3X28B

Crystal structure of nitrile hydratase mutant br56k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Reaction intermediate of nitrile hydratase determined by time-resolved crystallography reveals the cysteine-sulfenic acid ligand to be a catalytic nucleophile
rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x28B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x28B02
4KT0E 2ZPGB 3QYGB 3A8HB 2PUOB 3WVEB 1UGSB 2ZPEB 3A8MB 2PU9B 2DD4A 3VYHB 3LW5E 1PSFA 1DJ7B 4L6V5 2DD5A 2ZPIB 1PSEA 2DXBB 2O01E 3A8LB 2PVGB 2CZ7B 2D0QB 2CZ6B 1UGRB 3WVDB 4XK8E 1UGQB 2ZZDB 1GXIE 4OB3B 3X25B 3QZ9B 2DPPB 3A8GB 2WSFE 4FM4B 2DD5B 2CZ1B 2DXCA 4RKUE 1QP3A 5L8RE 3X24B 1JB0E 4OB1B 2ZPHB 2AHJB 2WSCE 3X28B 4ZGJB 4OB2B 2WSEE 3QXEB 2CZ0B 1AHJB 2DXCB 3X20B 3X26B 2DD4B 4ZGDB 3QZ5B 2ZPFB 4Y28E 2PVDB 2CYZB 3VYGA 3QYHB 1V29B 4ZGEB 2QDYB 2DXBA 1UGPB 4OB0B 2PUKB 3HHTB 1QP2A 2ZZDA 2PVOB 1IREB 3A8OB 3VYGB 2ZCFB 2ZPBB
chains in the Genus database with same CATH superfamily
4DBFA 3KUFA 1RLPC 4HL4A 3GNFB 3CQTA 1H25B 1G3NC 2DVEA 5I2SA 2CP0A 2W96A 2AZSA 2ROTA 3RMSA 3CPWA 5GANe 4ZTFA 4EONB 4HXJA 3HRUA 1WQ7A 2BIVA 3PFSA 4EOKB 3HBLA 1UJ0A 4EOOB 2VKNA 2W9FA 4DQ2A 4ZTJA 2WIPB 1DJ7B 2MPXC 3HL8A 1M90U 4AMCA 2XKOC 5GAOp 2ZPIB 1PSEA 1PCXA 2JMAA 3CCJQ 3SWNA 1A0NB 2MF2A 4J9CA 4JX6A 3S3MA 4J6YA 2D0QB 3CCEQ 3WVDB 5GMKi 2AKLA 4J9DA 2H3JA 2DLPA 1Q95G 1V76A 4BI3A 5IDPB 3OS0A 1K9MC 3JB9F 1H92A 4DBHA 3J81E 1TH7A 3ZBDA 1GCPA 3LWIA 3OW2S 1EIFA 2E6ZA 4BCNB 4AKIA 2EYXA 2BZYA 1AWWA 1YHQT 4EIKA 1BKBA 1D0ZA 5CVIA 3LH5A 5GAOl 1WX6A 4PLIA 2F2XA 4OR5B 2F2CA 3C0CA 2WSEE 2LRQA 2D8HA 4F6WB 4CC2A 1YNZA 4BACA 1MMNA 2ZPFB 2ECZA 4QVCA 4BCGB 4F70B 2L89A 4RTWA 1VQLA 3SWNB 3QUIA 3GPLA 3OMCA 4NC6A 1FX7A 4IIOA 4PKCC 1BBZA 2DO3A 2EYZA 1MGQA 1NYFA 1WFWA 2EYQA 4ME7A 2JT4A 3ZL7C 4EMGA 3S3OA 1O9KA 4EMKC 4C92B 5LJ5j 2C06A 1B07A 4JX4A 5LJ3e 2M02A 4C8QF 2V8JA 4LDYA 4RCCA 3NDQA 5EJCA 2O9VA 2X3XD 2GGRA 1S72Q 2YUQA 2XDPA 3JB9J 4ZNXA 3M55A 4M6VA 5IH2A 3MY1B 4FX3B 1ENWA 5AT1B 1K8AU 4QW2A 3JB9D 3O8VA 4M78E 2FZGB 2O4XA 1GCQC 4KBMB 4E47A 2DD4A 4RTZA 2EYWA 3CMAT 3JRZA 5HNBB 1MHNA 2X1NB 2JJ9A 2SRCA 5CAIA 5CKDA 1X6GA 2KROA 5GMKh 4PJOA 2A3LA 1O9KB 1NZ9A 3OYAA 2PVGB 3C4SA 1UNLD 2RHIA 8AT1B 4FIBA 4RMOA 1M1FA 2IVWA 4FYYB 1MMAA 4M77C 1M8VA 4A4GA 2QK0A 3CC2A 5L2WB 3OS2A 2EQUA 3JB9H 2NUZA 1X75C 2HEQA 3SHWA 1VQ7Q 3I56A 1D3UB 3QSUA 5LJ5f 5KYYA 2YUPA 5LMKB 1BI1A 3REAB 4F6SB 1M3CA 4N0AA 1K73R 2WSCE 1NE8A 4DBQA 1WJRA 1YI2Q 2EGCA 1WPYA 1XQHA 2EKHA 5HKCA 1MV3A 2X4WA 2QTVA 3QKJA 3PGGA 1OU9A 2DD4B 4C8QD 2LDMA 3M54A 2RD1A 1YJNQ 4ELYC 1C1AA 1U06A 2QEXQ 3F70A 2PVDB 2X4XA 4PJOB 1WDXA 2QGFB 2KGTA 1IO6A 1SHFA 1AISB 5LJ3d 4D8DA 1GH6B 1SSHA 1K9MU 3OMGA 2RM4A 2MAMA 2PUKB 1VQ8Q 4QVZA 4M77E 2EQIA 1RABB 4EORB 3OYEA 2PVOB 5KYYB 1URCB 1WI7A 3EHQA 3QYBA 2HD0A 4KH1B 1Q7YC 2IW9B 3OYDA 4A53A 4DEXA 1BU1A 2D6FA 2BZXA 3O5ZA 2PNIA 4MDXA 4C92G 1VQ4A 2BS3A 4AG1C 2HBWA 5FU7B 5CK9A 2LTOA 4XQ3A 1VYWB 2E12A 2ZAEA 3GLXA 2FPDA 3EH1A 2K79A 2KAFA 2EW3A 4L6V5 1ABQA 1KFZA 1SSFA 1QKWA 4Y92A 4BCQB 1BCMA 3OYNA 1M5Q1 4O5VA 3PMIA 3V7SA 2GFUA 1WHKA 4BXXX 4GY5A 3OYMA 1VQ5A 2DAQA 3EGXB 2H3EB 1JBMA 4F14A 4FM4B 1H24B 2DVJA 1PKDB 3BY7A 3U23A 4LDWA 4FYXB 1D0YA 2F1LA 4CFXB 5CYIB 4F6UB 2D0NA 4CFUB 4OP0A 4M7DC 2X3WD 3E1SA 2WXVB 1RLQC 3CC4Q 1VQKA 2RHZA 1AT1B 2QG9B 1OQKA 5FROA 3M5AA 3MEAA 4ZGDB 3CBOA 5I22A 3INZA 2RF0A 2A28A 2LMJA 1LVKA 2Y4YA 2LT1A 3QBYA 3M58A 1OIYB 4LNPA 2C6TB 1SRMA 2JM9A 1NPRA 2W2HA 3RKXA 1OL1B 5CIUA 3S6WA 3MI9B 4E2FB 2K5LA 4EPCA 5LJ5h 3FC3A 2KNBB 4BY6C 1WQWA 4PJOG 4KRCB 4Z89A 4YOZA 4X9CA 2BS4A 4TTHA 3OW2A 3DTOA 3ZFJA 3OQ5A 1EFNA 4J5YA 2Z0WA 2BTTA 4M7DE 3H8ZA 4OMQA 3RKWA 3QDRB 3GTMS 1TU0B 1G83A 2XD0A 2WIHB 1VQPA 1VQLT 1VYUA 5GANj 2RJEA 3CXCS 4MFEA 3VYHB 4HVWA 1PSFA 4AI6A 1OOTA 2BKZB 4C0FA 4BCPB 2KRMA 1VQ6A 2DX1A 3LGLA 1WGSA 3PMTA 4EMKA 1HYOA 4KRDB 3CMEA 4Z6YA 1I1JA 3CPWP 1FXXA 2CT3A 1Q82C 1Q7YU 2W9ZA 2LVMA 3G71Q 1YWPA 2R5MA 3M0TA 2HQEA 2QQ8A 2KDSA 4RKUE 1P92A 1C9BA 2A7YA 4AFQC 5CQYA 3M9QA 1QVGS 2YHTA 2FYKA 5HVYB 1TG0A 1YFNA 3G33B 2QGGA 5GAN5 3BHVB 3BFMA 4M78B 2RNAA 2K5IA 1XNIA 2CSQA 2RH2A 2K3XA 5GAMh 2WMAB 1TUCA 2G77A 3DKMA 5EG2A 1GCQA 3CBPA 5KE2A 3CCRQ 1XOVA 3L2RA 3FEOA 4KUDK 2HCKA 1I8FA 4AFSC 3OYYA 3BW1A 1VUBA 2FO0A 3RR6A 2B86A 2QDJA 2E70A 2NUPB 5GANf 3CC2T 1UE9A 1M1GA 1NJIR 4MMKA 2GFAA 2QA4T 4BCKB 3CCJA 4J7IA 3CCEA 3I56T 1M8MA 4M7AF 3HHTB 3RUXA 1H8KA 1QCNA 3VYGB 4AFUC 5LJ3j 4CFUD 2ENMA 2WJ9A 4N4GA 2E3HA 5EFQB 2DYIA 3H0IA 2OTLQ 1TD6A 2ROLA 1UGSB 3CCMT 2RA2A 2C5XB 1VQ5Q 5I11A 2PU9B 1U1SA 1WHMA 1IGUA 1Y07A 2E10A 3UA6A 1G3YA 2EGAA 4BCHB 3UA7A 4GLKA 1FINB 4PFZA 5GAMg 2M51A 1KXUA 1UNGD 2J6KA 4M77B 2NUTA 4KH0B 5IXBA 2P84A 1VQNT 2CP2A 4DA4A 3GP8A 2RI3A 4HCBA 2LNHB 3REBB 3PE0A 4RG2A 1ZA2B 4BI4A 2CGHA 3M57A 3P8DA 2KMTA 3EOCB 2G9XB 2W99A 4BY7X 4M4ZA 3C12A 5KYNA 5KYXA 1U3OA 2YSQA 3SEMA 1TUDA 2DF6A 2F5TX 4LD6A 1B3QA 2DRMA 1X27A 3C95A 1VQ4T 5IT9E 2LCSA 4M75E 1Y71A 2VC8A 1S72A 3HFOA 3I55A 4OMLA 1UDLA 5LJ3f 5GMKl 4QVDA 5I5ZB 1K0XA 4JRKA 1CKBA 4E7SA 2KMGA 1VQOT 4M7AD 2PZ1A 1K4US 1TTHB 1W2BS 3X20B 1O75A 2YRVA 1J3TA 1CSKA 3TSWA 3ME9A 1PHTA 5HBJB 3DLMA 5C6SA 4F16A 2OAWA 1YIJQ 4HCKA 2NUTB 4ORZA 3V8LA 3GIBA 4OGCA 4PFOA 4M78G 2I53A 3JCMe 4PJJA 3HTRA 1Q82U 1KK7A 2QDYB 3CD6A 1UGPB 1RAHB 1AZEA 3MO8A 1VQPQ 2L3PA 1Q82R 5KYXB 2ESWA 3CCQQ 1G3WA 4BDYA 3SDZA 3A1PA 2HMAA 3E19A 4ZN1A 4ROCA 4HLQA 1O9SA 1F5QB 2DTHA 1VQ7A 2ZCFB 1VQKT 1N8RR 1VQ6Q 4FCYA 1WHGA 5IHNA 4LDXA 2AZVA 4PJMA 3CMEQ 4YC3B 3OYKA 1OZ3A 1NEGA 2QASA 4FW2A 4AFZC 1YI2A 1KG1A 2C5NB 2UZLB 3L2ZA 4RTVA 4JZ3A 1D09B 5I21A 5IN1A 2GF7A 3QIIA 4HCCA 1U8RA 1YCYA 1AWJA 4MZPA 2CCHB 5FGKB 3NTKA 4BCMB 1HXDA 1G8XA 2CKKA 4XTVA 1BYMA 2EJGA 3LW5E 4PL6A 4J8OA 1QVFS 1Q86R 4DOVA 1YJNA 2EAYA 2QEXA 4C0GA 3KBGA 1KQ2A 2IW8B 3K7AM 3URGA 1K73C 3TCJA 5CEIB 4A63B 3JB9I 2CZ6B 5IDNB 2OTJT 4OB3B 2CP7A 1VIFA 1VQ8A 4RTTA 2LQ8A 4JS4A 3QWYA 2WSFE 1FYNA 2DBKA 3UPUA 2QQBA 3GNGA 4RTYA 4F7SB 4FYVB 3NTIA 4Y91A 4M7DB 2XMFA 1M1KR 4M77G 3JCMc 1KQ1A 1X2QA 1JB0E 1OPLA 2KYMA 1VINA 2Y4XA 3EAEA 3DLLA 3EGUA 2OX7A 3H0HA 4OB2B 3E9FA 5ECAA 4NL2A 2LJ1A 4R0KA 3QXEB 1ZSGA 1H27B 1W6XA 1GFCA 4BCJB 3JCMd 3TSZA 2HZYA 4C92A 4HT8A 2L0AA 2UUEB 4Y28E 1QLYA 2DL7A 2JUFA 5IXFA 2JW4A 4FSXA 3H41A 3CXCA 5A0LA 1WXBA 2RK1A 2RI5A 4OB0B 2EKOA 4BY6B 4BBRM 1G2BA 2P4RA 1H28B 1XJWB 3BG5A 1JKWA 3V8JA 4M78C 2DRKA 2F5KA 1OIUB 5CO7A 3VKGA 3L2QA 5LJ3h 2K6DA 1Y0MA 2RK2A 1GBQA 2RHXA 4XU0A 3JCMV 2VGNA 3OYBA 1Y96A 4QSHA 3HSBA 3C94A 4PFPA 1H1SB 2DIQA 1QVGA 3CC4A 4X1VA 1JJ2S 3NGPA 1UTIA 4RTXA 4JPBW 2DL4A 1WIEA 1RAEB 3DDQB 3CCJT 5CR2A 3OW2P 1N27A 5CQXA 5GANd 3VS5A 3LYIA 1FWZA 3I55Q 3CCET 4XTZA 2XDBA 2PMIB 3A8LB 4MZMA 4HNUA 1ZSZC 3PIPA 3FLGA 3OYGA 3A8GB 1TXQA 3QPHA 2B9RA 3MP8A 4LDUA 2X9HA 3CCVQ 2DZ9A 1FKMA 4IURA 1QP3A 4FYWB 2E3IA 1NM7A 1Y96B 4B9XA 2LJ0A 5CKEA 3CD6Q 5FRNA 3EFSA 3MEVA 2IW6B 2KT1A 1H1RB 1JU5C 1OZ2A 2K2VA 4BCFB 4M7DG 3I5SA 4XTWA 1X69A 1K73U 2FPFA 3L2UA 4JRQA 4NSTB 1UNHD 1BIAA 5AYFA 3UATA 2KSSA 