1E9HB

Thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Inhibitor Binding to Active and Inactive Cdk2: The Crystal Structure of Cdk2-Cyclin A/Indirubin-5-Sulphonate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 95
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1e9hB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1e9hB02
2C5NB 1W98B 3H4CA 2CCHB 4UN0A 5IF1B 2BKZB 4BCQB 1KXUA 2PMIB 3EOCB 4KRDB 4EOPB 4ROCA 2WMAB 3F5XB 3M03A 3POMA 4I3ZB 4IMYB 4EC8B 3BLHB 5HBEB 1BU2A 1FVVB 1OI9B 3BHTB 2IVXA 4YOSA 4BCKB 2WFYB 5HQ0B 1URCB 1H28B 1OIUB 1H25B 2IW8B 2UZEB 1VOLA 5LMKB 2PK2A 4BCND 1H26B 4OR5B 1C9BA 4CFNB 2QDJA 3MIAB 2BPMB 1JOWA 2JGZB 2WPAB 2W99A 3O0GD 4ROEA 5BNJB 3QHWB 1G3NC 2C6TB 1JKWA 2C4GB 1H1SB 4BCFB 5CEIB 4TTHA 3TNIB 4BCMD 4F7NB 3DDQB 4CFUB 5IDPB 1AISB 2C5VB 4OGRB 3TNWB 1OGUB 1AD6A 1OL1B 4YC3B 3TN8B 1D3UB 5HNBB 1FINB 1QMZB 4II5B 1P5EB 3BHUB 4EOKB 1VYWB 2I40B 3QHRB 3EIDB 5HBHB 4BCGB 4EOOB 1UNGD 5EFQB 4RODA 2W2HA 2C5XB 4BCQD 4F70B 5I5ZB 2UZDB 4EOLB 3DDPB 4BCHB 2R7GA 4ELLA 2UUEB 2B9RA 1JSUB 4CFXB 2WEVB 2WIHB 2PHGA 2WMBB 2I53A 2WXVB 2CJMB 4ELJA 3G33B 3BLQB 4Y72B 3RGFB 4YOZA 4F7SB 4CRLB 4EORB 5IDNB 1N4MA 2F2CA 4BCJB 1GY3B 4EC9B 4EONB 1E9HB 5CYIB 1JSTB 2W9FA 1H1PB 5ACBA 2X1NB 4F6SB 3LQ5B 1H27B 1H1RB 5HBJB 4F7JB 3K7AM 4EOSB 3EJ1B 5HVYB 1OKVB 2IW9B 4BCIB 1F5QB 1ZP2A 2WIPB 3DOGB 3MY5B 4EOJB 4EOQB 1H1QB 1OKWB 4NSTB 1O9KB 4F6UB 2W96A 2WHBB 5L2WB 2C5OB 2UZBB 5FGKB 4CFUD 3MI9B 1OIYB 4BCNB 2UZLB 1UNLD 4EOIB 1GUXB 1UNHD 4G6LB 4KRCB 4CFMB 4CXAB 4CFWB 5LQFB 4EOMB 1VINA 3MY1B 2V22B 1TFBA 2W9ZA 4BCMB 2EUFA 1H24B 4F6WB 1H4LD 2IW6B 3BHVB 1PKDB 2CCIB 4FX3B 1O9KA 4BCOB 4CFVB 3TNHB 2G9XB 5ICPB 4BCPB 1GH6B 4YOOA 1XO2A 1OL2B 4F7LB 2PK9B 3BLRB 1GUXA
chains in the Genus database with same CATH superfamily
2PJQA 4BCQB 1KXUA 2PMIB 4KRDB 3NDQA 3POMA 4I3ZB 4IMYB 4EC8B 4BY1X 2KMGA 4JX6A 4BCKB 4AKHA 1H28B 2IW8B 2UZEB 1VOLA 1UGQB 4AI6A 2WPAB 3QYBA 1G3NC 2QF7A 4TTHA 1OGUB 1AD6A 3TN8B 4M6VA 4II5B 1P5EB 3BHUB 4EOKB 3QHRB 5HBHB 2ZPBB 4EOOB 5EFQB 3KHIA 1IREB 3X25B 2B9RA 2WMBB 2WXVB 4LOCA 4OB1B 4F7SB 4YOZA 3WVEB 2F2CA 4EC9B 5CYIB 4QSHA 1H1PB 5ACBA 2DD5B 3A8GB 1H27B 