3X28B

Crystal structure of nitrile hydratase mutant br56k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Reaction intermediate of nitrile hydratase determined by time-resolved crystallography reveals the cysteine-sulfenic acid ligand to be a catalytic nucleophile
rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x28B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x28B02
2AHJB 1PSEA 4XK8E 2DPPB 1QP3A 2QDYB 4OB0B 1V29B 4FM4B 1GXIE 2CZ1B 2PUOB 2ZPFB 3WVEB 3A8OB 4RKUE 1UGSB 3VYGB 2DD5B 2WSEE 2ZPEB 1PSFA 3VYGA 2DD5A 2PVDB 2ZPBB 3A8GB 2ZCFB 2PVGB 4ZGDB 2PVOB 1DJ7B 2ZPHB 3QYGB 2PU9B 3LW5E 1QP2A 3HHTB 1UGQB 2WSFE 4OB1B 3A8LB 1UGPB 3X20B 2DXBA 2D0QB 3VYHB 3QXEB 2DD4A 2CZ0B 3QYHB 2CZ7B 4L6V5 4ZGEB 2WSCE 1AHJB 3X28B 3QZ9B 2O01E 3X26B 2PUKB 3WVDB 1JB0E 3X25B 4OB3B 2DXBB 4KT0E 2ZZDB 2DD4B 2DXCB 2CYZB 2CZ6B 5L8RE 2ZZDA 3X24B 2DXCA 4Y28E 4ZGJB 4OB2B 3A8MB 1IREB 2ZPGB 1UGRB 2ZPIB 3A8HB 3QZ5B
chains in the Genus database with same CATH superfamily
1Q82R 4OGRB 1M3BA 5FU6C 1QQJA 2QK0A 4C8QE 4NL3A 3LWIA 3DLLA 4BCND 1XOVA 2M51A 2OJ2A 1YITA 1URCB 2EWNA 3OYMA 2FO0A 4M7DG 1LVKA 2MYSA 7AT1B 1RADB 1Y07A 4BCQB 2EIFA 2SEMA 1YJWQ 5GAMf 4BCMD 2O88A 2DD5A 1UJ0A 3I9QA 4OVAA 3CCSA 3PVQA 3I55T 3RKXA 2QG9B 1VYVA 1YIJA 2IPOB 4JZ4A 2EVRA 1H24B 1U3OA 2PVOB 3UDCA 3VKGA 2K5LA 4J9GA 4XTXA 2GQVA 5LJ3h 2CP0A 2DVJA 4M78A 2CGHA 1UGQB 2YHTA 4L5GA 4XU3A 2EYZA 3KFVA 4RCCA 5I2SA 1W1FA 4II5B 3REAB 3H4CA 3TW7A 2IW8B 3QXEB 4HNUA 3VU3C 4NOYA 1JXOA 3UA7A 2OTJA 4NS5A 2COYA 2X4YA 2O01E 2LCSA 2MIOA 1X43A 5KCOA 2E65A 2WEVB 2ZGWA 2DO3A 3EG3A 2C5VB 2F2XA 4BCFB 3CBMA 3UPUA 1EZZB 1PKDB 5KYXA 2EQMA 4DOVA 4DBFA 4Z02A 1VQPQ 4C8QF 1U1SA 2CYZB 4J9EA 2I0NA 2H3JA 2YXYA 2YUNA 3EGXB 4PLIA 4A63B 4B9XA 2E64A 2MI6A 2D8JA 3EGUA 4RODA 4IUTA 2D8HA 1N6AA 4BY7X 2L3SA 3EIDB 1BCMA 5I21A 5DM7R 3OA6A 4M7AB 3JCMX 2AHJB 2LQNA 1SKUB 4X9DA 3RNJA 1AWJA 2ATCB 4LDUA 5GAN5 3M0QA 2HD0A 2RPNA 2Y90A 2KEAA 2BPMB 3HRUA 1HSQA 2CDTA 3NGPA 2RO0A 3CXCA 3A8OB 2F5TX 5GAN8 1I1JA 1VQ4T 3VYGB 2VYTA 3TU4K 4JLIA 3KHIA 2VB6A 2A08A 3H9NA 3CEYA 4XU1A 2XICA 5KH6A 3OYKA 2IN3A 2VASA 4BCKB 2VGNA 1GBQA 1Q81R 2DIQA 2ENMA 4FYYB 1DJ7B 1Z9ZA 1Y7XA 3V8KA 1X6BA 3CCJA 3S3NA 8AT1B 4LDWA 2VC8A 4BCJB 1OULA 4BCHB 3H8ZA 1G3TA 1OEBA 3HO8A 4C8QA 2EGAA 4IURA 1K73C 5GANd 2WSFE 3GF5A 1M5Q1 4Z89A 3CMAQ 5GANe 2FRWA 1H1QB 2LW4A 2G3RA 4LD9K 1BU1A 2R5MA 3TREA 1AISB 1WHKA 1S72T 1K9AA 1WHGA 1BK2A 3EFOB 2C06A 2IW6B 1TSFA 2GFAA 3HRTA 4A4HA 4C0DB 3VRZA 1FXXA 4F7UB 2G77A 1VQ6T 3UATA 5BNJB 2DX1A 3JCMQ 1GFCA 3LGLA 2O31A 1IRXA 3HTRA 3CCQT 2PZ1A 4QQGA 1SSHA 2EQKA 3ULRB 3X24B 3PIPA 3ER0A 1MMNA 2SRCA 2CP5A 1VQ9T 2XHCA 1E7OA 2FG0A 4AMCA 2KMGA 4FW1A 3VUBA 1ZSGA 1ZSZA 2E3HA 2JVVA 2W10A 4BCQD 4G6LB 3DJBA 3CXCP 2DBMA 2DA9A 3E1SA 3TNWB 3JB9I 2LX7A 1RI0A 1GXIE 3FRNA 1ZBJA 2PUOB 1MNEA 1VQOT 3EH1A 3V8LA 4RKUE 5GJWB 1I81A 3CBOA 1OI1A 5KE3A 3CCMT 3GP8A 1VOLA 5ICPB 2YLBA 2KYMA 5HCKA 4MMLA 3MO8A 4BXXX 2RK1A 1Q7YR 3HZJA 2UZLB 4JRPA 1G3WA 3V8JA 4AFZC 3OMCA 3M03A 3I35A 4X34A 4C5HA 2EQIA 2ROTA 1UEBA 4HLQA 2K6DA 4C92E 2AIRB 2XD0A 1W98B 2F69A 4PJOE 1X01A 1YWPA 1NM7A 3BE3A 2LP5A 1PKTA 4AI6A 3P8BB 3M57A 4WCIA 2C5OB 3VYHB 3UT1A 2QEXA 1TU0B 2EYQA 1VQKA 1M9SA 1N8RR 4F70B 1KJWA 2BZYA 3M59A 3RMSA 1OPLA 4LDYA 3L2WA 1YCYA 1IO6A 2CSIA 2M1HA 1ZQ1A 3DOGB 4M7AD 2DEUA 1YJNT 2F1LA 2K4YA 1M8VA 1M4ZA 3CPFA 2JS2A 4MIMA 2JMCA 3DB3A 1KC8U 4YTLA 4JPBW 4Y28E 3BHUB 1VQNQ 5GMKe 1ZSZC 4M77B 1N4MA 4PFPA 1Z9QA 1JQQA 1PSEA 2GQIA 2KDSA 2W2HA 4EPCA 3URGA 3M0SA 2V8KA 1TWBA 1QCFA 1BI3A 5GANh 4L59A 2QGGA 2J6FA 1H1RB 4MMKA 2HQEA 3TSWA 3MI9B 1YWOA 1IHWA 1UB4A 4BACA 2JZ2A 2MAMA 5LMKB 4C92F 4QVDA 1N8RC 3TQ7P 4PJOF 2WIPB 4ZNXA 4FCYA 3INZA 3BFMA 1VQLT 3CCEQ 2JNGA 4M7AG 1NEBA 2P4TA 2PVGB 4E7JA 1H1SB 1K8AR 2YDLA 4Y92A 4Z8AA 2RM4A 3NMZC 1UUEA 2K3BA 2KT8A 2KRMA 4EOKB 2I2LA 1RAGB 4CC2A 2JGZB 1FYNA 1KFZA 3OB9A 4NC6A 3I55A 1B07A 1UDLA 3A8LB 2KT1A 1UGPB 2DEQA 2XK0A 1VQ5Q 2BS2A 1BKBA 1HXDA 3JSCA 4A4FA 1ZUKA 4XTVA 2WPAB 4ZTJA 2VUBA 3I56T 1O9KB 1WQ7A 5LJ5j 2VVKA 3JCMf 2DL5A 2E12A 1YJWT 3LQ5B 1SEMA 3FIFA 3OS0A 4FW2A 4JDSA 4JS4A 1ARKA 3PO3S 5LJ5g 5IHYA 3EFRA 2EGEA 1UNGD 2CCIB 2CS7A 5FRNA 5HVYB 2ZZDA 2FZCB 2QAZA 3M58A 4C92A 5KYYB 3DL1A 2HBWA 3CC4Q 2YRVA 4EIKA 1EFNA 4UC4A 4AFQC 1Q82U 4PJOA 3QDFA 1AD5A 3CCUQ 5IF1B 1VYTA 2CJMB 1D3BB 2KYBA 2F2WA 6AT1B 4B9WA 1V76A 4AKIA 1G5VA 2C0IA 4M75B 1IGQA 2DE0X 4ROCA 2EJ9A 1UNLD 3CCRT 1WJQA 2OTLQ 2XKOC 2RHYA 4LDVA 1WYXA 1TH7A 2HSEB 4RTZA 2RJCA 1GBRA 1MV3A 3OYDA 4BDYA 3VKIA 2E5KA 5LJ3f 1NLPC 4QVCA 3VS4A 2DL7A 3GLXA 4J9CA 5DY9A 2PK2A 1PD1A 3JCMg 4J9BA 4AT1B 2NUPB 1M2OA 2RHIA 4D8DA 5J3BA 1VQPT 1WFWA 2K5FA 1YIJQ 3TCJA 2V1QA 1P5EB 3FDRA 2QA4A 3META 4BE1A 2C0OA 1PRLC 3RR6A 3BG5A 2A3LA 1VQ4A 2HBPA 2R57A 5M9OA 1W4SA 2HDAA 4F16A 4AKHA 4I3ZB 4EMKB 2GTOA 5CAIA 5GMKh 1QVFS 4OR5B 2A28A 3HL8A 4M78G 4HNTA 4OB1B 4F04B 2FEIA 5HK3A 3EOCB 3V7SA 2D0QB 2RHUA 3CCVT 2WXVB 5I2MA 3NHNA 4IUUA 1PNJA 2FPEA 1KQSP 4PK4A 3CCLT 1BU2A 3Q1JA 2JOYA 1PKSA 3RGFB 2CP6A 2PUKB 3JB9F 4ATOA 5KCHA 1YJ9A 3OY9A 5LJ3g 2LJ1A 4YOSA 1QCOA 4KRTA 4M77D 1SG5A 5FU7C 2AT1B 3VS2A 2KE9A 3QKJA 1Q86R 1KC8C 4EONB 4BUGA 1S72A 3K7AM 3EFSA 2EJFA 1K73U 2J7IA 1WQWA 3EHRA 1LPLA 3OSSC 4F6WB 2JS0A 4EC8B 4CC4B 3CD6T 2XIDA 1TUGB 5KYUA 2FPDA 3ZEHA 4C92C 4F17A 2DRKA 1R0BG 3C4SA 3BHTB 1FX7A 3UF4A 2HCKA 5I22A 4PJOC 1VQ6A 3QZ5B 4KUIA 1YFNA 3S6WA 2V26A 3VV0A 5IT9E 4PKCC 4E7KA 2PJQA 2HQHA 4EOLB 4RTVA 3CCQA 4UN0A 4J9DA 4QQ6A 1GCPA 2YT6A 3I5RA 2CP2A 3OYBA 1VQ9A 2K3XA 3G4SQ 1Q81U 2NUTB 3PVLA 2YSQA 1PHTA 1AWWA 2WACA 4ROEA 1HJDA 4M77G 4WF2A 4J6WA 2DTHA 1M2VB 2KR6A 2BZ8A 3MPUB 1VQOA 4RG2A 2HKQB 3EFOA 1H3ZA 2LMJA 1C1AA 2ROLA 3QJ6A 3CCMA 4M7DE 2RF0A 2JT4A 1WZOA 2EPDA 2FB7A 1G3YA 4C8QG 2DL8A 1JKWA 2RQTA 2RA2A 4EOOB 3M54A 1ABOA 1LJOA 4Y91A 1O9SA 4M4ZA 4F7LB 1C0MA 1B34A 4KGVB 1OQKA 5GAMd 3MY5B 5AT1B 1H28B 4CRLB 2OAUA 3A1PA 2V1RA 1OX8A 2DYBA 5GAMe 4TTHA 1W2BA 3CBPA 2I53A 1GH6B 4HNVA 3QYBA 1R77A 2DZCA 4N4GA 3HFNA 4E7LA 1YN8A 1D1AA 1TTHB 2D9TA 3LH5A 3HPWA 3UWNA 2GTJA 4M75D 3ASKA 1Q82C 4A4KA 2RNAA 3EG9B 3H0FA 4F7NB 3VJPA 3RMQA 2E6ZA 1HYOA 3OS5A 4BY1X 1EX4A 3U23A 1U5SA 4II1A 2HKNA 1WHJA 5FU6B 3A8HB 2QDLA 4DBHA 3BHVB 4R0KA 1KIKA 3WXMB 2K3YA 1YJNA 4XTUA 2W9ZA 4FYVB 4OB0B 5KYWB 4CFMB 1QW1A 2EYXA 3CC7T 2O9VA 4EOSB 3J81E 1HD3A 1M27C 2HQXA 4M7DF 1Q7YU 1I5LA 4AG2C 3C94A 3TSZA 2PVDB 2MMPA 3F5XB 4CFWB 2QQ8A 1QLBA 4MZTA 3SDZA 1WPYA 1D0YA 1BBZA 2LTOA 4RTTA 4BI3A 1SHGA 4V2SA 4M75G 1BCOA 5IH2A 1K76A 4RTYA 5DLOA 3NPFA 1VYWB 1VQMT 5GMKl 2ZPHB 2LZ6B 3E19A 1VQNT 4C0DC 1H26B 2E3IA 1T3SA 2DYIA 9ATCB 1VQLA 1YP5A 2CUBA 4QKUA 3EAEA 4OMLA 3EJ1B 3VUZA 3G6ET 1M8MA 2M02A 4RTWA 1N8RU 2YRCA 4NL2A 2C5XB 3MEVA 4C5GA 1G83A 3JCMb 1PD0A 2M0OA 5CEIB 1SPKA 4ZGEB 3DKMA 3GBQA 1V1CA 1VQKQ 2QQAA 1W2BS 3X26B 1QWEA 1SF9A 2QQSA 4AG1C 4Z88A 4N4IA 2KI7A 1H4LD 3SHWA 4OMMA 3M4YA 4XTWA 3PE0A 4N4HA 3OYLA 2DD4B 2Y4YA 5GAOm 4PJJA 2CZ6B 2EAYA 5L8RE 1GUXB 4M7DA 4NSTB 5ACBA 2DTIA 3I56A 1G2BA 1F1BB 4KGZB 1WIEA 1NJIR 4IKFA 