3OY9A 2FRWA 1GRIA 3UT1A 1N6AA 4R56A 2IN3A 2XHCA 1YJWT 2CT4A 4C92F 3M0UA 3BE3A 1UG1A 1KC8R 4YOSA 2YRCA 4X9DA 4LD9K 1RAAB 1M4ZA 2IIMA 3FJ5A 3PO3S 2DXUA 1ZP2A 2LCCA 1X6BA 1S72T 1PC0A 2MWPA 1TS9A 2HL3A 1GBRA 3G71A 2HSPA 3T9NA 2M0YA 4ANJA 1UHCA 3HB9A 1BI3A 1MMGA 1NG2A 2LP5A 4A54A 1OGUB 3LWHA 1I5LA 4VUBA 3BLQB 3RBBB 4BCND 2X35A 1EX4A 5HCKA 4E7LA 2EPDA 1PWTA 4RUGA 3CCRA 1UB4A 1W2BA 2PK9B 3MP6A 3EGXA 1G3TA 4OVAA 1MUZA 1M2VA 4KULA 3TNHB 2VB6A 4II1A 5A0GA 5FW9A 2XG8D 1H3ZA 4XTYA 1ZLMA 3AHUA 1YJ9Q 4JUVA 3X25B 1SHGA 3R6NA 2LQKA 1VQ7T 2MCNA 3VS7A 2RHUA 1SEMA 2PTKA 2EIFA 2GQIA 4J9IA 5HBEB 4CFNB 1YI2T 5FWBA 2AHJB 3I5RA 4C92D 3EG2A 2QQ9A 1ZX6A 1NJIC 2GNCA 2COWA 3G4ST 2OTLA 4FW1A 3LLRA 4F7LB 2DXCB 1YJNT 4C5IA 2QEXT 2K9GA 4KUIA 1IRXA 4PJOF 4I3ZB 1M2VB 3VS0A 1UEBA 3BG9A 3TW6A 5D7UA 1GFDA 3CCLA 4PJLA 1OPKA 4WF2A 1PNJA 3NHNA 4GLMA 1VQ8T 4XAXB 1PKTA 2C0TA 2YUNA 3CCUQ 1T0HA 4BE1A 3VS6A 2OI3A 4PNOA 2M16A 1F1BB 4D8KA 2NYSA 3BDUA 1EZZB 1LNXA 2PQWA 3A8OB 2NWMA 5IAYA 3HKSA 1JRIA 2GQVA 5IF1B 2JMCA 3EG9A 4A4FA 5GMKm 1IHWA 3EIDB 3ASKA 4C8QC 1TOVA 2YWWA 4KGZB 2GBQA 3A8MB 4PLLA 4BBSM 3HFNA 1M9SA 3OA6A 4M75G 2EJ9A 4OMFB 2CDTA 1QKXA 4MDWA 1I81A 1KHIA 1ABOA 2XIDA 1SRLA 2QQAA 4JZ4A 1YIJA 3QWLA 3MCAB 1Z9ZA 1IGQA 4DBRA 3M56A 1KJWA 1N9RA 3P8HA 3OBWA 2EQKA 4AG2C 2MWOA 3G7ZA 2COZA 2EFIA 1TWBA 1SF9A 3IQLA 4CI0C 4M78A 4NS5A 2J06A 1Z9QA 1D1BA 2KXCA 2VXFA 3G6EQ 1R77A 2XU8A 2DYBA 4PJOD 2DD5B 4XU2A 3JCMf 3CCQA 2QQSA 3EG9B 2JNGA 2K4YA 2V1QA 3FDRA 4B6MA 4LUDA 3CC4T 3X28B 4CC3A 4C8QE 3HO8A 5FWCA 4E7IA 3TN8B 2NUPA 4BB7A 1AHJB 2RN8A 4E7ZA 4OF1A 2KK4A 1T3LA 4HCZA 3MKDA 3HZJA 4F7UG 3TW7A 2CUDA 4L5GA 4FT2A 1N8RC 2L5QA 3VYGA 5LJ5g 3OYIA 1N4MA 1YHQA 1PKSA 1B34A 2HQXA 3EG3A 5IHYA 1PD1A 1ZSZA 1YCSB 4ZGEB 1RI0A 3OSVA 4B9WA 1MNDA 2HAXA 1W1FA 1AD5A 3L42A 2IVXA 2LNVA 4BDZA 1YN8A 5FRMA 4C0DC 4BCQD 1AZGB 1JXOA 4Z8AA 5D6XA 4WTOB 1Q86C 1NJIU 1ZUYA 4JRPA 3CXCP 3GOXA 4UN0A 4C0ZA 1OULA 4BY1X 4LDVA 2OJ2A 4RCBA 4M77A 5J26A 3JAME 2DIGA 3A5ZB 5CKBA 4F04B 1TSFA 1UGVA 2DL8A 1GL5A 3M4YA 4L59A 2K3YA 1VQ9Q 2LX9A 2P0KA 5GAOr 2VASA 4BCIB 1UUEA 4QKUA 3UDCA 1M1KC 1T0JA 2YT6A 1B34B 5GAOm 4M75C 2VXEA 1ZSZB 5GAMe 4DEYA 5J39A 1D1CA 4XK8E 2C0IA 2LT4A 5C0MA 1QVGP 2O2OA 2DPPB 1BI0A 3G71T 4FU6A 1VQOQ 1SKUB 4BI8B 2QFZA 2E65A 1TUGB 4CFVB 4A4HA 3CCLQ 2RJFA 4O6JA 4OB1B 4ROEA 1WLPB 4M78F 3M53A 2F2VA 1N5ZA 1G3SA 2FL7A 3VS1A 1X6OA 1VOLA 2RQWA 3VKHA 3MHXA 2RJCA 1KQSS 3CCRT 4A4EA 4N4IA 1VQMQ 3UF4A 4JDSA 1PG5B 3M0SA 3VS4A 3DB3A 3M59A 4J9BA 3QZ5B 3CCSQ 2QXFA 5CKHA 3S3NA 3B57A 1QCOA 3PVQA 3META 3JSCA 1P5EB 2CYZB 4OMNA 4C5HA 1YITQ 4F17A 2JS0A 4IIMA 1I0CA 4NOYA 3J80E 1ZQ1A 2BPMB 1W4SA 2WPAB 3JCMh 2BE7D 2YLBA 3CC7Q 5IHKA 2COYA 2J05A 4EOJB 2B8AA 1BU2A 2RQTA 3TU4K 3MEUA 4MFDA 4JJNK 1V1CA 3PTAA 2DBMA 3V8KA 3CCVA 2V26A 2EJFA 2K5FA 2XICA 2RQUA 2RO0A 2Y90A 2FZKB 1HSQA 1QWEA 1E6GA 1H3HA 2FG0A 1X01A 3MPUB 2JM8A 3WVEB 1VQ5T 2R57A 1D1AA 1FMWA 4HVUA 2C0OA 2VGMA 2YXYA 4XU1A 5DM7R 1JQQA 3OYHA 5GAOn 1N8RU 2FEIA 4XTUA 2KYBA 4M77F 5DLQE 1R0BG 4LOCA 4M7DA 4M78D 2V1RA 4X34A 2K2MA 1E6HA 1S1NA 2XDDA 3OSSC 1PRLC 4F7UE 5D6WA 2JS2A 3QZ9B 2DJZA 2IG0A 1X2KA 3UWNA 1Q86U 2EVRA 3PVLA 1R0CB 2RB6A 5GANh 1IXDA 1W2BP 3KXTA 4V2SA 1HK9A 5GAN4 4E7JA 5FU6C 4C8QA 1YHQQ 1OV3A 5J3BA 2ED1A 2FZCB 1K0SA 1MMDA 1QMZB 3PNWC 4IUUA 4BD3A 2A37A 3CEYA 4IMYB 2HBPA 1IHVA 4F7JB 2GTOA 1U1TA 1KC8C 3X26B 2ATCB 2M1HA 2A08A 3P8BB 1WHLA 4FT4A 1M1KU 2DFUA 2O31A 4P5NA 2AK5A 2K57A 3VJPA 1JXMA 1UJYA 2P4TA 2J7IA 1VQPT 4XU3A 2K7AA 3BLRB 1ZA1B 5KYUA 2QQRA 5GAOq 2MIOA 3RESA 3DOGB 3CCQT 2HQHA 5DY9A 1YJ9A 1ACMB 1QCFA 5BNJB 3JCMb 2BUDA 2FHDA 1QLBA 2JXBA 1C6VX 1VQ6T 4C8QB 1U5SA 3JV3A 1NPPA 4M77D 2YRDA 3QYEA 4M7AC 3NTHA 1WHJA 3CMET 1M90R 1WZOA 2PHGA 1JO8A 3D7SB 3EG0A 9ATCB 1QVFP 2EQJA 5GANg 3V7CA 4ZN3A 4J9EA 1AVZC 5EC7A 1LJOA 2QGSA 1C0MA 1KIKA 3HRTA 3FRNA 3KHIA 2WACA 2RQVA 2BZ8A 4OMMA 4IUVA 2VUBA 4RTUA 4II5B 3R6OA 2EGEA 2E5QA 3TEEA 1QMCA 2DL5A 2YUOA 3MP1A 3CMAQ 5KYUB 5ICPB 1W98B 3BG3A 4RG8A 4JJDA 2GTJA 3SB2A 1UGQB 2JZ2A 2ZGWA 2CCIB 3EJ1B 3CCUA 2DM1A 2DXTA 4ELJA 1RACB 2RHYA 2QYZA 4GBQA 4M7DF 4JJCA 3AT1B 4EC8B 2LCLA 3EGDA 3FIFA 1Q81C 5L23A 2C4GB 2J6OA 2KT8A 2VV5A 3ER0A 4M7AE 4JX5A 1WYXA 1NLOC 2KI7A 5GAN6 2YLCA 4ZGJB 2O9SA 3DL1A 1ARKA 4BE0A 2MMPA 2CP5A 4EDUA 5KCHA 2A0FB 3H6ZA 1YJWQ 2WFYB 2CSIA 2LQNA 3DJBA 3JB9G 1UFFA 1QQJA 3HPWA 1JOWA 2DMOA 2I40B 4J9GA 3RGFB 4M75A 2KXDA 2CS7A 2JOYA 1PRMC 4MMLA 3SFMA 3LH0A 4EMHA 4PK4A 2DK3A 3DDPB 5LJ3g 4CC4B 4FSSA 4QQDA 2ABLA 3MEWA 2E64A 3VS2A 3EGDB 4BCMD 1VIEA 1K8AR 1NYGA 4C0DB 3G6EA 1JJ2P 2ZPBB 1I4K1 2DEQA 4IKFA 3POMA 2EBPA 1OI1A 2UZEB 1UHFA 3QYGB 2PUOB 2E5KA 3A98A 4Y72B 3RERA 1KC8U 3M03A 2JVVA 3GF5A 2H8HA 2EUFA 2LZ6B 2I2LA 2O88A 2QA4A 2D1XA 3G1JA 2L3QA 3BDLA 4M7DD 2SEMA 3L1AA 4C8QG 4ELLA 1RL2A 4AT1B 4M75B 1RUWA 1IZ6A 1KQSA 3VU3C 5GMKe 2LC4A 4JS5A 3BHTB 3MIAB 3I55T 1I5OB 3V7RA 4UC4A 2E41A 5HK0A 4CFWB 3OBYA 5ACBA 4F7UA 3TVTA 3LGFA 5GAMj 2KR6A 2O4XB 1K76A 3G4SQ 4J7FA 1H641 4IUPA 3VUZA 3CCVT 2DE0X 1VYVA 1M27C 3QHWB 2AIRB 5GAN8 3CCMA 2RI2A 2EYYA 1NEBA 2DTOA 1NBEB 2DXCA 3RMQA 4OGEA 1PM3A 2HNIA 4J6XA 1ZHIA 3CD6T 2IPOB 1ZUKA 1WXUA 1SPKA 1X43A 3DB4A 3Q1JA 2V8KA 2KQWA 2LX7A 3OB9A 2J6FA 4JJBA 1K9MR 1VQNA 3H9NA 1QWFA 1LOJA 1G5VA 2F2WA 4LXCA 3FJPA 2GCXA 3NPFA 2X4JA 4CXAB 3EFRA 1VYTA 3JCMW 1VQ9A 4HT9A 2QTXA 2G6FX 1M30A 4HVVA 5D6YA 2XI9A 4BE2A 2HSEB 4F7UB 5I2MA 3QWXX 4K11A 2DXBA 3JCMX 2RPNA 1N9SA 2VWFA 4M75F 4KRTA 4F7NB 1Q81U 2P0PA 3FB9A 1VQOA 3OS1A 1Q81R 5GAMf 5GJWB 2PJQA 1VA7A 5DQVA 2KR3A 1KSWA 3NFCA 4JLIA 4HA8A 1WA7A 1OKWB 4BCOB 1WHHA 5A0DA 1QVFA 4CFMB 2LJ3A 2DKGA 1KHCA 1UECA 3VS3A 4KGXB 1RI9A 3EH2A 1LCKA 4J9FA 2WHBB 2W0ZA 2E1HA 1VQMA 1H26B 2OAUA 1VQLQ 3OYLA 4KGVB 2KBTA 3CCSA 4C5EA 2X4YA 1ZBJA 2DD5A 1OI9B 1Y57A 4Q5WA 1H1QB 2DXBB 1YITA 1YJ9T 2AKKA 2R58A 4EOMB 2CZ7B 4EOPB 1K1ZA 5GJVB 3O0GD 1UGRB 3VKIA 4IUQA 1GXIE 4HKEA 2AT1B 2CH4A 2JN0A 5FU6B 3CC7A 2CREA 4Z02A 4M7AA 4F7UF 2M0OA 2D9TA 1AWOA 3CPWS 2MI6A 4AKHA 2MK5A 1H1PB 5LQFB 3NMZC 2BKDN 3OYCA 4YTLA 5KH6A 4M75D 1KD1C 2KRSA 3EG1A 2QI2A 3F5XB 3QO3A 6AT1B 2OTJA 4MIMA 2CH4W 5IHIA 4QQGA 2UZBB 1ZUUA 4D6WA 2C5VB 4ESRA 4DOWA 3CCUT 3PT9A 5LJ5e 3SWNC 3CC2Q 4XTXA 2VVKA 1E7PA 2QA4Q 4E7KA 1AEYA 4E7HA 2DTIA 3H0FA 2LW4A 1QP2A 2ZZDA 3I35A 2F69A 4M7AB 2E6NA 3I56Q 1VOMA 2XK0A 4C92C 4C5GA 4RODA 1JJ2A 3THKA 1XTDA 4LN2A 3M0QA 2FVUA 3PIOA 4KT0E 2V22B 4ATOA 1B7TA 2CP3A 2DETA 4EOQB 1PD0A 2KEAA 3HP9A 2ZPEB 2DZCA 4EOIB 4J6WA 2MYSA 2DERA 3JCMQ 5GAN7 2DNUA 3CCMQ 3QG1A 3VV0A 3L2VA 1D3BA 3JCMJ 1Q7YR 1TFBA 1BB9A 4WCIA 1JSTB 3CBMA 3M4GA 2K3BA 1QW1A 5DQWA 2W10A 2O01E 3SD4A 3LQ5B 1Y7XA 2WMBB 2JGZB 4IUTA 4QT7A 2KRNA 2R7GA 1VQNQ 2QAZA 8ATCB 2KE9A 2A36A 3OS5A 2ZZDB 1E7OA 2ED0A 2RJDA 4BUGA 3G6ET 2WEVB 4PJNA 4QQ6A 4A4KA 4HNVA 2FPEA 2KVQG 2NLUA 2CZ1B 2JTFA 4C92E 3E2UA 4CC7A 2D8JA 2DILA 5L8RE 3L2WA 1OL2B 5CCAA 4EMKB 1YWOA 2VYTA 1W70A 5HY6A 1VQ4Q 3MY5B 2E4HA 2M9UA 2UZDB 1RAGB 2DL3A 3VRZA 1QVPA 1D3BB 3OYJA 1HJDA 7AT1B 4JRIA 3QJYA 4NL3A 3OYFA 2L3RA 4MZTA 1D0XA 