1UGSB 3A8OB 4EOSB 2IW9B 4BCIB 1F5QB 3QYEA 2WIPB 4NSTB 1O9KB 4CFUD 4BCNB 3HHTB 4EOIB 1UNHD 4KRCB 4CXAB 4CFWB 5LQFB 2LW4A 4OB3B 1VINA 3X24B 1TFBA 3A8LB 4HL4A 2IW6B 1PKDB 4FX3B 5ICPB 4YOOA 1OL2B 2R7GA 4HNUA 3GTMS 3VKHA 2C5NB 1W98B 3H4CA 5IF1B 3F5XB 3PO3S 1TD6A 2DXCB 1FVVB 1OI9B 3BHTB 5IHYA 2IVXA 3X28B 2ZZDB 1URCB 4HLQA 1H25B 2PK2A 4OR5B 1C9BA 4CFNB 4NC6A 1E7PA 3DDQB 3TNWB 4YC3B 1D3UB 3DL1A 5HNBB 2I40B 4JX4A 3A8MB 4RODA 2W2HA 4BCQD 4F70B 2CZ1B 5I5ZB 4AKGA 3B57A 4EOLB 4BCHB 4ELLA 2UUEB 1JSUB 3VYGB 2WEVB 2WIHB 1QLBA 2QDYB 5DQVA 3G33B 4CRLB 4EORB 1JSTB 4OB0B 4F6SB 5HBJB 4F7JB 3K7AM 3EJ1B 1OKVB 1ZP2A 3MY5B 5DQWA 4F6UB 1AHJB 5FGKB 2UZLB 1GUXB 4G6LB 4JX5A 3VKGA 2CZ0B 3WVDB 4EOMB 4BCMB 2EUFA 1H24B 4F6WB 1H4LD 4FM4B 4MFEA 2G9XB 2ZPIB 1XO2A 2CCHB 2BKZB 4EOPB 4ZGJB 3EOCB 2QFZA 2D0QB 4YOSA 2WFYB 1OIUB 2ZPEB 3QZ5B 4BCND 1H26B 3BG5A 3MIAB 2AHJB 4BCFB 3TNIB 5IDPB 4OGRB 1OL1B 3HZJA 1QMZB 2CYZB 1VYWB 2BS3A 2DXBB 2UZDB 3DDPB 2BS4A 3X20B 2PHGA 3TW7A 4ZGDB 2CJMB 1V29B 1N4MA 4BCJB 4EONB 1GY3B 1E9HB 1FKMA 1H1RB 3QYGB 3QXEB 5HVYB 4BY7X 3DOGB 4BXXX 4EOJB 4EOQB 1H1QB 3A8HB 4HNVA 2W96A 5L2WB 2C5OB 2UZBB 3QWLA 1OIYB 1UNLD 2DD4B 4CFMB 4HNTA 2IN3A 3QYHB 3BG3A 2ZPFB 3MY1B 3BHVB 2ZCFB 2CCIB 4BCOB 1O9KA 3X26B 3TNHB 4F7LB 2BS2A 4UN0A 1UGRB 4BBSM 4ROCA 2WMAB 4Z6YA 5EJCA 3M03A 4AKIA 3BLHB 5HBEB 1BU2A 3QZ9B 5HQ0B 3DJBA 3HB9A 2WJ9A 2ZPGB 2CZ6B 2ZPHB 5LMKB 4ZGEB 2CZ7B 2QDJA 2BPMB 1JOWA 3TW6A 2JGZB 2W99A 3O0GD 4ROEA 5BNJB 1ENWA 3QHWB 2C6TB 1JKWA 2C4GB 1H1SB 5CEIB 4F7NB 4BCMD 1AISB 4CFUB 2C5VB 4MFDA 2QGSA 1FINB 3EIDB 4BCGB 1UNGD 3HBLA 2C5XB 4BBRM 4CFXB 2I53A 4ELJA 3BLQB 4Y72B 3RGFB 5IDNB 2DMEA 2DPPB 2W9FA 2G77A 2X1NB 3LQ5B 4MIMA 2QQ8A 1OKWB 4OB2B 2WHBB 1UGPB 3MI9B 3HO8A 3BG9A 2V22B 3VYHB 2W9ZA 4CFVB 4BCPB 2KR6A 1GH6B 3DTOA 2PK9B 3BLRB 1GUXA
chains in the Genus database with same CATH topology
