3NDQA

Structure of human tfiis domain ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
97
structure length
97
Chain Sequence
RAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription elongation factor A protein 1
publication title Structure of Human TFIIS Domain II
rcsb
source organism Homo sapiens
total genus 40
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3ndqA00
2DMEA 3NDQA 4BY1X 3GTMS 3PO3S 4BXXX 2LW4A 4BY7X 1ENWA
chains in the Genus database with same CATH superfamily
1E7PA 3DJBA 4BCOB 1XO2A 2WMBB 1UGPB 3DOGB 4F7NB 5IDPB 2BS2A 1OI9B 4UN0A 4EOPB 4YOZA 1H1SB 3BG3A 1FINB 2QDYB 2IW6B 5EJCA 5HQ0B 4RODA 4YOSA 2W9FA 2W99A 4EOOB 1W98B 4EORB 2R7GA 4FM4B 1V29B 1H1RB 2CCIB 4NC6A 3POMA 3BG5A 4Z6YA 2DMEA 1VYWB 2V22B 1OGUB 3QZ9B 4OB3B 2BS4A 4EOJB 4Y72B 3X25B 4BCIB 1PKDB 2B9RA 2C5OB 4HLQA 2ZPFB 3EJ1B 4BCND 4EOIB 1GUXB 2C5XB 1AISB 2CJMB 2PMIB 1OL1B 1H4LD 3A8MB 4EONB 2AHJB 4HNUA 5L2WB 3NDQA 3VYHB 2ZCFB 4OGRB 2G9XB 3DTOA 3WVEB 4EOSB 4ELJA 4BXXX 2UZDB 1OKVB 2QQ8A 4CFUD 1OIYB 1UGRB 5CEIB 4CFMB 2D0QB 3DDQB 2CCHB 4CFNB 1F5QB 3RGFB 3MY5B 4EOLB 2WIHB 3K7AM 2ZPIB 3A8LB 3X24B 1ENWA 2W9ZA 2IW8B 3TNHB 1H26B 4II5B 1OKWB 2IW9B 1OL2B 3BLHB 2QGSA 3MY1B 5BNJB 3QWLA 4BY7X 2UUEB 2CYZB 3BLQB 4EOMB 1AHJB 2ZZDB 4BCJB 4ROCA 1JSTB 5DQWA 3HZJA 4AKGA 3M03A 4EOQB 5HBJB 2G77A 4ROEA 1QMZB 2WPAB 2F2CA 1UNHD 2WMAB 2I40B 4ELLA 2PHGA 3EOCB 3KHIA 3QZ5B 1JSUB 4JX6A 2C4GB 3TNIB 3DDPB 3TN8B 2PJQA 1BU2A 1P5EB 2WHBB 2QFZA 3HBLA 2C6TB 4BCNB 2I53A 3QHWB 4BCHB 1OIUB 3QHRB 2W2HA 1AD6A 2BPMB 2WEVB 2BKZB 3EIDB 2IVXA 2DD5B 4AI6A 2C5VB 4JX5A 2CZ7B 1JKWA 1H1QB 2CZ0B 2ZPGB 2DD4B 4CFXB 4ZGEB 3A8GB 4OB1B 4BCQD 5FGKB 4MFDA 2KMGA 5HNBB 4YC3B 4CFUB 1TD6A 2DXBB 3X20B 2IN3A 4HNVA 2BS3A 4F6SB 4FX3B 4BCMB 4OB0B 4BCKB 2WJ9A 3VKHA 4BCMD 2EUFA 3B57A 3QYEA 4YOOA 4AKHA 2CZ6B 5IF1B 1H25B 5IDNB 5CYIB 4EC9B 1O9KA 2UZLB 5DQVA 3VKGA 5HVYB 3HB9A 3A8HB 1FVVB 2LW4A 3MIAB 5I5ZB 3LQ5B 2UZEB 4OR5B 1UGSB 3X26B 2UZBB 5IHYA 5EFQB 1IREB 4KRCB 1URCB 4EC8B 2JGZB 1QLBA 5ACBA 4CFVB 3F5XB 5LQFB 1H28B 3BHUB 2DPPB 2WIPB 3X28B 5HBHB 3BG9A 4CXAB 3MI9B 1VINA 3H4CA 1GY3B 1UNLD 2PK9B 1FKMA 4BBSM 1C9BA 1E9HB 