1E9HB

Thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Inhibitor Binding to Active and Inactive Cdk2: The Crystal Structure of Cdk2-Cyclin A/Indirubin-5-Sulphonate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 95
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1e9hB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1e9hB02
4YOZA 5IDPB 1JKWA 5CYIB 1VYWB 1OI9B 2I40B 2UZBB 1D3UB 2C5OB 4OGRB 4F7JB 2V22B 3MY5B 3BHUB 4CFVB 2C5NB 3EOCB 2IW8B 3K7AM 2IW6B 2WMBB 3G33B 4YC3B 4F6UB 4F7SB 1VINA 1XO2A 4FX3B 1H27B 3TNWB 4BCQB 2C6TB 4ELLA 4EOJB 2BKZB 3TNIB 4TTHA 1N4MA 1URCB 2IVXA 2WIHB 2QDJA 1UNGD 4BCQD 3EIDB 4EONB 3QHWB 1W98B 4EOLB 4EORB 4I3ZB 2PHGA 1F5QB 3MI9B 1H26B 3TN8B 4BCGB 5HBEB 5ICPB 3DDQB 4YOSA 4EC9B 1GY3B 4EC8B 5BNJB 4II5B 2X1NB 1H1QB 2CCHB 1KXUA 4BCIB 1FVVB 4IMYB 1JOWA 2UUEB 4ELJA 1H1RB 1P5EB 1ZP2A 2CJMB 1H28B 1OIUB 3BHVB 4G6LB 1H1PB 5HQ0B 1H24B 2W96A 4F6WB 4CFUB 5LMKB 3POMA 2WHBB 1E9HB 2UZEB 2W9FA 4EOMB 1VOLA 5HVYB 4EOQB 4CFUD 1AD6A 1H4LD 1PKDB 1QMZB 3DDPB 4F7LB 4Y72B 2PMIB 5IDNB 2UZDB 1OL2B 1OKWB 1H25B 4BCNB 4EOKB 2C5VB 2W99A 4OR5B 2BPMB 2JGZB 2CCIB 2WMAB 2PK9B 3RGFB 4CXAB 4UN0A 1O9KA 1O9KB 1FINB 5HNBB 1TFBA 4BCND 2W9ZA 5HBHB 4BCHB 5HBJB 3MIAB 1G3NC 2W2HA 3BLRB 2WIPB 2WXVB 4F6SB 1OIYB 1OL1B 1OKVB 4BCPB 3MY1B 1JSTB 1GH6B 2UZLB 3DOGB 4YOOA 4BCKB 1H1SB 4F7NB 3H4CA 4F70B 1C9BA 1UNLD 2R7GA 3QHRB 3O0GD 3BLQB 5CEIB 2G9XB 5LQFB 4KRDB 4EOIB 2EUFA 2C5XB 2WFYB 1GUXA 1GUXB 3F5XB 4CRLB 3M03A 3TNHB 2F2CA 4EOPB 5I5ZB 5EFQB 4BCJB 5ACBA 4CFNB 3BLHB 2IW9B 4NSTB 5FGKB 5L2WB 1AISB 1OGUB 4BCFB 4BCOB 4CFXB 3BHTB 1JSUB 4KRCB 2WEVB 4BCMB 4EOOB 1UNHD 3LQ5B 2C4GB 4ROCA 2B9RA 5IF1B 4CFMB 2PK2A 4BCMD 2WPAB 1BU2A 4RODA 3EJ1B 4EOSB 4CFWB 2I53A 4ROEA
chains in the Genus database with same CATH superfamily
5IDPB 1OI9B 2DD4B 3DL1A 3X26B 4CFVB 3K7AM 3HBLA 1ENWA 4TTHA 1N4MA 2WIHB 4OB3B 2QDJA 1UNGD 4BCQD 1W98B 4EOLB 4EORB 4I3ZB 3X25B 4EC9B 5BNJB 4BXXX 4II5B 2UUEB 4ELJA 1H1RB 2ZPHB 2CJMB 3HB9A 4FM4B 3TW7A 4CFUB 1E9HB 5DQVA 2W9FA 2G77A 1PKDB 1QMZB 3A8GB 1IREB 3DDPB 4F7LB 4Y72B 2PMIB 2BS2A 1OL2B 4BY7X 3GTMS 2JGZB 2CCIB 2PK9B 5HNBB 1UGQB 4BCND 3QYGB 4NC6A 1G3NC 