2NUZA 1GCQA 1KHCA 3LYIA 3RKWA 2KROA 2DNUA 4J9HA 1JBMA 2YUQA 2A0FB 4CFUB 3HRSA 1OI9B 1YJWA 4LN2A 1OL1B 2DIGA 4CFXB 3JCMV 4E7HA 5CKEA 1KQ1A 1NE8A 4DBRA 3V7RA 3ME9A 2BIVA 2JUFA 2IVWA 5GAN3 4HCBA 2QQ9A 1IZ6A 2R58A 1KD1R 2ZAEA 1OU9A 2ED1A 2MOXA 2P0PA 1M1FA 3BDUA 3KXTA 4IIOA 1JSTB 1Q81C 3PGGA 2EQUA 4GLKA 1WI7A 2DD5B 1ZUUA 4C5EA 4WTOB 5GAMh 4KH1B 5GANj 5I5ZB 1K8AU 2BE9B 1H641 4CXAB 3CCRA 3RUXA 4FT4A 1ZP2A 1QCNA 1UTIA 2BKDN 1U8RA 3CC2Q 3N5BB 3BG3A 3OQ5A 3CC4T 5GANg 2X9HA 2G6FX 3G71Q 2KMTA 3S3MA 2L8DA 1O9KA 4M78B 4PJNA 1QP2A 3RKYA 4BBSM 2QQBA 3CMET 5A2QE 1TUDA 3HBLA 2RI5A 1VQPA 4EOIB 4KUDK 4BBRM 1D0ZA 1M1KR 3LWHA 3NTIA 2B8AA 2OTLT 5LQFB 1AOJA 1G8XA 2LVMA 2CZ0B 4IMYB 1E6HA 4L6V5 1NLOC 5HK0A 1TOVA 3BG9A 2GCXA 2QASA 3JCMc 2E4HA 1KD1C 3GNFB 2RH2A 2O4XA 1QWFA 4KGXB 3LLRA 4BCOB 3M0PA 4HA8A 2D6FA 2QQRA 3P8HA 4JX5A 2DXBB 4FSSA 5IN1A 2W9FA 3CCVA 1NEGA 1CSKA 2KRNA 3CCLA 3RESA 4M7DC 4Z6YA 3MKDA 4OMOA 1VQ8Q 3OS1A 3UA6A 4FL6A 1M30A 2JTEA 3A8MB 1IREB 1GCQC 3GOXA 3RDVA 4E7IA 4E47A 5IAYA 5D6YA 1QLYA 2DVEA 5GAOq 5GAOl 2NUPA 1PM3A 3A5ZB 2A7YA 4JX6A 3QDRB 2DL4A 2JJ9A 4FM4B 2L3RA 2DXTA 4PLLA 2R5AA 3CD6A 3QYEA 1UHCA 1Q7YC 1I4K1 1OPKA 1D09B 2BUDA 2AKLA 1X27A 3OSVA 1ZLMA 2QTVA 4ZN1A 2P0KA 2WSEE 2RHXA 4IUPA 1BI0A 3M9QA 1VA7A 2E10A 2EGCA 1QMZB 4A4EA 4EMKA 5CKDA 3CPWA 3EGDA 3M53A 2DJZA 4J83A 3NTHA 4XU2A 3PNWC 4JRKA 2IW9B 4ELZC 3L2VA 2P0QA 2PQWA 2ED0A 2QA4Q 4JJDA 1OX9A 5IDNB 2EKHA 4C8QB 1VQ7T 1UFFA 2DJQA 3RBBB 5CK9A 1CKAA 5LJ5f 2RN8A 1OL2B 3T9NA 3JV3A 3X20B 2KGTA 5KE2A 4OMPA 4F6UB 1C6VX 5GAOr 3GIBA 4M7AE 2DZ9A 1TS9A 5GMKj 5LJ5d 1K9MR 3M55A 5EG2A 3VS1A 1YCSB 2HEQA 2DMOA 3G4ST 1Q86U 5J39A 1I8FA 3VKHA 3QO3A 4CC3A 4QQDA 1YJ9Q 5DLQE 1NBEB 4CFUD 2VXEA 4F14A 1QVFA 2WMBB 2J06A 2C5NB 2RQVA 4VUBA 4DBQA 3TN8B 4HCKA 1E7PA 2LQWA 2COWA 3EG0A 1VIFA 4QVZA 1RABB 3LX7A 4IIMA 1X6GA 1M1GA 2DXCA 4MFDA 2L3PA 3JB9J 1NZ9A 3SFMA 1AT1B 1AWXA 5FWCA 1AD6A 2ZPGB 1UGRB 1VQ6Q 2LCLA 4BY6C 1BYMA 2NUTA 2X1NB 2EUFA 3D7SB 4OF1A 4C0ZA 3CCQQ 4JX4A 1PG5B 3F70A 4O5VA 4HCZA 5IHNA 3JCMd 3QSUA 1M2VA 2DLPA 4X1VA 2W96A 2XDPA 1A0NB 5IXBA 1K8AC 1ZA1B 2LNVA 4TVRA 3LH0A 1YHQQ 2JTFA 2ECZA 4RUGA 4M78D 3CPWS 3GNGA 1YI2Q 4EMGA 3ZL7C 4EMKC 2ZPBB 3A8GB 5CYIB 2DRMA 4E6RA 3CC7A 2KY9A 1LOJA 4F7UE 4M7AF 1K4US 2ABLA 1E6GA 1FMVA 2L89A 5GMKi 5GAOn 3OYCA 1YITQ 3M0UA 4LXCA 4EOQB 3AT1B 3JB9G 2RI2A 2HNIA 1T3LA 1ABQA 1M3AA 3TVTA 3LW5E 1OIYB 3POMA 3C95A 4MDXA 5HKCA 3CCSQ 5IHKA 3MEWA 2XG8D 5HBEB 4EC9B 1BI1A 1WXUA 2CH4A 4XTYA 5LJ3d 2EW3A 4F7JB 4BI8B 3FC3A 1VQMA 1QVFP 5LJ3e 1JSUB 1UNHD 3H41A 3QZ9B 5I11A 2LX9A 3WVDB 3CQTA 2MCNA 3TNIB 3G6EA 3NDQA 2QXFA 4GLMA 2X4WA 1WHLA 5DQWA 3PIOA 4FT2A 2DFUA 3KUFA 5J26A 2F5KA 2BTTA 2AZVA 1D3UB 2OTJQ 1M90R 5HQ0B 5FRMA 3EGXA 2CT3A 4A54A 2BZXA 1R0CB 4ORZA 1PCXA 2ZPIB 2K9GA 3LGFA 1H27B 4M7AA 4AKGA 4BCPB 4BB7A 2O9SA 2KQWA 3PMTA 4F7UF 1V29B 4EORB 2GFUA 2LCCA 4XU0A 1WHHA 2KVQG 2EBPA 2UZBB 1QKXA 1WGSA 4MFEA 1MMGA 2H3EB 1U06A 2XMFA 4C0FA 2ZPEB 3P8DA 4RTUA 3EHQA 3VYGA 3DTOA 2V22B 4JJCA 4C8QD 2GNCA 2HSPA 1F5QB 5GAN7 3M0RA 3CMAT 2K2MA 4HL4A 1GY3B 3OW2S 1SRMA 4Y72B 2UZDB 2XDDA 5GAN6 2MWPA 1GFDA 3OYHA 1UECA 2HL5C 3AHUA 2V8JA 5EJCA 5L23A 5CQYA 2JW4A 1M90C 2X4JA 4EOJB 1Q95G 3OYYA 2CREA 2GGRA 2L5QA 4FYXB 2YUPA 1AWOA 2HZYA 4EOMB 3I5SA 1FINB 1O75A 2DETA 2DL3A 4M77E 2DD4A 3CC4A 4PJLA 1GUXA 4M6VA 1Q86C 5IXFA 1AHJB 1TFBA 2W0ZA 3L42A 1RAAB 3HB9A 3CCJQ 2LC4A 1SSFA 1W6XA 2LT1A 4OMFB 2M9UA 1ZX6A 2FL7A 1YBYA 2HL3A 1IB8A 2WFYB 3JCMW 1I5OB 3CMEA 2JXBA 4F7UA 2DTOA 5D6XA 2MK5A 2FRYA 4K11A 1NJIU 1MGQA 1WNLA 2C0TA 2OTLA 2ZZDB 4LNPA 4C92B 3QHRB 1D0XA 1RAIB 3M0TA 2YUOA 3CC2T 3E2UA 3ZBDA 4KBMB 2L3QA 3MEUA 4KULA 4LUDA 1TUCA 1HK9A 4PJOB 2QGFB 1NPPA 3I56Q 3G71T 4EMHA 2FVUA 4PFOA 2WHBB 2E5QA 1XNIA 2JM9A 1KD1U 5HY6A 2DPPB 3MP1A 4J7FA 3A98A 3SWNB 5CQXA 4M7AC 2DM1A 3MY1B 2YWWA 3HSBA 1KG1A 1H3HA 2X3XD 4FSXA 2QFZA 2MF2A 2ZPFB 2QGSA 4GY5A 4ZN3A 1ACMB 3QJYA 2DK3A 4EOPB 1G3SA 2X35A 1LCKA 3MP6A 3QBYA 2CT4A 1PRMC 2NLUA 4LOCA 4J7IA 3TNHB 3CCRQ 1I07A 2QYZA 3R6OA 4M77F 4AFUC 2PTKA 2ZCFB 2BS3A 4D6WA 5GAMj 5HNBB 1VQ8T 4HT8A 2DXUA 4C5IA 4DOWA 4J8OA 3QYGB 2IIMA 1M1KU 5KYNA 2PK9B 2LJ0A 4OGEA 2YLCA 1TG0A 5GAMg 2RK2A 2NYSA 2B86A 4HVUA 2A37A 2DXBA 1H1PB 3V7CA 3VS0A 1ZUYA 1JU5C 3BDLA 1JEGA 4F6SB 3B57A 1BIAA 2RQUA 2CUDA 1WDXA 3JRZA 4BI4A 1YNZA 5FGKB 4M75E 1QVPA 1OU8A 4PJMA 1WX6A 1K73R 1VQ7A 4JS5A 4JZ3A 3JAME 4HVWA 2AK5A 5CKFA 4OB3B 2LQ8A 1FMWA 3M56A 2XU8A 2LT4A 5IDPB 2CKKA 4KH0B 2QI2A 3CCVQ 1P92A 1UGVA 2CH4W 3E9FA 5KYUB 1LNXA 1WJRA 1W2BP 5A0DA 1IXDA 3FJPA 2QA4T 4FU6A 4RTXA 3CCLQ 1OKVB 5HBJB 2QEXQ 1AVZC 2E41A 2PHGA 3OYIA 1UE9A 3BLQB 3G4SA 2E1HA 1U1TA 1TXQA 4A53A 4DA4A 2GBQA 3JCMJ 2DBKA 2F2CA 3PFSA 2RQWA 2EYYA 4KRCB 1MV0B 4M77A 2K5IA 2ESWA 2JMAA 2X51A 2R7GA 1QP3A 2L2PA 1M3CA 3VRYA 3CCET 5GANf 1VUBA 3CD6Q 2VV5A 5GAN2 1D1CA 1XQHA 1VINA 3EG1A 2QTXA 1NYFA 4J5YA 1Y96B 3OYAA 2VKNA 1K0XA 1UGSB 2KK4A 4CI0C 1IHVA 2M0YA 1IGUA 4FX3B 1CKBA 4E2FB 1RAFB 2X3WD 1YJ9T 3G33B 4M78C 3FB9A 3VS7A 1S1NA 1ZHIA 4MDWA 2RQRA 2XI9A 5ECAA 2MPXC 1VQ5T 4ME7A 4ZGDB 2Z0WA 2K7AA 4M75F 2PMIB 5CO7A 5C0MA 1T0HA 2EQJA 1WXTA 3EG2A 3FEOA 4CFNB 2PU9B 4R56A 3L2RA 4ANJA 2LJ3A 2WIHB 3M5AA 2V8IA 1K9MU 5GAOp 4RG8A 1OGUB 1OIUB 1B34B 2COZA 2P4RA 3HFOA 4C92D 2P84A 1UG1A 1AZEA 4J9IA 2PNIA 4JRQA 1FWZA 3MIAB 1JO8A 5A0GA 1MHNA 4PJOD 4JUVA 1KSWA 1E9HB 1JB0E 4OMQA 3CCUT 1YHQT 1NJIC 1NYGA 1OYXA 3X25B 1N5ZA 1YI2T 4HKEA 3I55Q 4AFSC 4KT0E 2DILA 1NG2A 5CR2A 2EFIA 3SEMA 2KBTA 4BDZA 1J3TA 1WJSA 2LDMA 3CXCS 4JJNK 1RLQC 2CP7A 1YITT 4HT9A 4F7SB 5KYYA 1UJYA 1BB9A 1B7TA 4ELJA 2K2VA 4OP0A 4C0GA 4D8KA 4P5NA 5KYXB 2F2VA 3HKSA 4O6JA 1OKWB 4XK8E 3CCST 1D3BA 1Y57A 2AZSA 4M77C 2WJ9A 3QPHA 4YC3B 4M75A 1YIJT 1I0CA 3M4GA 1UHFA 3RERA 1MMAA 2LRQA 3L2ZA 4C92G 2A36A 4J6XA 1FKMA 4MZMA 5DQVA 4PJOG 2D0NA 4C8QC 3G7ZA 1OV3A 4N0AA 4A4GA 1R8OB 1X75C 4BE0A 4FIBA 3CC7Q 2JM8A 2RB6A 4BCGB 1M1KC 3QIIA 3MHXA 2OTJT 1MNDA 5C6SA 3E9GA 2H8HA 3MP8A 5HBHB 2K57A 4J6YA 3QHSA 4YOOA 4JJBA 2DERA 2DMEA 2VWFA 5LL6S 3CMAA 3G1JA 5L2WB 1PWTA 4E7ZA 2BE7D 2IVXA 2OX7A 1QKWA 2CZ7B 4QT7A 4XQ3A 1VQMQ 2KAFA 3O5ZA 1VQ4Q 2J05A 4KRDB 1WLPB 3OYNA 5D6WA 1SHFA 2FZGB 1X2QA 2KXDA 1GRIA 2OAWA 1M90U 3G6EQ 4B6MA 1ZBXA 4BE2A 5FWBA 4M7DB 3VS6A 2KXCA 4BD3A 2RJDA 5A0LA 1MUZA 2MWOA 3IQLA 5CCAA 1X69A 4HVVA 1OOTA 5IHIA 5LJ5e 1RACB 1VOMA 4X9CA 2WMAB 3H0HA 2C6TB 1C9BA 3CC2A 3DB4A 4ZTFA 4FYWB 1S72Q 4M75C 1XTDA 3G71A 1Y71A 3WVEB 3NTKA 3DDQB 1K1ZA 3BLHB 2D1XA 2HAXA 4PL6A 3JB9D 1ZSZB 3CCJT 4R55A 4E7SA 2NWMA 2BS4A 1WHMA 3GPLA 1BI2A 4LDXA 2JN0A 5CKBA 4N0AC 4BCNB 3OS2A 3QWXX 3KBGA 4CC7A 2KRSA 4DEYA 2EYWA 3QUIA 1QMCA 4BCIB 1N27A 1VYUA 3CPWP 2VGMA 3L1AA 1VIEA 2J6OA 1VQ9Q 3JCMe 4BCMB 4DEXA 2KSSA 3L2QA 3J7AF 1H8KA 4RMOA 3HHTB 4CFVB 4HXJA 4DQ2A 1K9MC 2JTMA 4ELYC 3THKA 1OZ3A 1T0JA 2CSQA 3SB2A 2RHZA 3H0IA 2AKKA 1KQSA 2DKGA 4OMNA 4PFZA 2FHDA 1EIFA 3S3OA 3OBYA 1WA7A 2E6NA 1RL2A 3JCMP 1H25B 4JLGA 1G3NC 2RJEA 2L0AA 3O8VA 3OYFA 3OW2A 1VQOQ 1VQ8A 2O4XB 2WSCE 4LUEA 3X28B 3RIRA 2FYKA 4XAXB 1JJ2A 1TD6A 