3NDQA

Structure of human tfiis domain ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
97
structure length
97
Chain Sequence
b'RAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation factor A protein 1
publication title Structure of Human TFIIS Domain II
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3ndqA00
1ENWA 2DMEA 4BY1X 3PO3S 3NDQA 4BY7X 4BXXX 2LW4A 3GTMS
chains in the Genus database with same CATH superfamily
1ZP2A 4BCQD 1P5EB 5HBHB 3VKHA 2WIHB 4M6VA 2LW4A 1UGPB 1OL1B 1FINB 1VYWB 4KRCB 4F7JB 3G33B 1F5QB 4EOJB 3BHUB 3A8OB 1GUXB 4JX6A 4F7SB 3VYHB 2KR6A 3B57A 4AKGA 1H1QB 3QHRB 2BKZB 1BU2A 1OL2B 3VYGB 4YOZA 4BXXX 4ELLA 2X1NB 2QQ8A 2IN3A 1OKWB 5ICPB 1D3UB 2EUFA 2DD4B 2PK9B 3BLQB 4HNUA 4EORB 4QSHA 2UUEB 2C4GB 2R7GA 3F5XB 1H25B 4MIMA 3DL1A 1H24B 5IDNB 4EOOB 2W2HA 4EOLB 3HZJA 3DDPB 3QYHB 4CFNB 3QYBA 5LQFB 4BCKB 2F2CA 4FX3B 1UGSB 4MFEA 4OGRB 1UGQB 5HBEB 4Y72B 4ZGDB 1UNGD 3BG9A 1UNLD 4EOKB 2BS3A 2G9XB 3MY5B 5BNJB 4EOIB 3HB9A 4NSTB 2C5XB 2WPAB 2IW6B 2UZEB 3QYEA 2CYZB 2WXVB 2QGSA 3EJ1B 5FGKB 2QFZA 4HL4A 1H28B 5HBJB 1OIUB 4EOQB 1VINA 4BBRM 1IREB 3HBLA 4OR5B 1JSTB 5HQ0B 1JSUB 1N4MA 4BCHB 1AD6A 4YOSA 2AHJB 1OIYB 1AHJB 1TFBA 3QWLA 3TW7A 5I5ZB 4EOMB 4ROCA 2UZDB 3TNIB 3A8GB 2DD5B 3EIDB 4AKIA 2I40B 3QZ5B 4BCOB 2JGZB 2WFYB 3DDQB 3MY1B 1PKDB 5LMKB 3X28B 4BCJB 3POMA 4CFUD 4ZGEB 3M03A 1OI9B 3TNHB 2IW9B 4II5B 3RGFB 4BCMD 4AI6A 2D0QB 4IMYB 4YC3B 4Z6YA 4CFXB 4FM4B 4F6SB 1VOLA 2QDYB 4JX4A 4KRDB 3VKGA 3QZ9B 3BG3A 1E9HB 5L2WB 3HHTB 2ZPFB 5IDPB 3WVDB 1FKMA 4LOCA 1OKVB 1JKWA 2DXBB 1KXUA 4EOPB 1QLBA 2CJMB 3QXEB 2W9ZA 3X26B 1H1RB 2C5OB 3X20B 4OB2B 3A8LB 4F7NB 4JX5A 5EJCA 3O0GD 2CZ6B 4NC6A 4HNTA 4HLQA 4EC8B 4BCIB 3TNWB 2DXCB 2WJ9A 1GY3B 2C5NB 2ZPEB 2ZPHB 4OB3B 4RODA 1OGUB 2I53A 2ZZDB 2UZLB 5ACBA 5HVYB 3HO8A 4F70B 2IVXA 4CRLB 4EC9B 1TD6A 2ZPIB 4CXAB 2ZCFB 4G6LB 3TN8B 2BS4A 3DTOA 3BLRB 4UN0A 2ZPBB 2BS2A 1H26B 1O9KA 1XO2A 4OB0B 1UGRB 5HNBB 2WMBB 3A8MB 4TTHA 4CFUB 4HNVA 3WVEB 4ROEA 3H4CA 2CZ1B 4I3ZB 5DQWA 4CFWB 2IW8B 5IF1B 3MIAB 1QMZB 2KMGA 4BCMB 2G77A 5DQVA 2B9RA 2CCIB 1H1PB 2W99A 3BHTB 5IHYA 4BY7X 1JOWA 3X24B 2C6TB 