3X28B

Crystal structure of nitrile hydratase mutant br56k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction intermediate of nitrile hydratase determined by time-resolved crystallography reveals the cysteine-sulfenic acid ligand to be a catalytic nucleophile
rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x28B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x28B02
2WSCE 3VYGB 5L8RE 2DXCB 2ZPHB 1UGSB 1AHJB 2PUOB 2ZCFB 2CYZB 4RKUE 3A8HB 2ZPEB 2O01E 2PU9B 2WSEE 4ZGJB 4FM4B 2AHJB 2ZPIB 4XK8E 3QZ5B 3X26B 2DXCA 2CZ7B 2PVGB 2D0QB 3WVDB 4OB2B 3HHTB 2ZPFB 3X20B 3QYGB 2WSFE 4OB0B 2CZ0B 4Y28E 3WVEB 2DXBB 1UGRB 2DD4B 2ZPBB 3QYHB 3A8LB 3X24B 3A8MB 4ZGDB 1JB0E 2ZZDA 3LW5E 3VYHB 1V29B 4L6V5 1QP3A 2ZPGB 4OB3B 2PUKB 1PSFA 2DD5A 4KT0E 1QP2A 3QXEB 1GXIE 2QDYB 2DPPB 3A8OB 2DXBA 1IREB 2DD4A 2PVDB 3VYGA 2CZ6B 1DJ7B 1UGQB 2ZZDB 1PSEA 2DD5B 2CZ1B 2PVOB 3QZ9B 1UGPB 3A8GB 3X28B 4ZGEB 4OB1B 3X25B
chains in the Genus database with same CATH superfamily
2WSCE 4XTVA 4FCYA 4PJOA 1QMCA 1V1CA 1EIFA 1ZSZA 1X6GA 4A4FA 1FMWA 2RF0A 2RPNA 1VQOT 4RG8A 4BB7A 4BY6C 2E3IA 1AD5A 4HNTA 4MFDA 2XKOC 3OQ5A 4C5GA 1WJSA 5GAN8 2EJFA 1WQWA 2P0QA 5J3BA 2YLBA 4GLKA 1SSFA 1SSHA 5GAMg 1NBEB 3M55A 2YDLA 5DLOA 2LQKA 3TNWB 4N0AA 5CKEA 3QKJA 2D0QB 1K9AA 4F04B 4TTHA 1WNLA 4OB2B 2OI3A 4XU1A 1UJYA 4PJOB 1SRMA 2F5KA 2QI2A 4RTYA 5J26A 1FWZA 3UWNA 3BLQB 4ATOA 2KRSA 2EBPA 4DOVA 1N6AA 1N27A 1CKAA 1E7OA 5CYIB 4OB0B 2E4HA 2CCIB 2G6FX 2R5MA 2V8KA 3CD6T 3J7AF 1VQPQ 3DDQB 3M0SA 4JRPA 1Q86U 2A37A 2FPEA 5KH6A 2VWFA 4OMNA 3A8MB 4ZGDB 2A08A 4Z8AA 4LXCA 1YIJQ 4AFQC 1K4US 3QYEA 1PCXA 2DEQA 3R6OA 4BE0A 4MZPA 2EW3A 1I4K1 4CXAB 2CP3A 4CRIA 2A0FB 5GAOp 1M2VA 4QKUA 3MY5B 5HCKA 4KT0E 1ZSGA 1RABB 2F2CA 2DETA 2M9UA 5L2WB 4XTYA 1M4ZA 2H8HA 4XQ3A 3ULRB 3OMCA 4IUPA 2LW4A 2RB6A 1BI0A 3TW6A 1VQ6Q 2BE7D 2K57A 2MWPA 2JM9A 2NUTA 3UT1A 4EC8B 1YJWQ 5IXFA 5GAOr 1F1BB 3KXTA 4EOLB 2L89A 1U8RA 4M78B 3A8GB 5KYWB 2HEQA 4OP0A 2DJQA 1TS9A 4M78F 4MFEA 1VQNQ 2EJ9A 5HKCA 1Q7YC 4HNVA 1YJ9Q 3MJXA 2EUFA 1R0BG 3EHQA 5I5ZB 2KY9A 1FKMA 4L59A 4RCCA 3H41A 1VQKT 4ORZA 3SEMA 3MO8A 8AT1B 2ESWA 2GTOA 3G4SA 3I56A 3CXCS 5ECAA 1VQOA 1VQ8A 1OPLA 2J05A 1G3TA 4C0ZA 1GCPA 4NSTB 3S3MA 1WHGA 1WFWA 1SF9A 2AZSA 2X4JA 4MMKA 4EMKC 4E7IA 1NYGA 1WJRA 2QK0A 2FZGB 3GF5A 2C5XB 2P4RA 2EAYA 1C1AA 1TFBA 1OKWB 3BG9A 3CCUA 4J7FA 1MGQA 3V7CA 5FROA 2DD4B 3CEYA 2D9TA 2DL3A 3BY7A 3G1JA 2BUDA 2L3PA 2HDAA 4FW1A 1K8AU 2QQBA 3I55T 1K73U 1UGVA 2EQKA 1VUBA 4M75F 2EWNA 4LOCA 2ED0A 2M1HA 2K3BA 1M3CA 1WHLA 1VYVA 4Y92A 5IHNA 5IHKA 4G6LB 4LD6A 1BB9A 2DVEA 2R5AA 1NYFA 4C0GA 1IREB 1GCQC 2MK5A 4DBQA 1O9KB 3PFSA 2EQJA 3OYFA 4JX4A 1MNEA 4QQDA 4FYVB 2MOXA 4M75A 3VS1A 2NLUA 2DD5B 2E5QA 4BY1X 1H3ZA 2JZ2A 4Z02A 5I11A 1XOVA 1N9SA 2LZ6B 2CCHB 1OZ2A 1RI9A 2AKLA 3CMEQ 2XIDA 2DYIA 2C0IA 5GAN2 1VA7A 1D0YA 2RD1A 3QIIA 2DVJA 4EMHA 1KD1R 2CGHA 5LJ5g 5KYUA 1IB8A 2GBQA 1SG5A 1BI1A 4CFVB 3FJPA 4J83A 4IIOA 2O88A 2LJ3A 3M59A 4PFZA 3UDCA 5HK0A 4IMYB 4EOOB 1RL2A 5GMKi 4BD3A 3MEAA 1GBQA 1M90R 2PU9B 4X34A 1I5OB 1ABOA 2HNIA 2DX1A 2NUPA 5CKFA 1IRXA 4J9CA 1M3AA 4AG1C 3H9NA 5CKDA 4F70B 4AKIA 4J9EA 3QHSA 1H1QB 1Q82U 2RQTA 1YJ9T 4JJDA 4IKFA 1LVKA 2RHYA 3FEOA 2M51A 2E3HA 5KYYA 2RN8A 1QCFA 2FRYA 5GMKe 4C0FA 1KC8U 1MV3A 5FWCA 5HBEB 1M1KC 5DQWA 2DL4A 1Q95G 3N5BB 4N0AC 1HYOA 2X3WD 3CCSA 2CT4A 3BLRB 4VUBA 3VRZA 4JX5A 1VQPA 3BHVB 2HKNA 1AWJA 4HLQA 2JS0A 5HVYB 1JJ2P 1Q86C 1C6VX 2DIQA 1Q81U 4PL6A 2EPDA 4F7UA 2KBTA 4EORB 2CP5A 3VS6A 1M90C 2QDYB 4J9IA 3VV0A 2BE9B 1PRLC 1VQLQ 4HCCA 3HTRA 4D8DA 4F7JB 2DO3A 1KIKA 2OTJA 2YUQA 2FRWA 1TXQA 4DOWA 3I56T 2M16A 4HVVA 3QZ9B 1X43A 2EYQA 2VGMA 4N4GA 4ZGEB 4CRLB 4OB1B 1IO6A 5LJ5e 3LWIA 4RTXA 3SWNC 1ZBXA 4F17A 1GFCA 3CCJQ 3JCMX 3MEVA 2E41A 1T0JA 4RTVA 2KGTA 2PK2A 3DB4A 3SDZA 1UGSB 3KBGA 1V76A 2CSQA 3RDVA 3G6ET 1UHCA 3HPWA 3SWNA 3I5SA 3BG3A 2KNBB 2EGAA 1SHGA 2RHIA 4PLIA 3CQTA 1PKDB 2XI9A 2KR3A 5KYXA 1OULA 3EH2A 2Y4YA 3C12A 2IVXA 5HK3A 3NTIA 2DYBA 2VKNA 3TN8B 3L2VA 3ZL7C 4KGVB 4BI3A 3BDUA 2L8DA 2RM4A 2KYMA 1ZUYA 2PK9B 4MZMA 2CZ0B 1MNDA 2KI7A 4PJOC 3VUZA 5GAOl 2K9GA 2K2VA 1QWEA 2P84A 1ZP2A 1YI2A 1PD1A 3JSCA 2IW6B 3JCMV 5GAN7 3CCJA 3G71T 1S1NA 3HFNA 2RK1A 1VQMA 1TOVA 1W1FA 3M0UA 3M0TA 1V29B 5KCHA 1QP3A 2ZPGB 4M78A 5KYWA 3OMGA 5FW9A 4FYYB 4A54A 3CCEA 4M7DD 4BCOB 5GAN6 3C94A 3O8VA 3EG3A 1H1SB 3HRSA 1OU9A 1ZUKA 4HCBA 3TEEA 3CC7T 4RTUA 3MKDA 2G77A 4A53A 1BYMA 1M8VA 4CC2A 3IQLA 3OB9A 3OS5A 1QVFS 5GANf 1VQLA 3X25B 1GY3B 3H6ZA 4BY7X 3KHIA 3JCMg 1RAEB 2UZEB 3VU3C 3H0FA 5ACBA 1FINB 3OBYA 4J7IA 2EJGA 3P8BB 2IW9B 3A98A 2BKZB 2KR6A 1M1KR 3MI9B 1NG2A 1OV3A 4D8KA 1QCNA 2FHDA 2MIOA 4QT7A 2J6KA 2Y4XA 1YHQT 4M7AG 4MDWA 4ELZC 2JNGA 1UE9A 3CBMA 2OTLT 3OBWA 3CXCA 2DXCA 3C4SA 1WJQA 1E6HA 1VQ8Q 2ZPFB 1XQHA 4M77G 3EG1A 5LJ3f 1VYWB 2DFUA 1YITT 5IAYA 2VXFA 4IUVA 5IH2A 2ATCB 2BIVA 1X27A 1WA7A 3LQ5B 1B3QA 4J5YA 2LVMA 1IHVA 2YRCA 4OGEA 4LUEA 3K7AM 1WHHA 1N8RU 1SHFA 4C8QE 3GPLA 2RQUA 2JMCA 1Q82C 4F16A 3G71A 1K76A 3OYIA 1NE8A 1X6BA 4C92B 1VQ5T 1M1GA 1GFDA 3PMTA 1YI2T 4C92F 3GNGA 1JQQA 1G3NC 3ZBDA 3P8HA 3OYJA 2CH4A 1N4MA 5GAOn 3DB3A 5I21A 2WMBB 4M7DC 2IVWA 4CC4B 2DD5A 3QO3A 3EFSA 4LDWA 5ICPB 1K0XA 1MMNA 4C5EA 2LCCA 2L3RA 1G5VA 2GGRA 1M2OA 1YJ9A 3PT9A 2P0KA 2FPFA 4M7DA 3NFCA 3VYGA 1O75A 4C8QB 5A0LA 1UGQB 3EGUA 2W99A 1JU5C 4WTOB 4FT2A 1R0CB 1N8RR 4EONB 1VQ9A 2OX7A 4LDVA 1GBRA 4QW2A 1UB4A 4PJOD 2D1XA 3GBQA 2KK4A 3I5RA 5GAN5 2BZXA 4AMCA 1WLPB 1X2QA 4LD9K 2FEIA 4I3ZB 3H8ZA 4M7AC 4EOIB 3QUIA 3JCMP 2HD0A 1TG0A 3DLLA 4GBQA 3MP6A 4E7ZA 3G6EQ 4M7DB 2AZVA 2F2VA 1G83A 2MPXC 3OA6A 1SKUB 4YOOA 2VVKA 1M1KU 4E7JA 2AHJB 3NTHA 1KQSA 3VS0A 3HRUA 4HXJA 2VUBA 2J6OA 4M77E 3H0IA 5D6YA 1TUDA 4HKEA 3SD4A 4EOJB 5KE2A 1OIUB 2FPDA 4JRKA 2JXBA 5HQ0B 4C8QD 2EGCA 4IURA 3CC7Q 5DQVA 4BBRM 3VRYA 3QJ6A 5I22A 3OYGA 1WDXA 2JUFA 1Y71A 3UA7A 2IN3A 1P5EB 4A4HA 2DNUA 4EDUA 1VQ4Q 4II1A 2KEAA 5LMKB 1H25B 1BIAA 4F7UB 3CCST 3JB9G 2JGZB 4P5NA 2F69A 3I55A 2X4XA 4CFXB 2LP5A 1VQOQ 1W70A 4KUDK 4J9GA 5FU6C 2VXEA 5HY6A 3I56Q 1UECA 1OI1A 3JCMJ 5GANj 2RMOA 3VKHA 4NL2A 3J81E 1XO2A 4XU2A 2RQVA 1BKBA 1JEGA 1NEGA 3CC4Q 1YWOA 1U5SA 4BE2A 4YC3B 3CMAQ 1B7TA 3F5XB 4J8OA 4R55A 3JB9D 4F6SB 2CH4W 1K73C 2QEXQ 5FRNA 2QGGA 1KHCA 2O4XA 2KDSA 5IXBA 1RACB 3QJYA 1C0MA 2ZZDB 1D0XA 4BUGA 1VQ6A 1YCYA 2QG9B 5CKBA 4JLIA 1JRIA 1AISB 2ABLA 5LQFB 2O31A 4LN2A 1H1PB 4RCBA 4RTTA 1B07A 1IGUA 1WHJA 1VQNA 2XD0A 2X3XD 2RI2A 3PTAA 4NC6A 2GNCA 5LJ3h 2K6DA 2H3JA 3G7ZA 4OMMA 5I2SA 2V8JA 1N5ZA 2WFYB 1TU0B 1Y07A 4JS4A 3META 4BACA 2O4XB 2MWOA 4BCPB 3A8HB 1VQ9T 5J39A 2OTJQ 4FT4A 5GMKl 1BBZA 2BTTA 4ZTJA 3QZ5B 4K11A 1UUEA 4F6WB 1FMVA 5DLQE 3OS1A 3OYCA 2CZ7B 3UPUA 4M7AF 4DBRA 2KVQG 3ER0A 3OYHA 2COYA 1HXDA 2GFAA 2E1HA 5GAMf 1U1SA 2KXCA 1MMDA 3OYYA 4L5GA 3T9NA 2IIMA 4FYWB 1SRLA 3B57A 2JVVA 3GLXA 2QASA 4Y28E 1OIYB 4M4ZA 4PJOF 2GF7A 1KC8R 4CFUD 4E7KA 4M7DE 1ZA1B 4M77D 5GAOq 3JAME 2KRMA 4EIKA 4M78C 2WIHB 3LW5E 5FWBA 2CREA 2DZ9A 3CC2T 1W4SA 1AZEA 5IF1B 1ZLMA 2RHXA 4M7AD 3EGDB 1YJNA 3CC2A 1Q81R 