3HHTB

A mutant of the nitrile hydratase from geobacillus pallidus having enhanced thermostability
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLALGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFSKKPDTKIPRREDPALVKLVEKALNDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title The high-resolution structure of a Cobalt containing nitrile hydratase
rcsb
source organism Geobacillus pallidus
molecule tags Lyase
total genus 65
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hhtB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hhtB02
2ZPBB 4L6V5 1V29B 2PU9B 2D0QB 3X24B 2DXBA 3X25B 1DJ7B 2PVGB 2DD5B 1UGSB 3QYHB 2ZCFB 2AHJB 3QZ5B 2WSCE 5L8RE 1AHJB 3WVDB 1UGPB 2ZPHB 2PUKB 3LW5E 2QDYB 3VYGA 1GXIE 2CZ6B 4OB0B 2DXBB 1UGQB 3A8GB 2PVOB 1PSFA 2PVDB 4ZGJB 3HHTB 2DPPB 4ZGDB 2ZZDB 3WVEB 2DXCB 3QXEB 2ZPFB 1UGRB 2ZPEB 4XK8E 1IREB 2CZ1B 4OB2B 4ZGEB 2ZPGB 3X26B 3QZ9B 4OB1B 3A8MB 2DD4A 2WSFE 4OB3B 2CZ0B 3A8HB 4KT0E 4RKUE 2CZ7B 2ZPIB 3A8LB 1QP2A 1QP3A 4Y28E 4FM4B 1JB0E 2DD5A 3VYHB 3QYGB 2PUOB 2O01E 3A8OB 3X20B 3VYGB 3X28B 2ZZDA 2DXCA 2DD4B 2WSEE 2CYZB 1PSEA
chains in the Genus database with same CATH superfamily
4QQDA 3JCMg 2PU9B 1P92A 3EG2A 2KYMA 1GY3B 1RAHB 3META 4C92B 4A4FA 1VYVA 4F7UB 3TN8B 3I56A 3CC2T 4M75A 1QLBA 2D9TA 4FX3B 5IN1A 2WPAB 2P0KA 2RI2A 1VQNT 3OS5A 2V8JA 1VQPA 2QA4Q 2QAZA 5ECAA 2Z0WA 2FVUA 4XTUA 3BG9A 3URGA 3CCSA 4LUDA 2VXEA 4IKFA 3WVDB 5HCKA 1JJ2S 4CFUD 1OGUB 3G6EA 2DIGA 3P8HA 3NTIA 2W9FA 1JOWA 3VS2A 1UGQB 2O9VA 3CQTA 3FIFA 1VQOA 1TD6A 2PVOB 3CCQT 2Y4XA 1Q7YU 4HKEA 3CMEA 4AI6A 5IHIA 2O4XA 3CCJA 1GBRA 1AEYA 1PKTA 2DRMA 5DY9A 1TUGB 3H6ZA 2RHYA 2WMBB 1H1SB 4M75D 2R58A 1UGRB 5D7UA 4KGVB 2EPDA 1AWWA 1BU1A 1OKWB 3LWIA 2H3JA 1C6VX 4JX6A 4LN2A 4XU2A 4DEXA 3CCUQ 5DQVA 2LCCA 4RTVA 1M3CA 1WJRA 3SD4A 1K73C 3TVTA 4M78B 4C0DB 1I0CA 5LJ3g 4A54A 4M7DF 4XAXB 2O9SA 4IIOA 3C12A 4PNOA 3VJPA 1X27A 4Y28E 4X34A 4BY6B 1KD1R 3VYHB 4EMGA 3BG5A 1TU0B 4JLGA 4LDUA 1MMAA 3L42A 1WHGA 2HMAA 2NUTA 3VYGB 1I07A 5IH2A 2W99A 2JNGA 1PSEA 4AKHA 2WJ9A 4PJOB 2CH4W 3OYYA 1D0XA 5HBHB 2D0QB 3X24B 5LJ5f 2OTJQ 2FG0A 2YT6A 3JB9H 3G71A 1M90R 2VGMA 3OS0A 1Y7XA 2SRCA 3L2WA 1MMGA 4M77B 3CC2A 1VQ7Q 4OMPA 1NBEB 2CCHB 1PM3A 3QWXX 1VQNA 4TVRA 2W2HA 2FZCB 1K8AR 1U5SA 2RHXA 1K9MR 1R0CB 2M1HA 1WQ7A 2VWFA 3MP1A 3TW7A 1R0BG 2E12A 1PWTA 3M0QA 4QKUA 5GMKh 2KQWA 4BE2A 2X51A 1A0NB 2W9ZA 2DPPB 4A4KA 3RGFB 1M4ZA 3CCQA 2DXUA 3VV0A 1YI2Q 3EFSA 3P8BB 5DLQE 3G4SQ 2ZPEB 4PJLA 2KK4A 4XK8E 3KBGA 1KQSS 3H8ZA 1UTIA 1X01A 1W98B 1MMNA 2RB6A 2KI7A 3EG3A 1OU8A 4OMMA 2C5XB 4CFWB 2E6ZA 3A8MB 2JGZB 1JO8A 5GAN2 2I2LA 2HCKA 1PCXA 4GY5A 3PFSA 3OA6A 3QWYA 1Q95G 4UC4A 4C5GA 2C0TA 2EAYA 1LPLA 3OW2A 3BLRB 2GFAA 1D0ZA 2EQUA 2RHUA 1WX6A 2RN8A 4ANJA 4EC9B 1VUBA 2YUOA 2COWA 2DMOA 4LE9A 2PUOB 1ZSZA 4FT2A 4RTYA 2RQTA 1AT1B 4BCMD 2CJMB 2DXCA 3V8LA 3CCRT 1BK2A 2XU8A 3HRUA 4CFNB 5KYUB 2YLBA 3DB3A 8ATCB 3CCMT 3S3NA 4E7JA 1G8XA 4OMNA 2ABLA 2XK0A 5A0DA 1VQKQ 4FYWB 1V1CA 5GMKl 2JT4A 2YRDA 4A4HA 4DOWA 3VS3A 4J7IA 4C92G 4BCIB 4BCJB 4PL6A 1GFDA 1ZUYA 4MFDA 1H1PB 4IUUA 2BZYA 4X9CA 3M53A 4QQGA 4BCNB 4FW1A 1G83A 1M1KC 1PD1A 1RUWA 1M2OA 1WXBA 3QPHA 2NLUA 1F5QB 2GGRA 3LW5E 2L8DA 2DA9A 2B9RA 2YUPA 5LL6S 3EFOB 4EOIB 2QDLA 1VQ9T 2GF7A 1WHMA 2I0NA 2A3LA 3GP8A 2IVXA 1M8MA 2LDMA 1H27B 2DRKA 2HKNA 5HQ0B 3VS6A 3P8DA 1VQ8Q 4F7NB 1QLYA 2R5MA 5GAMh 2AKKA 5L23A 1Y96A 3EOCB 4PFPA 1VIFA 1Q86R 4HXJA 3RMSA 3QHSA 1YNZA 1O9KA 1ZBXA 4OB1B 3LLRA 2EYXA 1CKAA 4JLIA 2RK2A 2GFUA 4DQ2A 3MIAB 1OOTA 1VQMQ 3H0HA 4PJJA 5FU6B 5KCHA 4OMFB 4II5B 1PKSA 2WHBB 3SEMA 3LQ5B 1LJOA 2CZ7B 1NZ9A 2XDPA 3EG9A 4ZTFA 4PJMA 7AT1B 2DJZA 3A8LB 4BUGA 4JRQA 4M7AA 4C0FA 2PK2A 3OYHA 2LP5A 1D3UB 1K73U 1VQKT 1TWBA 2VUBA 2PQWA 4EPCA 2O2OA 3L2VA 2XMFA 1H28B 2V8KA 2EGEA 5FWBA 4OMQA 2WEVB 4C0ZA 5LJ5j 3A98A 4BCPB 1I5LA 4C8QE 1H92A 2HNIA 3OYNA 3FJ5A 4C92C 4M7DB 1LVKA 3CCRA 3MO8A 3NTHA 1O9SA 4IUQA 4N4IA 3FRNA 4XQ3A 1BI2A 2CP3A 2UZLB 3QDFA 4A63B 1TS9A 2QQ8A 1QW1A 4F7UF 2P4RA 4PJOG 3CCMA 1IB8A 1X2KA 1EX4A 3VU3C 3GF5A 1NE8A 5CKDA 4CRLB 2HD0A 2J05A 4NL2A 5DLOA 4AKIA 3DLMA 2JS2A 5LJ5h 1QWFA 2QQRA 2DILA 2K5LA 3DL1A 1IHVA 3EGDA 3QZ5B 2LJ1A 4M77G 2DBKA 2C4GB 5J39A 3VS1A 2DJQA 5KH6A 4F16A 2QDYB 2RQVA 1VIEA 2DXBB 4KUDK 2ED0A 2R57A 4AT1B 4C8QG 3O0GD 4J9GA 1U06A 2F5TX 3MY1B 1H1QB 1OZ2A 2ED1A 4XTZA 4E2FB 5D6WA 1VQ9A 4BCGB 3DOGB 1G3NC 2KAFA 1IREB 4ZN1A 5I5ZB 3BHTB 3ER0A 3H4CA 1BBZA 5I2SA 3QZ9B 4RMOA 5CVIA 1C1AA 2DD4A 4LUEA 4OGRB 4NL3A 3EIDB 3QHWB 3QBYA 4WTOB 3RNJA 2E6NA 4BCKB 3H41A 4LD6A 1Z9ZA 1M8VA 2KGTA 1XOVA 1YJWQ 4M78F 2AK5A 2RK1A 4BY6C 4BI8B 2AT1B 1Q86C 2PMIB 1QP2A 1QP3A 4PLIA 2MYSA 3QIIA 4ELYC 1VQ4Q 3QYEA 4HNTA 1OQKA 1ZX6A 4KRTA 1IGQA 2HDAA 1ZBJA 3VS5A 3M59A 3MHXA 5LJ5e 3DJBA 2DIQA 5GAN6 4PJOC 2JMCA 4QVDA 1VQKA 1D1AA 1IXDA 3O8VA 2AZVA 2IVWA 2BIVA 1HXDA 5GANj 4A53A 1VQ5Q 2KT8A 1OL1B 4EORB 2WFYB 3KUFA 5LJ3d 3E2UA 5BNJB 1G3WA 4M77C 2NUPA 2ROTA 3TSZA 1UUEA 5CKHA 4J8OA 3QSUA 3UWNA 2QGSA 2E3HA 4BCFB 3BHVB 2VV5A 2K57A 2EBPA 2LJ0A 1YJNQ 2OTLQ 2DK3A 5CCAA 2R7GA 4EOLB 1K9AA 4JJCA 4JZ3A 3F70A 5KYXB 1LCKA 2VXFA 4KRCB 1FX7A 3O5ZA 3QDRB 1D3BA 4OB0B 2RPNA 1KHCA 5GANd 1RI9A 4M75B 1M1KU 1XNIA 2QQAA 4BI4A 4DBFA 1QMCA 3JCMW 1S1NA 2RA2A 2EQMA 2HL5C 2CP7A 3V7RA 3JB9D 3TQ7P 3VS7A 4KBMB 5GAOq 1RAAB 2K7AA 1M30A 1YJWT 4JRKA 4BCOB 1M27C 4F6UB 2BKDN 2P4TA 1X69A 2H8HA 5FU7C 3TNIB 2LQKA 1JSUB 1MNEA 1K9MU 1UHFA 2WSFE 1QMZB 3MPUB 2X3WD 1ZUUA 2CSQA 2LQNA 2L0AA 3M5AA 3VUBA 3V8KA 2DEUA 5GAOm 4RKUE 1BIAA 3I5RA 4ZNXA 4ELLA 1AD5A 3VKIA 4AKGA 2OAWA 2CUBA 2FRYA 2MK5A 5HY6A 4J9CA 4LDYA 1AZEA 2BZ8A 3V8JA 3CMAQ 3RKWA 2CSIA 2XKOC 1H4LD 4ZTJA 1RADB 4PK4A 1H25B 1WGSA 2LVMA 1U1TA 1QVFA 5HBEB 1HSQA 1VQ6Q 1ZA1B 1XO2A 2FPEA 2HQXA 4M7DG 4XTYA 2GTJA 4DBHA 1H641 5LJ5g 1JRIA 3QYHB 2NUTB 1D1CA 2JN0A 2DVJA 1AWJA 3DB4A 4ESRA 2RJDA 2DL3A 2DBMA 2RNAA 3OSVA 4R55A 4G6LB 1VQLQ 1OL2B 3QO3A 3MKDA 1KG1A 1ZHIA 1GXIE 1C9BA 5GAOp 1SSFA 2KT1A 1QCOA 4CC2A 2CP2A 2QEXQ 1WZOA 4N0AC 4ZGJB 1WJSA 4IIMA 3HHTB 3OYDA 4Y91A 4CC7A 2L3RA 4HVVA 3CD6T 2E41A 3SDZA 2FZKB 5FW9A 4L59A 3I55T 1MUZA 2RM4A 3CCET 2ZPGB 5GAMf 3OYMA 4JJDA 4DBQA 3VRYA 3VKGA 4YOOA 1YCYA 4MMLA 1OKVB 4R0KA 1YJWA 5FU6C 4ZN3A 1WLPB 2J6KA 2QDJA 4OB3B 3FDRA 4BCQD 3A8HB 1M1FA 2A7YA 4BCMB 2ZPIB 4J9EA 1Q82C 2QF7A 4PLLA 4E7ZA 5EC7A 4BB7A 4J9IA 1JB0E 3POMA 4XU3A 2EYYA 3NDQA 2C5VB 3EG1A 1W6XA 2C06A 2VYTA 2K3BA 1Q86U 5KE2A 1OPLA 4M7DC 2WXVB 2ZPBB 3CCLT 1X43A 1Y57A 1KIKA 3M4YA 4NS5A 2JTFA 2RHZA 4KH1B 2EYQA 5KCOA 3A5ZB 4DBRA 3MEUA 1W2BA 1KQ1A 2BKZB 1BIBA 4BACA 1KQSP 3OYGA 2EVRA 2F2XA 4JJBA 5IDPB 3JB9F 4QT7A 1SHGA 2QFZA 4HCBA 1ZSZB 2RH2A 2RO0A 2QEXT 3ULRB 1TSFA 4MZTA 4PFZA 3JSCA 2F2VA 1M1KR 2QA4T 5GANg 4Z88A 5GAN4 4FIBA 4BY7X 2JTMA 2DM1A 1M1GA 5FROA 3GPLA 4QW2A 4AFUC 2MOXA 3HRSA 4RCBA 2DAQA 1OX9A 4E7HA 2CGHA 2DFUA 1H3ZA 3PMTA 4CFMB 3I35A 2IW8B 2YUQA 5GMKj 1RAGB 3QKJA 4X1VA 2G77A 3NGPA 4F6WB 4C92A 1YHQQ 1KFZA 3OY9A 3TREA 3CXCA 2HQEA 3OYEA 4FSXA 2ECZA 4EIKA 1TUDA 4JS4A 2HAXA 1JEGA 3JCMf 4C5EA 5FLXE 1YJ9Q 3CD6A 2PK9B 