4KRDB

Crystal structure of pho85-pcl10 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
190
structure length
190
Chain Sequence
b'SENPLLHGIPVDVEVPHISVDEALANFKETIELLLKLSGNRKCTGFNTRVEKKEYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKLAASKLLLNELRSFC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclin-dependent protein kinase PHO85
publication title New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/signaling protein
total genus 72
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08613 Cyclin Cyclin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4krdB00
4YOZA 2PK9B 2UZBB 4F7NB 4BCKB 1H1QB 4EONB 5EFQB 4BCGB 4F7SB 1OKVB 1GY3B 2JGZB 4BCPB 1JSUB 4CXAB 2I53A 2CJMB 5LMKB 3DOGB 4CFVB 3TN8B 3BLHB 2WXVB 4OR5B 4BCQB 4EORB 1AISB 5FGKB 2WEVB 3TNHB 2UZLB 2W9ZA 4FX3B 4BCMB 4OGRB 1KXUA 1JSTB 1H27B 4CRLB 1URCB 2C5VB 5HBJB 1OIYB 4BCIB 3DDQB 3H4CA 4UN0A 1JKWA 3M03A 1UNHD 3G33B 2UZEB 2IW8B 1AD6A 2WIHB 4BCND 4CFUB 2WFYB 1H25B 3EOCB 4ELJA 1QMZB 4EOSB 1W98B 3BLRB 4KRCB 1JOWA 3BHTB 4G6LB 4ROEA 3POMA 4YOSA 1OIUB 3BHVB 3BLQB 4EOPB 4F7LB 3LQ5B 1N4MA 1FINB 1H1RB 5ICPB 4CFMB 4CFNB 4EOLB 4CFWB 2W2HA 2C5OB 3EJ1B 4F6SB 4EOJB 3BHUB 2BPMB 4Y72B 2UZDB 2C5NB 1OI9B 3RGFB 1VOLA 4EOMB 2WHBB 1D3UB 5L2WB 2V22B 4YC3B 1H1PB 4I3ZB 2W9FA 1UNLD 1H24B 3DDPB 1BU2A 1PKDB 4YOOA 5I5ZB 3EIDB 4EOOB 1OKWB 4F6WB 5CEIB 1VINA 2WPAB 2WMBB 3MI9B 1P5EB 4KRDB 5HVYB 1F5QB 2WMAB 4NSTB 5BNJB 3TNWB 5HQ0B 1H28B 4F6UB 4BCHB 5IF1B 5ACBA 1GUXB 1C9BA 4II5B 4TTHA 3MIAB 4RODA 3F5XB 5IDNB 2F2CA 4BCNB 2BKZB 2X1NB 4BCQD 3O0GD 1E9HB 1GH6B 2IW6B 5HBHB 5IDPB 2PMIB 4EOIB 1XO2A 4BCMD 4EOKB 1FVVB 1H26B 1TFBA 2EUFA 2WIPB 4CFXB 2PHGA 2C5XB 2C4GB 2IW9B 4ELLA 2UUEB 2CCHB 1OL1B 1OL2B 1VYWB 2PK2A 3MY5B 4IMYB 4BCOB 4EC8B 2I40B 1H4LD 2G9XB 4EOQB 2C6TB 5CYIB 1UNGD 4ROCA 1GUXA 3TNIB 4BCJB 3QHWB 2CCIB 4EC9B 1G3NC 1OGUB 1H1SB 4CFUD 2QDJA 3MY1B 5HNBB 5HBEB 2B9RA 4BCFB 1O9KA 4F70B 2IVXA 2W99A 2W96A 5LQFB 1ZP2A 4F7JB 1O9KB 2R7GA 3K7AM 3QHRB
chains in the Genus database with same CATH superfamily
