1E9HB

Thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Inhibitor Binding to Active and Inactive Cdk2: The Crystal Structure of Cdk2-Cyclin A/Indirubin-5-Sulphonate
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1e9hB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1e9hB02
1GUXA 4EOIB 2G9XB 4ELLA 2BPMB 2QDJA 5EFQB 4F7JB 1OIUB 4YOSA 4CFMB 1BU2A 1JSUB 4BCQD 2WMAB 1VINA 3G33B 3K7AM 1AD6A 2C5VB 2C4GB 5IDNB 2JGZB 4CFUB 1F5QB 4F6WB 4YOOA 2F2CA 2PK2A 4EOKB 2W9FA 1FVVB 2C5XB 5IDPB 1OKWB 4BCKB 4Y72B 4EOQB 1OKVB 4F6UB 1D3UB 2X1NB 1URCB 3DOGB 1JSTB 4F7LB 2CCHB 4BCFB 2PMIB 2R7GA 1AISB 1TFBA 2WXVB 3TN8B 4BCJB 3MIAB 2B9RA 3LQ5B 2WHBB 1GY3B 4BCOB 1H4LD 3BHVB 1UNGD 3TNWB 4CFXB 4II5B 1OL2B 5FGKB 5HNBB 2I40B 1O9KA 3EJ1B 3TNHB 1KXUA 3RGFB 4EOSB 4CFUD 2WFYB 1H24B 3DDPB 3MI9B 1GUXB 4CFVB 3EOCB 1H25B 2C6TB 2PK9B 1VYWB 4EOLB 3QHWB 1N4MA 5HBEB 1G3NC 4NSTB 1P5EB 2UUEB 4EOOB 4ROCA 2IW8B 4YC3B 5LQFB 4BCNB 4BCMB 2W2HA 5I5ZB 4CFNB 2I53A 4F70B 5HBHB 1PKDB 4TTHA 5CYIB 4F7NB 2IVXA 3BLHB 2CJMB 5ACBA 2W99A 5L2WB 3BHUB 3POMA 4I3ZB 2UZEB 3QHRB 3MY5B 3BLQB 1JKWA 2UZDB 3O0GD 1OL1B 3DDQB 3MY1B 4KRDB 5BNJB 4OR5B 1VOLA 2W96A 4CRLB 5IF1B 4KRCB 5HQ0B 3BLRB 4FX3B 4EC8B 1H26B 3H4CA 2C5OB 3EIDB 1H1SB 5ICPB 2WMBB 1UNLD 4CXAB 2IW9B 1H1RB 4EOMB 4BCHB 4EC9B 2V22B 4F7SB 1O9KB 4EOPB 5CEIB 2IW6B 1OI9B 4BCND 4BCQB 4BCMD 4YOZA 2WIHB 2BKZB 2UZLB 1UNHD 4EORB 2PHGA 4BCGB 4ELJA 4UN0A 5LMKB 2WEVB 1XO2A 4G6LB 3BHTB 4EOJB 1W98B 2WIPB 4IMYB 4BCIB 1GH6B 1H1QB 3TNIB 1H28B 2UZBB 1E9HB 1JOWA 4RODA 1H27B 2W9ZA 5HBJB 5HVYB 2C5NB 1H1PB 4OGRB 1QMZB 1OIYB 4EONB 3F5XB 1FINB 1OGUB 4CFWB 1C9BA 4F6SB 2CCIB 4BCPB 3M03A 1ZP2A 4ROEA 2WPAB 2EUFA
chains in the Genus database with same CATH superfamily
1ENWA 1GUXA 2BPMB 3X20B 5EFQB 1BU2A 2CZ6B 5IDNB 3A8GB 2PK2A 1TD6A 4LOCA 1OKVB 1D3UB 2ZPGB 4F7LB 2CCHB 3KHIA 4BCJB 3MIAB 2B9RA 2QQ8A 3LQ5B 2WHBB 1UNGD 3TNWB 1OL2B 5FGKB 2CZ1B 4BXXX 3BG9A 3TNHB 4EOSB 2KR6A 3QYEA 1H24B 3DDPB 1VYWB 2QFZA 3QHWB 2DD4B 2ZPHB 4ROCA 4BBSM 3HO8A 4BCNB 2W2HA 5I5ZB 2I53A 4F70B 1PKDB 4F7NB 5ACBA 3HZJA 3BHUB 2UZEB 3DTOA 1JKWA 3QZ5B 5BNJB 4FX3B 1H26B 2ZPIB 3H4CA 2DMEA 4CXAB 1UGRB 