5A0GA 2VGNA 3DLLA 2W0ZA 1M3BA 1SPKA 3I55A 1FXXA 3M4GA 4F6SB 3CCEA 1N4MA 4B9WA 3CCUT 1YWOA 8AT1B 4II1A 3EG0A 3JB9J 3EHRA 1AVZC 2E65A 2LTOA 2HL3A 3EAEA 1QVPA 2RI5A 2BE9B 2XDBA 3MP8A 2VC8A 3ZL7C 3RESA 1GRIA 4IUPA 4HCCA 2KE9A 5HVYB 1O9KB 2RHIA 3JCMP 2QXFA 1N5ZA 1VYTA 4C92E 2JS0A 3TEEA 3PMIA 4F7UE 3AT1B 3S3MA 3G1JA 1B34A 2FHDA 2DNUA 3LGLA 3CCLA 3H9NA 5AYFA 2HQHA 2EGCA 3M57A 4RG8A 1UEBA 3RKYA 4I3ZB 2OTJT 1QQJA 4J6XA 2FL7A 3JCMc 2G3RA 2IIMA 3NTKA 1TUCA 4XU1A 2DTHA 4Q5WA 2KRMA 1D09B 4ELJA 4D8KA 1SSHA 1Z9QA 3M03A 1URCB 2IW6B 5KYYA 1VQ7T 2CKKA 4EMKC 3CPWA 3CBOA 4M4ZA 2BTTA 4F7SB 1UGPB 5CYIB 4HA8A 2JM8A 2QEXA 4ME7A 3T9NA 1YIJQ 4Y72B 4M75C 3VYGA 4AFZC 2M51A 2DETA 1TTHB 2Y4YA 1KQ2A 3PTAA 5GMKe 4CXAB 2QA4A 1T0HA 3FC3A 1JBMA 2DEQA 4M75F 1H1RB 2JJ9A 4PJOA 4F7UG 5HK3A 2OAUA 2K6DA 4RTXA 1SRMA 1FWZA 2CT3A 1OPKA 5GAMj 5GAOr 1F1BB 4BBSM 2AIRB 1YI2T 3G4ST 3I9QA 4M77A 1MNDA 3C4SA 1RLPC 4BDYA 2MCNA 2QG9B 2D6FA 1WNLA 3VS4A 2DTOA 1X75C 1NPPA 4N4HA 2W96A 2EWNA 4QVCA 5HKCA 4GLKA 3PIPA 4M78E 1MGQA 3UF4A 1YCSB 2KMTA 1ZSGA 4C8QA 2FB7A 4YC3B 2A36A 1JXOA 4RG2A 5IT9E 1YP5A 3CCUA 4BE1A 1OIYB 3M58A 1BCOA 1QVGA 4BE0A 2O31A 4EONB 2FPFA 3QG1A 3S3OA 1Q82U 5HK0A 4PJOE 2H3EB 1W2BS 4B6MA 2DD4B 3KHIA 1LOJA 2CYZB 4EOPB 2DZCA 3OYBA 2LT4A 4MFEA 3FJPA 3M9QA 4B9XA 4LD9K 1JSTB 2AKLA 4J9BA 2RD1A 1RL2A 4O5VA 5EG2A 4E7KA 1ZLMA 1ZA2B 1HD3A 3CCVQ 4RTTA 2XG8D 4JX5A 1SG5A 2E1HA 3RIRA 3GBQA 5KE3A 4M77E 1RAEB 2LCLA 2ROLA 4M78G 2YHTA 2SEMA 4E47A 4C8QD 1K0SA 4E7LA 1T0JA 4N4GA 2OI3A 3HSBA 3OW2P 3BW1A 2OTJA 1B3QA 1GCQA 1HYOA 1O75A 3HPWA 3MEAA 5J3BA 5IXFA 3OYKA 3OYJA 2BS2A 1AHJB 3KFVA 3L1AA 4TTHA 2IG0A 1BU2A 1VYWB 2DL5A 4KULA 3SWNB 2ZGWA 1WIEA 3CC4Q 1D0YA 1PD0A 4LDVA 2LX7A 4OF1A 1VQ7A 3S6WA 3UATA 3BFMA 5KYUA 3C94A 2PVDB 4XTXA 3JCMJ 3SHWA 2NUPB 2LC4A 3PVLA 1AD6A 1YN8A 2K3XA 2A28A 5GJVB 5GAMe 4K11A 2L2PA 3QHRB 1KSWA 2ZPFB 1M9SA 2A08A 3OB9A 4X9DA 2KMGA 5LJ5d 4M7AD 3RUXA 4OGEA 1EZZB 1UNHD 1RAIB 3J81E 2WMAB 2DXTA 3CC7Q 2MWPA 1VQ8T 2BUDA 2I53A 1JKWA 3ASKA 2OJ2A 2M02A 4WF2A 1WJQA 3MP6A 1FYNA 2MWOA 1G3SA 4MZPA 2J7IA 1YI2A 1NYGA 3G4SA 1UNLD 2DO3A 3BDUA 3TNHB 1ZUKA 1BI0A 4HT9A 4YOZA 3KXTA 3JCMh 3EH2A 1VQMT 5CKBA 3EFOA 1WHLA 2KXCA 3HP9A 2DD5A 4JDSA 4Z8AA 2EKHA 1TFBA 3QYGB 3OW2S 3I56Q 4A4GA 3MEWA 4AG2C 4E6RA 1UDLA 4AFQC 3RDVA 1KC8R 1YITQ 5LMKB 4J5YA 2KYBA 3EHQA 4C0DC 4M78C 4J9DA 4FYXB 1VQPQ 2FO0A 2MAMA 2PHGA 4IUTA 1GUXA 4EMHA 3CCSQ 1PHTA 3BLHB 2RJCA 4EOSB 4J9FA 2HEQA 5GMKm 4EOOB 4ROCA 1XTDA 1GH6B 3G6EQ 2JVVA 3OYAA 3OMCA 1ZSZC 4PFOA 1JJ2A 2VKNA 1UJ0A 3OBYA 1VQOQ 2YDLA 2RF0A 2KXDA 3CMEQ 4AMCA 5L8RE 5KYWA 3MI9B 3CCJQ 2E5KA 2PUKB 2ZPHB 4F14A 2HBPA 4MDXA 1Q81C 2JUFA 5M9OA 4FW2A 4L5GA 2IPOB 4J7FA 2FEIA 3L2QA 2BZXA 4M7DA 1MV3A 4JZ4A 2B86A 3JCMe 2K4YA 2ZZDB 4MIMA 4WCIA 1TXQA 2EQKA 1NPRA 4MZMA 2D0NA 2BE7D 2YUNA 2CZ1B 2X4XA 1X6BA 2RMOA 4OR5B 3LH0A 1ABOA 1WHHA 4BCQB 3X26B 1S72Q 3BY7A 2GBQA 1B7TA 2DVEA 2E70A 2FYKA 2KRNA 4A4EA 1VQ8A 2BS4A 2E64A 1XJWB 4LDWA 2XD0A 1BCMA 1IHWA 1UG1A 4KT0E 5GAMg 1YITT 2FZGB 4NOYA 1Q82R 3PO3S 4Z02A 3ZEHA 1VOMA 2CCIB 3OMGA 1VQMA 3G71Q 5D6XA 3CEYA 3B57A 1VQ4T 2MMPA 2DL7A 5DQWA 5IHYA 1X6OA 1IO6A 4M7DE 3DKMA 2XHCA 2DX1A 3CC2Q 2RJEA 3TCJA 1VYUA 2O4XB 3G33B 3VUZA 1FMKA 1ENWA 3UA7A 4BCHB 3LH5A 1UFFA 1R77A 1CSKA 1OIUB 1DJ7B 2L5QA 1VQ5T 2WACA 2PVGB 4PJNA 4M7AF 2CP6A 4DOVA 4J6YA 3THKA 5A2QE 1KC8C 4AG1C 5CKFA 4Z89A 3RERA 4AFSC 1E7OA 3ME9A 1HK9A 3JAME 2YXYA 1GL5A 1M5Q1 3CCQQ 1YJNT 6AT1B 2OTLT 1KXUA 4OVAA 1IGUA 2JTEA 4BY1X 3TU4K 3DDQB 3GTMS 1U3OA 4ELZC 3LWHA 1S72T 1PRLC 3EH1A 4J9HA 2MIOA 2MPXC 1G2BA 3JB9G 3Q1JA 2P0QA 4BD3A 1Y71A 3OYFA 1AWXA 4E7SA 3E9GA 3TW6A 1YBYA 4LXCA 3FLGA 2X4JA 1X2QA 2FPDA 2QQBA 1WI7A 2G9XB 1P5EB 1NM7A 2K9GA 5KYXA 2EYWA 4EMKA 4KGXB 1N9RA 5IDNB 2KROA 5EJCA 2A0FB 2K2VA 2LJ3A 3SFMA 4O6JA 4FM4B 3I5SA 1HJDA 3F5XB 2X3XD 1YITA 1I4K1 2HSEB 5I2MA 1E6GA 1WXUA 1E6HA 1UHCA 1OU9A 1K0XA 4FU6A 5KYNA 3EGXA 2FRWA 4RTWA 5CEIB 1V29B 2WIHB 1VQ4A 1WHKA 2X9HA 1K4US 2C0IA 1M2VA 3CMAT 2W10A 4HVUA 4RTZA 5D6YA 2KNBB 2LCSA 2F5KA 1VQ6T 3EFRA 3E9FA 1BI3A 2X4WA 3M55A 4CI0C 4F7JB 1VQ5A 3BE3A 1UB4A 1Y07A 2AHJB 3A1PA 3PIOA 4E7IA 1TOVA 3H0IA 3SWNC 1QCFA 2VB6A 2UZBB 2J6FA 4M75E 1KK7A 1NJIR 1E9HB 1B34B 9ATCB 1GFCA 1PKDB 5CIUA 1VQLT 4HNVA 3L2ZA 3M56A 4C5HA 4FT4A 2BPMB 2KBTA 1YJNA 2OTLA 4DA4A 2LT1A 3HO8A 4R56A 3HRTA 1Q81U 2DYBA 3UDCA 4ZGDB 3REBB 2DF6A 3JV3A 1BKBA 3DTOA 4QQ6A 2DXCB 1OX8A 4EDUA 1QVFP 2KSSA 2MI6A 1S72A 5KYYB 3QJ6A 5GAN3 3VRZA 3CBMA 2HZYA 1CKBA 3GIBA 4JX4A 3HTRA 2RJFA 2LZ6B 5FWCA 2J6OA 2CREA 4BBRM 1PRMC 2DL8A 4C0GA 4ATOA 2C6TB 2EW3A 3JRZA 3M0SA 2COYA 2PJQA 1N8RR 2M0OA 1BYMA 1ACMB 1OULA 4M75G 3PT9A 4F7UA 3GOXA 1V76A 2EJFA 3MY5B 1GBQA 1IZ6A 3JCMV 3CCRQ 3V7SA 2CP5A 4GBQA 5DM7R 3X20B 3SB2A 2J06A 4CFXB 3CCMQ 1FINB 2L3PA 1FKMA 2QI2A 1UE9A 2NYSA 4V2SA 5GAN8 1XQHA 1PC0A 1AZGB 1H3HA 1JU5C 3UPUA 4C8QB 1WA7A 4J83A 4DEYA 1W4SA 1B07A 4RUGA 3JCMb 2F2WA 1AWOA 3IQLA 3R6OA 2COZA 3GNFB 4ROEA 2E3IA 2ENMA 1Y96B 1E7PA 2K79A 4LDXA 3CMAA 1VA7A 3HKSA 3NMZC 5CQXA 4C92D 1QVFS 1WQWA 2EJGA 1ZP2A 2ZCFB 5C6SA 1OI1A 2Y90A 3TNWB 2WSCE 1VQ6A 4OP0A 1BB9A 1KHIA 1VQ9Q 1KC8U 2LMJA 2XIDA 1SRLA 3HBLA 3EG9B 4JUVA 4LOCA 4M7AB 5ACBA 2HSPA 2CT4A 5FU7B 3BG3A 2A37A 2ESWA 4D8DA 4M78A 4IUVA 1VQLA 5I21A 3NHNA 3QWLA 1RI0A 2QK0A 4LNPA 1N9SA 1W2BP 2C5OB 2DKGA 1QWEA 4QSHA 1YHQT 1NJIC 1T3LA 3M0TA 2UZEB 3HFOA 1VINA 2EQIA 5LJ3f 3LGFA 1G3TA 2C0OA 4KUIA 3U23A 5EFQB 1WYXA 1OZ3A 1J3TA 1WDXA 1YJ9T 3LYIA 4NSTB 1ARKA 2C5NB 3E1SA 4C5IA 1UNGD 1AISB 4CC3A 3K7AM 2L89A 1KD1C 3EGDB 2QASA 3L2RA 2D1XA 2EJ9A 2QTXA 5I11A 4HVWA 5GANf 3LX7A 1AOJA 3MEVA 4M78D 3X28B 1OI9B 1N8RC 3OYCA 2GQIA 2CUDA 2QTVA 4YTLA 2WIPB 2X4YA 3CXCP 2LQWA 1WFWA 1NLPC 5CKEA 1Q7YR 2CH4A 2M16A 3X25B 3BHUB 1M90C 2DMEA 1WPYA 5GAMd 1MHNA 4RTUA 4PJOD 2DD5B 2YLCA 3HZJA 4VUBA 4CFVB 2V1RA 1NLOC 2RQUA 3E19A 2ZAEA 2V1QA 2X35A 4XTWA 1K8AC 3NPFA 4IURA 3UA6A 5A0LA 1K9MC 4M77D 5HNBB 2CP0A 3NFCA 1Q81R 1GUXB 2P0PA 2R5AA 4EC8B 3PE0A 1PSFA 4IMYB 1YIJT 1WXTA 4XTVA 3C0CA 3OYLA 4J6WA 4FYVB 2OX7A 4NC6A 5GAOn 2DTIA 3OBWA 4Z6YA 3QXEB 2K2MA 4EOJB 2E4HA 5FGKB 1IRXA 3OYIA 5IXBA 2JMAA 1H26B 1R8OB 5KYWB 2LW4A 3DDPB 1FMWA 2JXBA 3ZFJA 1K1ZA 1RAFB 3HB9A 4JRIA 2PZ1A 3MCAB 5C0MA 2CDTA 3ZBDA 3CXCS 3GNGA 1YHQA 4EOMB 1C0MA 1EFNA 3FEOA 5GAOl 1ZQ1A 3CPWP 2CZ0B 4QVZA 3REAB 4FYYB 3N5BB 1BI1A 4P5NA 2DL4A 4YOSA 2PTKA 2QGFB 1YJ9A 4C92F 4M6VA 2CS7A 4XU0A 2UZDB 1YWPA 2XI9A 3L2UA 1UJYA 4JPBW 2PNIA 1D3BB 2HBWA 3PNWC 2JM9A 2KVQG 3HFNA 2RI3A 3GLXA 3WXMB 4MMKA 5L2WB 2D8JA 4PKCC 1N27A 3QYBA 2RQWA 2XICA 4M7AE 3JCMd 2DERA 3OSSC 3CCVT 2JW4A 2JZ2A 2E5QA 4N0AA 1RLQC 3RR6A 1PNJA 2EFIA 5ICPB 2QQSA 3M0PA 1LNXA 1Q7YC 1QCNA 1JQQA 1FVVB 2EQJA 2BS3A 1VOLA 2GCXA 3OS2A 1QVGP 1RACB 4EOKB 1QKXA 4HT8A 1TH7A 4BCND 2VVKA 2DE0X 3EGUA 3CPWS 3PGGA 2F2CA 1U1SA 2AZSA 3CC4T 5IHKA 5CQYA 1KJWA 4CC4B 1N6AA 1G3YA 3M0RA 3J7AF 3TSWA 2JOYA 3WVEB 4M7AG 4HLQA 3MJXA 2VASA 1MMDA 1SKUB 4F17A 1YIJA 1YFNA 2YWWA 5LJ3j 5CR2A 3OS1A 2V26A 4FCYA 2QGGA 3RBBB 3JCMQ 4ZGEB 4HL4A 2GTOA 3CBPA 4GLMA 4FSSA 3RMQA 