1H1PB 4F7SB 3TW6A 4ZGJB 1H24B 3A8OB 2X1NB 2ZPEB 1JOWA 3HHTB 4LOCA 4BCPB 4JX4A 4KRDB 3TNWB 1ZP2A 4CRLB 4BCFB 4HNTA 4MFEA 1N4MA 1H27B 4BBRM 3QYHB 4HL4A 1TFBA 2C5NB 3WVDB 3BHTB 1VOLA 3GTMS 3TW7A 2DXCB 3O0GD 2QF7A 1KXUA 4BCQB 1G3NC 2PK2A 4F6UB 3G33B 1GUXA 5LMKB 4I3ZB 2ZPHB 3VYGB 2KR6A 4G6LB 4AKIA 3QYGB 5HBEB 5ICPB 2CZ1B 4F6WB 4F70B 4M6VA 1UGQB 3BHVB 3BLRB 2QDJA 3QXEB 4ZGDB 4F7LB 1GH6B 4OB2B 4CFWB 2WXVB 4IMYB 4BCGB 1O9KB 3QYBA 1D3UB 3DL1A 2ZPBB 3HO8A 2W96A 4BY1X 4QSHA 1UNGD 4TTHA 4EOKB 3PO3S 2WFYB 4MIMA 4NSTB 4F7JB
chains in the Genus database with same CATH topology
2DMEA 3NDQA 4BY1X 3GTMS 3PO3S 4BXXX 2LW4A 4BY7X 1ENWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DME A;  3NDQ A;  4BY1 X;  3GTM S;  3PO3 S;  4BXX X;  2LW4 A;  4BY7 X;  1ENW A; 
#chains in the Genus database with same CATH topology
 1E7P A;  3DJB A;  4BCO B;  1XO2 A;  2WMB B;  1UGP B;  3DOG B;  4F7N B;  5IDP B;  2BS2 A;  1OI9 B;  4UN0 A;  4EOP B;  4YOZ A;  1H1S B;  3BG3 A;  1FIN B;  2QDY B;  2IW6 B;  5EJC A;  5HQ0 B;  4ROD A;  4YOS A;  2W9F A;  2W99 A;  4EOO B;  1W98 B;  4EOR B;  2R7G A;  4FM4 B;  1V29 B;  1H1R B;  2CCI B;  4NC6 A;  3POM A;  3BG5 A;  4Z6Y A;  2DME A;  1VYW B;  2V22 B;  1OGU B;  3QZ9 B;  4OB3 B;  2BS4 A;  4EOJ B;  4Y72 B;  3X25 B;  4BCI B;  1PKD B;  2B9R A;  2C5O B;  4HLQ A;  2ZPF B;  3EJ1 B;  4BCN D;  4EOI B;  1GUX B;  2C5X B;  1AIS B;  2CJM B;  2PMI B;  1OL1 B;  1H4L D;  3A8M B;  4EON B;  2AHJ B;  4HNU A;  5L2W B;  3NDQ A;  3VYH B;  2ZCF B;  4OGR B;  2G9X B;  3DTO A;  3WVE B;  4EOS B;  4ELJ A;  4BXX X;  2UZD B;  1OKV B;  2QQ8 A;  4CFU D;  1OIY B;  1UGR B;  5CEI B;  4CFM B;  2D0Q B;  3DDQ B;  2CCH B;  4CFN B;  1F5Q B;  3RGF B;  3MY5 B;  4EOL B;  2WIH B;  3K7A M;  2ZPI B;  3A8L B;  3X24 B;  1ENW A;  2W9Z A;  2IW8 B;  3TNH B;  1H26 B;  4II5 B;  1OKW B;  2IW9 B;  1OL2 B;  3BLH B;  2QGS A;  3MY1 B;  5BNJ B;  3QWL A;  4BY7 X;  2UUE B;  2CYZ B;  3BLQ B;  4EOM B;  1AHJ B;  2ZZD B;  4BCJ B;  4ROC A;  1JST B;  5DQW A;  3HZJ A;  4AKG A;  3M03 A;  4EOQ B;  5HBJ B;  2G77 A;  4ROE A;  1QMZ B;  2WPA B;  2F2C A;  1UNH D;  2WMA B;  2I40 B;  4ELL A;  2PHG A;  