3BW1A 4XTZA 3PTAA 3CCMQ 2J6KA 1B3QA 4Q5WA 3CMEQ 1QVGA 3VS3A 1OZ2A 4HCCA 2KNBB 4F7UG 5FW9A 1KHIA 3QWYA 3R6NA 3SWNA 3REBB 5FROA 3L2UA 3NFCA 2EJGA 4QW2A 2DAQA 2B9RA 1JRIA 3SD4A 1ENWA 1AEYA 4BY6B 4MZPA 3J80E 2LQKA 3PT9A 3EG9A 4ZGJB 3H6ZA 2LNHB 4OB2B 1H92A 3VS5A 1VQNA 3TEEA 3OBWA 1XO2A 1KC8R 4QSHA 1JOWA 1RAEB 2XDBA 2Y4XA 2G9XB 4EDUA 2QDYB 3OMGA 3QG1A 4M78E 1NPRA 1Y0MA 3C0CA 3EH2A 2GF7A 2CZ1B 3OYGA 3QHWB 5GJVB 5KYWA 1RUWA 1KK7A 5EFQB 1AZGB 1BIBA 3GTMS 3DDPB 4J9FA 4JRIA 1SRLA 2UZEB 1N9SA 1PSFA 2UUEB 3EGDB 2HMAA 2KR3A 4PNOA 2QDJA 3O0GD 2RI3A 4CRIA 3CCEA 3OYJA 5EC7A 1YJNQ 4ESRA 4LE9A 4ELLA 5LJ3j 1KQ2A 3HP9A 3DLMA 1RAHB 2CP3A 3PMIA 2QEXT 4OGCA 5CKHA 2K79A 1VQKT 3TW6A 2RD1A 5CVIA 4IUQA 1FMKA 3OYEA 1KQSS 3OW2P 1X2KA 1RLPC 5LJ5h 5GAN4 2YRDA 2I40B 2CCHB 1JJ2P 1RI9A 1VQ5A 2VXFA 1MMDA 1WXBA 1QVGP 3QWLA 3QYHB 4M7DD 2O2OA 3C12A 3JB9H 3ZFJA 4LD6A 1X6OA 2DF6A 2EKOA 1JJ2S 4IUVA 1VQ7Q 3MJXA 1QVGS 4YOZA 1D1BA 2FZKB 2M16A 1JXMA 2RJFA 3FLGA 5AYFA 1FVVB 4RCBA 1K0SA 2W99A 1VQLQ 1GL5A 4M78F 2IG0A 3BY7A 2X4XA 2OI3A 1ZA2B 5FLXE 2DXCB 3SWNC 3BLRB 3MEAA 8ATCB 2BKZB 2FPFA 1N9RA 5D7UA 3MCAB 1Y96A 3CCUA 3FJ5A 2QF7A 3JCMh 1YHQA 1KXUA 1W70A 5CIUA 4GBQA 2C4GB 1XJWB 2E70A 2RMOA 5GMKm 5FU7B 1YI2A 1PC0A
chains in the Genus database with same CATH topology
2DVEA 4B9WA 5GAOq 4M77A 2K5IA 5GAOl 4AKIA 1G5VA 3A5ZB 4M75B 2A7YA 4JX6A 3QDRB 1QP3A 5FU6C 2EJ9A 3CCRT 3CCET 4C8QE 1WJQA 4NL3A 4FM4B 2L3RA 2DXTA 4PLLA 5GANf 3LWIA 2R5AA 2XKOC 3DLLA 1VUBA 2RHYA 4LDVA 3QYEA 2VV5A 5GAN2 3CD6A 1XOVA 1Q7YC 1TH7A 1I4K1 2RJCA 1YITA 1XQHA 2QTXA 2EWNA 3OYMA 3OYDA 4J5YA 4M7DG 1Y96B 2BUDA 3OYAA 1UGSB 3OSVA 3VKIA 4BDYA 4ZN1A 1Y07A 2EIFA 2KK4A 2P0KA 5LJ3f 4CI0C 2WSEE 2RHXA 4IUPA 4E47A 1BI0A 3GLXA 3M9QA 5DY9A 5GAMf 4QVCA 2DD5A 2E10A 3JCMg 1YJ9T 4M78C 3FB9A 2RHIA 4OVAA 1ZHIA 5J3BA 4A4EA 4MDWA 4EMKA 5CKDA 3CPWA 3CCSA 3M53A 3I55T 1VQPT 2DJZA 2XI9A 4J83A 3NTHA 4XU2A 3RKXA 2K5FA 3PNWC 1YIJA 4JRKA 4ELZC 3L2VA 3TCJA 2P0QA 1VQ5T 4ME7A 2PQWA 3FDRA 2QA4A 3META 4ZGDB 4BE1A 2PVOB 4M75F 3BG5A 2A3LA 5CO7A 1VQ4A 2HBPA 5C0MA 2R57A 3VKGA 2EQJA 2K5LA 3UDCA 4XTXA 5M9OA 1W4SA 2GQVA 3FEOA 4C8QB 1VQ7T 4AKHA 5LJ3h 2PU9B 4R56A 4M78A 2CGHA 4EMKB 5CK9A 5CAIA 5GMKh 1QVFS 3L2RA 1UGQB 2YHTA 3HL8A 5LJ5f 4M78G 4HNTA 3T9NA 4OB1B 4L5GA 4XU3A 3M5AA 2V8IA 4RCCA 3X20B 5I2SA 5KE2A 1K9MU 5HK3A 3V7SA 5GAOp 2D0QB 2RHUA 4RG8A 3CCVT 3H4CA 5I2MA 3TW7A 1B34B 4IUUA 3QXEB 5GAOr 3HFOA 4HNUA 3VU3C 3GIBA 4C92D 4M7AE 4NOYA 2OTJA 2DZ9A 4NS5A 2X4YA 3CCLT 4JRQA 3Q1JA 5GMKj 2JOYA 5LJ5d 1FWZA 3M55A 5A0GA 1MHNA 2O01E 5EG2A 4JUVA 4PJOD 2PUKB 5KCOA 2E65A 1Q86U 1JB0E 3G4ST 3CCUT 2ZGWA 5J39A 2DO3A 1YHQT 1NJIC 1I8FA 3JB9F 4ATOA 3VKHA 3X25B 1OYXA 3CBMA 3QO3A 4QQDA 5KCHA 3OY9A 5LJ3g 3UPUA 5DLQE 2EQMA 1YI2T 2VXEA 4DOVA 4HKEA 4M77D 1QVFA 4Z02A 5FU7C 4C8QF 3QKJA 4KT0E 1KC8C 4BUGA 1U1SA 4VUBA 2EFIA 3EFSA 5CR2A 4BDZA 2EJFA 1S72A 2CYZB 1WQWA 1WJSA 3OSSC 1E7PA 2LDMA 1K73U 2H3JA 3CXCS 1VIFA 2XIDA 4QVZA 3LX7A 3CD6T 2DXCA 1M1GA 3ZEHA 4MFDA 4C92C 4JJNK 4PLIA 1YITT 4HT9A 4B9XA 3JB9J 2E64A 2MI6A 1NZ9A 3SFMA 4IUTA 1N6AA 3C4SA 1FX7A 4ELJA 4PJOC 1VQ6A 2ZPGB 1UGRB 2K2VA 4OP0A 4C0GA 2LCLA 3QZ5B 4KUIA 4P5NA 4BY6C 5I21A 3S6WA 5DM7R 3OA6A 4M7AB 3VV0A 3HKSA 5IT9E 3JCMX 2AHJB 4PKCC 1BYMA 4E7KA 4O6JA 4XK8E 4X9DA 3CCST 1D3BA 3CCQA 4M77C 4OF1A 4C0ZA 2WJ9A 4LDUA 4JX4A 3QPHA 3F70A 4O5VA 4QQ6A 5GAN5 2HD0A 4M75A 1YIJT 4HCZA 3M4GA 3JCMd 2Y90A 3OYBA 3QSUA 3HRUA 3RERA 2RO0A 3CXCA 1VQ9A 3A8OB 2F5TX 2K3XA 2LRQA 3L2ZA 4C92G 5GAN8 1VQ4T 2XDPA 4J6XA 3VYGB 2VYTA 1K8AC 3TU4K 1FKMA 3KHIA 2LNVA 4JLIA 4MZMA 4TVRA 3LH0A 4PJOG 2JTFA 1Q81U 4C8QC 4M78D 3G7ZA 3CPWS 3CEYA 3GNGA 4XU1A 4EMGA 4N0AA 2XICA 2WACA 4A4GA 5KH6A 3OYKA 1R8OB 4EMKC 1X75C 2ZPBB 3A8GB 4M77G 4WF2A 3CC7A 2KY9A 4J6WA 4FIBA 4BE0A 1LOJA 2VGNA 4F7UE 2DTHA 2RB6A 4M7AF 2KR6A 2DIQA 1VQOA 4RG2A 1M1KC 2L89A 3QIIA 3MHXA 5GMKi 5GAOn 3OYCA 1DJ7B 1Y7XA 2OTJT 3V8KA 3CCJA 1H3ZA 3S3NA 5C6SA 4LDWA 2VC8A 3QJ6A 3H8ZA 3JB9G 2RI2A 3CCMA 4M7DE 2HNIA 1G3TA 3E9GA 3MP8A 3HO8A 2K57A 3LW5E 4C8QA 4J6YA 4IURA 3QHSA 1K73C 2FB7A 5GANd 1G3YA 2WSFE 3C95A 4C8QG 3GF5A 1Q81C 4MDXA 5LL6S 5HKCA 3CMAA 1M5Q1 5GANe 2RA2A 2G3RA 4LD9K 3M54A 3MEWA 2XG8D 1BI1A 1LJOA 2R5MA 3TREA 4Y91A 4XTYA 1S72T 1O9SA 5LJ3d 2CZ7B 4XQ3A 1B34A 2C06A 4BI8B 5GAMd 3FC3A 1VQMA 2OAUA 5LJ3e 2GFAA 3HRTA 2KAFA 4A4HA 4C0DB 3QZ9B 5GAMe 1FXXA 2LX9A 3WVDB 4F7UB 2G77A 5D6WA 5IAYA 3OYNA 1W2BA 3CBPA 1VQ6T 4HNVA 3QYBA 2DZCA 4N4GA 3HFNA 3JCMQ 3LGLA 4E7LA 1M8VA 3G6EA 1M90U 2D9TA 1ZBXA 3CCQT 4BE2A 2QXFA 4M7DB 3HPWA 4QQGA 3UWNA 2EQKA 2X4WA 4M75D 3PIOA 3ASKA 4FT2A 1Q82C 3X24B 4BD3A 3KUFA 5J26A 3PIPA 2F5KA 3ER0A 4A4KA 2RJDA 5A0LA 3VJPA 2XHCA 3RMQA 1VQ9T 5FRMA 2E6ZA 2KMGA 2MWOA 3OS5A 3VUBA 5CCAA 4II1A 4A54A 2JVVA 2ZPIB 3A8HB 5FU6B 5LJ5e 4X9CA 3WXMB 3E1SA 3LGFA 3JB9I 4M7AA 4AKGA 2K3YA 4BB7A 1YJNA 4XTUA 2KQWA 3PMTA 1RI0A 4F7UF 4OB0B 1V29B 3CC2A 3DB4A 1QW1A 2GFUA 4ZTFA 2LCCA 3FRNA 3CC7T 1GXIE 4XU0A 4M75C 2PUOB 1XTDA 3G71A 1VQOT 3J81E 2KVQG 1Y71A 3WVEB 3NTKA 3V8LA 1WGSA 4MFEA 4PL6A 1I81A 2HQXA 3CBOA 4RKUE 4R55A 3CCJT 3JB9D 1Q7YU 2BS4A 4M7DF 1OI1A 1I5LA 4C0FA 5KE3A 3CCMT 2ZPEB 3C94A 3GPLA 3P8DA 3GP8A 2YLBA 1BI2A 3VYGA 4MMLA 2PVDB 2MMPA 3MO8A 4C8QD 2QQ8A 1QLBA 2JN0A 4LDXA 5CKBA 4MZTA 2RK1A 3SDZA 5GAN7 1WPYA 4N0AC 3OS2A 3HZJA 3CMAT 4HL4A 3KBGA 1YJ9A 2LTOA 4JRPA 1G3WA 4BI3A 3OW2S 3V8JA 2XDDA 3OMCA 3QUIA 4C5HA 4X34A 5GAN6 4V2SA 1N27A 2MWPA 4M75G 1UEBA 5DLOA 4HLQA 2VGMA 1VIEA 3L1AA 1VQMT 3JCMe 5GMKl 3OYHA 2ZPHB 2KSSA 2V8JA 3E19A 3AHUA 5EJCA 4C92E 5CQYA 1VQNT 3L2QA 3J7AF 4RMOA 1M90C 2X4JA 2XD0A 3OYYA 4C0DC 3HHTB 4DQ2A 2F69A 1K9MC 2JTMA 4ELYC 1OZ3A 4PJOE 2L5QA 3SB2A 1X01A 2RHZA 1KQSA 1VQLA 2DKGA 2FHDA 1EIFA 3EAEA 3VUZA 3S3OA 3G6ET 1N8RU 3OBYA 4NL2A 4C5GA 4AI6A 3MEVA 2E6NA 1O75A 3P8BB 3M57A 1RL2A 3JCMb 3VYHB 3JCMP 4M77E 2DD4A 2M0OA 3CC4A 3UT1A 4JLGA 3OYFA 2RJEA 3O8VA 3OW2A 4M6VA 2QEXA 1Q86C 1VQ8A 4ZGEB 2O4XB 3DKMA 2EYQA 2WSCE 1AHJB 3RIRA 3X28B 3L42A 1M9SA 2FYKA 4XAXB 3HB9A 2QQAA 1VQKA 1W2BS 2LC4A 1SSFA 1JJ2A 3X26B 2LT1A 4OMFB 2M9UA 2FL7A 3BW1A 1YBYA 4XTZA 3M59A 3RMSA 3PTAA 3JCMW 2QQSA 3CMEA 4LDYA 4Q5WA 1QVGA 4N4IA 1YCYA 4F7UA 1OZ2A 3L2WA 2DTOA 4HCCA 5D6XA 2M1HA 2HAXA 1ZQ1A 3M4YA 4F7UG 4XTWA 1NJIU 1MGQA 4M7AD 1WNLA 1KHIA 1YJNT 2ZZDB 3SWNA 4C92B 5FROA 2OTLA 4N4HA 3OYLA 2DD4B 3L2UA 2Y4YA 2K4YA 2EJGA 3NFCA 5GAOm 2CZ6B 1M4ZA 2EAYA 5L8RE 3CC2T 4QW2A 2DAQA 3CPFA 4KBMB 3ZBDA 4MIMA 3MEUA 4KULA 3DB3A 4M7DA 2DTIA 1HK9A 1JRIA 3I56A 1KC8U 4PJOB 1NPPA 4YTLA 3SD4A 3G71T 4EMHA 2FVUA 4IKFA 4BY6B 4Y28E 2E5QA 4MZPA 3J80E 2LQKA 1KHCA 3LYIA 1XNIA 3PT9A 4ZGJB 3H6ZA 3RKWA 4OB2B 1YJWA 1JBMA 3HRSA 1VQNA 3TEEA 5GMKe 2DIGA 3JCMV 3OBWA 4M77B 4E7HA 5CKEA 1KQ1A 1NE8A 4QSHA 3V7RA 1KD1U 1PSEA 3ME9A 2KDSA 2XDBA 5HY6A 2BIVA 2Y4XA 2DPPB 2JUFA 3MP1A 4J7FA 3SWNB 5CQXA 2IVWA 5GAN3 4EDUA 4M7AC 2QDYB 3OMGA 3URGA 4EPCA 4HCBA 2V8KA 3QG1A 4M78E 1NPRA 1IZ6A 2QQ9A 2R58A 3HSBA 1BI3A 5GANh 2GF7A 2CZ1B 1KG1A 3OYGA 4L59A 4FSXA 2QFZA 2MF2A 2P0PA 1M1FA 3BDUA 2ZPFB 3KXTA 4MMKA 