3C95A 1UECA 2M9UA 3CC7T 5FRMA 2EKOA 4JS5A 2EYZA 4D6WA 2DYIA 5CAIA 1NJIU 3AHUA 4RODA 4PJOF 3PVQA 5AT1B 2I40B 3SWNA 4HNUA 3FB9A 1MV0B 4HCKA 2HKQB 5GAN5 5LJ3h 4BI3A 5J26A 1PG5B 1GCPA 1RABB 4ORZA 2D8HA 2KRSA 1TG0A 2IW9B 4OMLA 4KGZB 1W70A 2O01E 1I5OB 4CFUB 2QQ9A 3BDLA 1JXMA 2KR3A 2F69A 3CPFA 4M77F 2K5IA 1KD1U 1WHJA 4KH0B 3M0UA 3I56T 1K76A 3VKHA 2YRVA 4L6V5 2K5FA 4C8QC 1QVGS 2NWMA 5IHNA 1SF9A 3VS0A 2G6FX 4F04B 1EIFA 2EIFA 4EMKB 2P84A 2V22B 2DXBA 2LX9A 4C8QF 5GANh 4BDZA 1N8RU 2UUEB 4UN0A 1I1JA 1VQPT 2X1NB 3D7SB 3JCMX 4BXXX 2V8IA 3CCST 2EGAA 3OQ5A 5GAN7 4M7DD 4Y92A 1ABQA 1UGSB 4F7LB 5IF1B 2LNHB 4CRIA 3JB9I 2DLPA 1H8KA 1NEBA 1OEBA 1M90U 5GJWB 3G6ET 3CCVA 3EJ1B 2KEAA 1UGVA 1H24B 2QYZA 2L3SA 1VQOT 3EGXB 3BLQB 1D1BA 1QKWA 1OYXA 2EUFA 2GNCA 2M0YA 3CMET 1NG2A 1I81A 3CCJT 2CZ6B 2YRCA 1VQNQ 4M7AC 2YSQA 1M2VB 3A8GB 5IAYA 1W1FA 2K3YA 2KY9A 3M54A 1K8AU 2KR6A 2LQ8A 4EOQB 2XDDA 2E10A 5FRNA 3J80E 5LQFB 1T3SA 3CD6Q 4OGCA 4OMOA 5CK9A 4F70B 5LJ3e 1X6GA 4FL6A 1NEGA 1K73R 3H0FA 1GCQC 3I55Q 2B8AA 3CC4A 2IN3A 3HL8A 3CCEQ 5CO7A 1U8RA 2DZ9A 3R6NA 4OB2B 5HBJB 1M3AA 1OV3A 2LNVA 2O88A 2ATCB 2KDSA 2RQRA 1Y0MA 1JJ2P 2F1LA 3G7ZA 5I22A 2LRQA 2MF2A 1KQSA 1SHFA 3QJYA 4KRDB 3UT1A 5GANe 3CC7A 1SEMA 4RCCA 4HCZA 4JRPA 4MDWA 3INZA 3QUIA 2L3QA 1I8FA 1FMVA 1G5VA 3A8OB 3CCLQ 2ZZDA 3V7CA 1NYFA 2WSEE 2NUZA 3RKXA 3G71T 5GMKi 4JJNK 2GQVA
chains in the Genus database with same CATH topology
4V2SA 2LT4A 4MFEA 3FJPA 3M9QA 3O8VA 1XQHA 4QQDA 4B9XA 5GAN8 4LD9K 2RD1A 3JCMg 2PU9B 1RL2A 4O5VA 1P92A 3UPUA 5EG2A 1QVGS 4E7KA 4C8QB 2IVWA 4J83A 1W4SA 2BIVA 3META 1HXDA 4C92B 4A53A 5GANj 2XG8D 4JX5A 4A4FA 4F7UB 3JCMb 3I56A 4M75A 3CC2T 2E1HA 3RIRA 3R6OA 1QLBA 2D9TA 3GNFB 3KUFA 5LJ3d 5IN1A 4M77E 5KE3A 2LCLA 1G3WA 1Y96B 4M78G 1E7PA 2YHTA 4M77C 2P0KA 4LDXA 5CKHA 2RI2A 4E47A 4J8OA 3CMAA 4C8QD 1VQNT 3UWNA 3QSUA 3HKSA 1QVFS 5CQXA 3OS5A 4C92D 4E7LA 1WQWA 2V8JA 2EJGA 4N4GA 1VQPA 3HSBA 2ZCFB 3BW1A 2FVUA 2VV5A 2K57A 4XTUA 3BG9A 1OI1A 1O75A 2Y90A 3URGA 3HPWA 3MEAA 5J3BA 3CCSA 2VXEA 3OYKA 2DK3A 5CCAA 2WSCE 2BS2A 3OYJA 1AHJB 4OP0A 1VQ6A 4IKFA 3F70A 3WVDB 1KHIA 3L1AA 1JJ2S 2IG0A 3G6EA 2VXFA 2DIGA 3P8HA 1KC8U 3NTIA 1FX7A 4KULA 3SWNB 2ZGWA 2XIDA 3QDRB 1D3BA 4LDVA 4OF1A 4OB0B 3HBLA 3S6WA 1VQ7A 4JUVA 1UGQB 1KHCA 3FIFA 5GANd 1VQOA 2PVOB 4M75B 3BFMA 4LOCA 1XNIA 2QQAA 2Y4XA 4M7AB 3CCQT 1M1KU 3C94A 2PVDB 1Q7YU 4HKEA 4BI4A 4XTXA 5FU7B 3JCMJ 3CMEA 4AI6A 3BG3A 2O4XA 3JCMW 3CCJA 2LC4A 4M78A 2K3XA 2OTJA 4IUVA 1VQLA 5DY9A 5GAMe 3H6ZA 2RA2A 2RHYA 5I21A 2EQMA 3QWLA 2ZPFB 1M9SA 1RI0A 2R58A 4M75D 1UGRB 3OB9A 4X9DA 2KMGA 1N9SA 5LJ5d 3V7RA 2DKGA 4M7AD 3RUXA 4OGEA 3JB9D 3J81E 2DXTA 4KBMB 4QSHA 2MWPA 5GAOq 1YHQT 1VQ8T 3LWIA 2H3JA 2BUDA 1YJWT 1NJIC 3ASKA 4JRKA 4WF2A 3HFOA 1WJQA 3MP6A 4JX6A 2BKDN 2P4TA 4XU2A 5LJ3f 5FU7C 3LGFA 1G3TA 2LCCA 2MWOA 1G3SA 4MZPA 4KUIA 2LQKA 1YI2A 1OZ3A 3G4SA 1K9MU 1YJ9T 3LYIA 2WSFE 1WJRA 3SD4A 2DO3A 3M5AA 3BDUA 3E1SA 3VUBA 3V8KA 5GAOm 4C5IA 1K73C 1BI0A 4HT9A 4C0DB 4M78B 5LJ3g 4RKUE 4A54A 4M7DF 3KXTA 4XAXB 3JCMh 1VQMT 1BIAA 5CKBA 2L89A 3C12A 4PNOA 3VJPA 1KD1C 4Y28E 4X34A 3L2RA 4BY6B 3HP9A 2DD5A 3VYHB 4JDSA 3VKIA 4EMGA 4AKGA 3BG5A 2EJ9A 2QTXA 4JLGA 4LDUA 3QYGB 3L42A 3OW2S 5GANf 3LX7A 3MEVA 4M78D 3RKXA 3MEWA 4A4GA 5HY6A 3VYGB 3X28B 4LDYA 3V8JA 1N8RC 2JNGA 3OYCA 1PSEA 4AKHA 4YTLA 2WJ9A 2X4YA 4J5YA 4PJOB 4C0DC 4M78C 3OYYA 3RKWA 2XKOC 4ZTJA 5CKEA 2LVMA 1WGSA 2MAMA 2D0QB 3X24B 1U1TA 4IUTA 5LJ5f 4EMHA 1QVFA 2M16A 3X25B 2RJCA 3JB9H 3G71A 1M90C 1WPYA 2VGMA 3OS0A 5GAMd 1MHNA 2HQXA 4M7DG 1Y7XA 4PJOD 4XTYA 5GMKm 1XTDA 2DD5B 1H641 2JVVA 2YLCA 3OMCA 3OYAA 3HZJA 3L2WA 4VUBA 4M77B 3CC2A 1JJ2A 5LJ5g 3OBYA 1JRIA 3QYHB 3E19A 2JN0A 3OYBA 3DB4A 2X35A 5L8RE 2RJDA 4TVRA 4XTWA 1K8AC 1VQNA 3OSVA 4R55A 2PUKB 2ZPHB 4IURA 5A0LA 1K9MC 4M77D 2HBPA 2RHXA 3QO3A 4MDXA 1KG1A 1Q81C 3NFCA 2M1HA 1ZHIA 1GXIE 1WQ7A 2P0PA 3MP1A 1SSFA 2R5AA 5GAOp 2JUFA 5M9OA 3TW7A 1PSFA 4L5GA 1YIJT 4J7FA 2E12A 4XTVA 3L2QA 5GMKh 4BE2A 2KQWA 4N0AC 4ZGJB 1WJSA 4M7DA 3HHTB 2DPPB 4A4KA 3JCMe 3OYLA 2K4YA 1M4ZA 4J6WA 4NC6A 5GAOn 3OYDA 3CCQA 2DXUA 2ZZDB 2DTIA 3OBWA 4MIMA 3VV0A 3QXEB 4Z6YA 2EQKA 3EFSA 3P8BB 5DLQE 2ZPEB 2L3RA 4Y91A 3CD6T 1NPRA 2KK4A 4XK8E 3KBGA 4MZMA 1KQSS 3H8ZA 3OYIA 2E41A 2CZ1B 1X01A 2X4XA 1R8OB 3SDZA 3ZFJA 3LH0A 3I55T 4L59A 2RB6A 2RM4A 5C6SA 3CCET 2ZPGB 3HB9A 3X26B 4JRIA 3BY7A 3MCAB 2E6ZA 5GAMf 3A8MB 3OYMA 5C0MA 2DVEA 3ZBDA 3CXCS 2E70A 3VKGA 3GNGA 2FYKA 4A4EA 1YCYA 4MMLA 1VQ8A 1YHQA 2BS4A 2E64A 2I2LA 4LDWA 5GAN2 1YJWA 2XD0A 4GY5A 3FEOA 3PFSA 5FU6C 1ZQ1A 4ZN3A 5GAOl 2QDJA 4OB3B 3OA6A 2CZ0B 4QVZA 3FDRA 4UC4A 4C5GA 3A8HB 4KT0E 2EAYA 3N5BB 3OW2A 5GAMg 1M1FA 1BI1A 2A7YA 4P5NA 1YITT 2GFAA 2ZPIB 2EQUA 2RHUA 4NOYA 1Q82C 1YJ9A 4C92F 2QF7A 4M6VA 2CS7A 4PLLA 4BB7A 1VUBA 1JB0E 4XU0A 4Z02A 3ZEHA 2XI9A 4XQ3A 3L2UA 2PUOB 3OMGA 4XU3A 1VQMA 5D6XA 3CEYA 4FT2A 1VQ4T 2MMPA 1D3BB 3PNWC 3CCRT 2DXCA 3V8LA 2XU8A 2VYTA 2C06A 3HRUA 1Q86U 1X6OA 2KVQG 3HFNA 5KE2A 2YLBA 2RI3A 4M7DE 3DB3A 3DKMA 4M7DC 2ZPBB 2XHCA 3GLXA 2RJEA 3CCLT 3CCMT 3TCJA 3S3NA 2O4XB 3WXMB 4MMKA 4PKCC 3M4YA 4NS5A 1N27A 3QYBA 4E7JA 2XICA 3VUZA 2JTFA 2RHZA 2XK0A 2EYQA 5KCOA 3A5ZB 5A0DA 4M7AE 3MEUA 1W2BA 3JCMd 5GMKl 3OSSC 1KQ1A 1DJ7B 1BIBA 4BACA 2L5QA 3CCVT 2WACA 1VQ5T 2JZ2A 4A4HA 4DOWA 3OYGA 2PVGB 4J7IA 4C92G 4M7AF 3JB9F 4PL6A 2E5QA 4J6YA 4N0AA 4DOVA 4MFDA 2QFZA 4HCBA 5A2QE 1KC8C 4IUUA 2RH2A 2RO0A 2QEXT 5CKFA 4X9CA 3M53A 4QQGA 2EFIA 3RERA 4MZTA 1M1KC 3ME9A 1HK9A 2QQSA 3JSCA 3JAME 4EMKB 1LNXA 1Q7YC 3QPHA 2QA4T 5GANg 2NLUA 3LW5E 2L8DA 1M5Q1 5GAN4 2EQJA 4FIBA 1YJNT 2BS3A 2JTMA 2GCXA 3OS2A 2OTLT 4OVAA 1M1GA 5FROA 3GPLA 3TU4K 4HT8A 4QW2A 1TH7A 5LL6S 3HRSA 4RCBA 2DAQA 4E7HA 2CGHA 1VQ9T 2GF7A 3CPWS 3PGGA 4ELZC 1U1SA 1H3ZA 3PMTA 3CC4T 5GMKj 3LWHA 2A3LA 3GP8A 1S72T 3QKJA 5CQYA 2LDMA 1N6AA 1G3YA 2G77A 4C92A 3J7AF 2JOYA 3WVEB 3P8DA 4HLQA 4M7AG 3JB9G 3Q1JA 3OY9A 1YIJA 2P0QA 3TREA 2R5MA 3CXCA 5LJ3j 5CR2A 2HQEA 5GAMh 3OS1A 4BD3A 1Y96A 3OYEA 1VIFA 1Y71A 4FSXA 3JCMQ 3RMSA 3QHSA 3OYFA 4ZGEB 4JS4A 4HL4A 3CBPA 2HAXA 1ZBXA 3RMQA 3JCMf 4C5EA 3E9GA 3TW6A 1YBYA 5FLXE 3FLGA 4OB1B 3C95A 3LLRA 2X4JA 2M9UA 3CD6A 3CC7T 5FRMA 5A0GA 2VGNA 2EKOA 3DLLA 4JS5A 2QQBA 4JLIA 2RK2A 2GFUA 3I55A 4D6WA 1FXXA 4DQ2A 3M4GA 3CCEA 3CCUT 4B9WA 5CAIA 1NJIU 3AHUA 4EMKA 5FU6B 4PJOF 4OMFB 1N9RA 4II1A 5KCHA 3JB9J 3SWNA 1LJOA 2E65A 2CZ7B 4HNUA 2LTOA 1NZ9A 5EJCA 2XDPA 3EAEA 3FB9A 1QVPA 5GAN5 4ZTFA 2RI5A 2DJZA 5LJ3h 3A8LB 5J26A 4BI3A 2XDBA 3MP8A 4BUGA 4JRQA 2K2VA 3SFMA 2VC8A 4O6JA 4FM4B 3RESA 4C0FA 4M7AA 3OYHA 4IUPA 1YITA 1K73U 1I4K1 5I2MA 1VQKT 4HCCA 2O01E 2RHIA 2QQ9A 2VUBA 2PQWA 3BDLA 4EPCA 3L2VA 2F69A 3CPFA 4M77F 2V8KA 2K5IA 3JCMP 4C0ZA 5LJ5j 4FU6A 1KD1U 2QXFA 1I5LA 3I56T 4C8QE 3VKHA 2HNIA 2YRVA 4L6V5 2K5FA 3TEEA 4C8QC 1V29B 4C92E 3PMIA 3OYNA 4C92C 4F7UE 1VQ4A 4M7DB 3S3MA 3CCRA 3MO8A 3NTHA 1B34A 1EIFA 1O9SA 2EIFA 2FHDA 3FRNA 1BI2A 2DXBA 2LX9A 4IUQA 4N4IA 4C8QF 5GANh 4BDZA 3CMAT 2QQ8A 1N8RU 1QW1A 4F7UF 3LGLA 4PJOG 1VQPT 3CCLA 3CCMA 5AYFA 3M57A 3RKYA 4RG8A 1UEBA 3JCMX 2OTJT 