2C5NB 1W98B 3H4CA 2CCHB 4UN0A 5IF1B 2BKZB 4BCQB 1KXUA 2PMIB 3EOCB 4KRDB 4EOPB 4ROCA 2WMAB 3F5XB 3M03A 3POMA 4I3ZB 4IMYB 4EC8B 3BLHB 5HBEB 1BU2A 1FVVB 1OI9B 3BHTB 2IVXA 4YOSA 4BCKB 2WFYB 5HQ0B 1URCB 1H28B 1OIUB 1H25B 2IW8B 2UZEB 1VOLA 5LMKB 2PK2A 4BCND 1H26B 4OR5B 1C9BA 4CFNB 2QDJA 3MIAB 2BPMB 1JOWA 2JGZB 2WPAB 2W99A 3O0GD 4ROEA 5BNJB 3QHWB 1G3NC 2C6TB 1JKWA 2C4GB 1H1SB 4BCFB 5CEIB 4TTHA 3TNIB 4BCMD 4F7NB 3DDQB 4CFUB 5IDPB 1AISB 2C5VB 4OGRB 3TNWB 1OGUB 1AD6A 1OL1B 4YC3B 3TN8B 1D3UB 5HNBB 1FINB 1QMZB 4II5B 1P5EB 3BHUB 4EOKB 1VYWB 2I40B 3QHRB 3EIDB 5HBHB 4BCGB 4EOOB 1UNGD 5EFQB 4RODA 2W2HA 2C5XB 4BCQD 4F70B 5I5ZB 2UZDB 4EOLB 3DDPB 4BCHB 2R7GA 4ELLA 2UUEB 2B9RA 1JSUB 4CFXB 2WEVB 2WIHB 2PHGA 2WMBB 2I53A 2WXVB 2CJMB 4ELJA 3G33B 3BLQB 4Y72B 3RGFB 4YOZA 4F7SB 4CRLB 4EORB 5IDNB 1N4MA 2F2CA 4BCJB 1GY3B 4EC9B 4EONB 1E9HB 5CYIB 1JSTB 2W9FA 1H1PB 5ACBA 2X1NB 4F6SB 3LQ5B 1H27B 1H1RB 5HBJB 4F7JB 3K7AM 4EOSB 3EJ1B 5HVYB 1OKVB 2IW9B 4BCIB 1F5QB 1ZP2A 2WIPB 3DOGB 3MY5B 4EOJB 4EOQB 1H1QB 1OKWB 4NSTB 1O9KB 4F6UB 2W96A 2WHBB 5L2WB 2C5OB 2UZBB 5FGKB 4CFUD 3MI9B 1OIYB 4BCNB 2UZLB 1UNLD 4EOIB 1GUXB 1UNHD 4G6LB 4KRCB 4CFMB 4CXAB 4CFWB 5LQFB 4EOMB 1VINA 3MY1B 2V22B 1TFBA 2W9ZA 4BCMB 2EUFA 1H24B 4F6WB 1H4LD 2IW6B 3BHVB 1PKDB 2CCIB 4FX3B 1O9KA 4BCOB 4CFVB 3TNHB 2G9XB 5ICPB 4BCPB 1GH6B 4YOOA 1XO2A 1OL2B 4F7LB 2PK9B 3BLRB 1GUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5N B;  1W98 B;  3H4C A;  2CCH B;  4UN0 A;  5IF1 B;  2BKZ B;  4BCQ B;  1KXU A;  2PMI B;  3EOC B;  4KRD B;  4EOP B;  4ROC A;  2WMA B;  3F5X B;  3M03 A;  3POM A;  4I3Z B;  4IMY B;  4EC8 B;  3BLH B;  5HBE B;  1BU2 A;  1FVV B;  1OI9 B;  3BHT B;  2IVX A;  4YOS A;  4BCK B;  2WFY B;  5HQ0 B;  1URC B;  1H28 B;  1OIU B;  1H25 B;  2IW8 B;  2UZE B;  1VOL A;  5LMK B;  2PK2 A;  4BCN D;  1H26 B;  4OR5 B;  1C9B A;  4CFN B;  2QDJ A;  3MIA B;  2BPM B;  1JOW A;  2JGZ B;  2WPA B;  2W99 A;  3O0G D;  4ROE A;  5BNJ B;  3QHW B;  1G3N C;  2C6T B;  1JKW A;  2C4G B;  1H1S B;  4BCF B;  5CEI B;  4TTH A;  3TNI B;  4BCM D;  4F7N B;  3DDQ B;  4CFU B;  5IDP B;  1AIS B;  2C5V B;  4OGR B;  3TNW B;  1OGU B;  1AD6 A;  1OL1 B;  4YC3 B;  3TN8 B;  1D3U B;  5HNB B;  1FIN B;  1QMZ B;  4II5 B;  1P5E B;  3BHU B;  4EOK B;  1VYW B;  2I40 B;  3QHR B;  3EID B;  5HBH B;  4BCG B;  4EOO B;  1UNG D;  5EFQ B;  4ROD A;  2W2H A;  2C5X B;  4BCQ D;  4F70 B;  5I5Z B;  2UZD B;  4EOL B;  3DDP B;  4BCH B;  2R7G A;  4ELL A;  2UUE B;  2B9R A;  1JSU B;  