3ULRB 5LJ5d 2LQWA 2HL5C 3QJ6A 2EWNA 1YP5A 4G6LB 3QHSA 3E9GA 1M90C 4J9HA 1GY3B 4EOLB 3RNJA 3CMAA 1V29B 2CP6A 4PJOC 4E6RA 4OGRB 3EFOA 4Z88A 2EQMA 1JEGA 5HBHB 2FRYA 4AKGA 3RIRA 3KFVA 2FB7A 3LX7A 2DJQA 5KYWA 2KY9A 4N4HA 2P0QA 5FLXE 2ZPGB 5DLOA 1VQKQ 1OEBA 1T3SA 3A8HB 4N0AC 1OU8A 1RADB 4LUEA 1KD1U 2JTMA 2V8IA 2MOXA 4EOSB 2YDLA 1XO2A 1KD1R 1VQ9T 4M7AG 1OYXA 1H4LD 2G3RA 1YJWA 1FMVA 2DMEA 3TNIB 3QHRB 1ZBXA 1LPLA 3BLHB 5HK3A 5FU7C 3J7AF 1RAFB 1AWXA 2DEUA 1SG5A 3TQ7P 5KE3A 5GMKj 3TREA 2OTLT 2HDAA 4CRLB 2L8DA 3EFOB 1GUXA 4PJOE 2BE9B 1WNLA 1K9AA 2L2PA 3RKYA 2RMOA 3M0RA 5GAN3 4EC9B 1IB8A 2OTJQ 3GBQA 5GAMd 1BK2A 3CCLT 5KYWB 1KQSP 4OMOA 2QDLA 1R8OB 3X24B 4JLGA 1HD3A 1AOJA 1MV0B 2R5AA 5LL6S 3EHRA 2ZPHB 3QDFA 3VUBA 2CUBA 4FL6A 4R55A 5HQ0B 4OMPA 1I07A 2QF7A 2I0NA 1E9HB 3MJXA 1BCOA 3TNWB 1VQMT 4TVRA 5A2QE 2X51A 1AD6A 5M9OA 1JSUB 2CZ0B 4LE9A 3HRSA 5GAN2 1BIBA 1BI2A 1M3BA 3JCMP 1RAIB 3CCST 4HNTA 5CKFA 1WJQA 4ELZC 1K8AC 3RDVA 1YITT 1FVVB 1FMKA 4YOOA 1OKVB 1CKAA 2HKQB 3JCMg 4CRIA 1GUXB 1WXTA 1WJSA 2PK2A 2RQRA 1M2OA 3H4CA 3QYHB 3BHUB 2C5OB 3CPFA 3M0PA 3CC7T 2JTEA 1MNEA 5KCOA 1YBYA 2DA9A 3ZEHA 3WXMB 2L3SA 3G4SA 4J83A 2HKNA 1YIJT 1NLPC 3VRYA 1IREB 3I9QA 1M3AA 3N5BB 2CJMB 1OX9A 2BS2A 1OX8A
chains in the Genus database with same CATH topology
3KUFA 4HL4A 4A4FA 3GNFB 5GMKm 2WJ9A 1OI1A 4N4GA 3QYGB 3ASKA 2PUOB 4C8QC 2DVEA 5I2SA 1VQOA 3RERA 1KC8U 1UGSB 3A8MB 4PLLA 2JVVA 3GF5A 3CCMT 4BBSM 2RA2A 1M9SA 3HFNA 2PU9B 2I2LA 3RMSA 1U1SA 4M75G 5GANe 3OA6A 3CPWA 2EJ9A 2QA4A 1Y07A 2E10A 4ZTFA 3HRUA 1WQ7A 4OMFB 3BDLA 1G3YA 2BIVA 4MDWA 4M7DD 3L1AA 1I81A 3PFSA 4C8QG 1KHIA 1RL2A 4M75B 3HBLA 1IZ6A 1KQSA 3VU3C 4GLKA 2LC4A 2XIDA 4DQ2A 5GMKe 4JS5A 4ZTJA 1DJ7B 3I55T 2QQAA 3HL8A 1M90U 5GAMg 3V7RA 2XKOC 5GAOp 1YIJA 2ZPIB 3QWLA 1PSEA 3MCAB 4M77B 4UC4A 2E41A 3M56A 5HK0A 1VQNT 1N9RA 3P8HA 3SWNA 2MF2A 4JX6A 3OBYA 3OBWA 3S3MA 2EQKA 4F7UA 3GP8A 4DA4A 2RI3A 2D0QB 4J6YA 2MWOA 3G7ZA 4HCBA 3WVDB 4RG2A 5GMKi 3LGFA 5GAMj 2KR6A 2H3JA 2EFIA 2O4XB 4BI3A 3OS0A 4BI4A 1K9MC 2CGHA 4J7FA 4M78A 3M57A 4NS5A 1H641 1TH7A 4IUPA 3VUZA 3ZBDA 3J81E 3LWIA 3P8DA 2KMTA 3CCVT 3OW2S 2VXFA 5GAN8 3CCMA 1EIFA 2E6ZA 2XU8A 2RI2A 4AKIA 3C12A 4PJOD 2DD5B 2DTOA 4XU2A 3JCMf 3CCQA 2QQSA 2DXCA 2F5TX 3RMQA 4LD6A 4OGEA 1YHQT 2JNGA 3C95A 2K4YA 3FDRA 1VQ4T 2HNIA 1BKBA 4J6XA 1ZHIA 4M75E 1Y71A 5IT9E 3CD6T 2VC8A 3CC4T 5CVIA 1S72A 3HFOA 3Q1JA 3DB4A 3X28B 5GAOl 3I55A 1U8RA 4C8QE 4PLIA 5LJ3f 5GMKl 3HO8A 4QVDA 4E7IA 2V8KA 4JRKA 2KQWA 2KMGA 3OB9A 2WSEE 4BB7A 1VQOT 1VQNA 2LRQA 4M7AD 1AHJB 1LOJA 1W2BS 1G5VA 3X20B 1O75A 2YRVA 3FJPA 2KK4A 4OF1A 4BACA 3ME9A 4HCZA 2GCXA 2X4JA 3DLMA 3HZJA 2ZPFB 3EFRA 5C6SA 3JCMW 4F7UG 3TW7A 4QVCA 1VQ9A 2L89A 4HT9A 2QTXA 4L5GA 4FT2A 1VQLA 5D6YA 3SWNB 2XI9A 3QUIA 3V8LA 3OMCA 3GPLA 4NC6A 4BE2A 1FX7A 1N8RC 2L5QA 4OGCA 3VYGA 4PKCC 4F7UB 5LJ5g 4M78G 2DO3A 5I2MA 3OYIA 3JCMe 1MGQA 1YHQA 4ME7A 2EYQA 1B34A 2HQXA 1Q82U 4ZGEB 1RI0A 2QDYB 4EMGA 2DXBA 3CD6A 1UGPB 3S3OA 3OSVA 3JCMX 3MO8A 1N9SA 4B9WA 4EMKC 4C92B 5LJ5j 2C06A 4M75F 1Q81U 2HAXA 4JX4A 5LJ3e 1G3WA 2P0PA 3SDZA 4BDYA 3FB9A 3E19A 3L42A 2LNVA 2V8JA 4C8QF 4ZN1A 4LDYA 3OS1A 4BDZA 4HLQA 1O9SA 4RCCA 5GAMf 2DTHA 5EJCA 2ZCFB 1VQ7A 5FRMA 1VQKT 4C0DC 1Q86C 2XDPA 5D6XA 3JB9J 1NJIU 3NFCA 4JLIA 3M55A 4HA8A 4JRPA 4M6VA 3GOXA 4C0ZA 4LDXA 4LDVA 4RCBA 3OYKA 1OZ3A 4M77A 5J26A 5A0DA 1QVFA 1YI2A 2DKGA 1KHCA 1KG1A 3JAME 2DIGA 3L2ZA 3A5ZB 5CKBA 4QW2A 3JB9D 1K8AU 3O8VA 3M4YA 4L59A 5I21A 5IN1A 2GF7A 3QIIA 2K3YA 4M78E 4HCCA 2E1HA 2LX9A 1YCYA 2O4XA 2P0KA 4KBMB 4MZPA 4CI0C 2OAUA 4E47A 5GAOr 3OYLA 2DD4A 3NTKA 1HXDA 2CKKA 4XTVA 1BYMA 2EJGA 3LW5E 4PL6A 4J8OA 3UDCA 3CMAT 1QVFS 3JRZA 3CCSA 4DOVA 1YJNA 4C5EA 2X4YA 1MHNA 1M1KC 2EAYA 2QEXA 2DD5A 1B34B 3KBGA 4C0GA 5GAOm 1KQ2A 4M75C 2VXEA 5CAIA 5GMKh 5CKDA 4Q5WA 3URGA 4PJOA 2DXBB 2A3LA 1YITA 1YJ9T 1K73C 3TCJA 5GAMe 1NZ9A 2R58A 3JB9I 5J39A 3OYAA 2PVGB 2CZ7B 3C4SA 2CZ6B 2RHIA 4RMOA 4FIBA 1UGRB 1M1FA 2IVWA 4XK8E 4M77C 2OTJT 3VKIA 2LT4A 5C0MA 1M8VA 4IUQA 4OB3B 1GXIE 4A4GA 4HKEA 3CC2A 1VIFA 2DPPB 3OS2A 2EQUA 1BI0A 3G71T 4FU6A 1VQ8A 2LQ8A 4BI8B 4JS4A 3JB9H 2WSFE 1X75C 2JN0A 2QFZA 2QQBA 2E65A 5FU6B 3GNGA 3CC7A 3UPUA 3NTIA 4Y91A 4Z02A 4A4HA 3I56A 3QSUA 4M7AA 4M7DB 4F7UF 5LJ5f 4M77G 3JCMc 1KQ1A 2M0OA 1BI1A 2RJFA 4O6JA 1JB0E 3EAEA 4OB1B 2Y4XA 4N0AA 3DLLA 2D9TA 2WSCE 1NE8A 3M53A 4M78F 2MI6A 3CPWS 1G3SA 1WJRA 2FL7A 4AKHA 1WPYA 1XQHA 4OB2B 3E9FA 5HKCA 4NL2A 1X6OA 2X4WA 3VKHA 3MHXA 3QXEB 2RJCA 1KQSS 2BKDN 3OYCA 3QKJA 4YTLA 3PGGA 4M75D 4N4IA 4A4EA 5KH6A 3CCRT 2DD4B 3JCMd 4JDSA 2QI2A 3QO3A 4C8QD 3DB3A 2OTJA 2LDMA 3M59A 4MIMA 3M54A 2RD1A 4C92A 3QZ5B 4HT8A 2QXFA 5CKHA 4ELYC 3S3NA 4QQGA 3F70A 2PVDB 4Y28E 2X4XA 2JUFA 3JSCA 3META 2CYZB 4D6WA 4PJOB 4C5HA 4DOWA 5LJ3d 4FSXA 3CXCA 3CCUT 3PT9A 5A0LA 4NOYA 2RK1A 3OMGA 2RM4A 5LJ5e 3J80E 3SWNC 1ZQ1A 2RI5A 1K9MU 4OB0B 1W4SA 2EKOA 2MAMA 2PUKB 4QVZA 4XTXA 1E7PA 4BBRM 4BY6B 4M77E 4E7KA 3JCMh 4E7HA 2DTIA 2YLBA 3BG5A 1QP2A 2ZZDA 3V8JA 2F69A 4M7AB 2E6NA 4M78C 3OYEA 2PVOB 3TU4K 2B8AA 2F5KA 2XK0A 3MEUA 4MFDA 4C92C 4C5GA 3QYBA 2HD0A 5CO7A 4JJNK 1Q7YC 3VKGA 3L2QA 5LJ3h 3PTAA 1JJ2A 3OYDA 1XTDA 3V8KA 4A53A 3CCVA 2EJFA 2FVUA 2RK2A 2K5FA 2D6FA 2XICA 3PIOA 4KT0E 2RO0A 4ATOA 2Y90A 2RHXA 4XU0A 3JCMV 2VGNA 3OYBA 1X01A 1Y96A 1VQ5T 4QSHA 3WVEB 4MDXA 4C92G 3HP9A 3HSBA 2R57A 3C94A 2ZPEB 1VQ4A 2BS3A 2DZCA 4J6WA 5CK9A 5FU7B 2DIQA 1QVGA 3CC4A 3JCMQ 2LTOA 1JJ2S 5GAN7 4XQ3A 2E12A 2VGMA 3QG1A 4XU1A 3VV0A 5DM7R 3L2VA 3GLXA 1D3BA 3JCMJ 3OYHA 5GAOn 1N8RU 4XTUA 2KAFA 4L6V5 4M77F 3CCJT 5DLQE 3CBMA 5CR2A 4LOCA 1N27A 3M4GA 5CQXA 5GANd 3LYIA 1SSFA 4M7DA 1FWZA 1QW1A 4M78D 3CCET 4XTZA 4X34A 2O01E 3SD4A 2XDBA 1Y7XA 3A8LB 4MZMA 4IUTA 3OYNA 4HNUA 1M5Q1 3PMIA 4O5VA 3V7SA 3OSSC 2XDDA 3OS5A 2ZZDB 2GFUA 5D6WA 4F7UE 3PIPA 2RJDA 4BUGA 3G6ET 4GY5A 3FLGA 3QZ9B 2DJZA 3OYMA 1VQ5A 4QQ6A 4A4KA 3A8GB 3QPHA 3OYGA 2IG0A 4HNVA 2DAQA 2KVQG 1JBMA 3MP8A 4FM4B 4LDUA 3UWNA 2NLUA 1Q86U 2CZ1B 2JTFA 3BY7A 4C92E 2DZ9A 5GANh 2RB6A 1FKMA 4IURA 4LDWA 1QP3A 5L8RE 3L2WA 5CCAA 3KXTA 4V2SA 1HK9A 5GAN4 1Y96B 4E7JA 5FU6C 4EMKB 4C8QA 4B9XA 1KD1C 5J3BA 4OP0A 4M7DC 2VYTA 5HY6A 3E1SA 5CKEA 3PNWC 2M9UA 4IUUA 1VQKA 3EFSA 2RHZA 4BD3A 3CEYA 5FRNA 3MEVA 2HBPA 1QVPA 1D3BB 3OYJA 1OZ2A 5FROA 2K2VA 1U1TA 1KC8C 4JRIA 3X26B 3QJYA 2M1HA 3M5AA 3MEAA 4NL3A 3OYFA 4M7DG 2L3RA 4MZTA 4ZGDB 3P8BB 4FT4A 5LJ5d 1M1KU 3CBOA 4P5NA 3INZA 4XTWA 1K73U 3L2UA 4JRQA 3QJ6A 2K57A 3VJPA 2EWNA 1BIAA 5AYFA 2KSSA 2Y4YA 2LT1A 2P4TA 3QBYA 3M58A 3OY9A 3QHSA 3UT1A 1VQMA 1N6AA 3E9GA 4R56A 1M90C 1NPRA 3CMAA 1V29B 4XU3A 3RKXA 2XHCA 1YJWT 1VQPT 4PJOC 4C92F 2QQRA 5GAOq 5CIUA 3RESA 3S6WA 2K5LA 3CCQT 2EQMA 5DY9A 1YJ9A 4EPCA 5LJ5h 3FC3A 4X9DA 4LD9K 3JCMb 4AKGA 1M4ZA 1WQWA 2BUDA 2FHDA 4BY6C 3RIRA 1QLBA 2DXUA 4PJOG 2LCCA 1S72T 2MWPA 1VQ6T 4C8QB 4M77D 1NPPA 2FB7A 3G71A 3T9NA 4X9CA 3QYEA 3LX7A 2BS4A 3NTHA 2KY9A 4N4HA 3OW2A 4M7AC 3ZFJA 2P0QA 3OQ5A 4J5YA 3HB9A 2ZPGB 5FLXE 5DLOA 1BI3A 3CMET 3A8HB 3H8ZA 4M7DE 4N0AC 1KD1U 2JTMA 2V8IA 3RKWA 2EQJA 5GANg 