5D6YA 3VU3C 3GF5A 2V8IA 3CCST 4J6XA 1NE8A 2FL7A 3OQ5A 3JCMc 5CKDA 5GAN7 4M7DD 2F5KA 2G3RA 1VQ6T 2HD0A 5DLOA 3EFRA 3NTKA 4NL2A 4XU1A 3E9FA 1UGSB 2DTHA 4AKIA 4Q5WA 3DLMA 1BI3A 4CRIA 2X4WA 3M55A 3JB9I 4CI0C 4ELJA 1M90U 3G6ET 5LJ5h 3CCVA 2QQRA 1VQ5A 1UB4A 1Y07A 2K5LA 2AHJB 3PIOA 1VQ7T 3DL1A 3QZ5B 2CKKA 4E7IA 1VQOT 4EMKC 4M77G 3CPWA 3CBOA 4HA8A 5J39A 1UGPB 3SWNC 1OYXA 2QEXA 4ME7A 3CMET 5KH6A 4M75E 1I81A 3T9NA 4M75C 2QDYB 1B34B 3VYGA 2CZ6B 1VIEA 3CCJT 4M7AC 2DXBB 2Y4YA 4KUDK 5CIUA 1KQ2A 3A8GB 3PTAA 4HNVA 2R57A 3L2ZA 3M56A 2K3YA 4C5HA 5IAYA 5GMKe 3FC3A 1JBMA 2QA4A 2DEQA 2KY9A 3M54A 4FT4A 4M75F 4C8QG 1K8AU 4PJOA 2KR6A 2LQ8A 2XDDA 1YJNA 2E10A 2OTLA 5FRNA 4DA4A 2LT1A 4F7UG 2F5TX 3J80E 3HO8A 4R56A 3HRTA 1Q81U 5HK3A 3UDCA 4OGCA 4ZGDB 2OAUA 5CK9A 1OZ2A 1BKBA 4XTZA 4FL6A 5LJ3e 5D6WA 1VQ9A 4QQ6A 2DXCB 1FWZA 4EDUA 2KSSA 2B8AA 3CC4A 3HL8A 2MI6A 5GAMj 5CO7A 5GAOr 2KAFA 1IREB 4ZN1A 1U8RA 1S72A 3QJ6A 5GAN3 4BBSM 2DZ9A 3CBMA 3ER0A 3GIBA 4OB2B 3H4CA 5I2SA 1YI2T 4JX4A 2LNVA 3G4ST 4M77A 2RJFA 1VQKA 2KDSA 3QZ9B 3C4SA 5CVIA 4RMOA 2DD4A 4BDYA 2D6FA 4BBRM 3G7ZA 4C0GA 1WNLA 2LRQA 2MF2A 4NL3A 3JRZA 4ATOA 2DTOA 1KQSA 1X75C 1NPPA 3QBYA 2EWNA 4N4HA 4QVCA 5HKCA 4GLKA 2M0OA 3QJYA 3PIPA 4M78E 1MGQA 3UT1A 1BYMA 2KMTA 2E6NA 4C8QA 4LD6A 5GANe 3CC7A 1M8VA 4M75G 3PT9A 4F7UA 4RCCA 4HCZA 3GOXA 2FB7A 1XOVA 2EJFA 4M78F 4RG2A 4MDWA 4JRPA 1VQLT 3INZA 2RK1A 3QUIA 4BY6C 5IT9E 4BI8B 3CCUA 4BE1A 1Q86C 1QP2A 4PLIA 1QP3A 3QIIA 4ELYC 1IZ6A 3JCMV 3M58A 3QYEA 4HNTA 3V7SA 1QVGA 1I8FA 3M59A 3MHXA 4BE0A 5DM7R 1G5VA 3A8OB 3X20B 3SB2A 5LJ5e 2DIQA 3QG1A 2ZZDA 5GAN6 3S3OA 3V7CA 5HK0A 1Q82U 4PJOE 1W2BS 2DD4B 4PJOC 3KHIA 1LOJA 1FKMA 2WSEE 2CYZB 4QVDA 2QI2A 3G71T 5GMKi 4JJNK 2DZCA 2GQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPB B;  4L6V 5;  1V29 B;  2PU9 B;  2D0Q B;  3X24 B;  2DXB A;  3X25 B;  1DJ7 B;  2PVG B;  2DD5 B;  1UGS B;  3QYH B;  2ZCF B;  2AHJ B;  3QZ5 B;  2WSC E;  5L8R E;  1AHJ B;  3WVD B;  1UGP B;  2ZPH B;  2PUK B;  3LW5 E;  2QDY B;  3VYG A;  1GXI E;  2CZ6 B;  4OB0 B;  2DXB B;  1UGQ B;  3A8G B;  2PVO B;  1PSF A;  2PVD B;  4ZGJ B;  3HHT B;  2DPP B;  4ZGD B;  2ZZD B;  3WVE B;  2DXC B;  3QXE B;  2ZPF B;  1UGR B;  2ZPE B;  4XK8 E;  1IRE B;  2CZ1 B;  4OB2 B;  4ZGE B;  2ZPG B;  3X26 B;  3QZ9 B;  4OB1 B;  3A8M B;  2DD4 A;  2WSF E;  4OB3 B;  2CZ0 B;  3A8H B;  4KT0 E;  4RKU E;  2CZ7 B;  2ZPI B;  3A8L B;  1QP2 A;  1QP3 A;  4Y28 E;  4FM4 B;  1JB0 E;  2DD5 A;  3VYH B;  3QYG B;  2PUO B;  2O01 E;  3A8O B;  3X20 B;  3VYG B;  3X28 B;  2ZZD A;  2DXC A;  2DD4 B;  2WSE E;  2CYZ B;  1PSE A; 
#chains in the Genus database with same CATH topology
 4QQD A;  3JCM g;  2PU9 B;  1P92 A;  3EG2 A;  2KYM A;  1GY3 B;  1RAH B;  3MET A;  4C92 B;  4A4F A;  1VYV A;  4F7U B;  3TN8 B;  3I56 A;  3CC2 T;  4M75 A;  1QLB A;  2D9T A;  4FX3 B;  5IN1 A;  2WPA B;  2P0K A;  2RI2 A;  1VQN T;  3OS5 A;  2V8J A;  1VQP A;  2QA4 Q;  2QAZ A;  5ECA A;  2Z0W A;  2FVU A;  4XTU A;  3BG9 A;  3URG A;  3CCS A;  4LUD A;  2VXE A;  4IKF A;  3WVD B;  5HCK A;  1JJ2 S;  4CFU D;  1OGU B;  3G6E A;  2DIG A;  3P8H A;  3NTI A;  2W9F A;  1JOW A;  3VS2 A;  1UGQ B;  2O9V A;  3CQT A;  3FIF A;  1VQO A;  1TD6 A;  2PVO B;  3CCQ T;  2Y4X A;  1Q7Y U;  4HKE A;  3CME A;  4AI6 A;  5IHI A;  2O4X A;  3CCJ A;  1GBR A;  1AEY A;  1PKT A;  2DRM A;  5DY9 A;  1TUG B;  3H6Z A;  2RHY A;  2WMB B;  1H1S B;  4M75 D;  2R58 A;  1UGR B;  5D7U A;  4KGV B;  2EPD A;  1AWW A;  1BU1 A;  1OKW B;  3LWI A;  2H3J A;  1C6V X;  4JX6 A;  4LN2 A;  4XU2 A;  4DEX A;  3CCU Q;  5DQV A;  2LCC A;  4RTV A;  1M3C A;  1WJR A;  3SD4 A;  1K73 C;  3TVT A;  4M78 B;  4C0D B;  1I0C A;  5LJ3 g;  4A54 A;  4M7D F;  4XAX B;  2O9S A;  4IIO A;  3C12 A;  4PNO A;  3VJP A;  1X27 A;  4Y28 E;  4X34 A;  4BY6 B;  1KD1 R;  3VYH B;  4EMG A;  3BG5 A;  1TU0 B;  4JLG A;  4LDU A;  1MMA A;  3L42 A;  1WHG A;  2HMA A;  2NUT A;  3VYG B;  1I07 A;  5IH2 A;  2W99 A;  2JNG A;  1PSE A;  4AKH A;  2WJ9 A;  4PJO B;  2CH4 W;  3OYY A;  1D0X A;  5HBH B;  2D0Q B;  3X24 B;  5LJ5 f;  2OTJ Q;  2FG0 A;  2YT6 A;  3JB9 H;  3G71 A;  1M90 R;  2VGM A;  3OS0 A;  1Y7X A;  2SRC A;  3L2W A;  1MMG A;  4M77 B;  3CC2 A;  1VQ7 Q;  4OMP A;  1NBE B;  2CCH B;  1PM3 A;  3QWX X;  1VQN A;  4TVR A;  2W2H A;  2FZC B;  1K8A R;  1U5S A;  2RHX A;  1K9M R;  1R0C B;  2M1H A;  1WQ7 A;  2VWF A;  3MP1 A;  3TW7 A;  1R0B G;  2E12 A;  1PWT A;  3M0Q A;  4QKU A;  5GMK h;  2KQW A;  4BE2 A;  2X51 A;  1A0N B;  2W9Z A;  2DPP B;  4A4K A;  3RGF B;  1M4Z A;  3CCQ A;  2DXU A;  3VV0 A;  1YI2 Q;  3EFS A;  3P8B B;  5DLQ E;  3G4S Q;  2ZPE B;  4PJL A;  2KK4 A;  4XK8 E;  3KBG A;  1KQS S;  3H8Z A;  1UTI A;  1X01 A;  1W98 B;  1MMN A;  2RB6 A;  2KI7 A;  3EG3 A;  1OU8 A;  4OMM A;  2C5X B;  4CFW B;  2E6Z A;  3A8M B;  2JGZ B;  1JO8 A;  5GAN 2;  2I2L A;  2HCK A;  1PCX A;  4GY5 A;  3PFS A;  3OA6 A;  3QWY A;  1Q95 G;  4UC4 A;  4C5G A;  2C0T A;  2EAY A;  1LPL A;  3OW2 A;  3BLR B;  2GFA A;  1D0Z A;  2EQU A;  2RHU A;  1WX6 A;  2RN8 A;  4ANJ A;  4EC9 B;  1VUB A;  2YUO A;  2COW A;  2DMO A;  4LE9 A;  2PUO B;  1ZSZ A;  4FT2 A;  4RTY A;  2RQT A;  1AT1 B;  4BCM D;  2CJM B;  2DXC A;  3V8L A;  3CCR T;  1BK2 A;  2XU8 A;  3HRU A;  4CFN B;  5KYU B;  2YLB A;  3DB3 A;  8ATC B;  3CCM T;  3S3N A;  4E7J A;  1G8X A;  4OMN A;  2ABL A;  2XK0 A;  5A0D A;  1VQK Q;  4FYW B;  1V1C A;  5GMK l;  2JT4 A;  2YRD A;  4A4H A;  4DOW A;  3VS3 A;  4J7I A;  4C92 G;  4BCI B;  4BCJ B;  4PL6 A;  1GFD A;  1ZUY A;  4MFD A;  1H1P B;  4IUU A;  2BZY A;  4X9C A;  3M53 A;  4QQG A;  4BCN B;  4FW1 A;  1G83 A;  1M1K C;  1PD1 A;  1RUW A;  1M2O A;  1WXB A;  3QPH A;  2NLU A;  1F5Q B;  2GGR A;  3LW5 E;  2L8D A;  2DA9 A;  2B9R A;  2YUP A;  5LL6 S;  3EFO B;  4EOI B;  2QDL A;  1VQ9 T;  2GF7 A;  1WHM A;  2I0N A;  2A3L A;  3GP8 A;  2IVX A;  1M8M A;  2LDM A;  1H27 B;  2DRK A;  2HKN A;  5HQ0 B;  3VS6 A;  3P8D A;  1VQ8 Q;  4F7N B;  1QLY A;  2R5M A;  5GAM h;  2AKK A;  5L23 A;  1Y96 A;  3EOC B;  4PFP A;  1VIF A;  1Q86 R;  4HXJ A;  3RMS A;  3QHS A;  1YNZ A;  1O9K A;  1ZBX A;  4OB1 B;  3LLR A;  2EYX A;  1CKA A;  4JLI A;  2RK2 A;  2GFU A;  4DQ2 A;  3MIA B;  1OOT A;  1VQM Q;  3H0H A;  4PJJ A;  5FU6 B;  5KCH A;  4OMF B;  4II5 B;  1PKS A;  2WHB B;  3SEM A;  3LQ5 B;  1LJO A;  2CZ7 B;  1NZ9 A;  2XDP A;  3EG9 A;  4ZTF A;  4PJM A;  7AT1 B;  2DJZ A;  3A8L B;  4BUG A;  4JRQ A;  4M7A A;  4C0F A;  2PK2 A;  3OYH A;  2LP5 A;  1D3U B;  1K73 U;  1VQK T;  1TWB A;  2VUB A;  2PQW A;  4EPC A;  2O2O A;  3L2V A;  2XMF A;  1H28 B;  2V8K A;  2EGE A;  5FWB A;  4OMQ A;  2WEV B;  4C0Z A;  5LJ5 j;  3A98 A;  4BCP B;  1I5L A;  4C8Q E;  1H92 A;  2HNI A;  3OYN A;  3FJ5 A;  4C92 C;  4M7D B;  1LVK A;  3CCR A;  3MO8 A;  3NTH A;  1O9S A;  4IUQ A;  4N4I A;  3FRN A;  4XQ3 A;  1BI2 A;  2CP3 A;  2UZL B;  3QDF A;  4A63 B;  1TS9 A;  2QQ8 A;  1QW1 A;  4F7U F;  2P4R A;  4PJO G;  3CCM A;  1IB8 A;  1X2K A;  1EX4 A;  3VU3 C;  3GF5 A;  1NE8 A;  5CKD A;  4CRL B;  2HD0 A;  2J05 A;  4NL2 A;  5DLO A;  4AKI A;  