2PMIB 3X25B 1GH6B 3K7AM 1H27B 3BG5A 4BCGB 2V22B 4F6WB 2WEVB 2QDJA 2UZBB 4ZGJB 2PJQA 3BLHB 1AISB 3QHWB 4YOOA 3PO3S 3QYGB 4BCFB 1GUXA 1URCB 2WIPB 1FVVB 2CZ7B 3BHVB 1H1SB 1O9KB 4F6UB 2BPMB 2QF7A 3DOGB 3EOCB 4CFVB 2W96A 2C5VB 1H4LD 4ELJA 5CEIB 4AKHA 4BBSM 2ZPGB 2PK2A 4OB1B 4EOSB 1UNHD 4BCNB 2DMEA 4MFDA 1W98B 2CZ0B 1C9BA 2DPPB 4BCQB 3KHIA 1E7PA 5CYIB 1V29B 4BCPB 1ENWA 3GTMS 3A8HB 4EONB 3MI9B 4BY1X 2WMAB 2W9FA 1G3NC 3LQ5B 2PHGA 5EFQB 4CFMB 3DJBA 4BCND 3NDQA 4F7LB 3TW6A 2WHBB 2CCHB
chains in the Genus database with same CATH topology
1ENWA 2DMEA 4BY1X 3PO3S 3NDQA 4BY7X 4BXXX 2LW4A 3GTMS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENW A;  2DME A;  4BY1 X;  3PO3 S;  3NDQ A;  4BY7 X;  4BXX X;  2LW4 A;  3GTM S; 
#chains in the Genus database with same CATH topology
 1ZP2 A;  4BCQ D;  1P5E B;  5HBH B;  3VKH A;  2WIH B;  4M6V A;  2LW4 A;  1UGP B;  1OL1 B;  1FIN B;  1VYW B;  4KRC B;  4F7J B;  3G33 B;  1F5Q B;  4EOJ B;  3BHU B;  3A8O B;  1GUX B;  4JX6 A;  4F7S B;  3VYH B;  2KR6 A;  3B57 A;  4AKG A;  1H1Q B;  3QHR B;  2BKZ B;  1BU2 A;  1OL2 B;  3VYG B;  4YOZ A;  4BXX X;  4ELL A;  2X1N B;  2QQ8 A;  2IN3 A;  1OKW B;  5ICP B;  1D3U B;  2EUF A;  2DD4 B;  2PK9 B;  3BLQ B;  4HNU A;  4EOR B;  4QSH A;  2UUE B;  2C4G B;  2R7G A;  3F5X B;  1H25 B;  4MIM A;  3DL1 A;  1H24 B;  5IDN B;  4EOO B;  2W2H A;  4EOL B;  3HZJ A;  3DDP B;  3QYH B;  4CFN B;  3QYB A;  5LQF B;  4BCK B;  2F2C A;  4FX3 B;  1UGS B;  4MFE A;  4OGR B;  1UGQ B;  5HBE B;  4Y72 B;  4ZGD B;  1UNG D;  3BG9 A;  1UNL D;  4EOK B;  2BS3 A;  2G9X B;  3MY5 B;  5BNJ B;  4EOI B;  3HB9 A;  4NST B;  2C5X B;  2WPA B;  2IW6 B;  2UZE B;  3QYE A;  2CYZ B;  2WXV B;  2QGS A;  3EJ1 B;  5FGK B;  2QFZ A;  4HL4 A;  1H28 B;  5HBJ B;  1OIU B;  4EOQ B;  1VIN A;  4BBR M;  1IRE B;  3HBL A;  4OR5 B;  1JST B;  5HQ0 B;  1JSU B;  1N4M A;  4BCH B;  1AD6 A;  4YOS A;  2AHJ B;  1OIY B;  1AHJ B;  1TFB A;  3QWL A;  3TW7 A;  5I5Z B;  4EOM B;  4ROC A;  2UZD B;  3TNI B;  3A8G B;  2DD5 B;  3EID B;  4AKI A;  2I40 B;  3QZ5 B;  4BCO B;  2JGZ B;  2WFY B;  3DDQ B;  3MY1 B;  1PKD B;  5LMK B;  3X28 B;  4BCJ B;  