3X28B

Crystal structure of nitrile hydratase mutant br56k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction intermediate of nitrile hydratase determined by time-resolved crystallography reveals the cysteine-sulfenic acid ligand to be a catalytic nucleophile
rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x28B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x28B02
1PSEA 4OB1B 2PVDB 1UGSB 5L8RE 2ZPHB 1UGQB 3X24B 1UGRB 3WVDB 2ZPIB 2O01E 2CZ7B 3A8OB 3X20B 2PU9B 3QZ5B 2DPPB 2ZZDB 2D0QB 2ZPEB 4ZGEB 1DJ7B 1JB0E 2DD4A 1QP3A 3A8LB 2DD5A 2ZPBB 3QYHB 2ZPGB 1QP2A 2CYZB 3X28B 1IREB 2CZ0B 1V29B 4OB0B 4OB3B 3A8MB 4L6V5 2DD5B 4KT0E 4ZGDB 2QDYB 2CZ1B 2AHJB 2ZZDA 3VYHB 4OB2B 3X26B 1PSFA 3QYGB 2DXBB 3A8HB 2DD4B 3X25B 2DXCA 2DXCB 4ZGJB 4RKUE 4FM4B 3A8GB 1UGPB 3LW5E 4XK8E 3QZ9B 2PUKB 2WSCE 2PVOB 3WVEB 2DXBA 1GXIE 2CZ6B 3VYGA 3VYGB 2ZCFB 2ZPFB 2WSFE 2PVGB 2PUOB 3QXEB 3HHTB 2WSEE 4Y28E 1AHJB
chains in the Genus database with same CATH superfamily
4LDXA 2YRVA 1M30A 4J6WA 4DOVA 1UGSB 3RMQA 3CC2A 3WVDB 4C0FA 4EOQB 3GNFB 2KAFA 1Q7YR 4RTTA 2MIOA 1Y07A 1OULA 2VGMA 5KYYB 4M75F 1XOVA 4J9HA 1AWOA 2WMBB 4OMNA 2C0TA 3PIPA 1XO2A 4PKCC 4ZTJA 3SDZA 3BE3A 4M7AD 3HTRA 3CCLQ 2F2WA 2JM8A 1OKVB 1I1JA 4EDUA 1WXBA 2DX1A 1M1KC 1X2KA 3HFOA 4GLMA 3SD4A 2IW6B 2RJCA 3ASKA 2LNVA 4FIBA 1E7PA 1D09B 2ZZDA 1KD1C 3TSWA 4JDSA 2J06A 4JPBW 1M3BA 4BI3A 2QYZA 3D7SB 5FRMA 1QVPA 2BZYA 2CP6A 2XI9A 1K0SA 1FVVB 1OPLA 3X25B 3OS2A 3G6ET 1H3ZA 3LGLA 2WJ9A 1VQ9T 4N4GA 5GAOm 4JRPA 3EG9A 1RI9A 4BACA 5I5ZB 5I2SA 1SPKA 4RG2A 3VUZA 3O8VA 5AT1B 3G4SA 2UZDB 1ZLMA 2K3BA 1VQ7A 2P84A 5D7UA 1VOMA 2JMCA 2BE9B 1VQPA 4HT8A 4PJOE 1M90R 1M9SA 3UATA 2YXYA 3OW2P 4QQGA 2EYXA 4RTVA 3SHWA 2KDSA 2PUOB 2RI2A 1VQKQ 4J9BA 4GLKA 5LJ3g 1K9MR 1VQNQ 1YIJA 4PJOD 2R5MA 2L8DA 3M4YA 2CS7A 1G3YA 3E19A 2XDBA 1MMDA 2EJFA 3UA7A 3QWLA 4PL6A 2BS4A 1M4ZA 1YITA 3SWNB 2KYBA 3OYDA 4J6YA 3TU4K 2EYYA 4AFZC 1HJDA 4LD9K 2GTOA 2EYZA 1I4K1 3P8BB 1VQ5T 1Q81C 3HRSA 3MEAA 1G3NC 2KSSA 3VS2A 3A1PA 4XU1A 4BB7A 3BDUA 1QP3A 2YT6A 2MCNA 2OTLA 1FWZA 2DXUA 3M53A 3MEWA 3P8HA 3WXMB 2VYTA 3CBOA 1YBYA 1ZA2B 2M1HA 3RKWA 4FT2A 4BE2A 1WHMA 1YJNQ 1UE9A 4QQDA 4OB0B 3V8LA 3THKA 3F5XB 4MDWA 3NFCA 1D1BA 2MYSA 1MNDA 2A37A 1AVZC 4DEXA 3CPWS 4BY6B 5J26A 4JZ4A 1VQKT 1VQNT 1H92A 2K4YA 5A0DA 3VRYA 2PQWA 3FRNA 3CCRA 1OX8A 4JS4A 1RLPC 1P5EB 2DXCA 1W98B 1ZP2A 1H28B 4OMQA 1UECA 5GMKj 4ME7A 5CO7A 3B57A 3BG3A 3NDQA 1X27A 3C0CA 1LNXA 3V7SA 3C95A 2UZLB 4JX6A 1SHGA 4OMOA 2QQRA 2BPMB 4E7LA 3WVEB 5D6YA 3LLRA 2IVWA 2X3WD 3SB2A 4BCJB 1G8XA 1UTIA 1IZ6A 2L3QA 4HVWA 4L5GA 1D1AA 1JEGA 2O31A 4RCCA 4J5YA 3G71Q 1X43A 4M75D 1OKWB 1QMCA 4AMCA 3QDRB 4OMLA 3M0PA 4PJMA 4M77A 1TD6A 4X9DA 4BD3A 1RABB 1OU8A 4UC4A 1KC8U 4FSSA 4M7AC 1M8VA 3CC4T 3POMA 2QGSA 2GQVA 1UHCA 1N4MA 3PTAA 2KT1A 2DBKA 9ATCB 4K11A 1G3WA 4R56A 2YDLA 2EWNA 1GCPA 2IVXA 1KIKA 3HO8A 1VQ6A 5KYUB 2M9UA 4GBQA 2QA4A 1RACB 5KE2A 5C6SA 5GAMh 1YJWA 1ZHIA 2RN8A 2XK0A 2L89A 3QWYA 3H8ZA 3M03A 4A63B 2QA4Q 3PVQA 2CSIA 3UA6A 4OB3B 1VQ6Q 2W0ZA 2EQMA 3JCMd 4F04B 4CXAB 5BNJB 3CCQA 2HL3A 1I5OB 2QA4T 1IHVA 4DBHA 4KGZB 4M7AG 3HFNA 5GANg 4OB2B 1RUWA 1AD6A 3RKXA 3QDFA 4X34A 1BI1A 1BIBA 3T9NA 3A8HB 1ACMB 2LJ0A 4CC7A 4JZ3A 2JJ9A 4II5B 1KXUA 3KUFA 5LJ3d 3I55T 2RQUA 4CC3A 2NUPA 2GCXA 2LT4A 3TCJA 2DYIA 2J05A 4J7FA 1K0XA 4F7NB 3CCMQ 4FX3B 2R58A 3LWIA 2OTLT 3GLXA 2HNIA 1TH7A 3RR6A 3VS7A 2LC4A 2EQIA 2W2HA 1VYWB 3GOXA 1KQSP 3A5ZB 2RD1A 2XMFA 1URCB 2LRQA 2XU8A 1IGUA 5FGKB 2RQTA 2CKKA 1JXMA 1D0YA 3H4CA 3CPFA 2FEIA 1NYFA 1OU9A 1ARKA 5FU6C 1V1CA 1KSWA 2CCIB 1MUZA 1QVGS 4M78G 3PGGA 1Q82U 2K7AA 2QG9B 3SWNC 1YIJT 3CMEQ 2VGNA 3CCSQ 4M7DF 4C92B 4J9EA 1SHFA 3LX7A 4DBQA 1WGSA 3KFVA 1H3HA 4M7DB 3CCRQ 2E41A 1JJ2A 4KBMB 3OBYA 3CXCA 2X51A 2DPPB 3OMGA 4FU6A 2LDMA 4AT1B 1M1KU 2DD5A 3V8KA 1W2BP 1VQLT 1D0ZA 1I07A 4XTUA 3QYHB 3VS5A 2DMEA 3CMET 2ZPGB 2L3PA 2LQWA 2P0KA 4M75E 1KD1U 4F6UB 5KCOA 2K5FA 2F1LA 4C8QA 3EFOA 2IW9B 2QDYB 4ZGDB 3EGUA 2G6FX 3EH2A 4N0AC 5KYNA 1N8RR 4C8QF 3MO8A 2KY9A 4M75B 3G6EQ 3I5SA 4NC6A 1KQ2A 3CCJA 4BI4A 2JTEA 1UNHD 1PHTA 4KUDK 4JRIA 4AKHA 3JCMg 2DL4A 4RTXA 2DO3A 3DJBA 1N9SA 4GY5A 4C92D 3EG1A 3ME9A 3TVTA 2QDLA 2RPNA 1MV0B 4Z88A 3HRTA 1SKUB 2O4XB 4PJOC 5IHIA 5ECAA 3EGXA 4PJLA 1JU5C 1BYMA 2W9ZA 2FL7A 4KULA 1YIJQ 4EOIB 4F70B 2FYKA 4XTYA 3PNWC 4RMOA 1WQ7A 3PO3S 1WX6A 1WXUA 1B07A 2X9HA 4FYWB 4IIOA 4CFMB 4IKFA 2EAYA 3CBMA 2E6ZA 3M54A 1SSFA 3EG3A 4X1VA 1F1BB 1N9RA 2QK0A 5GAN6 2DXTA 3TNIB 3DDPB 2DVJA 2UUEB 4XU0A 1M2VB 1C0MA 3PVLA 1WXTA 2E70A 2RK2A 2HZYA 3E1SA 4Z6YA 4EMKC 2VUBA 1V76A 2RJFA 3I56T 4CRLB 4N0AA 1VQ9A 5IHKA 1SRLA 1UNGD 5GAMj 4PLIA 3OMCA 2LQKA 3S3MA 4EPCA 2KE9A 2C5NB 1PM3A 5CKBA 2MAMA 1VQ9Q 1WFWA 1O9SA 1WPYA 2LX7A 3CCLA 1EZZB 4V2SA 4ZNXA 1VQ6T 4QQ6A 3EOCB 3EFRA 1H24B 2E5QA 4A4HA 3ULRB 3F70A 3I55A 5DQVA 1MHNA 4EOJB 1ZSZA 1W1FA 1VOLA 1PD0A 5GAN8 3X26B 3NTKA 2CCHB 1TXQA 2L3SA 3NMZC 4D8KA 3MCAB 3DB4A 4F7UF 4PJOB 5GANf 1XTDA 2DXCB 1NBEB 4RCBA 1RAAB 3H0FA 4BY6C 4PFZA 5CKEA 2YWWA 4OR5B 2DEQA 5HY6A 3CCUA 3EGDB 3HBLA 3GTMS 3LYIA 5CKFA 5GMKe 4MIMA 4M75G 4R0KA 1M90U 1KJWA 4F16A 4M77C 4DBFA 3I56A 1QCOA 3QKJA 2FRWA 1PKDB 1YHQQ 2X35A 4XAXB 4M78D 4A54A 3CMAQ 4F7UA 2E6NA 3I55Q 3OYIA 2LZ6B 3MIAB 4HCCA 4J9DA 2DMOA 3M58A 1IB8A 2C5VB 3REAB 4XTVA 4BCPB 1X6GA 2HSEB 5FU7B 1NJIC 1OZ2A 2EQKA 1NPRA 1M3AA 1ZUYA 2KMGA 1JKWA 2C0OA 1QVGA 2LJ1A 1AT1B 4PJNA 1YCSB 4YTLA 2E1HA 3SEMA 4C92C 4EMGA 3LH0A 2EGEA 3EJ1B 5HBEB 3EFSA 4M7DG 5L8RE 2JXBA 2JTFA 3OS0A 4M75C 1VA7A 2O01E 2YRCA 2MK5A 3G6EA 5GANh 5GMKl 2PU9B 4LDYA 4AG1C 3QZ5B 4G6LB 3FLGA 1BU2A 3RUXA 1O9KB 1NPPA 2M02A 3DLLA 4LE9A 1M1GA 2IIMA 2I0NA 4OGEA 3V8JA 1RI0A 3VS1A 4M78B 2E12A 4M78A 1A0NB 2JM9A 5LMKB 1ZBXA 3C94A 1YJWT 1I8FA 2RNAA 2PZ1A 1GRIA 3TNWB 1Q7YC 3PFSA 3DL1A 1U3OA 2FRYA 4N4IA 1HD3A 4Z8AA 3GP8A 1U1SA 3I9QA 4E7KA 4BCKB 3JCMh 3SFMA 4AFUC 5ICPB 4C5IA 4HCBA 2DZ9A 3CPWP 5LJ5h 1GFCA 2HCKA 3CCMA 2LTOA 1W2BS 1U1TA 2DIGA 3R6NA 2LVMA 3A8GB 3CD6T 3L1AA 4CFNB 2XIDA 1WJRA 3JCMJ 4F6SB 4BCGB 4EORB 3CCST 1WJQA 1U5SA 5LL6S 2WIPB 2QTXA 2DXBA 2WEVB 2R5AA 1R0BG 5GAOr 4F7UB 3M0SA 2P4TA 5D6WA 7AT1B 1Y71A 1H1PB 4PK4A 1QQJA 1R77A 2I2LA 1VQOA 2Y4YA 3FIFA 1OPKA 5KH6A 4IUTA 3FDRA 3HHTB 2C4GB 1I0CA 5LJ3h 4F7UE 3CQTA 1PNJA 1BBZA 3QHWB 2QQAA 4LXCA 1GL5A 2O9VA 3BLQB 1K8AC 2MWOA 3MP6A 2KR3A 3MY5B 4J83A 1T3LA 1QVFA 2NLUA 3GBQA 2A3LA 1CSKA 1YP5A 1HYOA 5LJ5f 1NZ9A 3CC4Q 2ZPIB 1YFNA 1UB4A 2YUNA 4HA8A 2CP2A 3CCSA 3CMEA 3OYGA 5CQYA 2DK3A 1WZOA 1VQLA 1VQ4T 2ROTA 4F7LB 4KUIA 1D3BA 2XD0A 3JV3A 1S1NA 2CGHA 2KT8A 3NPFA 4KRDB 4CC4B 1UEBA 1VQOQ 1OL1B 3HRUA 1IREB 3X28B 5I21A 2DILA 1V29B 4BCMB 5FLXE 2KVQG 4MMKA 2ED1A 1BB9A 1QKXA 5L2WB 2K79A 2CUBA 3REBB 2DXBB 1UHFA 2GTJA 1VIFA 3RMSA 4MZMA 4EOSB 5FRNA 2QDJA 5GJVB 2RJDA 1M3CA 1VQLQ 4ZGJB 1YCYA 4FM4B 1TOVA 1GY3B 1MNEA 4BCFB 2LCLA 1UGPB 3H41A 4QVDA 1ZUKA 1NE8A 3JSCA 1ABOA 2HDAA 2JT4A 2DZCA 3G71A 2K6DA 3CC4A 4C5EA 4A4FA 5LJ5g 2X4YA 1M2VA 1QVFP 4JUVA 3QO3A 1VQOT 4QKUA 2HQHA 4EMKB 2V8KA 4FYYB 1KQSS 2K5LA 