3DLM A;  2JS2 A;  5LJ5 h;  1QWF A;  2QQR A;  2DIL A;  2K5L A;  3DL1 A;  1IHV A;  3EGD A;  3QZ5 B;  2LJ1 A;  4M77 G;  2DBK A;  2C4G B;  5J39 A;  3VS1 A;  2DJQ A;  5KH6 A;  4F16 A;  2QDY B;  2RQV A;  1VIE A;  2DXB B;  4KUD K;  2ED0 A;  2R57 A;  4AT1 B;  4C8Q G;  3O0G D;  4J9G A;  1U06 A;  2F5T X;  3MY1 B;  1H1Q B;  1OZ2 A;  2ED1 A;  4XTZ A;  4E2F B;  5D6W A;  1VQ9 A;  4BCG B;  3DOG B;  1G3N C;  2KAF A;  1IRE B;  4ZN1 A;  5I5Z B;  3BHT B;  3ER0 A;  3H4C A;  1BBZ A;  5I2S A;  3QZ9 B;  4RMO A;  5CVI A;  1C1A A;  2DD4 A;  4LUE A;  4OGR B;  4NL3 A;  3EID B;  3QHW B;  3QBY A;  4WTO B;  3RNJ A;  2E6N A;  4BCK B;  3H41 A;  4LD6 A;  1Z9Z A;  1M8V A;  2KGT A;  1XOV A;  1YJW Q;  4M78 F;  2AK5 A;  2RK1 A;  4BY6 C;  4BI8 B;  2AT1 B;  1Q86 C;  2PMI B;  1QP2 A;  1QP3 A;  4PLI A;  2MYS A;  3QII A;  4ELY C;  1VQ4 Q;  3QYE A;  4HNT A;  1OQK A;  1ZX6 A;  4KRT A;  1IGQ A;  2HDA A;  1ZBJ A;  3VS5 A;  3M59 A;  3MHX A;  5LJ5 e;  3DJB A;  2DIQ A;  5GAN 6;  4PJO C;  2JMC A;  4QVD A;  1VQK A;  1D1A A;  1IXD A;  3O8V A;  2AZV A;  2IVW A;  2BIV A;  1HXD A;  5GAN j;  4A53 A;  1VQ5 Q;  2KT8 A;  1OL1 B;  4EOR B;  2WFY B;  3KUF A;  5LJ3 d;  3E2U A;  5BNJ B;  1G3W A;  4M77 C;  2NUP A;  2ROT A;  3TSZ A;  1UUE A;  5CKH A;  4J8O A;  3QSU A;  3UWN A;  2QGS A;  2E3H A;  4BCF B;  3BHV B;  2VV5 A;  2K57 A;  2EBP A;  2LJ0 A;  1YJN Q;  2OTL Q;  2DK3 A;  5CCA A;  2R7G A;  4EOL B;  1K9A A;  4JJC A;  4JZ3 A;  3F70 A;  5KYX B;  1LCK A;  2VXF A;  4KRC B;  1FX7 A;  3O5Z A;  3QDR B;  1D3B A;  4OB0 B;  2RPN A;  1KHC A;  5GAN d;  1RI9 A;  4M75 B;  1M1K U;  1XNI A;  2QQA A;  4BI4 A;  4DBF A;  1QMC A;  3JCM W;  1S1N A;  2RA2 A;  2EQM A;  2HL5 C;  2CP7 A;  3V7R A;  3JB9 D;  3TQ7 P;  3VS7 A;  4KBM B;  5GAO q;  1RAA B;  2K7A A;  1M30 A;  1YJW T;  4JRK A;  4BCO B;  1M27 C;  4F6U B;  2BKD N;  2P4T A;  1X69 A;  2H8H A;  5FU7 C;  3TNI B;  2LQK A;  1JSU B;  1MNE A;  1K9M U;  1UHF A;  2WSF E;  1QMZ B;  3MPU B;  2X3W D;  1ZUU A;  2CSQ A;  2LQN A;  2L0A A;  3M5A A;  3VUB A;  3V8K A;  2DEU A;  5GAO m;  4RKU E;  1BIA A;  3I5R A;  4ZNX A;  4ELL A;  1AD5 A;  3VKI A;  4AKG A;  2OAW A;  2CUB A;  2FRY A;  2MK5 A;  5HY6 A;  4J9C A;  4LDY A;  1AZE A;  2BZ8 A;  3V8J A;  3CMA Q;  3RKW A;  2CSI A;  2XKO C;  1H4L D;  4ZTJ A;  1RAD B;  4PK4 A;  1H25 B;  1WGS A;  2LVM A;  1U1T A;  1QVF A;  5HBE B;  1HSQ A;  1VQ6 Q;  1ZA1 B;  1XO2 A;  2FPE A;  2HQX A;  4M7D G;  4XTY A;  2GTJ A;  4DBH A;  1H64 1;  5LJ5 g;  1JRI A;  3QYH B;  2NUT B;  1D1C A;  2JN0 A;  2DVJ A;  1AWJ A;  3DB4 A;  4ESR A;  2RJD A;  2DL3 A;  2DBM A;  2RNA A;  3OSV A;  4R55 A;  4G6L B;  1VQL Q;  1OL2 B;  3QO3 A;  3MKD A;  1KG1 A;  1ZHI A;  1GXI E;  1C9B A;  5GAO p;  1SSF A;  2KT1 A;  1QCO A;  4CC2 A;  2CP2 A;  2QEX Q;  1WZO A;  4N0A C;  4ZGJ B;  1WJS A;  4IIM A;  3HHT B;  3OYD A;  4Y91 A;  4CC7 A;  2L3R A;  4HVV A;  3CD6 T;  2E41 A;  3SDZ A;  2FZK B;  5FW9 A;  4L59 A;  3I55 T;  1MUZ A;  2RM4 A;  3CCE T;  2ZPG B;  5GAM f;  3OYM A;  4JJD A;  4DBQ A;  3VRY A;  3VKG A;  4YOO A;  1YCY A;  4MML A;  1OKV B;  4R0K A;  1YJW A;  5FU6 C;  4ZN3 A;  1WLP B;  2J6K A;  2QDJ A;  4OB3 B;  3FDR A;  4BCQ D;  3A8H B;  1M1F A;  2A7Y A;  4BCM B;  2ZPI B;  4J9E A;  1Q82 C;  2QF7 A;  4PLL A;  4E7Z A;  5EC7 A;  4BB7 A;  4J9I A;  1JB0 E;  3POM A;  4XU3 A;  2EYY A;  3NDQ A;  2C5V B;  3EG1 A;  1W6X A;  2C06 A;  2VYT A;  2K3B A;  1Q86 U;  5KE2 A;  1OPL A;  4M7D C;  2WXV B;  2ZPB B;  3CCL T;  1X43 A;  1Y57 A;  1KIK A;  3M4Y A;  4NS5 A;  2JTF A;  2RHZ A;  4KH1 B;  2EYQ A;  5KCO A;  3A5Z B;  4DBR A;  3MEU A;  1W2B A;  1KQ1 A;  2BKZ B;  1BIB A;  4BAC A;  1KQS P;  3OYG A;  2EVR A;  2F2X A;  4JJB A;  5IDP B;  3JB9 F;  4QT7 A;  1SHG A;  2QFZ A;  4HCB A;  1ZSZ B;  2RH2 A;  2RO0 A;  2QEX T;  3ULR B;  1TSF A;  4MZT A;  4PFZ A;  3JSC A;  2F2V A;  1M1K R;  2QA4 T;  5GAN g;  4Z88 A;  5GAN 4;  4FIB A;  4BY7 X;  2JTM A;  2DM1 A;  1M1G A;  5FRO A;  3GPL A;  4QW2 A;  4AFU C;  2MOX A;  3HRS A;  4RCB A;  2DAQ A;  1OX9 A;  4E7H A;  2CGH A;  2DFU A;  1H3Z A;  3PMT A;  4CFM B;  3I35 A;  2IW8 B;  2YUQ A;  5GMK j;  1RAG B;  3QKJ A;  4X1V A;  2G77 A;  3NGP A;  4F6W B;  4C92 A;  1YHQ Q;  1KFZ A;  3OY9 A;  3TRE A;  3CXC A;  2HQE A;  3OYE A;  4FSX A;  2ECZ A;  4EIK A;  1TUD A;  4JS4 A;  2HAX A;  1JEG A;  3JCM f;  4C5E A;  5FLX E;  1YJ9 Q;  3CD6 A;  2PK9 B;  5A0G A;  2VGN A;  3DLL A;  2W0Z A;  1M3B A;  1SPK A;  3I55 A;  1FXX A;  3M4G A;  4F6S B;  3CCE A;  1N4M A;  4B9W A;  3CCU T;  1YWO A;  8AT1 B;  4II1 A;  3EG0 A;  3JB9 J;  3EHR A;  1AVZ C;  2E65 A;  2LTO A;  2HL3 A;  3EAE A;  1QVP A;  2RI5 A;  2BE9 B;  2XDB A;  3MP8 A;  2VC8 A;  3ZL7 C;  3RES A;  1GRI A;  4IUP A;  4HCC A;  2KE9 A;  5HVY B;  1O9K B;  2RHI A;  3JCM P;  2QXF A;  1N5Z A;  1VYT A;  4C92 E;  2JS0 A;  3TEE A;  3PMI A;  4F7U E;  3AT1 B;  3S3M A;  3G1J A;  1B34 A;  2FHD A;  2DNU A;  3LGL A;  3CCL A;  3H9N A;  5AYF A;  2HQH A;  2EGC A;  3M57 A;  4RG8 A;  1UEB A;  3RKY A;  4I3Z B;  2OTJ T;  1QQJ A;  4J6X A;  2FL7 A;  3JCM c;  2G3R A;  2IIM A;  3NTK A;  1TUC A;  4XU1 A;  2DTH A;  4Q5W A;  2KRM A;  1D09 B;  4ELJ A;  4D8K A;  1SSH A;  1Z9Q A;  3M03 A;  1URC B;  2IW6 B;  5KYY A;  1VQ7 T;  2CKK A;  4EMK C;  3CPW A;  3CBO A;  4M4Z A;  2BTT A;  4F7S B;  1UGP B;  5CYI B;  4HA8 A;  2JM8 A;  2QEX A;  4ME7 A;  3T9N A;  1YIJ Q;  4Y72 B;  4M75 C;  3VYG A;  4AFZ C;  2M51 A;  2DET A;  1TTH B;  2Y4Y A;  1KQ2 A;  3PTA A;  5GMK e;  4CXA B;  2QA4 A;  1T0H A;  3FC3 A;  1JBM A;  2DEQ A;  4M75 F;  1H1R B;  2JJ9 A;  4PJO A;  4F7U G;  5HK3 A;  2OAU A;  2K6D A;  4RTX A;  1SRM A;  1FWZ A;  2CT3 A;  1OPK A;  5GAM j;  5GAO r;  1F1B B;  4BBS M;  2AIR B;  1YI2 T;  3G4S T;  3I9Q A;  4M77 A;  1MND A;  3C4S A;  1RLP C;  4BDY A;  2MCN A;  2QG9 B;  2D6F A;  1WNL A;  3VS4 A;  2DTO A;  1X75 C;  1NPP A;  4N4H A;  2W96 A;  2EWN A;  4QVC A;  5HKC A;  4GLK A;  3PIP A;  4M78 E;  1MGQ A;  3UF4 A;  1YCS B;  2KMT A;  1ZSG A;  4C8Q A;  2FB7 A;  4YC3 B;  2A36 A;  1JXO A;  4RG2 A;  5IT9 E;  1YP5 A;  3CCU A;  4BE1 A;  1OIY B;  3M58 A;  1BCO A;  1QVG A;  4BE0 A;  2O31 A;  4EON B;  2FPF A;  3QG1 A;  3S3O A;  1Q82 U;  5HK0 A;  4PJO E;  2H3E B;  1W2B S;  4B6M A;  2DD4 B;  3KHI A;  1LOJ A;  2CYZ B;  4EOP B;  2DZC A;  3OYB A;  2LT4 A;  4MFE A;  3FJP A;  3M9Q A;  4B9X A;  4LD9 K;  1JST B;  2AKL A;  4J9B A;  2RD1 A;  1RL2 A;  4O5V A;  5EG2 A;  4E7K A;  1ZLM A;  1ZA2 B;  1HD3 A;  3CCV Q;  4RTT A;  2XG8 D;  4JX5 A;  1SG5 A;  2E1H A;  3RIR A;  3GBQ A;  5KE3 A;  4M77 E;  1RAE B;  2LCL A;  2ROL A;  4M78 G;  2YHT A;  2SEM A;  4E47 A;  4C8Q D;  1K0S A;  4E7L A;  1T0J A;  4N4G A;  2OI3 A;  3HSB A;  3OW2 P;  3BW1 A;  2OTJ A;  1B3Q A;  1GCQ A;  1HYO A;  1O75 A;  3HPW A;  3MEA A;  5J3B A;  5IXF A;  3OYK A;  3OYJ A;  2BS2 A;  1AHJ B;  3KFV A;  3L1A A;  4TTH A;  2IG0 A;  1BU2 A;  1VYW B;  2DL5 A;  4KUL A;  3SWN B;  2ZGW A;  1WIE A;  3CC4 Q;  1D0Y A;  1PD0 A;  4LDV A;  2LX7 A;  4OF1 A;  1VQ7 A;  3S6W A;  3UAT A;  3BFM A;  