3HHTB

A mutant of the nitrile hydratase from geobacillus pallidus having enhanced thermostability
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
b'MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLALGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFSKKPDTKIPRREDPALVKLVEKALNDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title The high-resolution structure of a Cobalt containing nitrile hydratase
rcsb
source organism Geobacillus pallidus
molecule tags Lyase
total genus 65
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hhtB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hhtB02
3X20B 3A8OB 2CZ0B 2DXBB 4Y28E 2ZPEB 2WSCE 3VYGA 1JB0E 3HHTB 2CYZB 3VYHB 3X24B 2PVGB 1V29B 2DD4A 3VYGB 4OB3B 2ZZDB 2D0QB 4ZGJB 2PUKB 1GXIE 2CZ1B 1UGSB 1IREB 3A8LB 3QZ9B 4OB1B 4FM4B 3X28B 3A8MB 4XK8E 1DJ7B 4L6V5 3LW5E 3WVEB 2PVOB 1UGPB 2DD5A 1PSFA 2DXCA 2PU9B 3A8GB 4KT0E 1QP3A 2PUOB 2DD4B 4OB0B 2DD5B 2DXCB 4ZGDB 3QYGB 3X26B 2CZ6B 2AHJB 3A8HB 2ZPBB 4ZGEB 3QYHB 2PVDB 1PSEA 1QP2A 2O01E 2ZCFB 4RKUE 2ZZDA 3X25B 2QDYB 3QZ5B 2ZPHB 4OB2B 1UGQB 1AHJB 3QXEB 2ZPGB 3WVDB 2DXBA 1UGRB 2ZPIB 2WSFE 2WSEE 2ZPFB 5L8RE 2DPPB 2CZ7B
chains in the Genus database with same CATH superfamily
4F7UA 2R7GA 2ESWA 3NTKA 1TS9A 2KK4A 1B3QA 3C95A 4M6VA 3URGA 3UA6A 2G3RA 4LE9A 5KYUA 1JEGA 2R5MA 1TXQA 4FSXA 4BI4A 4PJOA 4M7DD 1K9MC 2K79A 2HDAA 1CSKA 4M7DE 4J83A 4ZGJB 4J6YA 1KC8R 4M7AG 5DQVA 4BCKB 3WXMB 1GXIE 1RAGB 4C92G 1VIEA 1JU5C 2IW9B 4CFUD 4M77F 1VQ6T 2DL5A 4X1VA 5HNBB 1G83A 1PCXA 1BU2A 3VRYA 3R6OA 1QCFA 4LUEA 1Q95G 2KT1A 4NS5A 2X1NB 4M7AD 2SEMA 2ED1A 4JJDA 1VQ8T 3GTMS 1JQQA 1TU0B 2QTXA 4AG2C 4F16A 3HSBA 4M7AE 4V2SA 3CCST 2EJFA 2HZYA 2M02A 3CXCS 1Y96B 2C6TB 5HBJB 3E19A 1PKTA 3EAEA 1TOVA 3EFRA 2PUOB 2ED0A 1PD0A 5LJ3e 4JRPA 3EG9B 5LJ3j 3CC7Q 3VRZA 1BYMA 5KYYB 3H0HA 4JRQA 5LJ5g 1H4LD 1CKBA 2COYA 2QQ9A 2PMIB 1GFDA 1UEBA 1D1BA 1KC8U 1BB9A 3OYGA 3TSZA 1WHMA 1M3AA 2RK1A 2COZA 3A8HB 3OW2S 3JB9H 1SF9A 1F1BB 4M7DA 3ASKA 1TTHB 3UT1A 1Q82C 1G3YA 2XICA 3P8HA 4WF2A 3I56T 5HVYB 2NUPA 2DTIA 5FRNA 5I2SA 5GAMh 1I4K1 4BCIB 1H26B 1ZP2A 3DJBA 2NUTB 4QQDA 2RJCA 1ZBJA 5KYWA 1VINA 1UGQB 1MV0B 3E9FA 1KQSS 2ZPGB 3MP6A 2QEXT 2E1HA 3Q1JA 4OVAA 5GMKi 4M7AA 2AIRB 4HCKA 1H1PB 5HBHB 1JXMA 1M1KC 5IXBA 2MMPA 1VQKA 4AI6A 3VYGA 2J7IA 2XHCA 4RTZA 5ECAA 3A98A 3TN8B 3NPFA 3BLHB 3RIRA 2LCSA 3I55T 3C0CA 4PJOF 3JCMV 3L2UA 1U3OA 1J3TA 5GANf 1B34A 4DA4A 