4YOZA 2UZBB 5DQVA 2D0QB 2LW4A 2KMGA 2QDYB 4Z6YA 4BCPB 4CXAB 2CJMB 4CFVB 4OR5B 1AISB 2ZZDB 5FGKB 1KXUA 3VKHA 2DPPB 2QFZA 1URCB 2C5VB 3QYBA 4ZGEB 4UN0A 1JKWA 3A8HB 3M03A 3G33B 2BS4A 2ZPBB 1ENWA 1H25B 2G77A 3BLRB 4KRCB 3QYHB 1JOWA 1N4MA 1FINB 4CFNB 4EOJB 3BHUB 2UZDB 3RGFB 2V22B 4OB2B 2W9FA 1UNLD 1H24B 3DDPB 3HBLA 3EIDB 3VYHB 3MI9B 2KR6A 4NSTB 5BNJB 3KHIA 5HQ0B 4F6UB 3HZJA 5ACBA 4TTHA 4ZGJB 5IDNB 2ZCFB 2IW6B 1GH6B 5HBHB 4EOIB 4BCMD 4HNVA 2C5XB 3A8OB 2IW9B 4ELLA 2ZPFB 1OL1B 3MY5B 4EC8B 2I40B 4QSHA 3X28B 5CYIB 4CFUD 3MY1B 4AKHA 2B9RA 4BCFB 4AI6A 2WJ9A 2PK9B 4EONB 5EFQB 4F7SB 1GY3B 2CZ1B 2JGZB 1JSUB 2I53A 2QGSA 2WXVB 4EORB 2WEVB 1UGQB 4BCMB 5EJCA 3H4CA 2IW8B 1AD6A 1E7PA 4CFUB 2WFYB 2CZ6B 3HO8A 4ELJA 3BHTB 4G6LB 4ROEA 3BHVB 3BG9A 5DQWA 1H1RB 4EOLB 3EJ1B 2BPMB 4NC6A 4Y72B 1AHJB 1H1PB 4I3ZB 3DJBA 4YOOA 2DD5B 2BS2A 4LOCA 4F6WB 1VINA 2WPAB 2WMBB 3A8MB 1P5EB 5HVYB 3HB9A 3TNWB 1H28B 5IF1B 2BS3A 4II5B 2F2CA 3O0GD 5IDPB 4JX5A 2PMIB 3TW6A 1XO2A 1H26B 2WIPB 2QQ8A 4IMYB 4BCOB 2PK2A 3HHTB 4BXXX 1UNGD 3QHWB 2CCIB 4EC9B 1H1SB 4MIMA 3NDQA 4OB1B 3QXEB 4F7JB 1O9KB 2R7GA 3QYEA 1H1QB 2IN3A 1OKVB 2ZPIB 2CYZB 3BLHB 3GTMS 3A8LB 3TNHB 4FX3B 4BBRM 2DXCB 1H27B 4CRLB 4BBSM 4BCIB 1OIYB 3QZ9B 1UNHD 2UZEB 2ZPEB 2WIHB 4BCND 3B57A 1IREB 3EOCB 1QMZB 1W98B 4HLQA 4YOSA 3BLQB 4EOPB 4CFMB 4CFWB 3TW7A 2W2HA 3X24B 4F6SB 2C5NB 1OI9B 3VYGB 4HNUA 4EOMB 2WHBB 1D3UB 1V29B 4YC3B 3X25B 3DTOA 3A8GB 1BU2A 1PKDB 2CZ7B 3DL1A 1OKWB 5CEIB 4M6VA 3QZ5B 2WMAB 4AKIA 1QLBA 4FM4B 4BCNB 2BKZB 2X1NB 4BCQD 1E9HB 1TFBA 2EUFA 2PHGA 3WVDB 2UUEB 2DD4B 1H4LD 2G9XB 2C6TB 1GUXA 3TNIB 4BCJB 1G3NC 5HNBB 5HBEB 2IVXA 2W99A 2DMEA 1ZP2A 3K7AM 3QHRB 4F7NB 4BCKB 4HL4A 4BCGB 1TD6A 4MFDA 5LMKB 3DOGB 3TN8B 4BCQB 1UGSB 2UZLB 2W9ZA 4OGRB 3VKGA 1JSTB 5HBJB 3DDQB 4BY7X 4OB0B 4EOSB 4HNTA 3POMA 1OIUB 4F7LB 3LQ5B 4MFEA 5ICPB 2AHJB 2DXBB 2C5OB 4BY1X 1VOLA 5L2WB 2PJQA 3QYGB 1UGRB 3BG3A 5I5ZB 4EOOB 4JX4A 3X20B 3PO3S 3WVEB 4KRDB 1F5QB 4BCHB 1UGPB 1C9BA 1GUXB 3MIAB 4RODA 3F5XB 1FKMA 1FVVB 4EOKB 4CFXB 2ZPGB 4OB3B 3X26B 4JX6A 2C4GB 4AKGA 2CCHB 1VYWB 1OL2B 5IHYA 4EOQB 4ZGDB 4ROCA 1OGUB 2QDJA 2QF7A 1O9KA 3QWLA 4F70B 2W96A 5LQFB 2ZPHB 3BG5A 2CZ0B
chains in the Genus database with same CATH topology