5KYU A;  3C94 A;  2PVD B;  4XTX A;  3JCM J;  3SHW A;  2NUP B;  2LC4 A;  3PVL A;  1AD6 A;  1YN8 A;  2K3X A;  2A28 A;  5GJV B;  5GAM e;  4K11 A;  2L2P A;  3QHR B;  1KSW A;  2ZPF B;  1M9S A;  2A08 A;  3OB9 A;  4X9D A;  2KMG A;  5LJ5 d;  4M7A D;  3RUX A;  4OGE A;  1EZZ B;  1UNH D;  1RAI B;  3J81 E;  2WMA B;  2DXT A;  3CC7 Q;  2MWP A;  1VQ8 T;  2BUD A;  2I53 A;  1JKW A;  3ASK A;  2OJ2 A;  2M02 A;  4WF2 A;  1WJQ A;  3MP6 A;  1FYN A;  2MWO A;  1G3S A;  4MZP A;  2J7I A;  1YI2 A;  1NYG A;  3G4S A;  1UNL D;  2DO3 A;  3BDU A;  3TNH B;  1ZUK A;  1BI0 A;  4HT9 A;  4YOZ A;  3KXT A;  3JCM h;  3EH2 A;  1VQM T;  5CKB A;  3EFO A;  1WHL A;  2KXC A;  3HP9 A;  2DD5 A;  4JDS A;  4Z8A A;  2EKH A;  1TFB A;  3QYG B;  3OW2 S;  3I56 Q;  4A4G A;  3MEW A;  4AG2 C;  4E6R A;  1UDL A;  4AFQ C;  3RDV A;  1KC8 R;  1YIT Q;  5LMK B;  4J5Y A;  2KYB A;  3EHQ A;  4C0D C;  4M78 C;  4J9D A;  4FYX B;  1VQP Q;  2FO0 A;  2MAM A;  2PHG A;  4IUT A;  1GUX A;  4EMH A;  3CCS Q;  1PHT A;  3BLH B;  2RJC A;  4EOS B;  4J9F A;  2HEQ A;  5GMK m;  4EOO B;  4ROC A;  1XTD A;  1GH6 B;  3G6E Q;  2JVV A;  3OYA A;  3OMC A;  1ZSZ C;  4PFO A;  1JJ2 A;  2VKN A;  1UJ0 A;  3OBY A;  1VQO Q;  2YDL A;  2RF0 A;  2KXD A;  3CME Q;  4AMC A;  5L8R E;  5KYW A;  3MI9 B;  3CCJ Q;  2E5K A;  2PUK B;  2ZPH B;  4F14 A;  2HBP A;  4MDX A;  1Q81 C;  2JUF A;  5M9O A;  4FW2 A;  4L5G A;  2IPO B;  4J7F A;  2FEI A;  3L2Q A;  2BZX A;  4M7D A;  1MV3 A;  4JZ4 A;  2B86 A;  3JCM e;  2K4Y A;  2ZZD B;  4MIM A;  4WCI A;  1TXQ A;  2EQK A;  1NPR A;  4MZM A;  2D0N A;  2BE7 D;  2YUN A;  2CZ1 B;  2X4X A;  1X6B A;  2RMO A;  4OR5 B;  3LH0 A;  1ABO A;  1WHH A;  4BCQ B;  3X26 B;  1S72 Q;  3BY7 A;  2GBQ A;  1B7T A;  2DVE A;  2E70 A;  2FYK A;  2KRN A;  4A4E A;  1VQ8 A;  2BS4 A;  2E64 A;  1XJW B;  4LDW A;  2XD0 A;  1BCM A;  1IHW A;  1UG1 A;  4KT0 E;  5GAM g;  1YIT T;  2FZG B;  4NOY A;  1Q82 R;  3PO3 S;  4Z02 A;  3ZEH A;  1VOM A;  2CCI B;  3OMG A;  1VQM A;  3G71 Q;  5D6X A;  3CEY A;  3B57 A;  1VQ4 T;  2MMP A;  2DL7 A;  5DQW A;  5IHY A;  1X6O A;  1IO6 A;  4M7D E;  3DKM A;  2XHC A;  2DX1 A;  3CC2 Q;  2RJE A;  3TCJ A;  1VYU A;  2O4X B;  3G33 B;  3VUZ A;  1FMK A;  1ENW A;  3UA7 A;  4BCH B;  3LH5 A;  1UFF A;  1R77 A;  1CSK A;  1OIU B;  1DJ7 B;  2L5Q A;  1VQ5 T;  2WAC A;  2PVG B;  4PJN A;  4M7A F;  2CP6 A;  4DOV A;  4J6Y A;  3THK A;  5A2Q E;  1KC8 C;  4AG1 C;  5CKF A;  4Z89 A;  3RER A;  4AFS C;  1E7O A;  3ME9 A;  1HK9 A;  3JAM E;  2YXY A;  1GL5 A;  1M5Q 1;  3CCQ Q;  1YJN T;  6AT1 B;  2OTL T;  1KXU A;  4OVA A;  1IGU A;  2JTE A;  4BY1 X;  3TU4 K;  3DDQ B;  3GTM S;  1U3O A;  4ELZ C;  3LWH A;  1S72 T;  1PRL C;  3EH1 A;  4J9H A;  2MIO A;  2MPX C;  1G2B A;  3JB9 G;  3Q1J A;  2P0Q A;  4BD3 A;  1Y71 A;  3OYF A;  1AWX A;  4E7S A;  3E9G A;  3TW6 A;  1YBY A;  4LXC A;  3FLG A;  2X4J A;  1X2Q A;  2FPD A;  2QQB A;  1WI7 A;  2G9X B;  1P5E B;  1NM7 A;  2K9G A;  5KYX A;  2EYW A;  4EMK A;  4KGX B;  1N9R A;  5IDN B;  2KRO A;  5EJC A;  2A0F B;  2K2V A;  2LJ3 A;  3SFM A;  4O6J A;  4FM4 B;  3I5S A;  1HJD A;  3F5X B;  2X3X D;  1YIT A;  1I4K 1;  2HSE B;  5I2M A;  1E6G A;  1WXU A;  1E6H A;  1UHC A;  1OU9 A;  1K0X A;  4FU6 A;  5KYN A;  3EGX A;  2FRW A;  4RTW A;  5CEI B;  1V29 B;  2WIH B;  1VQ4 A;  1WHK A;  2X9H A;  1K4U S;  2C0I A;  1M2V A;  3CMA T;  2W10 A;  4HVU A;  4RTZ A;  5D6Y A;  2KNB B;  2LCS A;  2F5K A;  1VQ6 T;  3EFR A;  3E9F A;  1BI3 A;  2X4W A;  3M55 A;  4CI0 C;  4F7J B;  1VQ5 A;  3BE3 A;  1UB4 A;  1Y07 A;  2AHJ B;  3A1P A;  3PIO A;  4E7I A;  1TOV A;  3H0I A;  3SWN C;  1QCF A;  2VB6 A;  2UZB B;  2J6F A;  4M75 E;  1KK7 A;  1NJI R;  1E9H B;  1B34 B;  9ATC B;  1GFC A;  1PKD B;  5CIU A;  1VQL T;  4HNV A;  3L2Z A;  3M56 A;  4C5H A;  4FT4 A;  2BPM B;  2KBT A;  1YJN A;  2OTL A;  4DA4 A;  2LT1 A;  3HO8 A;  4R56 A;  3HRT A;  1Q81 U;  2DYB A;  3UDC A;  4ZGD B;  3REB B;  2DF6 A;  3JV3 A;  1BKB A;  3DTO A;  4QQ6 A;  2DXC B;  1OX8 A;  4EDU A;  1QVF P;  2KSS A;  2MI6 A;  1S72 A;  5KYY B;  3QJ6 A;  5GAN 3;  3VRZ A;  3CBM A;  2HZY A;  1CKB A;  3GIB A;  4JX4 A;  3HTR A;  2RJF A;  2LZ6 B;  5FWC A;  2J6O A;  2CRE A;  4BBR M;  1PRM C;  2DL8 A;  4C0G A;  4ATO A;  2C6T B;  2EW3 A;  3JRZ A;  3M0S A;  2COY A;  2PJQ A;  1N8R R;  2M0O A;  1BYM A;  1ACM B;  1OUL A;  4M75 G;  3PT9 A;  4F7U A;  3GOX A;  1V76 A;  2EJF A;  3MY5 B;  1GBQ A;  1IZ6 A;  3JCM V;  3CCR Q;  3V7S A;  2CP5 A;  4GBQ A;  5DM7 R;  3X20 B;  3SB2 A;  2J06 A;  4CFX B;  3CCM Q;  1FIN B;  2L3P A;  1FKM A;  2QI2 A;  1UE9 A;  2NYS A;  4V2S A;  5GAN 8;  1XQH A;  1PC0 A;  1AZG B;  1H3H A;  1JU5 C;  3UPU A;  4C8Q B;  1WA7 A;  4J83 A;  4DEY A;  1W4S A;  1B07 A;  4RUG A;  3JCM b;  2F2W A;  1AWO A;  3IQL A;  3R6O A;  2COZ A;  3GNF B;  4ROE A;  2E3I A;  2ENM A;  1Y96 B;  1E7P A;  2K79 A;  4LDX A;  3CMA A;  1VA7 A;  3HKS A;  3NMZ C;  5CQX A;  4C92 D;  1QVF S;  1WQW A;  2EJG A;  1ZP2 A;  2ZCF B;  5C6S A;  1OI1 A;  2Y90 A;  3TNW B;  2WSC E;  1VQ6 A;  4OP0 A;  1BB9 A;  1KHI A;  1VQ9 Q;  1KC8 U;  2LMJ A;  2XID A;  1SRL A;  3HBL A;  3EG9 B;  4JUV A;  4LOC A;  4M7A B;  5ACB A;  2HSP A;  2CT4 A;  5FU7 B;  3BG3 A;  2A37 A;  2ESW A;  4D8D A;  4M78 A;  4IUV A;  1VQL A;  5I21 A;  3NHN A;  3QWL A;  1RI0 A;  2QK0 A;  4LNP A;  1N9S A;  1W2B P;  2C5O B;  2DKG A;  1QWE A;  4QSH A;  1YHQ T;  1NJI C;  1T3L A;  3M0T A;  2UZE B;  3HFO A;  1VIN A;  2EQI A;  5LJ3 f;  3LGF A;  1G3T A;  2C0O A;  4KUI A;  3U23 A;  5EFQ B;  1WYX A;  1OZ3 A;  1J3T A;  1WDX A;  1YJ9 T;  3LYI A;  4NST B;  1ARK A;  2C5N B;  3E1S A;  4C5I A;  1UNG D;  1AIS B;  4CC3 A;  3K7A M;  2L89 A;  1KD1 C;  3EGD B;  2QAS A;  3L2R A;  2D1X A;  2EJ9 A;  2QTX A;  5I11 A;  4HVW A;  5GAN f;  3LX7 A;  1AOJ A;  3MEV A;  4M78 D;  3X28 B;  1OI9 B;  1N8R C;  3OYC A;  2GQI A;  2CUD A;  2QTV A;  4YTL A;  2WIP B;  2X4Y A;  3CXC P;  2LQW A;  1WFW A;  1NLP C;  5CKE A;  1Q7Y R;  2CH4 A;  2M16 A;  3X25 B;  3BHU B;  1M90 C;  2DME A;  1WPY A;  5GAM d;  1MHN A;  4RTU A;  4PJO D;  2DD5 B;  2YLC A;  3HZJ A;  4VUB A;  4CFV B;  2V1R A;  1NLO C;  2RQU A;  3E19 A;  2ZAE A;  2V1Q A;  2X35 A;  4XTW A;  1K8A C;  3NPF A;  4IUR A;  3UA6 A;  5A0L A;  1K9M C;  4M77 D;  5HNB B;  2CP0 A;  3NFC A;  1Q81 R;  1GUX B;  2P0P A;  2R5A A;  4EC8 B;  3PE0 A;  1PSF A;  4IMY B;  1YIJ T;  1WXT A;  4XTV A;  3C0C A;  3OYL A;  4J6W A;  4FYV B;  2OX7 A;  4NC6 A;  5GAO n;  2DTI A;  3OBW A;  4Z6Y A;  3QXE B;  2K2M A;  4EOJ B;  2E4H A;  5FGK B;  1IRX A;  3OYI A;  5IXB A;  2JMA A;  1H26 B;  1R8O B;  5KYW B;  2LW4 A;  3DDP B;  1FMW A;  2JXB A;  3ZFJ A;  1K1Z A;  1RAF B;  3HB9 A;  4JRI A;  2PZ1 A;  3MCA B;  5C0M A;  2CDT A;  3ZBD A;  3CXC S;  3GNG A;  1YHQ A;  4EOM B;  1C0M A;  1EFN A;  3FEO A;  5GAO l;  1ZQ1 A;  3CPW P;  2CZ0 B;  4QVZ A;  3REA B;  4FYY B;  3N5B B;  1BI1 A;  4P5N A;  2DL4 A;  4YOS A;  2PTK A;  2QGF B;  1YJ9 A;  4C92 F;  4M6V A;  2CS7 A;  4XU0 A;  2UZD B;  1YWP A;  2XI9 A;  3L2U A;  1UJY A;  4JPB W;  2PNI A;  1D3B B;  2HBW A;  3PNW C;  