3X28B

Crystal structure of nitrile hydratase mutant br56k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Reaction intermediate of nitrile hydratase determined by time-resolved crystallography reveals the cysteine-sulfenic acid ligand to be a catalytic nucleophile
rcsb
source organism Rhodococcus erythropolis
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x28B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x28B02
5L8RE 1AHJB 2WSCE 3WVDB 2WSEE 4RKUE 3X25B 2DPPB 2PUOB 1JB0E 2D0QB 2CZ1B 4OB3B 2DXBA 2O01E 2ZPGB 1PSEA 2PUKB 1V29B 4ZGDB 3X20B 2DXCA 2DD4A 3X24B 1DJ7B 1UGQB 2DXBB 2CZ6B 3A8OB 2CZ0B 2AHJB 1UGPB 3QZ5B 3A8MB 4ZGEB 2ZPIB 3VYGA 2DXCB 2ZZDA 1QP3A 3A8LB 2CZ7B 2DD4B 1QP2A 3QZ9B 2WSFE 3A8HB 4OB1B 4KT0E 3VYHB 1UGRB 4XK8E 3VYGB 2QDYB 2ZZDB 4OB2B 3X26B 2DD5A 3A8GB 3QYGB 3LW5E 1IREB 2ZPEB 2ZPHB 1GXIE 4L6V5 2PVGB 2PU9B 3WVEB 2DD5B 2CYZB 3QYHB 2ZCFB 2ZPBB 4FM4B 4ZGJB 4OB0B 2PVOB 1PSFA 4Y28E 3HHTB 2PVDB 1UGSB 3X28B 2ZPFB 3QXEB
chains in the Genus database with same CATH superfamily
4EMKB 3MEVA 2V26A 3N5BB 1IHVA 3QJ6A 4JRPA 5IT9E 4CXAB 4HT9A 3X25B 5CCAA 4EOLB 4AFQC 3RMQA 3OYDA 2LJ1A 3VS5A 2DILA 5GAMg 1N9SA 3CMAT 3CC7A 4RTUA 3CCRQ 1HK9A 2RN8A 1D1BA 1G2BA 1YJWT 2OJ2A 3HTRA 1TFBA 1M3BA 2LMJA 3MI9B 4O5VA 1N27A 4NS5A 1ZBJA 3OYYA 1WLPB 3QHSA 1ZBXA 2CZ6B 1UNLD 4ELLA 2CP7A 2A28A 1WQWA 2QQRA 2PK2A 3LYIA 5LJ3d 3I56A 5BNJB 1FX7A 1AT1B 4M75C 2KYMA 4FIBA 4ZN3A 2RI5A 1YNZA 3META 2LJ3A 2K79A 2JZ2A 5DLOA 4LNPA 3CCJQ 5HKCA 2EYXA 4AMCA 2OTJQ 3NGPA 3QYEA 3CPFA 4M77E 2NUZA 2E10A 3OBWA 4GLMA 4MZMA 3BLHB 4J6WA 1PNJA 3OQ5A 4XQ3A 4OB2B 3PMIA 2OTLQ 4YTLA 3FJ5A 1KD1U 3EGXB 3A8GB 2M0OA 1N9RA 3FEOA 5CYIB 1WA7A 3CD6A 4D8KA 2LQNA 2GTOA 2O88A 5IDNB 4BCQB 2Y4YA 3EGUA 3H0HA 1W2BA 4LDVA 5IHNA 2EYWA 2K7AA 2KROA 2G9XB 2IW9B 2W96A 1VQ5T 2CH4A 2LJ0A 5J26A 2JMAA 2RQUA 1M90U 5CEIB 3HHTB 2F69A 1YJ9Q 1OV3A 2YRCA 3PFSA 2O2OA 2E5QA 2UZLB 1TXQA 4NOYA 4C5EA 5CO7A 2YXYA 5IHKA 5ICPB 4IUTA 3M5AA 1M1FA 3JB9H 3FIFA 3GNFB 2RHIA 2GF7A 2C5NB 3K7AM 2HSPA 3CPWS 1BU1A 3CCVQ 4IUVA 5CKDA 2DPPB 3E9GA 1IO6A 2J6FA 1TD6A 2LX7A 1O9SA 1VQ9Q 3G33B 3M57A 2KQWA 3BLRB 1ZSZC 1K73R 1VOLA 2I0NA 2RNAA 1PG5B 2DVEA 3QWXX 1KIKA 4HCZA 2RQWA 2RPNA 4OGEA 2K3BA 1E9HB 3LWHA 2WFYB 1I0CA 4BE1A 4HCCA 3X24B 1SEMA 1K9MC 1HJDA 3J80E 1G3YA 3J81E 3OYNA 4KH1B 1YITA 2E6ZA 4BCMD 1VQ7Q 2O9VA 2X35A 1FMVA 5M9OA 1N8RR 3SDZA 4C5GA 2DXCB 2RD1A 2LNVA 2MOXA 1LOJA 2MPXC 5AYFA 5FROA 3RESA 1UNGD 1VQPQ 4M7AE 1RI9A 5GANg 3CBMA 3ASKA 3B57A 1JKWA 3QDRB 3NHNA 1QVGA 2GBQA 4JZ4A 2J06A 2FYKA 5GAOl 4J9CA 4IMYB 1WHKA 2HL3A 1K9AA 3H8ZA 1UGRB 4E7HA 4HKEA 4J6YA 1FVVB 1D09B 3GNGA 3JCMg 3MCAB 1SSFA 1WHJA 1WHLA 1Z9ZA 1K9MR 1UE9A 1YIJQ 5D6XA 3CCET 1TU0B 2DERA 3PMTA 4M4ZA 3L2RA 2JJ9A 2EKOA 2Y90A 1TS9A 4FU6A 5GAN7 1GXIE 5FGKB 4L6V5 2PVGB 4NL3A 3BE3A 3UA7A 1GBRA 2LCLA 5LJ5h 1AZEA 2CYZB 2EGEA 4C92A 3QJYA 2W99A 4M7DA 1U1SA 4X9DA 1KQSP 2RK2A 1KQ1A 3I55A 2KT8A 4JJBA 4NSTB 2GGRA 1XO2A 5FLXE 4B9WA 4I3ZB 1OZ2A 3THKA 1W4SA 2DYIA 2QTXA 2CP5A 1TUDA 2DEQA 3M0TA 4ROCA 3C12A 2QEXA 1RACB 2EIFA 2FVUA 2WSCE 2RJEA 4OP0A 4BCFB 1M3AA 2PUOB 2JTEA 2HBWA 5EFQB 2VYTA 2WPAB 2CZ1B 2XIDA 4Y91A 4B6MA 1M8VA 1VQ4Q 4F70B 1H8KA 1U06A 2KY9A 3OS1A 4ROEA 1VQLQ 4EMKC 1W6XA 2HQHA 8ATCB 1Q7YR 2K3XA 5HK0A 4R55A 1RABB 1UGVA 3VRYA 4A53A 2CH4W 5LJ3h 1JOWA 1R8OB 4LDXA 1IZ6A 1MUZA 2AHJB 2QQAA 2YT6A 4LDWA 3S3MA 2RO0A 3T9NA 1NJIR 1KFZA 2IPOB 2C5VB 1H24B 2V8KA 2NUTA 4FYYB 4EOPB 2DXTA 1QCFA 4IUQA 5IDPB 4JX4A 4XAXB 1BI3A 3CCRA 2J6KA 3Q1JA 4MDWA 2WACA 3V7CA 1A0NB 1AWJA 4C92D 4M7DD 3I9QA 4N0AC 3OB9A 2KYBA 2DX1A 3I35A 3LQ5B 1YFNA 5EJCA 2Z0WA 2YRVA 4E47A 1AD6A 1MV0B 2EQUA 3OA6A 4ANJA 2XKOC 2DEUA 4FT2A 3M4GA 2K5FA 3OW2A 3MPUB 2DMEA 1QMZB 2QDJA 3GBQA 3TNWB 1BI0A 4CFWB 3EGDA 5IHIA 1E7OA 3KFVA 1QVPA 4EOOB 3OW2P 1I5LA 3L2WA 2QXFA 2X3WD 3PE0A 4RTWA 3EHQA 4M78E 4OMLA 3BHTB 2R5AA 2K5IA 4FW2A 3QSUA 4JDSA 1MGQA 3JRZA 4KGZB 1H25B 4PLLA 3GOXA 5L2WB 2COZA 5GAN3 5GAMd 1OIYB 2RQRA 3LGLA 4FYVB 4MMKA 4F7JB 1B34B 3M0QA 1WIEA 4M7AD 2R57A 1GCQC 3JV3A 1SHGA 3PTAA 2PTKA 4KGVB 5HK3A 4C92G 4M7DG 3BDLA 3RMSA 2L8DA 4AI6A 1JB0E 1X2QA 2AIRB 3EOCB 3JAME 4BY7X 1H1QB 3WXMB 2RF0A 1YJ9A 3CC7Q 1K1ZA 2O9SA 3VU3C 4GY5A 4DOWA 4BCOB 1X6OA 4R56A 3BG5A 1H26B 1RL2A 2KI7A 4MZPA 3H6ZA 4GLKA 2EQMA 1YI2A 4FT4A 2CCIB 2HQXA 2DXBB 2CKKA 3MP8A 2DRKA 1SRMA 4XU3A 5KYNA 4RTTA 3CCQQ 2JXBA 1AOJA 2DTHA 1VQ9A 1QWEA 3OMGA 4RTZA 1QVFP 3VV0A 1KQ2A 1Y96A 2CZ7B 4BCKB 2BTTA 4M7AG 2M02A 3HFNA 3G4ST 4FL6A 2UUEB 2VXFA 1WDXA 1XOVA 4OMPA 1WQ7A 4LUEA 2QASA 5CAIA 2DJQA 5KCOA 1CSKA 2ZZDB 2HAXA 1KHCA 1QMCA 4PFOA 4XTZA 3UT1A 5KYWA 1N8RU 1M4ZA 3BHUB 3EHRA 3G71T 3REAB 1KD1R 5C0MA 3VS2A 4JZ3A 3HRTA 8AT1B 1ABQA 4M7DB 2F1LA 4OMOA 1MMGA 1VQPA 4EOJB 5KE3A 2CDTA 2IW8B 3MO8A 3L1AA 2MIOA 1BYMA 2HQEA 5DM7R 5A2QE 3OYLA 2E70A 3TNHB 2YUQA 2JT4A 1KHIA 1K9MU 2CP0A 3CCMQ 2XDDA 1OOTA 2LX9A 4JX6A 2KNBB 2J05A 5L8RE 1O9KA 1HD3A 4FW1A 5D6YA 2IVWA 4C5IA 1JJ2S 1BCMA 3G1JA 4EONB 1OYXA 2WMBB 5GJWB 2W2HA 2PMIB 1X2KA 3AHUA 2OTJT 2B8AA 4F7UE 4OR5B 2DE0X 1X69A 2V1QA 4WCIA 2BUDA 2KRNA 3TU4K 1Y0MA 2O01E 3H0FA 3S6WA 2OTLT 1UDLA 2CGHA 4C0GA 4CC4B 2WEVB 1YWOA 3HBLA 2DBMA 1S72Q 4F6SB 2I40B 5GANd 5DLQE 4LXCA 1Y57A 2HNIA 2X4JA 3HP9A 3REBB 3CMEA 3EG9B 1OU8A 2OI3A 2DD4A 1D0ZA 5GMKh 1T3LA 1UGQB 4C0FA 2QGSA 2NUTB 2L3RA 2EKHA 1EZZB 2JS0A 3CEYA 3JCMd 4IURA 4F04B 4PJOA 4KRCB 2DKGA 1YBYA 1VQ4A 1BK2A 2LCCA 1QCOA 4BUGA 1E7PA 3C4SA 1AWOA 1Z9QA 4WTOB 1VQLA 2VXEA 2UZEB 3QHWB 3QYBA 1FXXA 2IW6B 1U3OA 1WX6A 2XG8D 4J9EA 1PKDB 4CRLB 2QYZA 4EPCA 5HCKA 4HNUA 1NJIU 1JEGA 3OYFA 3G6ET 3KHIA 1VQ8T 3EGDB 3H4CA 4PJLA 1UUEA 3RR6A 3LW5E 1IREB 1HSQA 2EJFA 1SKUB 2C0TA 3SD4A 1G5VA 2CREA 4JS4A 2W9ZA 3NPFA 3D7SB 5GAN4 3OYEA 1QKWA 3TW7A 4AT1B 4EDUA 5GAN8 2DYBA 5GAMh 2EJ9A 1IGUA 4IIOA 1V76A 4J83A 4KBMB 3CC4A 4Z88A 2P0KA 3AT1B 1JO8A 2KVQG 3SFMA 2KEAA 2L0AA 2PK9B 1RAGB 4RCBA 5DQVA 1MNDA 2DL8A 5CQXA 3CPWP 2RQTA 1TUGB 2LTOA 1UNHD 1ENWA 1LJOA 5J39A 2VKNA 2P84A 1VQKQ 1PD0A 4HCBA 2Y4XA 3LH5A 1Y7XA 4QW2A 4HCKA 2BPMB 2GCXA 2DK3A 2E4HA 4PJOD 4M6VA 1ZUUA 2G3RA 1Q86C 1YIJT 2EFIA 1OPKA 4XU1A 2YSQA 3M55A 3RKXA 4O6JA 1NYGA 2RHXA 2SRCA 3TN8B 3E9FA 2B9RA 2W0ZA 1X6BA 1RLPC 1S1NA 3V8KA 5LL6S 3BLQB 3E1SA 4RG8A 4CFUD 1MMDA 1GFDA 2KSSA 2BZXA 4FSSA 1M1KR 3CXCA 4BDZA 1OX9A 1SF9A 5KH6A 1MMAA 3ZBDA 4LOCA 1BI1A 4C92F 3A8MB 3OYJA 3VYGA 5LJ5f 4M7DF 1OKVB 1LVKA 1WHMA 4LDYA 3CXCP 3MP6A 5KCHA 1OQKA 3OS0A 4ZTFA 1UB4A 2MK5A 5CK9A 1U5SA 3OYGA 5GMKm 1VIFA 2QF7A 1FMWA 3QUIA 1YJNQ 2L3PA 1VYTA 2R7GA 4PK4A 3PIOA 2BKZB 2YLCA 1VA7A 4PJOG 1H92A 3HB9A 3CCQA 1VINA 4BACA 2L3SA 3M0UA 3QYGB 2DFUA 3DJBA 2H3EB 4II5B 1FMKA 2QQSA 2R5MA 2GQVA 4C8QA 2IIMA 3VRZA 3TEEA 5AT1B 3OYCA 3V8LA 2JTFA 1ABOA 2LW4A 4EOQB 2PVOB 1I1JA 1O9KB 2E6NA 2K2MA 2P4TA 5DQWA 3OYAA 1NPPA 4CC2A 4E2FB 2ROTA 1XJWB 2KBTA 5LJ3f 3PGGA 5I22A 4BCND 4M7DC 4LDUA 2H3JA 2WSEE 3RKWA 2DETA 4X1VA 4KUDK 1NEBA 2D6FA 4YOSA 2X4WA 3JCMP 4F7UG 1UTIA 1OIUB 1OULA 2AKLA 3CCMA 5GANh 1H4LD 2JUFA 3OYIA 4BB7A 2L3QA 3CC2Q 4OMQA 1YWPA 