2HQEA 4GY5A 1UB4A 1BIBA 4ZN3A 4BACA 3PGGA 2EQUA 2JZ2A 2DK3A 2MAMA 3QJYA 4GLKA 4C92F 4JRIA 2DD5B 4C5EA 1N9SA 1G3SA 2X35A 4QVDA 3CCUA 1PSFA 5GAMh 3MP6A 3QBYA 1N8RC 4PJOF 5GANj 4PNOA 1K8AU 2NLUA 4LOCA 4J7IA 2QDJA 1H641 2RI3A 3BFMA 3INZA 4CRIA 3CCEA 3CCRA 3OYJA 1VQLT 3RUXA 4FT4A 3R6OA 2JNGA 4M7AG 2BKDN 4M77F 1U8RA 2ZCFB 2BS3A 2P4TA 5LJ3j 2PVGB 3N5BB 4E7JA 3BG3A 3OQ5A 3CC4T 4D6WA 5GANg 1KQ2A 2RM4A 5GAMj 3HP9A 3DLMA 3PMIA 2QEXT 1VQ8T 4OGCA 2KMTA 3S3MA 4HT8A 2DXUA 2L8DA 2I2LA 5CKHA 4C5IA 4J8OA 4DOWA 3QYGB 1VQKT 4M78B 1M1KU 3TW6A 2RD1A 5CVIA 4IUQA 1QP2A 3RKYA 4BBSM 3OYEA 1KQSS 2QQBA 3CMET 3OB9A 4NC6A 5A2QE 3HBLA 4OGEA 5LJ5h 2RI5A 2YLCA 5GAMg 3I55A 1VQPA 4KUDK 2RK2A 5GAN4 3A8LB 4BBRM 1UGPB 2DEQA 3LWHA 2DXBA 2XK0A 3NTIA 2B8AA 3V7CA 1VQ5A 2OTLT 2VXFA 2BS2A 1BKBA 3BDLA 2LVMA 2CZ0B 1HXDA 3JSCA 3QWLA 3QYHB 1BIAA 4A4FA 4M7DD 4L6V5 3C12A 3JB9H 4XTVA 3JRZA 4LD6A 1X6OA 2VUBA 3ZFJA 4BI4A 5HK0A 3I56T 3BG9A 2EKOA 2GCXA 4M75E 3JCMc 1KD1C 3GNFB 2RH2A 1QVPA 1WQ7A 5LJ5j 1JJ2S 2O4XA 3JCMf 1VQ7A 4IUVA 2E12A 4JS5A 3JAME 1QVGS 1YJWT 2RJFA 2M16A 3LLRA 5AYFA 3FIFA 3FLGA 4HA8A 3OS0A 4RCBA 5CKFA 2QQRA 3P8HA 2D6FA 4OB3B 2LQ8A 4JX5A 3M56A 4JDSA 2DXBB 2XU8A 2LT4A 4JS4A 4M78F 5IN1A 5LJ5g 2CKKA 2IG0A 3EFRA 3CCVA 2QI2A 3BY7A 2X4XA 1P92A 3E9FA 1LNXA 1WJRA 2DXCB 2CS7A 3SWNC 5FLXE 5A0DA 4ZTJA 5FRNA 2ZZDA 3M58A 4C92A 3FJPA 2QA4T 4FU6A 3DL1A 3MEAA 3CCLA 3RESA 4M7DC 4Z6YA 2YRVA 1N9RA 3OS1A 4UC4A 2E41A 1Q82U 4PJOA 4FL6A 3MCAB 3OYIA 1Y96A 3G4SA 1U1TA 3A8MB 1IREB 2QF7A 2E1HA 3JCMh 4A53A 3GOXA 4DA4A 1YHQA 5CIUA 3JCMJ 2E70A 5GMKm 5FU7B 4E7IA 1YI2A 3PFSA 1D3BB 5D6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHJ B;  1PSE A;  4XK8 E;  2DPP B;  1QP3 A;  2QDY B;  4OB0 B;  1V29 B;  4FM4 B;  1GXI E;  2CZ1 B;  2PUO B;  2ZPF B;  3WVE B;  3A8O B;  4RKU E;  1UGS B;  3VYG B;  2DD5 B;  2WSE E;  2ZPE B;  1PSF A;  3VYG A;  2DD5 A;  2PVD B;  2ZPB B;  3A8G B;  2ZCF B;  2PVG B;  4ZGD B;  2PVO B;  1DJ7 B;  2ZPH B;  3QYG B;  2PU9 B;  3LW5 E;  1QP2 A;  3HHT B;  1UGQ B;  2WSF E;  4OB1 B;  3A8L B;  1UGP B;  3X20 B;  2DXB A;  2D0Q B;  3VYH B;  3QXE B;  2DD4 A;  2CZ0 B;  3QYH B;  2CZ7 B;  4L6V 5;  4ZGE B;  2WSC E;  1AHJ B;  3X28 B;  3QZ9 B;  2O01 E;  3X26 B;  2PUK B;  3WVD B;  1JB0 E;  3X25 B;  4OB3 B;  2DXB B;  4KT0 E;  2ZZD B;  2DD4 B;  2DXC B;  2CYZ B;  2CZ6 B;  5L8R E;  2ZZD A;  3X24 B;  2DXC A;  4Y28 E;  4ZGJ B;  4OB2 B;  3A8M B;  1IRE B;  2ZPG B;  1UGR B;  2ZPI B;  3A8H B;  3QZ5 B; 
#chains in the Genus database with same CATH topology
 1Q82 R;  4OGR B;  1M3B A;  5FU6 C;  1QQJ A;  2QK0 A;  4C8Q E;  4NL3 A;  3LWI A;  3DLL A;  4BCN D;  1XOV A;  2M51 A;  2OJ2 A;  1YIT A;  1URC B;  2EWN A;  3OYM A;  2FO0 A;  4M7D G;  1LVK A;  2MYS A;  7AT1 B;  1RAD B;  1Y07 A;  4BCQ B;  2EIF A;  2SEM A;  1YJW Q;  5GAM f;  4BCM D;  2O88 A;  2DD5 A;  1UJ0 A;  3I9Q A;  4OVA A;  3CCS A;  3PVQ A;  3I55 T;  3RKX A;  2QG9 B;  1VYV A;  1YIJ A;  2IPO B;  4JZ4 A;  2EVR A;  1H24 B;  1U3O A;  2PVO B;  3UDC A;  3VKG A;  2K5L A;  4J9G A;  4XTX A;  2GQV A;  5LJ3 h;  2CP0 A;  2DVJ A;  4M78 A;  2CGH A;  1UGQ B;  2YHT A;  4L5G A;  4XU3 A;  2EYZ A;  3KFV A;  4RCC A;  5I2S A;  1W1F A;  4II5 B;  3REA B;  3H4C A;  3TW7 A;  2IW8 B;  3QXE B;  4HNU A;  3VU3 C;  4NOY A;  1JXO A;  3UA7 A;  2OTJ A;  4NS5 A;  2COY A;  2X4Y A;  2O01 E;  2LCS A;  2MIO A;  1X43 A;  5KCO A;  2E65 A;  2WEV B;  2ZGW A;  2DO3 A;  3EG3 A;  2C5V B;  2F2X A;  4BCF B;  3CBM A;  3UPU A;  1EZZ B;  1PKD B;  5KYX A;  2EQM A;  4DOV A;  4DBF A;  4Z02 A;  1VQP Q;  4C8Q F;  1U1S A;  2CYZ B;  4J9E A;  2I0N A;  2H3J A;  2YXY A;  2YUN A;  3EGX B;  4PLI A;  4A63 B;  4B9X A;  2E64 A;  2MI6 A;  2D8J A;  3EGU A;  4ROD A;  4IUT A;  2D8H A;  1N6A A;  4BY7 X;  2L3S A;  3EID B;  1BCM A;  5I21 A;  5DM7 R;  3OA6 A;  4M7A B;  3JCM X;  2AHJ B;  2LQN A;  1SKU B;  4X9D A;  3RNJ A;  1AWJ A;  2ATC B;  4LDU A;  5GAN 5;  3M0Q A;  2HD0 A;  2RPN A;  2Y90 A;  2KEA A;  2BPM B;  3HRU A;  1HSQ A;  2CDT A;  3NGP A;  2RO0 A;  3CXC A;  3A8O B;  2F5T X;  5GAN 8;  1I1J A;  1VQ4 T;  3VYG B;  2VYT A;  3TU4 K;  4JLI A;  3KHI A;  2VB6 A;  2A08 A;  3H9N A;  3CEY A;  4XU1 A;  2XIC A;  5KH6 A;  3OYK A;  2IN3 A;  2VAS A;  4BCK B;  2VGN A;  1GBQ A;  1Q81 R;  2DIQ A;  2ENM A;  4FYY B;  1DJ7 B;  1Z9Z A;  1Y7X A;  3V8K A;  1X6B A;  3CCJ A;  3S3N A;  8AT1 B;  4LDW A;  2VC8 A;  4BCJ B;  1OUL A;  4BCH B;  3H8Z A;  1G3T A;  1OEB A;  3HO8 A;  4C8Q A;  2EGA A;  4IUR A;  1K73 C;  5GAN d;  2WSF E;  3GF5 A;  1M5Q 1;  4Z89 A;  3CMA Q;  5GAN e;  2FRW A;  1H1Q B;  2LW4 A;  2G3R A;  4LD9 K;  1BU1 A;  2R5M A;  3TRE A;  1AIS B;  1WHK A;  1S72 T;  1K9A A;  1WHG A;  1BK2 A;  3EFO B;  2C06 A;  2IW6 B;  1TSF A;  2GFA A;  3HRT A;  4A4H A;  4C0D B;  3VRZ A;  1FXX A;  4F7U B;  2G77 A;  1VQ6 T;  3UAT A;  5BNJ B;  2DX1 A;  3JCM Q;  1GFC A;  3LGL A;  2O31 A;  1IRX A;  3HTR A;  3CCQ T;  2PZ1 A;  4QQG A;  1SSH A;  2EQK A;  3ULR B;  3X24 B;  3PIP A;  3ER0 A;  1MMN A;  2SRC A;  2CP5 A;  1VQ9 T;  2XHC A;  1E7O A;  2FG0 A;  4AMC A;  2KMG A;  4FW1 A;  3VUB A;  1ZSG A;  1ZSZ A;  2E3H A;  2JVV A;  2W10 A;  4BCQ D;  4G6L B;  3DJB A;  3CXC P;  2DBM A;  2DA9 A;  3E1S A;  3TNW B;  3JB9 I;  2LX7 A;  1RI0 A;  1GXI E;  3FRN A;  1ZBJ A;  2PUO B;  1MNE A;  1VQO T;  3EH1 A;  3V8L A;  4RKU E;  5GJW B;  1I81 A;  3CBO A;  1OI1 A;  5KE3 A;  3CCM T;  3GP8 A;  1VOL A;  5ICP B;  2YLB A;  2KYM A;  5HCK A;  4MML A;  3MO8 A;  4BXX X;  2RK1 A;  1Q7Y R;  3HZJ A;  2UZL B;  4JRP A;  1G3W A;  3V8J A;  4AFZ C;  3OMC A;  3M03 A;  3I35 A;  4X34 A;  4C5H A;  2EQI A;  2ROT A;  1UEB A;  4HLQ A;  2K6D A;  4C92 E;  2AIR B;  2XD0 A;  1W98 B;  2F69 A;  4PJO E;  1X01 A;  1YWP A;  1NM7 A;  3BE3 A;  2LP5 A;  1PKT A;  4AI6 A;  3P8B B;  3M57 A;  4WCI A;  2C5O B;  3VYH B;  3UT1 A;  2QEX A;  1TU0 B;  2EYQ A;  1VQK A;  1M9S A;  1N8R R;  4F70 B;  1KJW A;  2BZY A;  3M59 A;  3RMS A;  1OPL A;  4LDY A;  3L2W A;  1YCY A;  1IO6 A;  2CSI A;  2M1H A;  1ZQ1 A;  3DOG B;  4M7A D;  2DEU A;  1YJN T;  2F1L A;  2K4Y A;  1M8V A;  1M4Z A;  3CPF A;  2JS2 A;  4MIM A;  2JMC A;  3DB3 A;  1KC8 U;  4YTL A;  4JPB W;  4Y28 E;  3BHU B;  1VQN Q;  5GMK e;  1ZSZ C;  4M77 B;  1N4M A;  4PFP A;  1Z9Q A;  1JQQ A;  1PSE A;  2GQI A;  2KDS A;  2W2H A;  4EPC A;  3URG A;  3M0S A;  2V8K A;  1TWB A;  1QCF A;  1BI3 A;  5GAN h;  4L59 A;  2QGG A;  2J6F A;  1H1R B;  4MMK A;  2HQE A;  3TSW A;  3MI9 B;  1YWO A;  1IHW A;  1UB4 A;  4BAC A;  2JZ2 A;  2MAM A;  5LMK B;  4C92 F;  4QVD A;  1N8R C;  3TQ7 P;  4PJO F;  2WIP B;  4ZNX A;  4FCY A;  3INZ A;  3BFM A;  1VQL T;  3CCE Q;  2JNG A;  4M7A G;  1NEB A;  2P4T A;  2PVG B;  4E7J A;  1H1S B;  1K8A R;  2YDL A;  4Y92 A;  4Z8A A;  2RM4 A;  3NMZ C;  1UUE A;  2K3B A;  2KT8 A;  2KRM A;  4EOK B;  2I2L A;  1RAG B;  4CC2 A;  2JGZ B;  1FYN A;  1KFZ A;  3OB9 A;  4NC6 A;  3I55 A;  1B07 A;  1UDL A;  3A8L B;  2KT1 A;  1UGP B;  2DEQ A;  2XK0 A;  1VQ5 Q;  2BS2 A;  1BKB A;  1HXD A;  3JSC A;  4A4F