4ZTFA 2ZPFB 4KRCB 4F17A 5FU6B 4B9XA 2YUPA 2WSFE 2DTIA 1WI7A 2CP5A 4A4GA 4B9WA 1R8OB 4WTOB 2E3HA 4N4HA 4O6JA 5EJCA 2D8HA 3RDVA 1K1ZA 4FYVB 1OIUB 4BCMD 3VKGA 2KXDA 2VV5A 2DJZA 2QI2A 2E65A 4RUGA 2JVVA 2E10A 4M78F 4B6MA 3E2UA 4Y72B 4DEYA 4TVRA 2ZAEA 1G2BA 1M1KR 4RTZA 3JCMf 3OS1A 1TU0B 4FW1A 4EIKA 2D6FA 2MF2A 1FKMA 1X2QA 4OF1A 1KD1R 4XTXA 3AHUA 1VQ5Q 2A0FB 3CCVQ 3M4GA 2KR6A 4MFDA 4BDZA 1YJNA 1FMVA 1N8RU 2EGAA 1VQKA 1VQNA 4HCKA 4M7AA 1OZ3A 5CQXA 4ELYC 1K8AU 2RHXA 1OGUB 3RBBB 4M77F 2EUFA 2EKOA 2DD5B 4DBRA 2VKNA 2IG0A 3CMAA 2QAZA 5GAOq 5J39A 3BG5A 5HQ0B 1MV3A 3VKHA 1Y57A 1SRMA 2GBQA 1RLQC 3FEOA 3CMAT 3HZJA 1B3QA 4XTWA 3NGPA 2E3IA 4KRTA 3TREA 4EMHA 1QW1A 3EGDA 2G3RA 3M56A 2KNBB 4IURA 3Q1JA 3CBPA 2C5OB 2AKKA 4AKGA 2E64A 2JN0A 2K3XA 3ZL7C 4J9FA 2W99A 1M8MA 2FZCB 3QYEA 4C92A 1LOJA 3PMIA 1YI2T 1FXXA 1CKBA 2QQSA 3BLHB 4LUEA 1VQ7Q 3HKSA 1RAEB 1Q95G 4C0DB 4MFEA 4CI0C 1I5LA 1TUGB 5DM7R 3BDLA 2FPEA 4BBRM 1Q81R 3CCVT 2DA9A 1JXOA 1Q86U 2RMOA 2QQ9A 1QLBA 1G83A 4YC3B 1O75A 2OTLQ 1KFZA 1FX7A 2J6OA 1AZGB 1AISB 3L2VA 3EIDB 4E7ZA 4J7IA 3JB9G 4M77D 2LP5A 1HK9A 4PJJA 1LJOA 3M9QA 3S3NA 1TWBA 1KQ1A 1H4LD 2D0QB 2RM4A 2X4WA 2V1QA 2DIQA 4F7SB 3UF4A 2YLBA 5LJ3j 2X3XD 5GAOl 4ELJA 3BG9A 3G33B 4JJNK 4JJCA 2BTTA 4C5GA 1PG5B 5LJ3e 4HL4A 2YSQA 1PRLC 2VASA 4A4KA 3A8MB 2R7GA 2RJEA 2QXFA 1ZX6A 3V7CA 4XQ3A 1K9MU 1GBRA 2D0NA 2VWFA 4JLIA 3G4SQ 1RL2A 1K73R 4AI6A 1GFDA 2G9XB 1OI9B 1BCMA 3CCUQ 2WMAB 4ANJA 5GAN7 4RG8A 2PK2A 1R0CB 2EVRA 5I11A 1AWJA 3EGXB 2OTJT 1JBMA 2DRKA 1AD5A 1Q7YU 2F2CA 5CKDA 1Z9ZA 2H3JA 1Q86C 1N8RC 4QSHA 1H25B 4EOOB 2OI3A 2DERA 2PUKB 5LJ3f 4C8QC 1J3TA 4MMLA 4HVUA 4AKIA 4JX4A 4DOWA 1Y0MA 2DL5A 2GGRA 2VB6A 1KHIA 3EG2A 3TSZA 1VYVA 3OW2A 1WJSA 1H27B 3JB9J 4LDWA 1VINA 2OTJA 3EFOB 4AFSC 3L2QA 1QVGP 2A28A 2DYBA 3QPHA 3CCMT 1YJ9A 5D6XA 5KYYA 3LWHA 3MY1B 1YNZA 2WSEE 5HKCA 2B86A 3VJPA 4C8QG 1D3BB 1JJ2P 2BKZB 3OYYA 1VIEA 5IDPB 1G3SA 1KHCA 2KGTA 5CVIA 2BS3A 2J6FA 1NM7A 1AEYA 2HEQA 1OL2B 1U06A 1MMNA 4TTHA 2XHCA 3DTOA 3LH5A 1U8RA 2E4HA 1RAGB 1MGQA 2MMPA 4PFPA 3TN8B 3CC7T 3JCMW 4PJOA 2G77A 2JS0A 4ZGEB 4YOZA 1BI0A 2BKDN 4IMYB 2EBPA 3OYKA 3UPUA 2A08A 2ESWA 5IH2A 4BCND 1AWWA 5GAOp 1N6AA 3J7AF 1QP2A 5FW9A 3G1JA 4BDYA 2LCSA 2V8IA 2F69A 1F5QB 3BW1A 2FG0A 2UZEB 2DTHA 1WA7A 2P4RA 2HKQB 3OYNA 3AT1B 1VQ4A 2W96A 1EFNA 4DQ2A 2RO0A 5LJ5j 2XDDA 3CCLT 2EYWA 1T3SA 1JOWA 1UNLD 2CT3A 3FB9A 1BKBA 4Y91A 3CCVA 3MP8A 3OSSC 3CPWA 2C0IA 2ROLA 3LW5E 1AOJA 1FMKA 2AT1B 2VXEA 3M5AA 1UDLA 2PVOB 2AZVA 1UGVA 3SWNA 3KXTA 2YUOA 5J3BA 4Q5WA 3FC3A 1MMAA 4J8OA 1WHGA 2LX9A 3CCQQ 4C0GA 3CCUT 4C0ZA 1N27A 3VYGB 4BY1X 1M1FA 3E9GA 1Q82C 3M0TA 4L59A 2PJQA 1PWTA 2EPDA 4NL3A 2B9RA 4C5HA 3TEEA 2QFZA 2EW3A 2H3EB 5IHYA 2AK5A 3JCMP 3GF5A 4M4ZA 2O2OA 4PJOF 1PKSA 1SF9A 2MI6A 4CC2A 4A53A 2DKGA 1O9KA 2LCCA 3OYFA 1JSUB 3IQLA 3CD6A 4VUBA 1M90C 2DLPA 3MI9B 2ED0A 2VXFA 3QG1A 1WHJA 1QMZB 4C92G 2O4XA 4DA4A 3OS5A 1H8KA 3VU3C 3A8OB 3X20B 1WLPB 2QF7A 2BIVA 1NJIR 2ZZDB 5CKHA 1DJ7B 2M51A 1ABQA 2ZPBB 4M77B 2IW8B 5CR2A 2KRMA 4XU2A 2RK1A 2FHDA 3EH1A 3VV0A 1VUBA 3OYMA 5IF1B 3MHXA 1SG5A 4IIMA 1ZA1B 3N5BB 1RAHB 4C8QD 3QUIA 1S72T 4YOOA 2CZ1B 1Y7XA 2SEMA 4F7UG 4HVVA 1I81A 2DRMA 5CCAA 5FU7C 3UDCA 5GAMf 3LGFA 2EGCA 2FO0A 3HL8A 1KC8R 3OYLA 1YJWQ 5DQWA 4O5VA 2W9FA 1M5Q1 1XNIA 3H0HA 1E6GA 2MWPA 5KE3A 4OMMA 2LQ8A 2KRNA 3TNHB 3ER0A 1G5VA 2L0AA 8AT1B 3QBYA 5HVYB 2HBWA 3QZ9B 4FSXA 4ORZA 3O0GD 4BCHB 1WDXA 5KYWB 1Y96A 1GUXB 1IRXA 5CK9A 1WIEA 1ZUUA 1QWFA 1UJ0A 3URGA 2F2VA 4EC8B 1WHKA 1M2OA 3S3OA 5EG2A 2V22B 4BCNB 1W4SA 5GANd 1UFFA 1TUCA 1SEMA 4R55A 3DOGB 1ZSZB 3MPUB 5IXFA 2BZXA 5L23A 1GH6B 1T0HA 3VRZA 2O9SA 1JJ2S 4C92E 3META 2WIHB 2DNUA 2FZKB 1JRIA 5CYIB 1OV3A 1Z9QA 1QLYA 2CREA 3RNJA 1YJ9T 4C8QE 5DY9A 3CCET 2RHZA 1PSEA 2D9TA 2ENMA 2QGFB 5GAN4 3PE0A 4C92F 2DTOA 3X24B 2YRDA 4EOMB 4I3ZB 2J6KA 2KYMA 1VQ4Q 4M6VA 2GQIA 3FJPA 2NUPB 1YITQ 1VQ8A 1ENWA 1JO8A 3QHSA 2OX7A 4CFXB 5EC7A 4LN2A 4YOSA 1K8AR 2LQNA 3JB9F 1RADB 2ABLA 2PK9B 3JCMQ 3NHNA 1W2BA 1N5ZA 1S72A 2COZA 1OYXA 1QCFA 4Z02A 1TFBA 4RODA 2NUTA 1VQPQ 4KT0E 2CUDA 3HP9A 1XJWB 2LW4A 3VYHB 3CCEA 1PCXA 3CC7A 1PSFA 3MJXA 5DLQE 4NOYA 1P92A 4M7DD 4PFOA 3BY7A 2BE7D 1YWPA 1QKWA 2WPAB 4M7DC 2WACA 3MEVA 3P8DA 3JB9H 3EG9B 2CT4A 1BI3A 3DKMA 4ZN1A 1YJ9Q 1K9MC 2Y90A 3R6OA 1OQKA 2DBMA 2HQEA 3G7ZA 5C0MA 1VQ8T 3JCMe 3L2WA 1UJYA 5LJ5e 2RHYA 3VS4A 3NTHA 4F7JB 4M75A 2ZCFB 3I5RA 2IPOB 3OYCA 1VQPT 4C8QB 5GAN5 1WHHA 2KEAA 1B7TA 2EJ9A 4CFVB 2CH4W 5EFQB 3M57A 1GBQA 2DL8A 2Y4XA 1X69A 1YWOA 4ESRA 3MKDA 1AHJB 4FW2A 4OGCA 2QEXT 1JSTB 2V1RA 5A2QE 4JRKA 5GAMe 2J7IA 2F5TX 3OA6A 2RF0A 1CKAA 4XTZA 1PRMC 3RIRA 2F5KA 4CFWB 1E6HA 1BI2A 2WFYB 2CH4A 1B34B 1ZQ1A 1TUDA 2CP7A 1H1SB 4M7DA 4MZPA 1OOTA 3PMTA 2C5XB 2HSPA 4IUPA 2DD4A 4F14A 4BCIB 3JRZA 1YI2Q 2KXCA 2A36A 1UG1A 2CZ0B 3BLRB 1K73U 5IAYA 3EG0A 2EFIA 3OYAA 2VVKA 5GAOn 5GJWB 2VC8A 4ELZC 3U23A 5GANe 2EQUA 2K3YA 3TW7A 3RESA 1OIYB 2EIFA 2RQVA 4CRIA 3CCQT 1MMGA 4EC9B 1D3UB 5HCKA 2RHIA 4FCYA 1SSHA 2JMAA 1NEBA 4PNOA 2BZ8A 4RKUE 3L2RA 2JGZB 2CP0A 4BCOB 2JTMA 2PHGA 1QWEA 3NTIA 5GAN3 2HAXA 3OYJA 3BHTB 4QT7A 2XKOC 2KBTA 1K76A 3S6WA 5HBHB 3CC2Q 1WHLA 2HBPA 1IXDA 5HNBB 4NS5A 2KI7A 2BS2A 3VS3A 2MPXC 2W10A 3J81E 2DL3A 2K5IA 3M59A 4HCZA 1S72Q 2E5KA 1EIFA 2JNGA 1OI1A 2PVGB 2DJQA 2HMAA 3INZA 1GUXA 3EHRA 2JS2A 3KHIA 2R57A 1NLOC 2K2VA 4Z89A 1VQ8Q 2DEUA 4E7JA 2DF6A 4E47A 1BU1A 4OB1B 5KYUA 2PTKA 4KGVB 2ZPHB 1UGQB 2LJ3A 2X1NB 4EOKB 2FPFA 1UGRB 1H641 3CC7Q 2I40B 2PNIA 1G3TA 3QHRB 2COYA 2LT1A 5LQFB 2QGGA 1PC0A 4EOLB 1K4US 4X9CA 2M0OA 2F2XA 2FPDA 4RTYA 3K7AM 3VUBA 4E7IA 3G71T 4FYXB 3BFMA 2FZGB 5FWCA 3CCJT 2NUZA 4ELLA 2XG8D 4KH0B 3VKIA 1WNLA 4J9IA 4OVAA 2RI5A 2CYZB 1ZSZC 1T0JA 3CCJQ 1X75C 2HKNA 3VS0A 3L2UA 1RAFB 3RGFB 1FMWA 1VQ5A 3OBWA 2V8JA 4LD6A 5IDNB 4F6WB 4JX5A 1YJNT 1HXDA 4M78E 2AHJB 4ROEA 1KQSA 2QEXA 3QYGB 2DM1A 3EHQA 4FT4A 3CXCS 5IXBA 4BUGA 1UUEA 2NYSA 2Z0WA 3M0RA 3JCMX 2GNCA 1VYTA 1H26B 3M55A 2EKHA 4MZTA 1NEGA 3BHUB 4KGXB 2EYQA 5HBJB 1FYNA 4OP0A 2RQWA 5FWBA 2XDPA 3M0UA 4JJBA 5GMKh 1W6XA 2WSCE 3UWNA 4P5NA 4RTUA 3J80E 1VQ7T 2V26A 2M16A 3CCEQ 4UN0A 2DVEA 1VQMA 2K9GA 1IGQA 1WQWA 2NUTB 5A0LA 2OJ2A 1PKTA 4FL6A 1AZEA 2CP3A 3VYGA 3HPWA 1BIAA 1E7OA 2RI3A 2CSQA 5ACBA 1QVFS 3JCMb 4NSTB 3OYHA 4HXJA 2QTVA 1KK7A 3JB9I 1ZBJA 5CAIA 1OEBA 2COWA 3GIBA 5HK3A 2ZGWA 3E9FA 2RB6A 2DETA 4HT9A 3GNGA 3TW6A 2NWMA 3OB9A 4J9CA 4LDVA 4M7AF 2PVDB 1E9HB 1NJIU 2BUDA 1QCNA 4EONB 1X6BA 3DB3A 2HQXA 1WYXA 5GAMg 2IN3A 2YHTA 3O5ZA 2WHBB 3C4SA 2I53A 1NG2A 2RA2A 4JRQA 3JAME 1VQMT 3MP1A 4KH1B 2ZPEB 2RQRA 4J9GA 1JB0E 4E6RA 3A8LB 3OY9A 4M78C 4QVCA 3H0IA 2JZ2A 3PIOA 4MDXA 2OAWA 3OQ5A 3OSVA 3QSUA 1TG0A 2X4XA 5LJ5d 1H1QB 4D6WA 1IHWA 3EAEA 2FB7A 4JLGA 4OGRB 4CFUD 3H9NA 4HNUA 3V7RA 5KYWA 2GFAA 3OW2S 1M27C 1VQMQ 4OMFB 2GF7A 1B34A 4IUUA 1VYUA 4LDUA 2DD4B 5CIUA 4M77E 4RTWA 4BBSM 5GMKm 5GAN2 3RKYA 1H1RB 4QVZA 3I35A 1EX4A 4AFQC 2JOYA 1OX9A 1TSFA 5I22A 1YITT 5IT9E 1GCQA 4XK8E 1D1CA 1TTHB 2JW4A 3ZEHA 1PD1A 4XU3A 2K57A 2KROA 4D8DA 2D1XA 2CDTA 4HNVA 1FINB 