2F1LA 4XTUA 4DA4A 1M8MA 4DEXA 3QXEB 2HMAA 2DPPB 2KSSA 3MEWA 5I2MA 1K73R 1M90U 4ROEA 1DJ7B 3RKXA 4C0DB 4Y91A 1W2BA 1M5Q1 5IHIA 1PG5B 4D6WA 2LX7A 1SPKA 4FSSA 2A3LA 2RA2A 1JSTB 4PJNA 2XMFA 1UGPB 4BCMD 3MEUA 1H28B 3MY1B 1WI7A 3EGDA 3NHNA 2CT3A 5C6SA 2YT6A 1QVFA 3H4CA 5L8RE 1OQKA 1Q82R 2DXCB 1O9KA 2LJ1A 4FIBA 1KK7A 3M4YA 3OSSC 1IGQA 1VQKQ 2K5IA 3FC3A 1NZ9A 3FIFA 4M75C 5GAMj 1VQ7Q 3EAEA 3HZJA 3FRNA 3O5ZA 3CC4T 3CC7A 3LYIA 5FRMA 1H1RB 1VQNT 1GUXA 4ELJA 1O9SA 3L2ZA 4N4HA 2IW8B 2PVGB 2V8IA 3CCQQ 4C92A 3OYAA 3CCET 2IPOB 3OS0A 4M78E 1OOTA 2HL3A 2IG0A 3QWLA 3QYGB 2HL5C 3GIBA 5A0GA 1NLPC 4F7SB 4M78G 2XU8A 1QVFP 2DMEA 3DDPB 2E70A 3RR6A 1S72A 3TCJA 4M7DG 3UA6A 3RMSA 3G33B 2HQXA 3QYHB 2QQRA 3VS2A 3M0PA 9ATCB 1ENWA 4XTXA 3BFMA 1KG1A 3OSVA 2JS2A 4B6MA 1YI2Q 2LQWA 1K9MC 1GL5A 3C0CA 4F6UB 3EG9B 5IDNB 2K79A 2MYSA 2LT4A 2QEXT 4UC4A 2L3SA 5KCOA 1YJNT 2PQWA 2QQSA 1BU1A 3EGXB 4QVDA 1FMKA 4M7DF 5LJ3e 2VC8A 4ANJA 5EG2A 1D1CA 2I2LA 4EMKA 1TSFA 1JBMA 3TQ7P 1K8AR 1KQ2A 2GCXA 2BZ8A 2BS2A 4PK4A 2K3XA 1I5LA 2CDTA 2L2PA 4F7LB 1MMAA 4J9FA 4BCNB 1AZGB 1AWOA 4M75E 3G6EA 5IHYA 3HP9A 2ENMA 2KYBA 1P92A 1UEBA 2V22B 5CO7A 4MDXA 4NOYA 3M5AA 4OVAA 2ZPHB 1GH6B 4F7UG 4ELLA 4LDYA 2QGSA 1YCSB 5CR2A 2AIRB 3INZA 1YJNQ 1AHJB 3EFOB 3M4GA 2O9SA 5GANh 4EOPB 5IN1A 4X9CA 4O5VA 1OU8A 1D1BA 5GAN3 3DLMA 3OW2S 4A4KA 2ZPIB 1XNIA 2HSEB 4XK8E 2XDDA 2FYKA 4OGCA 4M7AE 1WGSA 5D7UA 1ABQA 2RQRA 1VINA 2VV5A 1H27B 2XK0A 1S72Q 1VQ5Q 2GTJA 3UF4A 1VQ6T 3SWNB 1RUWA 2FB7A 2WSFE 2Y90A 3EG0A 4CFNB 1AWXA 4CFMB 2KMTA 3PNWC 4BE1A 5KYXB 2YRDA 1Y7XA 3A8LB 4MMLA 2DL8A 2W0ZA 3OW2P 1H24B 4EC9B 4LDXA 2PHGA 2V26A 2X51A 5LJ3g 1HSQA 2GQVA 3NGPA 1QQJA 2CKKA 1R8OB 4OMPA 5LJ5h 1M3BA 3VYHB 4M77F 3EG2A 4PJOG 4OB3B 3I35A 1Z9QA 2XDBA 2JN0A 3QHWB 1EX4A 1XTDA 5A2QE 5FU6B 1Y57A 1IHWA 3M57A 4KGXB 4FYXB 2R57A 1FX7A 2BPMB 3HO8A 1WX6A 2LQNA 2O9VA 1ZQ1A 2CZ6B 1WPYA 4M6VA 3JV3A 4C5IA 2ZGWA 3DJBA 3REAB 2RI5A 2C4GB 3OYBA 3HL8A 1H4LD 3TNHB 4BCKB 1UJ0A 2BS4A 1JO8A 2NYSA 3HRTA 2J6FA 4J9DA 4FX3B 2B86A 2XG8D 3VKGA 1KC8C 1EZZB 3JCMd 1VQ8T 4PJLA 1YHQA 1VOMA 5GJVB 3PGGA 4LE9A 3FLGA 1VQKA 3QDRB 1M30A 3CXCP 5IDPB 2RJDA 2K2MA 3O0GD 2QGFB 1BCMA 2W2HA 2DXTA 4FM4B 4BDYA 2DAQA 3LLRA 5GMKm 1ZUUA 3JCMQ 1Y96B 3G71Q 1VQLT 2DMOA 2AK5A 3D7SB 3VUBA 2JTFA 2YUPA 1NLOC 2PNIA 2UZLB 3PIPA 4KGZB 1IXDA 3RGFB 4WF2A 3QDFA 1ZHIA 1JSUB 4BDZA 5M9OA 4BCMB 2G9XB 5FGKB 1I1JA 4A63B 2W96A 3HKSA 1RLQC 1HJDA 4F7UF 4NL3A 5CQXA 5GANg 2X1NB 1JB0E 2LDMA 1UFFA 3CBOA 4YTLA 4M75B 1QWFA 3L1AA 1BI2A 1KSWA 3GOXA 2KE9A 1D1AA 1VQMT 4ELYC 1OZ3A 4DQ2A 2DA9A 2YHTA 1H26B 2DRMA 1E9HB 2QYZA 5L23A 1ACMB 4PLLA 2WMAB 4BCFB 2RK2A 2F5TX 4X1VA 2DZCA 2I53A 2DD4A 2WHBB 2ECZA 3SFMA 4ZNXA 4KBMB 3CCMA 2DTOA 3I9QA 1R77A 1RAIB 2HKQB 2EQUA 2M02A 3TVTA 4EOKB 1JXMA 4Z89A 3G4ST 1YITA 4ZN3A 1AWWA 4Y72B 2C5NB 4CFUB 1M9SA 4XAXB 1T3LA 4CI0C 2PMIB 3QWXX 5KE3A 1I81A 3OYKA 3POMA 1G3SA 1X2KA 4YOSA 2QQ9A 2OTLA 3HBLA 1GUXB 3M54A 5IT9E 3SB2A 1AD6A 1Q7YR 3VYGB 1OPKA 2FVUA 2SRCA 3M9QA 5GJWB 2G3RA 1QMZB 3M53A 2CP0A 3QWYA 3PMIA 4RMOA 2LRQA 1QLBA 3CC2Q 4BCGB 3GTMS 3E9FA 1ZX6A 1VYTA 2HQHA 2KT8A 1RI0A 2PJQA 1FXXA 1NEBA 2O01E 1RAAB 3DL1A 2P0PA 4OR5B 1OX8A 1UNHD 3TREA 4JJCA 3CCMT 1NJIU 2A36A 2GFUA 4JPBW 1PKSA 1H3HA 2CSIA 2LJ0A 4M7AA 4C8QC 3X20B 2FO0A 2RHUA 3CCVT 4BCQD 3EG9A 3L2WA 2LC4A 4HL4A 3FJ5A 3TSZA 3TU4K 2C06A 1M27C 3C95A 2JT4A 2NWMA 3BLHB 1UTIA 3BDLA 3LGLA 1ZBJA 4BI8B 4HVUA 2FL7A 1TTHB 2LMJA 2HBWA 5CK9A 1WQ7A 1YIJA 2QF7A 5GAMh 2NUPB 4F7NB 5GAMe 2JJ9A 2K7AA 1KQSS 4KRDB 2COZA 4M7AB 4HA8A 1JJ2S 1D0ZA 4FW2A 4EMGA 2H3EB 1U06A 1VQMQ 1K1ZA 1A0NB 3JB9I 3QBYA 5LJ3j 2OAUA 1ZA2B 2L3QA 2PVDB 3OYMA 4RTWA 4F14A 3CCRT 1MMGA 2WJ9A 1X69A 2E6NA 2UZDB 1PSEA 5EFQB 2CZ1B 3RERA 3BE3A 2C5VB 4IUTA 3E1SA 1LOJA 1KD1U 3JB9J 4C8QF 4AFSC 2CS7A 1NM7A 2EQMA 3LX7A 2QA4T 2QDLA 3LWHA 2QTXA 2JMAA 2DF6A 3MCAB 4ME7A 2D6FA 2EKOA 2EYYA 5FLXE 4ROCA 5D6XA 2OAWA 3OW2A 1QLYA 1W2BS 2BS3A 4RUGA 4BCJB 2MI6A 2VB6A 1OKVB 4FL6A 2DKGA 2V1RA 3OYLA 1PD0A 3CCSQ 3AHUA 3NDQA 1AEYA 1AT1B 4MZTA 4ZN1A 4OMLA 3CMAT 2LCLA 2MCNA 2F2XA 1TWBA 2MF2A 4PJOE 1B34A 1T3SA 4IIMA 1YFNA 1OYXA 4KUIA 3DOGB 2DERA 2JTMA 5BNJB 5DY9A 1QVGP 1OL2B 1WIEA 5A0DA 3CMET 1KFZA 2E64A 5EC7A 5C0MA 1W2BP 2WIPB 1XJWB 2MMPA 1GRIA 1YHQQ 3I55Q 4XTZA 3ASKA 1NJIC 1OGUB 4BCQB 1VQ4A 2X4YA 2WEVB 3U23A 2A7YA 3VS4A 1MHNA 1NPPA 2PTKA 3VS3A 3M58A 2O2OA 4JRQA 1VQPT 3CCUQ 2C6TB 2PUKB 3V8JA 1B34B 1Q81C 2RQWA 1UDLA 1PSFA 5AT1B 3MIAB 2LNVA 4RG2A 2NUTB 2E6ZA 3S6WA 3EFRA 2DXUA 1QP2A 2YSQA 4II5B 3A5ZB 1WHKA 3KFVA 5GAN4 2ROTA 1YWPA 1JOWA 5CCAA 3RKWA 1PWTA 4XTWA 2HQEA 3HB9A 2JW4A 4BI4A 3RNJA 3CPFA 1GCQA 1BCOA 4KH0B 2DRKA 3CPWS 1N8RC 5CQYA 2DJZA 2QFZA 1BU2A 3J80E 2EYZA 3X28B 1PRMC 2WPAB 1BIBA 3M03A 2R58A 3EIDB 1NPRA 2K5FA 1I8FA 3HSBA 2K4YA 3CCEQ 2QA4A 4KRTA 3CCQT 1YBYA 1Y96A 4R0KA 1HD3A 3JB9F 1U3OA 3BHUB 4OMFB 4Z6YA 1SEMA 5CEIB 1MV0B 3Q1JA 4CC7A 3WXMB 2WSEE 4ZGJB 4C0DC 1KHIA 5KYNA 1QVPA 2KAFA 4LDUA 2PZ1A 3ZFJA 1TUGB 4Z88A 1BI3A 1UNGD 2LTOA 1I0CA 1N9RA 1X01A 4B9WA 1AVZC 3M0RA 3OYDA 4TVRA 2SEMA 2CP6A 1H641 5D6WA 3DKMA 3PVLA 3F70A 2UUEB 1YJWT 3P8DA 2CJMB 2QEXA 1JXOA 2EGEA 4PJJA 4AKGA 2CUBA 4C92E 1VQ4T 1LNXA 3OY9A 1RADB 1YIJT 2QQAA 1ZSZC 3M56A 2YLCA 6AT1B 2KQWA 5AYFA 1I07A 2E65A 2E5KA 4AI6A 4J9BA 3THKA 3CMEA 4M77B 2D0NA 3S3OA 2COWA 2AKKA 2EFIA 1AOJA 1T0HA 3JCMh 3VS5A 3LH0A 1K9MR 1RAFB 1VQ5A 1YNZA 3RUXA 2OTLQ 2LX9A 3QYBA 2RJCA 3PVQA 4PNOA 3CCUT 3LGFA 2HAXA 4R56A 3S3NA 5GMKh 3EGXA 1OEBA 2LCSA 1F5QB 2CP7A 4FU6A 2RO0A 3RESA 1PM3A 1D3BB 2HBPA 2C0OA 3RMQA 5EJCA 3ME9A 1QW1A 4Q5WA 4M77A 4JZ4A 3V8LA 2JTEA 1JKWA 2DE0X 2DM1A 2M0OA 4LUDA 2K3YA 3ZEHA 1VOLA 2DEUA 5FU7B 4JS5A 2KXDA 3RBBB 3CPWP 4BXXX 2W9FA 4ZTFA 2PUOB 4PKCC 3BW1A 2CYZB 4RKUE 2EYXA 2J06A 4M77C 2DTHA 2FZKB 1KD1C 1RLPC 1H92A 5KYYB 5LJ5d 2KMGA 4KRCB 3OYNA 4ESRA 2WACA 4GY5A 1K0SA 4M75D 2YXYA 4J9HA 1D3BA 1PC0A 5CAIA 4KH1B 4E7SA 4JUVA 1JJ2A 4QVCA 3HHTB 3EH1A 1G3YA 4DBHA 4QQGA 4BCIB 3WVEB 2ZPBB 1LJOA 5GAOm 3AT1B 1KXUA 3VKIA 4OMOA 1X75C 2DL5A 3JB9H 4KULA 3QHRB 2ZZDA 1E7PA 1QVGS 3HFOA 3MPUB 2WXVB 1E6GA 3JCMc 2CP2A 4DEYA 2RH2A 2RNAA 1YITQ 4QQ6A 3CCRQ 1RAHB 2HZYA 3NMZC 2HSPA 5GANd 2C5OB 4FSXA 3CCLT 4CC3A 2YUOA 3CCJT 4AFUC 3CCMQ 1PHTA 1EFNA 4A4GA 1QCOA 3FB9A 2QAZA 3A8OB 5DM7R 3UATA 2KRNA 1U1TA 1PNJA 1W6XA 3MHXA 3CD6A 3JCMW 2DIGA 4DBFA 2ROLA 3PO3S 4EOMB 5GANe 2BZYA 1M2VB 4JJBA 2JOYA 8ATCB 3CCVQ 1W98B 3EJ1B 1G8XA 2PVOB 3V7SA 3EOCB 2DL7A 2X4WA 4A4EA 1MUZA 4BCND 3CBPA 4WCIA 2V1QA 2LNHB 1QVGA 1TUCA 1WZOA 2DBKA 3GP8A 2QTVA 5LJ5j 2OJ2A 3H0HA 3JCMb 1VIEA 3FDRA 3JRZA 3L2UA 1ARKA 2RJEA 1OL1B 2ZCFB 5CIUA 4CFWB 2ZPEB 1BK2A 5CKHA 1VQ9Q 2YUNA 1LCKA 2QQ8A 2L5QA 2VASA 1QKWA 4E7LA 2QA4Q 2DILA 5GAMd 2EQIA 2XICA 3E19A 1CSKA 3MP1A 5HBJB 2Z0WA 5FU7C 3WVDB 4E47A 1Q7YU 3BG5A 5HNBB 7AT1B 4BY6B 4AFZC 1C9BA 4HNUA 3MP8A 3G4SQ 2F2WA 4OF1A 2D8HA 1LPLA 4JZ3A 4C92C 4QVZA 1FVVB 1WXBA 1VQ7T 2OTJT 4E2FB 3JCMf 2XDPA 2DXBB 1UGRB 3KUFA 1WXTA 4IUUA 3VJPA 3GNFB 3BHTB 4C92D 3X24B 2EKHA 3RIRA 1Z9ZA 1URCB 1YN8A 4LNPA 4XU0A 