4KRDB

Crystal structure of pho85-pcl10 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
SENPLLHGIPVDVEVPHISVDEALANFKETIELLLKLSGNRKCTGFNTRVEKKEYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKLAASKLLLNELRSFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords Cyclin-dependent protein kinase PHO85
publication title New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08613 Cyclin Cyclin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4krdB00
2R7GA 2UUEB 4KRCB 4EOPB 3G33B 1H24B 1UNLD 4BCQD 3BHTB 4BCQB 2WIPB 2UZBB 2W96A 4BCKB 4F6SB 4F7JB 2EUFA 5CEIB 1H4LD 5IF1B 1OI9B 4EOLB 1F5QB 2CCIB 4BCOB 4ELJA 4F6UB 5ICPB 5HBEB 4EC8B 4TTHA 3TNIB 2JGZB 1AD6A 5LQFB 3BLQB 4EOJB 2PK2A 1QMZB 1XO2A 4G6LB 4EC9B 4BCMD 4YOSA 5HBHB 1D3UB 4CFVB 2I40B 2UZDB 1OIUB 5HQ0B 1JSUB 2IW8B 3MI9B 2CJMB 1PKDB 3BHVB 1FVVB 1KXUA 3QHRB 4BCPB 2WFYB 4CFUD 1UNHD 3RGFB 5L2WB 2I53A 4KRDB 4UN0A 4IMYB 2IVXA 2V22B 1H27B 1ZP2A 2WMBB 2X1NB 4CFXB 3M03A 4ROEA 2W99A 4NSTB 3POMA 4EOKB 4YOOA 4EOIB 5HVYB 3BLRB 1W98B 4II5B 1H1PB 4YOZA 2IW6B 4OGRB 2WIHB 4BCND 4BCMB 4BCHB 4EOMB 1VINA 5HBJB 1UNGD 3EIDB 1H25B 1URCB 3EJ1B 1OL1B 2WMAB 3MY5B 1E9HB 2C5XB 1TFBA 3O0GD 1GY3B 1JSTB 1H1SB 2WPAB 4I3ZB 5HNBB 3TN8B 4F7LB 2BKZB 4CFUB 2W9FA 1GUXB 3H4CA 4YC3B 2W9ZA 5I5ZB 4CRLB 1BU2A 1VYWB 2B9RA 5EFQB 5BNJB 1JKWA 1C9BA 4BCIB 4EOOB 3DDQB 4EOSB 2PK9B 1O9KB 2WEVB 1OGUB 3BHUB 2G9XB 2CCHB 2WHBB 3MIAB 4CFWB 4EONB 1G3NC 1GUXA 5IDPB 4OR5B 5IDNB 4CXAB 1JOWA 4BCFB 3EOCB 2C4GB 4EOQB 4Y72B 4BCNB 2C5VB 1H28B 4F7SB 1OKVB 4BCJB 4ELLA 1H1RB 1O9KA 1P5EB 2PMIB 1OKWB 4EORB 5FGKB 2IW9B 2BPMB 4CFMB 3MY1B 2C5OB 3DDPB 4FX3B 4CFNB 4F7NB 1AISB 1N4MA 3F5XB 4BCGB 5ACBA 2UZLB 1FINB 3QHWB 3DOGB 3TNHB 3BLHB 3LQ5B 2W2HA 1VOLA 2WXVB 4RODA 3K7AM 1OL2B 4ROCA 5LMKB 3TNWB 2C6TB 5CYIB 2PHGA 1H26B 1H1QB 1GH6B 2QDJA 4F6WB 1OIYB 2UZEB 2C5NB 2F2CA 4F70B
chains in the Genus database with same CATH superfamily