2HEQA 4ZTFA 4KRTA 2QQSA 2CH4W 2AKLA 1UDLA 1X27A 3HRTA 2XG8D 5LL6S 3UWNA 1XTDA 1PRLC 1D3UB 3CMEQ 3WVEB 4EOOB 2LNHB 1P5EB 1Y7XA 3H6ZA 5A0LA 4BBSM 2Y90A 4EDUA 3EOCB 2LQWA 3JCMh 4EOIB 8AT1B 3QYBA 4CFXB 5EFQB 2EGCA 2RHUA 2HQEA 3REAB 2VGMA 5DY9A 4CC3A 2KR3A 2HCKA 1ZLMA 1H641 3CBPA 4ROCA 1QWFA 4M75D 2CP7A 4KH1B 3OYDA 2DLPA 3CC7T 1X69A 4LDYA 2L3RA 4M75E 3I56A 3CCUA 1VYTA 4A4FA 3NHNA 1M27C 1HYOA 2DERA 1M2OA 1TFBA 2YWWA 3CPFA 4EMHA 1N9SA 2X4XA 2BKZB 2BKDN 3BW1A 1D0XA 4AKGA 1FYNA 2F1LA 1QVGS 2HKNA 3TNHB 2DL3A 1NEBA 2W99A 2HBWA 2K5FA 3VS5A 1Q7YC 1C0MA 1YNZA 4PNOA 1AISB 4MZMA 1M1GA 2AZVA 2ZPFB 2YHTA 1N8RR 2DPPB 2LT4A 5J39A 4AFQC 2A37A 1EZZB 4M7AF 3S3MA 4PKCC 3OYEA 1B7TA 1WA7A 1GUXA 4HNVA 2LDMA 4C92F 5FW9A 5GANg 3I55A 3CXCP 1NLOC 1EX4A 3FLGA 4ORZA 1M5Q1 3HB9A 3M0TA 3EG1A 2OAWA 3CPWA 5A0DA 2YLCA 1UHCA 4M75A 1VQ5A 4OGRB 2DRKA 5DQWA 1E7OA 4LOCA 3CCMA 2K2MA 2J6KA 3M0SA 2ATCB 2VXFA 4KRCB 4RODA 3MY5B 1MNEA 1N8RU 1PHTA 3BY7A 1H28B 1LJOA 2V8JA 4IUVA 4JZ3A 1UGPB 4EC8B 4ROEA 2J06A 4HNTA 1IB8A 1TUDA 1YFNA 4HA8A 5GAMd 2CCHB 4EONB 2OTJQ 3ZL7C 4KT0E 2MYSA 1FX7A 1HXDA 1AWXA 1OX9A 2XMFA 3CMET 4PLIA 1BI3A 1KK7A 1KQSP 2W96A 1G3WA 2AK5A 2LX9A 3EH2A 4ZGDB 3M59A 5DLOA 2W9FA 2BS4A 5GAN5 2WHBB 4HCZA 3QYGB 4L5GA 1UUEA 3TREA 2LW4A 3SDZA 1UB4A 4PL6A 5CKBA 2LC4A 4NL3A 2FRWA 2RMOA 4LDXA 3GBQA 1X75C 4X9DA 3J80E 3AHUA 3QSUA 1YJWA 2JMAA 1RAHB 4JJNK 4RTVA 4F14A 2HL5C 4DBRA 1WHKA 2CP3A 3HRUA 1OKVB 3QZ5B 3GP8A 2L8DA 2CP5A 1MMGA 3HBLA 4FSSA 1WXTA 2QG9B 4Y91A 3O0GD 2RHZA 3PIOA 2EYWA 3C12A 2BS3A 1ZX6A 2M16A 2DXBB 2RI5A 2PK9B 2OTLQ 4D6WA 2VUBA 2UZLB 2CYZB 3PMTA 4F7UB 5KE2A 3JCMd 4C5HA 1TD6A 3VU3C 2DILA 4FL6A 2M1HA 2E64A 1RUWA 5EJCA 1BCMA 4OB3B 4PJMA 5KYUB 2P0PA 3MEWA 4PJOB 1X6GA 3NTIA 3BG9A 3THKA 2CP6A 3D7SB 4EMKA 5M9OA 2DL4A 4X9CA 3CCVQ 4BUGA 2D8JA 3H9NA 2AT1B 3QZ9B 5J26A 2GTOA 2VC8A 2K5IA 4C0GA 5D6YA 1K0SA 2DD5A 3OY9A 2V1QA 1NE8A 2J6OA 3OYJA 1FWZA 1WHHA 3FRNA 3OS5A 1K76A 4BY6B 3LYIA 1JJ2A 1WQ7A 2JGZB 2X4JA 4BDYA 2B8AA 5FLXE 3OYHA 3VS7A 1OL1B 1K1ZA 2UZEB 2DKGA 2DETA 2OI3A 5I21A 4EPCA 2OTJT 4EOKB 1SEMA 1LCKA 3PGGA 4JLGA 5GAN4 2DIQA 3OYAA 4CFMB 2PQWA 4II1A 1GL5A 1YWPA 1KG1A 2ROLA 4HLQA 2EKHA 4LDVA 4PLLA 2W10A 1YHQA 1O9KA 3FDRA 1D3BA 4BXXX 1QCOA 2LX7A 2MK5A 3O8VA 2PZ1A 2LQNA 2C0TA 4M77D 3VS1A 4M7DB 2EYZA 4DBQA 5KYNA 3E1SA 2QQAA 2RPNA 2KMGA 4M77E 2NUPB 3QDRB 2DVJA 1WDXA 1OZ3A 1TSFA 1UGRB 2EW3A 2P84A 4CFUB 5L8RE 4EORB 1WHLA 1W2BA 1BI2A 