2W2HA 4F6SB 3BG5A 3MY1B 3DOGB 4YOOA 4F7NB 4F70B 1C9BA 4AKIA 5CEIB 3QZ5B 2WFYB 4MFEA 5EFQB 4CFNB 3BLHB 4BCFB 2ZPEB 4CFXB 1JSUB 4KRCB 4OB1B 4BCMD 1BU2A 5IHYA 1JKWA 5CYIB 1D3UB 2V22B 3EOCB 2IW8B 3G33B 4YC3B 2DD5B 1VINA 1XO2A 4FX3B 3TNWB 2C6TB 3TNIB 2IVXA 3EIDB 3QYBA 4EONB 1F5QB 5ICPB 4BCGB 2IN3A 4YOSA 1GY3B 2BS3A 2CZ7B 4IMYB 3X28B 3QXEB 1ZP2A 1H24B 4F6WB 2UZEB 1VOLA 3WVDB 4CFUD 1AD6A 1H4LD 2DMEA 3BG9A 2C5VB 4UN0A 1TFBA 4MFDA 2QGSA 1OKVB 2UZLB 2QDYB 3H4CA 2LW4A 2R7GA 2G9XB 3NDQA 2F2CA 4HL4A 5ACBA 4QSHA 5FGKB 5L2WB 1OGUB 4ZGEB 4HLQA 1UNHD 2ZPIB 2B9RA 2WPAB 2BS4A 3HHTB 2KMGA 4OB0B 4HNTA 2I40B 3BG3A 4OGRB 3MY5B 3BHUB 4JX5A 2C5NB 4F6UB 1H27B 1TD6A 4OB2B 4ELLA 3WVEB 3QHWB 2QF7A 4HNVA 4MIMA 2PHGA 5HBEB 1H26B 3QYHB 1H1QB 2CCHB 1KXUA 1FVVB 1UGRB 1JOWA 1P5EB 3HZJA 4BBSM 3BHVB 4G6LB 3DTOA 1H1PB 4JX4A 3POMA 4LOCA 4EOQB 3A8LB 2AHJB 5IDNB 2UZDB 1OKWB 4EOKB 1H25B 4OR5B 4ZGDB 2WMAB 4CXAB 1UGPB 1O9KA 1O9KB 3QYEA 5EJCA 2DPPB 2D0QB 5HBHB 4BCHB 2DXBB 2WIPB 1V29B 1OL1B 1JSTB 1GH6B 1FKMA 4BCKB 1H1SB 4AI6A 1UNLD 3QHRB 3O0GD 3BLQB 5LQFB 2EUFA 4EOPB 3TNHB 4BCJB 2IW9B 1AISB 4BCOB 3BHTB 4HNUA 3LQ5B 2C4GB 1AHJB 4CFMB 4RODA 3EJ1B 4EOSB 2I53A 4ROEA 3VYHB 4YOZA 3VYGB 1VYWB 2UZBB 2C5OB 4F7JB 2ZCFB 2IW6B 2WMBB 4F7SB 5LMKB 2PJQA 4BCQB 4AKGA 2ZZDB 3X24B 5DQWA 2DXCB 4EOJB 2BKZB 2KR6A 1URCB 2CZ1B 2ZPBB 3MI9B 3TN8B 3DDQB 4EC8B 2X1NB 2QFZA 4BCIB 1H28B 1OIUB 3VKGA 5HQ0B 2W96A 2WHBB 2CZ6B 4EOMB 5HVYB 2WJ9A 3A8MB 3PO3S 3VKHA 4BY1X 2QQ8A 4BCNB 2W99A 2BPMB 3RGFB 1FINB 2W9ZA 5HBJB 3MIAB 3BLRB 2WXVB 3B57A 1OIYB 4BCPB 2CZ0B 1QLBA 1E7PA 2CYZB 2ZPFB 4M6VA 4KRDB 4EOIB 2C5XB 1GUXA 1GUXB 3F5XB 3QWLA 3M03A 4CRLB 4Z6YA 3A8OB 5I5ZB 3X20B 4NSTB 4ZGJB 4AKHA 3TW6A 4BBRM 4JX6A 3QZ9B 3HO8A 2WEVB 3DJBA 4BCMB 4EOOB 4ROCA 1UGSB 3A8HB 5IF1B 2PK2A 2ZPGB 4CFWB 3KHIA
chains in the Genus database with same CATH topology