2LW4A 1O9KB 2ZPBB 1UGPB 1OI9B 4BCND 4BCQB 4EORB 4ELJA 4MFDA 3HHTB 4HNTA 4IMYB 3VKHA 2UZBB 2ZZDB 2C5NB 4JX6A 1OIYB 1OGUB 3QYGB 2QDYB 3M03A 5DQVA 2G9XB 3WVDB 1JSUB 4BCQD 3VKGA 1VINA 3G33B 2C5XB 4FM4B 3NDQA 1QLBA 3A8MB 2PMIB 1AISB 3QYBA 2DXBB 2QGSA 4II5B 4BBRM 3EJ1B 3RGFB 2WFYB 1GUXB 3X28B 3EOCB 4EOLB 3HB9A 1G3NC 1P5EB 5LQFB 2DD5B 4AKHA 2IVXA 4Z6YA 3POMA 4ZGJB 4KRDB 2UZDB 3O0GD 3DDQB 4HNUA 2W96A 3BLRB 1UGQB 4EC8B 3EIDB 1H1SB 5ICPB 2IW9B 4BCHB 3DJBA 2BKZB 2UZLB 3TW7A 2ZPEB 2PHGA 1XO2A 2IN3A 1W98B 3TNIB 2BS4A 1E9HB 4OB0B 1H27B 5HBJB 1QMZB 2WPAB 2EUFA 4EOIB 3BG5A 2QDJA 3A8HB 4F7JB 4CFMB 4OB1B 2DPPB 2F2CA 4EOKB 1FVVB 5IDPB 4EOQB 3X26B 4F6UB 3DOGB 1JSTB 4BCFB 4JX5A 1V29B 1TFBA 2WXVB 2D0QB 1GY3B 1H4LD 3BHVB 3QYHB 5HNBB 2I40B 1KXUA 4HLQA 3MI9B 4OB2B 1H25B 2PK9B 5HBEB 4NSTB 2UUEB 4EOOB 3VYHB 3TW6A 4CFNB 2QF7A 5CYIB 3QXEB 3BLHB 2DXCB 5L2WB 3QZ9B 2G77A 3MY5B 3BLQB 3MY1B 4OR5B 3HBLA 1VOLA 3A8LB 2ZCFB 4KRCB 1UNLD 2V22B 4EOPB 4YOZA 1UNHD 4M6VA 4BCGB 4UN0A 5LMKB 4AKGA 3BHTB 2WIPB 1GH6B 1H1QB 2AHJB 4MIMA 4EONB 3F5XB 1FINB 3WVEB 4CFWB 1ZP2A 1FKMA 4ELLA 1IREB 1OIUB 4YOSA 2WMAB 3K7AM 1AD6A 5IHYA 3VYGB 2C5VB 2C4GB 2CZ0B 2JGZB 4CFUB 1F5QB 4AKIA 4F6WB 3BG3A 4YOOA 3DL1A 2W9FA 2KMGA 1OKWB 4BCKB 3X24B 4Y72B 2X1NB 1URCB 2R7GA 2WJ9A 4JX4A 4NC6A 3TN8B 4MFEA 4BCOB 4QSHA 4CFXB 1O9KA 1E7PA 2CZ7B 4CFUD 5EJCA 3X25B 4CFVB 4AI6A 2C6TB 1N4MA 5DQWA 2IW8B 2BS2A 4YC3B 4BY1X 4BCMB 4ZGEB 5HBHB 4TTHA 2CJMB 2W99A 4I3ZB 3QHRB 1OL1B 4HNVA 4BY7X 4CRLB 5IF1B 3GTMS 2C5OB 3PO3S 2CYZB 4ZGDB 2WMBB 1AHJB 1H1RB 4EOMB 4EC9B 4F7SB 5CEIB 2BS3A 2IW6B 2ZPFB 4BCMD 2WIHB 1UGSB 4OB3B 2PJQA 2WEVB 4G6LB 3B57A 4EOJB 4BCIB 3A8OB 1H28B 1JOWA 4RODA 2W9ZA 5HVYB 1H1PB 4OGRB 4HL4A 1C9BA 4F6SB 2CCIB 3QWLA 4BCPB 4ROEA 5HQ0B
chains in the Genus database with same CATH topology
1GUXA 4EOIB 2G9XB 4ELLA 2BPMB 2QDJA 5EFQB 4F7JB 1OIUB 4YOSA 4CFMB 1BU2A 1JSUB 4BCQD 2WMAB 1VINA 3G33B 3K7AM 1AD6A 2C5VB 2C4GB 5IDNB 2JGZB 4CFUB 1F5QB 4F6WB 4YOOA 2F2CA 2PK2A 4EOKB 2W9FA 1FVVB 2C5XB 5IDPB 1OKWB 4BCKB 4Y72B 4EOQB 1OKVB 4F6UB 1D3UB 2X1NB 1URCB 3DOGB 1JSTB 4F7LB 2CCHB 4BCFB 2PMIB 2R7GA 1AISB 1TFBA 2WXVB 3TN8B 4BCJB 3MIAB 