5GANj 2RH2A 2QEXQ 3JCMc 1GXIE 1BCOA 1LPLA 2YUQA 2CZ6B 4E7SA 3QJYA 4M7AB 5IHNA 1X01A 3CC2T 2UZBB 5KYXA 5DLOA 4M77G 3A98A 4WF2A 4BI8B 2B8AA 3L2ZA 1IO6A 3ZBDA 1W70A 1NYGA 5KYXB 2QQBA 4ZN3A 4C0DC 4ATOA 1TS9A 2A7YA 3G4ST 4M7AE 4QW2A 4E2FB 4BE1A 1C1AA 1HSQA 2X4JA 4NL2A 2P0PA 4AG2C 2O88A 3DLMA 3FJ5A 5AYFA 2KQWA 2WXVB 3LQ5B 4LNPA 5KCHA 5M9OA 4HLQA 4HNTA 1JQQA 1Q82R 2OAUA 1YHQT 3QJ6A 2ECZA 4Y92A 2FVUA 3C12A 4BCQB 2DL7A 1ZSGA 2GFUA 3QWXX 4BCQD 2CZ7B 3CD6Q 2M0YA 3OYBA 4IUVA 2DFUA 5I2MA 2K2MA 2KRSA 3PT9A 2HL5C 5GAMd 1K73C 2H8HA 3CCRT 3BHVB 2AIRB 3ZFJA 4BE0A 2KK4A 2QASA 3DDQB 3HSBA 2AKLA 3TQ7P 2LMJA 4M7DE 2D8JA 4WCIA 4E7HA 4EMKA 3M0QA 1Q81U 4L6V5 4LUDA 1Q86R 2MOXA 5A0GA 2CJMB 2DE0X 2C6TB 4LOCA 1XQHA 2L3RA 1LVKA 8ATCB 5FROA 5IN1A 3HB9A 1YN8A 2HD0A 4PLLA 4ROCA 3QIIA 1KG1A 1GCQC 1NLPC 1C9BA 4JJDA 4PJOG 1LCKA 2XICA 1K9AA 4A4EA 2JUFA 1AWXA 2AZSA 3QYBA 4IUQA 4BXXX 3UT1A 5HK0A 1RAIB 3MEUA 1BK2A 6AT1B 2SRCA 2QQ8A 2LNHB 2OTJQ 3JCMV 4JS5A 2L2PA 1KC8C 2PMIB 2ATCB 2EQJA 4J6XA 4II1A 2YLCA 3CEYA 3H6ZA 2RHUA 2EJGA 3KBGA 2P0QA 1YHQA 3CXCP 3OYEA 2C06A 2KMTA 3I56Q 3GPLA 5GMKi 2L5QA 3L42A 4EOPB 1C6VX 4OMPA 3RERA 1D0XA 5CEIB 3QXEB 1Y96B 2DAQA 3VS6A 1YI2A 4CFUB 4HKEA 1X6OA 4Y28E 3JB9D 4BY7X
chains in the Genus database with same CATH topology
4LDXA 2YRVA 4OGCA 4N0AA 2QEXT 4J6WA 5A2QE 1VQ9A 4JRKA 1UGSB 4DOVA 3RMQA 5GAMe 2F5TX 3OA6A 3L2VA 4XTZA 3CC2A 3WVDB 5GAMj 4C0FA 3GNFB 4PLIA 3OMCA 4J7IA 3RIRA 2F5KA 2KAFA 2LQKA 4M77D 3S3MA 4EPCA 3JB9G 1HK9A 5CKBA 1BI2A 1B34B 1LJOA 1ZQ1A 1Y07A 2MAMA 3M9QA 4M7DA 4MZPA 2VGMA 3PMTA 3S3NA 1KQ1A 2D0QB 2RM4A 4M75F 2X4WA 1XOVA 1O9SA 1WPYA 4IUPA 2DIQA 2DD4A 3CCLA 2YLBA 3JRZA 3PIPA 4V2SA 1VQ6T 4PKCC 4ZTJA 5LJ3j 3SDZA 4QQ6A 5GAOl 4ELJA 3BG9A 4JJNK 2CZ0B 3EFRA 4M7AD 4C5GA 2E5QA 4A4HA 5LJ3e 4HL4A 3F70A 4EDUA 3I55A 1K73U 4A4KA 5IAYA 1M1KC 3A8MB 1MHNA 2EFIA 3HFOA 2RJEA 3OYAA 2QXFA 3SD4A 1K9MU 3V7CA 4XQ3A 2RJCA 5GAOn 3ASKA 2LNVA 2VC8A 4FIBA 1E7PA 2ZZDA 4JLIA 4ELZC 1KD1C 5GANe 2EQUA 2K3YA 4JDSA 3TW7A 3RESA 4BI3A 1RL2A 2EIFA 3X26B 4CRIA 5GAN8 3NTKA 4AI6A 3CCQT 5FRMA 1QVPA 2XI9A 2RHIA 5GAN7 3MCAB 4RG8A 4PNOA 3X25B 3DB4A 4F7UF 4PJOB 5GANf 1XTDA 3OS2A 3G6ET 2DXCB 4RKUE 3L2RA 4RCBA 4BY6C 1H3ZA 3LGLA 2OTJT 1JBMA 2WJ9A 2JTMA 1VQ9T 4N4GA 1Q7YU 5GAOm 4JRPA 3NTIA 5CKDA 5CKEA 5GAN3 2HAXA 2H3JA 3OYJA 1Q86C 2DEQA 5HY6A 3CCUA 4QSHA 2XKOC 4BACA 1N8RC 2PUKB 3HBLA 5CKFA 3LYIA 5LJ3f 4C8QC 4MIMA 4M75G 5I2SA 4RG2A 4MMLA 1M90U 4AKIA 3VUZA 4JX4A 4DOWA 3S6WA 3O8VA 4M77C 3I56A 3G4SA 3QKJA 1KHIA 2HBPA 2X35A 1VQ7A 4NS5A 2BS2A 4M78D 4XAXB 4A54A 3OW2A 4F7UA 2E6NA 1VQPA 3J81E 4HT8A 4PJOE 1M9SA 1WJSA 3OYIA 4HCCA 3JB9J 4LDWA 2K5IA 3M58A 3M59A 4HCZA 2OTJA 2JNGA 1EIFA 4XTVA 1OI1A 4QQGA 3L2QA 2PVGB 3QPHA 2KDSA 2PUOB 2RI2A 5FU7B 4GLKA 5LJ3g 3INZA 3CCMT 1YIJA 1YJ9A 2R5MA 5D6XA 1OZ2A 1NJIC 2EQKA 4PJOD 1NPRA 3LWHA 2L8DA 2WSEE 3M4YA 2KMGA 2CS7A 5HKCA 1QVGA 3KHIA 4YTLA 1G3YA 3E19A 2XDBA 2E1HA 2EJFA 3VJPA 4C92C 3QWLA 4PL6A 2R57A 4EMGA 4C8QG 2K2VA 1D3BB 2BS4A 1M4ZA 3EFSA 3LH0A 4E7JA 1YITA 3SWNB 4E47A 3OYDA 3OYYA 1VIEA 4OB1B 4J6YA 3TU4K 1G3SA 1KHCA 4M7DG 4LD9K 5CVIA 2BS3A 1UGQB 2ZPHB 5L8RE 1UGRB 2JTFA 1H641 4M7DF 1I4K1 2XHCA 3P8BB 1G3TA 1U8RA 1VQ5T 3OS0A 2LT1A 4M75C 1Q81C 2O01E 1MGQA 3HRSA 3G6EA 5GANh 2MMPA 3MEAA 5GMKl 2PU9B 4LDYA 3QZ5B 4X9CA 2KSSA 3CC7T 3JCMW 4PJOA 2G77A 2M0OA 4XU1A 3FLGA 3VUBA 4BB7A 4ZGEB 4E7IA 1BI0A 2BKDN 3G71T 3RUXA 3BDUA 3OYKA 3UPUA 1QP3A 1NPPA 3DLLA 3BFMA 2OTLA 1M1GA 1FWZA 2DXUA 3M53A 4OGEA 3CCJT 3MEWA 3P8HA 3WXMB 2VYTA 2XG8D 1YBYA 3CBOA 3V8JA 1RI0A 2M1HA 3VKIA 1N6AA 1WNLA 5GAOp 3J7AF 4OVAA 2RI5A 1QP2A 4M78B 2CYZB 4FT2A 3RKWA 2E12A 4M78A 4BE2A 4BDYA 4QQDA 2V8IA 4OB0B 1X75C 2F69A 3L2UA 1ZBXA 3C94A 1VQ5A 3V8LA 1YJWT 3BW1A 1I8FA 4MDWA 3NFCA 3OBWA 2V8JA 1Q7YC 3PFSA 3DL1A 2DTHA 4LD6A 4N4IA 3CPWS 4JX5A 4BY6B 1YJNT 5J26A 1HXDA 3OYNA 1VQKT 1VQ4A 4M78E 2AHJB 1VQNT 2K4YA 5A0DA 3GP8A 1KQSA 1U1SA 2QEXA 2PQWA 4DQ2A 2RO0A 3FRNA 4E7KA 5LJ5j 3CCRA 3QYGB 2XDDA 3CCLT 3JCMh 3SFMA 4FT4A 3CXCS 4JS4A 4C5IA 4HCBA 2DZ9A 4BUGA 5LJ5h 3JCMX 2DXCA 3M55A 3CCMA 3FB9A 2LTOA 4MZTA 1W2BS 1U1TA 2DIGA 1BKBA 4Y91A 3CCVA 3MP8A 2LVMA 3OSSC 3CPWA 2EYQA 3A8GB 4OP0A 5GMKj 4ME7A 5CO7A 3CD6T 3BG3A 3LW5E 2XDPA 1LNXA 3L1AA 3V7SA 2VXEA 3M5AA 5GMKh 3C95A 4JX6A 2XIDA 2WSCE 2QQRA 1WJRA 3UWNA 3JCMJ 4P5NA 2PVOB 3J80E 1VQ7T 4E7LA 3WVEB 5D6YA 2M16A 3SWNA 2DVEA 1WJQA 3CCST 3KXTA 1VQMA 5LL6S 3LLRA 1WQWA 4Q5WA 5J3BA 2QTXA 2DXBA 4M7DD 2IVWA 3FC3A 3SB2A 4J8OA 5A0LA 2LX9A 2R5AA 4FL6A 4C0GA 3CCUT 3VYGA 4C0ZA 3HPWA 1N27A 1BIAA 3VYGB 2RI3A 1IZ6A 1M1FA 3E9GA 4L5GA 4F7UB 5GAOr 1Q82C 1QVFS 2P4TA 4L59A 3JCMb 5D6WA 3OYHA 4RCCA 1Y71A 4J5YA 4NL3A 3JB9I 2I2LA 1VQOA 4C5HA 2Y4YA 3FIFA 4M75D 3TEEA 4IUTA 2QFZA 5CAIA 5KH6A 3FDRA 3HHTB 5LJ3h 5HK3A 3GIBA 2ZGWA 3E9FA 3QDRB 3GF5A 4F7UE 3JCMP 2QQAA 2RB6A 4M77A 4PJOF 1K8AC 4X9DA 4BD3A 2MWOA 2MI6A 4UC4A 3GNGA 2DKGA 3TW6A 3MP6A 3OB9A 2LCCA 4A53A 1KC8U 4HT9A 4LDVA 3OYFA 3CC4T 3CD6A 4J83A 4M7AF 1QVFA 2PVDB 4VUBA 2NLUA 2BUDA 2GQVA 1NJIU 2A3LA 3DB3A 1M90C 2HQXA 3PTAA 3QG1A 2VXFA 5LJ5f 4C92G 5GAMg 1NZ9A 1G3WA 4R56A 2YHTA 3C4SA 2ZPIB 2EWNA 1UB4A 2O4XA 3OS5A 2RA2A 4DA4A 1M8VA 3VU3C 3A8OB 3X20B 4JRQA 2QF7A 4HA8A 2BIVA 3JAME 3CCSA 1VQMT 3MP1A 3CMEA 2ZZDB 5CKHA 3HO8A 3OYGA 1VQ6A 2ZPEB 5CQYA 2DK3A 1DJ7B 2M9UA 1JB0E 2QA4A 1VQLA 5KE2A 1VQ4T 4KUIA 3A8LB 1D3BA 3OY9A 4M78C 2XD0A 2ZPBB 4QVCA 4M77B 5C6SA 2CGHA 2JZ2A 5CR2A 4XU2A 1UEBA 2RK1A 2FHDA 5GAMh 3VV0A 3PIOA 1VUBA 3OYMA 1YJWA 1ZHIA 3HRUA 4MDXA 3MHXA 1IREB 3X28B 2XK0A 2L89A 5I21A 3H8ZA 3OQ5A 3OSVA 1V29B 3N5BB 3QSUA 5FLXE 2X4XA 4C8QD 5LJ5d 2KVQG 3QUIA 4MMKA 4OB3B 1S72T 2EQMA 4D6WA 3JCMd 2CZ1B 1Y7XA 3CCQA 3EAEA 2FB7A 4JLGA 4F7UG 1I81A 2QA4T 4HNUA 3V7RA 3OW2S 2GFAA 5CCAA 4M7AG 3HFNA 5GANg 4OB2B 3RKXA 5FU7C 3UDCA 5GAMf 3LGFA 4X34A 4OMFB 2GF7A 1B34A 3HL8A 2DXBB 1BI1A 1BIBA 3T9NA 3A8HB 4IUUA 4LDUA 2DD4B 5CIUA 3OYLA 4M77E 4O5VA 1VIFA 3RMSA 3KUFA 4MZMA 5LJ3d 3I55T 5FRNA 4BBSM 2QDJA 1M5Q1 1XNIA 5GMKm 3RKYA 5GAN2 2RJDA 4QVZA 2GCXA 2JOYA 2LT4A 4ZGJB 1YCYA 3TCJA 4FM4B 2MWPA 5KE3A 4J7FA 2LCLA 2LQ8A 1UGPB 3ER0A 1G5VA 1YITT 3QBYA 4QVDA 5IT9E 1NE8A 2R58A 4XK8E 3QZ9B 3LWIA 2OTLT 3GLXA 3JSCA 2HNIA 1TH7A 4FSXA 3ZEHA 2DZCA 4XU3A 3G71A 2K57A 2LC4A 4C5EA 3CC4A 4A4FA 4HNVA 1Y96A 5LJ5g 2X4YA 5CK9A 3GOXA 5GANj 2RH2A 4JUVA 3A5ZB 3JCMc 3QO3A 2RD1A 1VQOT 3URGA 1GXIE 4EMKB 2CZ6B 3S3OA 2LRQA 2V8KA 5EG2A 2XU8A 3QJYA 1W4SA 4M7AB 5GANd 1KQSS 2K5LA 1X01A 3CC2T 2CKKA 4ZTFA 4R55A 2ZPFB 3H4CA 3CPFA 5DLOA 5FU6B 4M77G 4B9XA 4WF2A 4BI8B 2B8AA 3L2ZA 3ZBDA 2WSFE 2DTIA 5FROA 5FU6C 1JJ2S 2QQBA 4A4GA 4B9WA 3META 1R8OB 4C0DC 4C92E 4ZN3A 4ATOA 1JRIA 2A7YA 3G4ST 4N4HA 4QW2A 4O6JA 5EJCA 4M7AE 1QVGS 4M78G 4BE1A 3PGGA 1Q82U 3SWNC 1YIJT 1YJ9T 3VKGA 2VGNA 2X4JA 4NL2A 2P0PA 5DY9A 4C8QE 3DLMA 2RHZA 2VV5A 5GMKe 3CCET 4C92B 1PSEA 2DJZA 2D9TA 3LX7A 5AYFA 2QI2A 2E65A 2KQWA 5KCHA 5M9OA 4HLQA 4HNTA 5GAN4 1WGSA 2JVVA 4C92F 2E10A 2DTOA 4M78F 3X24B 2OAUA 1YHQT 3QJ6A 4M7DB 4TVRA 2E41A 2FVUA 3C12A 4KBMB 