4YOZA 5IDPB 1JKWA 5CYIB 1VYWB 1OI9B 2I40B 2UZBB 1D3UB 2C5OB 4OGRB 4F7JB 2V22B 3MY5B 3BHUB 4CFVB 2C5NB 3EOCB 2IW8B 3K7AM 2IW6B 2WMBB 3G33B 4YC3B 4F6UB 4F7SB 1VINA 1XO2A 4FX3B 1H27B 3TNWB 4BCQB 2C6TB 4ELLA 4EOJB 2BKZB 3TNIB 4TTHA 1N4MA 1URCB 2IVXA 2WIHB 2QDJA 1UNGD 4BCQD 3EIDB 4EONB 3QHWB 1W98B 4EOLB 4EORB 4I3ZB 2PHGA 1F5QB 3MI9B 1H26B 3TN8B 4BCGB 5HBEB 5ICPB 3DDQB 4YOSA 4EC9B 1GY3B 4EC8B 5BNJB 4II5B 2X1NB 1H1QB 2CCHB 1KXUA 4BCIB 1FVVB 4IMYB 1JOWA 2UUEB 4ELJA 1H1RB 1P5EB 1ZP2A 2CJMB 1H28B 1OIUB 3BHVB 4G6LB 1H1PB 5HQ0B 1H24B 2W96A 4F6WB 4CFUB 5LMKB 3POMA 2WHBB 1E9HB 2UZEB 2W9FA 4EOMB 1VOLA 5HVYB 4EOQB 4CFUD 1AD6A 1H4LD 1PKDB 1QMZB 3DDPB 4F7LB 4Y72B 2PMIB 5IDNB 2UZDB 1OL2B 1OKWB 1H25B 4BCNB 4EOKB 2C5VB 2W99A 4OR5B 2BPMB 2JGZB 2CCIB 2WMAB 2PK9B 3RGFB 4CXAB 4UN0A 1O9KA 1O9KB 1FINB 5HNBB 1TFBA 4BCND 2W9ZA 5HBHB 4BCHB 5HBJB 3MIAB 1G3NC 2W2HA 3BLRB 2WIPB 2WXVB 4F6SB 1OIYB 1OL1B 1OKVB 4BCPB 3MY1B 1JSTB 1GH6B 2UZLB 3DOGB 4YOOA 4BCKB 1H1SB 4F7NB 3H4CA 4F70B 1C9BA 1UNLD 2R7GA 3QHRB 3O0GD 3BLQB 5CEIB 2G9XB 5LQFB 4KRDB 4EOIB 2EUFA 2C5XB 2WFYB 1GUXA 1GUXB 3F5XB 4CRLB 3M03A 3TNHB 2F2CA 4EOPB 5I5ZB 5EFQB 4BCJB 5ACBA 4CFNB 3BLHB 2IW9B 4NSTB 5FGKB 5L2WB 1AISB 1OGUB 4BCFB 4BCOB 4CFXB 3BHTB 1JSUB 4KRCB 2WEVB 4BCMB 4EOOB 1UNHD 3LQ5B 2C4GB 4ROCA 2B9RA 5IF1B 4CFMB 2PK2A 4BCMD 2WPAB 1BU2A 4RODA 3EJ1B 4EOSB 4CFWB 2I53A 4ROEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOZ A;  5IDP B;  1JKW A;  5CYI B;  1VYW B;  1OI9 B;  2I40 B;  2UZB B;  1D3U B;  2C5O B;  4OGR B;  4F7J B;  2V22 B;  3MY5 B;  3BHU B;  4CFV B;  2C5N B;  3EOC B;  2IW8 B;  3K7A M;  2IW6 B;  2WMB B;  3G33 B;  4YC3 B;  4F6U B;  4F7S B;  1VIN A;  1XO2 A;  4FX3 B;  1H27 B;  3TNW B;  4BCQ B;  2C6T B;  4ELL A;  4EOJ B;  2BKZ B;  3TNI B;  4TTH A;  1N4M A;  1URC B;  2IVX A;  2WIH B;  2QDJ A;  1UNG D;  4BCQ D;  3EID B;  4EON B;  3QHW B;  1W98 B;  4EOL B;  4EOR B;  4I3Z B;  2PHG A;  1F5Q B;  3MI9 B;  1H26 B;  3TN8 B;  4BCG B;  5HBE B;  5ICP B;  3DDQ B;  4YOS A;  4EC9 B;  1GY3 B;  4EC8 B;  5BNJ B;  4II5 B;  2X1N B;  1H1Q B;  2CCH B;  1KXU A;  4BCI B;  1FVV B;  4IMY B;  1JOW A;  2UUE B;  4ELJ A;  1H1R B;  1P5E B;  1ZP2 A;  2CJM B;  1H28 B;  1OIU B;  3BHV B;  4G6L B;  1H1P B;  5HQ0 B;  1H24 B;  2W96 A;  4F6W B;  4CFU B;  5LMK B;  3POM A;  2WHB B;  1E9H B;  2UZE B;  2W9F A;  4EOM B;  1VOL A;  5HVY B;  4EOQ B;  4CFU D;  1AD6 A;  1H4L D;  1PKD B;  1QMZ B;  3DDP B;  4F7L B;  4Y72 B;  2PMI B;  5IDN B;  2UZD B;  