A;  1ZUK A;  4XTV A;  2WPA B;  4ZTJ A;  2VUB A;  3I56 T;  1O9K B;  1WQ7 A;  5LJ5 j;  2VVK A;  3JCM f;  2DL5 A;  2E12 A;  1YJW T;  3LQ5 B;  1SEM A;  3FIF A;  3OS0 A;  4FW2 A;  4JDS A;  4JS4 A;  1ARK A;  3PO3 S;  5LJ5 g;  5IHY A;  3EFR A;  2EGE A;  1UNG D;  2CCI B;  2CS7 A;  5FRN A;  5HVY B;  2ZZD A;  2FZC B;  2QAZ A;  3M58 A;  4C92 A;  5KYY B;  3DL1 A;  2HBW A;  3CC4 Q;  2YRV A;  4EIK A;  1EFN A;  4UC4 A;  4AFQ C;  1Q82 U;  4PJO A;  3QDF A;  1AD5 A;  3CCU Q;  5IF1 B;  1VYT A;  2CJM B;  1D3B B;  2KYB A;  2F2W A;  6AT1 B;  4B9W A;  1V76 A;  4AKI A;  1G5V A;  2C0I A;  4M75 B;  1IGQ A;  2DE0 X;  4ROC A;  2EJ9 A;  1UNL D;  3CCR T;  1WJQ A;  2OTL Q;  2XKO C;  2RHY A;  4LDV A;  1WYX A;  1TH7 A;  2HSE B;  4RTZ A;  2RJC A;  1GBR A;  1MV3 A;  3OYD A;  4BDY A;  3VKI A;  2E5K A;  5LJ3 f;  1NLP C;  4QVC A;  3VS4 A;  2DL7 A;  3GLX A;  4J9C A;  5DY9 A;  2PK2 A;  1PD1 A;  3JCM g;  4J9B A;  4AT1 B;  2NUP B;  1M2O A;  2RHI A;  4D8D A;  5J3B A;  1VQP T;  1WFW A;  2K5F A;  1YIJ Q;  3TCJ A;  2V1Q A;  1P5E B;  3FDR A;  2QA4 A;  3MET A;  4BE1 A;  2C0O A;  1PRL C;  3RR6 A;  3BG5 A;  2A3L A;  1VQ4 A;  2HBP A;  2R57 A;  5M9O A;  1W4S A;  2HDA A;  4F16 A;  4AKH A;  4I3Z B;  4EMK B;  2GTO A;  5CAI A;  5GMK h;  1QVF S;  4OR5 B;  2A28 A;  3HL8 A;  4M78 G;  4HNT A;  4OB1 B;  4F04 B;  2FEI A;  5HK3 A;  3EOC B;  3V7S A;  2D0Q B;  2RHU A;  3CCV T;  2WXV B;  5I2M A;  3NHN A;  4IUU A;  1PNJ A;  2FPE A;  1KQS P;  4PK4 A;  3CCL T;  1BU2 A;  3Q1J A;  2JOY A;  1PKS A;  3RGF B;  2CP6 A;  2PUK B;  3JB9 F;  4ATO A;  5KCH A;  1YJ9 A;  3OY9 A;  5LJ3 g;  2LJ1 A;  4YOS A;  1QCO A;  4KRT A;  4M77 D;  1SG5 A;  5FU7 C;  2AT1 B;  3VS2 A;  2KE9 A;  3QKJ A;  1Q86 R;  1KC8 C;  4EON B;  4BUG A;  1S72 A;  3K7A M;  3EFS A;  2EJF A;  1K73 U;  2J7I A;  1WQW A;  3EHR A;  1LPL A;  3OSS C;  4F6W B;  2JS0 A;  4EC8 B;  4CC4 B;  3CD6 T;  2XID A;  1TUG B;  5KYU A;  2FPD A;  3ZEH A;  4C92 C;  4F17 A;  2DRK A;  1R0B G;  3C4S A;  3BHT B;  1FX7 A;  3UF4 A;  2HCK A;  5I22 A;  4PJO C;  1VQ6 A;  3QZ5 B;  4KUI A;  1YFN A;  3S6W A;  2V26 A;  3VV0 A;  5IT9 E;  4PKC C;  4E7K A;  2PJQ A;  2HQH A;  4EOL B;  4RTV A;  3CCQ A;  4UN0 A;  4J9D A;  4QQ6 A;  1GCP A;  2YT6 A;  3I5R A;  2CP2 A;  3OYB A;  1VQ9 A;  2K3X A;  3G4S Q;  1Q81 U;  2NUT B;  3PVL A;  2YSQ A;  1PHT A;  1AWW A;  2WAC A;  4ROE A;  1HJD A;  4M77 G;  4WF2 A;  4J6W A;  2DTH A;  1M2V B;  2KR6 A;  2BZ8 A;  3MPU B;  1VQO A;  4RG2 A;  2HKQ B;  3EFO A;  1H3Z A;  2LMJ A;  1C1A A;  2ROL A;  3QJ6 A;  3CCM A;  4M7D E;  2RF0 A;  2JT4 A;  1WZO A;  2EPD A;  2FB7 A;  1G3Y A;  4C8Q G;  2DL8 A;  1JKW A;  2RQT A;  2RA2 A;  4EOO B;  3M54 A;  1ABO A;  1LJO A;  4Y91 A;  1O9S A;  4M4Z A;  4F7L B;  1C0M A;  1B34 A;  4KGV B;  1OQK A;  5GAM d;  3MY5 B;  5AT1 B;  1H28 B;  4CRL B;  2OAU A;  3A1P A;  2V1R A;  1OX8 A;  2DYB A;  5GAM e;  4TTH A;  1W2B A;  3CBP A;  2I53 A;  1GH6 B;  4HNV A;  3QYB A;  1R77 A;  2DZC A;  4N4G A;  3HFN A;  4E7L A;  1YN8 A;  1D1A A;  1TTH B;  2D9T A;  3LH5 A;  3HPW A;  3UWN A;  2GTJ A;  4M75 D;  3ASK A;  1Q82 C;  4A4K A;  2RNA A;  3EG9 B;  3H0F A;  4F7N B;  3VJP A;  3RMQ A;  2E6Z A;  1HYO A;  3OS5 A;  4BY1 X;  1EX4 A;  3U23 A;  1U5S A;  4II1 A;  2HKN A;  1WHJ A;  5FU6 B;  3A8H B;  2QDL A;  4DBH A;  3BHV B;  4R0K A;  1KIK A;  3WXM B;  2K3Y A;  1YJN A;  4XTU A;  2W9Z A;  4FYV B;  4OB0 B;  5KYW B;  4CFM B;  1QW1 A;  2EYX A;  3CC7 T;  2O9V A;  4EOS B;  3J81 E;  1HD3 A;  1M27 C;  2HQX A;  4M7D F;  1Q7Y U;  1I5L A;  4AG2 C;  3C94 A;  3TSZ A;  2PVD B;  2MMP A;  3F5X B;  4CFW B;  2QQ8 A;  1QLB A;  4MZT A;  3SDZ A;  1WPY A;  1D0Y A;  1BBZ A;  2LTO A;  4RTT A;  4BI3 A;  1SHG A;  4V2S A;  4M75 G;  1BCO A;  5IH2 A;  1K76 A;  4RTY A;  5DLO A;  3NPF A;  1VYW B;  1VQM T;  5GMK l;  2ZPH B;  2LZ6 B;  3E19 A;  1VQN T;  4C0D C;  1H26 B;  2E3I A;  1T3S A;  2DYI A;  9ATC B;  1VQL A;  1YP5 A;  2CUB A;  4QKU A;  3EAE A;  4OML A;  3EJ1 B;  3VUZ A;  3G6E T;  1M8M A;  2M02 A;  4RTW A;  1N8R U;  2YRC A;  4NL2 A;  2C5X B;  3MEV A;  4C5G A;  1G83 A;  3JCM b;  1PD0 A;  2M0O A;  5CEI B;  1SPK A;  4ZGE B;  3DKM A;  3GBQ A;  1V1C A;  1VQK Q;  2QQA A;  1W2B S;  3X26 B;  1QWE A;  1SF9 A;  2QQS A;  4AG1 C;  4Z88 A;  4N4I A;  2KI7 A;  1H4L D;  3SHW A;  4OMM A;  3M4Y A;  4XTW A;  3PE0 A;  4N4H A;  3OYL A;  2DD4 B;  2Y4Y A;  5GAO m;  4PJJ A;  2CZ6 B;  2EAY A;  5L8R E;  1GUX B;  4M7D A;  4NST B;  5ACB A;  2DTI A;  3I56 A;  1G2B A;  1F1B B;  4KGZ B;  1WIE A;  1NJI R;  4IKF A;  2NUZ A;  1GCQ A;  1KHC A;  3LYI A;  3RKW A;  2KRO A;  2DNU A;  4J9H A;  1JBM A;  2YUQ A;  2A0F B;  4CFU B;  3HRS A;  1OI9 B;  1YJW A;  4LN2 A;  1OL1 B;  2DIG A;  4CFX B;  3JCM V;  4E7H A;  5CKE A;  1KQ1 A;  1NE8 A;  4DBR A;  3V7R A;  3ME9 A;  2BIV A;  2JUF A;  2IVW A;  5GAN 3;  4HCB A;  2QQ9 A;  1IZ6 A;  2R58 A;  1KD1 R;  2ZAE A;  1OU9 A;  2ED1 A;  2MOX A;  2P0P A;  1M1F A;  3BDU A;  3KXT A;  4IIO A;  1JST B;  1Q81 C;  3PGG A;  2EQU A;  4GLK A;  1WI7 A;  2DD5 B;  1ZUU A;  4C5E A;  4WTO B;  5GAM h;  4KH1 B;  5GAN j;  5I5Z B;  1K8A U;  2BE9 B;  1H64 1;  4CXA B;  3CCR A;  3RUX A;  4FT4 A;  1ZP2 A;  1QCN A;  1UTI A;  2BKD N;  1U8R A;  3CC2 Q;  3N5B B;  3BG3 A;  3OQ5 A;  3CC4 T;  5GAN g;  2X9H A;  2G6F X;  3G71 Q;  2KMT A;  3S3M A;  2L8D A;  1O9K A;  4M78 B;  4PJN A;  1QP2 A;  3RKY A;  4BBS M;  2QQB A;  3CME T;  5A2Q E;  1TUD A;  3HBL A;  2RI5 A;  1VQP A;  4EOI B;  4KUD K;  4BBR M;  1D0Z A;  1M1K R;  3LWH A;  3NTI A;  2B8A A;  2OTL T;  5LQF B;  1AOJ A;  1G8X A;  2LVM A;  2CZ0 B;  4IMY B;  1E6H A;  4L6V 5;  1NLO C;  5HK0 A;  1TOV A;  3BG9 A;  2GCX A;  2QAS A;  3JCM c;  2E4H A;  1KD1 C;  3GNF B;  2RH2 A;  2O4X A;  1QWF A;  4KGX B;  3LLR A;  4BCO B;  3M0P A;  4HA8 A;  2D6F A;  2QQR A;  3P8H A;  4JX5 A;  2DXB B;  4FSS A;  5IN1 A;  2W9F A;  3CCV A;  1NEG A;  1CSK A;  2KRN A;  3CCL A;  3RES A;  4M7D C;  4Z6Y A;  3MKD A;  4OMO A;  1VQ8 Q;  3OS1 A;  3UA6 A;  4FL6 A;  1M30 A;  2JTE A;  3A8M B;  1IRE B;  1GCQ C;  3GOX A;  3RDV A;  4E7I A;  4E47 A;  5IAY A;  5D6Y A;  1QLY A;  2DVE A;  5GAO q;  5GAO l;  2NUP A;  1PM3 A;  3A5Z B;  2A7Y A;  4JX6 A;  3QDR B;  2DL4 A;  2JJ9 A;  4FM4 B;  2L3R A;  2DXT A;  4PLL A;  2R5A A;  3CD6 A;  3QYE A;  1UHC A;  1Q7Y C;  1I4K 1;  1OPK A;  1D09 B;  2BUD A;  2AKL A;  1X27 A;  3OSV A;  1ZLM A;  2QTV A;  4ZN1 A;  2P0K A;  2WSE E;  2RHX A;  4IUP A;  1BI0 A;  3M9Q A;  1VA7 A;  2E10 A;  2EGC A;  1QMZ B;  4A4E A;  4EMK A;  5CKD A;  3CPW A;  3EGD A;  3M53 A;  2DJZ A;  4J83 A;  3NTH A;  4XU2 A;  3PNW C;  4JRK A;  2IW9 B;  4ELZ C;  3L2V A;  2P0Q A;  2PQW A;  2ED0 A;  2QA4 Q;  4JJD A;  1OX9 A;  5IDN B;  2EKH A;  4C8Q B;  1VQ7 T;  1UFF A;  2DJQ A;  3RBB B;  5CK9 A;  1CKA A;  5LJ5 f;  2RN8 A;  1OL2 B;  3T9N A;  3JV3 A;  3X20 B;  2KGT A;  5KE2 A;  4OMP A;  4F6U B;  1C6V X;  5GAO r;  3GIB A;  4M7A E;  2DZ9 A;  1TS9 A;  5GMK j;  5LJ5 d;  1K9M R;  3M55 A;  5EG2 A;  3VS1 A;  1YCS B;  2HEQ A;  2DMO A;  