2YUPA 1YCYA 1R0BG 4M75E 1H1SB 1OGUB 1WJRA 5GAOn 2DF6A 1YI2Q 1VQNT 1B3QA 1WHHA 2OAWA 3JCMh 2DL3A 2NLUA 3TSWA 1DJ7B 2SEMA 2IG0A 3I5SA 2EVRA 4E7LA 3QO3A 4AKGA 4J7FA 1GY3B 1Q81C 3RGFB 3EIDB 2K2VA 4PJMA 2EJGA 2DBKA 3M56A 1QP3A 1JSUB 3QHRB 4F7LB 4CFUB 2PQWA 1S72A 2BZYA 4C8QD 1YHQQ 1NLPC 5KYUB 4BCHB 2X4YA 4A54A 4F14A 3VYHB 5C6SA 3HZJA 4M77A 2LVMA 2E64A 1T3SA 3E2UA 2QDYB 2JTMA 4QT7A 1BU2A 2DD5A 1M9SA 1MNEA 1HYOA 2WMAB 3CC7T 3NDQA 2KR3A 1W1FA 2EWNA 5FW9A 4QQDA 4OMNA 4OMFB 1CKBA 4XTWA 4TTHA 5HBHB 2CSQA 2BS2A 1VQMQ 4MIMA 3S3OA 4OVAA 4EOIB 3OS2A 1C6VX 2C5XB 3CBOA 3CCSQ 3X28B 2D9TA 1VYVA 3I56T 4BY1X 4PFZA 2OX7A 4C8QG 3CCLA 3LX7A 3U23A 1KQSA 3C94A 4IIMA 4AG2C 4BY6B 4BBRM 3VS0A 1U8RA 3QPHA 1ZP2A 3RDVA 3A5ZB 2D0NA 1N5ZA 1F1BB 4R0KA 3UDCA 2A7YA 2LQKA 1UEBA 2KMGA 1J3TA 3C0CA 4LUDA 1M2VA 1NEGA 1PKTA 3CD6T 1B07A 5GMKl 1V29B 2E41A 3QBYA 4ZGDB 2FZGB 1C1AA 5CKFA 3CMEQ 2QAZA 4HXJA 1NPRA 2A0FB 2O31A 5I5ZB 4BBSM 1QQJA 3BDUA 2X1NB 2EYYA 2FZCB 4M77D 4E7KA 1VQKA 2QA4A 3C95A 2CZ0B 1M5Q1 1PRMC 5CKBA 3CCUT 3EAEA 4A4GA 2HZYA 3EG2A 1YJWQ 3M0PA 4M7AA 2WSFE 5GAOr 4OB1B 3MP1A 3EFOA 4RMOA 2YWWA 5LQFB 4LD6A 4OGRB 4KT0E 3OSVA 3DB4A 1M1KU 2XICA 4KH0B 4PL6A 3RERA 1W2BS 5KYXA 2BKDN 3OYKA 2LC4A 2B86A 3OYMA 4C8QB 2JN0A 4HL4A 3DLLA 1Q86U 1ZSZA 2DL7A 1FINB 5I2SA 5A0GA 2ZPHB 1BIBA 2YRDA 4J5YA 3MKDA 3OMCA 4BCMB 3LWIA 9ATCB 1EIFA 4QKUA 3WVEB 3SB2A 3INZA 2RMOA 2KE9A 1LPLA 4J9BA 4EOKB 1NE8A 3GLXA 4M77G 3OYBA 1BKBA 4JPBW 3CC4Q 2BE9B 1YJNA 1YITT 5IF1B 3ZFJA 4F6WB 4DEYA 1ACMB 1VIEA 3S3NA 3HRSA 1VQ6A 4PJOF 2DZCA 3JCMc 1VQ5Q 1G3TA 4CFVB 1B7TA 4JUVA 5CIUA 3FLGA 1K0SA 1KG1A 1WXBA 4CRIA 2O4XA 1ZUYA 2KXDA 4E7ZA 3VKIA 5FU6B 2PUKB 5IXFA 2M0YA 3M54A 2CP3A 2FG0A 1K76A 2ZAEA 1ZUKA 2QK0A 3PT9A 1BBZA 4EMGA 2PHGA 2X3XD 1QVGS 3A8OB 3I55T 2LRQA 2JNGA 3VS1A 3JB9D 3CC2A 4M77B 4BI4A 1LCKA 5GAMf 1H1RB 1V1CA 3URGA 2I2LA 1NBEB 5FRNA 2QEXT 5GJVB 2RJFA 3JCMJ 3A1PA 4VUBA 2DIGA 4OF1A 1QVFA 1R0CB 4FYXB 1KQSS 1OU9A 4YOZA 5KYYA 2YUNA 5HQ0B 5HBEB 4A4FA 2JVVA 4BD3A 2W10A 2ZPEB 2MAMA 2UZBB 3SWNA 3IQLA 2FPEA 4RCCA 4EMKA 2UZDB 2EAYA 1X27A 1YHQA 3BFMA 4M78A 4DA4A 1KXUA 4A4KA 1VQ8A 1UGSB 1K0XA 1N4MA 3GF5A 1F5QB 3JB9G 2V8JA 3MEUA 1QW1A 2LT4A 4RUGA 3OY9A 1VQOA 4C92B 1ARKA 3JCMQ 1KSWA 3CCRT 1GCPA 3VJPA 4DBRA 4HNVA 1M2VB 5J3BA 4F7NB 2J7IA 4RKUE 3UWNA 3VUBA 2QDLA 1M90C 3PO3S 1VQMA 1KJWA 5I11A 4JS5A 2MYSA 4BE2A 4EOMB 3SEMA 2ZPGB 4K11A 5LMKB 5LJ5j 3CCSA 3DL1A 4L59A 2EQIA 2RA2A 1KC8C 2FZKB 2WXVB 3MY1B 3CCJT 4CFMB 3NMZC 4C8QF 4JLGA 4BY6C 5A0DA 3KBGA 4AFUC 5FU7C 1BCOA 2COYA 4M7AB 3V7SA 3EFOB 1G3NC 2CS7A 4J7IA 3NTKA 1WXTA 3CQTA 1JXMA 2K9GA 1JU5C 3DOGB 3EGXA 1JBMA 1URCB 2VGNA 5KYXB 2JOYA 2LT1A 1D3BA 3OW2S 1GCQA 3ZEHA 1AZGB 4M78D 3RUXA 4QVCA 1WFWA 3X26B 5A0LA 2FHDA 4XU2A 2RI2A 1YJ9T 1ZLMA 3ME9A 4AKIA 2J6OA 3CMAA 2MMPA 4Z89A 2MWOA 1ZHIA 5LJ3j 2XHCA 1YJWA 2M16A 3HKSA 2GFUA 3JCMV 5GANf 1M2OA 3O8VA 2L5QA 1YI2T 1M27C 4PKCC 4UC4A 3CCVT 1WJSA 4Y28E 1IHWA 4PFPA 5FWBA 2KMTA 1ZX6A 1VQ9T 3BHVB 4JX5A 4QVZA 3JCMf 4C8QC 1OKWB 3QWYA 5LJ5e 4J8OA 1D1AA 3CCLQ 1P5EB 5HBJB 1D0YA 4IKFA 2EGCA 2EYZA 3L2UA 1UJYA 2VVKA 5L23A 2XI9A 1R77A 1BIAA 4M78G 2X4XA 3ER0A 3M0SA 1SHFA 4F7UA 3OYHA 4AKHA 4M77F 2PJQA 1AISB 3CPWA 1VQ7T 3BY7A 3MY5B 1I4K1 1RAIB 1QLYA 1QVFS 1IGQA 3JB9J 4EC9B 1VQPT 1XQHA 1OPLA 2DXCA 4HVUA 2C5OB 4IUUA 2WIPB 2DRMA 4DOVA 2DL5A 1VQ5A 3V8JA 2VWFA 4BCQD 3KXTA 3P8DA 2QA4Q 3F5XB 1M30A 3BW1A 2YHTA 5HNBB 2C0IA 5IAYA 1UG1A 2FB7A 2X51A 4DQ2A 5GAOp 4WF2A 4HNTA 4ZGEB 1UFFA 4AFSC 1RAEB 2P0QA 2PZ1A 3VUZA 3OBYA 5FU6C 1I81A 1OL1B 3QZ9B 1C0MA 4F16A 4ZTJA 4DBHA 1QCNA 2CUDA 5LJ3e 4EORB 2RJDA 1U1TA 3RNJA 2QTVA 1G8XA 2VUBA 4RODA 5KYYB 4BE0A 4A63B 1W70A 2BS4A 3ZL7C 1TH7A 5EC7A 2GNCA 1H28B 5GAOm 3HO8A 1Y96B 2L2PA 3R6NA 1TWBA 3SWNB 1RAAB 5GAOq 2DMOA 3G4SQ 1AD5A 2DL4A 4II1A 5IH2A 2V8IA 2V22B 1SSHA 1I07A 2XD0A 3OSSC 4M78B 4M77C 1Q86R 3CMET 1UHFA 2XDPA 3I5RA 4RG2A 4NL2A 5KYWB 5GAN2 3MEAA 1RLQC 2ZPBB 4FM4B 4A4HA 1YP5A 2AZVA 3L2VA 2QFZA 4BDYA 4Z02A 2CT4A 2WHBB 1RI0A 3G71Q 1MMNA 2HEQA 4J9FA 1VQ6Q 1VQ4T 5ECAA 2COWA 1K8AC 3PIPA 2CT3A 4PJJA 2ED0A 3POMA 1VQLT 5EG2A 3FC3A 4DBQA 2PNIA 4M7AF 1IRXA 4J9DA 1PC0A 2D8JA 2ED1A 5CKHA 2JW4A 1QLBA 1MV3A 3SHWA 1NG2A 4HA8A 3CCEA 4KRTA 3JB9I 3UA6A 1G83A 2C0OA 2NUPA 1H641 4C92C 2OAUA 2ECZA 2EPDA 3JB9F 2G77A 1SRLA 7AT1B 1K8AR 4JRIA 1H3HA 4Q5WA 2E5KA 2HL5C 3CC4T 3QDFA 4BI3A 2LCSA 3PNWC 1D3BB 5FRMA 1VYWB 4AG1C 5IXBA 2DD4B 4HT8A 2HBPA 2ATCB 2EW3A 1NLOC 4CFXB 4G6LB 2JMCA 2M51A 1VOMA 4QVDA 3TCJA 1W2BP 4PJOB 1N6AA 1D3UB 3L2ZA 2BIVA 1GBQA 4E6RA 1K73C 4J9HA 2M1HA 4C0ZA 4EC8B 2LP5A 4F17A 3CCUA 3V7RA 2HSEB 4M7AC 3O0GD 2K3YA 5GMKj 4BCIB 3TSZA 1JQQA 2QGGA 2CCHB 5GAN5 1ZA2B 4ZN1A 3TW6A 3HPWA 4JJDA 2WJ9A 1B34A 1T0HA 2GFAA 4C92E 4ELYC 4M7DE 1KC8U 4ZGJB 1N8RC 3GP8A 3GIBA 1OL2B 3G6EQ 1UECA 1VQ8Q 4BXXX 1P92A 5HY6A 2KGTA 3BG9A 1H3ZA 5KE2A 3DTOA 2LQWA 3LLRA 3JCMb 2ZPFB 3DDPB 4QSHA 3QXEB 1GL5A 4RTVA 2DIQA 2KT1A 1VQOQ 1X01A 2KXCA 1Q81R 1ZSGA 3L2QA 4LD9K 1OX8A 4F7UB 2DVJA 2VASA 2K57A 3WVDB 4GBQA 2G6FX 4A4EA 2ZGWA 1WI7A 3GTMS 4ELZC 2JS2A 2D0QB 4CC7A 1FYNA 1LNXA 4OB3B 4EMHA 2DXBA 3TVTA 2IN3A 3CCQT 5CQYA 1PSEA 2BS3A 3H41A 4ZNXA 3PVLA 1M8MA 3LH0A 3CXCS 4ELJA 5GAMj 3R6OA 4M75A 2E1HA 3MEWA 4NC6A 2L89A 5GMKi 4FYWB 4OGCA 3EFSA 1WYXA 3NFCA 4HLQA 2K4YA 1QVGP 3EH2A 4BI8B 5FU7B 4ESRA 3MHXA 2F5TX 3TREA 3M0RA 2FRYA 4XTXA 3QZ5B 4BCNB 1E6GA 2ZPIB 2ZZDA 4M78F 2D8HA 3M53A 5GMKe 4AFZC 1OI9B 4MDXA 4V2SA 3EH1A 5D7UA 2HMAA 3TNIB 3M03A 3HFOA 2F2VA 2CP6A 2DLPA 2MF2A 2ESWA 5CVIA 4BCGB 2CJMB 3EFRA 3VYGB 3HSBA 1I5OB 2FPDA 2LNHB 2F2CA 1JRIA 4JRKA 3CCMT 1Q7YC 2JM8A 3CMAQ 2BZ8A 2EQKA 4Y72B 1QWFA 2RK1A 1MHNA 4C0DB 2FRWA 2DO3A 2C06A 4MZTA 3P8HA 2EBPA 1BB9A 3JCMW 1YN8A 4D6WA 3QYHB 4JJCA 3UATA 1NJIC 1CKAA 4MFDA 3LGFA 3DKMA 4J9GA 1WJQA 2PVDB 4EOSB 5IN1A 2AK5A 4P5NA 2YDLA 2A08A 4KRDB 3SWNC 2FEIA 1WZOA 1AHJB 1AWXA 2RM4A 2QGFB 2WIHB 4BCPB 3G4SA 1BI2A 3F70A 1X75C 2QQ9A 1S72T 5GAMe 1PRLC 1HXDA 1EX4A 4M75D 4M78C 1RAFB 1AVZC 1E6HA 4HVVA 1OI1A 3EG9A 2YLBA 2NUPB 5LJ5g 1JJ2A 4PNOA 4YOOA 4DEXA 1JSTB 1Y71A 3G71A 1TOVA 4E7JA 1ZQ1A 3G7ZA 4ME7A 1JJ2P 4BCJB 3X20B 3OS5A 4N4GA 2NWMA 2M9UA 2D1XA 3BG3A 5ACBA 4N4HA 4C5HA 2EUFA 3FRNA 1PWTA 4UN0A 4L5GA 2A37A 1Q82C 4HVWA 3VS4A 3H0IA 3O5ZA 1WNLA 5D6WA 1UHCA 3P8BB 4JLIA 4JRQA 5DY9A 1VQNQ 3E19A 4FSXA 1T0JA 1K8AU 3NTIA 4M75G 3CCLT 2VV5A 2K5LA 3CCJA 5GANj 2W9FA 2OTJA 1H1PB 2KR6A 1PM3A 2AZSA 4D8DA 2JGZB 2C6TB 1EFNA 1TUCA 2DJZA 1G3SA 1M1GA 3VKHA 1GH6B 2OTLA 2RJCA 2VC8A 5LJ3g 3QWLA 1GUXA 4FX3B 2LDMA 2HKQB 1Q82R 4F7UF 3HL8A 3FB9A 3ULRB 2DTIA 5I2MA 4KUIA 5I21A 4JJNK 2ENMA 3L42A 2KRSA 2XU8A 3M59A 4PJNA 1O75A 1X43A 4QQGA 2VGMA 1W98B 2DD5B 1AWWA 2JM9A 4PJOC 4KGXB 1PSFA 2FPFA 1VQKT 2A36A 2LQ8A 2QA4T 2MCNA 3QIIA 1XNIA 4Y92A 1JXOA 2F5KA 4LN2A 2KAFA 4Z8AA 4J9IA 2AT1B 1IB8A 2RQVA 2E3IA 2DAQA 2DXUA 2P4RA 2I53A 2C4GB 1RUWA 3FDRA 3CCVA 1SPKA 1ZA1B 3J7AF 4FCYA 2AKKA 4DBFA 3DDQB 3RIRA 1KD1C 3EJ1B 2DA9A 1K73U 3CCEQ 2RHUA 3I56Q 1VUBA 3G6EA 4M75B 3PVQA 3RKYA 2H8HA 3H9NA 1Q81U 4ORZA 1D1CA 