2B9RA 3LQ5B 2WHBB 1GY3B 4BCOB 1H4LD 3BHVB 1UNGD 3TNWB 4CFXB 4II5B 1OL2B 5FGKB 5HNBB 2I40B 1O9KA 3EJ1B 3TNHB 1KXUA 3RGFB 4EOSB 4CFUD 2WFYB 1H24B 3DDPB 3MI9B 1GUXB 4CFVB 3EOCB 1H25B 2C6TB 2PK9B 1VYWB 4EOLB 3QHWB 1N4MA 5HBEB 1G3NC 4NSTB 1P5EB 2UUEB 4EOOB 4ROCA 2IW8B 4YC3B 5LQFB 4BCNB 4BCMB 2W2HA 5I5ZB 4CFNB 2I53A 4F70B 5HBHB 1PKDB 4TTHA 5CYIB 4F7NB 2IVXA 3BLHB 2CJMB 5ACBA 2W99A 5L2WB 3BHUB 3POMA 4I3ZB 2UZEB 3QHRB 3MY5B 3BLQB 1JKWA 2UZDB 3O0GD 1OL1B 3DDQB 3MY1B 4KRDB 5BNJB 4OR5B 1VOLA 2W96A 4CRLB 5IF1B 4KRCB 5HQ0B 3BLRB 4FX3B 4EC8B 1H26B 3H4CA 2C5OB 3EIDB 1H1SB 5ICPB 2WMBB 1UNLD 4CXAB 2IW9B 1H1RB 4EOMB 4BCHB 4EC9B 2V22B 4F7SB 1O9KB 4EOPB 5CEIB 2IW6B 1OI9B 4BCND 4BCQB 4BCMD 4YOZA 2WIHB 2BKZB 2UZLB 1UNHD 4EORB 2PHGA 4BCGB 4ELJA 4UN0A 5LMKB 2WEVB 1XO2A 4G6LB 3BHTB 4EOJB 1W98B 2WIPB 4IMYB 4BCIB 1GH6B 1H1QB 3TNIB 1H28B 2UZBB 1E9HB 1JOWA 4RODA 1H27B 2W9ZA 5HBJB 5HVYB 2C5NB 1H1PB 4OGRB 1QMZB 1OIYB 4EONB 3F5XB 1FINB 1OGUB 4CFWB 1C9BA 4F6SB 2CCIB 4BCPB 3M03A 1ZP2A 4ROEA 2WPAB 2EUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUX A;  4EOI B;  2G9X B;  4ELL A;  2BPM B;  2QDJ A;  5EFQ B;  4F7J B;  1OIU B;  4YOS A;  4CFM B;  1BU2 A;  1JSU B;  4BCQ D;  2WMA B;  1VIN A;  3G33 B;  3K7A M;  1AD6 A;  2C5V B;  2C4G B;  5IDN B;  2JGZ B;  4CFU B;  1F5Q B;  4F6W B;  4YOO A;  2F2C A;  2PK2 A;  4EOK B;  2W9F A;  1FVV B;  2C5X B;  5IDP B;  1OKW B;  4BCK B;  4Y72 B;  4EOQ B;  1OKV B;  4F6U B;  1D3U B;  2X1N B;  1URC B;  3DOG B;  1JST B;  4F7L B;  2CCH B;  4BCF B;  2PMI B;  2R7G A;  1AIS B;  1TFB A;  2WXV B;  3TN8 B;  4BCJ B;  3MIA B;  2B9R A;  3LQ5 B;  2WHB B;  1GY3 B;  4BCO B;  1H4L D;  3BHV B;  1UNG D;  3TNW B;  4CFX B;  4II5 B;  1OL2 B;  5FGK B;  5HNB B;  2I40 B;  1O9K A;  3EJ1 B;  3TNH B;  1KXU A;  3RGF B;  4EOS B;  4CFU D;  2WFY B;  1H24 B;  3DDP B;  3MI9 B;  1GUX B;  4CFV B;  3EOC B;  1H25 B;  2C6T B;  2PK9 B;  1VYW B;  4EOL B;  3QHW B;  1N4M A;  5HBE B;  1G3N C;  4NST B;  1P5E B;  2UUE B;  4EOO B;  4ROC A;  2IW8 B;  4YC3 B;  5LQF B;  4BCN B;  4BCM B;  2W2H A;  5I5Z B;  4CFN B;  2I53 A;  4F70 B;  5HBH B;  1PKD B;  4TTH A;  5CYI B;  4F7N B;  2IVX A;  