3V7CA 3QDRB 4ZN3A 4A54A 1LJOA 3LWHA 3HRTA 3FRNA 1VQ9T 1OYXA 4VUBA 3KHIA 2WACA 1I5LA 2XD0A 2G3RA 4M7AG 2X35A 1VQPA 1YJWA 1VQLT 1ZBXA 4E7LA 5HK3A 5GANj 5FU7C 3J7AF 4IUVA 2RJEA 3CXCS 2VUBA 4MFEA 3VYHB 3R6OA 3CCRA 1PSFA 4AI6A 1UB4A 3MP6A 1W2BA 2E5QA 3TEEA 1G3TA 4OVAA 5KE3A 5GMKj 4KULA 4C0FA 3TREA 3MP1A 1VQ6A 2OTLT 4II1A 5A0GA 3BG3A 4RG8A 2XG8D 3LGLA 1H3ZA 2L8DA 1WGSA 3PMTA 4XTYA 3AHUA 4PJOE 4EMKA 3SB2A 1UGQB 2JZ2A 1WNLA 2ZGWA 3CMEA 4Z6YA 4JUVA 3RKYA 3CCUA 5GAN3 2DXTA 3X25B 1Q82C 1FXXA 2LQKA 1VQ7T 4ELJA 2RHYA 1Q7YU 2LVMA 5GAMd 4M7DF 2RHUA 3CCLT 2LCLA 2R5MA 2HQEA 2QQ8A 3FIFA 1Q81C 2KDSA 4RKUE 1P92A 1R8OB 2A7YA 2EIFA 3X24B 2VV5A 4JLGA 3ER0A 5CQYA 1YI2T 3M9QA 4M7AE 4JX5A 1QVGS 2R5AA 2FYKA 2YHTA 5LL6S 2ZPHB 2AHJB 3VUBA 5GAN6 5GAN5 4FL6A 2YLCA 3BFMA 4R55A 4ZGJB 4M78B 3DL1A 4C92D 2QF7A 4BE0A 2K5IA 2QQ9A 1NJIC 2MMPA 1VQMT 4TVRA 4EDUA 1XNIA 2RH2A 5KCHA 3G4ST 2OTLA 3H6ZA 5A2QE 5M9OA 2CZ0B 3JB9G 2K3XA 5GAMh 3HRSA 3LLRA 5GAN2 2G77A 3DKMA 2DXCB 1BIBA 1BI2A 3CBPA 5EG2A 3CCST 5KE2A 4C5IA 3JCMP 1YJNT 4HNTA 5CKFA 2QEXT 1WJQA 4KUIA 4ELZC 1K8AC 3HPWA 1XOVA 3L2RA 3FEOA 4PJOF 4KUDK 1YITT 1I8FA 1UEBA 3OYYA 3BG9A 3BW1A 3TW6A 1VUBA 4M75A 3JCMg 3CCLA 4CRIA 2CS7A 2JOYA 2QDJA 4WF2A 2E70A 4MMLA 5GANf 1WJSA 3SFMA 3LH0A 3CC2T 4EMHA 1VQ8T 1M1GA 3H4CA 3QYHB 4MMKA 2GFAA 4XAXB 2QA4T 3CCJA 3CPFA 2DK3A 3CC7T 4J7IA 5LJ3g 4BE1A 3CCEA 4QQDA 3I56T 3MEWA 5KCOA 2E64A 4M7AF 4PNOA 1YBYA 3ZEHA 3HHTB 3WXMB 1VIEA 3RUXA 3G4SA 4C0DB 2M16A 4J83A 3JB9F 3GIBA 1YIJT 3BDUA 1LNXA 2PQWA 1IREB 3A8OB 3VYGB 3G6EA 5LJ3j 3N5BB 5IAYA 2ZPBB 2BS2A 1JRIA 1I4K1 2GQVA 2DEQA 3HKSA 4IKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 E;  2ZPG B;  3QYG B;  3A8H B;  2PUO B;  3WVE B;  1UGS B;  2ZPE B;  3A8M B;  2PU9 B;  2DD4 A;  3VYH B;  3LW5 E;  1PSF A;  1DJ7 B;  4L6V 5;  2DD5 A;  2ZPI B;  1PSE A;  2DXB B;  2O01 E;  3A8L B;  2PVG B;  2CZ7 B;  2D0Q B;  2CZ6 B;  1UGR B;  3WVD B;  4XK8 E;  1UGQ B;  2ZZD B;  1GXI E;  4OB3 B;  3X25 B;  3QZ9 B;  2DPP B;  3A8G B;  2WSF E;  4FM4 B;  2DD5 B;  2CZ1 B;  2DXC A;  4RKU E;  1QP3 A;  5L8R E;  3X24 B;  1JB0 E;  4OB1 B;  2ZPH B;  2AHJ B;  2WSC E;  3X28 B;  4ZGJ B;  4OB2 B;  2WSE E;  3QXE B;  2CZ0 B;  1AHJ B;  2DXC B;  3X20 B;  3X26 B;  2DD4 B;  4ZGD B;  3QZ5 B;  2ZPF B;  4Y28 E;  2PVD B;  2CYZ B;  3VYG A;  3QYH B;  1V29 B;  4ZGE B;  2QDY B;  2DXB A;  1UGP B;  4OB0 B;  2PUK B;  3HHT B;  1QP2 A;  2ZZD A;  2PVO B;  1IRE B;  3A8O B;  3VYG B;  2ZCF B;  2ZPB B; 
#chains in the Genus database with same CATH topology
 4DBF A;  3KUF A;  1RLP C;  4HL4 A;  3GNF B;  3CQT A;  1H25 B;  1G3N C;  2DVE A;  5I2S A;  2CP0 A;  2W96 A;  2AZS A;  2ROT A;  3RMS A;  3CPW A;  5GAN e;  4ZTF A;  4EON B;  4HXJ A;  3HRU A;  1WQ7 A;  2BIV A;  3PFS A;  4EOK B;  3HBL A;  1UJ0 A;  4EOO B;  2VKN A;  2W9F A;  4DQ2 A;  4ZTJ A;  2WIP B;  1DJ7 B;  2MPX C;  3HL8 A;  1M90 U;  4AMC A;  2XKO C;  5GAO p;  2ZPI B;  1PSE A;  1PCX A;  2JMA A;  3CCJ Q;  3SWN A;  1A0N B;  2MF2 A;  4J9C A;  4JX6 A;  3S3M A;  4J6Y A;  2D0Q B;  3CCE Q;  3WVD B;  5GMK i;  2AKL A;  4J9D A;  2H3J A;  2DLP A;  1Q95 G;  1V76 A;  4BI3 A;  5IDP B;  3OS0 A;  1K9M C;  3JB9 F;  1H92 A;  4DBH A;  3J81 E;  1TH7 A;  3ZBD A;  1GCP A;  3LWI A;  3OW2 S;  1EIF A;  2E6Z A;  4BCN B;  4AKI A;  2EYX A;  2BZY A;  1AWW A;  1YHQ T;  4EIK A;  1BKB A;  1D0Z A;  5CVI A;  3LH5 A;  5GAO l;  1WX6 A;  4PLI A;  2F2X A;  4OR5 B;  2F2C A;  3C0C A;  2WSE E;  2LRQ A;  2D8H A;  4F6W B;  4CC2 A;  1YNZ A;  4BAC A;  1MMN A;  2ZPF B;  2ECZ A;  4QVC A;  4BCG B;  4F70 B;  2L89 A;  4RTW A;  1VQL A;  3SWN B;  3QUI A;  3GPL A;  3OMC A;  4NC6 A;  1FX7 A;  4IIO A;  4PKC C;  1BBZ A;  2DO3 A;  2EYZ A;  1MGQ A;  1NYF A;  1WFW A;  2EYQ A;  4ME7 A;  2JT4 A;  3ZL7 C;  4EMG A;  3S3O A;  1O9K A;  4EMK C;  4C92 B;  5LJ5 j;  2C06 A;  1B07 A;  4JX4 A;  5LJ3 e;  2M02 A;  4C8Q F;  2V8J A;  4LDY A;  4RCC A;  3NDQ A;  5EJC A;  2O9V A;  2X3X D;  2GGR A;  1S72 Q;  2YUQ A;  2XDP A;  3JB9 J;  4ZNX A;  3M55 A;  4M6V A;  5IH2 A;  3MY1 B;  4FX3 B;  1ENW A;  5AT1 B;  1K8A U;  4QW2 A;  3JB9 D;  3O8V A;  4M78 E;  2FZG B;  2O4X A;  1GCQ C;  4KBM B;  4E47 A;  2DD4 A;  4RTZ A;  2EYW A;  3CMA T;  3JRZ A;  5HNB B;  1MHN A;  2X1N B;  2JJ9 A;  2SRC A;  5CAI A;  5CKD A;  1X6G A;  2KRO A;  5GMK h;  4PJO A;  2A3L A;  1O9K B;  1NZ9 A;  3OYA A;  2PVG B;  3C4S A;  1UNL D;  2RHI A;  8AT1 B;  4FIB A;  4RMO A;  1M1F A;  2IVW A;  4FYY B;  1MMA A;  4M77 C;  1M8V A;  4A4G A;  2QK0 A;  3CC2 A;  5L2W B;  3OS2 A;  2EQU A;  3JB9 H;  2NUZ A;  1X75 C;  2HEQ A;  3SHW A;  1VQ7 Q;  3I56 A;  1D3U B;  3QSU A;  5LJ5 f;  5KYY A;  2YUP A;  5LMK B;  1BI1 A;  3REA B;  4F6S B;  1M3C A;  4N0A A;  1K73 R;  2WSC E;  1NE8 A;  4DBQ A;  1WJR A;  1YI2 Q;  2EGC A;  1WPY A;  1XQH A;  2EKH A;  5HKC A;  1MV3 A;  2X4W A;  2QTV A;  3QKJ A;  3PGG A;  1OU9 A;  2DD4 B;  4C8Q D;  2LDM A;  3M54 A;  2RD1 A;  1YJN Q;  4ELY C;  1C1A A;  1U06 A;  2QEX Q;  3F70 A;  2PVD B;  2X4X A;  4PJO B;  1WDX A;  2QGF B;  2KGT A;  1IO6 A;  1SHF A;  1AIS B;  5LJ3 d;  4D8D A;  1GH6 B;  1SSH A;  1K9M U;  3OMG A;  2RM4 A;  2MAM A;  2PUK B;  1VQ8 Q;  4QVZ A;  4M77 E;  2EQI A;  1RAB B;  4EOR B;  3OYE A;  2PVO B;  5KYY B;  1URC B;  1WI7 A;  3EHQ A;  3QYB A;  2HD0 A;  4KH1 B;  1Q7Y C;  2IW9 B;  3OYD A;  4A53 A;  4DEX A;  1BU1 A;  2D6F A;  2BZX A;  3O5Z A;  2PNI A;  4MDX A;  4C92 G;  1VQ4 A;  2BS3 A;  4AG1 C;  2HBW A;  5FU7 B;  5CK9 A;  2LTO A;  4XQ3 A;  1VYW B;  2E12 A;  2ZAE A;  3GLX A;  2FPD A;  3EH1 A;  2K79 A;  2KAF A;  2EW3 A;  4L6V 5;  1ABQ A;  1KFZ A;  1SSF A;  1QKW A;  4Y92 A;  4BCQ B;  1BCM A;  3OYN A;  1M5Q 1;  4O5V A;  3PMI A;  3V7S A;  2GFU A;  1WHK A;  4BXX X;  4GY5 A;  3OYM A;  1VQ5 A;  2DAQ A;  3EGX B;  2H3E B;  1JBM A;  4F14 A;  4FM4 B;  1H24 B;  2DVJ A;  1PKD B;  3BY7 A;  3U23 A;  4LDW A;  4FYX B;  1D0Y A;  2F1L A;  4CFX B;  5CYI B;  4F6U B;  2D0N A;  4CFU B;  4OP0 A;  4M7D C;  2X3W D;  3E1S A;  2WXV B;  1RLQ C;  3CC4 Q;  1VQK A;  2RHZ A;  1AT1 B;  2QG9 B;  1OQK A;  5FRO A;  3M5A A;  3MEA A;  4ZGD B;  3CBO A;  5I22 A;  3INZ A;  2RF0 A;  2A28 A;  2LMJ A;  1LVK A;  2Y4Y A;  2LT1 A;  3QBY A;  3M58 A;  1OIY B;  4LNP A;  2C6T B;  1SRM A;  2JM9 A;  1NPR A;  2W2H A;  3RKX A;  1OL1 B;  5CIU A;  3S6W A;  3MI9 B;  4E2F B;  2K5L A;  4EPC A;  5LJ5 h;  3FC3 A;  2KNB B;  4BY6 C;  1WQW A;  4PJO G;  4KRC B;  4Z89 A;  4YOZ A;  4X9C A;  2BS4 A;  4TTH A;  3OW2 A;  3DTO A;  3ZFJ A;  3OQ5 A;  1EFN A;  4J5Y A;  2Z0W A;  2BTT A;  4M7D E;  3H8Z A;  4OMQ A;  3RKW A;  3QDR B;  3GTM S;  1TU0 B;  1G83 A;  2XD0 A;  2WIH B;  1VQP A;  1VQL T;  1VYU A;  5GAN j;  2RJE A;  3CXC S;  4MFE A;  3VYH B;  4HVW A;  1PSF A;  4AI6 A;  1OOT A;  2BKZ B;  4C0F A;  4BCP B;  2KRM A;  1VQ6 A;  2DX1 A;  3LGL A;  1WGS A;  3PMT A;  4EMK A;  1HYO A;  4KRD B;  3CME A;  4Z6Y A;  1I1J A;  3CPW P;  1FXX A;  2CT3 A;  1Q82 C;  1Q7Y U;  2W9Z A;  2LVM A;  3G71 Q;  1YWP A;  2R5M A;  3M0T A;  2HQE A;  2QQ8 