2QG9B 3A98A 2KRMA 1UJ0A 2EYQA 4RTYA 3EG3A 3KUFA 2RHZA 1YCSB 3FJPA 5GANe 3UF4A 1YJNT 4PJOE 2RH2A 1PKSA 3CD6Q 3NTHA 1UGPB 2NYSA 1VQ7A 1PHTA 2KK4A 4N0AA 4IUPA 3JCMe 2K6DA 3A8LB 3VKGA 3M9QA 3EG0A 1VQ6T 1QP2A 2A3LA 1AEYA 1TSFA 2RB6A 4CFNB 3CCUQ 1WGSA 1SG5A 1X6GA 2E65A 4J6XA 1M90R 3DLMA 4OMMA 4EIKA 1FWZA 1YIJA 2LZ6B 1I8FA 2ABLA 1QKXA 3VS6A 1C9BA 2GQIA 1OEBA 1G3WA 2PU9B 2CUBA 1NM7A 2ZCFB 1PCXA 3VS7A 4OB0B 5IHYA 2KDSA 1M3CA 1PD1A 1KC8R 1ZSZB 2XK0A 2HKNA 1OZ3A 3DB3A 2EGAA 3QG1A 1NYFA 1Y07A 2V1RA 3CC2T 4C0DC 2QQBA 2MWPA 1GFCA 4X9CA 5FWCA 3HRUA 2E3HA 1YITQ 2EQJA 4TVRA 1WHGA 3JCMX 4LE9A 2HCKA 2VB6A 3UPUA 1K4US 1RAHB 4MFEA 2FL7A 2DNUA 1Q7YU 1Q95G 4F7SB 3CBPA 4XTVA 4KULA 2FO0A 2DM1A 1H27B 1YHQT 2O4XB 4E7IA 2QQ8A 1TG0A 4YC3B 5KYUA 1NZ9A 3TQ7P 2YUOA 5GAN6 3EG1A 2X9HA 4Z6YA 3A8HB 1VQOT 2DTOA 3JSCA 5CKEA 2ROLA 4CI0C 2HDAA 2GTJA 4MMLA 3M58A 1GUXB 1VYUA 2MI6A 4F6UB 3M4YA 4XK8E 4CC3A 4E7SA 3I55Q 1WPYA 2HD0A 1VQMT 2P0PA 4XU0A 2CP2A 1KK7A 2XDBA 1XTDA 1FKMA 3RBBB 2XMFA 2R58A 3CCST 4XTUA 3QKJA 1RADB 2BE7D 1TTHB 4C8QE 5HVYB 4PLIA 2E12A 2QEXQ 1GRIA 2DZ9A 1WXUA 2RHYA 1VQNA 4QQ6A 3MIAB 1M1KC 2IVXA 2RI3A 4XTYA 2F2XA 2QI2A 3VS3A 1IXDA 4B9XA 4ATOA 3MJXA 4M75F 3GPLA 2CSIA 2F2WA 5LJ5d 4X34A 5CR2A 4RTXA 1D0XA 4N4IA 1Q82U 6AT1B
chains in the Genus database with same CATH topology
1VIEA 5L8RE 3S3NA 2DIQA 3MEVA 4EMKB 1X01A 3HRSA 2IVWA 5D6YA 4C5IA 1VQ6A 4PJOF 3N5BB 2DZCA 3JCMc 1VQOA 1JJ2S 3QJ6A 3L2QA 4JRPA 5IT9E 4LD9K 4F7UB 1G3TA 2K57A 1OYXA 3WVDB 1GXIE 4JUVA 4A4EA 2ZGWA 3AHUA 3X25B 4HT9A 2B8AA 5CIUA 2OTJT 4ELZC 5CCAA 3FLGA 4F7UE 2D0QB 1KG1A 3RMQA 4CRIA 1LNXA 4OB3B 2BUDA 3OYDA 2O4XA 4EMHA 2DXBA 3TU4K 2O01E 3S6WA 2OTLT 3VKIA 2CGHA 4C0GA 3CCQT 5CQYA 5FU6B 1N9SA 1PSEA 2BS3A 5GAMg 3CMAT 3CC7A 3HBLA 2PUKB 1HK9A 5GANd 5DLQE 3CXCS 3LH0A 4ELJA 5GAMj 3M54A 2HNIA 2X4JA 3HP9A 3R6OA 1YJWT 4M75A 3CMEA 2E1HA 3MEWA 4NC6A 2L89A 5GMKi 4OGCA 2DD4A 3EFSA 5GMKh 3NFCA 4HLQA 3PT9A 1UGQB 4C0FA 4EMGA 2K4YA 4O5VA 1N27A 4BI8B 2L3RA 4NS5A 5FU7B 3MHXA 3CEYA 2F5TX 3OYYA 3TREA 3QHSA 1ZBXA 2CZ6B 3A8OB 4IURA 3JCMd 1QVGS 4PJOA 3I55T 1WQWA 2LRQA 2QQRA 4XTXA 3QZ5B 3LYIA 2DKGA 2ZPIB 2JNGA 5LJ3d 3I56A 1FX7A 2ZZDA 4M75C 1YBYA 4M78F 1VQ4A 3M53A 5GMKe 2LCCA 4BUGA 4FIBA 3JB9D 1E7PA 3C4SA 4ZN3A 3CC2A 2RI5A 3META 4M77B 4BI4A 5GAMf 4MDXA 2JZ2A 4V2SA 5DLOA 3URGA 2I2LA 1VQLA 2VXEA 5FRNA 2QEXT 5HKCA 3QYBA 1FXXA 3QYEA 2XG8D 3CPFA 3HFOA 4M77E 2E10A 2RJFA 2MF2A 3JCMJ 3OBWA 4MZMA 4VUBA 5CVIA 4EPCA 4J6WA 3EFRA 3VYGB 4HNUA 2DIGA 3HSBA 1NJIU 3OQ5A 4XQ3A 4OF1A 3OYFA 1QVFA 4OB2B 3PMIA 1KQSS 1JRIA 4YTLA 1KD1U 4JRKA 3A8GB 2M0OA 3KHIA 1N9RA 3FEOA 3H4CA 3G6ET 3CCMT 1Q7YC 1VQ8T 2EQKA 2RK1A 4A4FA 2JVVA 4BD3A 1MHNA 3CD6A 3LW5E 1IREB 4C0DB 2ZPEB 2EJFA 2MAMA 3JCMb 1G5VA 3SD4A 2Y4YA 3SWNA 1W2BA 4JS4A 4LDVA 2DO3A 2C06A 4MZTA 3P8HA 5GAN4 4RCCA 4EMKA 3OYEA 3JCMW 2EAYA 1YHQA 3TW7A 4D6WA 1VQ5T 3BFMA 3QYHB 1NJIC 4EDUA 5GAN8 5J26A 5GAMh 4MFDA 2EJ9A 3LGFA 3DKMA 4M78A 4DA4A 1M90U 4J83A 3HHTB 2F69A 4KBMB 3CC4A 4A4KA 1WJQA 2PVDB 5IN1A 2P0KA 1UGSB 3PFSA 1VQ8A 2KVQG 3SFMA 4P5NA 3SWNC 3GF5A 2E5QA 4NOYA 4C5EA 3JB9G 5CO7A 2V8JA 1AHJB 3MEUA 2RM4A 4RCBA 1QW1A 3G4SA 2LT4A 1BI2A 3M5AA 1M1FA 4IUTA 3F70A 1X75C 2QQ9A 5CQXA 3FIFA 2LTOA 3GNFB 2RHIA 4C92B 5GAMe 2GF7A 1HXDA 3CCRT 1S72T 3VJPA 4M75D 1LJOA 4M78C 5J39A 3CPWS 4HNVA 4IUVA 5J3BA 1M90C 4RKUE 3VUBA 3UWNA 5CKDA 2DPPB 3E9GA 4HCBA 4M7DF 1OI1A 2Y4XA 1Y7XA 2YLBA 4QW2A 1O9SA 1VQMA 4JS5A 2GCXA 2DK3A 3M57A 2KQWA 4PNOA 5LJ5g 1JJ2A 4BE2A 4PJOD 4M6VA 2ZPGB 2G3RA 1Q86C 1Y71A 3G71A 1YIJT 2EFIA 5LJ5j 3CCSA 4E7JA 3DL1A 1ZQ1A 3G7ZA 4L59A 4ME7A 4XU1A 3M55A 3RKXA 2RA2A 2DVEA 4O6JA 2RHXA 4HCZA 3X20B 3E9FA 3OS5A 4OGEA 4N4GA 1KC8C 2M9UA 3LWHA 4BE1A 3BG3A 4HCCA 3X24B 3CCJT 3V8KA 5LL6S 1K9MC 4N4HA 3E1SA 4RG8A 3J80E 4C8QF 4JLGA 4BY6C 1G3YA 5A0DA 3KBGA 3J81E 4C5HA 3OYNA 1YITA 2KSSA 3FRNA 5FU7C 2E6ZA 4L5GA 3CXCA 4BDZA 1Q82C 5KH6A 4M7AB 3V7SA 2X35A 2CS7A 4LOCA 1BI1A 3ZBDA 4J7IA 3SDZA 3A8MB 1WNLA 3NTKA 5D6WA 3VYGA 2DXCB 2RD1A 4C5GA 5LJ5f 3OYJA 2LNVA 3P8BB 1LOJA 4LDYA 5AYFA 5FROA 3RESA 4JLIA 4M7AE 4JRQA 5GANg 1JBMA 3CBMA 3ASKA 3E19A 3MP6A 4FSXA 5DY9A 3QDRB 2VGNA 5KCHA 1K8AU 3NTIA 4M75G 3OS0A 4ZTFA 1UB4A 2JOYA 5CK9A 2LT1A 3CCLT 1QVGA 2VV5A 5GAOl 2FYKA 2K5LA 1D3BA 3CCJA 5GANj 3OYGA 5GMKm 1VIFA 2QF7A 2OTJA 3QUIA 3OW2S 2KR6A 3H8ZA 1UGRB 3ZEHA 4E7HA 4HKEA 4J6YA 3PIOA 3GNGA 4M78D 2YLCA 3JCMg 3MCAB 1SSFA 3RUXA 2DJZA 4QVCA 4PJOG 3X26B 5A0LA 1G3SA 1M1GA 2FHDA 5D6XA 3VKHA 2OTLA 3HB9A 4XU2A 3CCQA 3CCET 2RI2A 4BACA 2RJCA 3ME9A 1YJ9T 2VC8A 4AKIA 3QYGB 3QWLA 3PMTA 5LJ3g 3L2RA 3CMAA 2MMPA 2LDMA 2EKOA 2Y90A 2MWOA 2QQSA 1ZHIA 3HL8A 2R5MA 2GQVA 3FB9A 4F7UF 2DTIA 4FU6A 4KUIA 5I2MA 4C8QA 2XHCA 5I21A 5LJ3j 3TEEA 5GAN7 4JJNK 2M16A 1YJWA 3HKSA 3L42A 2PVGB 2GFUA 2XU8A 3M59A 4L6V5 4NL3A 1O75A 3JCMV 5GANf 3OYCA 4QQGA 2VGMA 3O8VA 2LCLA 2L5QA 3V8LA 1YI2T 2JTFA 5LJ5h 2DD5B 2CYZB 4PKCC 4UC4A 4C92A 3QJYA 4PJOC 2PVOB 3CCVT 4M7DA 1PSFA 1WJSA 2E6NA 1U1SA 4X9DA 4Y28E 1VQKT 2LQ8A 2P4TA 2RK2A 2QA4T 1KQ1A 2KMTA 3I55A 3QIIA 1XNIA 3OYAA 1NPPA 5FLXE 1VQ9T 4QVZA 4JX5A 3JCMf 4B9WA 4C8QC 1OZ2A 2F5KA 1W4SA 2KAFA 5LJ5e 2QTXA 4J8OA 5LJ3f 3PGGA 2DAQA 2DEQA 2DXUA 3C12A 2QEXA 4C92F 3JCMQ 4IKFA 2EIFA 2FVUA 2WSCE 2RJEA 4M7DC 4OP0A 3L2UA 4LDUA 2H3JA 2WSEE 3RKWA 3FDRA 3CCVA 2PUOB 3J7AF 2XI9A 4KUDK 2D6FA 3RIRA 1BIAA 2X4WA 4M78G 3JCMP 1KD1C 4F7UG 2VYTA 2X4XA 3ER0A 4F7UA 1K73U 4Y91A 2CZ1B 2RHUA 2XIDA 3CCMA 1VUBA 5GANh 3OYHA 3G6EA 4AKHA 1M8VA 4M75B 2KY9A 2JUFA 4M77F 3OS1A 3OYIA 3RKYA 4BB7A 3CPWA 3BY7A 1Q81U 1VQ7T 1I4K1 1YCYA 1QVFS 4EMKC 4M75E 3JB9J 2EYQA 1WJRA 1VQPT 1XQHA 2K3XA 5HK0A 5GAOn 4R55A 4IUUA 2DXCA 1VQNT 3KUFA 2RHZA 3JCMh 4A53A 2NLUA 4DOVA 3FJPA 5GANe 1VQ5A 3V8JA 1DJ7B 2IG0A 3KXTA 3P8DA 5LJ3h 4E7LA 3BW1A 3QO3A 4AKGA 1R8OB 2RH2A 2YHTA 1YJNT 4LDXA 4PJOE 5IAYA 1IZ6A 2QQAA 2AHJB 4J7FA 4LDWA 1Q81C 2FB7A 4DQ2A 3S3MA 2RO0A 3NTHA 3T9NA 5GAOp 1UGPB 1VQ7A 2K2VA 4WF2A 3RERA 4HNTA 4ZGEB 2KK4A 4N0AA 2EJGA 2V8KA 4IUPA 3JCMe 2P0QA 3M56A 3VUZA 1QP3A 3A8LB 2DXTA 3VKGA 3M9QA 3OBYA 5FU6C 1I81A 3OY9A 1VQ6T 4IUQA 1QP2A 3QZ9B 2PQWA 4ZTJA 2A3LA 1S72A 4JX4A 4XAXB 1BI3A 4C8QD 5LJ3e 3CCRA 2RJDA 1U1TA 3Q1JA 2VUBA 2X4YA 4A54A 5C6SA 3VYHB 4BE0A 4MDWA 2WACA 3V7CA 3HZJA 2RB6A 4M77A 2LVMA 2BS4A 2E64A 1TH7A 4C92D 4M7DD 2QDYB 4N0AC 5GAOm 3OB9A 3HO8A 1Y96B 2JTMA 1WGSA 3SWNB 2DD5A 2E65A 1M9SA 4J6XA 5GAOq 5EJCA 3DLMA 1FWZA 2YRVA 4E47A 1YIJA 2EQUA 3OA6A 2XKOC 1I8FA 4FT2A 3CC7T 3M4GA 2K5FA 3OW2A 4II1A 2V8IA 2QDJA 2EWNA 2XD0A 3OSSC 1BI0A 4QQDA 4M78B 4M77C 4OMFB 1BYMA 3CMET 2XDPA 4RG2A 1G3WA 4XTWA 4NL2A 1QVPA 2PU9B 3L2WA 2QXFA 5GAN2 3MEAA 1I5LA 2ZCFB 2BS2A 2ZPBB 4FM4B 4OB0B 2KDSA 4MIMA 4M78E 4A4HA 2R5AA 2K5IA 3L2VA 2QFZA 3S3OA 3QSUA 4OVAA 4BDYA 4Z02A 4JDSA 3OS2A 1MGQA 1RI0A 2XK0A 3JRZA 4PLLA 3GOXA 3CBOA 1OZ3A 3X28B 2D9TA 5GAN3 3I56T 5GAMd 3DB3A 3LGLA 3QG1A 1VQ4T 4MMKA 1B34B 1Y07A 1K8AC 3PIPA 3CC2T 4C8QG 4C0DC 4M7AD 2R57A 2QQBA 2MWPA 1VQLT 5EG2A 3FC3A 3CCLA 3LX7A 4X9CA 1KQSA 3C94A 3HRUA 3PTAA 4BY6B 4BBRM 