4RGZ 1;  4PNC A;  5E5B A;  1YW9 A;  4ZWU A;  3PKD A;  3FM3 A;  5CE6 A;  2BN7 A;  2GGC A;  2GG9 A;  1R5H A;  2DFI A;  2BWT A;  3PKC A;  4RZY A;  4IEC A;  4FO7 A;  4ZNG A;  1WN1 A;  3IU9 A;  4IKS A;  2Q95 A;  1QXY A;  5FCH A;  3MR1 A;  2EA4 A;  2P98 A;  2BWU A;  3PKE A;  2BB7 A;  4FUK A;  2BHD A;  1C24 A;  2BHA A;  1XGS A;  4U1B A;  3L24 A;  1YJ3 A;  5CLS A;  4U71 A;  3PKB A;  1XGN A;  5CDE A;  2GG3 A;  1WY2 A;  2NQ7 A;  5CDV A;  3MAT A;  4U6W A;  4KM3 A;  2GG0 A;  1M35 A;  1B59 A;  2Q96 A;  1PV9 A;  1QXZ A;  1MAT A;  1B6A A;  1BOA A;  4S2T P;  4S00 A;  1XGM A;  1R5G A;  4U6E A;  1JAW A;  1YW8 A;  2EVO A;  4Z7M A;  4IU6 A;  1CHM A;  3PKA A;  3Q6D A;  2BWV A;  2GGB A;  3CB5 A;  1WL6 A;  4U6C A;  2Q94 A;  3MX6 A;  5JFR A;  4IPA A;  5CIK A;  4IF7 A;  4U70 A;  4RZZ A;  4A6V A;  1YVM A;  2NQ6 A;  2V3X A;  4U6J A;  2ADU A;  4U75 A;  1XNZ A;  4QR8 A; 
#chains in the Genus database with same CATH topology
 1C21 A;  2BHB A;  1QXW A;  3S6B A;  2B3H A;  1C23 A;  1KQ0 A;  3FMR A;  3BIP A;  2GU5 A;  3IG4 A;  1WLR A;  2GU6 A;  1BN5 A;  1R58 A;  4IDY A;  2HOW A;  5D6F A;  3BIT A;  4JUQ A;  5FCF A;  2GG8 A;  2Q92 A;  2EVC A;  2GG5 A;  4MAT A;  5D6E A;  1W7V A;  4U69 A;  4U6Z A;  4S01 A;  2GU7 A;  4EGE A;  3TAV A;  1KP0 A;  1WL9 A;  2BH3 A;  4FKC A;  2Q8K A;  2GG7 A;  2EVM A;  3IU8 A;  4IKT A;  2BWS A;  2BWW A;  1Y1N A;  1C27 A;  3BIQ A;  3CTZ A;  2ZSG A;  1XGO A;  1N51 A;  1A16 A;  4U73 A;  2BWX A;  4HXX A;  3L7G A;  4A6W A;  1YW7 A;  2BHC A;  3TB5 A;  2EA2 A;  3D27 A;  4FLI A;  1W2M A;  4ZWO A;  3ROR A;  2V3Y A;  2G6P A;  4S2R P;  2MAT A;  4OOK A;  4FLL A;  4FLK A;  2V3Z A;  3FMQ A;  4FLJ A;  2OKN A;  2GG2 A;  4ZWP A;  4B28 A;  5JI6 A;  5JHU A;  4R60 A;  2GA2 A;  3IU7 A;  3RVA A;  2BWY A;  2B3K A;  2Q93 A;  1KQ9 A;  2V6C A;  4IKU A;  4U76 A;  1C22 A;  2GZ5 A;  5CNX A;  5CDL A;  2OAZ A;  2B3L A;  1QZY A;  1WBQ A;  3CB6 A;  4IKR A;  1O0X A;  4PV4 A;  2P99 A;  2GU4 A;  4FO8 A;  1WKM A;  2P9A A;  2GTX A;  2IW2 A;  4RGZ 1;  4PNC A;  5E5B A;  1YW9 A;  4ZWU A;  3PKD A;  3FM3 A;  5CE6 A;  2BN7 A;  2GGC A;  2GG9 A;  1R5H A;  2DFI A;  2BWT A;  3PKC A;  4RZY A;  4IEC A;  4FO7 A;  4ZNG A;  1WN1 A;  3IU9 A;  4IKS A;  2Q95 A;  1QXY A;  5FCH A;  3MR1 A;  2EA4 A;  2P98 A;  2BWU A;  3PKE A;  2BB7 A;  4FUK A;  2BHD A;  1C24 A;  2BHA A;  1XGS A;  4U1B A;  3L24 A;  1YJ3 A;  5CLS A;  4U71 A;  3PKB A;  1XGN A;  5CDE A;  2GG3 A;  1WY2 A;  2NQ7 A;  5CDV A;  3MAT A;  4U6W A;  