3EOC B;  3KHI A;  3QZ5 B;  1JSU B;  4JX6 A;  2C4G B;  3TNI B;  3DDP B;  3TN8 B;  2PJQ A;  1BU2 A;  1P5E B;  2WHB B;  2QFZ A;  3HBL A;  2C6T B;  4BCN B;  2I53 A;  3QHW B;  4BCH B;  1OIU B;  3QHR B;  2W2H A;  1AD6 A;  2BPM B;  2WEV B;  2BKZ B;  3EID B;  2IVX A;  2DD5 B;  4AI6 A;  2C5V B;  4JX5 A;  2CZ7 B;  1JKW A;  1H1Q B;  2CZ0 B;  2ZPG B;  2DD4 B;  4CFX B;  4ZGE B;  3A8G B;  4OB1 B;  4BCQ D;  5FGK B;  4MFD A;  2KMG A;  5HNB B;  4YC3 B;  4CFU B;  1TD6 A;  2DXB B;  3X20 B;  2IN3 A;  4HNV A;  2BS3 A;  4F6S B;  4FX3 B;  4BCM B;  4OB0 B;  4BCK B;  2WJ9 A;  3VKH A;  4BCM D;  2EUF A;  3B57 A;  3QYE A;  4YOO A;  4AKH A;  2CZ6 B;  5IF1 B;  1H25 B;  5IDN B;  5CYI B;  4EC9 B;  1O9K A;  2UZL B;  5DQV A;  3VKG A;  5HVY B;  3HB9 A;  3A8H B;  1FVV B;  2LW4 A;  3MIA B;  5I5Z B;  3LQ5 B;  2UZE B;  4OR5 B;  1UGS B;  3X26 B;  2UZB B;  5IHY A;  5EFQ B;  1IRE B;  4KRC B;  1URC B;  4EC8 B;  2JGZ B;  1QLB A;  5ACB A;  4CFV B;  3F5X B;  5LQF B;  1H28 B;  3BHU B;  2DPP B;  2WIP B;  3X28 B;  5HBH B;  3BG9 A;  4CXA B;  3MI9 B;  1VIN A;  3H4C A;  1GY3 B;  1UNL D;  2PK9 B;  1FKM A;  4BBS M;  1C9B A;  1E9H B;  1H1P B;  4F7S B;  3TW6 A;  4ZGJ B;  1H24 B;  3A8O B;  2X1N B;  2ZPE B;  1JOW A;  3HHT B;  4LOC A;  4BCP B;  4JX4 A;  4KRD B;  3TNW B;  1ZP2 A;  4CRL B;  4BCF B;  4HNT A;  4MFE A;  1N4M A;  1H27 B;  4BBR M;  3QYH B;  4HL4 A;  1TFB A;  2C5N B;  3WVD B;  3BHT B;  1VOL A;  3GTM S;  3TW7 A;  2DXC B;  3O0G D;  2QF7 A;  1KXU A;  4BCQ B;  1G3N C;  2PK2 A;  4F6U B;  3G33 B;  1GUX A;  5LMK B;  4I3Z B;  2ZPH B;  3VYG B;  2KR6 A;  4G6L B;  4AKI A;  3QYG B;  5HBE B;  5ICP B;  2CZ1 B;  4F6W B;  4F70 B;  4M6V A;  1UGQ B;  3BHV B;  3BLR B;  2QDJ A;  3QXE B;  4ZGD B;  4F7L B;  1GH6 B;  4OB2 B;  4CFW B;  2WXV B;  4IMY B;  4BCG B;  1O9K B;  3QYB A;  1D3U B;  3DL1 A;  2ZPB B;  3HO8 A;  2W96 A;  4BY1 X;  4QSH A;  1UNG D;  4TTH A;  4EOK B;  3PO3 S;  2WFY B;  4MIM A;  4NST B;  4F7J B; 
#chains in the Genus database with same CATH homology
 2DME A;  3NDQ A;  4BY1 X;  3GTM S;  3PO3 S;  4BXX X;  2LW4 A;  4BY7 X;  1ENW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...