1U8RA 3QPHA 5HK3A 4C92G 2EQJA 4M7AF 4M7DG 3BDLA 3RMSA 3A5ZB 2L8DA 4TVRA 4AI6A 1JB0E 3JCMX 3UPUA 5CKHA 3UDCA 3JAME 2A7YA 2LQKA 1UEBA 1QLBA 2KMGA 4MFEA 4HA8A 3CCEA 2FL7A 3WXMB 1YJ9A 3JB9I 1Q7YU 3CD6T 4M7DE 5GMKl 1V29B 2E41A 3QBYA 4ZGDB 3VU3C 3CBPA 4GY5A 5CKFA 4DOWA 1X6OA 1H641 4R56A 1NPRA 4XTVA 4KULA 3BG5A 4C92C 4BBSM 1RL2A 2OAUA 4MZPA 3H6ZA 4GLKA 2G77A 2EQMA 3JB9F 1YI2A 4FT4A 3BDUA 1YHQT 2O4XB 2HQXA 2DXBB 4JRIA 4E7IA 2CKKA 2QQ8A 3MP8A 4M77D 4E7KA 1VQKA 4XU3A 2QA4A 1NZ9A 3C95A 4Q5WA 3CC4T 2CZ0B 1M5Q1 5CKBA 2DTHA 5M9OA 3CCUT 4BI3A 1VQ9A 3EAEA 4A4GA 2HAXA 3OMGA 3PNWC 5GAN6 1D3BB 5FRMA 3VV0A 1KQ2A 1Y96A 2CZ7B 2DD4B 4HT8A 4M7AG 2HBPA 3HFNA 3G4ST 4M7AA 2WSFE 4Z6YA 3A8HB 4OB1B 3MP1A 4FL6A 5GAOr 1VQOT 2VXFA 4RMOA 2DTOA 3JSCA 5CKEA 4CI0C 4LD6A 1XOVA 4KT0E 4QVDA 3TCJA 3OSVA 3DB4A 4PJOB 1WQ7A 1N6AA 1M1KU 5CAIA 2XICA 3L2ZA 3M58A 4MMLA 2BIVA 4PL6A 2MI6A 4XK8E 5KCOA 1W2BS 3M4YA 2BKDN 2M1HA 3OYKA 1K73C 2ZZDB 2LC4A 1WPYA 4C0ZA 1KHCA 2HD0A 3OYMA 1VQMT 4XTZA 3UT1A 1N8RU 2P0PA 3CCUA 1M4ZA 4XU0A 4C8QB 3V7RA 2XDBA 1XTDA 2JN0A 4HL4A 1FKMA 4M7AC 3G71T 3DLLA 2K3YA 5GMKj 2R58A 3CCST 1Q86U 5C0MA 4XTUA 3QKJA 4C8QE 3HRTA 4PLIA 2E12A 5I2SA 5A0GA 2ZPHB 2DZ9A 1BIBA 5GAN5 4M7DB 4J5YA 1VQPA 4ZN1A 2RHYA 1VQNA 3OMCA 4QQ6A 1M1KC 3TW6A 2RI3A 3HPWA 4XTYA 5KE3A 2WJ9A 1B34A 1EIFA 2QI2A 3MO8A 3WVEB 2GFAA 3L1AA 4C92E 4ELYC 4B9XA 3JB9H 2HQEA 3INZA 3SB2A 5DM7R 4ZGJB 5A2QE 1KC8U 3GLXA 1NE8A 4M77G 3OYLA 1N8RC 2E70A 3GP8A 3GIBA 1K9MU 1KHIA 1BKBA 3OYBA 4ATOA 4M75F 3GPLA 1YJNA 1YITT 2XDDA 1P92A 5HY6A 2LX9A 5LJ5d 3BG9A 4JX6A 4X34A 5KE2A 1H3ZA 3ZFJA 5CR2A 3LWIA 4N4IA 1Q82U 3LLRA 2ZPFB 4QSHA 3QXEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R E;  1AHJ B;  2WSC E;  3WVD B;  2WSE E;  4RKU E;  3X25 B;  2DPP B;  2PUO B;  1JB0 E;  2D0Q B;  2CZ1 B;  4OB3 B;  2DXB A;  2O01 E;  2ZPG B;  1PSE A;  2PUK B;  1V29 B;  4ZGD B;  3X20 B;  2DXC A;  2DD4 A;  3X24 B;  1DJ7 B;  1UGQ B;  2DXB B;  2CZ6 B;  3A8O B;  2CZ0 B;  2AHJ B;  1UGP B;  3QZ5 B;  3A8M B;  4ZGE B;  2ZPI B;  3VYG A;  2DXC B;  2ZZD A;  1QP3 A;  3A8L B;  2CZ7 B;  2DD4 B;  1QP2 A;  3QZ9 B;  2WSF E;  3A8H B;  4OB1 B;  4KT0 E;  3VYH B;  1UGR B;  4XK8 E;  3VYG B;  2QDY B;  2ZZD B;  4OB2 B;  3X26 B;  2DD5 A;  3A8G B;  3QYG B;  3LW5 E;  1IRE B;  2ZPE B;  2ZPH B;  1GXI E;  4L6V 5;  2PVG B;  2PU9 B;  3WVE B;  2DD5 B;  2CYZ B;  3QYH B;  2ZCF B;  2ZPB B;  4FM4 B;  4ZGJ B;  4OB0 B;  2PVO B;  1PSF A;  4Y28 E;  3HHT B;  2PVD B;  1UGS B;  3X28 B;  2ZPF B;  3QXE B; 
#chains in the Genus database with same CATH topology
 4EMK B;  3MEV A;  2V26 A;  3N5B B;  1IHV A;  3QJ6 A;  4JRP A;  5IT9 E;  4CXA B;  4HT9 A;  3X25 B;  5CCA A;  4EOL B;  4AFQ C;  3RMQ A;  3OYD A;  2LJ1 A;  3VS5 A;  2DIL A;  5GAM g;  1N9S A;  3CMA T;  3CC7 A;  4RTU A;  3CCR Q;  1HK9 A;  2RN8 A;  1D1B A;  1G2B A;  1YJW T;  2OJ2 A;  3HTR A;  1TFB A;  1M3B A;  2LMJ A;  3MI9 B;  4O5V A;  1N27 A;  4NS5 A;  1ZBJ A;  3OYY A;  1WLP B;  3QHS A;  1ZBX A;  2CZ6 B;  1UNL D;  4ELL A;  2CP7 A;  2A28 A;  1WQW A;  2QQR A;  2PK2 A;  3LYI A;  5LJ3 d;  3I56 A;  5BNJ B;  1FX7 A;  1AT1 B;  4M75 C;  2KYM A;  4FIB A;  4ZN3 A;  2RI5 A;  1YNZ A;  3MET A;  2LJ3 A;  2K79 A;  2JZ2 A;  5DLO A;  4LNP A;  3CCJ Q;  5HKC A;  2EYX A;  4AMC A;  2OTJ Q;  3NGP A;  3QYE A;  3CPF A;  4M77 E;  2NUZ A;  2E10 A;  3OBW A;  4GLM A;  4MZM A;  3BLH B;  4J6W A;  1PNJ A;  3OQ5 A;  4XQ3 A;  4OB2 B;  3PMI A;  2OTL Q;  4YTL A;  3FJ5 A;  1KD1 U;  3EGX B;  3A8G B;  2M0O A;  1N9R A;  3FEO A;  5CYI B;  1WA7 A;  3CD6 A;  4D8K A;  2LQN A;  2GTO A;  2O88 A;  5IDN B;  4BCQ B;  2Y4Y A;  3EGU A;  3H0H A;  1W2B A;  4LDV A;  5IHN A;  2EYW A;  2K7A A;  2KRO A;  2G9X B;  2IW9 B;  2W96 A;  1VQ5 T;  2CH4 A;  2LJ0 A;  5J26 A;  2JMA A;  2RQU A;  1M90 U;  5CEI B;  3HHT B;  2F69 A;  1YJ9 Q;  1OV3 A;  2YRC A;  3PFS A;  2O2O A;  2E5Q A;  2UZL B;  1TXQ A;  4NOY A;  4C5E A;  5CO7 A;  2YXY A;  5IHK A;  5ICP B;  4IUT A;  3M5A A;  1M1F A;  3JB9 H;  3FIF A;  3GNF B;  2RHI A;  2GF7 A;  2C5N B;  3K7A M;  2HSP A;  3CPW S;  1BU1 A;  3CCV Q;  4IUV A;  5CKD A;  2DPP B;  3E9G A;  1IO6 A;  2J6F A;  1TD6 A;  2LX7 A;  1O9S A;  1VQ9 Q;  3G33 B;  3M57 A;  2KQW A;  3BLR B;  1ZSZ C;  1K73 R;  1VOL A;  2I0N A;  2RNA A;  1PG5 B;  2DVE A;  3QWX X;  1KIK A;  4HCZ A;  2RQW A;  2RPN A;  4OGE A;  2K3B A;  1E9H B;  3LWH A;  2WFY B;  1I0C A;  4BE1 A;  4HCC A;  3X24 B;  1SEM A;  1K9M C;  1HJD A;  3J80 E;  1G3Y A;  3J81 E;  3OYN A;  4KH1 B;  1YIT A;  2E6Z A;  4BCM D;  1VQ7 Q;  2O9V A;  2X35 A;  1FMV A;  5M9O A;  1N8R R;  3SDZ A;  4C5G A;  2DXC B;  2RD1 A;  2LNV A;  2MOX A;  1LOJ A;  2MPX C;  5AYF A;  5FRO A;  3RES A;  1UNG D;  1VQP Q;  4M7A E;  1RI9 A;  5GAN g;  3CBM A;  3ASK A;  3B57 A;  1JKW A;  3QDR B;  3NHN A;  1QVG A;  2GBQ A;  4JZ4 A;  2J06 A;  2FYK A;  5GAO l;  4J9C A;  4IMY B;  1WHK A;  2HL3 A;  1K9A A;  3H8Z A;  1UGR B;  4E7H A;  4HKE A;  4J6Y A;  1FVV B;  1D09 B;  3GNG A;  3JCM g;  3MCA B;  1SSF A;  1WHJ A;  1WHL A;  1Z9Z A;  1K9M R;  1UE9 A;  1YIJ Q;  5D6X A;  3CCE T;  1TU0 B;  2DER A;  3PMT A;  4M4Z A;  3L2R A;  2JJ9 A;  2EKO A;  2Y90 A;  1TS9 A;  4FU6 A;  5GAN 7;  1GXI E;  5FGK B;  4L6V 5;  2PVG B;  4NL3 A;  3BE3 A;  3UA7 A;  1GBR A;  2LCL A;  5LJ5 h;  1AZE A;  2CYZ B;  2EGE A;  4C92 A;  3QJY A;  2W99 A;  4M7D A;  1U1S A;  4X9D A;  1KQS P;  2RK2 A;  1KQ1 A;  3I55 A;  2KT8 A;  4JJB A;  4NST B;  2GGR A;  1XO2 A;  5FLX E;  4B9W A;  4I3Z B;  1OZ2 A;  3THK A;  1W4S A;  2DYI A;  2QTX A;  2CP5 A;  1TUD A;  2DEQ A;  3M0T A;  4ROC A;  3C12 A;  2QEX A;  1RAC B;  2EIF A;  2FVU A;  2WSC E;  2RJE A;  4OP0 A;  4BCF B;  1M3A A;  2PUO B;  2JTE A;  2HBW A;  5EFQ B;  2VYT A;  2WPA B;  2CZ1 B;  2XID A;  4Y91 A;  4B6M A;  1M8V A;  1VQ4 Q;  4F70 B;  1H8K A;  1U06 A;  2KY9 A;  3OS1 A;  4ROE A;  1VQL Q;  4EMK C;  1W6X A;  2HQH A;  8ATC B;  1Q7Y R;  2K3X A;  5HK0 A;  4R55 A;  1RAB B;  1UGV A;  3VRY A;  4A53 A;  2CH4 W;  5LJ3 h;  1JOW A;  1R8O B;  4LDX A;  1IZ6 A;  1MUZ A;  2AHJ B;  2QQA A;  2YT6 A;  4LDW A;  3S3M A;  2RO0 A;  3T9N A;  1NJI R;  1KFZ A;  2IPO B;  2C5V B;  1H24 B;  2V8K A;  2NUT A;  4FYY B;  4EOP B;  2DXT A;  1QCF A;  4IUQ A;  5IDP B;  4JX4 A;  4XAX B;  1BI3 A;  3CCR A;  2J6K A;  3Q1J A;  4MDW A;  2WAC A;  3V7C A;  1A0N B;  1AWJ A;  4C92 D;  4M7D D;  3I9Q A;  4N0A C;  3OB9 A;  2KYB A;  2DX1 A;  3I35 A;  3LQ5 B;  1YFN A;  5EJC A;  2Z0W A;  2YRV A;  4E47 A;  1AD6 A;  1MV0 B;  2EQU A;  3OA6 A;  4ANJ A;  2XKO C;  2DEU A;  4FT2 A;  3M4G A;  2K5F A;  3OW2 A;  3MPU B;  2DME A;  1QMZ B;  2QDJ A;  3GBQ A;  3TNW B;  1BI0 A;  4CFW B;  3EGD A;  5IHI A;  1E7O A;  3KFV A;  1QVP A;  4EOO B;  3OW2 P;  1I5L A;  3L2W A;  2QXF A;  2X3W D;  3PE0 A;  4RTW A;  3EHQ A;  4M78 E;  4OML A;  3BHT B;  2R5A A;  2K5I A;  4FW2 A;  3QSU A;  4JDS A;  1MGQ A;  3JRZ A;  4KGZ B;  1H25 B;  4PLL A;  3GOX A;  5L2W B;  2COZ A;  5GAN 3;  5GAM d;  1OIY B;  2RQR A;  3LGL A;  4FYV B;  4MMK A;  4F7J B;  1B34 B;  