2DD4B 2R7GA 2UUEB 4EOPB 4HNTA 3BG5A 4HNUA 4F6SB 1H4LD 4EOLB 3QYGB 2CCIB 4ELJA 5HBEB 5LQFB 4G6LB 4EC9B 3TW6A 4YOSA 1UGRB 2DD5B 3A8HB 2UZDB 4OB1B 4AKGA 3MI9B 3BHVB 3QHRB 4BCPB 3RGFB 5L2WB 2I53A 4KRDB 2QFZA 4IMYB 2V22B 2WMBB 2X1NB 4CFXB 4ROEA 2W99A 4BXXX 4NSTB 4EOIB 3BLRB 1W98B 4II5B 2IW6B 4EOMB 3QYEA 1VINA 2ZPFB 3EIDB 3DL1A 1H25B 1URCB 3O0GD 1E9HB 2C5XB 1UGPB 2DMEA 5HNBB 3VYHB 3TN8B 4CFUB 4YC3B 5I5ZB 4ZGJB 2B9RA 5EFQB 3A8GB 2CZ6B 2PJQA 4EOSB 1O9KB 2BS2A 4ZGEB 3X26B 4EONB 1G3NC 5IDPB 3B57A 4EOQB 2G77A 1FKMA 2C5VB 1H28B 4EORB 2WJ9A 2BPMB 4CFMB 3MY1B 2C5OB 3DDPB 4CFNB 3A8LB 3DOGB 3K7AM 3QYHB 4AKHA 1E7PA 2QDJA 1QLBA 4F6WB 2UZLB 4KRCB 3G33B 1H24B 3BHTB 4QSHA 4BCQB 3HHTB 4BCKB 2EUFA 4M6VA 3TNIB 2JGZB 1QMZB 3QXEB 2ZPIB 4CFVB 2IN3A 5HQ0B 3HB9A 2CJMB 1KXUA 2KR6A 2WFYB 4CFUD 3WVEB 3A8OB 3HO8A 3X20B 3QWLA 1H1PB 2QGSA 2WIHB 4BCMB 4BCHB 3HBLA 4BY1X 3EJ1B 1OL1B 3QZ9B 1H1SB 3X24B 1GUXB 2QDYB 5BNJB 3NDQA 1C9BA 4BCIB 4EOOB 1OGUB 1UGSB 2ZPHB 4OR5B 1JOWA 2C4GB 4OB2B 2ZCFB 4FM4B 3QZ5B 1O9KA 5FGKB 2ZPBB 1ENWA 4FX3B 2AHJB 5ACBA 1FINB 3QHWB 3TNHB 3LQ5B 4RODA 2DXBB 2C6TB 1H26B 1H1QB 3A8MB 2C5NB 1UNLD 1V29B 2W96A 1OI9B 5EJCA 4BCOB 1XO2A 4JX6A 4BCMD 5HBHB 4HNVA 3PO3S 2I40B 1OIUB 2DXCB 3QYBA 1UNHD 2KMGA 2ZPEB 2QQ8A 3BG3A 3M03A 4LOCA 4HL4A 5DQWA 2CZ7B 2CYZB 3GTMS 1UNGD 1GY3B 3BG9A 2WPAB 3VYGB 4BBSM 2W9FA 1UGQB 4BBRM 2W9ZA 3DDQB 3HZJA 2CZ1B 2PK9B 2G9XB 4JX4A 2WHBB 1GUXA 4BY7X 5IDNB 4BCFB 3EOCB 4Y72B 4NC6A 4BCNB 3X25B 4MIMA 4ELLA 4BCJB 2LW4A 2BS4A 1N4MA 3BLHB 1VOLA 1OL2B 5LMKB 3TNWB 5CYIB 2PHGA 3TW7A 1GH6B 2D0QB 3DJBA 3VKHA 1OIYB 1TFBA 4F70B 4ZGDB 4BCQD 2WIPB 2UZBB 4F7JB 5CEIB 4OB3B 4JX5A 5IF1B 1TD6A 1F5QB 4F6UB 1IREB 5ICPB 4EC8B 4TTHA 1AD6A 4AI6A 3BLQB 4EOJB 2PK2A 5IHYA 1D3UB 1JSUB 2IW8B 1PKDB 1FVVB 4UN0A 2IVXA 4MFDA 3X28B 1H27B 1ZP2A 3POMA 4EOKB 4YOOA 5HVYB 4YOZA 4OGRB 4BCND 4OB0B 5HBJB 3MY5B 2WMAB 2BS3A 4AKIA 1JSTB 4I3ZB 4F7LB 2BKZB 3H4CA 4CRLB 1BU2A 1VYWB 1JKWA 2CZ0B 2WEVB 2ZZDB 3BHUB 3KHIA 3WVDB 3MIAB 2CCHB 4CFWB 4Z6YA 5DQVA 4CXAB 4F7SB 1OKVB 1H1RB 1P5EB 2PMIB 1OKWB 2IW9B 4F7NB 1AISB 3F5XB 4BCGB 4HLQA 2W2HA 2WXVB 4ROCA 1AHJB 2DPPB 3DTOA 2ZPGB 2QF7A 2UZEB 2F2CA 4MFEA 3VKGA
chains in the Genus database with same CATH topology