2JM9 A;  2KVQ G;  3HFN A;  2RI3 A;  3GLX A;  3WXM B;  4MMK A;  5L2W B;  2D8J A;  4PKC C;  1N27 A;  3QYB A;  2RQW A;  2XIC A;  4M7A E;  3JCM d;  2DER A;  3OSS C;  3CCV T;  2JW4 A;  2JZ2 A;  2E5Q A;  4N0A A;  1RLQ C;  3RR6 A;  1PNJ A;  2EFI A;  5ICP B;  2QQS A;  3M0P A;  1LNX A;  1Q7Y C;  1QCN A;  1JQQ A;  1FVV B;  2EQJ A;  2BS3 A;  1VOL A;  2GCX A;  3OS2 A;  1QVG P;  1RAC B;  4EOK B;  1QKX A;  4HT8 A;  1TH7 A;  4BCN D;  2VVK A;  2DE0 X;  3EGU A;  3CPW S;  3PGG A;  2F2C A;  1U1S A;  2AZS A;  3CC4 T;  5IHK A;  5CQY A;  1KJW A;  4CC4 B;  1N6A A;  1G3Y A;  3M0R A;  3J7A F;  3TSW A;  2JOY A;  3WVE B;  4M7A G;  4HLQ A;  3MJX A;  2VAS A;  1MMD A;  1SKU B;  4F17 A;  1YIJ A;  1YFN A;  2YWW A;  5LJ3 j;  5CR2 A;  3OS1 A;  2V26 A;  4FCY A;  2QGG A;  3RBB B;  3JCM Q;  4ZGE B;  4HL4 A;  2GTO A;  3CBP A;  4GLM A;  4FSS A;  3RMQ A;  3C95 A;  1UEC A;  2M9U A;  3CC7 T;  5FRM A;  2EKO A;  4JS5 A;  2EYZ A;  4D6W A;  2DYI A;  5CAI A;  1NJI U;  3AHU A;  4ROD A;  4PJO F;  3PVQ A;  5AT1 B;  2I40 B;  3SWN A;  4HNU A;  3FB9 A;  1MV0 B;  4HCK A;  2HKQ B;  5GAN 5;  5LJ3 h;  4BI3 A;  5J26 A;  1PG5 B;  1GCP A;  1RAB B;  4ORZ A;  2D8H A;  2KRS A;  1TG0 A;  2IW9 B;  4OML A;  4KGZ B;  1W70 A;  2O01 E;  1I5O B;  4CFU B;  2QQ9 A;  3BDL A;  1JXM A;  2KR3 A;  2F69 A;  3CPF A;  4M77 F;  2K5I A;  1KD1 U;  1WHJ A;  4KH0 B;  3M0U A;  3I56 T;  1K76 A;  3VKH A;  2YRV A;  4L6V 5;  2K5F A;  4C8Q C;  1QVG S;  2NWM A;  5IHN A;  1SF9 A;  3VS0 A;  2G6F X;  4F04 B;  1EIF A;  2EIF A;  4EMK B;  2P84 A;  2V22 B;  2DXB A;  2LX9 A;  4C8Q F;  5GAN h;  4BDZ A;  1N8R U;  2UUE B;  4UN0 A;  1I1J A;  1VQP T;  2X1N B;  3D7S B;  3JCM X;  4BXX X;  2V8I A;  3CCS T;  2EGA A;  3OQ5 A;  5GAN 7;  4M7D D;  4Y92 A;  1ABQ A;  1UGS B;  4F7L B;  5IF1 B;  2LNH B;  4CRI A;  3JB9 I;  2DLP A;  1H8K A;  1NEB A;  1OEB A;  1M90 U;  5GJW B;  3G6E T;  3CCV A;  3EJ1 B;  2KEA A;  1UGV A;  1H24 B;  2QYZ A;  2L3S A;  1VQO T;  3EGX B;  3BLQ B;  1D1B A;  1QKW A;  1OYX A;  2EUF A;  2GNC A;  2M0Y A;  3CME T;  1NG2 A;  1I81 A;  3CCJ T;  2CZ6 B;  2YRC A;  1VQN Q;  4M7A C;  2YSQ A;  1M2V B;  3A8G B;  5IAY A;  1W1F A;  2K3Y A;  2KY9 A;  3M54 A;  1K8A U;  2KR6 A;  2LQ8 A;  4EOQ B;  2XDD A;  2E10 A;  5FRN A;  3J80 E;  5LQF B;  1T3S A;  3CD6 Q;  4OGC A;  4OMO A;  5CK9 A;  4F70 B;  5LJ3 e;  1X6G A;  4FL6 A;  1NEG A;  1K73 R;  3H0F A;  1GCQ C;  3I55 Q;  2B8A A;  3CC4 A;  2IN3 A;  3HL8 A;  3CCE Q;  5CO7 A;  1U8R A;  2DZ9 A;  3R6N A;  4OB2 B;  5HBJ B;  1M3A A;  1OV3 A;  2LNV A;  2O88 A;  2ATC B;  2KDS A;  2RQR A;  1Y0M A;  1JJ2 P;  2F1L A;  3G7Z A;  5I22 A;  2LRQ A;  2MF2 A;  1KQS A;  1SHF A;  3QJY A;  4KRD B;  3UT1 A;  5GAN e;  3CC7 A;  1SEM A;  4RCC A;  4HCZ A;  4JRP A;  4MDW A;  3INZ A;  3QUI A;  2L3Q A;  1I8F A;  1FMV A;  1G5V A;  3A8O B;  3CCL Q;  2ZZD A;  3V7C A;  1NYF A;  2WSE E;  2NUZ A;  3RKX A;  3G71 T;  5GMK i;  4JJN K;  2GQV A; 
#chains in the Genus database with same CATH homology
 4V2S A;  2LT4 A;  4MFE A;  3FJP A;  3M9Q A;  3O8V A;  1XQH A;  4QQD A;  4B9X A;  5GAN 8;  4LD9 K;  2RD1 A;  3JCM g;  2PU9 B;  1RL2 A;  4O5V A;  1P92 A;  3UPU A;  5EG2 A;  1QVG S;  4E7K A;  4C8Q B;  2IVW A;  4J83 A;  1W4S A;  2BIV A;  3MET A;  1HXD A;  4C92 B;  4A53 A;  5GAN j;  2XG8 D;  4JX5 A;  4A4F A;  4F7U B;  3JCM b;  3I56 A;  4M75 A;  3CC2 T;  2E1H A;  3RIR A;  3R6O A;  1QLB A;  2D9T A;  3GNF B;  3KUF A;  5LJ3 d;  5IN1 A;  4M77 E;  5KE3 A;  2LCL A;  1G3W A;  1Y96 B;  4M78 G;  1E7P A;  2YHT A;  4M77 C;  2P0K A;  4LDX A;  5CKH A;  2RI2 A;  4E47 A;  4J8O A;  3CMA A;  4C8Q D;  1VQN T;  3UWN A;  3QSU A;  3HKS A;  1QVF S;  5CQX A;  3OS5 A;  4C92 D;  4E7L A;  1WQW A;  2V8J A;  2EJG A;  4N4G A;  1VQP A;  3HSB A;  2ZCF B;  3BW1 A;  2FVU A;  2VV5 A;  2K57 A;  4XTU A;  3BG9 A;  1OI1 A;  1O75 A;  2Y90 A;  3URG A;  3HPW A;  3MEA A;  5J3B A;  3CCS A;  2VXE A;  3OYK A;  2DK3 A;  5CCA A;  2WSC E;  2BS2 A;  3OYJ A;  1AHJ B;  4OP0 A;  1VQ6 A;  4IKF A;  3F70 A;  3WVD B;  1KHI A;  3L1A A;  1JJ2 S;  2IG0 A;  3G6E A;  2VXF A;  2DIG A;  3P8H A;  1KC8 U;  3NTI A;  1FX7 A;  4KUL A;  3SWN B;  2ZGW A;  2XID A;  3QDR B;  1D3B A;  4LDV A;  4OF1 A;  4OB0 B;  3HBL A;  3S6W A;  1VQ7 A;  4JUV A;  1UGQ B;  1KHC A;  3FIF A;  5GAN d;  1VQO A;  2PVO B;  4M75 B;  3BFM A;  4LOC A;  1XNI A;  2QQA A;  2Y4X A;  4M7A B;  3CCQ T;  1M1K U;  3C94 A;  2PVD B;  1Q7Y U;  4HKE A;  4BI4 A;  4XTX A;  5FU7 B;  3JCM J;  3CME A;  4AI6 A;  3BG3 A;  2O4X A;  3JCM W;  3CCJ A;  2LC4 A;  4M78 A;  2K3X A;  2OTJ A;  4IUV A;  1VQL A;  5DY9 A;  5GAM e;  3H6Z A;  2RA2 A;  2RHY A;  5I21 A;  2EQM A;  3QWL A;  2ZPF B;  1M9S A;  1RI0 A;  2R58 A;  4M75 D;  1UGR B;  3OB9 A;  4X9D A;  2KMG A;  1N9S A;  5LJ5 d;  3V7R A;  2DKG A;  4M7A D;  3RUX A;  4OGE A;  3JB9 D;  3J81 E;  2DXT A;  4KBM B;  4QSH A;  2MWP A;  5GAO q;  1YHQ T;  1VQ8 T;  3LWI A;  2H3J A;  2BUD A;  1YJW T;  1NJI C;  3ASK A;  4JRK A;  4WF2 A;  3HFO A;  1WJQ A;  3MP6 A;  4JX6 A;  2BKD N;  2P4T A;  4XU2 A;  5LJ3 f;  5FU7 C;  3LGF A;  1G3T A;  2LCC A;  2MWO A;  1G3S A;  4MZP A;  4KUI A;  2LQK A;  1YI2 A;  1OZ3 A;  3G4S A;  1K9M U;  1YJ9 T;  3LYI A;  2WSF E;  1WJR A;  3SD4 A;  2DO3 A;  3M5A A;  3BDU A;  3E1S A;  3VUB A;  3V8K A;  5GAO m;  4C5I A;  1K73 C;  1BI0 A;  4HT9 A;  4C0D B;  4M78 B;  5LJ3 g;  4RKU E;  4A54 A;  4M7D F;  3KXT A;  4XAX B;  3JCM h;  1VQM T;  1BIA A;  5CKB A;  2L89 A;  3C12 A;  4PNO A;  3VJP A;  1KD1 C;  4Y28 E;  4X34 A;  3L2R A;  4BY6 B;  3HP9 A;  2DD5 A;  3VYH B;  4JDS A;  3VKI A;  4EMG A;  4AKG A;  3BG5 A;  2EJ9 A;  2QTX A;  4JLG A;  4LDU A;  3QYG B;  3L42 A;  3OW2 S;  5GAN f;  3LX7 A;  3MEV A;  4M78 D;  3RKX A;  3MEW A;  4A4G A;  5HY6 A;  3VYG B;  3X28 B;  4LDY A;  3V8J A;  1N8R C;  2JNG A;  3OYC A;  1PSE A;  4AKH A;  4YTL A;  2WJ9 A;  2X4Y A;  4J5Y A;  4PJO B;  4C0D C;  4M78 C;  3OYY A;  3RKW A;  2XKO C;  4ZTJ A;  5CKE A;  2LVM A;  1WGS A;  2MAM A;  2D0Q B;  3X24 B;  1U1T A;  4IUT A;  5LJ5 f;  4EMH A;  1QVF A;  2M16 A;  3X25 B;  2RJC A;  3JB9 H;  3G71 A;  1M90 C;  1WPY A;  2VGM A;  3OS0 A;  5GAM d;  1MHN A;  2HQX A;  4M7D G;  1Y7X A;  4PJO D;  4XTY A;  5GMK m;  1XTD A;  2DD5 B;  1H64 1;  2JVV A;  2YLC A;  3OMC A;  3OYA A;  3HZJ A;  3L2W A;  4VUB A;  4M77 B;  3CC2 A;  1JJ2 A;  5LJ5 g;  3OBY A;  1JRI A;  3QYH B;  3E19 A;  2JN0 A;  3OYB A;  3DB4 A;  2X35 A;  5L8R E;  2RJD A;  4TVR A;  4XTW A;  1K8A C;  1VQN A;  3OSV A;  4R55 A;  2PUK B;  2ZPH B;  4IUR A;  5A0L A;  1K9M C;  4M77 D;  2HBP A;  2RHX A;  3QO3 A;  4MDX A;  1KG1 A;  1Q81 C;  3NFC A;  2M1H A;  1ZHI A;  1GXI E;  1WQ7 A;  2P0P A;  3MP1 A;  1SSF A;  2R5A A;  5GAO p;  2JUF A;  5M9O A;  3TW7 A;  1PSF A;  4L5G A;  1YIJ T;  4J7F A;  2E12 A;  4XTV A;  3L2Q A;  5GMK h;  4BE2 A;  2KQW A;  4N0A C;  4ZGJ B;  1WJS A;  4M7D A;  3HHT B;  2DPP B;  4A4K A;  3JCM e;  3OYL A;  2K4Y A;  1M4Z A;  4J6W A;  4NC6 A;  5GAO n;  3OYD A;  3CCQ A;  2DXU A;  2ZZD B;  2DTI A;  3OBW A;  4MIM A;  3VV0 