1JJ2A 2GFUA 3OBYA 3JCMf 3OS1A 3CXCA 2CZ7B 4M6VA 3FJPA 2DPPB 3OYBA 2D6FA 2MF2A 4IUVA 1FKMA 4OF1A 3OMGA 4FU6A 5I2MA 3PT9A 1VQ8A 4XTXA 3QHSA 5GAMd 3AHUA 2LDMA 1K73C 3CCRT 3M4GA 1M1KU 2DD5A 3V8KA 4MFDA 2KR6A 4BDZA 1YJNA 1VQLT 4XTUA 3JB9F 3ZFJA 4BE0A 3QYHB 2KK4A 3CMET 2ZPGB 1N8RU 1VQKA 1VQNA 2P0KA 4M75E 3JCMQ 1KD1U 3HSBA 1W2BA 4M7AA 1OZ3A 4M7DE 5KCOA 5CQXA 1S72A 1OYXA 4ELYC 2RHXA 4Z02A 2K5FA 4EMKA 4E7HA 1K8AU 4M77F 4C8QA 1Q81U 2EKOA 4L6V5 2DD5B 4KT0E 4ZGDB 2QDYB 2IG0A 3HP9A 4N0AC 3CMAA 4C8QF 5GAOq 3MO8A 2KY9A 4M75B 5J39A 4NC6A 5A0GA 3BG5A 3VYHB 1KQ2A 4LOCA 3CCEA 3CCJA 4BI4A 1XQHA 3VKHA 3CC7A 1PSFA 2L3RA 4KUDK 5DLQE 4NOYA 1P92A 5IN1A 4JRIA 4AKHA 3FEOA 3HB9A 2HD0A 4PLLA 3JCMg 3CMAT 3BY7A 3HZJA 3QIIA 4XTWA 1KG1A 2DO3A 1N9SA 4GY5A 3TREA 4M7DC 4C92D 2WACA 4EMHA 3MEVA 3ME9A 4PJOG 1QW1A 2XICA 3P8DA 2G3RA 3M56A 3JB9H 4IURA 4A4EA 3Q1JA 2JUFA 3CBPA 3HRTA 3QYBA 2O4XB 4IUQA 3UT1A 4PJOC 5HK0A 4M7AC 1BYMA 4AKGA 4KULA 2E64A 1BI3A 2FL7A 2JN0A 3DKMA 4ZN1A 1K9MC 3MEUA 2K3XA 2Y90A 2FYKA 3R6OA 4XTYA 2QQ8A 3PNWC 4RMOA 1WQ7A 2HQEA 3G7ZA 5C0MA 3JCMV 1VQ8T 3QYEA 4C92A 3JCMe 1LOJA 3PMIA 3L2WA 1FXXA 4JS5A 1YI2T 1KC8C 5LJ5e 2RHYA 2EQJA 4J6XA 4II1A 2QQSA 2YLCA 3CEYA 4IKFA 2EAYA 2RHUA 3CBMA 3H6ZA 2E6ZA 2EJGA 1SSFA 3M54A 3KBGA 3NTHA 3HKSA 4M75A 2P0QA 2ZCFB 1YHQA 3OYEA 1N9RA 3OYCA 2KMTA 2C06A 4C0DB 4MFEA 4CI0C 3GPLA 5GMKi 5GAN6 1VQPT 2L5QA 3BDLA 3L42A 5DM7R 1I5LA 4BBRM 2DXTA 4C8QB 5GAN5 3CCVT 2EJ9A 3RERA 4XU0A 1Q86U 2QQ9A 2E70A 1QLBA 3QXEB 1Y96B 2DAQA 2RK2A 1O75A 1YI2A 3M57A 2Y4XA 3E1SA 4Z6YA 4HKEA 1FX7A 4EMKC 1X6OA 2VUBA 4Y28E 2RJFA 3I56T 3JB9D 1AHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSE A;  4OB1 B;  2PVD B;  1UGS B;  5L8R E;  2ZPH B;  1UGQ B;  3X24 B;  1UGR B;  3WVD B;  2ZPI B;  2O01 E;  2CZ7 B;  3A8O B;  3X20 B;  2PU9 B;  3QZ5 B;  2DPP B;  2ZZD B;  2D0Q B;  2ZPE B;  4ZGE B;  1DJ7 B;  1JB0 E;  2DD4 A;  1QP3 A;  3A8L B;  2DD5 A;  2ZPB B;  3QYH B;  2ZPG B;  1QP2 A;  2CYZ B;  3X28 B;  1IRE B;  2CZ0 B;  1V29 B;  4OB0 B;  4OB3 B;  3A8M B;  4L6V 5;  2DD5 B;  4KT0 E;  4ZGD B;  2QDY B;  2CZ1 B;  2AHJ B;  2ZZD A;  3VYH B;  4OB2 B;  3X26 B;  1PSF A;  3QYG B;  2DXB B;  3A8H B;  2DD4 B;  3X25 B;  2DXC A;  2DXC B;  4ZGJ B;  4RKU E;  4FM4 B;  3A8G B;  1UGP B;  3LW5 E;  4XK8 E;  3QZ9 B;  2PUK B;  2WSC E;  2PVO B;  3WVE B;  2DXB A;  1GXI E;  2CZ6 B;  3VYG A;  3VYG B;  2ZCF B;  2ZPF B;  2WSF E;  2PVG B;  2PUO B;  3QXE B;  3HHT B;  2WSE E;  4Y28 E;  1AHJ B; 
#chains in the Genus database with same CATH topology
 4LDX A;  2YRV A;  1M30 A;  4J6W A;  4DOV A;  1UGS B;  3RMQ A;  3CC2 A;  3WVD B;  4C0F A;  4EOQ B;  3GNF B;  2KAF A;  1Q7Y R;  4RTT A;  2MIO A;  1Y07 A;  1OUL A;  2VGM A;  5KYY B;  4M75 F;  1XOV A;  4J9H A;  1AWO A;  2WMB B;  4OMN A;  2C0T A;  3PIP A;  1XO2 A;  4PKC C;  4ZTJ A;  3SDZ A;  3BE3 A;  4M7A D;  3HTR A;  3CCL Q;  2F2W A;  2JM8 A;  1OKV B;  1I1J A;  4EDU A;  1WXB A;  2DX1 A;  1M1K C;  1X2K A;  3HFO A;  4GLM A;  3SD4 A;  2IW6 B;  2RJC A;  3ASK A;  2LNV A;  4FIB A;  1E7P A;  1D09 B;  2ZZD A;  1KD1 C;  3TSW A;  4JDS A;  2J06 A;  4JPB W;  1M3B A;  4BI3 A;  2QYZ A;  3D7S B;  5FRM A;  1QVP A;  2BZY A;  2CP6 A;  2XI9 A;  1K0S A;  1FVV B;  1OPL A;  3X25 B;  3OS2 A;  3G6E T;  1H3Z A;  3LGL A;  2WJ9 A;  1VQ9 T;  4N4G A;  5GAO m;  4JRP A;  3EG9 A;  1RI9 A;  4BAC A;  5I5Z B;  5I2S A;  1SPK A;  4RG2 A;  3VUZ A;  3O8V A;  5AT1 B;  3G4S A;  2UZD B;  1ZLM A;  2K3B A;  1VQ7 A;  2P84 A;  5D7U A;  1VOM A;  2JMC A;  2BE9 B;  1VQP A;  4HT8 A;  4PJO E;  1M90 R;  1M9S A;  3UAT A;  2YXY A;  3OW2 P;  4QQG A;  2EYX A;  4RTV A;  3SHW A;  2KDS A;  2PUO B;  2RI2 A;  1VQK Q;  4J9B A;  4GLK A;  5LJ3 g;  1K9M R;  1VQN Q;  1YIJ A;  4PJO D;  2R5M A;  2L8D A;  3M4Y A;  2CS7 A;  1G3Y A;  3E19 A;  2XDB A;  1MMD A;  2EJF A;  3UA7 A;  3QWL A;  4PL6 A;  2BS4 A;  1M4Z A;  1YIT A;  3SWN B;  2KYB A;  3OYD A;  4J6Y A;  3TU4 K;  2EYY A;  4AFZ C;  1HJD A;  4LD9 K;  2GTO A;  2EYZ A;  1I4K 1;  3P8B B;  1VQ5 T;  1Q81 C;  3HRS A;  3MEA A;  1G3N C;  2KSS A;  3VS2 A;  3A1P A;  4XU1 A;  4BB7 A;  3BDU A;  1QP3 A;  2YT6 A;  2MCN A;  2OTL A;  1FWZ A;  2DXU A;  3M53 A;  3MEW A;  3P8H A;  3WXM B;  2VYT A;  3CBO A;  1YBY A;  1ZA2 B;  2M1H A;  3RKW A;  4FT2 A;  4BE2 A;  1WHM A;  1YJN Q;  1UE9 A;  4QQD A;  4OB0 B;  3V8L A;  3THK A;  3F5X B;  4MDW A;  3NFC A;  1D1B A;  2MYS A;  1MND A;  2A37 A;  1AVZ C;  4DEX A;  3CPW S;  4BY6 B;  5J26 A;  4JZ4 A;  1VQK T;  1VQN T;  1H92 A;  2K4Y A;  5A0D A;  3VRY A;  2PQW A;  3FRN A;  3CCR A;  1OX8 A;  4JS4 A;  1RLP C;  1P5E B;  2DXC A;  1W98 B;  1ZP2 A;  1H28 B;  4OMQ A;  1UEC A;  5GMK j;  4ME7 A;  5CO7 A;  3B57 A;  3BG3 A;  3NDQ A;  1X27 A;  3C0C A;  1LNX A;  3V7S A;  3C95 A;  2UZL B;  4JX6 A;  1SHG A;  4OMO A;  2QQR A;  2BPM B;  4E7L A;  3WVE B;  5D6Y A;  3LLR A;  2IVW A;  2X3W D;  3SB2 A;  4BCJ B;  1G8X A;  1UTI A;  1IZ6 A;  2L3Q A;  4HVW A;  4L5G A;  1D1A A;  1JEG A;  2O31 A;  4RCC A;  4J5Y A;  3G71 Q;  1X43 A;  4M75 D;  1OKW B;  1QMC A;  4AMC A;  3QDR B;  4OML A;  3M0P A;  4PJM A;  4M77 A;  1TD6 A;  4X9D A;  4BD3 A;  1RAB B;  1OU8 A;  4UC4 A;  1KC8 U;  4FSS A;  4M7A C;  1M8V A;  3CC4 T;  3POM A;  2QGS A;  2GQV A;  1UHC A;  1N4M A;  3PTA A;  2KT1 A;  2DBK A;  9ATC B;  4K11 A;  1G3W A;  4R56 A;  2YDL A;  2EWN A;  1GCP A;  2IVX A;  1KIK A;  3HO8 A;  1VQ6 A;  5KYU B;  2M9U A;  4GBQ A;  2QA4 A;  1RAC B;  5KE2 A;  5C6S A;  5GAM h;  1YJW A;  1ZHI A;  2RN8 A;  2XK0 A;  2L89 A;  3QWY A;  3H8Z A;  3M03 A;  4A63 B;  2QA4 Q;  3PVQ A;  2CSI A;  3UA6 A;  4OB3 B;  1VQ6 Q;  2W0Z A;  2EQM A;  3JCM d;  4F04 B;  4CXA B;  5BNJ B;  3CCQ A;  2HL3 A;  1I5O B;  2QA4 T;  1IHV A;  4DBH A;  4KGZ B;  4M7A G;  3HFN A;  5GAN g;  4OB2 B;  1RUW A;  1AD6 A;  3RKX A;  3QDF A;  4X34 A;  1BI1 A;  1BIB A;  3T9N A;  3A8H B;  1ACM B;  2LJ0 A;  4CC7 A;  4JZ3 A;  2JJ9 A;  4II5 B;  1KXU A;  3KUF A;  5LJ3 d;  3I55 T;  2RQU A;  4CC3 A;  2NUP A;  2GCX A;  2LT4 A;  3TCJ A;  2DYI A;  2J05 A;  4J7F A;  1K0X A;  4F7N B;  3CCM Q;  4FX3 B;  2R58 A;  3LWI A;  2OTL T;  3GLX A;  2HNI A;  1TH7 A;  3RR6 A;  3VS7 A;  2LC4 A;  2EQI A;  2W2H A;  1VYW B;  3GOX A;  1KQS P;  3A5Z B;  2RD1 A;  2XMF A;  1URC B;  2LRQ A;  2XU8 A;  1IGU A;  5FGK B;  2RQT A;  2CKK A;  1JXM A;  1D0Y A;  3H4C A;  3CPF A;  2FEI A;  1NYF A;  1OU9 A;  1ARK A;  5FU6 C;  1V1C A;  1KSW A;  2CCI B;  1MUZ A;  1QVG S;  4M78 G;  3PGG A;  1Q82 U;  2K7A A;  2QG9 B;  3SWN C;  1YIJ T;  3CME Q;  2VGN A;  3CCS Q;  4M7D F;  4C92 B;  4J9E A;  1SHF A;  3LX7 A;  4DBQ A;  1WGS A;  3KFV A;  1H3H A;  4M7D B;  3CCR Q;  2E41 A;  1JJ2 A;  4KBM B;  3OBY A;  3CXC A;  2X51 A;  2DPP B;  3OMG A;  4FU6 A;  2LDM A;  4AT1 B;  1M1K U;  2DD5 A;  3V8K A;  1W2B P;  1VQL T;  1D0Z A;  1I07 A;  4XTU A;  3QYH B;  3VS5 A;  2DME A;  3CME T;  2ZPG B;  2L3P A;  2LQW A;  2P0K A;  4M75 E;  1KD1 U;  4F6U B;  5KCO A;  2K5F A;  2F1L A;  4C8Q A;  3EFO A;  2IW9 B;  2QDY B;  4ZGD B;  3EGU A;  