4CFX B;  2WEV B;  2WIH B;  2PHG A;  2WMB B;  2I53 A;  2WXV B;  2CJM B;  4ELJ A;  3G33 B;  3BLQ B;  4Y72 B;  3RGF B;  4YOZ A;  4F7S B;  4CRL B;  4EOR B;  5IDN B;  1N4M A;  2F2C A;  4BCJ B;  1GY3 B;  4EC9 B;  4EON B;  1E9H B;  5CYI B;  1JST B;  2W9F A;  1H1P B;  5ACB A;  2X1N B;  4F6S B;  3LQ5 B;  1H27 B;  1H1R B;  5HBJ B;  4F7J B;  3K7A M;  4EOS B;  3EJ1 B;  5HVY B;  1OKV B;  2IW9 B;  4BCI B;  1F5Q B;  1ZP2 A;  2WIP B;  3DOG B;  3MY5 B;  4EOJ B;  4EOQ B;  1H1Q B;  1OKW B;  4NST B;  1O9K B;  4F6U B;  2W96 A;  2WHB B;  5L2W B;  2C5O B;  2UZB B;  5FGK B;  4CFU D;  3MI9 B;  1OIY B;  4BCN B;  2UZL B;  1UNL D;  4EOI B;  1GUX B;  1UNH D;  4G6L B;  4KRC B;  4CFM B;  4CXA B;  4CFW B;  5LQF B;  4EOM B;  1VIN A;  3MY1 B;  2V22 B;  1TFB A;  2W9Z A;  4BCM B;  2EUF A;  1H24 B;  4F6W B;  1H4L D;  2IW6 B;  3BHV B;  1PKD B;  2CCI B;  4FX3 B;  1O9K A;  4BCO B;  4CFV B;  3TNH B;  2G9X B;  5ICP B;  4BCP B;  1GH6 B;  4YOO A;  1XO2 A;  1OL2 B;  4F7L B;  2PK9 B;  3BLR B;  1GUX A; 
#chains in the Genus database with same CATH topology
 2PJQ A;  4BCQ B;  1KXU A;  2PMI B;  4KRD B;  3NDQ A;  3POM A;  4I3Z B;  4IMY B;  4EC8 B;  4BY1 X;  2KMG A;  4JX6 A;  4BCK B;  4AKH A;  1H28 B;  2IW8 B;  2UZE B;  1VOL A;  1UGQ B;  4AI6 A;  2WPA B;  3QYB A;  1G3N C;  2QF7 A;  4TTH A;  1OGU B;  1AD6 A;  3TN8 B;  4M6V A;  4II5 B;  1P5E B;  3BHU B;  4EOK B;  3QHR B;  5HBH B;  2ZPB B;  4EOO B;  5EFQ B;  3KHI A;  1IRE B;  3X25 B;  2B9R A;  2WMB B;  2WXV B;  4LOC A;  4OB1 B;  4F7S B;  4YOZ A;  3WVE B;  2F2C A;  4EC9 B;  5CYI B;  4QSH A;  1H1P B;  5ACB A;  2DD5 B;  3A8G B;  1H27 B;  1UGS B;  3A8O B;  4EOS B;  2IW9 B;  4BCI B;  1F5Q B;  3QYE A;  2WIP B;  4NST B;  1O9K B;  4CFU D;  4BCN B;  3HHT B;  4EOI B;  1UNH D;  4KRC B;  4CXA B;  4CFW B;  5LQF B;  2LW4 A;  4OB3 B;  1VIN A;  3X24 B;  1TFB A;  3A8L B;  4HL4 A;  2IW6 B;  1PKD B;  4FX3 B;  5ICP B;  4YOO A;  1OL2 B;  2R7G A;  4HNU A;  3GTM S;  3VKH A;  2C5N B;  1W98 B;  3H4C A;  5IF1 B;  3F5X B;  3PO3 S;  1TD6 A;  2DXC B;  1FVV B;  1OI9 B;  3BHT B;  5IHY A;  2IVX A;  3X28 B;  2ZZD B;  1URC B;  4HLQ A;  1H25 B;  2PK2 A;  4OR5 B;  1C9B A;  4CFN B;  