3PE0A 3OS2A 4BCHB 1WYXA 4C5HA 1TD6A 1H8KA 3V8KA 1YJWA 2E12A 4L6V5 3L2RA 4HVWA 4EPCA 4EOSB 2J7IA 3V7RA 1UG1A 4AG2C 1RAGB 4OGRB 2D8JA 5LL6S 1D09B 3DTOA 1HK9A 1NJIR 2GQIA 2EYWA 2DTIA 4NS5A 2DLPA 2DXBA 1QKXA 3NTKA 1Y0MA 3A1PA 2K5LA 3REBB 2VGNA 1K8AC 2B9RA 3LH5A 2P4TA 3JCMe 5LJ5f 2QXFA 3QG1A 2VYTA 2EIFA 3QPHA 1X6OA 1OX9A 4RODA 3SHWA 1UHFA 3CCQA 3EHRA 3URGA 2NUZA 1VYUA 2RHZA 5CVIA 2YRVA 2W9ZA 1D3UB 4JLGA 2B8AA 4M78D 4MIMA 2RI3A 2CUDA 1UNLD 4JDSA 1FYNA 3RKYA 3CCLQ 2KT1A 4C92G 1PKTA 2FG0A 3VS7A 5KYUB 3TW7A 2AT1B 2X35A 2LQ8A 3CD6Q 3X26B 1CKBA 2E10A 4HCZA 3E9GA 2LT1A 2BKDN 4PFOA 4PJMA 4OMQA 4RTZA 4V2SA 1KJWA 2JM8A 4HT9A 3L42A 2XHCA 4J6XA 5GMKj 3M0QA 2M0YA 2DBMA 3L2QA 3CCRA 3R6NA 4EMKB 4AKHA 1G3WA 3CPWA 4JRIA 1VIFA 4UN0A 1G2BA 2EVRA 1Q86R 1YP5A 2YWWA 4C8QG 2KROA 3TNIB 2UZBB 1TH7A 2A28A 4QSHA 3CCLA 1WXUA 2FZCB 4PFPA 4X9DA 1S72T 4C8QA 1K9MU 1KQSP 2RJFA 3QSUA 3E2UA 1J3TA 4E7HA 2I40B 1M1FA 2HCKA 1ZSZB 4N4IA 3OYEA 2I0NA 4YOZA 2ED1A 2R7GA 5LJ3d 5HBHB 3PIOA 1GXIE 3NPFA 2L0AA 4B9XA 2W10A 2C0TA 4BBSM 4HCKA 2ZAEA 4IUQA 3EFOA 3CMAA 1IZ6A 4JJNK 1WHMA 1VQ7A 2QDJA 3TSWA 4GLMA 4F7UE 3CC4A 1OI9B 4XU3A 3CCVA 1KQ1A 4JX6A 4J6YA 4EOQB 2MAMA 2X9HA 4HT8A 4O6JA 4J6WA 4AT1B 4E6RA 2DK3A 4M75G
chains in the Genus database with same CATH topology
2WSCE 2R58A 4XTVA 5CO7A 4PJOA 3KHIA 4MDXA 1EIFA 1NPRA 2K5FA 4NOYA 3JCMg 3M5AA 1I8FA 4A4FA 3HSBA 2K4YA 4OVAA 3VU3C 2QA4A 3CCQT 2ZPHB 1VQOT 3OBYA 1YBYA 1Y96A 4RG8A 4BB7A 4F7UG 4J7IA 4LDYA 5CR2A 3INZA 2EJGA 3P8BB 4BY6C 3JB9F 1AHJB 3M4GA 5GANh 2KR6A 4OMFB 4HNTA 4MFDA 4Z6YA 2XKOC 3OQ5A 5IN1A 4X9CA 1WJSA 2FHDA 2EJFA 4C5GA 5GAN8 3Q1JA 1WQWA 2P0QA 5J3BA 2YLBA 4GLKA 1SSFA 2Y4XA 4O5VA 2WSEE 4ZGJB 3WXMB 5GAMg 1YHQT 5GAN3 4C0DC 3DLMA 4M7AG 3OW2S 4A4KA 2ZPIB 1KHIA 1XNIA 2JNGA 3M55A 4MDWA 4XK8E 4ELZC 2LQKA 5DLOA 3CBMA 1QVPA 2FYKA 3OBWA 4OGCA 2KAFA 4LDUA 2OTLT 4M7AE 3CXCA 1WGSA 2DXCA 4N0AA 3QKJA 5CKEA 3C4SA 2D0QB 3ZFJA 1WNLA 1WJQA 4OB2B 4XU1A 1BI3A 2ZPFB 2F5KA 2QI2A 5J26A 4PJOB 1XQHA 2LTOA 2VV5A 2XK0A 4M77G 1N9RA 5LJ3f 1FWZA 3UWNA 1YITT 1X01A 4B9WA 5IAYA 2VXFA 4IUVA 1VQ6T 2BIVA 3SWNB 4ATOA 3OYDA 2FB7A 2WSFE 2Y90A 4J5YA 4TVRA 4DOVA 1N6AA 2LVMA 1N27A 1H641 5D6WA 4OGEA 4OB0B 2R5MA 3DKMA 2V8KA 3F70A 2KMTA 3PNWC 1N8RU 4BE1A 1YJWT 3CD6T 3J7AF 3P8DA 4C8QE 3GPLA 2QEXA 4JRPA 1Y7XA 3A8LB 4MMLA 1Q86U 1Q82C 3G71A 4LDXA 4AKGA 4C92E 1NE8A 5KH6A 4C92B 3OYIA 1VQ4T 1VQ5T 3A8MB 4ZGDB 1LNXA 1M1GA 5LJ3g 3OY9A 1YIJT 2QQAA 3PMTA 1YI2T 2GQVA 4C92F 3QYEA 3M56A 2CKKA 3GNGA 2DEQA 2YLCA 1R8OB 5LJ5h 3R6OA 2KQWA 3ZBDA 4MZPA 3P8HA 4BE0A 5AYFA 3OYJA 1I4K1 3VYHB 2E65A 4M77F 4AI6A 5GAOn 3DB3A 4CRIA 5I21A 3CMEA 4PJOG 4OB3B 2IVWA 5GAOp 4M7DC 4M77B 3S3OA 2DD5A 2XDBA 2JN0A 3QO3A 3EFSA 2EFIA 1XTDA 4LDWA 4KT0E 5A2QE 5FU6B 3JCMh 1M8VA 3LH0A 3M57A 4C5EA 2LCCA 2M9UA 3RUXA 1VQ5A 2L3RA 1G5VA 2R57A 1FX7A 2LX9A 1YJ9A 4XTYA 3HO8A 1M4ZA 3PT9A 2P0KA 3QYBA 2RJCA 4XQ3A 1VQLT 1ZQ1A 3OMCA 4M7DA 3NFCA 2CZ6B 4IUPA 4PNOA 3VYGA 3CCUT 2RB6A 3LGFA 2HAXA 1BI0A 1O75A 4R56A 1WPYA 4M6VA 4C8QB 5A0LA 3S3NA 1UGQB 3TW6A 5GMKh 4FT2A 4C5IA 2K57A 2MWPA 2ZGWA 4FU6A 1VQ9A 3UT1A 5GAOr 2RO0A 4LDVA 3RESA 3KXTA 2RI5A 2L89A 1D3BB 3OYBA 3HL8A 1U8RA 2HBPA 4M78B 3A8GB 4QW2A 3RMQA 1UB4A 5EJCA 3ME9A 4PJOD 1QW1A 2BS4A 2KK4A 3HRTA 4OP0A 4M78F 4M77A 4Q5WA 4MFEA 5GAN5 3V8LA 2EJ9A 5HKCA 2XG8D 4LD9K 1Q7YC 4HNVA 2M0OA 3VKGA 2K3YA 3H8ZA 3ZEHA 4M7AC 1KC8C 3QUIA 3JCMd 1VQ8T 1YHQA 5FU7B 4JS5A 2KY9A 3JCMP 2HD0A 1FKMA 3DLLA 3MP6A 4L59A 3PGGA 4ZTFA 2PUOB 3FLGA 4RCCA 4PKCC 1VQKT 3BW1A 1VQKA 2CYZB 3QDRB 4M7DB 4RKUE 4M77C 2DTHA 3MO8A 3OA6A 1KD1C 2RJDA 3G4SA 3I56A 3CXCS 5LJ5d 2KMGA 1VQOA 1VQ8A 2DXTA 3OYNA 1M1KU 4FM4B 2AHJB 3NTHA 4E7JA 4BDYA 2WACA 4GY5A 2DAQA 3LLRA 1G3TA 4C0ZA 5GMKm 1KQSA 4M75D 3S3MA 1D3BA 3HRUA 2VUBA 4M77E 5CAIA 1JJ2A 5D6YA 1Y96B 4JUVA 2X4JA 4HKEA 4MMKA 3SD4A 4EMKC 1WJRA 4QVCA 5KE2A 4E7IA 3HHTB 4JRKA 4C8QD 3VUBA 2JTFA 3GF5A 4IURA 3PIPA 4BBRM 1G3YA 3QJ6A 4QQGA 3OYGA 4WF2A 2EAYA 1ZHIA 1Y71A 2JUFA 3CCUA 3BG9A 4BDZA 4J7FA 4A4HA 5M9OA 4EDUA 3WVEB 1MGQA 3V7CA 5FROA 2DD4B 2ZPBB 1LJOA 3CEYA 4II1A 5GAOm 1BIAA 3HKSA 2D9TA 4F7UB 3CCST 3JB9G 3BY7A 3VKIA 4P5NA 3I55A 2F69A 4F7UF 2BUDA 2X4XA 4NL3A 5CQXA 1X75C 5GANg 3JB9H 1K8AU 1JB0E 4KULA 2LDMA 2ZZDA 3CBOA 4YTLA 2QQBA 3I55T 1E7PA 4M75B 1K73U 1QVGS 4KUDK 5FU6C 2VXEA 5HY6A 2EQKA 1OI1A 3HFOA 1VUBA 4M75F 3JCMJ 3L1AA 1BI2A 2EWNA 3GOXA 5GANj 4LOCA 3JCMc 2M1HA 3VKHA 2RH2A 4NL2A 3J81E 4QQ6A 4XU2A 1BKBA 4ELYC 1VQMT 1OZ3A 4DQ2A 5GANd 4FSXA 3CCLT 2YHTA 3CCJT 4BE2A 4PLLA 4J8OA 4A4GA 4LD6A 4R55A 3JB9D 2DVEA 2R5AA 3FB9A 2RK2A 3A8OB 5DM7R 2F5TX 1K73C 4C0GA 2DZCA 5FRNA 1U1TA 1IREB 2DD4A 3MHXA 3SFMA 1KHCA 3CD6A 4KBMB 2O4XA 3CCMA 3JCMW 2DIGA 2KDSA 3PFSA 2DTOA 2EQJA 3OYFA 4JX4A 3QJYA 4QQDA 2EQUA 2ZZDB 4BUGA 5GANe 4M75A 1VQ6A 1YCYA 3G4ST 2JOYA 2DD5B 2E5QA 2NLUA 2PVOB 4ZN3A 1YITA 5CKBA 4JLIA 2JZ2A 3V7SA 4Z02A 1H3ZA 1JRIA 1M9SA 1XOVA 1N9SA 2X4WA 4XAXB 1OZ2A 2XIDA 4CI0C 4A4EA 5KE3A 1I81A 5GAN2 3OYKA 1G3SA 2RD1A 3CBPA 3QIIA 4RCBA 4EMHA 2QQ9A 2CGHA 5LJ5g 2OTLA 3HBLA 1QVGA 5IT9E 3M54A 1VQNA 2XD0A 3SB2A 1BI1A 2RI2A 3FJPA 4J83A 3GP8A 3VYGB 4NC6A 2FVUA 3M9QA 5LJ3h 3PTAA 2G3RA 2H3JA 3M53A 5LJ5j 3JCMb 3G7ZA 3PMIA 4RMOA 3M59A 1VIEA 2LRQA 3FDRA 5I2SA 1QLBA 2V8JA 3JRZA 3UDCA 3L2UA 1Y07A 5HK0A 4JS4A 3META 2RJEA 3E9FA 2ZCFB 4BACA 2O4XB 2MWOA 5CIUA 1RI0A 1RL2A 3A8HB 5GMKi 4BD3A 2ZPEB 5J39A 5CKHA 3MEAA 1FXXA 1VQ9T 2O01E 2QQ8A 2PU9B 3DL1A 2L5QA 4FT4A 4X34A 4E7LA 2P0PA 5GMKl 2HNIA 5CKFA 3TREA 5GAMd 2XICA 3CCMT 4ZTJA 3QZ5B 1NJIU 3E19A 2GFUA 3MP1A 3OS1A 5DLQE 3UPUA 3JCMQ 3OYCA 2CZ7B 4AKIA 5CKDA 3QHSA 3WVDB 5FU7C 1Q82U 4M7AF 1YJ9T 2KVQG 4E47A 1Q7YU 3BG5A 4M7AA 4C8QC 3X20B 4BY6B 4IKFA 3ER0A 3OYHA 2RHUA 1HXDA 4HNUA 2GFAA 3MP8A 2E1HA 3CCVT 3L2WA 4OF1A 2RHYA 5GAMf 2LC4A 1U1SA 3FEOA 4C92C 4QVZA 3OYYA 4L5GA 3T9NA 4HL4A 3TU4K 1VQ7T 2C06A 2OTJT 2JVVA 3C95A 3GLXA 3JCMf 2XDPA 4Y28E 2DXBB 1UGRB 3KUFA 5GMKe 4PJOF 4IUUA 3BDLA 2GF7A 3LGLA 4C0FA 4BI8B 4E7KA 1KC8U 3VJPA 2FL7A 3GNFB 1M1KC 5CK9A 4M7DE 4C92D 3X24B 4M77D 1WQ7A 3RIRA 1YIJA 2QF7A 5GAMh 5GAOq 3JAME 3N5BB 4XU0A 5GAMe 4M78C 3LW5E 4N0AC 3OS2A 3CCSA 4C5HA 4VUBA 2DZ9A 3CC2T 1W4SA 3V8KA 1YJWA 1KQSS 4JX5A 1VQPA 2E12A 2RHXA 4M7AB 4HA8A 4M7AD 4L6V5 3L2RA 1YJNA 4EPCA 3CC2A 4HLQA 1JJ2S 1Q86C 3V7RA 4EMGA 2DIQA 1Q81U 5LL6S 4XTUA 4PL6A 4DA4A 4F7UA 1HK9A 3QXEB 3JB9I 1M90C 2QDYB 2DTIA 4NS5A 2DPPB 2KSSA 3MEWA 3QBYA 3VV0A 2DXBA 5LJ3j 5I2MA 2OAUA 3NTKA 4HCCA 1M90U 2PVDB 3OYMA 2K5LA 1DJ7B 2DO3A 2VGNA 3RKXA 4C0DB 3CCRT 4Y91A 1K8AC 1W2BA 2OTJA 1M5Q1 2WJ9A 2P4TA 4D6WA 3JCMe 2E6NA 1PSEA 2QXFA 5LJ5f 4DOWA 3QG1A 3I56T 2VYTA 2M16A 2EIFA 2A3LA 2CZ1B 2RA2A 3QPHA 3RERA 3QZ9B 1X6OA 2EYQA 1UGPB 2VGMA 4N4GA 4M75G 4ZGEB 3MEUA 4OB1B 5LJ5e 4IUTA 3E1SA 3LWIA 1LOJA 1KD1U 3SWNC 3JB9J 4C8QF 1ZBXA 2CS7A 5C6SA 3CCQA 3JCMX 1QVFA 2EQMA 3LX7A 3MEVA 2E41A 3LWHA 2QA4T 3H4CA 3URGA 5L8RE 2RHZA 2DXCB 2QTXA 5CVIA 2YRVA 4FIBA 3MCAB 4JLGA 4ME7A 2EKOA 3DB4A 3SDZA 1UGSB 2B8AA 3M4YA 3KBGA 3OSSC 4M78D 5D6XA 5FLXE 4MIMA 