3POM A;  4CFU D;  4ZGE B;  3M03 A;  1OI9 B;  3TNH B;  2IW9 B;  4II5 B;  3RGF B;  4BCM D;  4AI6 A;  2D0Q B;  4IMY B;  4YC3 B;  4Z6Y A;  4CFX B;  4FM4 B;  4F6S B;  1VOL A;  2QDY B;  4JX4 A;  4KRD B;  3VKG A;  3QZ9 B;  3BG3 A;  1E9H B;  5L2W B;  3HHT B;  2ZPF B;  5IDP B;  3WVD B;  1FKM A;  4LOC A;  1OKV B;  1JKW A;  2DXB B;  1KXU A;  4EOP B;  1QLB A;  2CJM B;  3QXE B;  2W9Z A;  3X26 B;  1H1R B;  2C5O B;  3X20 B;  4OB2 B;  3A8L B;  4F7N B;  4JX5 A;  5EJC A;  3O0G D;  2CZ6 B;  4NC6 A;  4HNT A;  4HLQ A;  4EC8 B;  4BCI B;  3TNW B;  2DXC B;  2WJ9 A;  1GY3 B;  2C5N B;  2ZPE B;  2ZPH B;  4OB3 B;  4ROD A;  1OGU B;  2I53 A;  2ZZD B;  2UZL B;  5ACB A;  5HVY B;  3HO8 A;  4F70 B;  2IVX A;  4CRL B;  4EC9 B;  1TD6 A;  2ZPI B;  4CXA B;  2ZCF B;  4G6L B;  3TN8 B;  2BS4 A;  3DTO A;  3BLR B;  4UN0 A;  2ZPB B;  2BS2 A;  1H26 B;  1O9K A;  1XO2 A;  4OB0 B;  1UGR B;  5HNB B;  2WMB B;  3A8M B;  4TTH A;  4CFU B;  4HNV A;  3WVE B;  4ROE A;  3H4C A;  2CZ1 B;  4I3Z B;  5DQW A;  4CFW B;  2IW8 B;  5IF1 B;  3MIA B;  1QMZ B;  2KMG A;  4BCM B;  2G77 A;  5DQV A;  2B9R A;  2CCI B;  1H1P B;  2W99 A;  3BHT B;  5IHY A;  4BY7 X;  1JOW A;  3X24 B;  2C6T B;  2PMI B;  3X25 B;  1GH6 B;  3K7A M;  1H27 B;  3BG5 A;  4BCG B;  2V22 B;  4F6W B;  2WEV B;  2QDJ A;  2UZB B;  4ZGJ B;  2PJQ A;  3BLH B;  1AIS B;  3QHW B;  4YOO A;  3PO3 S;  3QYG B;  4BCF B;  1GUX A;  1URC B;  2WIP B;  1FVV B;  2CZ7 B;  3BHV B;  1H1S B;  1O9K B;  4F6U B;  2BPM B;  2QF7 A;  3DOG B;  3EOC B;  4CFV B;  2W96 A;  2C5V B;  1H4L D;  4ELJ A;  5CEI B;  4AKH A;  4BBS M;  2ZPG B;  2PK2 A;  4OB1 B;  4EOS B;  1UNH D;  4BCN B;  2DME A;  4MFD A;  1W98 B;  2CZ0 B;  1C9B A;  2DPP B;  4BCQ B;  3KHI A;  1E7P A;  5CYI B;  1V29 B;  4BCP B;  1ENW A;  3GTM S;  3A8H B;  4EON B;  3MI9 B;  4BY1 X;  2WMA B;  2W9F A;  1G3N C;  3LQ5 B;  2PHG A;  5EFQ B;  4CFM B;  3DJB A;  4BCN D;  3NDQ A;  4F7L B;  3TW6 A;  2WHB B;  2CCH B; 
#chains in the Genus database with same CATH homology
 1ENW A;  2DME A;  4BY1 X;  3PO3 S;  3NDQ A;  4BY7 X;  4BXX X;  2LW4 A;  3GTM S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...