2JT4A 4J5YA 1VQ4Q 3QG1A 2IIMA 2O31A 2VKNA 1ZA1B 4D8KA 1D09B 1IXDA 4M78B 3RR6A 2DYBA 4JLIA 3VYGB 1I81A 5HBEB 5GAMf 4FT4A 4FYYB 5LJ3d 2CUBA 2QA4Q 2OTLT 1QLBA 3ER0A 2FPDA 3M57A 1FMVA 1MV3A 3CCRA 1NBEB 1WQWA 4CC4B 1H1SB 3M9QA 1WX6A 2MI6A 1TUGB 4RTWA 5KE3A 1Y57A 1G8XA 3OQ5A 1QLYA 4BCFB 5CQYA 4F04B 3CC2Q 4DOWA 1AWOA 2C5VB 1GRIA 3TCJA 2E6ZA 4FU6A 4R55A 4F7JB 1W4SA 4RCBA 3CCVT 4XTWA 2K4YA 3RNJA 4Z88A 4NC6A 1R8OB 1NYFA 4BY6C 5ACBA 4F6UB 2OTJA 2YUQA 1MGQA 4BCND 4BCMB 5I2MA 1WNLA 1RL2A 1I07A 4MFDA 1D1AA 3JAME 1X6BA 1WHGA 4AG1C 3CXCA 1WGSA 5IDNB 4BCOB 4F6SB 3JCMe 2R5AA 1SHGA 3OYBA 4E7IA 2XDBA 1OOTA 2C5NB 3VS4A 1YITA 2VXEA 2WIHB 2JN0A 4OMPA 2KSSA 4MFEA 5FU6B 1KSWA 3QUIA 2BUDA 2ZPHB 1G3NC 4AFUC 4PJJA 4MZPA 4HCCA 3OW2A 2HQHA 1FINB 4FT2A 5GAN7 5L2WB 1KQ2A 4PFZA 1YBYA 5D6WA 5C0MA 3L2RA 2JJ9A 3A8OB 3QWYA 5LJ5e 1ENWA 5LJ5j 1O9SA 1UHFA 1YCYA 4Q5WA 3OYLA 5GJWB 1C6VX 2RJFA 1VYWB 1NPRA 1BBZA 5DLQE 2YT6A 3OB9A 4M78C 4EOLB 2LCCA 4IURA 4EOPB 1GUXB 3JSCA 2C4GB 5J3BA 3G71A 3SWNC 1VQ4T 1MUZA 2DO3A 3M0RA 3A5ZB 5ICPB 1KJWA 1MHNA 3UF4A 4N4GA 1F5QB 1ARKA 3V7SA 3VS2A 4RG2A 5CAIA 3LGLA 3FC3A 1YJNA 3LH5A 3KBGA 4HVUA 3HFNA 3VV0A 3PO3S 3VS6A 4XK8E 4CC2A 1ZQ1A 4BCQB 3CCVA 2QA4T 1OV3A 2PHGA 4BCGB 4M75B 1OIYB 4JJBA 4B6MA 2I2LA 2IW8B 4J9GA 4XTXA 4EOJB 3ZFJA 2CKKA 5CKHA 4C8QC 3CC2T 3E2UA 3HO8A 1E9HB 1TH7A 3MIAB 2F5KA 3MHXA 3EG0A 2DNUA 2C5OB 3RERA 4JX6A 2HAXA 2UUEB 4OMNA 2VGNA 4AT1B 3OYKA 4WCIA 3EGDB 4M4ZA 3GF5A 3BDUA 2JXBA 1GY3B 2CUDA 2JM9A 2RQRA 4C92D 1M90R 4E7KA 1GCQC 3EGXB 4C92E 3GPLA 1OPKA 5IT9E 1WJQA 3M53A 5CQXA 1JKWA 3EFOA 2DFUA 2FB7A 4C5GA 2YRCA 2Y4XA 3HRSA 2D1XA 2FRYA 2QK0A 3MKDA 4HXJA 3OMCA 4JJCA 2L5QA 1VQMT 2LZ6B 5GMKm 4OB2B 3OYMA 1H3HA 1AVZC 5LJ3f 4ZN1A 4BI8B 2YRVA 2ZPIB 2J6FA 2FVUA 1JO8A 3M0QA 5EG2A 4KUIA 4A4GA 5GAOp 4Y28E 3RGFB 3FB9A 1M90U 4HKEA 3CD6A 2GBQA 2CSIA 3OSVA 3KFVA 5IHYA 1ZA2B 2EWNA 1S72T 4QKUA 2DYIA 1QVGA 4B9XA 1OIUB 1HD3A 5IAYA 1VQ4A 2R58A 1HJDA 1ZSGA 1KC8C 3RKYA 2PJQA 3EHQA 4LXCA 4FYXB 1ZSZA 2DMEA 1X2KA 2PNIA 2EKOA 5BNJB 5I5ZB 3CMAQ 1ABQA 2G77A 1UNLD 5CKEA 4C92A 4NSTB 3UPUA 1UTIA 4FM4B 2K57A 3X28B 1OULA 1PKSA 2YRDA 2O4XB 4N0AC 5CIUA 4EMKB 2HKQB 2HQXA 3N5BB 1VQPQ 3LLRA 1WIEA 1FMWA 2YUOA 3CC2A 1WJSA 2EYQA 3META 5I22A 4ZNXA 3UATA 1VQ6A 3JCMP 6AT1B 4XU3A 2DD4B 2CS7A 2DD5B 4GBQA 4IUUA 2FEIA 3PIPA 5LQFB 2FPEA 2YUPA 4DEYA 1VQ8A 2I53A 3CCSA 2YXYA 2BZ8A 1BIAA 4HT8A 2KVQG 3DDQB 3CCLQ 4FW1A 2KT8A 1BI1A 1H25B 