3G4S T;  1Q86 U;  5J39 A;  1I8F A;  3VKH A;  3QO3 A;  4CC3 A;  4QQD A;  1YJ9 Q;  5DLQ E;  1NBE B;  4CFU D;  2VXE A;  4F14 A;  1QVF A;  2WMB B;  2J06 A;  2C5N B;  2RQV A;  4VUB A;  4DBQ A;  3TN8 B;  4HCK A;  1E7P A;  2LQW A;  2COW A;  3EG0 A;  1VIF A;  4QVZ A;  1RAB B;  3LX7 A;  4IIM A;  1X6G A;  1M1G A;  2DXC A;  4MFD A;  2L3P A;  3JB9 J;  1NZ9 A;  3SFM A;  1AT1 B;  1AWX A;  5FWC A;  1AD6 A;  2ZPG B;  1UGR B;  1VQ6 Q;  2LCL A;  4BY6 C;  1BYM A;  2NUT A;  2X1N B;  2EUF A;  3D7S B;  4OF1 A;  4C0Z A;  3CCQ Q;  4JX4 A;  1PG5 B;  3F70 A;  4O5V A;  4HCZ A;  5IHN A;  3JCM d;  3QSU A;  1M2V A;  2DLP A;  4X1V A;  2W96 A;  2XDP A;  1A0N B;  5IXB A;  1K8A C;  1ZA1 B;  2LNV A;  4TVR A;  3LH0 A;  1YHQ Q;  2JTF A;  2ECZ A;  4RUG A;  4M78 D;  3CPW S;  3GNG A;  1YI2 Q;  4EMG A;  3ZL7 C;  4EMK C;  2ZPB B;  3A8G B;  5CYI B;  2DRM A;  4E6R A;  3CC7 A;  2KY9 A;  1LOJ A;  4F7U E;  4M7A F;  1K4U S;  2ABL A;  1E6G A;  1FMV A;  2L89 A;  5GMK i;  5GAO n;  3OYC A;  1YIT Q;  3M0U A;  4LXC A;  4EOQ B;  3AT1 B;  3JB9 G;  2RI2 A;  2HNI A;  1T3L A;  1ABQ A;  1M3A A;  3TVT A;  3LW5 E;  1OIY B;  3POM A;  3C95 A;  4MDX A;  5HKC A;  3CCS Q;  5IHK A;  3MEW A;  2XG8 D;  5HBE B;  4EC9 B;  1BI1 A;  1WXU A;  2CH4 A;  4XTY A;  5LJ3 d;  2EW3 A;  4F7J B;  4BI8 B;  3FC3 A;  1VQM A;  1QVF P;  5LJ3 e;  1JSU B;  1UNH D;  3H41 A;  3QZ9 B;  5I11 A;  2LX9 A;  3WVD B;  3CQT A;  2MCN A;  3TNI B;  3G6E A;  3NDQ A;  2QXF A;  4GLM A;  2X4W A;  1WHL A;  5DQW A;  3PIO A;  4FT2 A;  2DFU A;  3KUF A;  5J26 A;  2F5K A;  2BTT A;  2AZV A;  1D3U B;  2OTJ Q;  1M90 R;  5HQ0 B;  5FRM A;  3EGX A;  2CT3 A;  4A54 A;  2BZX A;  1R0C B;  4ORZ A;  1PCX A;  2ZPI B;  2K9G A;  3LGF A;  1H27 B;  4M7A A;  4AKG A;  4BCP B;  4BB7 A;  2O9S A;  2KQW A;  3PMT A;  4F7U F;  1V29 B;  4EOR B;  2GFU A;  2LCC A;  4XU0 A;  1WHH A;  2KVQ G;  2EBP A;  2UZB B;  1QKX A;  1WGS A;  4MFE A;  1MMG A;  2H3E B;  1U06 A;  2XMF A;  4C0F A;  2ZPE B;  3P8D A;  4RTU A;  3EHQ A;  3VYG A;  3DTO A;  2V22 B;  4JJC A;  4C8Q D;  2GNC A;  2HSP A;  1F5Q B;  5GAN 7;  3M0R A;  3CMA T;  2K2M A;  4HL4 A;  1GY3 B;  3OW2 S;  1SRM A;  4Y72 B;  2UZD B;  2XDD A;  5GAN 6;  2MWP A;  1GFD A;  3OYH A;  1UEC A;  2HL5 C;  3AHU A;  2V8J A;  5EJC A;  5L23 A;  5CQY A;  2JW4 A;  1M90 C;  2X4J A;  4EOJ B;  1Q95 G;  3OYY A;  2CRE A;  2GGR A;  2L5Q A;  4FYX B;  2YUP A;  1AWO A;  2HZY A;  4EOM B;  3I5S A;  1FIN B;  1O75 A;  2DET A;  2DL3 A;  4M77 E;  2DD4 A;  3CC4 A;  4PJL A;  1GUX A;  4M6V A;  1Q86 C;  5IXF A;  1AHJ B;  1TFB A;  2W0Z A;  3L42 A;  1RAA B;  3HB9 A;  3CCJ Q;  2LC4 A;  1SSF A;  1W6X A;  2LT1 A;  4OMF B;  2M9U A;  1ZX6 A;  2FL7 A;  1YBY A;  2HL3 A;  1IB8 A;  2WFY B;  3JCM W;  1I5O B;  3CME A;  2JXB A;  4F7U A;  2DTO A;  5D6X A;  2MK5 A;  2FRY A;  4K11 A;  1NJI U;  1MGQ A;  1WNL A;  2C0T A;  2OTL A;  2ZZD B;  4LNP A;  4C92 B;  3QHR B;  1D0X A;  1RAI B;  3M0T A;  2YUO A;  3CC2 T;  3E2U A;  3ZBD A;  4KBM B;  2L3Q A;  3MEU A;  4KUL A;  4LUD A;  1TUC A;  1HK9 A;  4PJO B;  2QGF B;  1NPP A;  3I56 Q;  3G71 T;  4EMH A;  2FVU A;  4PFO A;  2WHB B;  2E5Q A;  1XNI A;  2JM9 A;  1KD1 U;  5HY6 A;  2DPP B;  3MP1 A;  4J7F A;  3A98 A;  3SWN B;  5CQX A;  4M7A C;  2DM1 A;  3MY1 B;  2YWW A;  3HSB A;  1KG1 A;  1H3H A;  2X3X D;  4FSX A;  2QFZ A;  2MF2 A;  2ZPF B;  2QGS A;  4GY5 A;  4ZN3 A;  1ACM B;  3QJY A;  2DK3 A;  4EOP B;  1G3S A;  2X35 A;  1LCK A;  3MP6 A;  3QBY A;  2CT4 A;  1PRM C;  2NLU A;  4LOC A;  4J7I A;  3TNH B;  3CCR Q;  1I07 A;  2QYZ A;  3R6O A;  4M77 F;  4AFU C;  2PTK A;  2ZCF B;  2BS3 A;  4D6W A;  5GAM j;  5HNB B;  1VQ8 T;  4HT8 A;  2DXU A;  4C5I A;  4DOW A;  4J8O A;  3QYG B;  2IIM A;  1M1K U;  5KYN A;  2PK9 B;  2LJ0 A;  4OGE A;  2YLC A;  1TG0 A;  5GAM g;  2RK2 A;  2NYS A;  2B86 A;  4HVU A;  2A37 A;  2DXB A;  1H1P B;  3V7C A;  3VS0 A;  1ZUY A;  1JU5 C;  3BDL A;  1JEG A;  4F6S B;  3B57 A;  1BIA A;  2RQU A;  2CUD A;  1WDX A;  3JRZ A;  4BI4 A;  1YNZ A;  5FGK B;  4M75 E;  1QVP A;  1OU8 A;  4PJM A;  1WX6 A;  1K73 R;  1VQ7 A;  4JS5 A;  4JZ3 A;  3JAM E;  4HVW A;  2AK5 A;  5CKF A;  4OB3 B;  2LQ8 A;  1FMW A;  3M56 A;  2XU8 A;  2LT4 A;  5IDP B;  2CKK A;  4KH0 B;  2QI2 A;  3CCV Q;  1P92 A;  1UGV A;  2CH4 W;  3E9F A;  5KYU B;  1LNX A;  1WJR A;  1W2B P;  5A0D A;  1IXD A;  3FJP A;  2QA4 T;  4FU6 A;  4RTX A;  3CCL Q;  1OKV B;  5HBJ B;  2QEX Q;  1AVZ C;  2E41 A;  2PHG A;  3OYI A;  1UE9 A;  3BLQ B;  3G4S A;  2E1H A;  1U1T A;  1TXQ A;  4A53 A;  4DA4 A;  2GBQ A;  3JCM J;  2DBK A;  2F2C A;  3PFS A;  2RQW A;  2EYY A;  4KRC B;  1MV0 B;  4M77 A;  2K5I A;  2ESW A;  2JMA A;  2X51 A;  2R7G A;  1QP3 A;  2L2P A;  1M3C A;  3VRY A;  3CCE T;  5GAN f;  1VUB A;  3CD6 Q;  2VV5 A;  5GAN 2;  1D1C A;  1XQH A;  1VIN A;  3EG1 A;  2QTX A;  1NYF A;  4J5Y A;  1Y96 B;  3OYA A;  2VKN A;  1K0X A;  1UGS B;  2KK4 A;  4CI0 C;  1IHV A;  2M0Y A;  1IGU A;  4FX3 B;  1CKB A;  4E2F B;  1RAF B;  2X3W D;  1YJ9 T;  3G33 B;  4M78 C;  3FB9 A;  3VS7 A;  1S1N A;  1ZHI A;  4MDW A;  2RQR A;  2XI9 A;  5ECA A;  2MPX C;  1VQ5 T;  4ME7 A;  4ZGD B;  2Z0W A;  2K7A A;  4M75 F;  2PMI B;  5CO7 A;  5C0M A;  1T0H A;  2EQJ A;  1WXT A;  3EG2 A;  3FEO A;  4CFN B;  2PU9 B;  4R56 A;  3L2R A;  4ANJ A;  2LJ3 A;  2WIH B;  3M5A A;  2V8I A;  1K9M U;  5GAO p;  4RG8 A;  1OGU B;  1OIU B;  1B34 B;  2COZ A;  2P4R A;  3HFO A;  4C92 D;  2P84 A;  1UG1 A;  1AZE A;  4J9I A;  2PNI A;  4JRQ A;  1FWZ A;  3MIA B;  1JO8 A;  5A0G A;  1MHN A;  4PJO D;  4JUV A;  1KSW A;  1E9H B;  1JB0 E;  4OMQ A;  3CCU T;  1YHQ T;  1NJI C;  1NYG A;  1OYX A;  3X25 B;  1N5Z A;  1YI2 T;  4HKE A;  3I55 Q;  4AFS C;  4KT0 E;  2DIL A;  1NG2 A;  5CR2 A;  2EFI A;  3SEM A;  2KBT A;  4BDZ A;  1J3T A;  1WJS A;  2LDM A;  3CXC S;  4JJN K;  1RLQ C;  2CP7 A;  1YIT T;  4HT9 A;  4F7S B;  5KYY A;  1UJY A;  1BB9 A;  1B7T A;  4ELJ A;  2K2V A;  4OP0 A;  4C0G A;  4D8K A;  4P5N A;  5KYX B;  2F2V A;  3HKS A;  4O6J A;  1OKW B;  4XK8 E;  3CCS T;  1D3B A;  1Y57 A;  2AZS A;  4M77 C;  2WJ9 A;  3QPH A;  4YC3 B;  4M75 A;  1YIJ T;  1I0C A;  3M4G A;  1UHF A;  3RER A;  1MMA A;  2LRQ A;  3L2Z A;  4C92 G;  2A36 A;  4J6X A;  1FKM A;  4MZM A;  5DQV A;  4PJO G;  2D0N A;  4C8Q C;  3G7Z A;  1OV3 A;  4N0A A;  4A4G A;  1R8O B;  1X75 C;  4BE0 A;  4FIB A;  3CC7 Q;  2JM8 A;  2RB6 A;  4BCG B;  1M1K C;  3QII A;  3MHX A;  2OTJ T;  1MND A;  5C6S A;  3E9G A;  2H8H A;  3MP8 A;  5HBH B;  2K57 A;  4J6Y A;  3QHS A;  4YOO A;  4JJB A;  2DER A;  2DME A;  2VWF A;  5LL6 S;  3CMA A;  3G1J A;  5L2W B;  1PWT A;  4E7Z A;  2BE7 D;  2IVX A;  2OX7 A;  1QKW A;  2CZ7 B;  4QT7 A;  4XQ3 A;  1VQM Q;  2KAF A;  3O5Z A;  1VQ4 Q;  2J05 A;  4KRD B;  1WLP B;  3OYN A;  5D6W A;  1SHF A;  2FZG B;  1X2Q A;  2KXD A;  1GRI A;  2OAW A;  1M90 U;  3G6E Q;  4B6M A;  1ZBX A;  4BE2 A;  5FWB A;  4M7D B;  3VS6 A;  2KXC A;  4BD3 A;  2RJD A;  5A0L A;  1MUZ A;  2MWO A;  3IQL A;  5CCA A;  1X69 A;  4HVV A;  1OOT A;  5IHI A;  5LJ5 e;  1RAC B;  1VOM A;  4X9C