4YOZA 2PK9B 2UZBB 4F7NB 4BCKB 1H1QB 4EONB 5EFQB 4BCGB 4F7SB 1OKVB 1GY3B 2JGZB 4BCPB 1JSUB 4CXAB 2I53A 2CJMB 5LMKB 3DOGB 4CFVB 3TN8B 3BLHB 2WXVB 4OR5B 4BCQB 4EORB 1AISB 5FGKB 2WEVB 3TNHB 2UZLB 2W9ZA 4FX3B 4BCMB 4OGRB 1KXUA 1JSTB 1H27B 4CRLB 1URCB 2C5VB 5HBJB 1OIYB 4BCIB 3DDQB 3H4CA 4UN0A 1JKWA 3M03A 1UNHD 3G33B 2UZEB 2IW8B 1AD6A 2WIHB 4BCND 4CFUB 2WFYB 1H25B 3EOCB 4ELJA 1QMZB 4EOSB 1W98B 3BLRB 4KRCB 1JOWA 3BHTB 4G6LB 4ROEA 3POMA 4YOSA 1OIUB 3BHVB 3BLQB 4EOPB 4F7LB 3LQ5B 1N4MA 1FINB 1H1RB 5ICPB 4CFMB 4CFNB 4EOLB 4CFWB 2W2HA 2C5OB 3EJ1B 4F6SB 4EOJB 3BHUB 2BPMB 4Y72B 2UZDB 2C5NB 1OI9B 3RGFB 1VOLA 4EOMB 2WHBB 1D3UB 5L2WB 2V22B 4YC3B 1H1PB 4I3ZB 2W9FA 1UNLD 1H24B 3DDPB 1BU2A 1PKDB 4YOOA 5I5ZB 3EIDB 4EOOB 1OKWB 4F6WB 5CEIB 1VINA 2WPAB 2WMBB 3MI9B 1P5EB 4KRDB 5HVYB 1F5QB 2WMAB 4NSTB 5BNJB 3TNWB 5HQ0B 1H28B 4F6UB 4BCHB 5IF1B 5ACBA 1GUXB 1C9BA 4II5B 4TTHA 3MIAB 4RODA 3F5XB 5IDNB 2F2CA 4BCNB 2BKZB 2X1NB 4BCQD 3O0GD 1E9HB 1GH6B 2IW6B 5HBHB 5IDPB 2PMIB 4EOIB 1XO2A 4BCMD 4EOKB 1FVVB 1H26B 1TFBA 2EUFA 2WIPB 4CFXB 2PHGA 2C5XB 2C4GB 2IW9B 4ELLA 2UUEB 2CCHB 1OL1B 1OL2B 1VYWB 2PK2A 3MY5B 4IMYB 4BCOB 4EC8B 2I40B 1H4LD 2G9XB 4EOQB 2C6TB 5CYIB 1UNGD 4ROCA 1GUXA 3TNIB 4BCJB 3QHWB 2CCIB 4EC9B 1G3NC 1OGUB 1H1SB 4CFUD 2QDJA 3MY1B 5HNBB 5HBEB 2B9RA 4BCFB 1O9KA 4F70B 2IVXA 2W99A 2W96A 5LQFB 1ZP2A 4F7JB 1O9KB 2R7GA 3K7AM 3QHRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOZ A;  2PK9 B;  2UZB B;  4F7N B;  4BCK B;  1H1Q B;  4EON B;  5EFQ B;  4BCG B;  4F7S B;  1OKV B;  1GY3 B;  2JGZ B;  4BCP B;  1JSU B;  4CXA B;  2I53 A;  2CJM B;  5LMK B;  3DOG B;  4CFV B;  3TN8 B;  3BLH B;  2WXV B;  4OR5 B;  4BCQ B;  4EOR B;  1AIS B;  5FGK B;  2WEV B;  3TNH B;  2UZL B;  2W9Z A;  4FX3 B;  4BCM B;  4OGR B;  1KXU A;  1JST B;  1H27 B;  4CRL B;  1URC B;  2C5V B;  5HBJ B;  1OIY B;  4BCI B;  3DDQ B;  3H4C A;  4UN0 A;  1JKW A;  3M03 A;  1UNH D;  3G33 B;  2UZE B;  2IW8 B;  1AD6 A;  2WIH B;  4BCN D;  4CFU B;  2WFY B;  1H25 B;  3EOC B;  4ELJ A;  1QMZ B;  4EOS B;  1W98 B;  3BLR B;  4KRC B;  1JOW A;  3BHT B;  4G6L B;  4ROE A;  3POM A;  4YOS A;  1OIU B;  3BHV B;  3BLQ B;  4EOP B;  4F7L B;  3LQ5 B;  1N4M A;  1FIN B;  1H1R B;  5ICP B;  4CFM B;  4CFN B;  4EOL B;  4CFW B;  2W2H A;  2C5O B;  3EJ1 B;  4F6S B;  4EOJ B;  3BHU B;  2BPM B;  4Y72 B;  2UZD B;  2C5N B;  1OI9 B;  3RGF