3BLH B;  2CJM B;  5ACB A;  2W99 A;  5L2W B;  3BHU B;  3POM A;  4I3Z B;  2UZE B;  3QHR B;  3MY5 B;  3BLQ B;  1JKW A;  2UZD B;  3O0G D;  1OL1 B;  3DDQ B;  3MY1 B;  4KRD B;  5BNJ B;  4OR5 B;  1VOL A;  2W96 A;  4CRL B;  5IF1 B;  4KRC B;  5HQ0 B;  3BLR B;  4FX3 B;  4EC8 B;  1H26 B;  3H4C A;  2C5O B;  3EID B;  1H1S B;  5ICP B;  2WMB B;  1UNL D;  4CXA B;  2IW9 B;  1H1R B;  4EOM B;  4BCH B;  4EC9 B;  2V22 B;  4F7S B;  1O9K B;  4EOP B;  5CEI B;  2IW6 B;  1OI9 B;  4BCN D;  4BCQ B;  4BCM D;  4YOZ A;  2WIH B;  2BKZ B;  2UZL B;  1UNH D;  4EOR B;  2PHG A;  4BCG B;  4ELJ A;  4UN0 A;  5LMK B;  2WEV B;  1XO2 A;  4G6L B;  3BHT B;  4EOJ B;  1W98 B;  2WIP B;  4IMY B;  4BCI B;  1GH6 B;  1H1Q B;  3TNI B;  1H28 B;  2UZB B;  1E9H B;  1JOW A;  4ROD A;  1H27 B;  2W9Z A;  5HBJ B;  5HVY B;  2C5N B;  1H1P B;  4OGR B;  1QMZ B;  1OIY B;  4EON B;  3F5X B;  1FIN B;  1OGU B;  4CFW B;  1C9B A;  4F6S B;  2CCI B;  4BCP B;  3M03 A;  1ZP2 A;  4ROE A;  2WPA B;  2EUF A; 
#chains in the Genus database with same CATH topology
 1ENW A;  1GUX A;  2BPM B;  3X20 B;  5EFQ B;  1BU2 A;  2CZ6 B;  5IDN B;  3A8G B;  2PK2 A;  1TD6 A;  4LOC A;  1OKV B;  1D3U B;  2ZPG B;  4F7L B;  2CCH B;  3KHI A;  4BCJ B;  3MIA B;  2B9R A;  2QQ8 A;  3LQ5 B;  2WHB B;  1UNG D;  3TNW B;  1OL2 B;  5FGK B;  2CZ1 B;  4BXX X;  3BG9 A;  3TNH B;  4EOS B;  2KR6 A;  3QYE A;  1H24 B;  3DDP B;  1VYW B;  2QFZ A;  3QHW B;  2DD4 B;  2ZPH B;  4ROC A;  4BBS M;  3HO8 A;  4BCN B;  2W2H A;  5I5Z B;  2I53 A;  4F70 B;  1PKD B;  4F7N B;  5ACB A;  3HZJ A;  3BHU B;  2UZE B;  3DTO A;  1JKW A;  3QZ5 B;  5BNJ B;  4FX3 B;  1H26 B;  2ZPI B;  3H4C A;  2DME A;  4CXA B;  1UGR B;  2LW4 A;  1O9K B;  2ZPB B;  1UGP B;  1OI9 B;  4BCN D;  4BCQ B;  4EOR B;  4ELJ A;  4MFD A;  3HHT B;  4HNT A;  4IMY B;  3VKH A;  2UZB B;  2ZZD B;  2C5N B;  4JX6 A;  1OIY B;  1OGU B;  3QYG B;  2QDY B;  3M03 A;  5DQV A;  2G9X B;  3WVD B;  1JSU B;  4BCQ D;  3VKG A;  1VIN A;  3G33 B;  2C5X B;  4FM4 B;  3NDQ A;  1QLB A;  3A8M B;  2PMI B;  1AIS B;  3QYB A;  2DXB B;  2QGS A;  4II5 B;  4BBR M;  3EJ1 B;  3RGF B;  2WFY B;  1GUX B;  3X28 B;  3EOC B;  4EOL B;  3HB9 A;  1G3N C;  