2KDSA 5LJ3g 3ZEHA 3QDFA 4JS5A 1VQMA 3HL8A 3NTHA 4LDWA 4E6RA 3RKWA 1I5OB 2IVWA 1IGQA 3TQ7P 3S3OA 4KRDB 3RUXA 3UDCA 1O9KB 2L3QA 3RBBB 2PTKA 3OYCA 2M51A 3QIIA 3M58A 4BCPB 4OMLA 2ENMA 4RTYA 3S3NA 4ELZC 3JCMQ 2WSEE 4BY1X 3VKIA 1D0YA 4OMQA 1FVVB 1NEGA 3KXTA 1Q81R 1S72A 2BTTA 4II5B 3ME9A 2ZGWA 4ELJA 1XO2A 5LJ5h 2E5QA 4C0DB 1TG0A 1VUBA 4QVZA 4R0KA 3V7RA 4QQGA 3MEUA 1SRLA 3F5XB 2QEXA 4HVVA 1XJWB 3KUFA 2RK2A 1NM7A 2ZZDB 3MPUB 5I11A 2CH4A 2MOXA 2EJGA 3JRZA 2VVKA 3OYFA 3EHRA 4BCHB 4UN0A 1VQNQ 4AKIA 1OU9A 2FZGB 2QI2A 1VQLQ 1WXUA 4J6WA 2KGTA 3CCJQ 1QKWA 1RADB 3G6EQ 1Q81U 1HK9A 4IUTA 2C0IA 2FO0A 3VUZA 1K0XA 1QWEA 2E10A 4C5IA 1BCOA 2L0AA 3MJXA 4F7LB 1QP3A 2KXDA 5CKDA 4P5NA 2MCNA 5GAOl 1VQPT 1YJ9Q 2DF6A 4M77B 5KCOA 2B9RA 1M3CA 2DXUA 1JBMA 2YLBA 1QVFP 3X26B 1XQHA 4YOOA 1YI2Q 1T0JA 2LJ3A 1K9AA 2O9SA 2P4TA 1H1QB 1R0CB 2ECZA 1AD6A 4BACA 4IMYB 4EOMB 2LNVA 3C4SA 3GNGA 4XQ3A 4HL4A 4E7HA 5KYXB 2O9VA 4ZTJA 3CC7A 4J9FA 2WXVB 2R57A 4EIKA 3CCLT 3G33B 3S6WA 2RHXA 3HKSA 2JZ2A 3PMIA 5CO7A 1N8RC 2CSQA 2RO0A 2WSFE 2QYZA 4ME7A 1VQOQ 3OBWA 2MPXC 4AKHA 4J8OA 2A36A 2HBPA 1FMKA 2BE9B 1Q86R 3VKHA 4QVDA 1GCPA 4KUDK 4LDUA 1NLPC 2XD0A 4BE0A 3PT9A 1V76A 1LPLA 4ELLA 3B57A 1G3TA 4BY7X 2XIDA 2CT4A 4X34A 4HT9A 2FZCB 3POMA 4QVCA 1SKUB 4XTUA 4GY5A 4BCNB 3O5ZA 4ANJA 1IHWA 2GQVA 1QQJA 2KQWA 2L89A 1VQNT 4B9WA 1VQLT 3CCJT 2KI7A 3ULRB 1MMAA 1RLQC 1RLPC 2GQIA 3TNIB 2FHDA 3HZJA 1GBQA 3PVQA 5D6XA 1Q86U 3G6ET 2DXTA 2E6NA 4BCJB 2X51A 4M77C 2JTEA 4FCYA 5GANh 3CCEQ 2VWFA 5GJVB 1VQ7Q 2LMJA 4QT7A 2CZ6B 2G9XB 4XTYA 1RAIB 1U1TA 2DA9A 3GNFB 5LJ5d 3SEMA 3SB2A 1JXOA 1YN8A 4LN2A 1YJ9T 2PVDB 3M0UA 3CMEA 3GOXA 3H8ZA 1LOJA 2I0NA 4IUPA 3C94A 2EUFA 1ZHIA 2WMAB 2RQTA 4DBHA 3JB9G 1UJYA 3EFOB 1YI2T 2C5XB 1M3BA 1IRXA 1YWOA 1M2VA 1IGUA 2LJ1A 1LVKA 1OU8A 2L3PA 2RJEA 3JB9D 2DL7A 1QKXA 2WACA 2B86A 1PWTA 2MF2A 1RABB 1HSQA 1I1JA 1QMCA 3OYNA 4JS4A 2K3XA 3HHTB 2Z0WA 3PNWC 1K73R 3X24B 2D0NA 2E5KA 1H27B 2E41A 3NFCA 4MMKA 2QAZA 2W9ZA 3CBOA 4JDSA 1M9SA 1VQOT 1GH6B 1RI9A 2ZAEA 1IHVA 2MIOA 1ZBXA 3ZBDA 4CFWB 2X4WA 2RD1A 4O5VA 4DQ2A 1Y07A 5KYWB 4C0ZA 2UZDB 1UFFA 1PNJA 1FXXA 1ZSZB 1K4US 4IIMA 2EGAA 2YDLA 2WMBB 3R6NA 2M0YA 2QTVA 4M7AB 4DBFA 1VOMA 5CK9A 4F6WB 3FJPA 5KH6A 4BDZA 1VOLA 1OZ2A 4C92B 1VQLA 1AZGB 2QQRA 3CCJA 3CBMA 2MAMA 3BLRB 1C1AA 1PSFA 2F2WA 1AD5A 1G5VA 2DZCA 3A8GB 2P0QA 3RMSA 2ABLA 4OR5B 2QASA 4CRIA 1T0HA 3G6EA 4PJOC 1W1FA 3TU4K 1NZ9A 1K73U 4PFOA 1I0CA 1OX8A 5FROA 3MEVA 