1OL2 B;  1OKW B;  1H25 B;  4BCN B;  4EOK B;  2C5V B;  2W99 A;  4OR5 B;  2BPM B;  2JGZ B;  2CCI B;  2WMA B;  2PK9 B;  3RGF B;  4CXA B;  4UN0 A;  1O9K A;  1O9K B;  1FIN B;  5HNB B;  1TFB A;  4BCN D;  2W9Z A;  5HBH B;  4BCH B;  5HBJ B;  3MIA B;  1G3N C;  2W2H A;  3BLR B;  2WIP B;  2WXV B;  4F6S B;  1OIY B;  1OL1 B;  1OKV B;  4BCP B;  3MY1 B;  1JST B;  1GH6 B;  2UZL B;  3DOG B;  4YOO A;  4BCK B;  1H1S B;  4F7N B;  3H4C A;  4F70 B;  1C9B A;  1UNL D;  2R7G A;  3QHR B;  3O0G D;  3BLQ B;  5CEI B;  2G9X B;  5LQF B;  4KRD B;  4EOI B;  2EUF A;  2C5X B;  2WFY B;  1GUX A;  1GUX B;  3F5X B;  4CRL B;  3M03 A;  3TNH B;  2F2C A;  4EOP B;  5I5Z B;  5EFQ B;  4BCJ B;  5ACB A;  4CFN B;  3BLH B;  2IW9 B;  4NST B;  5FGK B;  5L2W B;  1AIS B;  1OGU B;  4BCF B;  4BCO B;  4CFX B;  3BHT B;  1JSU B;  4KRC B;  2WEV B;  4BCM B;  4EOO B;  1UNH D;  3LQ5 B;  2C4G B;  4ROC A;  2B9R A;  5IF1 B;  4CFM B;  2PK2 A;  4BCM D;  2WPA B;  1BU2 A;  4ROD A;  3EJ1 B;  4EOS B;  4CFW B;  2I53 A;  4ROE A; 
#chains in the Genus database with same CATH topology
 5IDP B;  1OI9 B;  2DD4 B;  3DL1 A;  3X26 B;  4CFV B;  3K7A M;  3HBL A;  1ENW A;  4TTH A;  1N4M A;  2WIH B;  4OB3 B;  2QDJ A;  1UNG D;  4BCQ D;  1W98 B;  4EOL B;  4EOR B;  4I3Z B;  3X25 B;  4EC9 B;  5BNJ B;  4BXX X;  4II5 B;  2UUE B;  4ELJ A;  1H1R B;  2ZPH B;  2CJM B;  3HB9 A;  4FM4 B;  3TW7 A;  4CFU B;  1E9H B;  5DQV A;  2W9F A;  2G77 A;  1PKD B;  1QMZ B;  3A8G B;  1IRE B;  3DDP B;  4F7L B;  4Y72 B;  2PMI B;  2BS2 A;  1OL2 B;  4BY7 X;  3GTM S;  2JGZ B;  2CCI B;  2PK9 B;  5HNB B;  1UGQ B;  4BCN D;  3QYG B;  4NC6 A;  1G3N C;  2W2H A;  4F6S B;  3BG5 A;  3MY1 B;  3DOG B;  4YOO A;  4F7N B;  4F70 B;  1C9B A;  4AKI A;  5CEI B;  3QZ5 B;  2WFY B;  4MFE A;  5EFQ B;  4CFN B;  3BLH B;  4BCF B;  2ZPE B;  4CFX B;  1JSU B;  4KRC B;  4OB1 B;  4BCM D;  1BU2 A;  5IHY A;  1JKW A;  5CYI B;  1D3U B;  2V22 B;  3EOC B;  2IW8 B;  3G33 B;  4YC3 B;  2DD5 B;  1VIN A;  1XO2 A;  4FX3 B;  3TNW B;  2C6T B;  3TNI B;  2IVX A;  3EID B;  3QYB A;  4EON B;  1F5Q B;  5ICP B;  4BCG B;  2IN3 A;  4YOS A;  1GY3 B;  2BS3 A;  2CZ7 B;  4IMY B;  3X28 B;  3QXE B;  1ZP2 A;  1H24 B;  