3OW2A 3G6ET 2K5IA 2RI3A 3HPWA 1W2BS 3SWNA 4JDSA 3FC3A 2BS3A 3BG3A 1NZ9A 3FIFA 2RHIA 4M75C 4PLIA 3RKYA 5GAMj 2MI6A 4C92G 3EAEA 3HZJA 3FRNA 2DKGA 4FL6A 3OYLA 2XI9A 3CC4T 3CC7A 3AHUA 3LYIA 5FRMA 1VQNT 3TW7A 4ELJA 2LQ8A 2X35A 1O9SA 4MZTA 3L2ZA 2D6FA 4ZN1A 4N4HA 3X26B 2Y4YA 3CMAT 3C12A 2E10A 4HCZA 2PVGB 2LCLA 2BKDN 2LT1A 2V8IA 3E9GA 4C92A 5HK3A 3OYAA 3NTIA 3CCET 4V2SA 3OS0A 2MF2A 4PJOE 4M78E 1B34A 2IG0A 4HT9A 3QWLA 3QYGB 3L42A 3L2VA 1OYXA 5A0GA 3GIBA 2XHCA 4J6XA 4KUIA 5GMKj 4M78G 2XU8A 2JTMA 5DY9A 4BI3A 3BDUA 2L8DA 2RM4A 5A0DA 3L2QA 3CCRA 3CMET 4EMKB 4MZMA 2E70A 2CZ0B 4AKHA 2E64A 1G3WA 3TCJA 4JRIA 1VIFA 3VUZA 5C0MA 3RMSA 2HQXA 3CPWA 1S72A 3QYHB 5GAOl 4M7DG 2QQRA 2K2VA 2MMPA 4XTXA 4C8QG 1YI2A 3BFMA 4XTZA 1KG1A 3OSVA 3ASKA 3JSCA 1NJIC 3JCMV 1TH7A 5GAN7 1VQ4A 1K9MC 2X4YA 3G71T 4QSHA 3CCJA 3CCLA 2A7YA 1MHNA 2LT4A 2QEXT 1NPPA 3HFNA 2RK1A 4UC4A 5KCOA 4X9DA 1YJNT 2PQWA 3M58A 4C8QA 1VQMA 1S72T 1K9MU 2QQSA 2RJFA 4QVDA 4JRQA 1VQPT 3QSUA 1V29B 5KCHA 1QP3A 2ZPGB 1B34B 2PUKB 3V8JA 4E7HA 1PSFA 1Q81C 4M7DF 1M1FA 2LNVA 4RG2A 5LJ3e 2E6ZA 2VC8A 3S6WA 4N4IA 3EFRA 3OYEA 2DXUA 1QP2A 4M78A 5LJ3d 3PIOA 3A5ZB 1GXIE 3OMGA 5EG2A 4B9XA 2I2LA 4A54A 4EMKA 5GAN4 3CCEA 4BBSM 4M7DD 4IUQA 1JBMA 5CCAA 3CMAA 5GAN6 3RKWA 1IZ6A 4XTWA 3C94A 3O8VA 4JJNK 1KQ2A 2GCXA 2BS2A 3HRSA 1VQ7A 2HQEA 3HB9A 2K3XA 2QDJA 4HCBA 3TEEA 3CC7T 4BI4A 4F7UE 1I5LA 3CC4A 3CPFA 4XU3A 2G77A 4A53A 3CPWS 3CCVA 1KQ1A 1BYMA 4JX6A 4J6YA 2XDDA 2MAMA 5CQYA 2DJZA 2QFZA 1N8RC 4HT8A 3OB9A 3OS5A 4O6JA 4J6WA 3J80E 1QVFS 4M75E 3G6EA 4PJOC 5GANf 3HP9A 3X28B 1VQLA 3X25B 1P92A 1UEBA 2DK3A 3H6ZA 1BIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC E;  3VYG B;  5L8R E;  2DXC B;  2ZPH B;  1UGS B;  1AHJ B;  2PUO B;  2ZCF B;  2CYZ B;  4RKU E;  3A8H B;  2ZPE B;  2O01 E;  2PU9 B;  2WSE E;  4ZGJ B;  4FM4 B;  2AHJ B;  2ZPI B;  4XK8 E;  3QZ5 B;  3X26 B;  2DXC A;  2CZ7 B;  2PVG B;  2D0Q B;  3WVD B;  4OB2 B;  3HHT B;  2ZPF B;  3X20 B;  3QYG B;  2WSF E;  4OB0 B;  2CZ0 B;  4Y28 E;  3WVE B;  2DXB B;  1UGR B;  2DD4 B;  2ZPB B;  3QYH B;  3A8L B;  3X24 B;  3A8M B;  4ZGD B;  1JB0 E;  2ZZD A;  3LW5 E;  3VYH B;  1V29 B;  4L6V 5;  1QP3 A;  2ZPG B;  4OB3 B;  2PUK B;  1PSF A;  2DD5 A;  4KT0 E;  1QP2 A;  3QXE B;  1GXI E;  2QDY B;  2DPP B;  3A8O B;  2DXB A;  1IRE B;  2DD4 A;  2PVD B;  3VYG A;  2CZ6 B;  1DJ7 B;  1UGQ B;  2ZZD B;  1PSE A;  2DD5 B;  2CZ1 B;  2PVO B;  3QZ9 B;  1UGP B;  3A8G B;  3X28 B;  4ZGE B;  4OB1 B;  3X25 B; 
#chains in the Genus database with same CATH topology
 2WSC E;  4XTV A;  4FCY A;  4PJO A;  1QMC A;  1V1C A;  1EIF A;  1ZSZ A;  1X6G A;  4A4F A;  1FMW A;  2RF0 A;  2RPN A;  1VQO T;  4RG8 A;  4BB7 A;  4BY6 C;  2E3I A;  1AD5 A;  4HNT A;  4MFD A;  2XKO C;  3OQ5 A;  4C5G A;  1WJS A;  5GAN 8;  2EJF A;  1WQW A;  2P0Q A;  5J3B A;  2YLB A;  4GLK A;  1SSF A;  1SSH A;  5GAM g;  1NBE B;  3M55 A;  2YDL A;  5DLO A;  2LQK A;  3TNW B;  4N0A A;  5CKE A;  3QKJ A;  2D0Q B;  1K9A A;  4F04 B;  4TTH A;  1WNL A;  4OB2 B;  2OI3 A;  4XU1 A;  1UJY A;  4PJO B;  1SRM A;  2F5K A;  2QI2 A;  4RTY A;  5J26 A;  1FWZ A;  3UWN A;  3BLQ B;  4ATO A;  2KRS A;  2EBP A;  4DOV A;  1N6A A;  1N27 A;  1CKA A;  1E7O A;  5CYI B;  4OB0 B;  2E4H A;  2CCI B;  2G6F X;  2R5M A;  2V8K A;  3CD6 T;  3J7A F;  1VQP Q;  3DDQ B;  3M0S A;  4JRP A;  1Q86 U;  2A37 A;  2FPE A;  5KH6 A;  2VWF A;  4OMN A;  3A8M B;  4ZGD B;  2A08 A;  4Z8A A;  4LXC A;  1YIJ Q;  4AFQ C;  1K4U S;  3QYE A;  1PCX A;  2DEQ A;  3R6O A;  4BE0 A;  4MZP A;  2EW3 A;  1I4K 1;  4CXA B;  2CP3 A;  4CRI A;  2A0F B;  5GAO p;  1M2V A;  4QKU A;  3MY5 B;  5HCK A;  4KT0 E;  1ZSG A;  1RAB B;  2F2C A;  2DET A;  2M9U A;  5L2W B;  4XTY A;  1M4Z A;  2H8H A;  4XQ3 A;  3ULR B;  3OMC A;  4IUP A;  2LW4 A;  2RB6 A;  1BI0 A;  3TW6 A;  1VQ6 Q;  2BE7 D;  2K57 A;  2MWP A;  2JM9 A;  2NUT A;  3UT1 A;  4EC8 B;  1YJW Q;  5IXF A;  5GAO r;  1F1B B;  3KXT A;  4EOL B;  2L89 A;  1U8R A;  4M78 B;  3A8G B;  5KYW B;  2HEQ A;  4OP0 A;  2DJQ A;  1TS9 A;  4M78 F;  4MFE A;  1VQN Q;  2EJ9 A;  5HKC A;  1Q7Y C;  4HNV A;  1YJ9 Q;  3MJX A;  2EUF A;  1R0B G;  3EHQ A;  5I5Z B;  2KY9 A;  1FKM A;  4L59 A;  4RCC A;  3H41 A;  1VQK T;  4ORZ A;  3SEM A;  3MO8 A;  8AT1 B;  2ESW A;  2GTO A;  3G4S A;  3I56 A;  3CXC S;  5ECA A;  1VQO A;  1VQ8 A;  1OPL A;  2J05 A;  1G3T A;  4C0Z A;  1GCP A;  4NST B;  3S3M A;  1WHG A;  1WFW A;  1SF9 A;  2AZS A;  2X4J A;  4MMK A;  4EMK C;  4E7I A;  1NYG A;  1WJR A;  2QK0 A;  2FZG B;  3GF5 A;  2C5X B;  2P4R A;  2EAY A;  1C1A A;  1TFB A;  1OKW B;  3BG9 A;  3CCU A;  4J7F A;  1MGQ A;  3V7C A;  5FRO A;  2DD4 B;  3CEY A;  2D9T A;  2DL3 A;  3BY7 A;  3G1J A;  2BUD A;  2L3P A;  2HDA A;  4FW1 A;  1K8A U;  2QQB A;  3I55 T;  1K73 U;  1UGV A;  2EQK A;  1VUB A;  4M75 F;  2EWN A;  4LOC A;  2ED0 A;  2M1H A;  2K3B A;  1M3C A;  1WHL A;  1VYV A;  4Y92 A;  5IHN A;  5IHK A;  4G6L B;  4LD6 A;  1BB9 A;  2DVE A;  2R5A A;  1NYF A;  4C0G A;  1IRE B;  1GCQ C;  2MK5 A;  4DBQ A;  1O9K B;  3PFS A;  2EQJ A;  3OYF A;  4JX4 A;  1MNE A;  4QQD A;  4FYV B;  2MOX A;  4M75 A;  3VS1 A;  2NLU A;  2DD5 B;  2E5Q A;  4BY1 X;  1H3Z A;  2JZ2 A;  4Z02 A;  5I11 A;  1XOV A;  1N9S A;  2LZ6 B;  2CCH B;  1OZ2 A;  1RI9 A;  2AKL A;  3CME Q;  2XID A;  2DYI A;  2C0I A;  5GAN 2;  1VA7 A;  1D0Y A;  2RD1 A;  3QII A;  2DVJ A;  4EMH A;  1KD1 R;  2CGH A;  5LJ5 g;  5KYU A;  1IB8 A;  2GBQ A;  1SG5 A;  1BI1 A;  4CFV B;  3FJP A;  4J83 A;  4IIO A;  2O88 A;  2LJ3 A;  3M59 A;  4PFZ A;  3UDC A;  5HK0 A;  4IMY B;  4EOO B;  1RL2 A;  5GMK i;  4BD3 A;  3MEA A;  1GBQ A;  1M90 R;  2PU9 B;  4X34 A;  1I5O B;  1ABO A;  2HNI A;  2DX1 A;  2NUP A;  5CKF A;  1IRX A;  4J9C A;  1M3A A;  4AG1 C;  3H9N A;  5CKD A;  4F70 B;  4AKI A;  4J9E A;  3QHS A;  1H1Q B;  1Q82 U;  2RQT A;  1YJ9 T;  4JJD A;  4IKF A;  1LVK A;  2RHY A;  3FEO A;  2M51 A;  2E3H A;  5KYY A;  2RN8 A;  1QCF A;  2FRY A;  5GMK e;  4C0F A;  1KC8 U;  1MV3 A;  5FWC A;  5HBE B;  1M1K C;  5DQW A;  2DL4 A;  1Q95 G;  3N5B B;  4N0A C;  1HYO A;  2X3W D;  3CCS A;  2CT4 A;  3BLR B;  4VUB A;  3VRZ A;  4JX5 A;  1VQP A;  3BHV B;  2HKN A;  1AWJ A;  4HLQ A;  2JS0 A;  5HVY B;  1JJ2 P;  1Q86 C;  1C6V X;  2DIQ A;  1Q81 U;  4PL6 A;  2EPD A;  4F7U A;  2KBT A;  4EOR B;  2CP5 A;  3VS6 A;  1M90 C;  2QDY B;  4J9I A;  3VV0 A;  2BE9 B;  1PRL C;  1VQL Q;  4HCC A;  3HTR A;  4D8D A;  4F7J B;  2DO3 A;  1KIK A;  2OTJ A;  2YUQ A;  2FRW A;  1TXQ A;  4DOW A;  3I56 T;  2M16 A;  4HVV A;  3QZ9 B;  1X43 A;  2EYQ A;  2VGM A;  4N4G A;  4ZGE B;  4CRL B;  4OB1 B;  1IO6 A;  5LJ5 e;  3LWI A;  4RTX A;  3SWN C;  1ZBX A;  4F17 A;  1GFC A;  3CCJ Q;  3JCM X;  3MEV A;  2E41 A;  1T0J A;  4RTV A;  2KGT A;  2PK2 A;  3DB4 A;  3SDZ A;  1UGS B;  3KBG A;  1V76 A;  2CSQ A;  3RDV A;  3G6E T;  1UHC A;  3HPW A;  3SWN A;  3I5S A;  3BG3 A;  2KNB B;  2EGA A;  1SHG A;  2RHI A;  4PLI A;  3CQT A;  1PKD B;  2XI9 A;  2KR3 A;  5KYX A;  1OUL A;  3EH2 A;  2Y4Y A;  3C12 A;  2IVX A;  5HK3 A;  3NTI A;  2DYB A;  