1W98B 1N9RA 1PC0A 2E65A 3CCQQ 1SPKA 2DIGA 1B34B 1BU1A 4HVWA 4CRLB 1E6HA 1TUCA 4JX5A 2RF0A 3MCAB 1KIKA 2DRMA 3V8KA 1YJ9A 4E7SA 2RM4A 1D0ZA 1VQKQ 2LVMA 4OF1A 5CCAA 1PSEA 4N4HA 2P4RA 1K8AR 2XK0A 3CCET 2WIPB 3IQLA 7AT1B 1VQ7T 3VJPA 1GBRA 1NJIR 4LD6A 4QSHA 2KAFA 3H0FA 3M56A 2EIFA 2W0ZA 2QDYB 1RAAB 2XI9A 1M1FA 1PRMC 2E70A 1KD1R 1KHCA 2D8HA 2DTOA 2F69A 4E7LA 1JOWA 2EVRA 2DEQA 1OKWB 2EQJA 4XU1A 4RG8A 3BLQB 4A53A 4F7UG 1PM3A 5AYFA 3X20B 3OSSC 3TSWA 4EC9B 4PFPA 2RNAA 1SSFA 2DL8A 2GCXA 2L2PA 2KE9A 2V22B 2ROTA 4PJOG 3JCMf 4AFZC 5HQ0B 2O2OA 4MDWA 2QXFA 1QMZB 5GAN3 3MP8A 5GMKe 1VQOA 2CP0A 5GMKj 4JPBW 3DOGB 2C06A 4M7DC 4IIOA 1I5LA 2DTHA 3E9GA 1K8AU 1VA7A 2CJMB 5FGKB 1NJIU 2V1RA 2CCIB 2D0QB 2H3EB 1K9MR 4C5EA 5GANd 3NDQA 4JZ4A 3MY1B 3FEOA 4FW2A 2DK3A 1KD1U 5GAMg 4CC7A 4M7AC 3QBYA 1SRMA 4L6V5 1KHIA 4OP0A 4F17A 5GAOq 3CCUQ 3LGFA 1N5ZA 1KQSA 4JUVA 2OTLA 1NG2A 5LJ5f 2DMOA 1X2QA 3HP9A 4C0FA 3DKMA 2QDJA 1R77A 2A7YA 3H4CA 3INZA 4GLKA 1OQKA 2DBKA 3JCMX 4VUBA 2COWA 5HK0A 4FIBA 2M9UA 5L23A 1OI9B 1ZUYA 4OMFB 1K9MU 5FWBA 3I35A 3JB9F 4J9IA 1M8MA 2KYBA 2QGGA 4A4HA 3G4SQ 3CCEA 1OYXA 2DEUA 1VQ7A 1H8KA 4JRKA 4M7DG 3CCQT 2G6FX 2EFIA 1QP2A 3JB9J 2KNBB 1U8RA 5HK3A 4Z6YA 5CVIA 2XKOC 4EOQB 2KRSA 1WJRA 4IUQA 5KCHA 1Q82R 5IDPB 1VQKT 2QQ8A 1T3SA 1H24B 2JUFA 1AHJB 2MWOA 4KULA 3RDVA 1ZUUA 2RH2A 5HCKA 4OGEA 1M8VA 1UE9A 3JCMc 3L2QA 3JCMg 1VQ5Q 2JOYA 4E2FB 3CCMQ 3J7AF 4M78G 1YCSB 4A63B 3KHIA 4NL2A 3VUBA 2IVXA 4J9CA 4KGXB 2ZPEB 1U06A 1H92A 1M1KR 3DB4A 2D6FA 4LD9K 1B07A 2PVGB 5FU6C 3REBB 3M03A 4M78D 2F5TX 3V8JA 4FYVB 2RHYA 2K7AA 4M78E 3MEAA 1BK2A 2PUKB 2CZ1B 1Q82U 2QFZA 2QF7A 5AT1B 3TEEA 2WEVB 1UGSB 5EC7A 3VS3A 3OS0A 1IREB 1QVFS 4NOYA 2WPAB 1R0BG 4A4EA 3PFSA 1BIBA 2E3HA 1EIFA 2O88A 4XAXB 4C8QG 2AZSA 4BE1A 2CP2A 4J9HA 2PVOB 4A54A 1A0NB 3DL1A 2GFUA 2EQKA 2CDTA 1M1KU 1YJWQ 2P0KA 2DZ9A 2RI3A 4C8QD 2DJZA 1TWBA 3M4GA 2GFAA 3CCUT 4N4IA 2A3LA 4C8QE 2QA4A 2JTFA 2EQUA 3BG3A 3BE3A 2NUZA 1MMDA 4DOVA 2RB6A 1M90C 1H3ZA 4BCMD 2EPDA 4XTVA 4HCBA 3G7ZA 1YIJQ 2YSQA 3CCQA 2FL7A 4M75C 1JJ2P 1UGVA 4D8DA 4ELYC 1AWWA 3BG5A 3EG3A 1WXBA 2V8IA 3PE0A 4M78A 2EAYA 3I5RA 3L42A 2KR6A 3HPWA 3LWIA 2OX7A 1UNHD 4F7UF 3EGUA 4RCCA 5GANe 3SWNA 5GANj 1I8FA 4HNUA 2KYMA 3G4ST 1BKBA 5HKCA 4J6XA 3LQ5B 4ZN3A 2RA2A 1PKDB 1MMNA 1UNGD 1SSHA 5FRMA 5IN1A 1Q7YR 2CZ7B 1M2VB 2RQVA 2JS0A 4CFNB 2K5LA 3OMGA 5IHNA 2WSCE 1MNDA 1N27A 2X35A 2RJDA 2BZXA 1AT1B 2WFYB 4BBRM 1NYGA 4FYWB 3RESA 