4F6W B;  2UZE B;  1VOL A;  3WVD B;  4CFU D;  1AD6 A;  1H4L D;  2DME A;  3BG9 A;  2C5V B;  4UN0 A;  1TFB A;  4MFD A;  2QGS A;  1OKV B;  2UZL B;  2QDY B;  3H4C A;  2LW4 A;  2R7G A;  2G9X B;  3NDQ A;  2F2C A;  4HL4 A;  5ACB A;  4QSH A;  5FGK B;  5L2W B;  1OGU B;  4ZGE B;  4HLQ A;  1UNH D;  2ZPI B;  2B9R A;  2WPA B;  2BS4 A;  3HHT B;  2KMG A;  4OB0 B;  4HNT A;  2I40 B;  3BG3 A;  4OGR B;  3MY5 B;  3BHU B;  4JX5 A;  2C5N B;  4F6U B;  1H27 B;  1TD6 A;  4OB2 B;  4ELL A;  3WVE B;  3QHW B;  2QF7 A;  4HNV A;  4MIM A;  2PHG A;  5HBE B;  1H26 B;  3QYH B;  1H1Q B;  2CCH B;  1KXU A;  1FVV B;  1UGR B;  1JOW A;  1P5E B;  3HZJ A;  4BBS M;  3BHV B;  4G6L B;  3DTO A;  1H1P B;  4JX4 A;  3POM A;  4LOC A;  4EOQ B;  3A8L B;  2AHJ B;  5IDN B;  2UZD B;  1OKW B;  4EOK B;  1H25 B;  4OR5 B;  4ZGD B;  2WMA B;  4CXA B;  1UGP B;  1O9K A;  1O9K B;  3QYE A;  5EJC A;  2DPP B;  2D0Q B;  5HBH B;  4BCH B;  2DXB B;  2WIP B;  1V29 B;  1OL1 B;  1JST B;  1GH6 B;  1FKM A;  4BCK B;  1H1S B;  4AI6 A;  1UNL D;  3QHR B;  3O0G D;  3BLQ B;  5LQF B;  2EUF A;  4EOP B;  3TNH B;  4BCJ B;  2IW9 B;  1AIS B;  4BCO B;  3BHT B;  4HNU A;  3LQ5 B;  2C4G B;  1AHJ B;  4CFM B;  4ROD A;  3EJ1 B;  4EOS B;  2I53 A;  4ROE A;  3VYH B;  4YOZ A;  3VYG B;  1VYW B;  2UZB B;  2C5O B;  4F7J B;  2ZCF B;  2IW6 B;  2WMB B;  4F7S B;  5LMK B;  2PJQ A;  4BCQ B;  4AKG A;  2ZZD B;  3X24 B;  5DQW A;  2DXC B;  4EOJ B;  2BKZ B;  2KR6 A;  1URC B;  2CZ1 B;  2ZPB B;  3MI9 B;  3TN8 B;  3DDQ B;  4EC8 B;  2X1N B;  2QFZ A;  4BCI B;  1H28 B;  1OIU B;  3VKG A;  5HQ0 B;  2W96 A;  2WHB B;  2CZ6 B;  4EOM B;  5HVY B;  2WJ9 A;  3A8M B;  3PO3 S;  3VKH A;  4BY1 X;  2QQ8 A;  4BCN B;  2W99 A;  2BPM B;  3RGF B;  1FIN B;  2W9Z A;  5HBJ B;  3MIA B;  3BLR B;  2WXV B;  3B57 A;  1OIY B;  4BCP B;  2CZ0 B;  1QLB A;  1E7P A;  2CYZ B;  2ZPF B;  4M6V A;  4KRD B;  4EOI B;  2C5X B;  1GUX A;  1GUX B;  3F5X B;  3QWL A;  3M03 A;  4CRL B;  4Z6Y A;  3A8O B;  5I5Z B;  3X20 B;  4NST B;  4ZGJ B;  4AKH A;  3TW6 A;  4BBR M;  4JX6 A;  3QZ9 B;  3HO8 A;  2WEV B;  3DJB A;  4BCM B;  4EOO B;  4ROC A;  1UGS B;  3A8H B;  5IF1 B;  2PK2 A;  2ZPG B;  4CFW B;  3KHI A; 