4KM3 A;  2GG0 A;  1M35 A;  1B59 A;  2Q96 A;  1PV9 A;  1QXZ A;  1MAT A;  1B6A A;  1BOA A;  4S2T P;  4S00 A;  1XGM A;  1R5G A;  4U6E A;  1JAW A;  1YW8 A;  2EVO A;  4Z7M A;  4IU6 A;  1CHM A;  3PKA A;  3Q6D A;  2BWV A;  2GGB A;  3CB5 A;  1WL6 A;  4U6C A;  2Q94 A;  3MX6 A;  5JFR A;  4IPA A;  5CIK A;  4IF7 A;  4U70 A;  4RZZ A;  4A6V A;  1YVM A;  2NQ6 A;  2V3X A;  4U6J A;  2ADU A;  4U75 A;  1XNZ A;  4QR8 A; 
#chains in the Genus database with same CATH homology
 1C21 A;  2BHB A;  1QXW A;  3S6B A;  2B3H A;  1C23 A;  1KQ0 A;  3FMR A;  3BIP A;  2GU5 A;  3IG4 A;  1WLR A;  2GU6 A;  1BN5 A;  1R58 A;  4IDY A;  2HOW A;  5D6F A;  3BIT A;  4JUQ A;  5FCF A;  2GG8 A;  2Q92 A;  2EVC A;  2GG5 A;  4MAT A;  5D6E A;  1W7V A;  4U69 A;  4U6Z A;  4S01 A;  2GU7 A;  4EGE A;  3TAV A;  1KP0 A;  1WL9 A;  2BH3 A;  4FKC A;  2Q8K A;  2GG7 A;  2EVM A;  3IU8 A;  4IKT A;  2BWS A;  2BWW A;  1Y1N A;  1C27 A;  3BIQ A;  3CTZ A;  2ZSG A;  1XGO A;  1N51 A;  1A16 A;  4U73 A;  2BWX A;  4HXX A;  3L7G A;  4A6W A;  1YW7 A;  2BHC A;  3TB5 A;  2EA2 A;  3D27 A;  4FLI A;  1W2M A;  4ZWO A;  3ROR A;  2V3Y A;  2G6P A;  4S2R P;  2MAT A;  4OOK A;  4FLL A;  4FLK A;  2V3Z A;  3FMQ A;  4FLJ A;  2OKN A;  2GG2 A;  4ZWP A;  4B28 A;  5JI6 A;  5JHU A;  4R60 A;  2GA2 A;  3IU7 A;  3RVA A;  2BWY A;  2B3K A;  2Q93 A;  1KQ9 A;  2V6C A;  4IKU A;  4U76 A;  1C22 A;  2GZ5 A;  5CNX A;  5CDL A;  2OAZ A;  2B3L A;  1QZY A;  1WBQ A;  3CB6 A;  4IKR A;  1O0X A;  4PV4 A;  2P99 A;  2GU4 A;  4FO8 A;  1WKM A;  2P9A A;  2GTX A;  2IW2 A;  4RGZ 1;  4PNC A;  5E5B A;  1YW9 A;  4ZWU A;  3PKD A;  3FM3 A;  5CE6 A;  2BN7 A;  2GGC A;  2GG9 A;  1R5H A;  2DFI A;  2BWT A;  3PKC A;  4RZY A;  4IEC A;  4FO7 A;  4ZNG A;  1WN1 A;  3IU9 A;  4IKS A;  2Q95 A;  1QXY A;  5FCH A;  3MR1 A;  2EA4 A;  2P98 A;  2BWU A;  3PKE A;  2BB7 A;  4FUK A;  2BHD A;  1C24 A;  2BHA A;  1XGS A;  4U1B A;  3L24 A;  1YJ3 A;  5CLS A;  4U71 A;  3PKB A;  1XGN A;  5CDE A;  2GG3 A;  1WY2 A;  2NQ7 A;  5CDV A;  3MAT A;  4U6W A;  4KM3 A;  2GG0 A;  1M35 A;  1B59 A;  2Q96 A;  1PV9 A;  1QXZ A;  1MAT A;  1B6A A;  1BOA A;  4S2T P;  4S00 A;  1XGM A;  1R5G A;  4U6E A;  1JAW A;  1YW8 A;  2EVO A;  4Z7M A;  4IU6 A;  1CHM A;  3PKA A;  3Q6D A;  2BWV A;  2GGB A;  3CB5 A;  1WL6 A;  4U6C A;  2Q94 A;  3MX6 A;  5JFR A;  4IPA A;  5CIK A;  4IF7 A;  4U70 A;  4RZZ A;  4A6V A;  1YVM A;  2NQ6 A;  2V3X A;  4U6J A;  2ADU A;  4U75 A;  1XNZ A;  4QR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...