B;  1VOL A;  4EOM B;  2WHB B;  1D3U B;  5L2W B;  2V22 B;  4YC3 B;  1H1P B;  4I3Z B;  2W9F A;  1UNL D;  1H24 B;  3DDP B;  1BU2 A;  1PKD B;  4YOO A;  5I5Z B;  3EID B;  4EOO B;  1OKW B;  4F6W B;  5CEI B;  1VIN A;  2WPA B;  2WMB B;  3MI9 B;  1P5E B;  4KRD B;  5HVY B;  1F5Q B;  2WMA B;  4NST B;  5BNJ B;  3TNW B;  5HQ0 B;  1H28 B;  4F6U B;  4BCH B;  5IF1 B;  5ACB A;  1GUX B;  1C9B A;  4II5 B;  4TTH A;  3MIA B;  4ROD A;  3F5X B;  5IDN B;  2F2C A;  4BCN B;  2BKZ B;  2X1N B;  4BCQ D;  3O0G D;  1E9H B;  1GH6 B;  2IW6 B;  5HBH B;  5IDP B;  2PMI B;  4EOI B;  1XO2 A;  4BCM D;  4EOK B;  1FVV B;  1H26 B;  1TFB A;  2EUF A;  2WIP B;  4CFX B;  2PHG A;  2C5X B;  2C4G B;  2IW9 B;  4ELL A;  2UUE B;  2CCH B;  1OL1 B;  1OL2 B;  1VYW B;  2PK2 A;  3MY5 B;  4IMY B;  4BCO B;  4EC8 B;  2I40 B;  1H4L D;  2G9X B;  4EOQ B;  2C6T B;  5CYI B;  1UNG D;  4ROC A;  1GUX A;  3TNI B;  4BCJ B;  3QHW B;  2CCI B;  4EC9 B;  1G3N C;  1OGU B;  1H1S B;  4CFU D;  2QDJ A;  3MY1 B;  5HNB B;  5HBE B;  2B9R A;  4BCF B;  1O9K A;  4F70 B;  2IVX A;  2W99 A;  2W96 A;  5LQF B;  1ZP2 A;  4F7J B;  1O9K B;  2R7G A;  3K7A M;  3QHR B; 
#chains in the Genus database with same CATH topology
 4YOZ A;  2UZB B;  5DQV A;  2D0Q B;  2LW4 A;  2KMG A;  2QDY B;  4Z6Y A;  4BCP B;  4CXA B;  2CJM B;  4CFV B;  4OR5 B;  1AIS B;  2ZZD B;  5FGK B;  1KXU A;  3VKH A;  2DPP B;  2QFZ A;  1URC B;  2C5V B;  3QYB A;  4ZGE B;  4UN0 A;  1JKW A;  3A8H B;  3M03 A;  3G33 B;  2BS4 A;  2ZPB B;  1ENW A;  1H25 B;  2G77 A;  3BLR B;  4KRC B;  3QYH B;  1JOW A;  1N4M A;  1FIN B;  4CFN B;  4EOJ B;  3BHU B;  2UZD B;  3RGF B;  2V22 B;  4OB2 B;  2W9F A;  1UNL D;  1H24 B;  3DDP B;  3HBL A;  3EID B;  3VYH B;  3MI9 B;  2KR6 A;  4NST B;  5BNJ B;  3KHI A;  5HQ0 B;  4F6U B;  3HZJ A;  5ACB A;  4TTH A;  4ZGJ B;  5IDN B;  2ZCF B;  2IW6 B;  1GH6 B;  5HBH B;  4EOI B;  4BCM D;  4HNV A;  2C5X B;  3A8O B;  2IW9 B;  4ELL A;  2ZPF B;  1OL1 B;  3MY5 B;  4EC8 B;  2I40 B;  4QSH A;  3X28 B;  5CYI B;  4CFU D;  3MY1 B;  4AKH A;  2B9R A;  4BCF B;  4AI6 A;  2WJ9 A;  2PK9 B;  4EON B;  5EFQ B;  4F7S B;  1GY3 B;  2CZ1 B;  2JGZ B;  1JSU B;  2I53 A;  2QGS A;  2WXV B;  4EOR B;  2WEV B;  1UGQ B;  4BCM B;  5EJC A;  