4NC6 A;  1E7P A;  3DDQ B;  3TNW B;  4YC3 B;  1D3U B;  3DL1 A;  5HNB B;  2I40 B;  4JX4 A;  3A8M B;  4ROD A;  2W2H A;  4BCQ D;  4F70 B;  2CZ1 B;  5I5Z B;  4AKG A;  3B57 A;  4EOL B;  4BCH B;  4ELL A;  2UUE B;  1JSU B;  3VYG B;  2WEV B;  2WIH B;  1QLB A;  2QDY B;  5DQV A;  3G33 B;  4CRL B;  4EOR B;  1JST B;  4OB0 B;  4F6S B;  5HBJ B;  4F7J B;  3K7A M;  3EJ1 B;  1OKV B;  1ZP2 A;  3MY5 B;  5DQW A;  4F6U B;  1AHJ B;  5FGK B;  2UZL B;  1GUX B;  4G6L B;  4JX5 A;  3VKG A;  2CZ0 B;  3WVD B;  4EOM B;  4BCM B;  2EUF A;  1H24 B;  4F6W B;  1H4L D;  4FM4 B;  4MFE A;  2G9X B;  2ZPI B;  1XO2 A;  2CCH B;  2BKZ B;  4EOP B;  4ZGJ B;  3EOC B;  2QFZ A;  2D0Q B;  4YOS A;  2WFY B;  1OIU B;  2ZPE B;  3QZ5 B;  4BCN D;  1H26 B;  3BG5 A;  3MIA B;  2AHJ B;  4BCF B;  3TNI B;  5IDP B;  4OGR B;  1OL1 B;  3HZJ A;  1QMZ B;  2CYZ B;  1VYW B;  2BS3 A;  2DXB B;  2UZD B;  3DDP B;  2BS4 A;  3X20 B;  2PHG A;  3TW7 A;  4ZGD B;  2CJM B;  1V29 B;  1N4M A;  4BCJ B;  4EON B;  1GY3 B;  1E9H B;  1FKM A;  1H1R B;  3QYG B;  3QXE B;  5HVY B;  4BY7 X;  3DOG B;  4BXX X;  4EOJ B;  4EOQ B;  1H1Q B;  3A8H B;  4HNV A;  2W96 A;  5L2W B;  2C5O B;  2UZB B;  3QWL A;  1OIY B;  1UNL D;  2DD4 B;  4CFM B;  4HNT A;  2IN3 A;  3QYH B;  3BG3 A;  2ZPF B;  3MY1 B;  3BHV B;  2ZCF B;  2CCI B;  4BCO B;  1O9K A;  3X26 B;  3TNH B;  4F7L B;  2BS2 A;  4UN0 A;  1UGR B;  4BBS M;  4ROC A;  2WMA B;  4Z6Y A;  5EJC A;  3M03 A;  4AKI A;  3BLH B;  5HBE B;  1BU2 A;  3QZ9 B;  5HQ0 B;  3DJB A;  3HB9 A;  2WJ9 A;  2ZPG B;  2CZ6 B;  2ZPH B;  5LMK B;  4ZGE B;  2CZ7 B;  2QDJ A;  2BPM B;  1JOW A;  3TW6 A;  2JGZ B;  2W99 A;  3O0G D;  4ROE A;  5BNJ B;  1ENW A;  3QHW B;  2C6T B;  1JKW A;  2C4G B;  1H1S B;  5CEI B;  4F7N B;  4BCM D;  1AIS B;  4CFU B;  2C5V B;  4MFD A;  2QGS A;  1FIN B;  3EID B;  4BCG B;  1UNG D;  3HBL A;  2C5X B;  4BBR M;  4CFX B;  2I53 A;  4ELJ A;  3BLQ B;  4Y72 B;  3RGF B;  5IDN B;  2DME A;  2DPP B;  2W9F A;  2G77 A;  2X1N B;  3LQ5 B;  4MIM A;  2QQ8 A;  1OKW B;  4OB2 B;  2WHB B;  1UGP B;  3MI9 B;  3HO8 A;  3BG9 A;  2V22 B;  3VYH B;  2W9Z A;  4CFV B;  4BCP B;  2KR6 A;  1GH6 B;  3DTO A;  2PK9 B;  3BLR B;  1GUX A; 