2R7GA 2UUEB 4KRCB 4EOPB 3G33B 1H24B 1UNLD 4BCQD 3BHTB 4BCQB 2WIPB 2UZBB 2W96A 4BCKB 4F6SB 4F7JB 2EUFA 5CEIB 1H4LD 5IF1B 1OI9B 4EOLB 1F5QB 2CCIB 4BCOB 4ELJA 4F6UB 5ICPB 5HBEB 4EC8B 4TTHA 3TNIB 2JGZB 1AD6A 5LQFB 3BLQB 4EOJB 2PK2A 1QMZB 1XO2A 4G6LB 4EC9B 4BCMD 4YOSA 5HBHB 1D3UB 4CFVB 2I40B 2UZDB 1OIUB 5HQ0B 1JSUB 2IW8B 3MI9B 2CJMB 1PKDB 3BHVB 1FVVB 1KXUA 3QHRB 4BCPB 2WFYB 4CFUD 1UNHD 3RGFB 5L2WB 2I53A 4KRDB 4UN0A 4IMYB 2IVXA 2V22B 1H27B 1ZP2A 2WMBB 2X1NB 4CFXB 3M03A 4ROEA 2W99A 4NSTB 3POMA 4EOKB 4YOOA 4EOIB 5HVYB 3BLRB 1W98B 4II5B 1H1PB 4YOZA 2IW6B 4OGRB 2WIHB 4BCND 4BCMB 4BCHB 4EOMB 1VINA 5HBJB 1UNGD 3EIDB 1H25B 1URCB 3EJ1B 1OL1B 2WMAB 3MY5B 1E9HB 2C5XB 1TFBA 3O0GD 1GY3B 1JSTB 1H1SB 2WPAB 4I3ZB 5HNBB 3TN8B 4F7LB 2BKZB 4CFUB 2W9FA 1GUXB 3H4CA 4YC3B 2W9ZA 5I5ZB 4CRLB 1BU2A 1VYWB 2B9RA 5EFQB 5BNJB 1JKWA 1C9BA 4BCIB 4EOOB 3DDQB 4EOSB 2PK9B 1O9KB 2WEVB 1OGUB 3BHUB 2G9XB 2CCHB 2WHBB 3MIAB 4CFWB 4EONB 1G3NC 1GUXA 5IDPB 4OR5B 5IDNB 4CXAB 1JOWA 4BCFB 3EOCB 2C4GB 4EOQB 4Y72B 4BCNB 2C5VB 1H28B 4F7SB 1OKVB 4BCJB 4ELLA 1H1RB 1O9KA 1P5EB 2PMIB 1OKWB 4EORB 5FGKB 2IW9B 2BPMB 4CFMB 3MY1B 2C5OB 3DDPB 4FX3B 4CFNB 4F7NB 1AISB 1N4MA 3F5XB 4BCGB 5ACBA 2UZLB 1FINB 3QHWB 3DOGB 3TNHB 3BLHB 3LQ5B 2W2HA 1VOLA 2WXVB 4RODA 3K7AM 1OL2B 4ROCA 5LMKB 3TNWB 2C6TB 5CYIB 2PHGA 1H26B 1H1QB 1GH6B 2QDJA 4F6WB 1OIYB 2UZEB 2C5NB 2F2CA 4F70B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7G A;  2UUE B;  4KRC B;  4EOP B;  3G33 B;  1H24 B;  1UNL D;  4BCQ D;  3BHT B;  4BCQ B;  2WIP B;  2UZB B;  2W96 A;  4BCK B;  4F6S B;  4F7J B;  2EUF A;  5CEI B;  1H4L D;  5IF1 B;  1OI9 B;  4EOL B;  1F5Q B;  2CCI B;  4BCO B;  4ELJ A;  4F6U B;  5ICP B;  5HBE B;  4EC8 B;  4TTH A;  3TNI B;  2JGZ B;  1AD6 A;  5LQF B;  3BLQ B;  4EOJ B;  2PK2 A;  1QMZ B;  1XO2 A;  4G6L B;  4EC9 B;  4BCM D;  4YOS A;  5HBH B;  1D3U B;  4CFV B;  2I40 B;  2UZD B;  1OIU B;  5HQ0 B;  1JSU B;  2IW8 B;  3MI9 B;  2CJM B;  1PKD B;  3BHV B;  1FVV B;  1KXU A;  3QHR B;  4BCP B;  2WFY B;  4CFU D;  1UNH D;  3RGF B;  5L2W B;  2I53 A;  4KRD B;  4UN0 A;  4IMY B;  2IVX A;  2V22 B;  1H27 B;  1ZP2 A;  2WMB B;  2X1N B;  4CFX B;  3M03 A;  4ROE A;  2W99 A;  4NST B;  3POM A;  4EOK B;  4YOO A;  4EOI B;  5HVY B;  3BLR B;  1W98 B;  4II5 B;  1H1P B;  4YOZ A;  2IW6 B;  4OGR B;  2WIH B;  4BCN D;  4BCM B;  4BCH B;  4EOM B;  1VIN A;  5HBJ B;  1UNG D;  3EID B;  1H25 B;  1URC B;  3EJ1 B;  1OL1 