A;  2KDS A;  4RKU E;  1P92 A;  1C9B A;  2A7Y A;  4AFQ C;  5CQY A;  3M9Q A;  1QVG S;  2YHT A;  2FYK A;  5HVY B;  1TG0 A;  1YFN A;  3G33 B;  2QGG A;  5GAN 5;  3BHV B;  3BFM A;  4M78 B;  2RNA A;  2K5I A;  1XNI A;  2CSQ A;  2RH2 A;  2K3X A;  5GAM h;  2WMA B;  1TUC A;  2G77 A;  3DKM A;  5EG2 A;  1GCQ A;  3CBP A;  5KE2 A;  3CCR Q;  1XOV A;  3L2R A;  3FEO A;  4KUD K;  2HCK A;  1I8F A;  4AFS C;  3OYY A;  3BW1 A;  1VUB A;  2FO0 A;  3RR6 A;  2B86 A;  2QDJ A;  2E70 A;  2NUP B;  5GAN f;  3CC2 T;  1UE9 A;  1M1G A;  1NJI R;  4MMK A;  2GFA A;  2QA4 T;  4BCK B;  3CCJ A;  4J7I A;  3CCE A;  3I56 T;  1M8M A;  4M7A F;  3HHT B;  3RUX A;  1H8K A;  1QCN A;  3VYG B;  4AFU C;  5LJ3 j;  4CFU D;  2ENM A;  2WJ9 A;  4N4G A;  2E3H A;  5EFQ B;  2DYI A;  3H0I A;  2OTL Q;  1TD6 A;  2ROL A;  1UGS B;  3CCM T;  2RA2 A;  2C5X B;  1VQ5 Q;  5I11 A;  2PU9 B;  1U1S A;  1WHM A;  1IGU A;  1Y07 A;  2E10 A;  3UA6 A;  1G3Y A;  2EGA A;  4BCH B;  3UA7 A;  4GLK A;  1FIN B;  4PFZ A;  5GAM g;  2M51 A;  1KXU A;  1UNG D;  2J6K A;  4M77 B;  2NUT A;  4KH0 B;  5IXB A;  2P84 A;  1VQN T;  2CP2 A;  4DA4 A;  3GP8 A;  2RI3 A;  4HCB A;  2LNH B;  3REB B;  3PE0 A;  4RG2 A;  1ZA2 B;  4BI4 A;  2CGH A;  3M57 A;  3P8D A;  2KMT A;  3EOC B;  2G9X B;  2W99 A;  4BY7 X;  4M4Z A;  3C12 A;  5KYN A;  5KYX A;  1U3O A;  2YSQ A;  3SEM A;  1TUD A;  2DF6 A;  2F5T X;  4LD6 A;  1B3Q A;  2DRM A;  1X27 A;  3C95 A;  1VQ4 T;  5IT9 E;  2LCS A;  4M75 E;  1Y71 A;  2VC8 A;  1S72 A;  3HFO A;  3I55 A;  4OML A;  1UDL A;  5LJ3 f;  5GMK l;  4QVD A;  5I5Z B;  1K0X A;  4JRK A;  1CKB A;  4E7S A;  2KMG A;  1VQO T;  4M7A D;  2PZ1 A;  1K4U S;  1TTH B;  1W2B S;  3X20 B;  1O75 A;  2YRV A;  1J3T A;  1CSK A;  3TSW A;  3ME9 A;  1PHT A;  5HBJ B;  3DLM A;  5C6S A;  4F16 A;  2OAW A;  1YIJ Q;  4HCK A;  2NUT B;  4ORZ A;  3V8L A;  3GIB A;  4OGC A;  4PFO A;  4M78 G;  2I53 A;  3JCM e;  4PJJ A;  3HTR A;  1Q82 U;  1KK7 A;  2QDY B;  3CD6 A;  1UGP B;  1RAH B;  1AZE A;  3MO8 A;  1VQP Q;  2L3P A;  1Q82 R;  5KYX B;  2ESW A;  3CCQ Q;  1G3W A;  4BDY A;  3SDZ A;  3A1P A;  2HMA A;  3E19 A;  4ZN1 A;  4ROC A;  4HLQ A;  1O9S A;  1F5Q B;  2DTH A;  1VQ7 A;  2ZCF B;  1VQK T;  1N8R R;  1VQ6 Q;  4FCY A;  1WHG A;  5IHN A;  4LDX A;  2AZV A;  4PJM A;  3CME Q;  4YC3 B;  3OYK A;  1OZ3 A;  1NEG A;  2QAS A;  4FW2 A;  4AFZ C;  1YI2 A;  1KG1 A;  2C5N B;  2UZL B;  3L2Z A;  4RTV A;  4JZ3 A;  1D09 B;  5I21 A;  5IN1 A;  2GF7 A;  3QII A;  4HCC A;  1U8R A;  1YCY A;  1AWJ A;  4MZP A;  2CCH B;  5FGK B;  3NTK A;  4BCM B;  1HXD A;  1G8X A;  2CKK A;  4XTV A;  1BYM A;  2EJG A;  3LW5 E;  4PL6 A;  4J8O A;  1QVF S;  1Q86 R;  4DOV A;  1YJN A;  2EAY A;  2QEX A;  4C0G A;  3KBG A;  1KQ2 A;  2IW8 B;  3K7A M;  3URG A;  1K73 C;  3TCJ A;  5CEI B;  4A63 B;  3JB9 I;  2CZ6 B;  5IDN B;  2OTJ T;  4OB3 B;  2CP7 A;  1VIF A;  1VQ8 A;  4RTT A;  2LQ8 A;  4JS4 A;  3QWY A;  2WSF E;  1FYN A;  2DBK A;  3UPU A;  2QQB A;  3GNG A;  4RTY A;  4F7S B;  4FYV B;  3NTI A;  4Y91 A;  4M7D B;  2XMF A;  1M1K R;  4M77 G;  3JCM c;  1KQ1 A;  1X2Q A;  1JB0 E;  1OPL A;  2KYM A;  1VIN A;  2Y4X A;  3EAE A;  3DLL A;  3EGU A;  2OX7 A;  3H0H A;  4OB2 B;  3E9F A;  5ECA A;  4NL2 A;  2LJ1 A;  4R0K A;  3QXE B;  1ZSG A;  1H27 B;  1W6X A;  1GFC A;  4BCJ B;  3JCM d;  3TSZ A;  2HZY A;  4C92 A;  4HT8 A;  2L0A A;  2UUE B;  4Y28 E;  1QLY A;  2DL7 A;  2JUF A;  5IXF A;  2JW4 A;  4FSX A;  3H41 A;  3CXC A;  5A0L A;  1WXB A;  2RK1 A;  2RI5 A;  4OB0 B;  2EKO A;  4BY6 B;  4BBR M;  1G2B A;  2P4R A;  1H28 B;  1XJW B;  3BG5 A;  1JKW A;  3V8J A;  4M78 C;  2DRK A;  2F5K A;  1OIU B;  5CO7 A;  3VKG A;  3L2Q A;  5LJ3 h;  2K6D A;  1Y0M A;  2RK2 A;  1GBQ A;  2RHX A;  4XU0 A;  3JCM V;  2VGN A;  3OYB A;  1Y96 A;  4QSH A;  3HSB A;  3C94 A;  4PFP A;  1H1S B;  2DIQ A;  1QVG A;  3CC4 A;  4X1V A;  1JJ2 S;  3NGP A;  1UTI A;  4RTX A;  4JPB W;  2DL4 A;  1WIE A;  1RAE B;  3DDQ B;  3CCJ T;  5CR2 A;  3OW2 P;  1N27 A;  5CQX A;  5GAN d;  3VS5 A;  3LYI A;  1FWZ A;  3I55 Q;  3CCE T;  4XTZ A;  2XDB A;  2PMI B;  3A8L B;  4MZM A;  4HNU A;  1ZSZ C;  3PIP A;  3FLG A;  3OYG A;  3A8G B;  1TXQ A;  3QPH A;  2B9R A;  3MP8 A;  4LDU A;  2X9H A;  3CCV Q;  2DZ9 A;  1FKM A;  4IUR A;  1QP3 A;  4FYW B;  2E3I A;  1NM7 A;  1Y96 B;  4B9X A;  2LJ0 A;  5CKE A;  3CD6 Q;  5FRN A;  3EFS A;  3MEV A;  2IW6 B;  2KT1 A;  1H1R B;  1JU5 C;  1OZ2 A;  2K2V A;  4BCF B;  4M7D G;  3I5S A;  4XTW A;  1X69 A;  1K73 U;  2FPF A;  3L2U A;  4JRQ A;  4NST B;  1UNH D;  1BIA A;  5AYF A;  3UAT A;  2KSS A;  3OY9 A;  2FRW A;  1GRI A;  3UT1 A;  1N6A A;  4R56 A;  2IN3 A;  2XHC A;  1YJW T;  2CT4 A;  4C92 F;  3M0U A;  3BE3 A;  1UG1 A;  1KC8 R;  4YOS A;  2YRC A;  4X9D A;  4LD9 K;  1RAA B;  1M4Z A;  2IIM A;  3FJ5 A;  3PO3 S;  2DXU A;  1ZP2 A;  2LCC A;  1X6B A;  1S72 T;  1PC0 A;  2MWP A;  1TS9 A;  2HL3 A;  1GBR A;  3G71 A;  2HSP A;  3T9N A;  2M0Y A;  4ANJ A;  1UHC A;  3HB9 A;  1BI3 A;  1MMG A;  1NG2 A;  2LP5 A;  4A54 A;  1OGU B;  3LWH A;  1I5L A;  4VUB A;  3BLQ B;  3RBB B;  4BCN D;  2X35 A;  1EX4 A;  5HCK A;  4E7L A;  2EPD A;  1PWT A;  4RUG A;  3CCR A;  1UB4 A;  1W2B A;  2PK9 B;  3MP6 A;  3EGX A;  1G3T A;  4OVA A;  1MUZ A;  1M2V A;  4KUL A;  3TNH B;  2VB6 A;  4II1 A;  5A0G A;  5FW9 A;  2XG8 D;  1H3Z A;  4XTY A;  1ZLM A;  3AHU A;  1YJ9 Q;  4JUV A;  3X25 B;  1SHG A;  3R6N A;  2LQK A;  1VQ7 T;  2MCN A;  3VS7 A;  2RHU A;  1SEM A;  2PTK A;  2EIF A;  2GQI A;  4J9I A;  5HBE B;  4CFN B;  1YI2 T;  5FWB A;  2AHJ B;  3I5R A;  4C92 D;  3EG2 A;  2QQ9 A;  1ZX6 A;  1NJI C;  2GNC A;  2COW A;  3G4S T;  2OTL A;  4FW1 A;  3LLR A;  4F7L B;  2DXC B;  1YJN T;  4C5I A;  2QEX T;  2K9G A;  4KUI A;  1IRX A;  4PJO F;  4I3Z B;  1M2V B;  3VS0 A;  1UEB A;  3BG9 A;  3TW6 A;  5D7U A;  1GFD A;  3CCL A;  4PJL A;  1OPK A;  4WF2 A;  1PNJ A;  3NHN A;  4GLM A;  1VQ8 T;  4XAX B;  1PKT A;  2C0T A;  2YUN A;  3CCU Q;  1T0H A;  4BE1 A;  3VS6 A;  2OI3 A;  4PNO A;  2M16 A;  1F1B B;  4D8K A;  2NYS A;  3BDU A;  1EZZ B;  1LNX A;  2PQW A;  3A8O B;  2NWM A;  5IAY A;  3HKS A;  1JRI A;  2GQV A;  5IF1 B;  2JMC A;  3EG9 A;  4A4F A;  5GMK m;  1IHW A;  3EID B;  3ASK A;  4C8Q C;  1TOV A;  2YWW A;  4KGZ B;  2GBQ A;  3A8M B;  4PLL A;  4BBS M;  3HFN A;  1M9S A;  3OA6 A;  4M75 G;  2EJ9 A;  4OMF B;  2CDT A;  1QKX A;  4MDW A;  1I81 A;  1KHI A;  1ABO A;  2XID A;  1SRL A;  2QQA A;  4JZ4 A;  1YIJ A;  3QWL A;  3MCA B;  1Z9Z A;  1IGQ A;  4DBR A;  3M56 A;  1KJW A;  1N9R A;  3P8H A;  3OBW A;  2EQK A;  4AG2 C;  2MWO A;  3G7Z A;  2COZ A;  2EFI A;  1TWB A;  1SF9 A;  3IQL A;  4CI0 C;  4M78 A;  4NS5 A;  2J06 A;  1Z9Q A;  1D1B A;  2KXC A;  2VXF A;  3G6E Q;  1R77 A;  2XU8 A;  2DYB A;  4PJO D;  2DD5 B;  4XU2 A;  3JCM f;  3CCQ A;  2QQS A;  3EG9 B;  2JNG A;  2K4Y A;  2V1Q A;  3FDR A;  4B6M A;  4LUD A;  3CC4 T;  3X28 B;  4CC3 A;  4C8Q E;  3HO8 A;  5FWC A;  4E7I A;  3TN8 B;  2NUP A;  4BB7 A;  1AHJ B;  2RN8 A;  4E7Z A;  4OF1 A;  2KK4 A;  1T3L A;  4HCZ A;  3MKD A;  3HZJ A;  4F7U G;  3TW7 A;  