1P5E B;  5LQF B;  2DD5 B;  4AKH A;  2IVX A;  4Z6Y A;  3POM A;  4ZGJ B;  4KRD B;  2UZD B;  3O0G D;  3DDQ B;  4HNU A;  2W96 A;  3BLR B;  1UGQ B;  4EC8 B;  3EID B;  1H1S B;  5ICP B;  2IW9 B;  4BCH B;  3DJB A;  2BKZ B;  2UZL B;  3TW7 A;  2ZPE B;  2PHG A;  1XO2 A;  2IN3 A;  1W98 B;  3TNI B;  2BS4 A;  1E9H B;  4OB0 B;  1H27 B;  5HBJ B;  1QMZ B;  2WPA B;  2EUF A;  4EOI B;  3BG5 A;  2QDJ A;  3A8H B;  4F7J B;  4CFM B;  4OB1 B;  2DPP B;  2F2C A;  4EOK B;  1FVV B;  5IDP B;  4EOQ B;  3X26 B;  4F6U B;  3DOG B;  1JST B;  4BCF B;  4JX5 A;  1V29 B;  1TFB A;  2WXV B;  2D0Q B;  1GY3 B;  1H4L D;  3BHV B;  3QYH B;  5HNB B;  2I40 B;  1KXU A;  4HLQ A;  3MI9 B;  4OB2 B;  1H25 B;  2PK9 B;  5HBE B;  4NST B;  2UUE B;  4EOO B;  3VYH B;  3TW6 A;  4CFN B;  2QF7 A;  5CYI B;  3QXE B;  3BLH B;  2DXC B;  5L2W B;  3QZ9 B;  2G77 A;  3MY5 B;  3BLQ B;  3MY1 B;  4OR5 B;  3HBL A;  1VOL A;  3A8L B;  2ZCF B;  4KRC B;  1UNL D;  2V22 B;  4EOP B;  4YOZ A;  1UNH D;  4M6V A;  4BCG B;  4UN0 A;  5LMK B;  4AKG A;  3BHT B;  2WIP B;  1GH6 B;  1H1Q B;  2AHJ B;  4MIM A;  4EON B;  3F5X B;  1FIN B;  3WVE B;  4CFW B;  1ZP2 A;  1FKM A;  4ELL A;  1IRE B;  1OIU B;  4YOS A;  2WMA B;  3K7A M;  1AD6 A;  5IHY A;  3VYG B;  2C5V B;  2C4G B;  2CZ0 B;  2JGZ B;  4CFU B;  1F5Q B;  4AKI A;  4F6W B;  3BG3 A;  4YOO A;  3DL1 A;  2W9F A;  2KMG A;  1OKW B;  4BCK B;  3X24 B;  4Y72 B;  2X1N B;  1URC B;  2R7G A;  2WJ9 A;  4JX4 A;  4NC6 A;  3TN8 B;  4MFE A;  4BCO B;  4QSH A;  4CFX B;  1O9K A;  1E7P A;  2CZ7 B;  4CFU D;  5EJC A;  3X25 B;  4CFV B;  4AI6 A;  2C6T B;  1N4M A;  5DQW A;  2IW8 B;  2BS2 A;  4YC3 B;  4BY1 X;  4BCM B;  4ZGE B;  5HBH B;  4TTH A;  2CJM B;  2W99 A;  4I3Z B;  3QHR B;  1OL1 B;  4HNV A;  4BY7 X;  4CRL B;  5IF1 B;  3GTM S;  2C5O B;  3PO3 S;  2CYZ B;  4ZGD B;  2WMB B;  1AHJ B;  1H1R B;  4EOM B;  4EC9 B;  4F7S B;  5CEI B;  2BS3 A;  2IW6 B;  2ZPF B;  4BCM D;  2WIH B;  1UGS B;  4OB3 B;  2PJQ A;  2WEV B;  4G6L B;  3B57 A;  4EOJ B;  4BCI B;  3A8O B;  1H28 B;  1JOW A;  4ROD A;  2W9Z A;  5HVY B;  1H1P B;  4OGR B;  4HL4 A;  1C9B A;  4F6S B;  2CCI B;  3QWL A;  4BCP B;  4ROE A;  5HQ0 B; 