B;  2WMA B;  3MY5 B;  1E9H B;  2C5X B;  1TFB A;  3O0G D;  1GY3 B;  1JST B;  1H1S B;  2WPA B;  4I3Z B;  5HNB B;  3TN8 B;  4F7L B;  2BKZ B;  4CFU B;  2W9F A;  1GUX B;  3H4C A;  4YC3 B;  2W9Z A;  5I5Z B;  4CRL B;  1BU2 A;  1VYW B;  2B9R A;  5EFQ B;  5BNJ B;  1JKW A;  1C9B A;  4BCI B;  4EOO B;  3DDQ B;  4EOS B;  2PK9 B;  1O9K B;  2WEV B;  1OGU B;  3BHU B;  2G9X B;  2CCH B;  2WHB B;  3MIA B;  4CFW B;  4EON B;  1G3N C;  1GUX A;  5IDP B;  4OR5 B;  5IDN B;  4CXA B;  1JOW A;  4BCF B;  3EOC B;  2C4G B;  4EOQ B;  4Y72 B;  4BCN B;  2C5V B;  1H28 B;  4F7S B;  1OKV B;  4BCJ B;  4ELL A;  1H1R B;  1O9K A;  1P5E B;  2PMI B;  1OKW B;  4EOR B;  5FGK B;  2IW9 B;  2BPM B;  4CFM B;  3MY1 B;  2C5O B;  3DDP B;  4FX3 B;  4CFN B;  4F7N B;  1AIS B;  1N4M A;  3F5X B;  4BCG B;  5ACB A;  2UZL B;  1FIN B;  3QHW B;  3DOG B;  3TNH B;  3BLH B;  3LQ5 B;  2W2H A;  1VOL A;  2WXV B;  4ROD A;  3K7A M;  1OL2 B;  4ROC A;  5LMK B;  3TNW B;  2C6T B;  5CYI B;  2PHG A;  1H26 B;  1H1Q B;  1GH6 B;  2QDJ A;  4F6W B;  1OIY B;  2UZE B;  2C5N B;  2F2C A;  4F70 B; 
#chains in the Genus database with same CATH topology
 2DD4 B;  2R7G A;  2UUE B;  4EOP B;  4HNT A;  3BG5 A;  4HNU A;  4F6S B;  1H4L D;  4EOL B;  3QYG B;  2CCI B;  4ELJ A;  5HBE B;  5LQF B;  4G6L B;  4EC9 B;  3TW6 A;  4YOS A;  1UGR B;  2DD5 B;  3A8H B;  2UZD B;  4OB1 B;  4AKG A;  3MI9 B;  3BHV B;  3QHR B;  4BCP B;  3RGF B;  5L2W B;  2I53 A;  4KRD B;  2QFZ A;  4IMY B;  2V22 B;  2WMB B;  2X1N B;  4CFX B;  4ROE A;  2W99 A;  4BXX X;  4NST B;  4EOI B;  3BLR B;  1W98 B;  4II5 B;  2IW6 B;  4EOM B;  3QYE A;  1VIN A;  2ZPF B;  3EID B;  3DL1 A;  1H25 B;  1URC B;  3O0G D;  1E9H B;  2C5X B;  1UGP B;  2DME A;  5HNB B;  3VYH B;  3TN8 B;  4CFU B;  4YC3 B;  5I5Z B;  4ZGJ B;  2B9R A;  5EFQ B;  3A8G B;  2CZ6 B;  2PJQ A;  4EOS B;  1O9K B;  2BS2 A;  4ZGE B;  3X26 B;  4EON B;  1G3N C;  5IDP B;  3B57 A;  4EOQ B;  2G77 A;  1FKM A;  2C5V B;  1H28 B;  4EOR B;  2WJ9 A;  2BPM B;  4CFM B;  3MY1 B;  2C5O B;  3DDP B;  4CFN B;  3A8L B;  3DOG B;  3K7A M;  3QYH B;  4AKH A;  1E7P A;  2QDJ A;  1QLB A;  4F6W B;  2UZL B;  4KRC B;  3G33 B;  1H24 B;  3BHT B;  4QSH A;  4BCQ B;  3HHT B;  4BCK