2CUD A;  4L5G A;  4FT2 A;  1N8R C;  2L5Q A;  3VYG A;  5LJ5 g;  3OYI A;  1N4M A;  1YHQ A;  1PKS A;  1B34 A;  2HQX A;  3EG3 A;  5IHY A;  1PD1 A;  1ZSZ A;  1YCS B;  4ZGE B;  1RI0 A;  3OSV A;  4B9W A;  1MND A;  2HAX A;  1W1F A;  1AD5 A;  3L42 A;  2IVX A;  2LNV A;  4BDZ A;  1YN8 A;  5FRM A;  4C0D C;  4BCQ D;  1AZG B;  1JXO A;  4Z8A A;  5D6X A;  4WTO B;  1Q86 C;  1NJI U;  1ZUY A;  4JRP A;  3CXC P;  3GOX A;  4UN0 A;  4C0Z A;  1OUL A;  4BY1 X;  4LDV A;  2OJ2 A;  4RCB A;  4M77 A;  5J26 A;  3JAM E;  2DIG A;  3A5Z B;  5CKB A;  4F04 B;  1TSF A;  1UGV A;  2DL8 A;  1GL5 A;  3M4Y A;  4L59 A;  2K3Y A;  1VQ9 Q;  2LX9 A;  2P0K A;  5GAO r;  2VAS A;  4BCI B;  1UUE A;  4QKU A;  3UDC A;  1M1K C;  1T0J A;  2YT6 A;  1B34 B;  5GAO m;  4M75 C;  2VXE A;  1ZSZ B;  5GAM e;  4DEY A;  5J39 A;  1D1C A;  4XK8 E;  2C0I A;  2LT4 A;  5C0M A;  1QVG P;  2O2O A;  2DPP B;  1BI0 A;  3G71 T;  4FU6 A;  1VQO Q;  1SKU B;  4BI8 B;  2QFZ A;  2E65 A;  1TUG B;  4CFV B;  4A4H A;  3CCL Q;  2RJF A;  4O6J A;  4OB1 B;  4ROE A;  1WLP B;  4M78 F;  3M53 A;  2F2V A;  1N5Z A;  1G3S A;  2FL7 A;  3VS1 A;  1X6O A;  1VOL A;  2RQW A;  3VKH A;  3MHX A;  2RJC A;  1KQS S;  3CCR T;  4A4E A;  4N4I A;  1VQM Q;  3UF4 A;  4JDS A;  1PG5 B;  3M0S A;  3VS4 A;  3DB3 A;  3M59 A;  4J9B A;  3QZ5 B;  3CCS Q;  2QXF A;  5CKH A;  3S3N A;  3B57 A;  1QCO A;  3PVQ A;  3MET A;  3JSC A;  1P5E B;  2CYZ B;  4OMN A;  4C5H A;  1YIT Q;  4F17 A;  2JS0 A;  4IIM A;  1I0C A;  4NOY A;  3J80 E;  1ZQ1 A;  2BPM B;  1W4S A;  2WPA B;  3JCM h;  2BE7 D;  2YLB A;  3CC7 Q;  5IHK A;  2COY A;  2J05 A;  4EOJ B;  2B8A A;  1BU2 A;  2RQT A;  3TU4 K;  3MEU A;  4MFD A;  4JJN K;  1V1C A;  3PTA A;  2DBM A;  3V8K A;  3CCV A;  2V26 A;  2EJF A;  2K5F A;  2XIC A;  2RQU A;  2RO0 A;  2Y90 A;  2FZK B;  1HSQ A;  1QWE A;  1E6G A;  1H3H A;  2FG0 A;  1X01 A;  3MPU B;  2JM8 A;  3WVE B;  1VQ5 T;  2R57 A;  1D1A A;  1FMW A;  4HVU A;  2C0O A;  2VGM A;  2YXY A;  4XU1 A;  5DM7 R;  1JQQ A;  3OYH A;  5GAO n;  1N8R U;  2FEI A;  4XTU A;  2KYB A;  4M77 F;  5DLQ E;  1R0B G;  4LOC A;  4M7D A;  4M78 D;  2V1R A;  4X34 A;  2K2M A;  1E6H A;  1S1N A;  2XDD A;  3OSS C;  1PRL C;  4F7U E;  5D6W A;  2JS2 A;  3QZ9 B;  2DJZ A;  2IG0 A;  1X2K A;  3UWN A;  1Q86 U;  2EVR A;  3PVL A;  1R0C B;  2RB6 A;  5GAN h;  1IXD A;  1W2B P;  3KXT A;  4V2S A;  1HK9 A;  5GAN 4;  4E7J A;  5FU6 C;  4C8Q A;  1YHQ Q;  1OV3 A;  5J3B A;  2ED1 A;  2FZC B;  1K0S A;  1MMD A;  1QMZ B;  3PNW C;  4IUU A;  4BD3 A;  2A37 A;  3CEY A;  4IMY B;  2HBP A;  1IHV A;  4F7J B;  2GTO A;  1U1T A;  1KC8 C;  3X26 B;  2ATC B;  2M1H A;  2A08 A;  3P8B B;  1WHL A;  4FT4 A;  1M1K U;  2DFU A;  2O31 A;  4P5N A;  2AK5 A;  2K57 A;  3VJP A;  1JXM A;  1UJY A;  2P4T A;  2J7I A;  1VQP T;  4XU3 A;  2K7A A;  3BLR B;  1ZA1 B;  5KYU A;  2QQR A;  5GAO q;  2MIO A;  3RES A;  3DOG B;  3CCQ T;  2HQH A;  5DY9 A;  1YJ9 A;  1ACM B;  1QCF A;  5BNJ B;  3JCM b;  2BUD A;  2FHD A;  1QLB A;  2JXB A;  1C6V X;  1VQ6 T;  4C8Q B;  1U5S A;  3JV3 A;  1NPP A;  4M77 D;  2YRD A;  3QYE A;  4M7A C;  3NTH A;  1WHJ A;  3CME T;  1M90 R;  1WZO A;  2PHG A;  1JO8 A;  3D7S B;  3EG0 A;  9ATC B;  1QVF P;  2EQJ A;  5GAN g;  3V7C A;  4ZN3 A;  4J9E A;  1AVZ C;  5EC7 A;  1LJO A;  2QGS A;  1C0M A;  1KIK A;  3HRT A;  3FRN A;  3KHI A;  2WAC A;  2RQV A;  2BZ8 A;  4OMM A;  4IUV A;  2VUB A;  4RTU A;  4II5 B;  3R6O A;  2EGE A;  2E5Q A;  3TEE A;  1QMC A;  2DL5 A;  2YUO A;  3MP1 A;  3CMA Q;  5KYU B;  5ICP B;  1W98 B;  3BG3 A;  4RG8 A;  4JJD A;  2GTJ A;  3SB2 A;  1UGQ B;  2JZ2 A;  2ZGW A;  2CCI B;  3EJ1 B;  3CCU A;  2DM1 A;  2DXT A;  4ELJ A;  1RAC B;  2RHY A;  2QYZ A;  4GBQ A;  4M7D F;  4JJC A;  3AT1 B;  4EC8 B;  2LCL A;  3EGD A;  3FIF A;  1Q81 C;  5L23 A;  2C4G B;  2J6O A;  2KT8 A;  2VV5 A;  3ER0 A;  4M7A E;  4JX5 A;  1WYX A;  1NLO C;  2KI7 A;  5GAN 6;  2YLC A;  4ZGJ B;  2O9S A;  3DL1 A;  1ARK A;  4BE0 A;  2MMP A;  2CP5 A;  4EDU A;  5KCH A;  2A0F B;  3H6Z A;  1YJW Q;  2WFY B;  2CSI A;  2LQN A;  3DJB A;  3JB9 G;  1UFF A;  1QQJ A;  3HPW A;  1JOW A;  2DMO A;  2I40 B;  4J9G A;  3RGF B;  4M75 A;  2KXD A;  2CS7 A;  2JOY A;  1PRM C;  4MML A;  3SFM A;  3LH0 A;  4EMH A;  4PK4 A;  2DK3 A;  3DDP B;  5LJ3 g;  4CC4 B;  4FSS A;  4QQD A;  2ABL A;  3MEW A;  2E64 A;  3VS2 A;  3EGD B;  4BCM D;  1VIE A;  1K8A R;  1NYG A;  4C0D B;  3G6E A;  1JJ2 P;  2ZPB B;  1I4K 1;  2DEQ A;  4IKF A;  3POM A;  2EBP A;  1OI1 A;  2UZE B;  1UHF A;  3QYG B;  2PUO B;  2E5K A;  3A98 A;  4Y72 B;  3RER A;  1KC8 U;  3M03 A;  2JVV A;  3GF5 A;  2H8H A;  2EUF A;  2LZ6 B;  2I2L A;  2O88 A;  2QA4 A;  2D1X A;  3G1J A;  2L3Q A;  3BDL A;  4M7D D;  2SEM A;  3L1A A;  4C8Q G;  4ELL A;  1RL2 A;  4AT1 B;  4M75 B;  1RUW A;  1IZ6 A;  1KQS A;  3VU3 C;  5GMK e;  2LC4 A;  4JS5 A;  3BHT B;  3MIA B;  3I55 T;  1I5O B;  3V7R A;  4UC4 A;  2E41 A;  5HK0 A;  4CFW B;  3OBY A;  5ACB A;  4F7U A;  3TVT A;  3LGF A;  5GAM j;  2KR6 A;  2O4X B;  1K76 A;  3G4S Q;  4J7F A;  1H64 1;  4IUP A;  3VUZ A;  3CCV T;  2DE0 X;  1VYV A;  1M27 C;  3QHW B;  2AIR B;  5GAN 8;  3CCM A;  2RI2 A;  2EYY A;  1NEB A;  2DTO A;  1NBE B;  2DXC A;  3RMQ A;  4OGE A;  1PM3 A;  2HNI A;  4J6X A;  1ZHI A;  3CD6 T;  2IPO B;  1ZUK A;  1WXU A;  1SPK A;  1X43 A;  3DB4 A;  3Q1J A;  2V8K A;  2KQW A;  2LX7 A;  3OB9 A;  2J6F A;  4JJB A;  1K9M R;  1VQN A;  3H9N A;  1QWF A;  1LOJ A;  1G5V A;  2F2W A;  4LXC A;  3FJP A;  2GCX A;  3NPF A;  2X4J A;  4CXA B;  3EFR A;  1VYT A;  3JCM W;  1VQ9 A;  4HT9 A;  2QTX A;  2G6F X;  1M30 A;  4HVV A;  5D6Y A;  2XI9 A;  4BE2 A;  2HSE B;  4F7U B;  5I2M A;  3QWX X;  4K11 A;  2DXB A;  3JCM X;  2RPN A;  1N9S A;  2VWF A;  4M75 F;  4KRT A;  4F7N B;  1Q81 U;  2P0P A;  3FB9 A;  1VQO A;  3OS1 A;  1Q81 R;  5GAM f;  5GJW B;  2PJQ A;  1VA7 A;  5DQV A;  2KR3 A;  1KSW A;  3NFC A;  4JLI A;  4HA8 A;  1WA7 A;  1OKW B;  4BCO B;  1WHH A;  5A0D A;  1QVF A;  4CFM B;  2LJ3 A;  2DKG A;  1KHC A;  1UEC A;  3VS3 A;  4KGX B;  1RI9 A;  3EH2 A;  1LCK A;  4J9F A;  2WHB B;  2W0Z A;  2E1H A;  1VQM A;  1H26 B;  2OAU A;  1VQL Q;  3OYL A;  4KGV B;  2KBT A;  3CCS A;  4C5E A;  2X4Y A;  1ZBJ A;  2DD5 A;  1OI9 B;  1Y57 A;  4Q5W A;  1H1Q B;  2DXB B;  1YIT A;  1YJ9 T;  2AKK A;  2R58 A;  4EOM B;  2CZ7 B;  4EOP B;  1K1Z A;  5GJV B;  3O0G D;  1UGR B;  3VKI A;  4IUQ A;  1GXI E;  4HKE A;  2AT1 B;  2CH4 A;  2JN0 A;  5FU6 B;  3CC7 A;  2CRE A;  4Z02 A;  4M7A A;  4F7U F;  2M0O A;  2D9T A;  1AWO A;  3CPW S;  2MI6 A;  4AKH A;  2MK5 A;  1H1P B;  5LQF B;  3NMZ C;  2BKD N;  3OYC A;  4YTL A;  5KH6 A;  4M75 D;  1KD1 C;  2KRS A;  3EG1 A;  2QI2 A;  3F5X B;  3QO3 A;  6AT1 B;  2OTJ A;  4MIM A;  2CH4 W;  5IHI A;  4QQG A;  2UZB B;  1ZUU A;  4D6W A;  2C5V B;  4ESR A;  4DOW A;  3CCU T;  3PT9 A;  5LJ5 e;  3SWN C;  3CC2 Q;  4XTX A;  2VVK A;  1E7P A;  2QA4 Q;  4E7K A;  1AEY A;  4E7H A;  2DTI A;  3H0F A;  2LW4 A;  1QP2 A;  2ZZD A;  3I35 A;  2F69 A;  4M7A B;  2E6N A;  3I56 Q;  1VOM A;  2XK0 A;  4C92 C;  4C5G A;  4ROD A;  1JJ2 