3M0Q A;  1WIE A;  4M7A D;  2R57 A;  1GCQ C;  3JV3 A;  1SHG A;  3PTA A;  2PTK A;  4KGV B;  5HK3 A;  4C92 G;  4M7D G;  3BDL A;  3RMS A;  2L8D A;  4AI6 A;  1JB0 E;  1X2Q A;  2AIR B;  3EOC B;  3JAM E;  4BY7 X;  1H1Q B;  3WXM B;  2RF0 A;  1YJ9 A;  3CC7 Q;  1K1Z A;  2O9S A;  3VU3 C;  4GY5 A;  4DOW A;  4BCO B;  1X6O A;  4R56 A;  3BG5 A;  1H26 B;  1RL2 A;  2KI7 A;  4MZP A;  3H6Z A;  4GLK A;  2EQM A;  1YI2 A;  4FT4 A;  2CCI B;  2HQX A;  2DXB B;  2CKK A;  3MP8 A;  2DRK A;  1SRM A;  4XU3 A;  5KYN A;  4RTT A;  3CCQ Q;  2JXB A;  1AOJ A;  2DTH A;  1VQ9 A;  1QWE A;  3OMG A;  4RTZ A;  1QVF P;  3VV0 A;  1KQ2 A;  1Y96 A;  2CZ7 B;  4BCK B;  2BTT A;  4M7A G;  2M02 A;  3HFN A;  3G4S T;  4FL6 A;  2UUE B;  2VXF A;  1WDX A;  1XOV A;  4OMP A;  1WQ7 A;  4LUE A;  2QAS A;  5CAI A;  2DJQ A;  5KCO A;  1CSK A;  2ZZD B;  2HAX A;  1KHC A;  1QMC A;  4PFO A;  4XTZ A;  3UT1 A;  5KYW A;  1N8R U;  1M4Z A;  3BHU B;  3EHR A;  3G71 T;  3REA B;  1KD1 R;  5C0M A;  3VS2 A;  4JZ3 A;  3HRT A;  8AT1 B;  1ABQ A;  4M7D B;  2F1L A;  4OMO A;  1MMG A;  1VQP A;  4EOJ B;  5KE3 A;  2CDT A;  2IW8 B;  3MO8 A;  3L1A A;  2MIO A;  1BYM A;  2HQE A;  5DM7 R;  5A2Q E;  3OYL A;  2E70 A;  3TNH B;  2YUQ A;  2JT4 A;  1KHI A;  1K9M U;  2CP0 A;  3CCM Q;  2XDD A;  1OOT A;  2LX9 A;  4JX6 A;  2KNB B;  2J05 A;  5L8R E;  1O9K A;  1HD3 A;  4FW1 A;  5D6Y A;  2IVW A;  4C5I A;  1JJ2 S;  1BCM A;  3G1J A;  4EON B;  1OYX A;  2WMB B;  5GJW B;  2W2H A;  2PMI B;  1X2K A;  3AHU A;  2OTJ T;  2B8A A;  4F7U E;  4OR5 B;  2DE0 X;  1X69 A;  2V1Q A;  4WCI A;  2BUD A;  2KRN A;  3TU4 K;  1Y0M A;  2O01 E;  3H0F A;  3S6W A;  2OTL T;  1UDL A;  2CGH A;  4C0G A;  4CC4 B;  2WEV B;  1YWO A;  3HBL A;  2DBM A;  1S72 Q;  4F6S B;  2I40 B;  5GAN d;  5DLQ E;  4LXC A;  1Y57 A;  2HNI A;  2X4J A;  3HP9 A;  3REB B;  3CME A;  3EG9 B;  1OU8 A;  2OI3 A;  2DD4 A;  1D0Z A;  5GMK h;  1T3L A;  1UGQ B;  4C0F A;  2QGS A;  2NUT B;  2L3R A;  2EKH A;  1EZZ B;  2JS0 A;  3CEY A;  3JCM d;  4IUR A;  4F04 B;  4PJO A;  4KRC B;  2DKG A;  1YBY A;  1VQ4 A;  1BK2 A;  2LCC A;  1QCO A;  4BUG A;  1E7P A;  3C4S A;  1AWO A;  1Z9Q A;  4WTO B;  1VQL A;  2VXE A;  2UZE B;  3QHW B;  3QYB A;  1FXX A;  2IW6 B;  1U3O A;  1WX6 A;  2XG8 D;  4J9E A;  1PKD B;  4CRL B;  2QYZ A;  4EPC A;  5HCK A;  4HNU A;  1NJI U;  1JEG A;  3OYF A;  3G6E T;  3KHI A;  1VQ8 T;  3EGD B;  3H4C A;  4PJL A;  1UUE A;  3RR6 A;  3LW5 E;  1IRE B;  1HSQ A;  2EJF A;  1SKU B;  2C0T A;  3SD4 A;  1G5V A;  2CRE A;  4JS4 A;  2W9Z A;  3NPF A;  3D7S B;  5GAN 4;  3OYE A;  1QKW A;  3TW7 A;  4AT1 B;  4EDU A;  5GAN 8;  2DYB A;  5GAM h;  2EJ9 A;  1IGU A;  4IIO A;  1V76 A;  4J83 A;  4KBM B;  3CC4 A;  4Z88 A;  2P0K A;  3AT1 B;  1JO8 A;  2KVQ G;  3SFM A;  2KEA A;  2L0A A;  2PK9 B;  1RAG B;  4RCB A;  5DQV A;  1MND A;  2DL8 A;  5CQX A;  3CPW P;  2RQT A;  1TUG B;  2LTO A;  1UNH D;  1ENW A;  1LJO A;  5J39 A;  2VKN A;  2P84 A;  1VQK Q;  1PD0 A;  4HCB A;  2Y4X A;  3LH5 A;  1Y7X A;  4QW2 A;  4HCK A;  2BPM B;  2GCX A;  2DK3 A;  2E4H A;  4PJO D;  4M6V A;  1ZUU A;  2G3R A;  1Q86 C;  1YIJ T;  2EFI A;  1OPK A;  4XU1 A;  2YSQ A;  3M55 A;  3RKX A;  4O6J A;  1NYG A;  2RHX A;  2SRC A;  3TN8 B;  3E9F A;  2B9R A;  2W0Z A;  1X6B A;  1RLP C;  1S1N A;  3V8K A;  5LL6 S;  3BLQ B;  3E1S A;  4RG8 A;  4CFU D;  1MMD A;  1GFD A;  2KSS A;  2BZX A;  4FSS A;  1M1K R;  3CXC A;  4BDZ A;  1OX9 A;  1SF9 A;  5KH6 A;  1MMA A;  3ZBD A;  4LOC A;  1BI1 A;  4C92 F;  3A8M B;  3OYJ A;  3VYG A;  5LJ5 f;  4M7D F;  1OKV B;  1LVK A;  1WHM A;  4LDY A;  3CXC P;  3MP6 A;  5KCH A;  1OQK A;  3OS0 A;  4ZTF A;  1UB4 A;  2MK5 A;  5CK9 A;  1U5S A;  3OYG A;  5GMK m;  1VIF A;  2QF7 A;  1FMW A;  3QUI A;  1YJN Q;  2L3P A;  1VYT A;  2R7G A;  4PK4 A;  3PIO A;  2BKZ B;  2YLC A;  1VA7 A;  4PJO G;  1H92 A;  3HB9 A;  3CCQ A;  1VIN A;  4BAC A;  2L3S A;  3M0U A;  3QYG B;  2DFU A;  3DJB A;  2H3E B;  4II5 B;  1FMK A;  2QQS A;  2R5M A;  2GQV A;  4C8Q A;  2IIM A;  3VRZ A;  3TEE A;  5AT1 B;  3OYC A;  3V8L A;  2JTF A;  1ABO A;  2LW4 A;  4EOQ B;  2PVO B;  1I1J A;  1O9K B;  2E6N A;  2K2M A;  2P4T A;  5DQW A;  3OYA A;  1NPP A;  4CC2 A;  4E2F B;  2ROT A;  1XJW B;  2KBT A;  5LJ3 f;  3PGG A;  5I22 A;  4BCN D;  4M7D C;  4LDU A;  2H3J A;  2WSE E;  3RKW A;  2DET A;  4X1V A;  4KUD K;  1NEB A;  2D6F A;  4YOS A;  2X4W A;  3JCM P;  4F7U G;  1UTI A;  1OIU B;  1OUL A;  2AKL A;  3CCM A;  5GAN h;  1H4L D;  2JUF A;  3OYI A;  4BB7 A;  2L3Q A;  3CC2 Q;  4OMQ A;  1YWP A;  2YUP A;  1YCY A;  1R0B G;  4M75 E;  1H1S B;  1OGU B;  1WJR A;  5GAO n;  2DF6 A;  1YI2 Q;  1VQN T;  1B3Q A;  1WHH A;  2OAW A;  3JCM h;  2DL3 A;  2NLU A;  3TSW A;  1DJ7 B;  2SEM A;  2IG0 A;  3I5S A;  2EVR A;  4E7L A;  3QO3 A;  4AKG A;  4J7F A;  1GY3 B;  1Q81 C;  3RGF B;  3EID B;  2K2V A;  4PJM A;  2EJG A;  2DBK A;  3M56 A;  1QP3 A;  1JSU B;  3QHR B;  4F7L B;  4CFU B;  2PQW A;  1S72 A;  2BZY A;  4C8Q D;  1YHQ Q;  1NLP C;  5KYU B;  4BCH B;  2X4Y A;  4A54 A;  4F14 A;  3VYH B;  5C6S A;  3HZJ A;  4M77 A;  2LVM A;  2E64 A;  1T3S A;  3E2U A;  2QDY B;  2JTM A;  4QT7 A;  1BU2 A;  2DD5 A;  1M9S A;  1MNE A;  1HYO A;  2WMA B;  3CC7 T;  3NDQ A;  2KR3 A;  1W1F A;  2EWN A;  5FW9 A;  4QQD A;  4OMN A;  4OMF B;  1CKB A;  4XTW A;  4TTH A;  5HBH B;  2CSQ A;  2BS2 A;  1VQM Q;  4MIM A;  3S3O A;  4OVA A;  4EOI B;  3OS2 A;  1C6V X;  2C5X B;  3CBO A;  3CCS Q;  3X28 B;  2D9T A;  1VYV A;  3I56 T;  4BY1 X;  4PFZ A;  2OX7 A;  4C8Q G;  3CCL A;  3LX7 A;  3U23 A;  1KQS A;  3C94 A;  4IIM A;  4AG2 C;  4BY6 B;  4BBR M;  3VS0 A;  1U8R A;  3QPH A;  1ZP2 A;  3RDV A;  3A5Z B;  2D0N A;  1N5Z A;  1F1B B;  4R0K A;  3UDC A;  2A7Y A;  2LQK A;  1UEB A;  2KMG A;  1J3T A;  3C0C A;  4LUD A;  1M2V A;  1NEG A;  1PKT A;  3CD6 T;  1B07 A;  5GMK l;  1V29 B;  2E41 A;  3QBY A;  4ZGD B;  2FZG B;  1C1A A;  5CKF A;  3CME Q;  2QAZ A;  4HXJ A;  1NPR A;  2A0F B;  2O31 A;  5I5Z B;  4BBS M;  1QQJ A;  3BDU A;  2X1N B;  2EYY A;  2FZC B;  4M77 D;  4E7K A;  1VQK A;  2QA4 A;  3C95 A;  2CZ0 B;  1M5Q 1;  1PRM C;  5CKB A;  3CCU T;  3EAE A;  4A4G A;  2HZY A;  3EG2 A;  1YJW Q;  3M0P A;  4M7A A;  2WSF E;  5GAO r;  4OB1 B;  3MP1 A;  3EFO A;  4RMO A;  2YWW A;  5LQF B;  4LD6 A;  4OGR B;  4KT0 E;  3OSV A;  3DB4 A;  1M1K U;  2XIC A;  4KH0 B;  4PL6 A;  3RER A;  1W2B S;  5KYX A;  2BKD N;  3OYK A;  2LC4 A;  2B86 A;  3OYM A;  4C8Q B;  2JN0 A;  4HL4 A;  3DLL A;  1Q86 U;  1ZSZ A;  2DL7 A;  1FIN B;  5I2S A;  5A0G A;  2ZPH B;  1BIB A;  2YRD A;  4J5Y A;  3MKD A;  3OMC A;  4BCM B;  3LWI A;  9ATC B;  1EIF A;  4QKU A;  3WVE B;  3SB2 A;  3INZ A;  2RMO A;  2KE9 A;  1LPL A;  4J9B A;  4EOK B;  1NE8 A;  3GLX A;  4M77 G;  3OYB A;  1BKB A;  4JPB W;  3CC4 Q;  2BE9 B;  1YJN A;  1YIT T;  5IF1 B;  3ZFJ A;  4F6W B;  4DEY A;  1ACM B;  1VIE A;  3S3N A;  3HRS A;  1VQ6 A;  4PJO F;  2DZC A;  3JCM c;  1VQ5 Q;  1G3T A;  4CFV B;  1B7T A;  4JUV A;  5CIU A;  3FLG A;  1K0S A;  1KG1 A;  1WXB A;  4CRI A;  2O4X A;  1ZUY A;  2KXD A;  4E7Z A;  3VKI A;  5FU6 