B;  2EUF A;  4M6V A;  3TNI B;  2JGZ B;  1QMZ B;  3QXE B;  2ZPI B;  4CFV B;  2IN3 A;  5HQ0 B;  3HB9 A;  2CJM B;  1KXU A;  2KR6 A;  2WFY B;  4CFU D;  3WVE B;  3A8O B;  3HO8 A;  3X20 B;  3QWL A;  1H1P B;  2QGS A;  2WIH B;  4BCM B;  4BCH B;  3HBL A;  4BY1 X;  3EJ1 B;  1OL1 B;  3QZ9 B;  1H1S B;  3X24 B;  1GUX B;  2QDY B;  5BNJ B;  3NDQ A;  1C9B A;  4BCI B;  4EOO B;  1OGU B;  1UGS B;  2ZPH B;  4OR5 B;  1JOW A;  2C4G B;  4OB2 B;  2ZCF B;  4FM4 B;  3QZ5 B;  1O9K A;  5FGK B;  2ZPB B;  1ENW A;  4FX3 B;  2AHJ B;  5ACB A;  1FIN B;  3QHW B;  3TNH B;  3LQ5 B;  4ROD A;  2DXB B;  2C6T B;  1H26 B;  1H1Q B;  3A8M B;  2C5N B;  1UNL D;  1V29 B;  2W96 A;  1OI9 B;  5EJC A;  4BCO B;  1XO2 A;  4JX6 A;  4BCM D;  5HBH B;  4HNV A;  3PO3 S;  2I40 B;  1OIU B;  2DXC B;  3QYB A;  1UNH D;  2KMG A;  2ZPE B;  2QQ8 A;  3BG3 A;  3M03 A;  4LOC A;  4HL4 A;  5DQW A;  2CZ7 B;  2CYZ B;  3GTM S;  1UNG D;  1GY3 B;  3BG9 A;  2WPA B;  3VYG B;  4BBS M;  2W9F A;  1UGQ B;  4BBR M;  2W9Z A;  3DDQ B;  3HZJ A;  2CZ1 B;  2PK9 B;  2G9X B;  4JX4 A;  2WHB B;  1GUX A;  4BY7 X;  5IDN B;  4BCF B;  3EOC B;  4Y72 B;  4NC6 A;  4BCN B;  3X25 B;  4MIM A;  4ELL A;  4BCJ B;  2LW4 A;  2BS4 A;  1N4M A;  3BLH B;  1VOL A;  1OL2 B;  5LMK B;  3TNW B;  5CYI B;  2PHG A;  3TW7 A;  1GH6 B;  2D0Q B;  3DJB A;  3VKH A;  1OIY B;  1TFB A;  4F70 B;  4ZGD B;  4BCQ D;  2WIP B;  2UZB B;  4F7J B;  5CEI B;  4OB3 B;  4JX5 A;  5IF1 B;  1TD6 A;  1F5Q B;  4F6U B;  1IRE B;  5ICP B;  4EC8 B;  4TTH A;  1AD6 A;  4AI6 A;  3BLQ B;  4EOJ B;  2PK2 A;  5IHY A;  1D3U B;  1JSU B;  2IW8 B;  1PKD B;  1FVV B;  4UN0 A;  2IVX A;  4MFD A;  3X28 B;  1H27 B;  1ZP2 A;  3POM A;  4EOK B;  4YOO A;  5HVY B;  4YOZ A;  4OGR B;  4BCN D;  4OB0 B;  5HBJ B;  3MY5 B;  2WMA B;  2BS3 A;  4AKI A;  1JST B;  4I3Z B;  4F7L B;  2BKZ B;  3H4C A;  4CRL B;  1BU2 A;  1VYW B;  1JKW A;  2CZ0 B;  2WEV B;  2ZZD B;  3BHU B;  3KHI A;  3WVD B;  3MIA B;  2CCH B;  4CFW B;  4Z6Y A;  5DQV A;  4CXA B;  4F7S B;  1OKV B;  1H1R B;  1P5E B;  2PMI B;  1OKW B;  2IW9 B;  4F7N B;  1AIS B;  3F5X B;  4BCG B;  4HLQ A;  2W2H A;  2WXV B;  4ROC A;  1AHJ B;  2DPP B;  3DTO A;  2ZPG B;  2QF7 A;  2UZE B;  2F2C A;  4MFE A;  3VKG A; 