2VKN A;  3TN8 B;  3L2V A;  3ZL7 C;  4KGV B;  4BI3 A;  3BDU A;  2L8D A;  2RM4 A;  2KYM A;  1ZUY A;  2PK9 B;  4MZM A;  2CZ0 B;  1MND A;  2KI7 A;  4PJO C;  3VUZ A;  5GAO l;  2K9G A;  2K2V A;  1QWE A;  2P84 A;  1ZP2 A;  1YI2 A;  1PD1 A;  3JSC A;  2IW6 B;  3JCM V;  5GAN 7;  3CCJ A;  3G71 T;  1S1N A;  3HFN A;  2RK1 A;  1VQM A;  1TOV A;  1W1F A;  3M0U A;  3M0T A;  1V29 B;  5KCH A;  1QP3 A;  2ZPG B;  4M78 A;  5KYW A;  3OMG A;  5FW9 A;  4FYY B;  4A54 A;  3CCE A;  4M7D D;  4BCO B;  5GAN 6;  3C94 A;  3O8V A;  3EG3 A;  1H1S B;  3HRS A;  1OU9 A;  1ZUK A;  4HCB A;  3TEE A;  3CC7 T;  4RTU A;  3MKD A;  2G77 A;  4A53 A;  1BYM A;  1M8V A;  4CC2 A;  3IQL A;  3OB9 A;  3OS5 A;  1QVF S;  5GAN f;  1VQL A;  3X25 B;  1GY3 B;  3H6Z A;  4BY7 X;  3KHI A;  3JCM g;  1RAE B;  2UZE B;  3VU3 C;  3H0F A;  5ACB A;  1FIN B;  3OBY A;  4J7I A;  2EJG A;  3P8B B;  2IW9 B;  3A98 A;  2BKZ B;  2KR6 A;  1M1K R;  3MI9 B;  1NG2 A;  1OV3 A;  4D8K A;  1QCN A;  2FHD A;  2MIO A;  4QT7 A;  2J6K A;  2Y4X A;  1YHQ T;  4M7A G;  4MDW A;  4ELZ C;  2JNG A;  1UE9 A;  3CBM A;  2OTL T;  3OBW A;  3CXC A;  2DXC A;  3C4S A;  1WJQ A;  1E6H A;  1VQ8 Q;  2ZPF B;  1XQH A;  4M77 G;  3EG1 A;  5LJ3 f;  1VYW B;  2DFU A;  1YIT T;  5IAY A;  2VXF A;  4IUV A;  5IH2 A;  2ATC B;  2BIV A;  1X27 A;  1WA7 A;  3LQ5 B;  1B3Q A;  4J5Y A;  2LVM A;  1IHV A;  2YRC A;  4OGE A;  4LUE A;  3K7A M;  1WHH A;  1N8R U;  1SHF A;  4C8Q E;  3GPL A;  2RQU A;  2JMC A;  1Q82 C;  4F16 A;  3G71 A;  1K76 A;  3OYI A;  1NE8 A;  1X6B A;  4C92 B;  1VQ5 T;  1M1G A;  1GFD A;  3PMT A;  1YI2 T;  4C92 F;  3GNG A;  1JQQ A;  1G3N C;  3ZBD A;  3P8H A;  3OYJ A;  2CH4 A;  1N4M A;  5GAO n;  3DB3 A;  5I21 A;  2WMB B;  4M7D C;  2IVW A;  4CC4 B;  2DD5 A;  3QO3 A;  3EFS A;  4LDW A;  5ICP B;  1K0X A;  1MMN A;  4C5E A;  2LCC A;  2L3R A;  1G5V A;  2GGR A;  1M2O A;  1YJ9 A;  3PT9 A;  2P0K A;  2FPF A;  4M7D A;  3NFC A;  3VYG A;  1O75 A;  4C8Q B;  5A0L A;  1UGQ B;  3EGU A;  2W99 A;  1JU5 C;  4WTO B;  4FT2 A;  1R0C B;  1N8R R;  4EON B;  1VQ9 A;  2OX7 A;  4LDV A;  1GBR A;  4QW2 A;  1UB4 A;  4PJO D;  2D1X A;  3GBQ A;  2KK4 A;  3I5R A;  5GAN 5;  2BZX A;  4AMC A;  1WLP B;  1X2Q A;  4LD9 K;  2FEI A;  4I3Z B;  3H8Z A;  4M7A C;  4EOI B;  3QUI A;  3JCM P;  2HD0 A;  1TG0 A;  3DLL A;  4GBQ A;  3MP6 A;  4E7Z A;  3G6E Q;  4M7D B;  2AZV A;  2F2V A;  1G83 A;  2MPX C;  3OA6 A;  1SKU B;  4YOO A;  2VVK A;  1M1K U;  4E7J A;  2AHJ B;  3NTH A;  1KQS A;  3VS0 A;  3HRU A;  4HXJ A;  2VUB A;  2J6O A;  4M77 E;  3H0I A;  5D6Y A;  1TUD A;  4HKE A;  3SD4 A;  4EOJ B;  5KE2 A;  1OIU B;  2FPD A;  4JRK A;  2JXB A;  5HQ0 B;  4C8Q D;  2EGC A;  4IUR A;  3CC7 Q;  5DQV A;  4BBR M;  3VRY A;  3QJ6 A;  5I22 A;  3OYG A;  1WDX A;  2JUF A;  1Y71 A;  3UA7 A;  2IN3 A;  1P5E B;  4A4H A;  2DNU A;  4EDU A;  1VQ4 Q;  4II1 A;  2KEA A;  5LMK B;  1H25 B;  1BIA A;  4F7U B;  3CCS T;  3JB9 G;  2JGZ B;  4P5N A;  2F69 A;  3I55 A;  2X4X A;  4CFX B;  2LP5 A;  1VQO Q;  1W70 A;  4KUD K;  4J9G A;  5FU6 C;  2VXE A;  5HY6 A;  3I56 Q;  1UEC A;  1OI1 A;  3JCM J;  5GAN j;  2RMO A;  3VKH A;  4NL2 A;  3J81 E;  1XO2 A;  4XU2 A;  2RQV A;  1BKB A;  1JEG A;  1NEG A;  3CC4 Q;  1YWO A;  1U5S A;  4BE2 A;  4YC3 B;  3CMA Q;  1B7T A;  3F5X B;  4J8O A;  4R55 A;  3JB9 D;  4F6S B;  2CH4 W;  1K73 C;  2QEX Q;  5FRN A;  2QGG A;  1KHC A;  2O4X A;  2KDS A;  5IXB A;  1RAC B;  3QJY A;  1C0M A;  2ZZD B;  1D0X A;  4BUG A;  1VQ6 A;  1YCY A;  2QG9 B;  5CKB A;  4JLI A;  1JRI A;  1AIS B;  2ABL A;  5LQF B;  2O31 A;  4LN2 A;  1H1P B;  4RCB A;  4RTT A;  1B07 A;  1IGU A;  1WHJ A;  1VQN A;  2XD0 A;  2X3X D;  2RI2 A;  3PTA A;  4NC6 A;  2GNC A;  5LJ3 h;  2K6D A;  2H3J A;  3G7Z A;  4OMM A;  5I2S A;  2V8J A;  1N5Z A;  2WFY B;  1TU0 B;  1Y07 A;  4JS4 A;  3MET A;  4BAC A;  2O4X B;  2MWO A;  4BCP B;  3A8H B;  1VQ9 T;  5J39 A;  2OTJ Q;  4FT4 A;  5GMK l;  1BBZ A;  2BTT A;  4ZTJ A;  3QZ5 B;  4K11 A;  1UUE A;  4F6W B;  1FMV A;  5DLQ E;  3OS1 A;  3OYC A;  2CZ7 B;  3UPU A;  4M7A F;  4DBR A;  2KVQ G;  3ER0 A;  3OYH A;  2COY A;  1HXD A;  2GFA A;  2E1H A;  5GAM f;  1U1S A;  2KXC A;  1MMD A;  3OYY A;  4L5G A;  3T9N A;  2IIM A;  4FYW B;  1SRL A;  3B57 A;  2JVV A;  3GLX A;  2QAS A;  4Y28 E;  1OIY B;  4M4Z A;  4PJO F;  2GF7 A;  1KC8 R;  4CFU D;  4E7K A;  4M7D E;  1ZA1 B;  4M77 D;  5GAO q;  3JAM E;  2KRM A;  4EIK A;  4M78 C;  2WIH B;  3LW5 E;  5FWB A;  2CRE A;  2DZ9 A;  3CC2 T;  1W4S A;  1AZE A;  5IF1 B;  1ZLM A;  2RHX A;  4M7A D;  3EGD B;  1YJN A;  3CC2 A;  1Q81 R;  2F1L A;  4XTU A;  4DA4 A;  1M8M A;  4DEX A;  3QXE B;  2HMA A;  2DPP B;  2KSS A;  3MEW A;  5I2M A;  1K73 R;  1M90 U;  4ROE A;  1DJ7 B;  3RKX A;  4C0D B;  4Y91 A;  1W2B A;  1M5Q 1;  5IHI A;  1PG5 B;  4D6W A;  2LX7 A;  1SPK A;  4FSS A;  2A3L A;  2RA2 A;  1JST B;  4PJN A;  2XMF A;  1UGP B;  4BCM D;  3MEU A;  1H28 B;  3MY1 B;  1WI7 A;  3EGD A;  3NHN A;  2CT3 A;  5C6S A;  2YT6 A;  1QVF A;  3H4C A;  5L8R E;  1OQK A;  1Q82 R;  2DXC B;  1O9K A;  2LJ1 A;  4FIB A;  1KK7 A;  3M4Y A;  3OSS C;  1IGQ A;  1VQK Q;  2K5I A;  3FC3 A;  1NZ9 A;  3FIF A;  4M75 C;  5GAM j;  1VQ7 Q;  3EAE A;  3HZJ A;  3FRN A;  3O5Z A;  3CC4 T;  3CC7 A;  3LYI A;  5FRM A;  1H1R B;  1VQN T;  1GUX A;  4ELJ A;  1O9S A;  3L2Z A;  4N4H A;  2IW8 B;  2PVG B;  2V8I A;  3CCQ Q;  4C92 A;  3OYA A;  3CCE T;  2IPO B;  3OS0 A;  4M78 E;  1OOT A;  2HL3 A;  2IG0 A;  3QWL A;  3QYG B;  2HL5 C;  3GIB A;  5A0G A;  1NLP C;  4F7S B;  4M78 G;  2XU8 A;  1QVF P;  2DME A;  3DDP B;  2E70 A;  3RR6 A;  1S72 A;  3TCJ A;  4M7D G;  3UA6 A;  3RMS A;  3G33 B;  2HQX A;  3QYH B;  2QQR A;  3VS2 A;  3M0P A;  9ATC B;  1ENW A;  4XTX A;  3BFM A;  1KG1 A;  3OSV A;  2JS2 A;  4B6M A;  1YI2 Q;  2LQW A;  1K9M C;  1GL5 A;  3C0C A;  4F6U B;  3EG9 B;  5IDN B;  2K79 A;  2MYS A;  2LT4 A;  2QEX T;  4UC4 A;  2L3S A;  5KCO A;  1YJN T;  2PQW A;  2QQS A;  1BU1 A;  3EGX B;  4QVD A;  1FMK A;  4M7D F;  5LJ3 e;  2VC8 A;  4ANJ A;  5EG2 A;  1D1C A;  2I2L A;  4EMK A;  1TSF A;  1JBM A;  3TQ7 P;  1K8A R;  1KQ2 A;  2GCX A;  2BZ8 A;  2BS2 A;  4PK4 A;  2K3X A;  1I5L A;  2CDT A;  2L2P A;  4F7L B;  1MMA A;  4J9F A;  4BCN B;  1AZG B;  1AWO A;  4M75 E;  3G6E A;  5IHY A;  3HP9 A;  2ENM A;  2KYB A;  1P92 A;  1UEB A;  2V22 B;  5CO7 A;  4MDX A;  4NOY A;  3M5A A;  4OVA A;  2ZPH B;  1GH6 B;  4F7U G;  4ELL A;  4LDY A;  2QGS A;  1YCS B;  5CR2 A;  2AIR B;  3INZ A;  1YJN Q;  1AHJ B;  3EFO B;  3M4G A;  2O9S A;  5GAN h;  4EOP B;  5IN1 A;  4X9C A;  4O5V A;  1OU8 A;  1D1B A;  5GAN 3;  3DLM A;  3OW2 S;  4A4K A;  2ZPI B;  1XNI A;  2HSE B;  4XK8 E;  2XDD A;  2FYK A;  4OGC A;  4M7A E;  1WGS A;  5D7U A;  1ABQ A;  2RQR A;  1VIN A;  2VV5 A;  1H27 B;  2XK0 A;  1S72 Q;  1VQ5 Q;  2GTJ A;  3UF4 A;  1VQ6 T;  3SWN B;  1RUW A;  2FB7 A;  2WSF E;  2Y90 A;  3EG0 A;  4CFN B;  1AWX A;  4CFM B;  2KMT A;  3PNW C;  4BE1 A;  5KYX B;  2YRD A;  1Y7X A;  3A8L B;  4MML A;  2DL8 A;  2W0Z A;  3OW2 P;  1H24 B;  4EC9 B;  4LDX A;  2PHG A;  2V26 A;  2X51 