B;  2PUK B;  5IXF A;  2M0Y A;  3M54 A;  2CP3 A;  2FG0 A;  1K76 A;  2ZAE A;  1ZUK A;  2QK0 A;  3PT9 A;  1BBZ A;  4EMG A;  2PHG A;  2X3X D;  1QVG S;  3A8O B;  3I55 T;  2LRQ A;  2JNG A;  3VS1 A;  3JB9 D;  3CC2 A;  4M77 B;  4BI4 A;  1LCK A;  5GAM f;  1H1R B;  1V1C A;  3URG A;  2I2L A;  1NBE B;  5FRN A;  2QEX T;  5GJV B;  2RJF A;  3JCM J;  3A1P A;  4VUB A;  2DIG A;  4OF1 A;  1QVF A;  1R0C B;  4FYX B;  1KQS S;  1OU9 A;  4YOZ A;  5KYY A;  2YUN A;  5HQ0 B;  5HBE B;  4A4F A;  2JVV A;  4BD3 A;  2W10 A;  2ZPE B;  2MAM A;  2UZB B;  3SWN A;  3IQL A;  2FPE A;  4RCC A;  4EMK A;  2UZD B;  2EAY A;  1X27 A;  1YHQ A;  3BFM A;  4M78 A;  4DA4 A;  1KXU A;  4A4K A;  1VQ8 A;  1UGS B;  1K0X A;  1N4M A;  3GF5 A;  1F5Q B;  3JB9 G;  2V8J A;  3MEU A;  1QW1 A;  2LT4 A;  4RUG A;  3OY9 A;  1VQO A;  4C92 B;  1ARK A;  3JCM Q;  1KSW A;  3CCR T;  1GCP A;  3VJP A;  4DBR A;  4HNV A;  1M2V B;  5J3B A;  4F7N B;  2J7I A;  4RKU E;  3UWN A;  3VUB A;  2QDL A;  1M90 C;  3PO3 S;  1VQM A;  1KJW A;  5I11 A;  4JS5 A;  2MYS A;  4BE2 A;  4EOM B;  3SEM A;  2ZPG B;  4K11 A;  5LMK B;  5LJ5 j;  3CCS A;  3DL1 A;  4L59 A;  2EQI A;  2RA2 A;  1KC8 C;  2FZK B;  2WXV B;  3MY1 B;  3CCJ T;  4CFM B;  3NMZ C;  4C8Q F;  4JLG A;  4BY6 C;  5A0D A;  3KBG A;  4AFU C;  5FU7 C;  1BCO A;  2COY A;  4M7A B;  3V7S A;  3EFO B;  1G3N C;  2CS7 A;  4J7I A;  3NTK A;  1WXT A;  3CQT A;  1JXM A;  2K9G A;  1JU5 C;  3DOG B;  3EGX A;  1JBM A;  1URC B;  2VGN A;  5KYX B;  2JOY A;  2LT1 A;  1D3B A;  3OW2 S;  1GCQ A;  3ZEH A;  1AZG B;  4M78 D;  3RUX A;  4QVC A;  1WFW A;  3X26 B;  5A0L A;  2FHD A;  4XU2 A;  2RI2 A;  1YJ9 T;  1ZLM A;  3ME9 A;  4AKI A;  2J6O A;  3CMA A;  2MMP A;  4Z89 A;  2MWO A;  1ZHI A;  5LJ3 j;  2XHC A;  1YJW A;  2M16 A;  3HKS A;  2GFU A;  3JCM V;  5GAN f;  1M2O A;  3O8V A;  2L5Q A;  1YI2 T;  1M27 C;  4PKC C;  4UC4 A;  3CCV T;  1WJS A;  4Y28 E;  1IHW A;  4PFP A;  5FWB A;  2KMT A;  1ZX6 A;  1VQ9 T;  3BHV B;  4JX5 A;  4QVZ A;  3JCM f;  4C8Q C;  1OKW B;  3QWY A;  5LJ5 e;  4J8O A;  1D1A A;  3CCL Q;  1P5E B;  5HBJ B;  1D0Y A;  4IKF A;  2EGC A;  2EYZ A;  3L2U A;  1UJY A;  2VVK A;  5L23 A;  2XI9 A;  1R77 A;  1BIA A;  4M78 G;  2X4X A;  3ER0 A;  3M0S A;  1SHF A;  4F7U A;  3OYH A;  4AKH A;  4M77 F;  2PJQ A;  1AIS B;  3CPW A;  1VQ7 T;  3BY7 A;  3MY5 B;  1I4K 1;  1RAI B;  1QLY A;  1QVF S;  1IGQ A;  3JB9 J;  4EC9 B;  1VQP T;  1XQH A;  1OPL A;  2DXC A;  4HVU A;  2C5O B;  4IUU A;  2WIP B;  2DRM A;  4DOV A;  2DL5 A;  1VQ5 A;  3V8J A;  2VWF A;  4BCQ D;  3KXT A;  3P8D A;  2QA4 Q;  3F5X B;  1M30 A;  3BW1 A;  2YHT A;  5HNB B;  2C0I A;  5IAY A;  1UG1 A;  2FB7 A;  2X51 A;  4DQ2 A;  5GAO p;  4WF2 A;  4HNT A;  4ZGE B;  1UFF A;  4AFS C;  1RAE B;  2P0Q A;  2PZ1 A;  3VUZ A;  3OBY A;  5FU6 C;  1I81 A;  1OL1 B;  3QZ9 B;  1C0M A;  4F16 A;  4ZTJ A;  4DBH A;  1QCN A;  2CUD A;  5LJ3 e;  4EOR B;  2RJD A;  1U1T A;  3RNJ A;  2QTV A;  1G8X A;  2VUB A;  4ROD A;  5KYY B;  4BE0 A;  4A63 B;  1W70 A;  2BS4 A;  3ZL7 C;  1TH7 A;  5EC7 A;  2GNC A;  1H28 B;  5GAO m;  3HO8 A;  1Y96 B;  2L2P A;  3R6N A;  1TWB A;  3SWN B;  1RAA B;  5GAO q;  2DMO A;  3G4S Q;  1AD5 A;  2DL4 A;  4II1 A;  5IH2 A;  2V8I A;  2V22 B;  1SSH A;  1I07 A;  2XD0 A;  3OSS C;  4M78 B;  4M77 C;  1Q86 R;  3CME T;  1UHF A;  2XDP A;  3I5R A;  4RG2 A;  4NL2 A;  5KYW B;  5GAN 2;  3MEA A;  1RLQ C;  2ZPB B;  4FM4 B;  4A4H A;  1YP5 A;  2AZV A;  3L2V A;  2QFZ A;  4BDY A;  4Z02 A;  2CT4 A;  2WHB B;  1RI0 A;  3G71 Q;  1MMN A;  2HEQ A;  4J9F A;  1VQ6 Q;  1VQ4 T;  5ECA A;  2COW A;  1K8A C;  3PIP A;  2CT3 A;  4PJJ A;  2ED0 A;  3POM A;  1VQL T;  5EG2 A;  3FC3 A;  4DBQ A;  2PNI A;  4M7A F;  1IRX A;  4J9D A;  1PC0 A;  2D8J A;  2ED1 A;  5CKH A;  2JW4 A;  1QLB A;  1MV3 A;  3SHW A;  1NG2 A;  4HA8 A;  3CCE A;  4KRT A;  3JB9 I;  3UA6 A;  1G83 A;  2C0O A;  2NUP A;  1H64 1;  4C92 C;  2OAU A;  2ECZ A;  2EPD A;  3JB9 F;  2G77 A;  1SRL A;  7AT1 B;  1K8A R;  4JRI A;  1H3H A;  4Q5W A;  2E5K A;  2HL5 C;  3CC4 T;  3QDF A;  4BI3 A;  2LCS A;  3PNW C;  1D3B B;  5FRM A;  1VYW B;  4AG1 C;  5IXB A;  2DD4 B;  4HT8 A;  2HBP A;  2ATC B;  2EW3 A;  1NLO C;  4CFX B;  4G6L B;  2JMC A;  2M51 A;  1VOM A;  4QVD A;  3TCJ A;  1W2B P;  4PJO B;  1N6A A;  1D3U B;  3L2Z A;  2BIV A;  1GBQ A;  4E6R A;  1K73 C;  4J9H A;  2M1H A;  4C0Z A;  4EC8 B;  2LP5 A;  4F17 A;  3CCU A;  3V7R A;  2HSE B;  4M7A C;  3O0G D;  2K3Y A;  5GMK j;  4BCI B;  3TSZ A;  1JQQ A;  2QGG A;  2CCH B;  5GAN 5;  1ZA2 B;  4ZN1 A;  3TW6 A;  3HPW A;  4JJD A;  2WJ9 A;  1B34 A;  1T0H A;  2GFA A;  4C92 E;  4ELY C;  4M7D E;  1KC8 U;  4ZGJ B;  1N8R C;  3GP8 A;  3GIB A;  1OL2 B;  3G6E Q;  1UEC A;  1VQ8 Q;  4BXX X;  1P92 A;  5HY6 A;  2KGT A;  3BG9 A;  1H3Z A;  5KE2 A;  3DTO A;  2LQW A;  3LLR A;  3JCM b;  2ZPF B;  3DDP B;  4QSH A;  3QXE B;  1GL5 A;  4RTV A;  2DIQ A;  2KT1 A;  1VQO Q;  1X01 A;  2KXC A;  1Q81 R;  1ZSG A;  3L2Q A;  4LD9 K;  1OX8 A;  4F7U B;  2DVJ A;  2VAS A;  2K57 A;  3WVD B;  4GBQ A;  2G6F X;  4A4E A;  2ZGW A;  1WI7 A;  3GTM S;  4ELZ C;  2JS2 A;  2D0Q B;  4CC7 A;  1FYN A;  1LNX A;  4OB3 B;  4EMH A;  2DXB A;  3TVT A;  2IN3 A;  3CCQ T;  5CQY A;  1PSE A;  2BS3 A;  3H41 A;  4ZNX A;  3PVL A;  1M8M A;  3LH0 A;  3CXC S;  4ELJ A;  5GAM j;  3R6O A;  4M75 A;  2E1H A;  3MEW A;  4NC6 A;  2L89 A;  5GMK i;  4FYW B;  4OGC A;  3EFS A;  1WYX A;  3NFC A;  4HLQ A;  2K4Y A;  1QVG P;  3EH2 A;  4BI8 B;  5FU7 B;  4ESR A;  3MHX A;  2F5T X;  3TRE A;  3M0R A;  2FRY A;  4XTX A;  3QZ5 B;  4BCN B;  1E6G A;  2ZPI B;  2ZZD A;  4M78 F;  2D8H A;  3M53 A;  5GMK e;  4AFZ C;  1OI9 B;  4MDX A;  4V2S A;  3EH1 A;  5D7U A;  2HMA A;  3TNI B;  3M03 A;  3HFO A;  2F2V A;  2CP6 A;  2DLP A;  2MF2 A;  2ESW A;  5CVI A;  4BCG B;  2CJM B;  3EFR A;  3VYG B;  3HSB A;  1I5O B;  2FPD A;  2LNH B;  2F2C A;  1JRI A;  4JRK A;  3CCM T;  1Q7Y C;  2JM8 A;  3CMA Q;  2BZ8 A;  2EQK A;  4Y72 B;  1QWF A;  2RK1 A;  1MHN A;  4C0D B;  2FRW A;  2DO3 A;  2C06 A;  4MZT A;  3P8H A;  2EBP A;  1BB9 A;  3JCM W;  1YN8 A;  4D6W A;  3QYH B;  4JJC A;  3UAT A;  1NJI C;  1CKA A;  4MFD A;  3LGF A;  3DKM A;  4J9G A;  1WJQ A;  2PVD B;  4EOS B;  5IN1 A;  2AK5 A;  4P5N A;  2YDL A;  2A08 A;  4KRD B;  3SWN C;  2FEI A;  1WZO A;  1AHJ B;  1AWX A;  2RM4 A;  2QGF B;  2WIH B;  4BCP B;  3G4S A;  1BI2 A;  3F70 A;  1X75 C;  2QQ9 A;  1S72 T;  5GAM e;  1PRL C;  1HXD A;  1EX4 A;  4M75 D;  4M78 C;  1RAF B;  1AVZ C;  1E6H A;  4HVV A;  1OI1 A;  3EG9 A;  2YLB A;  2NUP B;  5LJ5 g;  1JJ2 A;  4PNO A;  4YOO A;  4DEX A;  1JST B;  1Y71 A;  3G71 A;  1TOV A;  4E7J A;  1ZQ1 A;  3G7Z A;  4ME7 A;  1JJ2 P;  4BCJ B;  3X20 B;  3OS5 A;  4N4G A;  2NWM A;  2M9U A;  2D1X A;  3BG3 A;  5ACB A;  4N4H A;  4C5H A;  2EUF A;  3FRN A;  1PWT A;  4UN0 A;  4L5G A;  2A37 A;  1Q82 C;  4HVW A;  3VS4 A;  3H0I A;  3O5Z A;  1WNL A;  5D6W A;  1UHC A;  3P8B B;  4JLI A;  4JRQ A;  5DY9 A;  1VQN Q;  3E19 A;  4FSX A;  1T0J A;  1K8A U;  3NTI A;  4M75 G;  3CCL T;  2VV5 A;  2K5L A;  3CCJ A;  5GAN