#chains in the Genus database with same CATH homology
 1GUX A;  4EOI B;  2G9X B;  4ELL A;  2BPM B;  2QDJ A;  5EFQ B;  4F7J B;  1OIU B;  4YOS A;  4CFM B;  1BU2 A;  1JSU B;  4BCQ D;  2WMA B;  1VIN A;  3G33 B;  3K7A M;  1AD6 A;  2C5V B;  2C4G B;  5IDN B;  2JGZ B;  4CFU B;  1F5Q B;  4F6W B;  4YOO A;  2F2C A;  2PK2 A;  4EOK B;  2W9F A;  1FVV B;  2C5X B;  5IDP B;  1OKW B;  4BCK B;  4Y72 B;  4EOQ B;  1OKV B;  4F6U B;  1D3U B;  2X1N B;  1URC B;  3DOG B;  1JST B;  4F7L B;  2CCH B;  4BCF B;  2PMI B;  2R7G A;  1AIS B;  1TFB A;  2WXV B;  3TN8 B;  4BCJ B;  3MIA B;  2B9R A;  3LQ5 B;  2WHB B;  1GY3 B;  4BCO B;  1H4L D;  3BHV B;  1UNG D;  3TNW B;  4CFX B;  4II5 B;  1OL2 B;  5FGK B;  5HNB B;  2I40 B;  1O9K A;  3EJ1 B;  3TNH B;  1KXU A;  3RGF B;  4EOS B;  4CFU D;  2WFY B;  1H24 B;  3DDP B;  3MI9 B;  1GUX B;  4CFV B;  3EOC B;  1H25 B;  2C6T B;  2PK9 B;  1VYW B;  4EOL B;  3QHW B;  1N4M A;  5HBE B;  1G3N C;  4NST B;  1P5E B;  2UUE B;  4EOO B;  4ROC A;  2IW8 B;  4YC3 B;  5LQF B;  4BCN B;  4BCM B;  2W2H A;  5I5Z B;  4CFN B;  2I53 A;  4F70 B;  5HBH B;  1PKD B;  4TTH A;  5CYI B;  4F7N B;  2IVX A;  3BLH B;  2CJM B;  5ACB A;  2W99 A;  5L2W B;  3BHU B;  3POM A;  4I3Z B;  2UZE B;  3QHR B;  3MY5 B;  3BLQ B;  1JKW A;  2UZD B;  3O0G D;  1OL1 B;  3DDQ B;  3MY1 B;  4KRD B;  5BNJ B;  4OR5 B;  1VOL A;  2W96 A;  4CRL B;  5IF1 B;  4KRC B;  5HQ0 B;  3BLR B;  4FX3 B;  4EC8 B;  1H26 B;  3H4C A;  2C5O B;  3EID B;  1H1S B;  5ICP B;  2WMB B;  1UNL D;  4CXA B;  2IW9 B;  1H1R B;  4EOM B;  4BCH B;  4EC9 B;  2V22 B;  4F7S B;  1O9K B;  4EOP B;  5CEI B;  2IW6 B;  1OI9 B;  4BCN D;  4BCQ B;  4BCM D;  4YOZ A;  2WIH B;  2BKZ B;  2UZL B;  1UNH D;  4EOR B;  2PHG A;  4BCG B;  4ELJ A;  4UN0 A;  5LMK B;  2WEV B;  1XO2 A;  4G6L B;  3BHT B;  4EOJ B;  1W98 B;  2WIP B;  4IMY B;  4BCI B;  1GH6 B;  1H1Q B;  3TNI B;  1H28 B;  2UZB B;  1E9H B;  1JOW A;  4ROD A;  1H27 B;  2W9Z A;  5HBJ B;  5HVY B;  2C5N B;  1H1P B;  4OGR B;  1QMZ B;  1OIY B;  4EON B;  3F5X B;  1FIN B;  1OGU B;  4CFW B;  1C9B A;  4F6S B;  2CCI B;  4BCP B;  3M03 A;  1ZP2 A;  4ROE A;  2WPA B;  2EUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...