A;  5LJ3 g;  1HSQ A;  2GQV A;  3NGP A;  1QQJ A;  2CKK A;  1R8O B;  4OMP A;  5LJ5 h;  1M3B A;  3VYH B;  4M77 F;  3EG2 A;  4PJO G;  4OB3 B;  3I35 A;  1Z9Q A;  2XDB A;  2JN0 A;  3QHW B;  1EX4 A;  1XTD A;  5A2Q E;  5FU6 B;  1Y57 A;  1IHW A;  3M57 A;  4KGX B;  4FYX B;  2R57 A;  1FX7 A;  2BPM B;  3HO8 A;  1WX6 A;  2LQN A;  2O9V A;  1ZQ1 A;  2CZ6 B;  1WPY A;  4M6V A;  3JV3 A;  4C5I A;  2ZGW A;  3DJB A;  3REA B;  2RI5 A;  2C4G B;  3OYB A;  3HL8 A;  1H4L D;  3TNH B;  4BCK B;  1UJ0 A;  2BS4 A;  1JO8 A;  2NYS A;  3HRT A;  2J6F A;  4J9D A;  4FX3 B;  2B86 A;  2XG8 D;  3VKG A;  1KC8 C;  1EZZ B;  3JCM d;  1VQ8 T;  4PJL A;  1YHQ A;  1VOM A;  5GJV B;  3PGG A;  4LE9 A;  3FLG A;  1VQK A;  3QDR B;  1M30 A;  3CXC P;  5IDP B;  2RJD A;  2K2M A;  3O0G D;  2QGF B;  1BCM A;  2W2H A;  2DXT A;  4FM4 B;  4BDY A;  2DAQ A;  3LLR A;  5GMK m;  1ZUU A;  3JCM Q;  1Y96 B;  3G71 Q;  1VQL T;  2DMO A;  2AK5 A;  3D7S B;  3VUB A;  2JTF A;  2YUP A;  1NLO C;  2PNI A;  2UZL B;  3PIP A;  4KGZ B;  1IXD A;  3RGF B;  4WF2 A;  3QDF A;  1ZHI A;  1JSU B;  4BDZ A;  5M9O A;  4BCM B;  2G9X B;  5FGK B;  1I1J A;  4A63 B;  2W96 A;  3HKS A;  1RLQ C;  1HJD A;  4F7U F;  4NL3 A;  5CQX A;  5GAN g;  2X1N B;  1JB0 E;  2LDM A;  1UFF A;  3CBO A;  4YTL A;  4M75 B;  1QWF A;  3L1A A;  1BI2 A;  1KSW A;  3GOX A;  2KE9 A;  1D1A A;  1VQM T;  4ELY C;  1OZ3 A;  4DQ2 A;  2DA9 A;  2YHT A;  1H26 B;  2DRM A;  1E9H B;  2QYZ A;  5L23 A;  1ACM B;  4PLL A;  2WMA B;  4BCF B;  2RK2 A;  2F5T X;  4X1V A;  2DZC A;  2I53 A;  2DD4 A;  2WHB B;  2ECZ A;  3SFM A;  4ZNX A;  4KBM B;  3CCM A;  2DTO A;  3I9Q A;  1R77 A;  1RAI B;  2HKQ B;  2EQU A;  2M02 A;  3TVT A;  4EOK B;  1JXM A;  4Z89 A;  3G4S T;  1YIT A;  4ZN3 A;  1AWW A;  4Y72 B;  2C5N B;  4CFU B;  1M9S A;  4XAX B;  1T3L A;  4CI0 C;  2PMI B;  3QWX X;  5KE3 A;  1I81 A;  3OYK A;  3POM A;  1G3S A;  1X2K A;  4YOS A;  2QQ9 A;  2OTL A;  3HBL A;  1GUX B;  3M54 A;  5IT9 E;  3SB2 A;  1AD6 A;  1Q7Y R;  3VYG B;  1OPK A;  2FVU A;  2SRC A;  3M9Q A;  5GJW B;  2G3R A;  1QMZ B;  3M53 A;  2CP0 A;  3QWY A;  3PMI A;  4RMO A;  2LRQ A;  1QLB A;  3CC2 Q;  4BCG B;  3GTM S;  3E9F A;  1ZX6 A;  1VYT A;  2HQH A;  2KT8 A;  1RI0 A;  2PJQ A;  1FXX A;  1NEB A;  2O01 E;  1RAA B;  3DL1 A;  2P0P A;  4OR5 B;  1OX8 A;  1UNH D;  3TRE A;  4JJC A;  3CCM T;  1NJI U;  2A36 A;  2GFU A;  4JPB W;  1PKS A;  1H3H A;  2CSI A;  2LJ0 A;  4M7A A;  4C8Q C;  3X20 B;  2FO0 A;  2RHU A;  3CCV T;  4BCQ D;  3EG9 A;  3L2W A;  2LC4 A;  4HL4 A;  3FJ5 A;  3TSZ A;  3TU4 K;  2C06 A;  1M27 C;  3C95 A;  2JT4 A;  2NWM A;  3BLH B;  1UTI A;  3BDL A;  3LGL A;  1ZBJ A;  4BI8 B;  4HVU A;  2FL7 A;  1TTH B;  2LMJ A;  2HBW A;  5CK9 A;  1WQ7 A;  1YIJ A;  2QF7 A;  5GAM h;  2NUP B;  4F7N B;  5GAM e;  2JJ9 A;  2K7A A;  1KQS S;  4KRD B;  2COZ A;  4M7A B;  4HA8 A;  1JJ2 S;  1D0Z A;  4FW2 A;  4EMG A;  2H3E B;  1U06 A;  1VQM Q;  1K1Z A;  1A0N B;  3JB9 I;  3QBY A;  5LJ3 j;  2OAU A;  1ZA2 B;  2L3Q A;  2PVD B;  3OYM A;  4RTW A;  4F14 A;  3CCR T;  1MMG A;  2WJ9 A;  1X69 A;  2E6N A;  2UZD B;  1PSE A;  5EFQ B;  2CZ1 B;  3RER A;  3BE3 A;  2C5V B;  4IUT A;  3E1S A;  1LOJ A;  1KD1 U;  3JB9 J;  4C8Q F;  4AFS C;  2CS7 A;  1NM7 A;  2EQM A;  3LX7 A;  2QA4 T;  2QDL A;  3LWH A;  2QTX A;  2JMA A;  2DF6 A;  3MCA B;  4ME7 A;  2D6F A;  2EKO A;  2EYY A;  5FLX E;  4ROC A;  5D6X A;  2OAW A;  3OW2 A;  1QLY A;  1W2B S;  2BS3 A;  4RUG A;  4BCJ B;  2MI6 A;  2VB6 A;  1OKV B;  4FL6 A;  2DKG A;  2V1R A;  3OYL A;  1PD0 A;  3CCS Q;  3AHU A;  3NDQ A;  1AEY A;  1AT1 B;  4MZT A;  4ZN1 A;  4OML A;  3CMA T;  2LCL A;  2MCN A;  2F2X A;  1TWB A;  2MF2 A;  4PJO E;  1B34 A;  1T3S A;  4IIM A;  1YFN A;  1OYX A;  4KUI A;  3DOG B;  2DER A;  2JTM A;  5BNJ B;  5DY9 A;  1QVG P;  1OL2 B;  1WIE A;  5A0D A;  3CME T;  1KFZ A;  2E64 A;  5EC7 A;  5C0M A;  1W2B P;  2WIP B;  1XJW B;  2MMP A;  1GRI A;  1YHQ Q;  3I55 Q;  4XTZ A;  3ASK A;  1NJI C;  1OGU B;  4BCQ B;  1VQ4 A;  2X4Y A;  2WEV B;  3U23 A;  2A7Y A;  3VS4 A;  1MHN A;  1NPP A;  2PTK A;  3VS3 A;  3M58 A;  2O2O A;  4JRQ A;  1VQP T;  3CCU Q;  2C6T B;  2PUK B;  3V8J A;  1B34 B;  1Q81 C;  2RQW A;  1UDL A;  1PSF A;  5AT1 B;  3MIA B;  2LNV A;  4RG2 A;  2NUT B;  2E6Z A;  3S6W A;  3EFR A;  2DXU A;  1QP2 A;  2YSQ A;  4II5 B;  3A5Z B;  1WHK A;  3KFV A;  5GAN 4;  2ROT A;  1YWP A;  1JOW A;  5CCA A;  3RKW A;  1PWT A;  4XTW A;  2HQE A;  3HB9 A;  2JW4 A;  4BI4 A;  3RNJ A;  3CPF A;  1GCQ A;  1BCO A;  4KH0 B;  2DRK A;  3CPW S;  1N8R C;  5CQY A;  2DJZ A;  2QFZ A;  1BU2 A;  3J80 E;  2EYZ A;  3X28 B;  1PRM C;  2WPA B;  1BIB A;  3M03 A;  2R58 A;  3EID B;  1NPR A;  2K5F A;  1I8F A;  3HSB A;  2K4Y A;  3CCE Q;  2QA4 A;  4KRT A;  3CCQ T;  1YBY A;  1Y96 A;  4R0K A;  1HD3 A;  3JB9 F;  1U3O A;  3BHU B;  4OMF B;  4Z6Y A;  1SEM A;  5CEI B;  1MV0 B;  3Q1J A;  4CC7 A;  3WXM B;  2WSE E;  4ZGJ B;  4C0D C;  1KHI A;  5KYN A;  1QVP A;  2KAF A;  4LDU A;  2PZ1 A;  3ZFJ A;  1TUG B;  4Z88 A;  1BI3 A;  1UNG D;  2LTO A;  1I0C A;  1N9R A;  1X01 A;  4B9W A;  1AVZ C;  3M0R A;  3OYD A;  4TVR A;  2SEM A;  2CP6 A;  1H64 1;  5D6W A;  3DKM A;  3PVL A;  3F70 A;  2UUE B;  1YJW T;  3P8D A;  2CJM B;  2QEX A;  1JXO A;  2EGE A;  4PJJ A;  4AKG A;  2CUB A;  4C92 E;  1VQ4 T;  1LNX A;  3OY9 A;  1RAD B;  1YIJ T;  2QQA A;  1ZSZ C;  3M56 A;  2YLC A;  6AT1 B;  2KQW A;  5AYF A;  1I07 A;  2E65 A;  2E5K A;  4AI6 A;  4J9B A;  3THK A;  3CME A;  4M77 B;  2D0N A;  3S3O A;  2COW A;  2AKK A;  2EFI A;  1AOJ A;  1T0H A;  3JCM h;  3VS5 A;  3LH0 A;  1K9M R;  1RAF B;  1VQ5 A;  1YNZ A;  3RUX A;  2OTL Q;  2LX9 A;  3QYB A;  2RJC A;  3PVQ A;  4PNO A;  3CCU T;  3LGF A;  2HAX A;  4R56 A;  3S3N A;  5GMK h;  3EGX A;  1OEB A;  2LCS A;  1F5Q B;  2CP7 A;  4FU6 A;  2RO0 A;  3RES A;  1PM3 A;  1D3B B;  2HBP A;  2C0O A;  3RMQ A;  5EJC A;  3ME9 A;  1QW1 A;  4Q5W A;  4M77 A;  4JZ4 A;  3V8L A;  2JTE A;  1JKW A;  2DE0 X;  2DM1 A;  2M0O A;  4LUD A;  2K3Y A;  3ZEH A;  1VOL A;  2DEU A;  5FU7 B;  4JS5 A;  2KXD A;  3RBB B;  3CPW P;  4BXX X;  2W9F A;  4ZTF A;  2PUO B;  4PKC C;  3BW1 A;  2CYZ B;  4RKU E;  2EYX A;  2J06 A;  4M77 C;  2DTH A;  2FZK B;  1KD1 C;  1RLP C;  1H92 A;  5KYY B;  5LJ5 d;  2KMG A;  4KRC B;  3OYN A;  4ESR A;  2WAC A;  4GY5 A;  1K0S A;  4M75 D;  2YXY A;  4J9H A;  1D3B A;  1PC0 A;  5CAI A;  4KH1 B;  4E7S A;  4JUV A;  1JJ2 A;  4QVC A;  3HHT B;  3EH1 A;  1G3Y A;  4DBH A;  4QQG A;  4BCI B;  3WVE B;  2ZPB B;  1LJO A;  5GAO m;  3AT1 B;  1KXU A;  3VKI A;  4OMO A;  1X75 C;  2DL5 A;  3JB9 H;  4KUL A;  3QHR B;  2ZZD A;  1E7P A;  1QVG S;  3HFO A;  3MPU B;  2WXV B;  1E6G A;  3JCM c;  2CP2 A;  4DEY A;  2RH2 A;  2RNA A;  1YIT Q;  4QQ6 A;  3CCR Q;  1RAH B;  2HZY A;  3NMZ C;  2HSP A;  5GAN d;  2C5O B;  4FSX A;  3CCL T;  4CC3 A;  2YUO A;  3CCJ T;  4AFU C;  3CCM Q;  1PHT A;  1EFN A;  4A4G A;  1QCO A;  3FB9 A;  2QAZ A;  3A8O B;  5DM7 R;  3UAT A;  2KRN A;  1U1T A;  1PNJ A;  1W6X A;  3MHX A;  3CD6 A;  3JCM W;  2DIG A;  4DBF A;  2ROL