j;  2W9F A;  2OTJ A;  1H1P B;  2KR6 A;  1PM3 A;  2AZS A;  4D8D A;  2JGZ B;  2C6T B;  1EFN A;  1TUC A;  2DJZ A;  1G3S A;  1M1G A;  3VKH A;  1GH6 B;  2OTL A;  2RJC A;  2VC8 A;  5LJ3 g;  3QWL A;  1GUX A;  4FX3 B;  2LDM A;  2HKQ B;  1Q82 R;  4F7U F;  3HL8 A;  3FB9 A;  3ULR B;  2DTI A;  5I2M A;  4KUI A;  5I21 A;  4JJN K;  2ENM A;  3L42 A;  2KRS A;  2XU8 A;  3M59 A;  4PJN A;  1O75 A;  1X43 A;  4QQG A;  2VGM A;  1W98 B;  2DD5 B;  1AWW A;  2JM9 A;  4PJO C;  4KGX B;  1PSF A;  2FPF A;  1VQK T;  2A36 A;  2LQ8 A;  2QA4 T;  2MCN A;  3QII A;  1XNI A;  4Y92 A;  1JXO A;  2F5K A;  4LN2 A;  2KAF A;  4Z8A A;  4J9I A;  2AT1 B;  1IB8 A;  2RQV A;  2E3I A;  2DAQ A;  2DXU A;  2P4R A;  2I53 A;  2C4G B;  1RUW A;  3FDR A;  3CCV A;  1SPK A;  1ZA1 B;  3J7A F;  4FCY A;  2AKK A;  4DBF A;  3DDQ B;  3RIR A;  1KD1 C;  3EJ1 B;  2DA9 A;  1K73 U;  3CCE Q;  2RHU A;  3I56 Q;  1VUB A;  3G6E A;  4M75 B;  3PVQ A;  3RKY A;  2H8H A;  3H9N A;  1Q81 U;  4ORZ A;  1D1C A;  2QG9 B;  3A98 A;  2KRM A;  1UJ0 A;  2EYQ A;  4RTY A;  3EG3 A;  3KUF A;  2RHZ A;  1YCS B;  3FJP A;  5GAN e;  3UF4 A;  1YJN T;  4PJO E;  2RH2 A;  1PKS A;  3CD6 Q;  3NTH A;  1UGP B;  2NYS A;  1VQ7 A;  1PHT A;  2KK4 A;  4N0A A;  4IUP A;  3JCM e;  2K6D A;  3A8L B;  3VKG A;  3M9Q A;  3EG0 A;  1VQ6 T;  1QP2 A;  2A3L A;  1AEY A;  1TSF A;  2RB6 A;  4CFN B;  3CCU Q;  1WGS A;  1SG5 A;  1X6G A;  2E65 A;  4J6X A;  1M90 R;  3DLM A;  4OMM A;  4EIK A;  1FWZ A;  1YIJ A;  2LZ6 B;  1I8F A;  2ABL A;  1QKX A;  3VS6 A;  1C9B A;  2GQI A;  1OEB A;  1G3W A;  2PU9 B;  2CUB A;  1NM7 A;  2ZCF B;  1PCX A;  3VS7 A;  4OB0 B;  5IHY A;  2KDS A;  1M3C A;  1PD1 A;  1KC8 R;  1ZSZ B;  2XK0 A;  2HKN A;  1OZ3 A;  3DB3 A;  2EGA A;  3QG1 A;  1NYF A;  1Y07 A;  2V1R A;  3CC2 T;  4C0D C;  2QQB A;  2MWP A;  1GFC A;  4X9C A;  5FWC A;  3HRU A;  2E3H A;  1YIT Q;  2EQJ A;  4TVR A;  1WHG A;  3JCM X;  4LE9 A;  2HCK A;  2VB6 A;  3UPU A;  1K4U S;  1RAH B;  4MFE A;  2FL7 A;  2DNU A;  1Q7Y U;  1Q95 G;  4F7S B;  3CBP A;  4XTV A;  4KUL A;  2FO0 A;  2DM1 A;  1H27 B;  1YHQ T;  2O4X B;  4E7I A;  2QQ8 A;  1TG0 A;  4YC3 B;  5KYU A;  1NZ9 A;  3TQ7 P;  2YUO A;  5GAN 6;  3EG1 A;  2X9H A;  4Z6Y A;  3A8H B;  1VQO T;  2DTO A;  3JSC A;  5CKE A;  2ROL A;  4CI0 C;  2HDA A;  2GTJ A;  4MML A;  3M58 A;  1GUX B;  1VYU A;  2MI6 A;  4F6U B;  3M4Y A;  4XK8 E;  4CC3 A;  4E7S A;  3I55 Q;  1WPY A;  2HD0 A;  1VQM T;  2P0P A;  4XU0 A;  2CP2 A;  1KK7 A;  2XDB A;  1XTD A;  1FKM A;  3RBB B;  2XMF A;  2R58 A;  3CCS T;  4XTU A;  3QKJ A;  1RAD B;  2BE7 D;  1TTH B;  4C8Q E;  5HVY B;  4PLI A;  2E12 A;  2QEX Q;  1GRI A;  2DZ9 A;  1WXU A;  2RHY A;  1VQN A;  4QQ6 A;  3MIA B;  1M1K C;  2IVX A;  2RI3 A;  4XTY A;  2F2X A;  2QI2 A;  3VS3 A;  1IXD A;  4B9X A;  4ATO A;  3MJX A;  4M75 F;  3GPL A;  2CSI A;  2F2W A;  5LJ5 d;  4X34 A;  5CR2 A;  4RTX A;  1D0X A;  4N4I A;  1Q82 U;  6AT1 B; 
#chains in the Genus database with same CATH homology
 1VIE A;  5L8R E;  3S3N A;  2DIQ A;  3MEV A;  4EMK B;  1X01 A;  3HRS A;  2IVW A;  5D6Y A;  4C5I A;  1VQ6 A;  4PJO F;  3N5B B;  2DZC A;  3JCM c;  1VQO A;  1JJ2 S;  3QJ6 A;  3L2Q A;  4JRP A;  5IT9 E;  4LD9 K;  4F7U B;  1G3T A;  2K57 A;  1OYX A;  3WVD B;  1GXI E;  4JUV A;  4A4E A;  2ZGW A;  3AHU A;  3X25 B;  4HT9 A;  2B8A A;  5CIU A;  2OTJ T;  4ELZ C;  5CCA A;  3FLG A;  4F7U E;  2D0Q B;  1KG1 A;  3RMQ A;  4CRI A;  1LNX A;  4OB3 B;  2BUD A;  3OYD A;  2O4X A;  4EMH A;  2DXB A;  3TU4 K;  2O01 E;  3S6W A;  2OTL T;  3VKI A;  2CGH A;  4C0G A;  3CCQ T;  5CQY A;  5FU6 B;  1N9S A;  1PSE A;  2BS3 A;  5GAM g;  3CMA T;  3CC7 A;  3HBL A;  2PUK B;  1HK9 A;  5GAN d;  5DLQ E;  3CXC S;  3LH0 A;  4ELJ A;  5GAM j;  3M54 A;  2HNI A;  2X4J A;  3HP9 A;  3R6O A;  1YJW T;  4M75 A;  3CME A;  2E1H A;  3MEW A;  4NC6 A;  2L89 A;  5GMK i;  4OGC A;  2DD4 A;  3EFS A;  5GMK h;  3NFC A;  4HLQ A;  3PT9 A;  1UGQ B;  4C0F A;  4EMG A;  2K4Y A;  4O5V A;  1N27 A;  4BI8 B;  2L3R A;  4NS5 A;  5FU7 B;  3MHX A;  3CEY A;  2F5T X;  3OYY A;  3TRE A;  3QHS A;  1ZBX A;  2CZ6 B;  3A8O B;  4IUR A;  3JCM d;  1QVG S;  4PJO A;  3I55 T;  1WQW A;  2LRQ A;  2QQR A;  4XTX A;  3QZ5 B;  3LYI A;  2DKG A;  2ZPI B;  2JNG A;  5LJ3 d;  3I56 A;  1FX7 A;  2ZZD A;  4M75 C;  1YBY A;  4M78 F;  1VQ4 A;  3M53 A;  5GMK e;  2LCC A;  4BUG A;  4FIB A;  3JB9 D;  1E7P A;  3C4S A;  4ZN3 A;  3CC2 A;  2RI5 A;  3MET A;  4M77 B;  4BI4 A;  5GAM f;  4MDX A;  2JZ2 A;  4V2S A;  5DLO A;  3URG A;  2I2L A;  1VQL A;  2VXE A;  5FRN A;  2QEX T;  5HKC A;  3QYB A;  1FXX A;  3QYE A;  2XG8 D;  3CPF A;  3HFO A;  4M77 E;  2E10 A;  2RJF A;  2MF2 A;  3JCM J;  3OBW A;  4MZM A;  4VUB A;  5CVI A;  4EPC A;  4J6W A;  3EFR A;  3VYG B;  4HNU A;  2DIG A;  3HSB A;  1NJI U;  3OQ5 A;  4XQ3 A;  4OF1 A;  3OYF A;  1QVF A;  4OB2 B;  3PMI A;  1KQS S;  1JRI A;  4YTL A;  1KD1 U;  4JRK A;  3A8G B;  2M0O A;  3KHI A;  1N9R A;  3FEO A;  3H4C A;  3G6E T;  3CCM T;  1Q7Y C;  1VQ8 T;  2EQK A;  2RK1 A;  4A4F A;  2JVV A;  4BD3 A;  1MHN A;  3CD6 A;  3LW5 E;  1IRE B;  4C0D B;  2ZPE B;  2EJF A;  2MAM A;  3JCM b;  1G5V A;  3SD4 A;  2Y4Y A;  3SWN A;  1W2B A;  4JS4 A;  4LDV A;  2DO3 A;  2C06 A;  4MZT A;  3P8H A;  5GAN 4;  4RCC A;  4EMK A;  3OYE A;  3JCM W;  2EAY A;  1YHQ A;  3TW7 A;  4D6W A;  1VQ5 T;  3BFM A;  3QYH B;  1NJI C;  4EDU A;  5GAN 8;  5J26 A;  5GAM h;  4MFD A;  2EJ9 A;  3LGF A;  3DKM A;  4M78 A;  4DA4 A;  1M90 U;  4J83 A;  3HHT B;  2F69 A;  4KBM B;  3CC4 A;  4A4K A;  1WJQ A;  2PVD B;  5IN1 A;  2P0K A;  1UGS B;  3PFS A;  1VQ8 A;  2KVQ G;  3SFM A;  4P5N A;  3SWN C;  3GF5 A;  2E5Q A;  4NOY A;  4C5E A;  3JB9 G;  5CO7 A;  2V8J A;  1AHJ B;  3MEU A;  2RM4 A;  4RCB A;  1QW1 A;  3G4S A;  2LT4 A;  1BI2 A;  3M5A A;  1M1F A;  4IUT A;  3F70 A;  1X75 C;  2QQ9 A;  5CQX A;  3FIF A;  2LTO A;  3GNF B;  2RHI A;  4C92 B;  5GAM e;  2GF7 A;  1HXD A;  3CCR T;  1S72 T;  3VJP A;  4M75 D;  1LJO A;  4M78 C;  5J39 A;  3CPW S;  4HNV A;  4IUV A;  5J3B A;  1M90 C;  4RKU E;  3VUB A;  3UWN A;  5CKD A;  2DPP B;  3E9G A;  4HCB A;  4M7D F;  1OI1 A;  2Y4X A;  1Y7X A;  2YLB A;  4QW2 A;  1O9S A;  1VQM A;  4JS5 A;  2GCX A;  2DK3 A;  3M57 A;  2KQW A;  4PNO A;  5LJ5 g;  1JJ2 A;  4BE2 A;  4PJO D;  4M6V A;  2ZPG B;  2G3R A;  1Q86 C;  1Y71 A;  3G71 A;  1YIJ T;  2EFI A;  5LJ5 j;  3CCS A;  4E7J A;  3DL1 A;  1ZQ1 A;  3G7Z A;  4L59 A;  4ME7 A;  4XU1 A;  3M55 A;  3RKX A;  2RA2 A;  2DVE A;  4O6J A;  2RHX A;  4HCZ A;  3X20 B;  3E9F A;  3OS5 A;  4OGE A;  4N4G A;  1KC8 C;  2M9U A;  3LWH A;  4BE1 A;  3BG3 A;  4HCC A;  3X24 B;  3CCJ T;  3V8K A;  5LL6 S;  1K9M C;  4N4H A;  3E1S A;  4RG8 A;  3J80 E;  4C8Q F;  4JLG A;  4BY6 C;  1G3Y A;  5A0D A;  3KBG A;  3J81 E;  4C5H A;  3OYN A;  1YIT A;  2KSS A;  3FRN A;  5FU7 C;  2E6Z A;  4L5G A;  3CXC A;  4BDZ A;  1Q82 C;  5KH6 A;  4M7A B;  3V7S A;  2X35 A;  2CS7 A;  4LOC A;  1BI1 A;  3ZBD A;  4J7I A;  3SDZ A;  3A8M B;  1WNL A;  3NTK A;  5D6W A;  3VYG A;  2DXC B;  2RD1 A;  4C5G A;  5LJ5 f;  3OYJ A;  2LNV