#chains in the Genus database with same CATH homology
 2R7G A;  2UUE B;  4KRC B;  4EOP B;  3G33 B;  1H24 B;  1UNL D;  4BCQ D;  3BHT B;  4BCQ B;  2WIP B;  2UZB B;  2W96 A;  4BCK B;  4F6S B;  4F7J B;  2EUF A;  5CEI B;  1H4L D;  5IF1 B;  1OI9 B;  4EOL B;  1F5Q B;  2CCI B;  4BCO B;  4ELJ A;  4F6U B;  5ICP B;  5HBE B;  4EC8 B;  4TTH A;  3TNI B;  2JGZ B;  1AD6 A;  5LQF B;  3BLQ B;  4EOJ B;  2PK2 A;  1QMZ B;  1XO2 A;  4G6L B;  4EC9 B;  4BCM D;  4YOS A;  5HBH B;  1D3U B;  4CFV B;  2I40 B;  2UZD B;  1OIU B;  5HQ0 B;  1JSU B;  2IW8 B;  3MI9 B;  2CJM B;  1PKD B;  3BHV B;  1FVV B;  1KXU A;  3QHR B;  4BCP B;  2WFY B;  4CFU D;  1UNH D;  3RGF B;  5L2W B;  2I53 A;  4KRD B;  4UN0 A;  4IMY B;  2IVX A;  2V22 B;  1H27 B;  1ZP2 A;  2WMB B;  2X1N B;  4CFX B;  3M03 A;  4ROE A;  2W99 A;  4NST B;  3POM A;  4EOK B;  4YOO A;  4EOI B;  5HVY B;  3BLR B;  1W98 B;  4II5 B;  1H1P B;  4YOZ A;  2IW6 B;  4OGR B;  2WIH B;  4BCN D;  4BCM B;  4BCH B;  4EOM B;  1VIN A;  5HBJ B;  1UNG D;  3EID B;  1H25 B;  1URC B;  3EJ1 B;  1OL1 B;  2WMA B;  3MY5 B;  1E9H B;  2C5X B;  1TFB A;  3O0G D;  1GY3 B;  1JST B;  1H1S B;  2WPA B;  4I3Z B;  5HNB B;  3TN8 B;  4F7L B;  2BKZ B;  4CFU B;  2W9F A;  1GUX B;  3H4C A;  4YC3 B;  2W9Z A;  5I5Z B;  4CRL B;  1BU2 A;  1VYW B;  2B9R A;  5EFQ B;  5BNJ B;  1JKW A;  1C9B A;  4BCI B;  4EOO B;  3DDQ B;  4EOS B;  2PK9 B;  1O9K B;  2WEV B;  1OGU B;  3BHU B;  2G9X B;  2CCH B;  2WHB B;  3MIA B;  4CFW B;  4EON B;  1G3N C;  1GUX A;  5IDP B;  4OR5 B;  5IDN B;  4CXA B;  1JOW A;  4BCF B;  3EOC B;  2C4G B;  4EOQ B;  4Y72 B;  4BCN B;  2C5V B;  1H28 B;  4F7S B;  1OKV B;  4BCJ B;  4ELL A;  1H1R B;  1O9K A;  1P5E B;  2PMI B;  1OKW B;  4EOR B;  5FGK B;  2IW9 B;  2BPM B;  4CFM B;  3MY1 B;  2C5O B;  3DDP B;  4FX3 B;  4CFN B;  4F7N B;  1AIS B;  1N4M A;  3F5X B;  4BCG B;  5ACB A;  2UZL B;  1FIN B;  3QHW B;  3DOG B;  3TNH B;  3BLH B;  3LQ5 B;  2W2H A;  1VOL A;  2WXV B;  4ROD A;  3K7A M;  1OL2 B;  4ROC A;  5LMK B;  3TNW B;  2C6T B;  5CYI B;  2PHG A;  1H26 B;  1H1Q B;  1GH6 B;  2QDJ A;  4F6W B;  1OIY B;  2UZE B;  2C5N B;  2F2C A;  4F70 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...