A;  2WMA B;  3H0H A;  2C6T B;  1C9B A;  3CC2 A;  3DB4 A;  4ZTF A;  4FYW B;  1S72 Q;  4M75 C;  1XTD A;  3G71 A;  1Y71 A;  3WVE B;  3NTK A;  3DDQ B;  1K1Z A;  3BLH B;  2D1X A;  2HAX A;  4PL6 A;  3JB9 D;  1ZSZ B;  3CCJ T;  4R55 A;  4E7S A;  2NWM A;  2BS4 A;  1WHM A;  3GPL A;  1BI2 A;  4LDX A;  2JN0 A;  5CKB A;  4N0A C;  4BCN B;  3OS2 A;  3QWX X;  3KBG A;  4CC7 A;  2KRS A;  4DEY A;  2EYW A;  3QUI A;  1QMC A;  4BCI B;  1N27 A;  1VYU A;  3CPW P;  2VGM A;  3L1A A;  1VIE A;  2J6O A;  1VQ9 Q;  3JCM e;  4BCM B;  4DEX A;  2KSS A;  3L2Q A;  3J7A F;  1H8K A;  4RMO A;  3HHT B;  4CFV B;  4HXJ A;  4DQ2 A;  1K9M C;  2JTM A;  4ELY C;  3THK A;  1OZ3 A;  1T0J A;  2CSQ A;  3SB2 A;  2RHZ A;  3H0I A;  2AKK A;  1KQS A;  2DKG A;  4OMN A;  4PFZ A;  2FHD A;  1EIF A;  3S3O A;  3OBY A;  1WA7 A;  2E6N A;  1RL2 A;  3JCM P;  1H25 B;  4JLG A;  1G3N C;  2RJE A;  2L0A A;  3O8V A;  3OYF A;  3OW2 A;  1VQO Q;  1VQ8 A;  2O4X B;  2WSC E;  4LUE A;  3X28 B;  3RIR A;  2FYK A;  4XAX B;  1JJ2 A;  1TD6 A;  3BW1 A;  4XTZ A;  3PTA A;  3CCM Q;  2J6K A;  1B3Q A;  4Q5W A;  3CME Q;  1QVG A;  3VS3 A;  1OZ2 A;  4HCC A;  2KNB B;  4F7U G;  5FW9 A;  1KHI A;  3QWY A;  3R6N A;  3SWN A;  3REB B;  5FRO A;  3L2U A;  3NFC A;  2EJG A;  4QW2 A;  2DAQ A;  2B9R A;  1JRI A;  3SD4 A;  1ENW A;  1AEY A;  4BY6 B;  4MZP A;  3J80 E;  2LQK A;  3PT9 A;  3EG9 A;  4ZGJ B;  3H6Z A;  2LNH B;  4OB2 B;  1H92 A;  3VS5 A;  1VQN A;  3TEE A;  3OBW A;  1XO2 A;  1KC8 R;  4QSH A;  1JOW A;  1RAE B;  2XDB A;  2Y4X A;  2G9X B;  4EDU A;  2QDY B;  3OMG A;  3QG1 A;  4M78 E;  1NPR A;  1Y0M A;  3C0C A;  3EH2 A;  2GF7 A;  2CZ1 B;  3OYG A;  3QHW B;  5GJV B;  5KYW A;  1RUW A;  1KK7 A;  5EFQ B;  1AZG B;  1BIB A;  3GTM S;  3DDP B;  4J9F A;  4JRI A;  1SRL A;  2UZE B;  1N9S A;  1PSF A;  2UUE B;  3EGD B;  2HMA A;  2KR3 A;  4PNO A;  2QDJ A;  3O0G D;  2RI3 A;  4CRI A;  3CCE A;  3OYJ A;  5EC7 A;  1YJN Q;  4ESR A;  4LE9 A;  4ELL A;  5LJ3 j;  1KQ2 A;  3HP9 A;  3DLM A;  1RAH B;  2CP3 A;  3PMI A;  2QEX T;  4OGC A;  5CKH A;  2K79 A;  1VQK T;  3TW6 A;  2RD1 A;  5CVI A;  4IUQ A;  1FMK A;  3OYE A;  1KQS S;  3OW2 P;  1X2K A;  1RLP C;  5LJ5 h;  5GAN 4;  2YRD A;  2I40 B;  2CCH B;  1JJ2 P;  1RI9 A;  1VQ5 A;  2VXF A;  1MMD A;  1WXB A;  1QVG P;  3QWL A;  3QYH B;  4M7D D;  2O2O A;  3C12 A;  3JB9 H;  3ZFJ A;  4LD6 A;  1X6O A;  2DF6 A;  2EKO A;  1JJ2 S;  4IUV A;  1VQ7 Q;  3MJX A;  1QVG S;  4YOZ A;  1D1B A;  2FZK B;  2M16 A;  1JXM A;  2RJF A;  3FLG A;  5AYF A;  1FVV B;  4RCB A;  1K0S A;  2W99 A;  1VQL Q;  1GL5 A;  4M78 F;  2IG0 A;  3BY7 A;  2X4X A;  2OI3 A;  1ZA2 B;  5FLX E;  2DXC B;  3SWN C;  3BLR B;  3MEA A;  8ATC B;  2BKZ B;  2FPF A;  1N9R A;  5D7U A;  3MCA B;  1Y96 A;  3CCU A;  3FJ5 A;  2QF7 A;  3JCM h;  1YHQ A;  1KXU A;  1W70 A;  5CIU A;  4GBQ A;  2C4G B;  1XJW B;  2E70 A;  2RMO A;  5GMK m;  5FU7 B;  1YI2 A;  1PC0 A; 
#chains in the Genus database with same CATH homology
 2DVE A;  4B9W A;  5GAO q;  4M77 A;  2K5I A;  5GAO l;  4AKI A;  1G5V A;  3A5Z B;  4M75 B;  2A7Y A;  4JX6 A;  3QDR B;  1QP3 A;  5FU6 C;  2EJ9 A;  3CCR T;  3CCE T;  4C8Q E;  1WJQ A;  4NL3 A;  4FM4 B;  2L3R A;  2DXT A;  4PLL A;  5GAN f;  3LWI A;  2R5A A;  2XKO C;  3DLL A;  1VUB A;  2RHY A;  4LDV A;  3QYE A;  2VV5 A;  5GAN 2;  3CD6 A;  1XOV A;  1Q7Y C;  1TH7 A;  1I4K 1;  2RJC A;  1YIT A;  1XQH A;  2QTX A;  2EWN A;  3OYM A;  3OYD A;  4J5Y A;  4M7D G;  1Y96 B;  2BUD A;  3OYA A;  1UGS B;  3OSV A;  3VKI A;  4BDY A;  4ZN1 A;  1Y07 A;  2EIF A;  2KK4 A;  2P0K A;  5LJ3 f;  4CI0 C;  2WSE E;  2RHX A;  4IUP A;  4E47 A;  1BI0 A;  3GLX A;  3M9Q A;  5DY9 A;  5GAM f;  4QVC A;  2DD5 A;  2E10 A;  3JCM g;  1YJ9 T;  4M78 C;  3FB9 A;  2RHI A;  4OVA A;  1ZHI A;  5J3B A;  4A4E A;  4MDW A;  4EMK A;  5CKD A;  3CPW A;  3CCS A;  3M53 A;  3I55 T;  1VQP T;  2DJZ A;  2XI9 A;  4J83 A;  3NTH A;  4XU2 A;  3RKX A;  2K5F A;  3PNW C;  1YIJ A;  4JRK A;  4ELZ C;  3L2V A;  3TCJ A;  2P0Q A;  1VQ5 T;  4ME7 A;  2PQW A;  3FDR A;  2QA4 A;  3MET A;  4ZGD B;  4BE1 A;  2PVO B;  4M75 F;  3BG5 A;  2A3L A;  5CO7 A;  1VQ4 A;  2HBP A;  5C0M A;  2R57 A;  3VKG A;  2EQJ A;  2K5L A;  3UDC A;  4XTX A;  5M9O A;  1W4S A;  2GQV A;  3FEO A;  4C8Q B;  1VQ7 T;  4AKH A;  5LJ3 h;  2PU9 B;  4R56 A;  4M78 A;  2CGH A;  4EMK B;  5CK9 A;  5CAI A;  5GMK h;  1QVF S;  3L2R A;  1UGQ B;  2YHT A;  3HL8 A;  5LJ5 f;  4M78 G;  4HNT A;  3T9N A;  4OB1 B;  4L5G A;  4XU3 A;  3M5A A;  2V8I A;  4RCC A;  3X20 B;  5I2S A;  5KE2 A;  1K9M U;  5HK3 A;  3V7S A;  5GAO p;  2D0Q B;  2RHU A;  4RG8 A;  3CCV T;  3H4C A;  5I2M A;  3TW7 A;  1B34 B;  4IUU A;  3QXE B;  5GAO r;  3HFO A;  4HNU A;  3VU3 C;  3GIB A;  4C92 D;  4M7A E;  4NOY A;  2OTJ A;  2DZ9 A;  4NS5 A;  2X4Y A;  3CCL T;  4JRQ A;  3Q1J A;  5GMK j;  2JOY A;  5LJ5 d;  1FWZ A;  3M55 A;  5A0G A;  1MHN A;  2O01 E;  5EG2 A;  4JUV A;  4PJO D;  2PUK B;  5KCO A;  2E65 A;  1Q86 U;  1JB0 E;  3G4S T;  3CCU T;  2ZGW A;  5J39 A;  2DO3 A;  1YHQ T;  1NJI C;  1I8F A;  3JB9 F;  4ATO A;  3VKH A;  3X25 B;  1OYX A;  3CBM A;  3QO3 A;  4QQD A;  5KCH A;  3OY9 A;  5LJ3 g;  3UPU A;  5DLQ E;  2EQM A;  1YI2 T;  2VXE A;  4DOV A;  4HKE A;  4M77 D;  1QVF A;  4Z02 A;  5FU7 C;  4C8Q F;  3QKJ A;  4KT0 E;  1KC8 C;  4BUG A;  1U1S A;  4VUB A;  2EFI A;  3EFS A;  5CR2 A;  4BDZ A;  2EJF A;  1S72 A;  2CYZ B;  1WQW A;  1WJS A;  3OSS C;  1E7P A;  2LDM A;  1K73 U;  2H3J A;  3CXC S;  1VIF A;  2XID A;  4QVZ A;  3LX7 A;  3CD6 T;  2DXC A;  1M1G A;  3ZEH A;  4MFD A;  4C92 C;  4JJN K;  4PLI A;  1YIT T;  4HT9 A;  4B9X A;  3JB9 J;  2E64 A;  2MI6 A;  1NZ9 A;  3SFM A;  4IUT A;  1N6A A;  3C4S A;  1FX7 A;  4ELJ A;  4PJO C;  1VQ6 A;  2ZPG B;  1UGR B;  2K2V A;  4OP0 A;  4C0G A;  2LCL A;  3QZ5 B;  4KUI A;  4P5N A;  4BY6 C;  5I21 A;  3S6W A;  5DM7 R;  3OA6 A;  4M7A B;  3VV0 A;  3HKS A;  5IT9 E;  3JCM X;  2AHJ B;  4PKC C;  1BYM A;  4E7K A;  4O6J A;  4XK8 E;  4X9D A;  3CCS T;  1D3B A;  3CCQ A;  4M77 C;  4OF1 A;  4C0Z A;  2WJ9 A;  4LDU A;  4JX4 A;  3QPH A;  3F70 A;  4O5V A;  4QQ6 A;  5GAN 5;  2HD0 A;  4M75 A;  1YIJ T;  4HCZ A;  3M4G A;  3JCM d;  2Y90 A;  3OYB A;  3QSU A;  3HRU A;  3RER A;  2RO0 A;  3CXC A;  1VQ9 A;  3A8O B;  2F5T X;  2K3X A;  2LRQ A;  3L2Z A;  4C92 G;  5GAN 8;  1VQ4 T;  2XDP A;  4J6X A;  3VYG B;  2VYT A;  1K8A C;  3TU4 K;  1FKM A;  3KHI A;  2LNV A;  4JLI A;  4MZM A;  4TVR A;  3LH0 A;  4PJO G;  2JTF A;  1Q81 U;  4C8Q C;  4M78 D;  3G7Z A;  3CPW S;  3CEY A;  3GNG A;  4XU1 A;  4EMG A;  4N0A A;  2XIC A;  2WAC A;  4A4G A;  5KH6 A;  3OYK A;  1R8O B;  4EMK C;  1X75 C;  2ZPB B;  3A8G B;  4M77 G;  4WF2 A;  3CC7 A;  2KY9 A;  4J6W A;  4FIB A;  4BE0 A;  1LOJ A;  2VGN A;  4F7U E;  2DTH A;  2RB6 A;  4M7A F;  2KR6 A;  2DIQ A;  1VQO A;  4RG2 A;  1M1K C;  2L89 A;  3QII A;  3MHX A;  5GMK i;  5GAO n;  3OYC A;  1DJ7 B;  1Y7X A;  2OTJ T;  3V8K A;  3CCJ A;  1H3Z A;  3S3N A;  5C6S A;  4LDW A;  2VC8 A;  3QJ6 A;  3H8Z A;  3JB9 G;  2RI2 A;  3CCM A;  4M7D E;  2HNI A;  1G3T A;  