2G6F X;  3EH2 A;  4N0A C;  5KYN A;  1N8R R;  4C8Q F;  3MO8 A;  2KY9 A;  4M75 B;  3G6E Q;  3I5S A;  4NC6 A;  1KQ2 A;  3CCJ A;  4BI4 A;  2JTE A;  1UNH D;  1PHT A;  4KUD K;  4JRI A;  4AKH A;  3JCM g;  2DL4 A;  4RTX A;  2DO3 A;  3DJB A;  1N9S A;  4GY5 A;  4C92 D;  3EG1 A;  3ME9 A;  3TVT A;  2QDL A;  2RPN A;  1MV0 B;  4Z88 A;  3HRT A;  1SKU B;  2O4X B;  4PJO C;  5IHI A;  5ECA A;  3EGX A;  4PJL A;  1JU5 C;  1BYM A;  2W9Z A;  2FL7 A;  4KUL A;  1YIJ Q;  4EOI B;  4F70 B;  2FYK A;  4XTY A;  3PNW C;  4RMO A;  1WQ7 A;  3PO3 S;  1WX6 A;  1WXU A;  1B07 A;  2X9H A;  4FYW B;  4IIO A;  4CFM B;  4IKF A;  2EAY A;  3CBM A;  2E6Z A;  3M54 A;  1SSF A;  3EG3 A;  4X1V A;  1F1B B;  1N9R A;  2QK0 A;  5GAN 6;  2DXT A;  3TNI B;  3DDP B;  2DVJ A;  2UUE B;  4XU0 A;  1M2V B;  1C0M A;  3PVL A;  1WXT A;  2E70 A;  2RK2 A;  2HZY A;  3E1S A;  4Z6Y A;  4EMK C;  2VUB A;  1V76 A;  2RJF A;  3I56 T;  4CRL B;  4N0A A;  1VQ9 A;  5IHK A;  1SRL A;  1UNG D;  5GAM j;  4PLI A;  3OMC A;  2LQK A;  3S3M A;  4EPC A;  2KE9 A;  2C5N B;  1PM3 A;  5CKB A;  2MAM A;  1VQ9 Q;  1WFW A;  1O9S A;  1WPY A;  2LX7 A;  3CCL A;  1EZZ B;  4V2S A;  4ZNX A;  1VQ6 T;  4QQ6 A;  3EOC B;  3EFR A;  1H24 B;  2E5Q A;  4A4H A;  3ULR B;  3F70 A;  3I55 A;  5DQV A;  1MHN A;  4EOJ B;  1ZSZ A;  1W1F A;  1VOL A;  1PD0 A;  5GAN 8;  3X26 B;  3NTK A;  2CCH B;  1TXQ A;  2L3S A;  3NMZ C;  4D8K A;  3MCA B;  3DB4 A;  4F7U F;  4PJO B;  5GAN f;  1XTD A;  2DXC B;  1NBE B;  4RCB A;  1RAA B;  3H0F A;  4BY6 C;  4PFZ A;  5CKE A;  2YWW A;  4OR5 B;  2DEQ A;  5HY6 A;  3CCU A;  3EGD B;  3HBL A;  3GTM S;  3LYI A;  5CKF A;  5GMK e;  4MIM A;  4M75 G;  4R0K A;  1M90 U;  1KJW A;  4F16 A;  4M77 C;  4DBF A;  3I56 A;  1QCO A;  3QKJ A;  2FRW A;  1PKD B;  1YHQ Q;  2X35 A;  4XAX B;  4M78 D;  4A54 A;  3CMA Q;  4F7U A;  2E6N A;  3I55 Q;  3OYI A;  2LZ6 B;  3MIA B;  4HCC A;  4J9D A;  2DMO A;  3M58 A;  1IB8 A;  2C5V B;  3REA B;  4XTV A;  4BCP B;  1X6G A;  2HSE B;  5FU7 B;  1NJI C;  1OZ2 A;  2EQK A;  1NPR A;  1M3A A;  1ZUY A;  2KMG A;  1JKW A;  2C0O A;  1QVG A;  2LJ1 A;  1AT1 B;  4PJN A;  1YCS B;  4YTL A;  2E1H A;  3SEM A;  4C92 C;  4EMG A;  3LH0 A;  2EGE A;  3EJ1 B;  5HBE B;  3EFS A;  4M7D G;  5L8R E;  2JXB A;  2JTF A;  3OS0 A;  4M75 C;  1VA7 A;  2O01 E;  2YRC A;  2MK5 A;  3G6E A;  5GAN h;  5GMK l;  2PU9 B;  4LDY A;  4AG1 C;  3QZ5 B;  4G6L B;  3FLG A;  1BU2 A;  3RUX A;  1O9K B;  1NPP A;  2M02 A;  3DLL A;  4LE9 A;  1M1G A;  2IIM A;  2I0N A;  4OGE A;  3V8J A;  1RI0 A;  3VS1 A;  4M78 B;  2E12 A;  4M78 A;  1A0N B;  2JM9 A;  5LMK B;  1ZBX A;  3C94 A;  1YJW T;  1I8F A;  2RNA A;  2PZ1 A;  1GRI A;  3TNW B;  1Q7Y C;  3PFS A;  3DL1 A;  1U3O A;  2FRY A;  4N4I A;  1HD3 A;  4Z8A A;  3GP8 A;  1U1S A;  3I9Q A;  4E7K A;  4BCK B;  3JCM h;  3SFM A;  4AFU C;  5ICP B;  4C5I A;  4HCB A;  2DZ9 A;  3CPW P;  5LJ5 h;  1GFC A;  2HCK A;  3CCM A;  2LTO A;  1W2B S;  1U1T A;  2DIG A;  3R6N A;  2LVM A;  3A8G B;  3CD6 T;  3L1A A;  4CFN B;  2XID A;  1WJR A;  3JCM J;  4F6S B;  4BCG B;  4EOR B;  3CCS T;  1WJQ A;  1U5S A;  5LL6 S;  2WIP B;  2QTX A;  2DXB A;  2WEV B;  2R5A A;  1R0B G;  5GAO r;  4F7U B;  3M0S A;  2P4T A;  5D6W A;  7AT1 B;  1Y71 A;  1H1P B;  4PK4 A;  1QQJ A;  1R77 A;  2I2L A;  1VQO A;  2Y4Y A;  3FIF A;  1OPK A;  5KH6 A;  4IUT A;  3FDR A;  3HHT B;  2C4G B;  1I0C A;  5LJ3 h;  4F7U E;  3CQT A;  1PNJ A;  1BBZ A;  3QHW B;  2QQA A;  4LXC A;  1GL5 A;  2O9V A;  3BLQ B;  1K8A C;  2MWO A;  3MP6 A;  2KR3 A;  3MY5 B;  4J83 A;  1T3L A;  1QVF A;  2NLU A;  3GBQ A;  2A3L A;  1CSK A;  1YP5 A;  1HYO A;  5LJ5 f;  1NZ9 A;  3CC4 Q;  2ZPI B;  1YFN A;  1UB4 A;  2YUN A;  4HA8 A;  2CP2 A;  3CCS A;  3CME A;  3OYG A;  5CQY A;  2DK3 A;  1WZO A;  1VQL A;  1VQ4 T;  2ROT A;  4F7L B;  4KUI A;  1D3B A;  2XD0 A;  3JV3 A;  1S1N A;  2CGH A;  2KT8 A;  3NPF A;  4KRD B;  4CC4 B;  1UEB A;  1VQO Q;  1OL1 B;  3HRU A;  1IRE B;  3X28 B;  5I21 A;  2DIL A;  1V29 B;  4BCM B;  5FLX E;  2KVQ G;  4MMK A;  2ED1 A;  1BB9 A;  1QKX A;  5L2W B;  2K79 A;  2CUB A;  3REB B;  2DXB B;  1UHF A;  2GTJ A;  1VIF A;  3RMS A;  4MZM A;  4EOS B;  5FRN A;  2QDJ A;  5GJV B;  2RJD A;  1M3C A;  1VQL Q;  4ZGJ B;  1YCY A;  4FM4 B;  1TOV A;  1GY3 B;  1MNE A;  4BCF B;  2LCL A;  1UGP B;  3H41 A;  4QVD A;  1ZUK A;  1NE8 A;  3JSC A;  1ABO A;  2HDA A;  2JT4 A;  2DZC A;  3G71 A;  2K6D A;  3CC4 A;  4C5E A;  4A4F A;  5LJ5 g;  2X4Y A;  1M2V A;  1QVF P;  4JUV A;  3QO3 A;  1VQO T;  4QKU A;  2HQH A;  4EMK B;  2V8K A;  4FYY B;  1KQS S;  2K5L A;  4ZTF A;  2ZPF B;  4KRC B;  4F17 A;  5FU6 B;  4B9X A;  2YUP A;  2WSF E;  2DTI A;  1WI7 A;  2CP5 A;  4A4G A;  4B9W A;  1R8O B;  4WTO B;  2E3H A;  4N4H A;  4O6J A;  5EJC A;  2D8H A;  3RDV A;  1K1Z A;  4FYV B;  1OIU B;  4BCM D;  3VKG A;  2KXD A;  2VV5 A;  2DJZ A;  2QI2 A;  2E65 A;  4RUG A;  2JVV A;  2E10 A;  4M78 F;  4B6M A;  3E2U A;  4Y72 B;  4DEY A;  4TVR A;  2ZAE A;  1G2B A;  1M1K R;  4RTZ A;  3JCM f;  3OS1 A;  1TU0 B;  4FW1 A;  4EIK A;  2D6F A;  2MF2 A;  1FKM A;  1X2Q A;  4OF1 A;  1KD1 R;  4XTX A;  3AHU A;  1VQ5 Q;  2A0F B;  3CCV Q;  3M4G A;  2KR6 A;  4MFD A;  4BDZ A;  1YJN A;  1FMV A;  1N8R U;  2EGA A;  1VQK A;  1VQN A;  4HCK A;  4M7A A;  1OZ3 A;  5CQX A;  4ELY C;  1K8A U;  2RHX A;  1OGU B;  3RBB B;  4M77 F;  2EUF A;  2EKO A;  2DD5 B;  4DBR A;  2VKN A;  2IG0 A;  3CMA A;  2QAZ A;  5GAO q;  5J39 A;  3BG5 A;  5HQ0 B;  1MV3 A;  3VKH A;  1Y57 A;  1SRM A;  2GBQ A;  1RLQ C;  3FEO A;  3CMA T;  3HZJ A;  1B3Q A;  4XTW A;  3NGP A;  2E3I A;  4KRT A;  3TRE A;  4EMH A;  1QW1 A;  3EGD A;  2G3R A;  3M56 A;  2KNB B;  4IUR A;  3Q1J A;  3CBP A;  2C5O B;  2AKK A;  4AKG A;  2E64 A;  2JN0 A;  2K3X A;  3ZL7 C;  4J9F A;  2W99 A;  1M8M A;  2FZC B;  3QYE A;  4C92 A;  1LOJ A;  3PMI A;  1YI2 T;  1FXX A;  1CKB A;  2QQS A;  3BLH B;  4LUE A;  1VQ7 Q;  3HKS A;  1RAE B;  1Q95 G;  4C0D B;  4MFE A;  4CI0 C;  1I5L A;  1TUG B;  5DM7 R;  3BDL A;  2FPE A;  4BBR M;  1Q81 R;  3CCV T;  2DA9 A;  1JXO A;  1Q86 U;  2RMO A;  2QQ9 A;  1QLB A;  1G83 A;  4YC3 B;  1O75 A;  2OTL Q;  1KFZ A;  1FX7 A;  2J6O A;  1AZG B;  1AIS B;  3L2V A;  3EID B;  4E7Z A;  4J7I A;  3JB9 G;  4M77 D;  2LP5 A;  1HK9 A;  4PJJ A;  1LJO A;  3M9Q A;  3S3N A;  1TWB A;  1KQ1 A;  1H4L D;  2D0Q B;  2RM4 A;  2X4W A;  2V1Q A;  2DIQ A;  4F7S B;  3UF4 A;  2YLB A;  5LJ3 j;  2X3X D;  5GAO l;  4ELJ A;  3BG9 A;  3G33 B;  4JJN K;  4JJC A;  2BTT A;  4C5G A;  1PG5 B;  5LJ3 e;  4HL4 A;  2YSQ A;  1PRL C;  2VAS A;  4A4K A;  3A8M B;  2R7G A;  2RJE A;  2QXF A;  1ZX6 A;  3V7C A;  4XQ3 A;  1K9M U;  1GBR A;  2D0N A;  2VWF A;  4JLI A;  3G4S Q;  1RL2 A;  1K73 R;  4AI6 A;  1GFD A;  2G9X B;  1OI9 B;  1BCM A;  3CCU Q;  2WMA B;  4ANJ A;  5GAN 7;  4RG8 A;  2PK2 A;  1R0C B;  2EVR A;  5I11 A;  1AWJ A;  3EGX B;  2OTJ T;  1JBM A;  2DRK A;  1AD5 A;  1Q7Y U;  2F2C A;  5CKD A;  1Z9Z A;  2H3J A;  1Q86 C;  1N8R C;  4QSH A;  1H25 B;  4EOO B;  2OI3 A;  2DER A;  2PUK B;  5LJ3 f;  4C8Q C;  1J3T A;  4MML A;  4HVU