#chains in the Genus database with same CATH homology
 4YOZ A;  5IDP B;  1JKW A;  5CYI B;  1VYW B;  1OI9 B;  2I40 B;  2UZB B;  1D3U B;  2C5O B;  4OGR B;  4F7J B;  2V22 B;  3MY5 B;  3BHU B;  4CFV B;  2C5N B;  3EOC B;  2IW8 B;  3K7A M;  2IW6 B;  2WMB B;  3G33 B;  4YC3 B;  4F6U B;  4F7S B;  1VIN A;  1XO2 A;  4FX3 B;  1H27 B;  3TNW B;  4BCQ B;  2C6T B;  4ELL A;  4EOJ B;  2BKZ B;  3TNI B;  4TTH A;  1N4M A;  1URC B;  2IVX A;  2WIH B;  2QDJ A;  1UNG D;  4BCQ D;  3EID B;  4EON B;  3QHW B;  1W98 B;  4EOL B;  4EOR B;  4I3Z B;  2PHG A;  1F5Q B;  3MI9 B;  1H26 B;  3TN8 B;  4BCG B;  5HBE B;  5ICP B;  3DDQ B;  4YOS A;  4EC9 B;  1GY3 B;  4EC8 B;  5BNJ B;  4II5 B;  2X1N B;  1H1Q B;  2CCH B;  1KXU A;  4BCI B;  1FVV B;  4IMY B;  1JOW A;  2UUE B;  4ELJ A;  1H1R B;  1P5E B;  1ZP2 A;  2CJM B;  1H28 B;  1OIU B;  3BHV B;  4G6L B;  1H1P B;  5HQ0 B;  1H24 B;  2W96 A;  4F6W B;  4CFU B;  5LMK B;  3POM A;  2WHB B;  1E9H B;  2UZE B;  2W9F A;  4EOM B;  1VOL A;  5HVY B;  4EOQ B;  4CFU D;  1AD6 A;  1H4L D;  1PKD B;  1QMZ B;  3DDP B;  4F7L B;  4Y72 B;  2PMI B;  5IDN B;  2UZD B;  1OL2 B;  1OKW B;  1H25 B;  4BCN B;  4EOK B;  2C5V B;  2W99 A;  4OR5 B;  2BPM B;  2JGZ B;  2CCI B;  2WMA B;  2PK9 B;  3RGF B;  4CXA B;  4UN0 A;  1O9K A;  1O9K B;  1FIN B;  5HNB B;  1TFB A;  4BCN D;  2W9Z A;  5HBH B;  4BCH B;  5HBJ B;  3MIA B;  1G3N C;  2W2H A;  3BLR B;  2WIP B;  2WXV B;  4F6S B;  1OIY B;  1OL1 B;  1OKV B;  4BCP B;  3MY1 B;  1JST B;  1GH6 B;  2UZL B;  3DOG B;  4YOO A;  4BCK B;  1H1S B;  4F7N B;  3H4C A;  4F70 B;  1C9B A;  1UNL D;  2R7G A;  3QHR B;  3O0G D;  3BLQ B;  5CEI B;  2G9X B;  5LQF B;  4KRD B;  4EOI B;  2EUF A;  2C5X B;  2WFY B;  1GUX A;  1GUX B;  3F5X B;  4CRL B;  3M03 A;  3TNH B;  2F2C A;  4EOP B;  5I5Z B;  5EFQ B;  4BCJ B;  5ACB A;  4CFN B;  3BLH B;  2IW9 B;  4NST B;  5FGK B;  5L2W B;  1AIS B;  1OGU B;  4BCF B;  4BCO B;  4CFX B;  3BHT B;  1JSU B;  4KRC B;  2WEV B;  4BCM B;  4EOO B;  1UNH D;  3LQ5 B;  2C4G B;  4ROC A;  2B9R A;  5IF1 B;  4CFM B;  2PK2 A;  4BCM D;  2WPA B;  1BU2 A;  4ROD A;  3EJ1 B;  4EOS B;  4CFW B;  2I53 A;  4ROE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...