3H4C A;  2IW8 B;  1AD6 A;  1E7P A;  4CFU B;  2WFY B;  2CZ6 B;  3HO8 A;  4ELJ A;  3BHT B;  4G6L B;  4ROE A;  3BHV B;  3BG9 A;  5DQW A;  1H1R B;  4EOL B;  3EJ1 B;  2BPM B;  4NC6 A;  4Y72 B;  1AHJ B;  1H1P B;  4I3Z B;  3DJB A;  4YOO A;  2DD5 B;  2BS2 A;  4LOC A;  4F6W B;  1VIN A;  2WPA B;  2WMB B;  3A8M B;  1P5E B;  5HVY B;  3HB9 A;  3TNW B;  1H28 B;  5IF1 B;  2BS3 A;  4II5 B;  2F2C A;  3O0G D;  5IDP B;  4JX5 A;  2PMI B;  3TW6 A;  1XO2 A;  1H26 B;  2WIP B;  2QQ8 A;  4IMY B;  4BCO B;  2PK2 A;  3HHT B;  4BXX X;  1UNG D;  3QHW B;  2CCI B;  4EC9 B;  1H1S B;  4MIM A;  3NDQ A;  4OB1 B;  3QXE B;  4F7J B;  1O9K B;  2R7G A;  3QYE A;  1H1Q B;  2IN3 A;  1OKV B;  2ZPI B;  2CYZ B;  3BLH B;  3GTM S;  3A8L B;  3TNH B;  4FX3 B;  4BBR M;  2DXC B;  1H27 B;  4CRL B;  4BBS M;  4BCI B;  1OIY B;  3QZ9 B;  1UNH D;  2UZE B;  2ZPE B;  2WIH B;  4BCN D;  3B57 A;  1IRE B;  3EOC B;  1QMZ B;  1W98 B;  4HLQ A;  4YOS A;  3BLQ B;  4EOP B;  4CFM B;  4CFW B;  3TW7 A;  2W2H A;  3X24 B;  4F6S B;  2C5N B;  1OI9 B;  3VYG B;  4HNU A;  4EOM B;  2WHB B;  1D3U B;  1V29 B;  4YC3 B;  3X25 B;  3DTO A;  3A8G B;  1BU2 A;  1PKD B;  2CZ7 B;  3DL1 A;  1OKW B;  5CEI B;  4M6V A;  3QZ5 B;  2WMA B;  4AKI A;  1QLB A;  4FM4 B;  4BCN B;  2BKZ B;  2X1N B;  4BCQ D;  1E9H B;  1TFB A;  2EUF A;  2PHG A;  3WVD B;  2UUE B;  2DD4 B;  1H4L D;  2G9X B;  2C6T B;  1GUX A;  3TNI B;  4BCJ B;  1G3N C;  5HNB B;  5HBE B;  2IVX A;  2W99 A;  2DME A;  1ZP2 A;  3K7A M;  3QHR B;  4F7N B;  4BCK B;  4HL4 A;  4BCG B;  1TD6 A;  4MFD A;  5LMK B;  3DOG B;  3TN8 B;  4BCQ B;  1UGS B;  2UZL B;  2W9Z A;  4OGR B;  3VKG A;  1JST B;  5HBJ B;  3DDQ B;  4BY7 X;  4OB0 B;  4EOS B;  4HNT A;  3POM A;  1OIU B;  4F7L B;  3LQ5 B;  4MFE A;  5ICP B;  2AHJ B;  2DXB B;  2C5O B;  4BY1 X;  1VOL A;  5L2W B;  2PJQ A;  3QYG B;  1UGR B;  3BG3 A;  5I5Z B;  4EOO B;  4JX4 A;  3X20 B;  3PO3 S;  3WVE B;  4KRD B;  1F5Q B;  4BCH B;  1UGP B;  1C9B A;  1GUX B;  3MIA B;  4ROD A;  3F5X B;  1FKM A;  1FVV B;  4EOK B;  4CFX B;  2ZPG B;  4OB3 B;  3X26 B;  4JX6 A;  2C4G B;  4AKG A;  2CCH B;  1VYW B;  1OL2 B;  5IHY A;  4EOQ B;  4ZGD B;  4ROC A;  1OGU B;  2QDJ A;  2QF7 A;  1O9K A;  3QWL A;  4F70 B;  2W96 A;  5LQF B;  2ZPH B;  3BG5 A;  2CZ0 B; 