A;  3THK A;  1XTD A;  4LN2 A;  3M0Q A;  2FVU A;  3PIO A;  4KT0 E;  2V22 B;  4ATO A;  1B7T A;  2CP3 A;  2DET A;  4EOQ B;  1PD0 A;  2KEA A;  3HP9 A;  2ZPE B;  2DZC A;  4EOI B;  4J6W A;  2MYS A;  2DER A;  3JCM Q;  5GAN 7;  2DNU A;  3CCM Q;  3QG1 A;  3VV0 A;  3L2V A;  1D3B A;  3JCM J;  1Q7Y R;  1TFB A;  1BB9 A;  4WCI A;  1JST B;  3CBM A;  3M4G A;  2K3B A;  1QW1 A;  5DQW A;  2W10 A;  2O01 E;  3SD4 A;  3LQ5 B;  1Y7X A;  2WMB B;  2JGZ B;  4IUT A;  4QT7 A;  2KRN A;  2R7G A;  1VQN Q;  2QAZ A;  8ATC B;  2KE9 A;  2A36 A;  3OS5 A;  2ZZD B;  1E7O A;  2ED0 A;  2RJD A;  4BUG A;  3G6E T;  2WEV B;  4PJN A;  4QQ6 A;  4A4K A;  4HNV A;  2FPE A;  2KVQ G;  2NLU A;  2CZ1 B;  2JTF A;  4C92 E;  3E2U A;  4CC7 A;  2D8J A;  2DIL A;  5L8R E;  3L2W A;  1OL2 B;  5CCA A;  4EMK B;  1YWO A;  2VYT A;  1W70 A;  5HY6 A;  1VQ4 Q;  3MY5 B;  2E4H A;  2M9U A;  2UZD B;  1RAG B;  2DL3 A;  3VRZ A;  1QVP A;  1D3B B;  3OYJ A;  1HJD A;  7AT1 B;  4JRI A;  3QJY A;  4NL3 A;  3OYF A;  2L3R A;  4MZT A;  1D0X A;  3ULR B;  5LJ5 d;  2LQW A;  2HL5 C;  3QJ6 A;  2EWN A;  1YP5 A;  4G6L B;  3QHS A;  3E9G A;  1M90 C;  4J9H A;  1GY3 B;  4EOL B;  3RNJ A;  3CMA A;  1V29 B;  2CP6 A;  4PJO C;  4E6R A;  4OGR B;  3EFO A;  4Z88 A;  2EQM A;  1JEG A;  5HBH B;  2FRY A;  4AKG A;  3RIR A;  3KFV A;  2FB7 A;  3LX7 A;  2DJQ A;  5KYW A;  2KY9 A;  4N4H A;  2P0Q A;  5FLX E;  2ZPG B;  5DLO A;  1VQK Q;  1OEB A;  1T3S A;  3A8H B;  4N0A C;  1OU8 A;  1RAD B;  4LUE A;  1KD1 U;  2JTM A;  2V8I A;  2MOX A;  4EOS B;  2YDL A;  1XO2 A;  1KD1 R;  1VQ9 T;  4M7A G;  1OYX A;  1H4L D;  2G3R A;  1YJW A;  1FMV A;  2DME A;  3TNI B;  3QHR B;  1ZBX A;  1LPL A;  3BLH B;  5HK3 A;  5FU7 C;  3J7A F;  1RAF B;  1AWX A;  2DEU A;  1SG5 A;  3TQ7 P;  5KE3 A;  5GMK j;  3TRE A;  2OTL T;  2HDA A;  4CRL B;  2L8D A;  3EFO B;  1GUX A;  4PJO E;  2BE9 B;  1WNL A;  1K9A A;  2L2P A;  3RKY A;  2RMO A;  3M0R A;  5GAN 3;  4EC9 B;  1IB8 A;  2OTJ Q;  3GBQ A;  5GAM d;  1BK2 A;  3CCL T;  5KYW B;  1KQS P;  4OMO A;  2QDL A;  1R8O B;  3X24 B;  4JLG A;  1HD3 A;  1AOJ A;  1MV0 B;  2R5A A;  5LL6 S;  3EHR A;  2ZPH B;  3QDF A;  3VUB A;  2CUB A;  4FL6 A;  4R55 A;  5HQ0 B;  4OMP A;  1I07 A;  2QF7 A;  2I0N A;  1E9H B;  3MJX A;  1BCO A;  3TNW B;  1VQM T;  4TVR A;  5A2Q E;  2X51 A;  1AD6 A;  5M9O A;  1JSU B;  2CZ0 B;  4LE9 A;  3HRS A;  5GAN 2;  1BIB A;  1BI2 A;  1M3B A;  3JCM P;  1RAI B;  3CCS T;  4HNT A;  5CKF A;  1WJQ A;  4ELZ C;  1K8A C;  3RDV A;  1YIT T;  1FVV B;  1FMK A;  4YOO A;  1OKV B;  1CKA A;  2HKQ B;  3JCM g;  4CRI A;  1GUX B;  1WXT A;  1WJS A;  2PK2 A;  2RQR A;  1M2O A;  3H4C A;  3QYH B;  3BHU B;  2C5O B;  3CPF A;  3M0P A;  3CC7 T;  2JTE A;  1MNE A;  5KCO A;  1YBY A;  2DA9 A;  3ZEH A;  3WXM B;  2L3S A;  3G4S A;  4J83 A;  2HKN A;  1YIJ T;  1NLP C;  3VRY A;  1IRE B;  3I9Q A;  1M3A A;  3N5B B;  2CJM B;  1OX9 A;  2BS2 A;  1OX8 A; 
#chains in the Genus database with same CATH homology
 3KUF A;  4HL4 A;  4A4F A;  3GNF B;  5GMK m;  2WJ9 A;  1OI1 A;  4N4G A;  3QYG B;  3ASK A;  2PUO B;  4C8Q C;  2DVE A;  5I2S A;  1VQO A;  3RER A;  1KC8 U;  1UGS B;  3A8M B;  4PLL A;  2JVV A;  3GF5 A;  3CCM T;  4BBS M;  2RA2 A;  1M9S A;  3HFN A;  2PU9 B;  2I2L A;  3RMS A;  1U1S A;  4M75 G;  5GAN e;  3OA6 A;  3CPW A;  2EJ9 A;  2QA4 A;  1Y07 A;  2E10 A;  4ZTF A;  3HRU A;  1WQ7 A;  4OMF B;  3BDL A;  1G3Y A;  2BIV A;  4MDW A;  4M7D D;  3L1A A;  1I81 A;  3PFS A;  4C8Q G;  1KHI A;  1RL2 A;  4M75 B;  3HBL A;  1IZ6 A;  1KQS A;  3VU3 C;  4GLK A;  2LC4 A;  2XID A;  4DQ2 A;  5GMK e;  4JS5 A;  4ZTJ A;  1DJ7 B;  3I55 T;  2QQA A;  3HL8 A;  1M90 U;  5GAM g;  3V7R A;  2XKO C;  5GAO p;  1YIJ A;  2ZPI B;  3QWL A;  1PSE A;  3MCA B;  4M77 B;  4UC4 A;  2E41 A;  3M56 A;  5HK0 A;  1VQN T;  1N9R A;  3P8H A;  3SWN A;  2MF2 A;  4JX6 A;  3OBY A;  3OBW A;  3S3M A;  2EQK A;  4F7U A;  3GP8 A;  4DA4 A;  2RI3 A;  2D0Q B;  4J6Y A;  2MWO A;  3G7Z A;  4HCB A;  3WVD B;  4RG2 A;  5GMK i;  3LGF A;  5GAM j;  2KR6 A;  2H3J A;  2EFI A;  2O4X B;  4BI3 A;  3OS0 A;  4BI4 A;  1K9M C;  2CGH A;  4J7F A;  4M78 A;  3M57 A;  4NS5 A;  1H64 1;  1TH7 A;  4IUP A;  3VUZ A;  3ZBD A;  3J81 E;  3LWI A;  3P8D A;  2KMT A;  3CCV T;  3OW2 S;  2VXF A;  5GAN 8;  3CCM A;  1EIF A;  2E6Z A;  2XU8 A;  2RI2 A;  4AKI A;  3C12 A;  4PJO D;  2DD5 B;  2DTO A;  4XU2 A;  3JCM f;  3CCQ A;  2QQS A;  2DXC A;  2F5T X;  3RMQ A;  4LD6 A;  4OGE A;  1YHQ T;  2JNG A;  3C95 A;  2K4Y A;  3FDR A;  1VQ4 T;  2HNI A;  1BKB A;  4J6X A;  1ZHI A;  4M75 E;  1Y71 A;  5IT9 E;  3CD6 T;  2VC8 A;  3CC4 T;  5CVI A;  1S72 A;  3HFO A;  3Q1J A;  3DB4 A;  3X28 B;  5GAO l;  3I55 A;  1U8R A;  4C8Q E;  4PLI A;  5LJ3 f;  5GMK l;  3HO8 A;  4QVD A;  4E7I A;  2V8K A;  4JRK A;  2KQW A;  2KMG A;  3OB9 A;  2WSE E;  4BB7 A;  1VQO T;  1VQN A;  2LRQ A;  4M7A D;  1AHJ B;  1LOJ A;  1W2B S;  1G5V A;  3X20 B;  1O75 A;  2YRV A;  3FJP A;  2KK4 A;  4OF1 A;  4BAC A;  3ME9 A;  4HCZ A;  2GCX A;  2X4J A;  3DLM A;  3HZJ A;  2ZPF B;  3EFR A;  5C6S A;  3JCM W;  4F7U G;  3TW7 A;  4QVC A;  1VQ9 A;  2L89 A;  4HT9 A;  2QTX A;  4L5G A;  4FT2 A;  1VQL A;  5D6Y A;  3SWN B;  2XI9 A;  3QUI A;  3V8L A;  3OMC A;  3GPL A;  4NC6 A;  4BE2 A;  1FX7 A;  1N8R C;  2L5Q A;  4OGC A;  3VYG A;  4PKC C;  4F7U B;  5LJ5 g;  4M78 G;  2DO3 A;  5I2M A;  3OYI A;  3JCM e;  1MGQ A;  1YHQ A;  4ME7 A;  2EYQ A;  1B34 A;  2HQX A;  1Q82 U;  4ZGE B;  1RI0 A;  2QDY B;  4EMG A;  2DXB A;  3CD6 A;  1UGP B;  3S3O A;  3OSV A;  3JCM X;  3MO8 A;  1N9S A;  4B9W A;  4EMK C;  4C92 B;  5LJ5 j;  2C06 A;  4M75 F;  1Q81 U;  2HAX A;  4JX4 A;  5LJ3 e;  1G3W A;  2P0P A;  3SDZ A;  4BDY A;  3FB9 A;  3E19 A;  3L42 A;  2LNV A;  2V8J A;  4C8Q F;  4ZN1 A;  4LDY A;  3OS1 A;  4BDZ A;  4HLQ A;  1O9S A;  4RCC A;  5GAM f;  2DTH A;  5EJC A;  2ZCF B;  1VQ7 A;  5FRM A;  1VQK T;  4C0D C;  1Q86 C;  2XDP A;  5D6X A;  3JB9 J;  1NJI U;  3NFC A;  4JLI A;  3M55 A;  4HA8 A;  4JRP A;  4M6V A;  3GOX A;  4C0Z A;  4LDX A;  4LDV A;  4RCB A;  3OYK A;  1OZ3 A;  4M77 A;  5J26 A;  5A0D A;  1QVF A;  1YI2 A;  2DKG A;  1KHC A;  1KG1 A;  3JAM E;  2DIG A;  3L2Z A;  3A5Z B;  5CKB A;  4QW2 A;  3JB9 D;  1K8A U;  3O8V A;  3M4Y A;  4L59 A;  5I21 A;  5IN1 A;  2GF7 A;  3QII A;  2K3Y A;  4M78 E;  4HCC A;  2E1H A;  2LX9 A;  1YCY A;  2O4X A;  2P0K A;  4KBM B;  4MZP A;  4CI0 C;  2OAU A;  4E47 A;  5GAO r;  3OYL A;  2DD4 A;  3NTK A;  1HXD A;  2CKK A;  4XTV A;  1BYM A;  2EJG A;  3LW5 E;  4PL6 A;  4J8O A;  3UDC A;  3CMA T;  1QVF S;  3JRZ A;  3CCS A;  4DOV A;  1YJN A;  4C5E A;  2X4Y A;  1MHN A;  1M1K C;  2EAY A;  2QEX A;  2DD5 A;  1B34 B;  3KBG A;  4C0G A;  5GAO m;  1KQ2 A;  4M75 C;  2VXE A;  5CAI A;  5GMK h;  5CKD A;  4Q5W A;  3URG A;  4PJO A;  2DXB B;  2A3L A;  1YIT A;  1YJ9 T;  1K73 C;  3TCJ A;  5GAM e;  1NZ9 A;  2R58 A;  3JB9 I;  5J39 A;  3OYA A;  2PVG B;  2CZ7 B;  3C4S A;  2CZ6 B;  2RHI A;  4RMO A;  4FIB A;  1UGR B;  1M1F A;  2IVW A;  4XK8 E;  4M77 C;  2OTJ T;  3VKI A;  2LT4 A;  5C0M A;  1M8V A;  