A;  4AKI A;  4JX4 A;  4DOW A;  1Y0M A;  2DL5 A;  2GGR A;  2VB6 A;  1KHI A;  3EG2 A;  3TSZ A;  1VYV A;  3OW2 A;  1WJS A;  1H27 B;  3JB9 J;  4LDW A;  1VIN A;  2OTJ A;  3EFO B;  4AFS C;  3L2Q A;  1QVG P;  2A28 A;  2DYB A;  3QPH A;  3CCM T;  1YJ9 A;  5D6X A;  5KYY A;  3LWH A;  3MY1 B;  1YNZ A;  2WSE E;  5HKC A;  2B86 A;  3VJP A;  4C8Q G;  1D3B B;  1JJ2 P;  2BKZ B;  3OYY A;  1VIE A;  5IDP B;  1G3S A;  1KHC A;  2KGT A;  5CVI A;  2BS3 A;  2J6F A;  1NM7 A;  1AEY A;  2HEQ A;  1OL2 B;  1U06 A;  1MMN A;  4TTH A;  2XHC A;  3DTO A;  3LH5 A;  1U8R A;  2E4H A;  1RAG B;  1MGQ A;  2MMP A;  4PFP A;  3TN8 B;  3CC7 T;  3JCM W;  4PJO A;  2G77 A;  2JS0 A;  4ZGE B;  4YOZ A;  1BI0 A;  2BKD N;  4IMY B;  2EBP A;  3OYK A;  3UPU A;  2A08 A;  2ESW A;  5IH2 A;  4BCN D;  1AWW A;  5GAO p;  1N6A A;  3J7A F;  1QP2 A;  5FW9 A;  3G1J A;  4BDY A;  2LCS A;  2V8I A;  2F69 A;  1F5Q B;  3BW1 A;  2FG0 A;  2UZE B;  2DTH A;  1WA7 A;  2P4R A;  2HKQ B;  3OYN A;  3AT1 B;  1VQ4 A;  2W96 A;  1EFN A;  4DQ2 A;  2RO0 A;  5LJ5 j;  2XDD A;  3CCL T;  2EYW A;  1T3S A;  1JOW A;  1UNL D;  2CT3 A;  3FB9 A;  1BKB A;  4Y91 A;  3CCV A;  3MP8 A;  3OSS C;  3CPW A;  2C0I A;  2ROL A;  3LW5 E;  1AOJ A;  1FMK A;  2AT1 B;  2VXE A;  3M5A A;  1UDL A;  2PVO B;  2AZV A;  1UGV A;  3SWN A;  3KXT A;  2YUO A;  5J3B A;  4Q5W A;  3FC3 A;  1MMA A;  4J8O A;  1WHG A;  2LX9 A;  3CCQ Q;  4C0G A;  3CCU T;  4C0Z A;  1N27 A;  3VYG B;  4BY1 X;  1M1F A;  3E9G A;  1Q82 C;  3M0T A;  4L59 A;  2PJQ A;  1PWT A;  2EPD A;  4NL3 A;  2B9R A;  4C5H A;  3TEE A;  2QFZ A;  2EW3 A;  2H3E B;  5IHY A;  2AK5 A;  3JCM P;  3GF5 A;  4M4Z A;  2O2O A;  4PJO F;  1PKS A;  1SF9 A;  2MI6 A;  4CC2 A;  4A53 A;  2DKG A;  1O9K A;  2LCC A;  3OYF A;  1JSU B;  3IQL A;  3CD6 A;  4VUB A;  1M90 C;  2DLP A;  3MI9 B;  2ED0 A;  2VXF A;  3QG1 A;  1WHJ A;  1QMZ B;  4C92 G;  2O4X A;  4DA4 A;  3OS5 A;  1H8K A;  3VU3 C;  3A8O B;  3X20 B;  1WLP B;  2QF7 A;  2BIV A;  1NJI R;  2ZZD B;  5CKH A;  1DJ7 B;  2M51 A;  1ABQ A;  2ZPB B;  4M77 B;  2IW8 B;  5CR2 A;  2KRM A;  4XU2 A;  2RK1 A;  2FHD A;  3EH1 A;  3VV0 A;  1VUB A;  3OYM A;  5IF1 B;  3MHX A;  1SG5 A;  4IIM A;  1ZA1 B;  3N5B B;  1RAH B;  4C8Q D;  3QUI A;  1S72 T;  4YOO A;  2CZ1 B;  1Y7X A;  2SEM A;  4F7U G;  4HVV A;  1I81 A;  2DRM A;  5CCA A;  5FU7 C;  3UDC A;  5GAM f;  3LGF A;  2EGC A;  2FO0 A;  3HL8 A;  1KC8 R;  3OYL A;  1YJW Q;  5DQW A;  4O5V A;  2W9F A;  1M5Q 1;  1XNI A;  3H0H A;  1E6G A;  2MWP A;  5KE3 A;  4OMM A;  2LQ8 A;  2KRN A;  3TNH B;  3ER0 A;  1G5V A;  2L0A A;  8AT1 B;  3QBY A;  5HVY B;  2HBW A;  3QZ9 B;  4FSX A;  4ORZ A;  3O0G D;  4BCH B;  1WDX A;  5KYW B;  1Y96 A;  1GUX B;  1IRX A;  5CK9 A;  1WIE A;  1ZUU A;  1QWF A;  1UJ0 A;  3URG A;  2F2V A;  4EC8 B;  1WHK A;  1M2O A;  3S3O A;  5EG2 A;  2V22 B;  4BCN B;  1W4S A;  5GAN d;  1UFF A;  1TUC A;  1SEM A;  4R55 A;  3DOG B;  1ZSZ B;  3MPU B;  5IXF A;  2BZX A;  5L23 A;  1GH6 B;  1T0H A;  3VRZ A;  2O9S A;  1JJ2 S;  4C92 E;  3MET A;  2WIH B;  2DNU A;  2FZK B;  1JRI A;  5CYI B;  1OV3 A;  1Z9Q A;  1QLY A;  2CRE A;  3RNJ A;  1YJ9 T;  4C8Q E;  5DY9 A;  3CCE T;  2RHZ A;  1PSE A;  2D9T A;  2ENM A;  2QGF B;  5GAN 4;  3PE0 A;  4C92 F;  2DTO A;  3X24 B;  2YRD A;  4EOM B;  4I3Z B;  2J6K A;  2KYM A;  1VQ4 Q;  4M6V A;  2GQI A;  3FJP A;  2NUP B;  1YIT Q;  1VQ8 A;  1ENW A;  1JO8 A;  3QHS A;  2OX7 A;  4CFX B;  5EC7 A;  4LN2 A;  4YOS A;  1K8A R;  2LQN A;  3JB9 F;  1RAD B;  2ABL A;  2PK9 B;  3JCM Q;  3NHN A;  1W2B A;  1N5Z A;  1S72 A;  2COZ A;  1OYX A;  1QCF A;  4Z02 A;  1TFB A;  4ROD A;  2NUT A;  1VQP Q;  4KT0 E;  2CUD A;  3HP9 A;  1XJW B;  2LW4 A;  3VYH B;  3CCE A;  1PCX A;  3CC7 A;  1PSF A;  3MJX A;  5DLQ E;  4NOY A;  1P92 A;  4M7D D;  4PFO A;  3BY7 A;  2BE7 D;  1YWP A;  1QKW A;  2WPA B;  4M7D C;  2WAC A;  3MEV A;  3P8D A;  3JB9 H;  3EG9 B;  2CT4 A;  1BI3 A;  3DKM A;  4ZN1 A;  1YJ9 Q;  1K9M C;  2Y90 A;  3R6O A;  1OQK A;  2DBM A;  2HQE A;  3G7Z A;  5C0M A;  1VQ8 T;  3JCM e;  3L2W A;  1UJY A;  5LJ5 e;  2RHY A;  3VS4 A;  3NTH A;  4F7J B;  4M75 A;  2ZCF B;  3I5R A;  2IPO B;  3OYC A;  1VQP T;  4C8Q B;  5GAN 5;  1WHH A;  2KEA A;  1B7T A;  2EJ9 A;  4CFV B;  2CH4 W;  5EFQ B;  3M57 A;  1GBQ A;  2DL8 A;  2Y4X A;  1X69 A;  1YWO A;  4ESR A;  3MKD A;  1AHJ B;  4FW2 A;  4OGC A;  2QEX T;  1JST B;  2V1R A;  5A2Q E;  4JRK A;  5GAM e;  2J7I A;  2F5T X;  3OA6 A;  2RF0 A;  1CKA A;  4XTZ A;  1PRM C;  3RIR A;  2F5K A;  4CFW B;  1E6H A;  1BI2 A;  2WFY B;  2CH4 A;  1B34 B;  1ZQ1 A;  1TUD A;  2CP7 A;  1H1S B;  4M7D A;  4MZP A;  1OOT A;  3PMT A;  2C5X B;  2HSP A;  4IUP A;  2DD4 A;  4F14 A;  4BCI B;  3JRZ A;  1YI2 Q;  2KXC A;  2A36 A;  1UG1 A;  2CZ0 B;  3BLR B;  1K73 U;  5IAY A;  3EG0 A;  2EFI A;  3OYA A;  2VVK A;  5GAO n;  5GJW B;  2VC8 A;  4ELZ C;  3U23 A;  5GAN e;  2EQU A;  2K3Y A;  3TW7 A;  3RES A;  1OIY B;  2EIF A;  2RQV A;  4CRI A;  3CCQ T;  1MMG A;  4EC9 B;  1D3U B;  5HCK A;  2RHI A;  4FCY A;  1SSH A;  2JMA A;  1NEB A;  4PNO A;  2BZ8 A;  4RKU E;  3L2R A;  2JGZ B;  2CP0 A;  4BCO B;  2JTM A;  2PHG A;  1QWE A;  3NTI A;  5GAN 3;  2HAX A;  3OYJ A;  3BHT B;  4QT7 A;  2XKO C;  2KBT A;  1K76 A;  3S6W A;  5HBH B;  3CC2 Q;  1WHL A;  2HBP A;  1IXD A;  5HNB B;  4NS5 A;  2KI7 A;  2BS2 A;  3VS3 A;  2MPX C;  2W10 A;  3J81 E;  2DL3 A;  2K5I A;  3M59 A;  4HCZ A;  1S72 Q;  2E5K A;  1EIF A;  2JNG A;  1OI1 A;  2PVG B;  2DJQ A;  2HMA A;  3INZ A;  1GUX A;  3EHR A;  2JS2 A;  3KHI A;  2R57 A;  1NLO C;  2K2V A;  4Z89 A;  1VQ8 Q;  2DEU A;  4E7J A;  2DF6 A;  4E47 A;  1BU1 A;  4OB1 B;  5KYU A;  2PTK A;  4KGV B;  2ZPH B;  1UGQ B;  2LJ3 A;  2X1N B;  4EOK B;  2FPF A;  1UGR B;  1H64 1;  3CC7 Q;  2I40 B;  2PNI A;  1G3T A;  3QHR B;  2COY A;  2LT1 A;  5LQF B;  2QGG A;  1PC0 A;  4EOL B;  1K4U S;  4X9C A;  2M0O A;  2F2X A;  2FPD A;  4RTY A;  3K7A M;  3VUB A;  4E7I A;  3G71 T;  4FYX B;  3BFM A;  2FZG B;  5FWC A;  3CCJ T;  2NUZ A;  4ELL A;  2XG8 D;  4KH0 B;  3VKI A;  1WNL A;  4J9I A;  4OVA A;  2RI5 A;  2CYZ B;  1ZSZ C;  1T0J A;  3CCJ Q;  1X75 C;  2HKN A;  3VS0 A;  3L2U A;  1RAF B;  3RGF B;  1FMW A;  1VQ5 A;  3OBW A;  2V8J A;  4LD6 A;  5IDN B;  4F6W B;  4JX5 A;  1YJN T;  1HXD A;  4M78 E;  2AHJ B;  4ROE A;  1KQS A;  2QEX A;  3QYG B;  2DM1 A;  3EHQ A;  4FT4 A;  3CXC S;  5IXB A;  4BUG A;  1UUE A;  2NYS A;  2Z0W A;  3M0R A;  3JCM X;  2GNC A;  1VYT A;  1H26 B;  3M55 A;  2EKH A;  4MZT A;  1NEG A;  3BHU B;  4KGX B;  2EYQ A;  5HBJ B;  1FYN A;  4OP0 A;  2RQW A;  5FWB A;  2XDP A;  3M0U A;  4JJB A;  5GMK h;  1W6X A;  2WSC E;  3UWN A;  4P5N A;  4RTU A;  3J80 E;  1VQ7 T;  2V26 A;  2M16 A;  3CCE Q;  4UN0 A;  2DVE A;  1VQM A;  2K9G A;  1IGQ A;  1WQW A;  2NUT B;  5A0L A;  2OJ2 A;  1PKT A;  4FL6 A;  1AZE A;  2CP3 A;  3VYG A;  3HPW A;  1BIA A;  1E7O A;  2RI3 A;  2CSQ A;  5ACB A;  1QVF S;  3JCM b;  4NST B;  3OYH A;  4HXJ A;  2QTV A;  1KK7 A;  3JB9 I;  1ZBJ A;  5CAI A;  1OEB A;  2COW A;  3GIB A;  5HK3 A;  2ZGW A;  3E9F A;  2RB6 