#chains in the Genus database with same CATH homology
 4YOZ A;  2PK9 B;  2UZB B;  4F7N B;  4BCK B;  1H1Q B;  4EON B;  5EFQ B;  4BCG B;  4F7S B;  1OKV B;  1GY3 B;  2JGZ B;  4BCP B;  1JSU B;  4CXA B;  2I53 A;  2CJM B;  5LMK B;  3DOG B;  4CFV B;  3TN8 B;  3BLH B;  2WXV B;  4OR5 B;  4BCQ B;  4EOR B;  1AIS B;  5FGK B;  2WEV B;  3TNH B;  2UZL B;  2W9Z A;  4FX3 B;  4BCM B;  4OGR B;  1KXU A;  1JST B;  1H27 B;  4CRL B;  1URC B;  2C5V B;  5HBJ B;  1OIY B;  4BCI B;  3DDQ B;  3H4C A;  4UN0 A;  1JKW A;  3M03 A;  1UNH D;  3G33 B;  2UZE B;  2IW8 B;  1AD6 A;  2WIH B;  4BCN D;  4CFU B;  2WFY B;  1H25 B;  3EOC B;  4ELJ A;  1QMZ B;  4EOS B;  1W98 B;  3BLR B;  4KRC B;  1JOW A;  3BHT B;  4G6L B;  4ROE A;  3POM A;  4YOS A;  1OIU B;  3BHV B;  3BLQ B;  4EOP B;  4F7L B;  3LQ5 B;  1N4M A;  1FIN B;  1H1R B;  5ICP B;  4CFM B;  4CFN B;  4EOL B;  4CFW B;  2W2H A;  2C5O B;  3EJ1 B;  4F6S B;  4EOJ B;  3BHU B;  2BPM B;  4Y72 B;  2UZD B;  2C5N B;  1OI9 B;  3RGF B;  1VOL A;  4EOM B;  2WHB B;  1D3U B;  5L2W B;  2V22 B;  4YC3 B;  1H1P B;  4I3Z B;  2W9F A;  1UNL D;  1H24 B;  3DDP B;  1BU2 A;  1PKD B;  4YOO A;  5I5Z B;  3EID B;  4EOO B;  1OKW B;  4F6W B;  5CEI B;  1VIN A;  2WPA B;  2WMB B;  3MI9 B;  1P5E B;  4KRD B;  5HVY B;  1F5Q B;  2WMA B;  4NST B;  5BNJ B;  3TNW B;  5HQ0 B;  1H28 B;  4F6U B;  4BCH B;  5IF1 B;  5ACB A;  1GUX B;  1C9B A;  4II5 B;  4TTH A;  3MIA B;  4ROD A;  3F5X B;  5IDN B;  2F2C A;  4BCN B;  2BKZ B;  2X1N B;  4BCQ D;  3O0G D;  1E9H B;  1GH6 B;  2IW6 B;  5HBH B;  5IDP B;  2PMI B;  4EOI B;  1XO2 A;  4BCM D;  4EOK B;  1FVV B;  1H26 B;  1TFB A;  2EUF A;  2WIP B;  4CFX B;  2PHG A;  2C5X B;  2C4G B;  2IW9 B;  4ELL A;  2UUE B;  2CCH B;  1OL1 B;  1OL2 B;  1VYW B;  2PK2 A;  3MY5 B;  4IMY B;  4BCO B;  4EC8 B;  2I40 B;  1H4L D;  2G9X B;  4EOQ B;  2C6T B;  5CYI B;  1UNG D;  4ROC A;  1GUX A;  3TNI B;  4BCJ B;  3QHW B;  2CCI B;  4EC9 B;  1G3N C;  1OGU B;  1H1S B;  4CFU D;  2QDJ A;  3MY1 B;  5HNB B;  5HBE B;  2B9R A;  4BCF B;  1O9K A;  4F70 B;  2IVX A;  2W99 A;  2W96 A;  5LQF B;  1ZP2 A;  4F7J B;  1O9K B;  2R7G A;  3K7A M;  3QHR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...