3AT1B 3I9QA 1VQ5T 1V29B 2LRQA 4KH0B 4C8QA 2E3IA 4OMOA 2I40B 1D3BB 3CCMT 5GMKh 4QW2A 3GIBA 1W2BP 2IW6B 2EQIA 3VS0A 4TVRA 2JM8A 4M75G 3L2VA 3T9NA 3A8LB 2HMAA 1RAEB 2QGSA 3V7CA 1GCQA 1H1RB 2W2HA 4BCQD 1GFCA 1EFNA 1Q7YU 1KQ1A 1YHQQ 2EQMA 4MMLA 2DXCA 1T3LA 3I5SA 4PJNA 2PU9B 4EMGA 2YUNA 3L2ZA 4Z02A 1ZUKA 2IG0A 1LNXA 2X3XD 1N4MA 2MWPA 2NYSA 4M7DF 3BHVB 4L59A 1ACMB 5GAOn 5LMKB 5D7UA 4EMKC 1V1CA 1YJWT 4PJLA 3CMAT 2JTMA 1IO6A 2RQUA 4JRIA 5HY6A 4F70B 2IPOB 3OA6A 4MIMA 2FZKB 2JS2A 1OL2B 4MDXA 1JRIA 2QGFB 2ZCFB 2L3SA 3G4SA 3EJ1B 3HTRA 1YIJT 4G6LB 3TW6A 4M78F 4OMMA 2LJ0A 1Z9QA 4RTTA 3CCRQ 1AZEA 4XTZA 4F7SB 1M30A 1Q81C 1Z9ZA 4N0AA 1U5SA 2WJ9A 3MI9B 4O6JA 2RI2A 2VB6A 2DM1A 4XU2A 2QQBA 4J7FA 5GAN2 4IKFA 1Y71A 3PVLA 3OW2P 3VYHB 1XOVA 3TNWB 2K6DA 2X9HA 3TW7A 9ATCB 1WZOA 1OGUB 4C8QF 4EOSB 5IXFA 2HD0A 3BFMA 3EGDA 1ABOA 3UA7A 3P8BB 1JSUB 2XDDA 2BE7D 5LJ3h 2HSEB 5FU7B 2BPMB 2F2XA 3SFMA 2K3BA 2K9GA 3A8MB 3EGXA 4R56A 1W6XA 1Y96A 3SD4A 4ESRA 1U1SA 4C0DC 2RQWA 3BHTB 4Y72B 5IHIA 4E7ZA 2KROA 4Y92A 3EG9A 2JVVA 1YITQ 2A28A 3DB3A 5KYYA 2KBTA 4ATOA 1AOJA 1QW1A 4KGVB 4GLMA 4J9BA 2C0OA 3QO3A 3M4YA 2F2VA 2KMTA 3F70A 3CMAA 1YHQT 3NMZC 1FKMA 4RTUA 2V8KA 2RN8A 3QKJA 3V8LA 3TVTA 1AWJA 3JCMW 5GAOr 1C9BA 3NGPA 2K2VA 4BD3A 2ZPBB 1WYXA 4ZGEB 1IZ6A 2DX1A 2RHIA 3QHRB 4AMCA 1Y0MA 4A4KA 1YIJA 1VQPA 5CEIB 1VQ9Q 4DEXA 2NUTA 2O01E 3K7AM 2JMCA 4BI3A 1D1CA 4CI0C 1NPPA 2SRCA 1QCNA 2AKKA 3G71Q 1BI0A 3OYYA 3QWXX 3QJ6A 2UZBB 1YP5A 3CC4Q 2EBPA 3QYEA 3EIDB 1JSTB 1YJNQ 4YOSA 2O4XA 3M55A 4TTHA 1X01A 2Y4YA 3BDLA 3BHUB 3LWHA 2GGRA 3EG2A 3CEYA 1OI1A 3M54A 2XU8A 3CPWS 2GF7A 3CCRT 3FJ5A 3CCLA 1Q86C 4M75F 4CFVB 1RACB 2GTJA 5GAN6 2DD4A 3OS1A 2A0FB 2CREA 1WI7A 2FYKA 1M4ZA 1QVPA 4AFSC 3RMQA 1KXUA 2DVEA 3QHSA 1QVGP 1OPLA 4Z89A 3QJYA 2K3YA 2KRMA 5FU7C 1X43A 2FPFA 5A2QE 1RAFB 1OEBA 1DJ7B 2FG0A 4YTLA 3LW5E 2DE0X 3OS2A 2LTOA 2XDPA 1SG5A 4M77G 8ATCB 3PTAA 5GAOm 1E7PA 5IF1B 3EH1A 4JX4A 4OB0B 2KRNA 2HSPA 5CYIB 4RUGA 3LH0A 3J81E 1N6AA 1SHFA 5DM7R 4K11A 2EYYA 1WLPB 1YITT 2OJ2A 1VYVA 4UC4A 3U23A 2LP5A 1VQNA 4E47A 4BE2A 4KGZB 2KY9A 4XU0A 5IH2A 3M5AA 3SHWA 2HL3A 1E6GA 3H0IA 1WHJA 2LT1A 3CD6Q 1W70A 3QYHB 2D9TA 1VYUA 1PG5B 3CQTA 1VIFA 5GAMe 5GAMj 3LX7A 5A0GA 3P8DA 2HNIA 2ZZDA 2VASA 5IHKA 2J05A 3QHWB 1AEYA 2DAQA 3QXEB 3SWNB 1VQ9T 5GMKl 2BZYA 3WVDB 1XNIA 1UG1A 4BB7A 2X4YA 3DLMA 3RKXA 2VYTA 3G71T 2CT3A 1KFZA 4I3ZB 2CZ0B 2DBMA 3CC4T 4WTOB 1YI2A 1K73C 4YOZA 1JB0E 4KBMB 