A;  2DET A;  4HT9 A;  3GNG A;  3TW6 A;  2NWM A;  3OB9 A;  4J9C A;  4LDV A;  4M7A F;  2PVD B;  1E9H B;  1NJI U;  2BUD A;  1QCN A;  4EON B;  1X6B A;  3DB3 A;  2HQX A;  1WYX A;  5GAM g;  2IN3 A;  2YHT A;  3O5Z A;  2WHB B;  3C4S A;  2I53 A;  1NG2 A;  2RA2 A;  4JRQ A;  3JAM E;  1VQM T;  3MP1 A;  4KH1 B;  2ZPE B;  2RQR A;  4J9G A;  1JB0 E;  4E6R A;  3A8L B;  3OY9 A;  4M78 C;  4QVC A;  3H0I A;  2JZ2 A;  3PIO A;  4MDX A;  2OAW A;  3OQ5 A;  3OSV A;  3QSU A;  1TG0 A;  2X4X A;  5LJ5 d;  1H1Q B;  4D6W A;  1IHW A;  3EAE A;  2FB7 A;  4JLG A;  4OGR B;  4CFU D;  3H9N A;  4HNU A;  3V7R A;  5KYW A;  2GFA A;  3OW2 S;  1M27 C;  1VQM Q;  4OMF B;  2GF7 A;  1B34 A;  4IUU A;  1VYU A;  4LDU A;  2DD4 B;  5CIU A;  4M77 E;  4RTW A;  4BBS M;  5GMK m;  5GAN 2;  3RKY A;  1H1R B;  4QVZ A;  3I35 A;  1EX4 A;  4AFQ C;  2JOY A;  1OX9 A;  1TSF A;  5I22 A;  1YIT T;  5IT9 E;  1GCQ A;  4XK8 E;  1D1C A;  1TTH B;  2JW4 A;  3ZEH A;  1PD1 A;  4XU3 A;  2K57 A;  2KRO A;  4D8D A;  2D1X A;  2CDT A;  4HNV A;  1FIN B;  5GAN j;  2RH2 A;  2QEX Q;  3JCM c;  1GXI E;  1BCO A;  1LPL A;  2YUQ A;  2CZ6 B;  4E7S A;  3QJY A;  4M7A B;  5IHN A;  1X01 A;  3CC2 T;  2UZB B;  5KYX A;  5DLO A;  4M77 G;  3A98 A;  4WF2 A;  4BI8 B;  2B8A A;  3L2Z A;  1IO6 A;  3ZBD A;  1W70 A;  1NYG A;  5KYX B;  2QQB A;  4ZN3 A;  4C0D C;  4ATO A;  1TS9 A;  2A7Y A;  3G4S T;  4M7A E;  4QW2 A;  4E2F B;  4BE1 A;  1C1A A;  1HSQ A;  2X4J A;  4NL2 A;  2P0P A;  4AG2 C;  2O88 A;  3DLM A;  3FJ5 A;  5AYF A;  2KQW A;  2WXV B;  3LQ5 B;  4LNP A;  5KCH A;  5M9O A;  4HLQ A;  4HNT A;  1JQQ A;  1Q82 R;  2OAU A;  1YHQ T;  3QJ6 A;  2ECZ A;  4Y92 A;  2FVU A;  3C12 A;  4BCQ B;  2DL7 A;  1ZSG A;  2GFU A;  3QWX X;  4BCQ D;  2CZ7 B;  3CD6 Q;  2M0Y A;  3OYB A;  4IUV A;  2DFU A;  5I2M A;  2K2M A;  2KRS A;  3PT9 A;  2HL5 C;  5GAM d;  1K73 C;  2H8H A;  3CCR T;  3BHV B;  2AIR B;  3ZFJ A;  4BE0 A;  2KK4 A;  2QAS A;  3DDQ B;  3HSB A;  2AKL A;  3TQ7 P;  2LMJ A;  4M7D E;  2D8J A;  4WCI A;  4E7H A;  4EMK A;  3M0Q A;  1Q81 U;  4L6V 5;  4LUD A;  1Q86 R;  2MOX A;  5A0G A;  2CJM B;  2DE0 X;  2C6T B;  4LOC A;  1XQH A;  2L3R A;  1LVK A;  8ATC B;  5FRO A;  5IN1 A;  3HB9 A;  1YN8 A;  2HD0 A;  4PLL A;  4ROC A;  3QII A;  1KG1 A;  1GCQ C;  1NLP C;  1C9B A;  4JJD A;  4PJO G;  1LCK A;  2XIC A;  1K9A A;  4A4E A;  2JUF A;  1AWX A;  2AZS A;  3QYB A;  4IUQ A;  4BXX X;  3UT1 A;  5HK0 A;  1RAI B;  3MEU A;  1BK2 A;  6AT1 B;  2SRC A;  2QQ8 A;  2LNH B;  2OTJ Q;  3JCM V;  4JS5 A;  2L2P A;  1KC8 C;  2PMI B;  2ATC B;  2EQJ A;  4J6X A;  4II1 A;  2YLC A;  3CEY A;  3H6Z A;  2RHU A;  2EJG A;  3KBG A;  2P0Q A;  1YHQ A;  3CXC P;  3OYE A;  2C06 A;  2KMT A;  3I56 Q;  3GPL A;  5GMK i;  2L5Q A;  3L42 A;  4EOP B;  1C6V X;  4OMP A;  3RER A;  1D0X A;  5CEI B;  3QXE B;  1Y96 B;  2DAQ A;  3VS6 A;  1YI2 A;  4CFU B;  4HKE A;  1X6O A;  4Y28 E;  3JB9 D;  4BY7 X; 
#chains in the Genus database with same CATH homology
 4LDX A;  2YRV A;  4OGC A;  4N0A A;  2QEX T;  4J6W A;  5A2Q E;  1VQ9 A;  4JRK A;  1UGS B;  4DOV A;  3RMQ A;  5GAM e;  2F5T X;  3OA6 A;  3L2V A;  4XTZ A;  3CC2 A;  3WVD B;  5GAM j;  4C0F A;  3GNF B;  4PLI A;  3OMC A;  4J7I A;  3RIR A;  2F5K A;  2KAF A;  2LQK A;  4M77 D;  3S3M A;  4EPC A;  3JB9 G;  1HK9 A;  5CKB A;  1BI2 A;  1B34 B;  1LJO A;  1ZQ1 A;  1Y07 A;  2MAM A;  3M9Q A;  4M7D A;  4MZP A;  2VGM A;  3PMT A;  3S3N A;  1KQ1 A;  2D0Q B;  2RM4 A;  4M75 F;  2X4W A;  1XOV A;  1O9S A;  1WPY A;  4IUP A;  2DIQ A;  2DD4 A;  3CCL A;  2YLB A;  3JRZ A;  3PIP A;  4V2S A;  1VQ6 T;  4PKC C;  4ZTJ A;  5LJ3 j;  3SDZ A;  4QQ6 A;  5GAO l;  4ELJ A;  3BG9 A;  4JJN K;  2CZ0 B;  3EFR A;  4M7A D;  4C5G A;  2E5Q A;  4A4H A;  5LJ3 e;  4HL4 A;  3F70 A;  4EDU A;  3I55 A;  1K73 U;  4A4K A;  5IAY A;  1M1K C;  3A8M B;  1MHN A;  2EFI A;  3HFO A;  2RJE A;  3OYA A;  2QXF A;  3SD4 A;  1K9M U;  3V7C A;  4XQ3 A;  2RJC A;  5GAO n;  3ASK A;  2LNV A;  2VC8 A;  4FIB A;  1E7P A;  2ZZD A;  4JLI A;  4ELZ C;  1KD1 C;  5GAN e;  2EQU A;  2K3Y A;  4JDS A;  3TW7 A;  3RES A;  4BI3 A;  1RL2 A;  2EIF A;  3X26 B;  4CRI A;  5GAN 8;  3NTK A;  4AI6 A;  3CCQ T;  5FRM A;  1QVP A;  2XI9 A;  2RHI A;  5GAN 7;  3MCA B;  4RG8 A;  4PNO A;  3X25 B;  3DB4 A;  4F7U F;  4PJO B;  5GAN f;  1XTD A;  3OS2 A;  3G6E T;  2DXC B;  4RKU E;  3L2R A;  4RCB A;  4BY6 C;  1H3Z A;  3LGL A;  2OTJ T;  1JBM A;  2WJ9 A;  2JTM A;  1VQ9 T;  4N4G A;  1Q7Y U;  5GAO m;  4JRP A;  3NTI A;  5CKD A;  5CKE A;  5GAN 3;  2HAX A;  2H3J A;  3OYJ A;  1Q86 C;  2DEQ A;  5HY6 A;  3CCU A;  4QSH A;  2XKO C;  4BAC A;  1N8R C;  2PUK B;  3HBL A;  5CKF A;  3LYI A;  5LJ3 f;  4C8Q C;  4MIM A;  4M75 G;  5I2S A;  4RG2 A;  4MML A;  1M90 U;  4AKI A;  3VUZ A;  4JX4 A;  4DOW A;  3S6W A;  3O8V A;  4M77 C;  3I56 A;  3G4S A;  3QKJ A;  1KHI A;  2HBP A;  2X35 A;  1VQ7 A;  4NS5 A;  2BS2 A;  4M78 D;  4XAX B;  4A54 A;  3OW2 A;  4F7U A;  2E6N A;  1VQP A;  3J81 E;  4HT8 A;  4PJO E;  1M9S A;  1WJS A;  3OYI A;  4HCC A;  3JB9 J;  4LDW A;  2K5I A;  3M58 A;  3M59 A;  4HCZ A;  2OTJ A;  2JNG A;  1EIF A;  4XTV A;  1OI1 A;  4QQG A;  3L2Q A;  2PVG B;  3QPH A;  2KDS A;  2PUO B;  2RI2 A;  5FU7 B;  4GLK A;  5LJ3 g;  3INZ A;  3CCM T;  1YIJ A;  1YJ9 A;  2R5M A;  5D6X A;  1OZ2 A;  1NJI C;  2EQK A;  4PJO D;  1NPR A;  3LWH A;  2L8D A;  2WSE E;  3M4Y A;  2KMG A;  2CS7 A;  5HKC A;  1QVG A;  3KHI A;  4YTL A;  1G3Y A;  3E19 A;  2XDB A;  2E1H A;  2EJF A;  3VJP A;  4C92 C;  3QWL A;  4PL6 A;  2R57 A;  4EMG A;  4C8Q G;  2K2V A;  1D3B B;  2BS4 A;  1M4Z A;  3EFS A;  3LH0 A;  4E7J A;  1YIT A;  3SWN B;  4E47 A;  3OYD A;  3OYY A;  1VIE A;  4OB1 B;  4J6Y A;  3TU4 K;  1G3S A;  1KHC A;  4M7D G;  4LD9 K;  5CVI A;  2BS3 A;  1UGQ B;  2ZPH B;  5L8R E;  1UGR B;  2JTF A;  1H64 1;  4M7D F;  1I4K 1;  2XHC A;  3P8B B;  1G3T A;  1U8R A;  1VQ5 T;  3OS0 A;  2LT1 A;  4M75 C;  1Q81 C;  2O01 E;  1MGQ A;  3HRS A;  3G6E A;  5GAN h;  2MMP A;  3MEA A;  5GMK l;  2PU9 B;  4LDY A;  3QZ5 B;  4X9C A;  2KSS A;  3CC7 T;  3JCM W;  4PJO A;  2G77 A;  2M0O A;  4XU1 A;  3FLG A;  3VUB A;  4BB7 A;  4ZGE B;  4E7I A;  1BI0 A;  2BKD N;  3G71 T;  3RUX A;  3BDU A;  3OYK A;  3UPU A;  1QP3 A;  1NPP A;  3DLL A;  3BFM A;  2OTL A;  1M1G A;  1FWZ A;  2DXU A;  3M53 A;  4OGE A;  3CCJ T;  3MEW A;  3P8H A;  3WXM B;  2VYT A;  2XG8 D;  1YBY A;  3CBO A;  3V8J A;  1RI0 A;  2M1H A;  3VKI A;  1N6A A;  1WNL A;  5GAO p;  3J7A F;  4OVA A;  2RI5 A;  1QP2 A;  4M78 B;  2CYZ B;  4FT2 A;  3RKW A;  2E12 A;  4M78 A;  4BE2 A;  4BDY A;  4QQD A;  2V8I A;  4OB0 B;  1X75 C;  2F69 A;  3L2U A;  1ZBX A;  3C94 A;  1VQ5 A;  3V8L A;  1YJW T;  3BW1 A;  1I8F A;  4MDW A;  3NFC A;  3OBW A;  2V8J A;  1Q7Y C;  3PFS A;  3DL1 A;  2DTH A;  4LD6 A;  4N4I A;  3CPW S;  4JX5 A;  4BY6 B;  1YJN T;  5J26 A;  1HXD A;  3OYN A;  1VQK T;  1VQ4 A;  4M78 E;  2AHJ B;  1VQN T;  2K4Y A;  5A0D A;  3GP8 A;  1KQS A;  1U1S A;  2QEX A;  2PQW A;  4DQ2 A;  2RO0 A;  3FRN A;  4E7K A;  5LJ5 j;  3CCR A;  3QYG B;  2XDD A;  3CCL T;  