#chains in the Genus database with same CATH homology
 2C5N B;  1W98 B;  3H4C A;  2CCH B;  4UN0 A;  5IF1 B;  2BKZ B;  4BCQ B;  1KXU A;  2PMI B;  3EOC B;  4KRD B;  4EOP B;  4ROC A;  2WMA B;  3F5X B;  3M03 A;  3POM A;  4I3Z B;  4IMY B;  4EC8 B;  3BLH B;  5HBE B;  1BU2 A;  1FVV B;  1OI9 B;  3BHT B;  2IVX A;  4YOS A;  4BCK B;  2WFY B;  5HQ0 B;  1URC B;  1H28 B;  1OIU B;  1H25 B;  2IW8 B;  2UZE B;  1VOL A;  5LMK B;  2PK2 A;  4BCN D;  1H26 B;  4OR5 B;  1C9B A;  4CFN B;  2QDJ A;  3MIA B;  2BPM B;  1JOW A;  2JGZ B;  2WPA B;  2W99 A;  3O0G D;  4ROE A;  5BNJ B;  3QHW B;  1G3N C;  2C6T B;  1JKW A;  2C4G B;  1H1S B;  4BCF B;  5CEI B;  4TTH A;  3TNI B;  4BCM D;  4F7N B;  3DDQ B;  4CFU B;  5IDP B;  1AIS B;  2C5V B;  4OGR B;  3TNW B;  1OGU B;  1AD6 A;  1OL1 B;  4YC3 B;  3TN8 B;  1D3U B;  5HNB B;  1FIN B;  1QMZ B;  4II5 B;  1P5E B;  3BHU B;  4EOK B;  1VYW B;  2I40 B;  3QHR B;  3EID B;  5HBH B;  4BCG B;  4EOO B;  1UNG D;  5EFQ B;  4ROD A;  2W2H A;  2C5X B;  4BCQ D;  4F70 B;  5I5Z B;  2UZD B;  4EOL B;  3DDP B;  4BCH B;  2R7G A;  4ELL A;  2UUE B;  2B9R A;  1JSU B;  4CFX B;  2WEV B;  2WIH B;  2PHG A;  2WMB B;  2I53 A;  2WXV B;  2CJM B;  4ELJ A;  3G33 B;  3BLQ B;  4Y72 B;  3RGF B;  4YOZ A;  4F7S B;  4CRL B;  4EOR B;  5IDN B;  1N4M A;  2F2C A;  4BCJ B;  1GY3 B;  4EC9 B;  4EON B;  1E9H B;  5CYI B;  1JST B;  2W9F A;  1H1P B;  5ACB A;  2X1N B;  4F6S B;  3LQ5 B;  1H27 B;  1H1R B;  5HBJ B;  4F7J B;  3K7A M;  4EOS B;  3EJ1 B;  5HVY B;  1OKV B;  2IW9 B;  4BCI B;  1F5Q B;  1ZP2 A;  2WIP B;  3DOG B;  3MY5 B;  4EOJ B;  4EOQ B;  1H1Q B;  1OKW B;  4NST B;  1O9K B;  4F6U B;  2W96 A;  2WHB B;  5L2W B;  2C5O B;  2UZB B;  5FGK B;  4CFU D;  3MI9 B;  1OIY B;  4BCN B;  2UZL B;  1UNL D;  4EOI B;  1GUX B;  1UNH D;  4G6L B;  4KRC B;  4CFM B;  4CXA B;  4CFW B;  5LQF B;  4EOM B;  1VIN A;  3MY1 B;  2V22 B;  1TFB A;  2W9Z A;  4BCM B;  2EUF A;  1H24 B;  4F6W B;  1H4L D;  2IW6 B;  3BHV B;  1PKD B;  2CCI B;  4FX3 B;  1O9K A;  4BCO B;  4CFV B;  3TNH B;  2G9X B;  5ICP B;  4BCP B;  1GH6 B;  4YOO A;  1XO2 A;  1OL2 B;  4F7L B;  2PK9 B;  3BLR B;  1GUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...