3E9G A;  3MP8 A;  3HO8 A;  2K57 A;  3LW5 E;  4C8Q A;  4J6Y A;  4IUR A;  3QHS A;  1K73 C;  2FB7 A;  5GAN d;  1G3Y A;  2WSF E;  3C95 A;  4C8Q G;  3GF5 A;  1Q81 C;  4MDX A;  5LL6 S;  5HKC A;  3CMA A;  1M5Q 1;  5GAN e;  2RA2 A;  2G3R A;  4LD9 K;  3M54 A;  3MEW A;  2XG8 D;  1BI1 A;  1LJO A;  2R5M A;  3TRE A;  4Y91 A;  4XTY A;  1S72 T;  1O9S A;  5LJ3 d;  2CZ7 B;  4XQ3 A;  1B34 A;  2C06 A;  4BI8 B;  5GAM d;  3FC3 A;  1VQM A;  2OAU A;  5LJ3 e;  2GFA A;  3HRT A;  2KAF A;  4A4H A;  4C0D B;  3QZ9 B;  5GAM e;  1FXX A;  2LX9 A;  3WVD B;  4F7U B;  2G77 A;  5D6W A;  5IAY A;  3OYN A;  1W2B A;  3CBP A;  1VQ6 T;  4HNV A;  3QYB A;  2DZC A;  4N4G A;  3HFN A;  3JCM Q;  3LGL A;  4E7L A;  1M8V A;  3G6E A;  1M90 U;  2D9T A;  1ZBX A;  3CCQ T;  4BE2 A;  2QXF A;  4M7D B;  3HPW A;  4QQG A;  3UWN A;  2EQK A;  2X4W A;  4M75 D;  3PIO A;  3ASK A;  4FT2 A;  1Q82 C;  3X24 B;  4BD3 A;  3KUF A;  5J26 A;  3PIP A;  2F5K A;  3ER0 A;  4A4K A;  2RJD A;  5A0L A;  3VJP A;  2XHC A;  3RMQ A;  1VQ9 T;  5FRM A;  2E6Z A;  2KMG A;  2MWO A;  3OS5 A;  3VUB A;  5CCA A;  4II1 A;  4A54 A;  2JVV A;  2ZPI B;  3A8H B;  5FU6 B;  5LJ5 e;  4X9C A;  3WXM B;  3E1S A;  3LGF A;  3JB9 I;  4M7A A;  4AKG A;  2K3Y A;  4BB7 A;  1YJN A;  4XTU A;  2KQW A;  3PMT A;  1RI0 A;  4F7U F;  4OB0 B;  1V29 B;  3CC2 A;  3DB4 A;  1QW1 A;  2GFU A;  4ZTF A;  2LCC A;  3FRN A;  3CC7 T;  1GXI E;  4XU0 A;  4M75 C;  2PUO B;  1XTD A;  3G71 A;  1VQO T;  3J81 E;  2KVQ G;  1Y71 A;  3WVE B;  3NTK A;  3V8L A;  1WGS A;  4MFE A;  4PL6 A;  1I81 A;  2HQX A;  3CBO A;  4RKU E;  4R55 A;  3CCJ T;  3JB9 D;  1Q7Y U;  2BS4 A;  4M7D F;  1OI1 A;  1I5L A;  4C0F A;  5KE3 A;  3CCM T;  2ZPE B;  3C94 A;  3GPL A;  3P8D A;  3GP8 A;  2YLB A;  1BI2 A;  3VYG A;  4MML A;  2PVD B;  2MMP A;  3MO8 A;  4C8Q D;  2QQ8 A;  1QLB A;  2JN0 A;  4LDX A;  5CKB A;  4MZT A;  2RK1 A;  3SDZ A;  5GAN 7;  1WPY A;  4N0A C;  3OS2 A;  3HZJ A;  3CMA T;  4HL4 A;  3KBG A;  1YJ9 A;  2LTO A;  4JRP A;  1G3W A;  4BI3 A;  3OW2 S;  3V8J A;  2XDD A;  3OMC A;  3QUI A;  4C5H A;  4X34 A;  5GAN 6;  4V2S A;  1N27 A;  2MWP A;  4M75 G;  1UEB A;  5DLO A;  4HLQ A;  2VGM A;  1VIE A;  3L1A A;  1VQM T;  3JCM e;  5GMK l;  3OYH A;  2ZPH B;  2KSS A;  2V8J A;  3E19 A;  3AHU A;  5EJC A;  4C92 E;  5CQY A;  1VQN T;  3L2Q A;  3J7A F;  4RMO A;  1M90 C;  2X4J A;  2XD0 A;  3OYY A;  4C0D C;  3HHT B;  4DQ2 A;  2F69 A;  1K9M C;  2JTM A;  4ELY C;  1OZ3 A;  4PJO E;  2L5Q A;  3SB2 A;  1X01 A;  2RHZ A;  1KQS A;  1VQL A;  2DKG A;  2FHD A;  1EIF A;  3EAE A;  3VUZ A;  3S3O A;  3G6E T;  1N8R U;  3OBY A;  4NL2 A;  4C5G A;  4AI6 A;  3MEV A;  2E6N A;  1O75 A;  3P8B B;  3M57 A;  1RL2 A;  3JCM b;  3VYH B;  3JCM P;  4M77 E;  2DD4 A;  2M0O A;  3CC4 A;  3UT1 A;  4JLG A;  3OYF A;  2RJE A;  3O8V A;  3OW2 A;  4M6V A;  2QEX A;  1Q86 C;  1VQ8 A;  4ZGE B;  2O4X B;  3DKM A;  2EYQ A;  2WSC E;  1AHJ B;  3RIR A;  3X28 B;  3L42 A;  1M9S A;  2FYK A;  4XAX B;  3HB9 A;  2QQA A;  1VQK A;  1W2B S;  2LC4 A;  1SSF A;  1JJ2 A;  3X26 B;  2LT1 A;  4OMF B;  2M9U A;  2FL7 A;  3BW1 A;  1YBY A;  4XTZ A;  3M59 A;  3RMS A;  3PTA A;  3JCM W;  2QQS A;  3CME A;  4LDY A;  4Q5W A;  1QVG A;  4N4I A;  1YCY A;  4F7U A;  1OZ2 A;  3L2W A;  2DTO A;  4HCC A;  5D6X A;  2M1H A;  2HAX A;  1ZQ1 A;  3M4Y A;  4F7U G;  4XTW A;  1NJI U;  1MGQ A;  4M7A D;  1WNL A;  1KHI A;  1YJN T;  2ZZD B;  3SWN A;  4C92 B;  5FRO A;  2OTL A;  4N4H A;  3OYL A;  2DD4 B;  3L2U A;  2Y4Y A;  2K4Y A;  2EJG A;  3NFC A;  5GAO m;  2CZ6 B;  1M4Z A;  2EAY A;  5L8R E;  3CC2 T;  4QW2 A;  2DAQ A;  3CPF A;  4KBM B;  3ZBD A;  4MIM A;  3MEU A;  4KUL A;  3DB3 A;  4M7D A;  2DTI A;  1HK9 A;  1JRI A;  3I56 A;  1KC8 U;  4PJO B;  1NPP A;  4YTL A;  3SD4 A;  3G71 T;  4EMH A;  2FVU A;  4IKF A;  4BY6 B;  4Y28 E;  2E5Q A;  4MZP A;  3J80 E;  2LQK A;  1KHC A;  3LYI A;  1XNI A;  3PT9 A;  4ZGJ B;  3H6Z A;  3RKW A;  4OB2 B;  1YJW A;  1JBM A;  3HRS A;  1VQN A;  3TEE A;  5GMK e;  2DIG A;  3JCM V;  3OBW A;  4M77 B;  4E7H A;  5CKE A;  1KQ1 A;  1NE8 A;  4QSH A;  3V7R A;  1KD1 U;  1PSE A;  3ME9 A;  2KDS A;  2XDB A;  5HY6 A;  2BIV A;  2Y4X A;  2DPP B;  2JUF A;  3MP1 A;  4J7F A;  3SWN B;  5CQX A;  2IVW A;  5GAN 3;  4EDU A;  4M7A C;  2QDY B;  3OMG A;  3URG A;  4EPC A;  4HCB A;  2V8K A;  3QG1 A;  4M78 E;  1NPR A;  1IZ6 A;  2QQ9 A;  2R58 A;  3HSB A;  1BI3 A;  5GAN h;  2GF7 A;  2CZ1 B;  1KG1 A;  3OYG A;  4L59 A;  4FSX A;  2QFZ A;  2MF2 A;  2P0P A;  1M1F A;  3BDU A;  2ZPF B;  3KXT A;  4MMK A;  2HQE A;  4GY5 A;  1UB4 A;  1BIB A;  4ZN3 A;  4BAC A;  3PGG A;  2EQU A;  2JZ2 A;  2DK3 A;  2MAM A;  3QJY A;  4GLK A;  4C92 F;  4JRI A;  2DD5 B;  4C5E A;  1N9S A;  1G3S A;  2X35 A;  4QVD A;  3CCU A;  1PSF A;  5GAM h;  3MP6 A;  3QBY A;  1N8R C;  4PJO F;  5GAN j;  4PNO A;  1K8A U;  2NLU A;  4LOC A;  4J7I A;  2QDJ A;  1H64 1;  2RI3 A;  3BFM A;  3INZ A;  4CRI A;  3CCE A;  3CCR A;  3OYJ A;  1VQL T;  3RUX A;  4FT4 A;  3R6O A;  2JNG A;  4M7A G;  2BKD N;  4M77 F;  1U8R A;  2ZCF B;  2BS3 A;  2P4T A;  5LJ3 j;  2PVG B;  3N5B B;  4E7J A;  3BG3 A;  3OQ5 A;  3CC4 T;  4D6W A;  5GAN g;  1KQ2 A;  2RM4 A;  5GAM j;  3HP9 A;  3DLM A;  3PMI A;  2QEX T;  1VQ8 T;  4OGC A;  2KMT A;  3S3M A;  4HT8 A;  2DXU A;  2L8D A;  2I2L A;  5CKH A;  4C5I A;  4J8O A;  4DOW A;  3QYG B;  1VQK T;  4M78 B;  1M1K U;  3TW6 A;  2RD1 A;  5CVI A;  4IUQ A;  1QP2 A;  3RKY A;  4BBS M;  3OYE A;  1KQS S;  2QQB A;  3CME T;  3OB9 A;  4NC6 A;  5A2Q E;  3HBL A;  4OGE A;  5LJ5 h;  2RI5 A;  2YLC A;  5GAM g;  3I55 A;  1VQP A;  4KUD K;  2RK2 A;  5GAN 4;  3A8L B;  4BBR M;  1UGP B;  2DEQ A;  3LWH A;  2DXB A;  2XK0 A;  3NTI A;  2B8A A;  3V7C A;  1VQ5 A;  2OTL T;  2VXF A;  2BS2 A;  1BKB A;  3BDL A;  2LVM A;  2CZ0 B;  1HXD A;  3JSC A;  3QWL A;  3QYH B;  1BIA A;  4A4F A;  4M7D D;  4L6V 5;  3C12 A;  3JB9 H;  4XTV A;  3JRZ A;  4LD6 A;  1X6O A;  2VUB A;  3ZFJ A;  4BI4 A;  5HK0 A;  3I56 T;  3BG9 A;  2EKO A;  2GCX A;  4M75 E;  3JCM c;  1KD1 C;  3GNF B;  2RH2 A;  1QVP A;  1WQ7 A;  5LJ5 j;  1JJ2 S;  2O4X A;  3JCM f;  1VQ7 A;  4IUV A;  2E12 A;  4JS5 A;  3JAM E;  1QVG S;  1YJW T;  2RJF A;  2M16 A;  3LLR A;  5AYF A;  3FIF A;  3FLG A;  4HA8 A;  3OS0 A;  4RCB A;  5CKF A;  2QQR A;  3P8H A;  2D6F A;  4OB3 B;  2LQ8 A;  4JX5 A;  3M56 A;  4JDS A;  2DXB B;  2XU8 A;  2LT4 A;  4JS4 A;  4M78 F;  5IN1 A;  5LJ5 g;  2CKK A;  2IG0 A;  3EFR A;  3CCV A;  2QI2 A;  3BY7 A;  2X4X A;  1P92 A;  3E9F A;  1LNX A;  1WJR A;  2DXC B;  2CS7 A;  3SWN C;  5FLX E;  5A0D A;  4ZTJ A;  5FRN A;  2ZZD A;  3M58 A;  4C92 A;  3FJP A;  2QA4 T;  4FU6 A;  3DL1 A;  3MEA A;  3CCL A;  3RES A;  4M7D C;  4Z6Y A;  2YRV A;  1N9R A;  3OS1 A;  4UC4 A;  2E41 A;  1Q82 U;  4PJO A;  4FL6 A;  3MCA B;  3OYI A;  1Y96 A;  3G4S A;  1U1T A;  3A8M B;  1IRE B;  2QF7 A;  2E1H A;  3JCM h;  4A53 A;  3GOX A;  4DA4 A;  1YHQ A;  5CIU A;  3JCM J;  2E70 A;  5GMK m;  5FU7 B;  4E7I A;  1YI2 A;  3PFS A;  1D3B B;  5D6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...