A;  3PO3 S;  4EOM B;  5GAN e;  2BZY A;  1M2V B;  4JJB A;  2JOY A;  8ATC B;  3CCV Q;  1W98 B;  3EJ1 B;  1G8X A;  2PVO B;  3V7S A;  3EOC B;  2DL7 A;  2X4W A;  4A4E A;  1MUZ A;  4BCN D;  3CBP A;  4WCI A;  2V1Q A;  2LNH B;  1QVG A;  1TUC A;  1WZO A;  2DBK A;  3GP8 A;  2QTV A;  5LJ5 j;  2OJ2 A;  3H0H A;  3JCM b;  1VIE A;  3FDR A;  3JRZ A;  3L2U A;  1ARK A;  2RJE A;  1OL1 B;  2ZCF B;  5CIU A;  4CFW B;  2ZPE B;  1BK2 A;  5CKH A;  1VQ9 Q;  2YUN A;  1LCK A;  2QQ8 A;  2L5Q A;  2VAS A;  1QKW A;  4E7L A;  2QA4 Q;  2DIL A;  5GAM d;  2EQI A;  2XIC A;  3E19 A;  1CSK A;  3MP1 A;  5HBJ B;  2Z0W A;  5FU7 C;  3WVD B;  4E47 A;  1Q7Y U;  3BG5 A;  5HNB B;  7AT1 B;  4BY6 B;  4AFZ C;  1C9B A;  4HNU A;  3MP8 A;  3G4S Q;  2F2W A;  4OF1 A;  2D8H A;  1LPL A;  4JZ3 A;  4C92 C;  4QVZ A;  1FVV B;  1WXB A;  1VQ7 T;  2OTJ T;  4E2F B;  3JCM f;  2XDP A;  2DXB B;  1UGR B;  3KUF A;  1WXT A;  4IUU A;  3VJP A;  3GNF B;  3BHT B;  4C92 D;  3X24 B;  2EKH A;  3RIR A;  1Z9Z A;  1URC B;  1YN8 A;  4LNP A;  4XU0 A;  3PE0 A;  3OS2 A;  4BCH B;  1WYX A;  4C5H A;  1TD6 A;  1H8K A;  3V8K A;  1YJW A;  2E12 A;  4L6V 5;  3L2R A;  4HVW A;  4EPC A;  4EOS B;  2J7I A;  3V7R A;  1UG1 A;  4AG2 C;  1RAG B;  4OGR B;  2D8J A;  5LL6 S;  1D09 B;  3DTO A;  1HK9 A;  1NJI R;  2GQI A;  2EYW A;  2DTI A;  4NS5 A;  2DLP A;  2DXB A;  1QKX A;  3NTK A;  1Y0M A;  3A1P A;  2K5L A;  3REB B;  2VGN A;  1K8A C;  2B9R A;  3LH5 A;  2P4T A;  3JCM e;  5LJ5 f;  2QXF A;  3QG1 A;  2VYT A;  2EIF A;  3QPH A;  1X6O A;  1OX9 A;  4ROD A;  3SHW A;  1UHF A;  3CCQ A;  3EHR A;  3URG A;  2NUZ A;  1VYU A;  2RHZ A;  5CVI A;  2YRV A;  2W9Z A;  1D3U B;  4JLG A;  2B8A A;  4M78 D;  4MIM A;  2RI3 A;  2CUD A;  1UNL D;  4JDS A;  1FYN A;  3RKY A;  3CCL Q;  2KT1 A;  4C92 G;  1PKT A;  2FG0 A;  3VS7 A;  5KYU B;  3TW7 A;  2AT1 B;  2X35 A;  2LQ8 A;  3CD6 Q;  3X26 B;  1CKB A;  2E10 A;  4HCZ A;  3E9G A;  2LT1 A;  2BKD N;  4PFO A;  4PJM A;  4OMQ A;  4RTZ A;  4V2S A;  1KJW A;  2JM8 A;  4HT9 A;  3L42 A;  2XHC A;  4J6X A;  5GMK j;  3M0Q A;  2M0Y A;  2DBM A;  3L2Q A;  3CCR A;  3R6N A;  4EMK B;  4AKH A;  1G3W A;  3CPW A;  4JRI A;  1VIF A;  4UN0 A;  1G2B A;  2EVR A;  1Q86 R;  1YP5 A;  2YWW A;  4C8Q G;  2KRO A;  3TNI B;  2UZB B;  1TH7 A;  2A28 A;  4QSH A;  3CCL A;  1WXU A;  2FZC B;  4PFP A;  4X9D A;  1S72 T;  4C8Q A;  1K9M U;  1KQS P;  2RJF A;  3QSU A;  3E2U A;  1J3T A;  4E7H A;  2I40 B;  1M1F A;  2HCK A;  1ZSZ B;  4N4I A;  3OYE A;  2I0N A;  4YOZ A;  2ED1 A;  2R7G A;  5LJ3 d;  5HBH B;  3PIO A;  1GXI E;  3NPF A;  2L0A A;  4B9X A;  2W10 A;  2C0T A;  4BBS M;  4HCK A;  2ZAE A;  4IUQ A;  3EFO A;  3CMA A;  1IZ6 A;  4JJN K;  1WHM A;  1VQ7 A;  2QDJ A;  3TSW A;  4GLM A;  4F7U E;  3CC4 A;  1OI9 B;  4XU3 A;  3CCV A;  1KQ1 A;  4JX6 A;  4J6Y A;  4EOQ B;  2MAM A;  2X9H A;  4HT8 A;  4O6J A;  4J6W A;  4AT1 B;  4E6R A;  2DK3 A;  4M75 G; 
#chains in the Genus database with same CATH homology
 2WSC E;  2R58 A;  4XTV A;  5CO7 A;  4PJO A;  3KHI A;  4MDX A;  1EIF A;  1NPR A;  2K5F A;  4NOY A;  3JCM g;  3M5A A;  1I8F A;  4A4F A;  3HSB A;  2K4Y A;  4OVA A;  3VU3 C;  2QA4 A;  3CCQ T;  2ZPH B;  1VQO T;  3OBY A;  1YBY A;  1Y96 A;  4RG8 A;  4BB7 A;  4F7U G;  4J7I A;  4LDY A;  5CR2 A;  3INZ A;  2EJG A;  3P8B B;  4BY6 C;  3JB9 F;  1AHJ B;  3M4G A;  5GAN h;  2KR6 A;  4OMF B;  4HNT A;  4MFD A;  4Z6Y A;  2XKO C;  3OQ5 A;  5IN1 A;  4X9C A;  1WJS A;  2FHD A;  2EJF A;  4C5G A;  5GAN 8;  3Q1J A;  1WQW A;  2P0Q A;  5J3B A;  2YLB A;  4GLK A;  1SSF A;  2Y4X A;  4O5V A;  2WSE E;  4ZGJ B;  3WXM B;  5GAM g;  1YHQ T;  5GAN 3;  4C0D C;  3DLM A;  4M7A G;  3OW2 S;  4A4K A;  2ZPI B;  1KHI A;  1XNI A;  2JNG A;  3M55 A;  4MDW A;  4XK8 E;  4ELZ C;  2LQK A;  5DLO A;  3CBM A;  1QVP A;  2FYK A;  3OBW A;  4OGC A;  2KAF A;  4LDU A;  2OTL T;  4M7A E;  3CXC A;  1WGS A;  2DXC A;  4N0A A;  3QKJ A;  5CKE A;  3C4S A;  2D0Q B;  3ZFJ A;  1WNL A;  1WJQ A;  4OB2 B;  4XU1 A;  1BI3 A;  2ZPF B;  2F5K A;  2QI2 A;  5J26 A;  4PJO B;  1XQH A;  2LTO A;  2VV5 A;  2XK0 A;  4M77 G;  1N9R A;  5LJ3 f;  1FWZ A;  3UWN A;  1YIT T;  1X01 A;  4B9W A;  5IAY A;  2VXF A;  4IUV A;  1VQ6 T;  2BIV A;  3SWN B;  4ATO A;  3OYD A;  2FB7 A;  2WSF E;  2Y90 A;  4J5Y A;  4TVR A;  4DOV A;  1N6A A;  2LVM A;  1N27 A;  1H64 1;  5D6W A;  4OGE A;  4OB0 B;  2R5M A;  3DKM A;  2V8K A;  3F70 A;  2KMT A;  3PNW C;  1N8R U;  4BE1 A;  1YJW T;  3CD6 T;  3J7A F;  3P8D A;  4C8Q E;  3GPL A;  2QEX A;  4JRP A;  1Y7X A;  3A8L B;  4MML A;  1Q86 U;  1Q82 C;  3G71 A;  4LDX A;  4AKG A;  4C92 E;  1NE8 A;  5KH6 A;  4C92 B;  3OYI A;  1VQ4 T;  1VQ5 T;  3A8M B;  4ZGD B;  1LNX A;  1M1G A;  5LJ3 g;  3OY9 A;  1YIJ T;  2QQA A;  3PMT A;  1YI2 T;  2GQV A;  4C92 F;  3QYE A;  3M56 A;  2CKK A;  3GNG A;  2DEQ A;  2YLC A;  1R8O B;  5LJ5 h;  3R6O A;  2KQW A;  3ZBD A;  4MZP A;  3P8H A;  4BE0 A;  5AYF A;  3OYJ A;  1I4K 1;  3VYH B;  2E65 A;  4M77 F;  4AI6 A;  5GAO n;  3DB3 A;  4CRI A;  5I21 A;  3CME A;  4PJO G;  4OB3 B;  2IVW A;  5GAO p;  4M7D C;  4M77 B;  3S3O A;  2DD5 A;  2XDB A;  2JN0 A;  3QO3 A;  3EFS A;  2EFI A;  1XTD A;  4LDW A;  4KT0 E;  5A2Q E;  5FU6 B;  3JCM h;  1M8V A;  3LH0 A;  3M57 A;  4C5E A;  2LCC A;  2M9U A;  3RUX A;  1VQ5 A;  2L3R A;  1G5V A;  2R57 A;  1FX7 A;  2LX9 A;  1YJ9 A;  4XTY A;  3HO8 A;  1M4Z A;  3PT9 A;  2P0K A;  3QYB A;  2RJC A;  4XQ3 A;  1VQL T;  1ZQ1 A;  3OMC A;  4M7D A;  3NFC A;  2CZ6 B;  4IUP A;  4PNO A;  3VYG A;  3CCU T;  2RB6 A;  3LGF A;  2HAX A;  1BI0 A;  1O75 A;  4R56 A;  1WPY A;  4M6V A;  4C8Q B;  5A0L A;  3S3N A;  1UGQ B;  3TW6 A;  5GMK h;  4FT2 A;  4C5I A;  2K57 A;  2MWP A;  2ZGW A;  4FU6 A;  1VQ9 A;  3UT1 A;  5GAO r;  2RO0 A;  4LDV A;  3RES A;  3KXT A;  2RI5 A;  2L89 A;  1D3B B;  3OYB A;  3HL8 A;  1U8R A;  2HBP A;  4M78 B;  3A8G B;  4QW2 A;  3RMQ A;  1UB4 A;  5EJC A;  3ME9 A;  4PJO D;  1QW1 A;  2BS4 A;  2KK4 A;  3HRT A;  4OP0 A;  4M78 F;  4M77 A;  4Q5W A;  4MFE A;  5GAN 5;  3V8L A;  2EJ9 A;  5HKC A;  2XG8 D;  4LD9 K;  1Q7Y C;  4HNV A;  2M0O A;  3VKG A;  2K3Y A;  3H8Z A;  3ZEH A;  4M7A C;  1KC8 C;  3QUI A;  3JCM d;  1VQ8 T;  1YHQ A;  5FU7 B;  4JS5 A;  2KY9 A;  3JCM P;  2HD0 A;  1FKM A;  3DLL A;  3MP6 A;  4L59 A;  3PGG A;  4ZTF A;  2PUO B;  3FLG A;  4RCC A;  4PKC C;  1VQK T;  3BW1 A;  1VQK A;  2CYZ B;  3QDR B;  4M7D B;  4RKU E;  4M77 C;  2DTH A;  3MO8 A;  3OA6 A;  1KD1 C;  2RJD A;  3G4S A;  3I56 A;  3CXC S;  5LJ5 d;  2KMG A;  1VQO A;  1VQ8 A;  2DXT A;  3OYN A;  1M1K U;  4FM4 B;  2AHJ B;  3NTH A;  4E7J A;  4BDY A;  2WAC A;  4GY5 A;  2DAQ A;  3LLR A;  1G3T A;  4C0Z A;  5GMK m;  1KQS A;  4M75 D;  3S3M A;  1D3B A;  3HRU A;  2VUB A;  4M77 E;  5CAI A;  1JJ2 A;  5D6Y A;  1Y96 B;  4JUV A;  2X4J A;  4HKE A;  4MMK A;  3SD4 A;  4EMK C;  1WJR A;  4QVC A;  5KE2 A;  4E7I A;  3HHT B;  4JRK A;  4C8Q D;  3VUB A;  2JTF A;  3GF5 A;  4IUR A;  3PIP A;  4BBR M;  1G3Y A;  3QJ6 A;  4QQG A;  3OYG A;  4WF2 A;  2EAY A;  1ZHI A;  1Y71 A;  2JUF A;  3CCU A;  3BG9 A;  