3M0PA 2OAUA 1YJNT 2JNGA 2QDLA 1VQ6Q 2X3WD 2E4HA 2CGHA 1CKAA 2EGEA 3DDPB 1PD1A 4M77A 1VQ8Q 4C8QB 1UECA 4F7NB 3GLXA 3CCSQ 4YC3B 3H41A 4LUDA 1X6OA 2GNCA 2LQKA 4PK4A 3G1JA 1JJ2S 4OB1B 1URCB 2BS2A 2VV5A 3JB9I 3OYIA 1WFWA 2PK2A 4J9EA 5GAN8 4Z8AA 1WPYA 3L2WA 3HFOA 4J7IA 4J9DA 1RI0A 3JCMb 4RMOA 1P92A 3MP1A 4F7UE 1VQMQ 5CKFA 5KYXA 3JCMJ 1QVFA 3JV3A 5FWCA 4RTXA 2EYXA 4PJOD 3QPHA 3EFSA 2DXCB 2KXCA 4PJOE 3DTOA 1ZSZC 2EJ9A 3VKGA 3MO8A 2BIVA 3I56Q 3L1AA 4C92C 3FIFA 2E12A 1S72Q 2AHJB 4LNPA 4CXAB 2V26A 4QQ6A 3CPWP 1K8AC 4MZTA 2DJQA 2LQ8A 1NJIC 2NLUA 3DLLA 2F2CA 2QEXQ 3A1PA 4RKUE 1W2BS 3OBYA 5C6SA 5CR2A 1O75A 2H8HA 1G2BA 3X25B 2H3JA 1KD1C 2IN3A 2JW4A 2M0OA 1VQ9A 3CD6T 4E7JA 4FX3B 1G3SA 1S1NA 2KEAA 2DXBA 3QWLA 3CC4A 4OGCA 1UJ0A 2NWMA 3I55Q 2LCLA 2A08A
chains in the Genus database with same CATH topology
4F7UA 4ME7A 1W2BA 3NTKA 1BI2A 2K5LA 2KK4A 3OMGA 3C95A 4J5YA 3OBWA 3QG1A 4AKHA 2WSCE 4M6VA 1N27A 2X35A 3URGA 2RJDA 4J8OA 2G3RA 4BBRM 2R5MA 3RESA 4FSXA 4BI4A 4PJOA 2HBPA 1VQ5T 4M7DD 1V29B 2LRQA 4M78B 4C8QA 3VKHA 3VYGB 1D3BB 1I81A 4JLIA 4QVDA 4LDUA 5GMKh 3CCMT 1K9MC 4QW2A 4FT4A 5GAMf 3GIBA 4M7DE 4J83A 5LJ3d 2XD0A 4ZGJB 4BE0A 3PT9A 4J6YA 2OTLT 4M7AG 1GXIE 3WXMB 1QLBA 3ER0A 1G3TA 3M57A 4C92G 2XIDA 4X34A 4HT9A 4TVRA 3CCRA 1VIEA 4M75G 3L2VA 4QVCA 1WQWA 4M77F 3T9NA 3A8LB 1VQ6T 3M9QA 4XTUA 2MI6A 4GY5A 3V7CA 3R6OA 5KE3A 2D6FA 3OQ5A 4NS5A 5CQYA 4DOWA 2GQVA 4M7AD 3TCJA 2E6ZA 4FU6A 4R55A 1VQ8T 1Q7YU 1W4SA 1KQ1A 2QTXA 3HSBA 4M7AE 4V2SA 3CCST 2KQWA 2EQMA 2EJFA 2L89A 4RCBA 4MMLA 3CCVT 4XTWA 2DXCA 2K4YA 1VQNT 3CXCS 1Y96B 4B9WA 1VQLT 2PU9B 4EMGA 3L2ZA 3E19A 4NC6A 3EAEA 3CCJT 1R8OB 4Z02A 2IG0A 3EFRA 2PUOB 5LJ3e 4BY6C 4JRPA 2FHDA 1LNXA 5LJ3j 3HZJA 5D6XA 1Q86U 1BYMA 2MWPA 4JRQA 5LJ5g 4L59A 4M7DF 2OTJA 3G6ET 2DXTA 2E6NA 2QQ9A 4M77C 1MGQA 5GAOn 1UEBA 5I2MA 5GANh 1WNLA 1KC8U 4EMKC 1RL2A 1YJWT 4MFDA 3OYGA 3JAME 3CMAT 3CXCA 2CZ6B 2JTMA 4XTYA 2RK1A 1WGSA 3A8HB 1U1TA 3GNFB 4JRIA 3JCMe 5HY6A 5LJ5d 3SB2A 3OA6A 3OW2S 1YJ9T 3JB9H 4MIMA 2PVDB 2R5AA 3OYBA 3CMEA 4E7IA 4M7DA 3GOXA 2XDBA 3H8ZA 3ASKA 1LOJA 3UT1A 4MDXA 1JRIA 1Q82C 2ZCFB 1YITA 2VXEA 1G3YA 2XICA 3P8HA 4IUPA 4WF2A 3G4SA 3C94A 3I56T 1ZHIA 1YIJT 2DTIA 5FRNA 2JN0A 3JB9G 5I2SA 5GAMh 2KSSA 3TW6A 4M78F 4MFEA 1I4K1 5FU6B 1YI2T 3QUIA 2BUDA 2ZPHB 4QQDA 2RJCA 3E9FA 1UGQB 4MZPA 1KQSS 4HCCA 4XTZA 2ZPGB 3MP6A 3OW2A 2RJEA 4FT2A 5GAN7 2QEXT 1Q81C 1KQ2A 2E1HA 3Q1JA 3JB9D 4N0AA 4OVAA 1YBYA 