A;  3QXE B;  4Z6Y A;  2EQK A;  3EFS A;  3P8B B;  5DLQ E;  2ZPE B;  2L3R A;  4Y91 A;  3CD6 T;  1NPR A;  2KK4 A;  4XK8 E;  3KBG A;  4MZM A;  1KQS S;  3H8Z A;  3OYI A;  2E41 A;  2CZ1 B;  1X01 A;  2X4X A;  1R8O B;  3SDZ A;  3ZFJ A;  3LH0 A;  3I55 T;  4L59 A;  2RB6 A;  2RM4 A;  5C6S A;  3CCE T;  2ZPG B;  3HB9 A;  3X26 B;  4JRI A;  3BY7 A;  3MCA B;  2E6Z A;  5GAM f;  3A8M B;  3OYM A;  5C0M A;  2DVE A;  3ZBD A;  3CXC S;  2E70 A;  3VKG A;  3GNG A;  2FYK A;  4A4E A;  1YCY A;  4MML A;  1VQ8 A;  1YHQ A;  2BS4 A;  2E64 A;  2I2L A;  4LDW A;  5GAN 2;  1YJW A;  2XD0 A;  4GY5 A;  3FEO A;  3PFS A;  5FU6 C;  1ZQ1 A;  4ZN3 A;  5GAO l;  2QDJ A;  4OB3 B;  3OA6 A;  2CZ0 B;  4QVZ A;  3FDR A;  4UC4 A;  4C5G A;  3A8H B;  4KT0 E;  2EAY A;  3N5B B;  3OW2 A;  5GAM g;  1M1F A;  1BI1 A;  2A7Y A;  4P5N A;  1YIT T;  2GFA A;  2ZPI B;  2EQU A;  2RHU A;  4NOY A;  1Q82 C;  1YJ9 A;  4C92 F;  2QF7 A;  4M6V A;  2CS7 A;  4PLL A;  4BB7 A;  1VUB A;  1JB0 E;  4XU0 A;  4Z02 A;  3ZEH A;  2XI9 A;  4XQ3 A;  3L2U A;  2PUO B;  3OMG A;  4XU3 A;  1VQM A;  5D6X A;  3CEY A;  4FT2 A;  1VQ4 T;  2MMP A;  1D3B B;  3PNW C;  3CCR T;  2DXC A;  3V8L A;  2XU8 A;  2VYT A;  2C06 A;  3HRU A;  1Q86 U;  1X6O A;  2KVQ G;  3HFN A;  5KE2 A;  2YLB A;  2RI3 A;  4M7D E;  3DB3 A;  3DKM A;  4M7D C;  2ZPB B;  2XHC A;  3GLX A;  2RJE A;  3CCL T;  3CCM T;  3TCJ A;  3S3N A;  2O4X B;  3WXM B;  4MMK A;  4PKC C;  3M4Y A;  4NS5 A;  1N27 A;  3QYB A;  4E7J A;  2XIC A;  3VUZ A;  2JTF A;  2RHZ A;  2XK0 A;  2EYQ A;  5KCO A;  3A5Z B;  5A0D A;  4M7A E;  3MEU A;  1W2B A;  3JCM d;  5GMK l;  3OSS C;  1KQ1 A;  1DJ7 B;  1BIB A;  4BAC A;  2L5Q A;  3CCV T;  2WAC A;  1VQ5 T;  2JZ2 A;  4A4H A;  4DOW A;  3OYG A;  2PVG B;  4J7I A;  4C92 G;  4M7A F;  3JB9 F;  4PL6 A;  2E5Q A;  4J6Y A;  4N0A A;  4DOV A;  4MFD A;  2QFZ A;  4HCB A;  5A2Q E;  1KC8 C;  4IUU A;  2RH2 A;  2RO0 A;  2QEX T;  5CKF A;  4X9C A;  3M53 A;  4QQG A;  2EFI A;  3RER A;  4MZT A;  1M1K C;  3ME9 A;  1HK9 A;  2QQS A;  3JSC A;  3JAM E;  4EMK B;  1LNX A;  1Q7Y C;  3QPH A;  2QA4 T;  5GAN g;  2NLU A;  3LW5 E;  2L8D A;  1M5Q 1;  5GAN 4;  2EQJ A;  4FIB A;  1YJN T;  2BS3 A;  2JTM A;  2GCX A;  3OS2 A;  2OTL T;  4OVA A;  1M1G A;  5FRO A;  3GPL A;  3TU4 K;  4HT8 A;  4QW2 A;  1TH7 A;  5LL6 S;  3HRS A;  4RCB A;  2DAQ A;  4E7H A;  2CGH A;  1VQ9 T;  2GF7 A;  3CPW S;  3PGG A;  4ELZ C;  1U1S A;  1H3Z A;  3PMT A;  3CC4 T;  5GMK j;  3LWH A;  2A3L A;  3GP8 A;  1S72 T;  3QKJ A;  5CQY A;  2LDM A;  1N6A A;  1G3Y A;  2G77 A;  4C92 A;  3J7A F;  2JOY A;  3WVE B;  3P8D A;  4HLQ A;  4M7A G;  3JB9 G;  3Q1J A;  3OY9 A;  1YIJ A;  2P0Q A;  3TRE A;  2R5M A;  3CXC A;  5LJ3 j;  5CR2 A;  2HQE A;  5GAM h;  3OS1 A;  4BD3 A;  1Y96 A;  3OYE A;  1VIF A;  1Y71 A;  4FSX A;  3JCM Q;  3RMS A;  3QHS A;  3OYF A;  4ZGE B;  4JS4 A;  4HL4 A;  3CBP A;  2HAX A;  1ZBX A;  3RMQ A;  3JCM f;  4C5E A;  3E9G A;  3TW6 A;  1YBY A;  5FLX E;  3FLG A;  4OB1 B;  3C95 A;  3LLR A;  2X4J A;  2M9U A;  3CD6 A;  3CC7 T;  5FRM A;  5A0G A;  2VGN A;  2EKO A;  3DLL A;  4JS5 A;  2QQB A;  4JLI A;  2RK2 A;  2GFU A;  3I55 A;  4D6W A;  1FXX A;  4DQ2 A;  3M4G A;  3CCE A;  3CCU T;  4B9W A;  5CAI A;  1NJI U;  3AHU A;  4EMK A;  5FU6 B;  4PJO F;  4OMF B;  1N9R A;  4II1 A;  5KCH A;  3JB9 J;  3SWN A;  1LJO A;  2E65 A;  2CZ7 B;  4HNU A;  2LTO A;  1NZ9 A;  5EJC A;  2XDP A;  3EAE A;  3FB9 A;  1QVP A;  5GAN 5;  4ZTF A;  2RI5 A;  2DJZ A;  5LJ3 h;  3A8L B;  5J26 A;  4BI3 A;  2XDB A;  3MP8 A;  4BUG A;  4JRQ A;  2K2V A;  3SFM A;  2VC8 A;  4O6J A;  4FM4 B;  3RES A;  4C0F A;  4M7A A;  3OYH A;  4IUP A;  1YIT A;  1K73 U;  1I4K 1;  5I2M A;  1VQK T;  4HCC A;  2O01 E;  2RHI A;  2QQ9 A;  2VUB A;  2PQW A;  3BDL A;  4EPC A;  3L2V A;  2F69 A;  3CPF A;  4M77 F;  2V8K A;  2K5I A;  3JCM P;  4C0Z A;  5LJ5 j;  4FU6 A;  1KD1 U;  2QXF A;  1I5L A;  3I56 T;  4C8Q E;  3VKH A;  2HNI A;  2YRV A;  4L6V 5;  2K5F A;  3TEE A;  4C8Q C;  1V29 B;  4C92 E;  3PMI A;  3OYN A;  4C92 C;  4F7U E;  1VQ4 A;  4M7D B;  3S3M A;  3CCR A;  3MO8 A;  3NTH A;  1B34 A;  1EIF A;  1O9S A;  2EIF A;  2FHD A;  3FRN A;  1BI2 A;  2DXB A;  2LX9 A;  4IUQ A;  4N4I A;  4C8Q F;  5GAN h;  4BDZ A;  3CMA T;  2QQ8 A;  1N8R U;  1QW1 A;  4F7U F;  3LGL A;  4PJO G;  1VQP T;  3CCL A;  3CCM A;  5AYF A;  3M57 A;  3RKY A;  4RG8 A;  1UEB A;  3JCM X;  2OTJ T;  5D6Y A;  3VU3 C;  3GF5 A;  2V8I A;  3CCS T;  4J6X A;  1NE8 A;  2FL7 A;  3OQ5 A;  3JCM c;  5CKD A;  5GAN 7;  4M7D D;  2F5K A;  2G3R A;  1VQ6 T;  2HD0 A;  5DLO A;  3EFR A;  3NTK A;  4NL2 A;  4XU1 A;  3E9F A;  1UGS B;  2DTH A;  4AKI A;  4Q5W A;  3DLM A;  1BI3 A;  4CRI A;  2X4W A;  3M55 A;  3JB9 I;  4CI0 C;  4ELJ A;  1M90 U;  3G6E T;  5LJ5 h;  3CCV A;  2QQR A;  1VQ5 A;  1UB4 A;  1Y07 A;  2K5L A;  2AHJ B;  3PIO A;  1VQ7 T;  3DL1 A;  3QZ5 B;  2CKK A;  4E7I A;  1VQO T;  4EMK C;  4M77 G;  3CPW A;  3CBO A;  4HA8 A;  5J39 A;  1UGP B;  3SWN C;  1OYX A;  2QEX A;  4ME7 A;  3CME T;  5KH6 A;  4M75 E;  1I81 A;  3T9N A;  4M75 C;  2QDY B;  1B34 B;  3VYG A;  2CZ6 B;  1VIE A;  3CCJ T;  4M7A C;  2DXB B;  2Y4Y A;  4KUD K;  5CIU A;  1KQ2 A;  3A8G B;  3PTA A;  4HNV A;  2R57 A;  3L2Z A;  3M56 A;  2K3Y A;  4C5H A;  5IAY A;  5GMK e;  3FC3 A;  1JBM A;  2QA4 A;  2DEQ A;  2KY9 A;  3M54 A;  4FT4 A;  4M75 F;  4C8Q G;  1K8A U;  4PJO A;  2KR6 A;  2LQ8 A;  2XDD A;  1YJN A;  2E10 A;  2OTL A;  5FRN A;  4DA4 A;  2LT1 A;  4F7U G;  2F5T X;  3J80 E;  3HO8 A;  4R56 A;  3HRT A;  1Q81 U;  5HK3 A;  3UDC A;  4OGC A;  4ZGD B;  2OAU A;  5CK9 A;  1OZ2 A;  1BKB A;  4XTZ A;  4FL6 A;  5LJ3 e;  5D6W A;  1VQ9 A;  4QQ6 A;  2DXC B;  1FWZ A;  4EDU A;  2KSS A;  2B8A A;  3CC4 A;  3HL8 A;  2MI6 A;  5GAM j;  5CO7 A;  5GAO r;  2KAF A;  1IRE B;  4ZN1 A;  1U8R A;  1S72 A;  3QJ6 A;  5GAN 3;  4BBS M;  2DZ9 A;  3CBM A;  3ER0 A;  3GIB A;  4OB2 B;  3H4C A;  5I2S A;  1YI2 T;  4JX4 A;  2LNV A;  3G4S T;  4M77 A;  2RJF A;  1VQK A;  2KDS A;  3QZ9 B;  3C4S A;  5CVI A;  4RMO A;  2DD4 A;  4BDY A;  2D6F A;  4BBR M;  3G7Z A;  4C0G A;  1WNL A;  2LRQ A;  2MF2 A;  4NL3 A;  3JRZ A;  4ATO A;  2DTO A;  1KQS A;  1X75 C;  1NPP A;  3QBY A;  2EWN A;  4N4H A;  4QVC A;  5HKC A;  4GLK A;  2M0O A;  3QJY A;  3PIP A;  4M78 E;  1MGQ A;  3UT1 A;  1BYM A;  2KMT A;  2E6N A;  4C8Q A;  4LD6 A;  5GAN e;  3CC7 A;  1M8V A;  4M75 G;  3PT9 A;  4F7U A;  4RCC A;  4HCZ A;  3GOX A;  2FB7 A;  1XOV A;  2EJF A;  4M78 F;  4RG2 A;  4MDW A;  4JRP A;  1VQL T;  3INZ A;  2RK1 A;  3QUI A;  4BY6 C;  5IT9 E;  4BI8 B;  3CCU A;  4BE1 A;  1Q86 C;  1QP2 A;  4PLI A;  1QP3 A;  3QII A;  4ELY C;  1IZ6 A;  3JCM V;  3M58 A;  3QYE A;  4HNT A;  3V7S A;  1QVG A;  1I8F A;  3M59 A;  3MHX A;  4BE0 A;  5DM7 R;  1G5V A;  3A8O B;  3X20 B;  3SB2 A;  5LJ5 e;  2DIQ A;  3QG1 A;  2ZZD A;  5GAN 6;  3S3O A;  3V7C A;  5HK0 A;  1Q82 U;  4PJO E;  1W2B S;  2DD4 B;  4PJO C;  3KHI A;  1LOJ A;  1FKM A;  2WSE E;  2CYZ B;  4QVD A;  2QI2 A;  3G71 T;  5GMK i;  4JJN K;  2DZC A;  2GQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...