3JCM h;  3SFM A;  4FT4 A;  3CXC S;  4JS4 A;  4C5I A;  4HCB A;  2DZ9 A;  4BUG A;  5LJ5 h;  3JCM X;  2DXC A;  3M55 A;  3CCM A;  3FB9 A;  2LTO A;  4MZT A;  1W2B S;  1U1T A;  2DIG A;  1BKB A;  4Y91 A;  3CCV A;  3MP8 A;  2LVM A;  3OSS C;  3CPW A;  2EYQ A;  3A8G B;  4OP0 A;  5GMK j;  4ME7 A;  5CO7 A;  3CD6 T;  3BG3 A;  3LW5 E;  2XDP A;  1LNX A;  3L1A A;  3V7S A;  2VXE A;  3M5A A;  5GMK h;  3C95 A;  4JX6 A;  2XID A;  2WSC E;  2QQR A;  1WJR A;  3UWN A;  3JCM J;  4P5N A;  2PVO B;  3J80 E;  1VQ7 T;  4E7L A;  3WVE B;  5D6Y A;  2M16 A;  3SWN A;  2DVE A;  1WJQ A;  3CCS T;  3KXT A;  1VQM A;  5LL6 S;  3LLR A;  1WQW A;  4Q5W A;  5J3B A;  2QTX A;  2DXB A;  4M7D D;  2IVW A;  3FC3 A;  3SB2 A;  4J8O A;  5A0L A;  2LX9 A;  2R5A A;  4FL6 A;  4C0G A;  3CCU T;  3VYG A;  4C0Z A;  3HPW A;  1N27 A;  1BIA A;  3VYG B;  2RI3 A;  1IZ6 A;  1M1F A;  3E9G A;  4L5G A;  4F7U B;  5GAO r;  1Q82 C;  1QVF S;  2P4T A;  4L59 A;  3JCM b;  5D6W A;  3OYH A;  4RCC A;  1Y71 A;  4J5Y A;  4NL3 A;  3JB9 I;  2I2L A;  1VQO A;  4C5H A;  2Y4Y A;  3FIF A;  4M75 D;  3TEE A;  4IUT A;  2QFZ A;  5CAI A;  5KH6 A;  3FDR A;  3HHT B;  5LJ3 h;  5HK3 A;  3GIB A;  2ZGW A;  3E9F A;  3QDR B;  3GF5 A;  4F7U E;  3JCM P;  2QQA A;  2RB6 A;  4M77 A;  4PJO F;  1K8A C;  4X9D A;  4BD3 A;  2MWO A;  2MI6 A;  4UC4 A;  3GNG A;  2DKG A;  3TW6 A;  3MP6 A;  3OB9 A;  2LCC A;  4A53 A;  1KC8 U;  4HT9 A;  4LDV A;  3OYF A;  3CC4 T;  3CD6 A;  4J83 A;  4M7A F;  1QVF A;  2PVD B;  4VUB A;  2NLU A;  2BUD A;  2GQV A;  1NJI U;  2A3L A;  3DB3 A;  1M90 C;  2HQX A;  3PTA A;  3QG1 A;  2VXF A;  5LJ5 f;  4C92 G;  5GAM g;  1NZ9 A;  1G3W A;  4R56 A;  2YHT A;  3C4S A;  2ZPI B;  2EWN A;  1UB4 A;  2O4X A;  3OS5 A;  2RA2 A;  4DA4 A;  1M8V A;  3VU3 C;  3A8O B;  3X20 B;  4JRQ A;  2QF7 A;  4HA8 A;  2BIV A;  3JAM E;  3CCS A;  1VQM T;  3MP1 A;  3CME A;  2ZZD B;  5CKH A;  3HO8 A;  3OYG A;  1VQ6 A;  2ZPE B;  5CQY A;  2DK3 A;  1DJ7 B;  2M9U A;  1JB0 E;  2QA4 A;  1VQL A;  5KE2 A;  1VQ4 T;  4KUI A;  3A8L B;  1D3B A;  3OY9 A;  4M78 C;  2XD0 A;  2ZPB B;  4QVC A;  4M77 B;  5C6S A;  2CGH A;  2JZ2 A;  5CR2 A;  4XU2 A;  1UEB A;  2RK1 A;  2FHD A;  5GAM h;  3VV0 A;  3PIO A;  1VUB A;  3OYM A;  1YJW A;  1ZHI A;  3HRU A;  4MDX A;  3MHX A;  1IRE B;  3X28 B;  2XK0 A;  2L89 A;  5I21 A;  3H8Z A;  3OQ5 A;  3OSV A;  1V29 B;  3N5B B;  3QSU A;  5FLX E;  2X4X A;  4C8Q D;  5LJ5 d;  2KVQ G;  3QUI A;  4MMK A;  4OB3 B;  1S72 T;  2EQM A;  4D6W A;  3JCM d;  2CZ1 B;  1Y7X A;  3CCQ A;  3EAE A;  2FB7 A;  4JLG A;  4F7U G;  1I81 A;  2QA4 T;  4HNU A;  3V7R A;  3OW2 S;  2GFA A;  5CCA A;  4M7A G;  3HFN A;  5GAN g;  4OB2 B;  3RKX A;  5FU7 C;  3UDC A;  5GAM f;  3LGF A;  4X34 A;  4OMF B;  2GF7 A;  1B34 A;  3HL8 A;  2DXB B;  1BI1 A;  1BIB A;  3T9N A;  3A8H B;  4IUU A;  4LDU A;  2DD4 B;  5CIU A;  3OYL A;  4M77 E;  4O5V A;  1VIF A;  3RMS A;  3KUF A;  4MZM A;  5LJ3 d;  3I55 T;  5FRN A;  4BBS M;  2QDJ A;  1M5Q 1;  1XNI A;  5GMK m;  3RKY A;  5GAN 2;  2RJD A;  4QVZ A;  2GCX A;  2JOY A;  2LT4 A;  4ZGJ B;  1YCY A;  3TCJ A;  4FM4 B;  2MWP A;  5KE3 A;  4J7F A;  2LCL A;  2LQ8 A;  1UGP B;  3ER0 A;  1G5V A;  1YIT T;  3QBY A;  4QVD A;  5IT9 E;  1NE8 A;  2R58 A;  4XK8 E;  3QZ9 B;  3LWI A;  2OTL T;  3GLX A;  3JSC A;  2HNI A;  1TH7 A;  4FSX A;  3ZEH A;  2DZC A;  4XU3 A;  3G71 A;  2K57 A;  2LC4 A;  4C5E A;  3CC4 A;  4A4F A;  4HNV A;  1Y96 A;  5LJ5 g;  2X4Y A;  5CK9 A;  3GOX A;  5GAN j;  2RH2 A;  4JUV A;  3A5Z B;  3JCM c;  3QO3 A;  2RD1 A;  1VQO T;  3URG A;  1GXI E;  4EMK B;  2CZ6 B;  3S3O A;  2LRQ A;  2V8K A;  5EG2 A;  2XU8 A;  3QJY A;  1W4S A;  4M7A B;  5GAN d;  1KQS S;  2K5L A;  1X01 A;  3CC2 T;  2CKK A;  4ZTF A;  4R55 A;  2ZPF B;  3H4C A;  3CPF A;  5DLO A;  5FU6 B;  4M77 G;  4B9X A;  4WF2 A;  4BI8 B;  2B8A A;  3L2Z A;  3ZBD A;  2WSF E;  2DTI A;  5FRO A;  5FU6 C;  1JJ2 S;  2QQB A;  4A4G A;  4B9W A;  3MET A;  1R8O B;  4C0D C;  4C92 E;  4ZN3 A;  4ATO A;  1JRI A;  2A7Y A;  3G4S T;  4N4H A;  4QW2 A;  4O6J A;  5EJC A;  4M7A E;  1QVG S;  4M78 G;  4BE1 A;  3PGG A;  1Q82 U;  3SWN C;  1YIJ T;  1YJ9 T;  3VKG A;  2VGN A;  2X4J A;  4NL2 A;  2P0P A;  5DY9 A;  4C8Q E;  3DLM A;  2RHZ A;  2VV5 A;  5GMK e;  3CCE T;  4C92 B;  1PSE A;  2DJZ A;  2D9T A;  3LX7 A;  5AYF A;  2QI2 A;  2E65 A;  2KQW A;  5KCH A;  5M9O A;  4HLQ A;  4HNT A;  5GAN 4;  1WGS A;  2JVV A;  4C92 F;  2E10 A;  2DTO A;  4M78 F;  3X24 B;  2OAU A;  1YHQ T;  3QJ6 A;  4M7D B;  4TVR A;  2E41 A;  2FVU A;  3C12 A;  4KBM B;  1JJ2 A;  2GFU A;  3OBY A;  3JCM f;  3OS1 A;  3CXC A;  2CZ7 B;  4M6V A;  3FJP A;  2DPP B;  3OYB A;  2D6F A;  2MF2 A;  4IUV A;  1FKM A;  4OF1 A;  3OMG A;  4FU6 A;  5I2M A;  3PT9 A;  1VQ8 A;  4XTX A;  3QHS A;  5GAM d;  3AHU A;  2LDM A;  1K73 C;  3CCR T;  3M4G A;  1M1K U;  2DD5 A;  3V8K A;  4MFD A;  2KR6 A;  4BDZ A;  1YJN A;  1VQL T;  4XTU A;  3JB9 F;  3ZFJ A;  4BE0 A;  3QYH B;  2KK4 A;  3CME T;  2ZPG B;  1N8R U;  1VQK A;  1VQN A;  2P0K A;  4M75 E;  3JCM Q;  1KD1 U;  3HSB A;  1W2B A;  4M7A A;  1OZ3 A;  4M7D E;  5KCO A;  5CQX A;  1S72 A;  1OYX A;  4ELY C;  2RHX A;  4Z02 A;  2K5F A;  4EMK A;  4E7H A;  1K8A U;  4M77 F;  4C8Q A;  1Q81 U;  2EKO A;  4L6V 5;  2DD5 B;  4KT0 E;  4ZGD B;  2QDY B;  2IG0 A;  3HP9 A;  4N0A C;  3CMA A;  4C8Q F;  5GAO q;  3MO8 A;  2KY9 A;  4M75 B;  5J39 A;  4NC6 A;  5A0G A;  3BG5 A;  3VYH B;  1KQ2 A;  4LOC A;  3CCE A;  3CCJ A;  4BI4 A;  1XQH A;  3VKH A;  3CC7 A;  1PSF A;  2L3R A;  4KUD K;  5DLQ E;  4NOY A;  1P92 A;  5IN1 A;  4JRI A;  4AKH A;  3FEO A;  3HB9 A;  2HD0 A;  4PLL A;  3JCM g;  3CMA T;  3BY7 A;  3HZJ A;  3QII A;  4XTW A;  1KG1 A;  2DO3 A;  1N9S A;  4GY5 A;  3TRE A;  4M7D C;  4C92 D;  2WAC A;  4EMH A;  3MEV A;  3ME9 A;  4PJO G;  1QW1 A;  2XIC A;  3P8D A;  2G3R A;  3M56 A;  3JB9 H;  4IUR A;  4A4E A;  3Q1J A;  2JUF A;  3CBP A;  3HRT A;  3QYB A;  2O4X B;  4IUQ A;  3UT1 A;  4PJO C;  5HK0 A;  4M7A C;  1BYM A;  4AKG A;  4KUL A;  2E64 A;  1BI3 A;  2FL7 A;  2JN0 A;  3DKM A;  4ZN1 A;  1K9M C;  3MEU A;  2K3X A;  2Y90 A;  2FYK A;  3R6O A;  4XTY A;  2QQ8 A;  3PNW C;  4RMO A;  1WQ7 A;  2HQE A;  3G7Z A;  5C0M A;  3JCM V;  1VQ8 T;  3QYE A;  4C92 A;  3JCM e;  1LOJ A;  3PMI A;  3L2W A;  1FXX A;  4JS5 A;  1YI2 T;  1KC8 C;  5LJ5 e;  2RHY A;  2EQJ A;  4J6X A;  4II1 A;  2QQS A;  2YLC A;  3CEY A;  4IKF A;  2EAY A;  2RHU A;  3CBM A;  3H6Z A;  2E6Z A;  2EJG A;  1SSF A;  3M54 A;  3KBG A;  3NTH A;  3HKS A;  4M75 A;  2P0Q A;  2ZCF B;  1YHQ A;  3OYE A;  1N9R A;  3OYC A;  2KMT A;  2C06 A;  4C0D B;  4MFE A;  4CI0 C;  3GPL A;  5GMK i;  5GAN 6;  1VQP T;  2L5Q A;  3BDL A;  3L42 A;  5DM7 R;  1I5L A;  4BBR M;  2DXT A;  4C8Q B;  5GAN 5;  3CCV T;  2EJ9 A;  3RER A;  4XU0 A;  1Q86 U;  2QQ9 A;  2E70 A;  1QLB A;  3QXE B;  1Y96 B;  2DAQ A;  2RK2 A;  1O75 A;  1YI2 A;  3M57 A;  2Y4X A;  3E1S A;  4Z6Y A;  4HKE A;  1FX7 A;  4EMK C;  1X6O A;  2VUB A;  4Y28 E;  2RJF A;  3I56 T;  3JB9 D;  1AHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...