A;  3P8B B;  1LOJ A;  4LDY A;  5AYF A;  5FRO A;  3RES A;  4JLI A;  4M7A E;  4JRQ A;  5GAN g;  1JBM A;  3CBM A;  3ASK A;  3E19 A;  3MP6 A;  4FSX A;  5DY9 A;  3QDR B;  2VGN A;  5KCH A;  1K8A U;  3NTI A;  4M75 G;  3OS0 A;  4ZTF A;  1UB4 A;  2JOY A;  5CK9 A;  2LT1 A;  3CCL T;  1QVG A;  2VV5 A;  5GAO l;  2FYK A;  2K5L A;  1D3B A;  3CCJ A;  5GAN j;  3OYG A;  5GMK m;  1VIF A;  2QF7 A;  2OTJ A;  3QUI A;  3OW2 S;  2KR6 A;  3H8Z A;  1UGR B;  3ZEH A;  4E7H A;  4HKE A;  4J6Y A;  3PIO A;  3GNG A;  4M78 D;  2YLC A;  3JCM g;  3MCA B;  1SSF A;  3RUX A;  2DJZ A;  4QVC A;  4PJO G;  3X26 B;  5A0L A;  1G3S A;  1M1G A;  2FHD A;  5D6X A;  3VKH A;  2OTL A;  3HB9 A;  4XU2 A;  3CCQ A;  3CCE T;  2RI2 A;  4BAC A;  2RJC A;  3ME9 A;  1YJ9 T;  2VC8 A;  4AKI A;  3QYG B;  3QWL A;  3PMT A;  5LJ3 g;  3L2R A;  3CMA A;  2MMP A;  2LDM A;  2EKO A;  2Y90 A;  2MWO A;  2QQS A;  1ZHI A;  3HL8 A;  2R5M A;  2GQV A;  3FB9 A;  4F7U F;  2DTI A;  4FU6 A;  4KUI A;  5I2M A;  4C8Q A;  2XHC A;  5I21 A;  5LJ3 j;  3TEE A;  5GAN 7;  4JJN K;  2M16 A;  1YJW A;  3HKS A;  3L42 A;  2PVG B;  2GFU A;  2XU8 A;  3M59 A;  4L6V 5;  4NL3 A;  1O75 A;  3JCM V;  5GAN f;  3OYC A;  4QQG A;  2VGM A;  3O8V A;  2LCL A;  2L5Q A;  3V8L A;  1YI2 T;  2JTF A;  5LJ5 h;  2DD5 B;  2CYZ B;  4PKC C;  4UC4 A;  4C92 A;  3QJY A;  4PJO C;  2PVO B;  3CCV T;  4M7D A;  1PSF A;  1WJS A;  2E6N A;  1U1S A;  4X9D A;  4Y28 E;  1VQK T;  2LQ8 A;  2P4T A;  2RK2 A;  2QA4 T;  1KQ1 A;  2KMT A;  3I55 A;  3QII A;  1XNI A;  3OYA A;  1NPP A;  5FLX E;  1VQ9 T;  4QVZ A;  4JX5 A;  3JCM f;  4B9W A;  4C8Q C;  1OZ2 A;  2F5K A;  1W4S A;  2KAF A;  5LJ5 e;  2QTX A;  4J8O A;  5LJ3 f;  3PGG A;  2DAQ A;  2DEQ A;  2DXU A;  3C12 A;  2QEX A;  4C92 F;  3JCM Q;  4IKF A;  2EIF A;  2FVU A;  2WSC E;  2RJE A;  4M7D C;  4OP0 A;  3L2U A;  4LDU A;  2H3J A;  2WSE E;  3RKW A;  3FDR A;  3CCV A;  2PUO B;  3J7A F;  2XI9 A;  4KUD K;  2D6F A;  3RIR A;  1BIA A;  2X4W A;  4M78 G;  3JCM P;  1KD1 C;  4F7U G;  2VYT A;  2X4X A;  3ER0 A;  4F7U A;  1K73 U;  4Y91 A;  2CZ1 B;  2RHU A;  2XID A;  3CCM A;  1VUB A;  5GAN h;  3OYH A;  3G6E A;  4AKH A;  1M8V A;  4M75 B;  2KY9 A;  2JUF A;  4M77 F;  3OS1 A;  3OYI A;  3RKY A;  4BB7 A;  3CPW A;  3BY7 A;  1Q81 U;  1VQ7 T;  1I4K 1;  1YCY A;  1QVF S;  4EMK C;  4M75 E;  3JB9 J;  2EYQ A;  1WJR A;  1VQP T;  1XQH A;  2K3X A;  5HK0 A;  5GAO n;  4R55 A;  4IUU A;  2DXC A;  1VQN T;  3KUF A;  2RHZ A;  3JCM h;  4A53 A;  2NLU A;  4DOV A;  3FJP A;  5GAN e;  1VQ5 A;  3V8J A;  1DJ7 B;  2IG0 A;  3KXT A;  3P8D A;  5LJ3 h;  4E7L A;  3BW1 A;  3QO3 A;  4AKG A;  1R8O B;  2RH2 A;  2YHT A;  1YJN T;  4LDX A;  4PJO E;  5IAY A;  1IZ6 A;  2QQA A;  2AHJ B;  4J7F A;  4LDW A;  1Q81 C;  2FB7 A;  4DQ2 A;  3S3M A;  2RO0 A;  3NTH A;  3T9N A;  5GAO p;  1UGP B;  1VQ7 A;  2K2V A;  4WF2 A;  3RER A;  4HNT A;  4ZGE B;  2KK4 A;  4N0A A;  2EJG A;  2V8K A;  4IUP A;  3JCM e;  2P0Q A;  3M56 A;  3VUZ A;  1QP3 A;  3A8L B;  2DXT A;  3VKG A;  3M9Q A;  3OBY A;  5FU6 C;  1I81 A;  3OY9 A;  1VQ6 T;  4IUQ A;  1QP2 A;  3QZ9 B;  2PQW A;  4ZTJ A;  2A3L A;  1S72 A;  4JX4 A;  4XAX B;  1BI3 A;  4C8Q D;  5LJ3 e;  3CCR A;  2RJD A;  1U1T A;  3Q1J A;  2VUB A;  2X4Y A;  4A54 A;  5C6S A;  3VYH B;  4BE0 A;  4MDW A;  2WAC A;  3V7C A;  3HZJ A;  2RB6 A;  4M77 A;  2LVM A;  2BS4 A;  2E64 A;  1TH7 A;  4C92 D;  4M7D D;  2QDY B;  4N0A C;  5GAO m;  3OB9 A;  3HO8 A;  1Y96 B;  2JTM A;  1WGS A;  3SWN B;  2DD5 A;  2E65 A;  1M9S A;  4J6X A;  5GAO q;  5EJC A;  3DLM A;  1FWZ A;  2YRV A;  4E47 A;  1YIJ A;  2EQU A;  3OA6 A;  2XKO C;  1I8F A;  4FT2 A;  3CC7 T;  3M4G A;  2K5F A;  3OW2 A;  4II1 A;  2V8I A;  2QDJ A;  2EWN A;  2XD0 A;  3OSS C;  1BI0 A;  4QQD A;  4M78 B;  4M77 C;  4OMF B;  1BYM A;  3CME T;  2XDP A;  4RG2 A;  1G3W A;  4XTW A;  4NL2 A;  1QVP A;  2PU9 B;  3L2W A;  2QXF A;  5GAN 2;  3MEA A;  1I5L A;  2ZCF B;  2BS2 A;  2ZPB B;  4FM4 B;  4OB0 B;  2KDS A;  4MIM A;  4M78 E;  4A4H A;  2R5A A;  2K5I A;  3L2V A;  2QFZ A;  3S3O A;  3QSU A;  4OVA A;  4BDY A;  4Z02 A;  4JDS A;  3OS2 A;  1MGQ A;  1RI0 A;  2XK0 A;  3JRZ A;  4PLL A;  3GOX A;  3CBO A;  1OZ3 A;  3X28 B;  2D9T A;  5GAN 3;  3I56 T;  5GAM d;  3DB3 A;  3LGL A;  3QG1 A;  1VQ4 T;  4MMK A;  1B34 B;  1Y07 A;  1K8A C;  3PIP A;  3CC2 T;  4C8Q G;  4C0D C;  4M7A D;  2R57 A;  2QQB A;  2MWP A;  1VQL T;  5EG2 A;  3FC3 A;  3CCL A;  3LX7 A;  4X9C A;  1KQS A;  3C94 A;  3HRU A;  3PTA A;  4BY6 B;  4BBR M;  1U8R A;  3QPH A;  5HK3 A;  4C92 G;  2EQJ A;  4M7A F;  4M7D G;  3BDL A;  3RMS A;  3A5Z B;  2L8D A;  4TVR A;  4AI6 A;  1JB0 E;  3JCM X;  3UPU A;  5CKH A;  3UDC A;  3JAM E;  2A7Y A;  2LQK A;  1UEB A;  1QLB A;  2KMG A;  4MFE A;  4HA8 A;  3CCE A;  2FL7 A;  3WXM B;  1YJ9 A;  3JB9 I;  1Q7Y U;  3CD6 T;  4M7D E;  5GMK l;  1V29 B;  2E41 A;  3QBY A;  4ZGD B;  3VU3 C;  3CBP A;  4GY5 A;  5CKF A;  4DOW A;  1X6O A;  1H64 1;  4R56 A;  1NPR A;  4XTV A;  4KUL A;  3BG5 A;  4C92 C;  4BBS M;  1RL2 A;  2OAU A;  4MZP A;  3H6Z A;  4GLK A;  2G77 A;  2EQM A;  3JB9 F;  1YI2 A;  4FT4 A;  3BDU A;  1YHQ T;  2O4X B;  2HQX A;  2DXB B;  4JRI A;  4E7I A;  2CKK A;  2QQ8 A;  3MP8 A;  4M77 D;  4E7K A;  1VQK A;  4XU3 A;  2QA4 A;  1NZ9 A;  3C95 A;  4Q5W A;  3CC4 T;  2CZ0 B;  1M5Q 1;  5CKB A;  2DTH A;  5M9O A;  3CCU T;  4BI3 A;  1VQ9 A;  3EAE A;  4A4G A;  2HAX A;  3OMG A;  3PNW C;  5GAN 6;  1D3B B;  5FRM A;  3VV0 A;  1KQ2 A;  1Y96 A;  2CZ7 B;  2DD4 B;  4HT8 A;  4M7A G;  2HBP A;  3HFN A;  3G4S T;  4M7A A;  2WSF E;  4Z6Y A;  3A8H B;  4OB1 B;  3MP1 A;  4FL6 A;  5GAO r;  1VQO T;  2VXF A;  4RMO A;  2DTO A;  3JSC A;  5CKE A;  4CI0 C;  4LD6 A;  1XOV A;  4KT0 E;  4QVD A;  3TCJ A;  3OSV A;  3DB4 A;  4PJO B;  1WQ7 A;  1N6A A;  1M1K U;  5CAI A;  2XIC A;  3L2Z A;  3M58 A;  4MML A;  2BIV A;  4PL6 A;  2MI6 A;  4XK8 E;  5KCO A;  1W2B S;  3M4Y A;  2BKD N;  2M1H A;  3OYK A;  1K73 C;  2ZZD B;  2LC4 A;  1WPY A;  4C0Z A;  1KHC A;  2HD0 A;  3OYM A;  1VQM T;  4XTZ A;  3UT1 A;  1N8R U;  2P0P A;  3CCU A;  1M4Z A;  4XU0 A;  4C8Q B;  3V7R A;  2XDB A;  1XTD A;  2JN0 A;  4HL4 A;  1FKM A;  4M7A C;  3G71 T;  3DLL A;  2K3Y A;  5GMK j;  2R58 A;  3CCS T;  1Q86 U;  5C0M A;  4XTU A;  3QKJ A;  4C8Q E;  3HRT A;  4PLI A;  2E12 A;  5I2S A;  5A0G A;  2ZPH B;  2DZ9 A;  1BIB A;  5GAN 5;  4M7D B;  4J5Y A;  1VQP A;  4ZN1 A;  2RHY A;  1VQN A;  3OMC A;  4QQ6 A;  1M1K C;  3TW6 A;  2RI3 A;  3HPW A;  4XTY A;  5KE3 A;  2WJ9 A;  1B34 A;  1EIF A;  2QI2 A;  3MO8 A;  3WVE B;  2GFA A;  3L1A A;  4C92 E;  4ELY C;  4B9X A;  3JB9 H;  2HQE A;  3INZ A;  3SB2 A;  5DM7 R;  4ZGJ B;  5A2Q E;  1KC8 U;  3GLX A;  1NE8 A;  4M77 G;  3OYL A;  1N8R C;  2E70 A;  3GP8 A;  3GIB A;  1K9M U;  1KHI A;  1BKB A;  3OYB A;  4ATO A;  4M75 F;  3GPL A;  1YJN A;  1YIT T;  2XDD A;  1P92 A;  5HY6 A;  2LX9 A;  5LJ5 d;  3BG9 A;  4JX6 A;  4X34 A;  5KE2 A;  1H3Z A;  3ZFJ A;  5CR2 A;  3LWI A;  4N4I A;  1Q82 U;  3LLR A;  2ZPF B;  4QSH A;  3QXE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...