4IUQ A;  4OB3 B;  1GXI E;  4A4G A;  4HKE A;  3CC2 A;  1VIF A;  2DPP B;  3OS2 A;  2EQU A;  1BI0 A;  3G71 T;  4FU6 A;  1VQ8 A;  2LQ8 A;  4BI8 B;  4JS4 A;  3JB9 H;  2WSF E;  1X75 C;  2JN0 A;  2QFZ A;  2QQB A;  2E65 A;  5FU6 B;  3GNG A;  3CC7 A;  3UPU A;  3NTI A;  4Y91 A;  4Z02 A;  4A4H A;  3I56 A;  3QSU A;  4M7A A;  4M7D B;  4F7U F;  5LJ5 f;  4M77 G;  3JCM c;  1KQ1 A;  2M0O A;  1BI1 A;  2RJF A;  4O6J A;  1JB0 E;  3EAE A;  4OB1 B;  2Y4X A;  4N0A A;  3DLL A;  2D9T A;  2WSC E;  1NE8 A;  3M53 A;  4M78 F;  2MI6 A;  3CPW S;  1G3S A;  1WJR A;  2FL7 A;  4AKH A;  1WPY A;  1XQH A;  4OB2 B;  3E9F A;  5HKC A;  4NL2 A;  1X6O A;  2X4W A;  3VKH A;  3MHX A;  3QXE B;  2RJC A;  1KQS S;  2BKD N;  3OYC A;  3QKJ A;  4YTL A;  3PGG A;  4M75 D;  4N4I A;  4A4E A;  5KH6 A;  3CCR T;  2DD4 B;  3JCM d;  4JDS A;  2QI2 A;  3QO3 A;  4C8Q D;  3DB3 A;  2OTJ A;  2LDM A;  3M59 A;  4MIM A;  3M54 A;  2RD1 A;  4C92 A;  3QZ5 B;  4HT8 A;  2QXF A;  5CKH A;  4ELY C;  3S3N A;  4QQG A;  3F70 A;  2PVD B;  4Y28 E;  2X4X A;  2JUF A;  3JSC A;  3MET A;  2CYZ B;  4D6W A;  4PJO B;  4C5H A;  4DOW A;  5LJ3 d;  4FSX A;  3CXC A;  3CCU T;  3PT9 A;  5A0L A;  4NOY A;  2RK1 A;  3OMG A;  2RM4 A;  5LJ5 e;  3J80 E;  3SWN C;  1ZQ1 A;  2RI5 A;  1K9M U;  4OB0 B;  1W4S A;  2EKO A;  2MAM A;  2PUK B;  4QVZ A;  4XTX A;  1E7P A;  4BBR M;  4BY6 B;  4M77 E;  4E7K A;  3JCM h;  4E7H A;  2DTI A;  2YLB A;  3BG5 A;  1QP2 A;  2ZZD A;  3V8J A;  2F69 A;  4M7A B;  2E6N A;  4M78 C;  3OYE A;  2PVO B;  3TU4 K;  2B8A A;  2F5K A;  2XK0 A;  3MEU A;  4MFD A;  4C92 C;  4C5G A;  3QYB A;  2HD0 A;  5CO7 A;  4JJN K;  1Q7Y C;  3VKG A;  3L2Q A;  5LJ3 h;  3PTA A;  1JJ2 A;  3OYD A;  1XTD A;  3V8K A;  4A53 A;  3CCV A;  2EJF A;  2FVU A;  2RK2 A;  2K5F A;  2D6F A;  2XIC A;  3PIO A;  4KT0 E;  2RO0 A;  4ATO A;  2Y90 A;  2RHX A;  4XU0 A;  3JCM V;  2VGN A;  3OYB A;  1X01 A;  1Y96 A;  1VQ5 T;  4QSH A;  3WVE B;  4MDX A;  4C92 G;  3HP9 A;  3HSB A;  2R57 A;  3C94 A;  2ZPE B;  1VQ4 A;  2BS3 A;  2DZC A;  4J6W A;  5CK9 A;  5FU7 B;  2DIQ A;  1QVG A;  3CC4 A;  3JCM Q;  2LTO A;  1JJ2 S;  5GAN 7;  4XQ3 A;  2E12 A;  2VGM A;  3QG1 A;  4XU1 A;  3VV0 A;  5DM7 R;  3L2V A;  3GLX A;  1D3B A;  3JCM J;  3OYH A;  5GAO n;  1N8R U;  4XTU A;  2KAF A;  4L6V 5;  4M77 F;  3CCJ T;  5DLQ E;  3CBM A;  5CR2 A;  4LOC A;  1N27 A;  3M4G A;  5CQX A;  5GAN d;  3LYI A;  1SSF A;  4M7D A;  1FWZ A;  1QW1 A;  4M78 D;  3CCE T;  4XTZ A;  4X34 A;  2O01 E;  3SD4 A;  2XDB A;  1Y7X A;  3A8L B;  4MZM A;  4IUT A;  3OYN A;  4HNU A;  1M5Q 1;  3PMI A;  4O5V A;  3V7S A;  3OSS C;  2XDD A;  3OS5 A;  2ZZD B;  2GFU A;  5D6W A;  4F7U E;  3PIP A;  2RJD A;  4BUG A;  3G6E T;  4GY5 A;  3FLG A;  3QZ9 B;  2DJZ A;  3OYM A;  1VQ5 A;  4QQ6 A;  4A4K A;  3A8G B;  3QPH A;  3OYG A;  2IG0 A;  4HNV A;  2DAQ A;  2KVQ G;  1JBM A;  3MP8 A;  4FM4 B;  4LDU A;  3UWN A;  2NLU A;  1Q86 U;  2CZ1 B;  2JTF A;  3BY7 A;  4C92 E;  2DZ9 A;  5GAN h;  2RB6 A;  1FKM A;  4IUR A;  4LDW A;  1QP3 A;  5L8R E;  3L2W A;  5CCA A;  3KXT A;  4V2S A;  1HK9 A;  5GAN 4;  1Y96 B;  4E7J A;  5FU6 C;  4EMK B;  4C8Q A;  4B9X A;  1KD1 C;  5J3B A;  4OP0 A;  4M7D C;  2VYT A;  5HY6 A;  3E1S A;  5CKE A;  3PNW C;  2M9U A;  4IUU A;  1VQK A;  3EFS A;  2RHZ A;  4BD3 A;  3CEY A;  5FRN A;  3MEV A;  2HBP A;  1QVP A;  1D3B B;  3OYJ A;  1OZ2 A;  5FRO A;  2K2V A;  1U1T A;  1KC8 C;  4JRI A;  3X26 B;  3QJY A;  2M1H A;  3M5A A;  3MEA A;  4NL3 A;  3OYF A;  4M7D G;  2L3R A;  4MZT A;  4ZGD B;  3P8B B;  4FT4 A;  5LJ5 d;  1M1K U;  3CBO A;  4P5N A;  3INZ A;  4XTW A;  1K73 U;  3L2U A;  4JRQ A;  3QJ6 A;  2K57 A;  3VJP A;  2EWN A;  1BIA A;  5AYF A;  2KSS A;  2Y4Y A;  2LT1 A;  2P4T A;  3QBY A;  3M58 A;  3OY9 A;  3QHS A;  3UT1 A;  1VQM A;  1N6A A;  3E9G A;  4R56 A;  1M90 C;  1NPR A;  3CMA A;  1V29 B;  4XU3 A;  3RKX A;  2XHC A;  1YJW T;  1VQP T;  4PJO C;  4C92 F;  2QQR A;  5GAO q;  5CIU A;  3RES A;  3S6W A;  2K5L A;  3CCQ T;  2EQM A;  5DY9 A;  1YJ9 A;  4EPC A;  5LJ5 h;  3FC3 A;  4X9D A;  4LD9 K;  3JCM b;  4AKG A;  1M4Z A;  1WQW A;  2BUD A;  2FHD A;  4BY6 C;  3RIR A;  1QLB A;  2DXU A;  4PJO G;  2LCC A;  1S72 T;  2MWP A;  1VQ6 T;  4C8Q B;  4M77 D;  1NPP A;  2FB7 A;  3G71 A;  3T9N A;  4X9C A;  3QYE A;  3LX7 A;  2BS4 A;  3NTH A;  2KY9 A;  4N4H A;  3OW2 A;  4M7A C;  3ZFJ A;  2P0Q A;  3OQ5 A;  4J5Y A;  3HB9 A;  2ZPG B;  5FLX E;  5DLO A;  1BI3 A;  3CME T;  3A8H B;  3H8Z A;  4M7D E;  4N0A C;  1KD1 U;  2JTM A;  2V8I A;  3RKW A;  2EQJ A;  5GAN g;  3V7C A;  3QDR B;  4ZN3 A;  4A54 A;  1LJO A;  3LWH A;  3HRT A;  3FRN A;  1VQ9 T;  1OYX A;  4VUB A;  3KHI A;  2WAC A;  1I5L A;  2XD0 A;  2G3R A;  4M7A G;  2X35 A;  1VQP A;  1YJW A;  1VQL T;  1ZBX A;  4E7L A;  5HK3 A;  5GAN j;  5FU7 C;  3J7A F;  4IUV A;  2RJE A;  3CXC S;  2VUB A;  4MFE A;  3VYH B;  3R6O A;  3CCR A;  1PSF A;  4AI6 A;  1UB4 A;  3MP6 A;  1W2B A;  2E5Q A;  3TEE A;  1G3T A;  4OVA A;  5KE3 A;  5GMK j;  4KUL A;  4C0F A;  3TRE A;  3MP1 A;  1VQ6 A;  2OTL T;  4II1 A;  5A0G A;  3BG3 A;  4RG8 A;  2XG8 D;  3LGL A;  1H3Z A;  2L8D A;  1WGS A;  3PMT A;  4XTY A;  3AHU A;  4PJO E;  4EMK A;  3SB2 A;  1UGQ B;  2JZ2 A;  1WNL A;  2ZGW A;  3CME A;  4Z6Y A;  4JUV A;  3RKY A;  3CCU A;  5GAN 3;  2DXT A;  3X25 B;  1Q82 C;  1FXX A;  2LQK A;  1VQ7 T;  4ELJ A;  2RHY A;  1Q7Y U;  2LVM A;  5GAM d;  4M7D F;  2RHU A;  3CCL T;  2LCL A;  2R5M A;  2HQE A;  2QQ8 A;  3FIF A;  1Q81 C;  2KDS A;  4RKU E;  1P92 A;  1R8O B;  2A7Y A;  2EIF A;  3X24 B;  2VV5 A;  4JLG A;  3ER0 A;  5CQY A;  1YI2 T;  3M9Q A;  4M7A E;  4JX5 A;  1QVG S;  2R5A A;  2FYK A;  2YHT A;  5LL6 S;  2ZPH B;  2AHJ B;  3VUB A;  5GAN 6;  5GAN 5;  4FL6 A;  2YLC A;  3BFM A;  4R55 A;  4ZGJ B;  4M78 B;  3DL1 A;  4C92 D;  2QF7 A;  4BE0 A;  2K5I A;  2QQ9 A;  1NJI C;  2MMP A;  1VQM T;  4TVR A;  4EDU A;  1XNI A;  2RH2 A;  5KCH A;  3G4S T;  2OTL A;  3H6Z A;  5A2Q E;  5M9O A;  2CZ0 B;  3JB9 G;  2K3X A;  5GAM h;  3HRS A;  3LLR A;  5GAN 2;  2G77 A;  3DKM A;  2DXC B;  1BIB A;  1BI2 A;  3CBP A;  5EG2 A;  3CCS T;  5KE2 A;  4C5I A;  3JCM P;  1YJN T;  4HNT A;  5CKF A;  2QEX T;  1WJQ A;  4KUI A;  4ELZ C;  1K8A C;  3HPW A;  1XOV A;  3L2R A;  3FEO A;  4PJO F;  4KUD K;  1YIT T;  1I8F A;  1UEB A;  3OYY A;  3BG9 A;  3BW1 A;  3TW6 A;  1VUB A;  4M75 A;  3JCM g;  3CCL A;  4CRI A;  2CS7 A;  2JOY A;  2QDJ A;  4WF2 A;  2E70 A;  4MML A;  5GAN f;  1WJS A;  3SFM A;  3LH0 A;  3CC2 T;  4EMH A;  1VQ8 T;  1M1G A;  3H4C A;  3QYH B;  4MMK A;  2GFA A;  4XAX B;  2QA4 T;  3CCJ A;  3CPF A;  2DK3 A;  3CC7 T;  4J7I A;  5LJ3 g;  4BE1 A;  3CCE A;  4QQD A;  3I56 T;  3MEW A;  5KCO A;  2E64 A;  4M7A F;  4PNO A;  1YBY A;  3ZEH A;  3HHT B;  3WXM B;  1VIE A;  3RUX A;  3G4S A;  4C0D B;  2M16 A;  4J83 A;  3JB9 F;  3GIB A;  1YIJ T;  3BDU A;  1LNX A;  2PQW A;  1IRE B;  3A8O B;  3VYG B;  3G6E A;  5LJ3 j;  3N5B B;  5IAY A;  2ZPB B;  2BS2 A;  1JRI A;  1I4K 1;  2GQV A;  2DEQ A;  3HKS A;  4IKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...