4BDZ A;  4J7F A;  4A4H A;  5M9O A;  4EDU A;  3WVE B;  1MGQ A;  3V7C A;  5FRO A;  2DD4 B;  2ZPB B;  1LJO A;  3CEY A;  4II1 A;  5GAO m;  1BIA A;  3HKS A;  2D9T A;  4F7U B;  3CCS T;  3JB9 G;  3BY7 A;  3VKI A;  4P5N A;  3I55 A;  2F69 A;  4F7U F;  2BUD A;  2X4X A;  4NL3 A;  5CQX A;  1X75 C;  5GAN g;  3JB9 H;  1K8A U;  1JB0 E;  4KUL A;  2LDM A;  2ZZD A;  3CBO A;  4YTL A;  2QQB A;  3I55 T;  1E7P A;  4M75 B;  1K73 U;  1QVG S;  4KUD K;  5FU6 C;  2VXE A;  5HY6 A;  2EQK A;  1OI1 A;  3HFO A;  1VUB A;  4M75 F;  3JCM J;  3L1A A;  1BI2 A;  2EWN A;  3GOX A;  5GAN j;  4LOC A;  3JCM c;  2M1H A;  3VKH A;  2RH2 A;  4NL2 A;  3J81 E;  4QQ6 A;  4XU2 A;  1BKB A;  4ELY C;  1VQM T;  1OZ3 A;  4DQ2 A;  5GAN d;  4FSX A;  3CCL T;  2YHT A;  3CCJ T;  4BE2 A;  4PLL A;  4J8O A;  4A4G A;  4LD6 A;  4R55 A;  3JB9 D;  2DVE A;  2R5A A;  3FB9 A;  2RK2 A;  3A8O B;  5DM7 R;  2F5T X;  1K73 C;  4C0G A;  2DZC A;  5FRN A;  1U1T A;  1IRE B;  2DD4 A;  3MHX A;  3SFM A;  1KHC A;  3CD6 A;  4KBM B;  2O4X A;  3CCM A;  3JCM W;  2DIG A;  2KDS A;  3PFS A;  2DTO A;  2EQJ A;  3OYF A;  4JX4 A;  3QJY A;  4QQD A;  2EQU A;  2ZZD B;  4BUG A;  5GAN e;  4M75 A;  1VQ6 A;  1YCY A;  3G4S T;  2JOY A;  2DD5 B;  2E5Q A;  2NLU A;  2PVO B;  4ZN3 A;  1YIT A;  5CKB A;  4JLI A;  2JZ2 A;  3V7S A;  4Z02 A;  1H3Z A;  1JRI A;  1M9S A;  1XOV A;  1N9S A;  2X4W A;  4XAX B;  1OZ2 A;  2XID A;  4CI0 C;  4A4E A;  5KE3 A;  1I81 A;  5GAN 2;  3OYK A;  1G3S A;  2RD1 A;  3CBP A;  3QII A;  4RCB A;  4EMH A;  2QQ9 A;  2CGH A;  5LJ5 g;  2OTL A;  3HBL A;  1QVG A;  5IT9 E;  3M54 A;  1VQN A;  2XD0 A;  3SB2 A;  1BI1 A;  2RI2 A;  3FJP A;  4J83 A;  3GP8 A;  3VYG B;  4NC6 A;  2FVU A;  3M9Q A;  5LJ3 h;  3PTA A;  2G3R A;  2H3J A;  3M53 A;  5LJ5 j;  3JCM b;  3G7Z A;  3PMI A;  4RMO A;  3M59 A;  1VIE A;  2LRQ A;  3FDR A;  5I2S A;  1QLB A;  2V8J A;  3JRZ A;  3UDC A;  3L2U A;  1Y07 A;  5HK0 A;  4JS4 A;  3MET A;  2RJE A;  3E9F A;  2ZCF B;  4BAC A;  2O4X B;  2MWO A;  5CIU A;  1RI0 A;  1RL2 A;  3A8H B;  5GMK i;  4BD3 A;  2ZPE B;  5J39 A;  5CKH A;  3MEA A;  1FXX A;  1VQ9 T;  2O01 E;  2QQ8 A;  2PU9 B;  3DL1 A;  2L5Q A;  4FT4 A;  4X34 A;  4E7L A;  2P0P A;  5GMK l;  2HNI A;  5CKF A;  3TRE A;  5GAM d;  2XIC A;  3CCM T;  4ZTJ A;  3QZ5 B;  1NJI U;  3E19 A;  2GFU A;  3MP1 A;  3OS1 A;  5DLQ E;  3UPU A;  3JCM Q;  3OYC A;  2CZ7 B;  4AKI A;  5CKD A;  3QHS A;  3WVD B;  5FU7 C;  1Q82 U;  4M7A F;  1YJ9 T;  2KVQ G;  4E47 A;  1Q7Y U;  3BG5 A;  4M7A A;  4C8Q C;  3X20 B;  4BY6 B;  4IKF A;  3ER0 A;  3OYH A;  2RHU A;  1HXD A;  4HNU A;  2GFA A;  3MP8 A;  2E1H A;  3CCV T;  3L2W A;  4OF1 A;  2RHY A;  5GAM f;  2LC4 A;  1U1S A;  3FEO A;  4C92 C;  4QVZ A;  3OYY A;  4L5G A;  3T9N A;  4HL4 A;  3TU4 K;  1VQ7 T;  2C06 A;  2OTJ T;  2JVV A;  3C95 A;  3GLX A;  3JCM f;  2XDP A;  4Y28 E;  2DXB B;  1UGR B;  3KUF A;  5GMK e;  4PJO F;  4IUU A;  3BDL A;  2GF7 A;  3LGL A;  4C0F A;  4BI8 B;  4E7K A;  1KC8 U;  3VJP A;  2FL7 A;  3GNF B;  1M1K C;  5CK9 A;  4M7D E;  4C92 D;  3X24 B;  4M77 D;  1WQ7 A;  3RIR A;  1YIJ A;  2QF7 A;  5GAM h;  5GAO q;  3JAM E;  3N5B B;  4XU0 A;  5GAM e;  4M78 C;  3LW5 E;  4N0A C;  3OS2 A;  3CCS A;  4C5H A;  4VUB A;  2DZ9 A;  3CC2 T;  1W4S A;  3V8K A;  1YJW A;  1KQS S;  4JX5 A;  1VQP A;  2E12 A;  2RHX A;  4M7A B;  4HA8 A;  4M7A D;  4L6V 5;  3L2R A;  1YJN A;  4EPC A;  3CC2 A;  4HLQ A;  1JJ2 S;  1Q86 C;  3V7R A;  4EMG A;  2DIQ A;  1Q81 U;  5LL6 S;  4XTU A;  4PL6 A;  4DA4 A;  4F7U A;  1HK9 A;  3QXE B;  3JB9 I;  1M90 C;  2QDY B;  2DTI A;  4NS5 A;  2DPP B;  2KSS A;  3MEW A;  3QBY A;  3VV0 A;  2DXB A;  5LJ3 j;  5I2M A;  2OAU A;  3NTK A;  4HCC A;  1M90 U;  2PVD B;  3OYM A;  2K5L A;  1DJ7 B;  2DO3 A;  2VGN A;  3RKX A;  4C0D B;  3CCR T;  4Y91 A;  1K8A C;  1W2B A;  2OTJ A;  1M5Q 1;  2WJ9 A;  2P4T A;  4D6W A;  3JCM e;  2E6N A;  1PSE A;  2QXF A;  5LJ5 f;  4DOW A;  3QG1 A;  3I56 T;  2VYT A;  2M16 A;  2EIF A;  2A3L A;  2CZ1 B;  2RA2 A;  3QPH A;  3RER A;  3QZ9 B;  1X6O A;  2EYQ A;  1UGP B;  2VGM A;  4N4G A;  4M75 G;  4ZGE B;  3MEU A;  4OB1 B;  5LJ5 e;  4IUT A;  3E1S A;  3LWI A;  1LOJ A;  1KD1 U;  3SWN C;  3JB9 J;  4C8Q F;  1ZBX A;  2CS7 A;  5C6S A;  3CCQ A;  3JCM X;  1QVF A;  2EQM A;  3LX7 A;  3MEV A;  2E41 A;  3LWH A;  2QA4 T;  3H4C A;  3URG A;  5L8R E;  2RHZ A;  2DXC B;  2QTX A;  5CVI A;  2YRV A;  4FIB A;  3MCA B;  4JLG A;  4ME7 A;  2EKO A;  3DB4 A;  3SDZ A;  1UGS B;  2B8A A;  3M4Y A;  3KBG A;  3OSS C;  4M78 D;  5D6X A;  5FLX E;  4MIM A;  3OW2 A;  3G6E T;  2K5I A;  2RI3 A;  3HPW A;  1W2B S;  3SWN A;  4JDS A;  3FC3 A;  2BS3 A;  3BG3 A;  1NZ9 A;  3FIF A;  2RHI A;  4M75 C;  4PLI A;  3RKY A;  5GAM j;  2MI6 A;  4C92 G;  3EAE A;  3HZJ A;  3FRN A;  2DKG A;  4FL6 A;  3OYL A;  2XI9 A;  3CC4 T;  3CC7 A;  3AHU A;  3LYI A;  5FRM A;  1VQN T;  3TW7 A;  4ELJ A;  2LQ8 A;  2X35 A;  1O9S A;  4MZT A;  3L2Z A;  2D6F A;  4ZN1 A;  4N4H A;  3X26 B;  2Y4Y A;  3CMA T;  3C12 A;  2E10 A;  4HCZ A;  2PVG B;  2LCL A;  2BKD N;  2LT1 A;  2V8I A;  3E9G A;  4C92 A;  5HK3 A;  3OYA A;  3NTI A;  3CCE T;  4V2S A;  3OS0 A;  2MF2 A;  4PJO E;  4M78 E;  1B34 A;  2IG0 A;  4HT9 A;  3QWL A;  3QYG B;  3L42 A;  3L2V A;  1OYX A;  5A0G A;  3GIB A;  2XHC A;  4J6X A;  4KUI A;  5GMK j;  4M78 G;  2XU8 A;  2JTM A;  5DY9 A;  4BI3 A;  3BDU A;  2L8D A;  2RM4 A;  5A0D A;  3L2Q A;  3CCR A;  3CME T;  4EMK B;  4MZM A;  2E70 A;  2CZ0 B;  4AKH A;  2E64 A;  1G3W A;  3TCJ A;  4JRI A;  1VIF A;  3VUZ A;  5C0M A;  3RMS A;  2HQX A;  3CPW A;  1S72 A;  3QYH B;  5GAO l;  4M7D G;  2QQR A;  2K2V A;  2MMP A;  4XTX A;  4C8Q G;  1YI2 A;  3BFM A;  4XTZ A;  1KG1 A;  3OSV A;  3ASK A;  3JSC A;  1NJI C;  3JCM V;  1TH7 A;  5GAN 7;  1VQ4 A;  1K9M C;  2X4Y A;  3G71 T;  4QSH A;  3CCJ A;  3CCL A;  2A7Y A;  1MHN A;  2LT4 A;  2QEX T;  1NPP A;  3HFN A;  2RK1 A;  4UC4 A;  5KCO A;  4X9D A;  1YJN T;  2PQW A;  3M58 A;  4C8Q A;  1VQM A;  1S72 T;  1K9M U;  2QQS A;  2RJF A;  4QVD A;  4JRQ A;  1VQP T;  3QSU A;  1V29 B;  5KCH A;  1QP3 A;  2ZPG B;  1B34 B;  2PUK B;  3V8J A;  4E7H A;  1PSF A;  1Q81 C;  4M7D F;  1M1F A;  2LNV A;  4RG2 A;  5LJ3 e;  2E6Z A;  2VC8 A;  3S6W A;  4N4I A;  3EFR A;  3OYE A;  2DXU A;  1QP2 A;  4M78 A;  5LJ3 d;  3PIO A;  3A5Z B;  1GXI E;  3OMG A;  5EG2 A;  4B9X A;  2I2L A;  4A54 A;  4EMK A;  5GAN 4;  3CCE A;  4BBS M;  4M7D D;  4IUQ A;  1JBM A;  5CCA A;  3CMA A;  5GAN 6;  3RKW A;  1IZ6 A;  4XTW A;  3C94 A;  3O8V A;  4JJN K;  1KQ2 A;  2GCX A;  2BS2 A;  3HRS A;  1VQ7 A;  2HQE A;  3HB9 A;  2K3X A;  2QDJ A;  4HCB A;  3TEE A;  3CC7 T;  4BI4 A;  4F7U E;  1I5L A;  3CC4 A;  3CPF A;  4XU3 A;  2G77 A;  4A53 A;  3CPW S;  3CCV A;  1KQ1 A;  1BYM A;  4JX6 A;  4J6Y A;  2XDD A;  2MAM A;  5CQY A;  2DJZ A;  2QFZ A;  1N8R C;  4HT8 A;  3OB9 A;  3OS5 A;  4O6J A;  4J6W A;  3J80 E;  1QVF S;  4M75 E;  3G6E A;  4PJO C;  5GAN f;  3HP9 A;  3X28 B;  1VQL A;  3X25 B;  1P92 A;  1UEB A;  2DK3 A;  3H6Z A;  1BIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...