5D6WA 5GMKi 4M7AA 5C0MA 3L2RA 2WJ9A 2WACA 1M1KC 2MF2A 4O6JA 3A8OB 2RI2A 5LJ5e 2MMPA 1VQKA 5LJ5j 4AI6A 3VYGA 4XU2A 1O9SA 2XHCA 1YCYA 2QQBA 4Q5WA 3OYNA 4J7FA 3OYLA 2K3XA 4JS4A 3HHTB 2RJFA 5GAN2 4IKFA 1Y71A 3PNWC 3VYHB 3X24B 1NPRA 5DLQE 1XOVA 2E41A 3NFCA 4MMKA 3OB9A 4M78C 3RIRA 3TW7A 3CBOA 3I55T 2LCCA 4JDSA 4IURA 1M9SA 1VQOT 4PJOF 3JSCA 5J3BA 3JCMV 3G71A 3L2UA 3SWNC 4C8QF 1VQ4T 3ZBDA 1ZBXA 5GANf 1B34A 2X4WA 2RD1A 4O5VA 2HD0A 4DA4A 2DO3A 4ZTFA 3A5ZB 4DQ2A 3BFMA 1MHNA 4N4GA 2QQSA 3V7SA 1Y07A 4C0ZA 3P8BB 2XDDA 1FXXA 4RG2A 5CAIA 3LGLA 3FC3A 1YJNA 5LJ3h 3HRTA 5FU7B 3KBGA 2XG8D 3HFNA 3VV0A 5LL6S 3SFMA 3A8MB 4XK8E 4M7AB 1ZQ1A 4R56A 1Y96A 3SD4A 3UWNA 5CK9A 3FJPA 3CCVA 1U1SA 1XTDA 1OZ2A 4C0DC 4C92B 5KH6A 2QA4T 4BDZA 1VQLA 4M75B 2QQRA 3CCJA 3WVEB 2I2LA 3CBMA 2MAMA 1Y7XA 3H6ZA 2JVVA 5A0LA 1PSFA 4BBSM 3DB3A 1G5VA 2DZCA 2Y90A 4XTXA 4EDUA 4ATOA 1QW1A 3A8GB 2P0QA 3RMSA 3ZFJA 3JCMh 4CRIA 3G6EA 3QYBA 4PJOC 2CKKA 5CKHA 1NZ9A 4C8QC 3TU4K 1K73U 3CC2T 3QO3A 3HO8A 3M4YA 1TH7A 5FROA 2RHUA 2F5KA 3MHXA 3MEVA 2HQEA 1N9RA 2E65A 2KMTA 3F70A 4JX6A 2VGMA 2DIGA 3RERA 5DY9A 1B34B 3CMAA 1YHQT 2HAXA 1FKMA 2VGNA 4JX5A 3OYKA 2V8KA 3QKJA 3MCAB 3V8LA 3GF5A 3V8KA 3BDUA 1YJ9A 4C92D 1H641 3CBPA 3JCMW 5GAOr 2RM4A 4M75D 3OYDA 2K2VA 4BD3A 2ZPBB 4E7KA 4ZGEB 1IZ6A 3CC7T 2LVMA 4C92E 3GPLA 2RHIA 4LDYA 5IT9E 1WJQA 2L3RA 4M75E 4OF1A 5CCAA 1PSEA 3I56A 3M53A 5CQXA 4N4HA 4A4KA 3CCUA 1VQPA 1YIJA 4A4FA 2FB7A 2XK0A 4C5GA 3CCET 2O01E 1VQ7T 3VJPA 4BI3A 2Y4XA 4LD6A 3HRSA 3CPFA 4CI0C 4QSHA 1NPPA 2KAFA 4EMHA 1N9SA 3M56A 2X4XA 2EIFA 1BI0A 2BKDN 3BW1A 3OMCA 3OYYA 4AKGA 2QDYB 2L5QA 3QJ6A 1VQMT 2XI9A 5GMKm 3QYEA 4OB2B 1M1FA 1QVGS 2E70A 3OYMA 1KHCA 5LJ3f 2DTOA 2F69A 4ZN1A 4E7LA 4BI8B 2YRVA 2DEQA 2K5FA 1Q7YC 2EQJA 2ZPIB 4PNOA 4XU1A 4RG8A 2FVUA 2O4XA 3M55A 4A53A 4F7UG 1X01A 2Y4YA 1M1GA 4MZMA 3BDLA 2ZPFB 2YHTA 3LWHA 4KUDK 2DPPB 5AYFA 2LT4A 3X20B 3OSSC 5EG2A 5J39A 3CEYA 1OI1A 3M54A 4KUIA 1SSFA 2GCXA 2XU8A 3FB9A 4Y28E 4A4GA 5GAOp 3CPWS 3S3MA 1M90U 4HKEA 3CD6A 4PKCC 2GF7A 3OYEA 3CCRT 3OSVA 4C92F 5GANg 4HNVA 2LDMA 4PJOG 3JCMf 3I55A 2EWNA 1Q86C 4MDWA 4M75F 2QXFA 5GAN3 3FLGA 3MP8A 4B9XA 5GMKe 1VQOA 1S72T 1QVGA 5IAYA 5GMKj 1VQ4A 2C06A 4M7DC 2R58A 5GAN6 1I5LA 2DTHA 2DD4A 1M5Q1 3E9GA 1K8AU 1KC8C 3RKYA 3OS1A 1NJIU 2D0QB 2FYKA 3HB9A 2EKOA 4C5EA 1M4ZA 1QVPA 5GANd 3RMQA 3FEOA 2DVEA 2G77A 3QHSA 5A0DA 3CPWA 5CKEA 4C92A 2DK3A 2YLCA 4M75A 5GAMg 3UPUA 1KD1U 3CCLA 4FM4B 2K3YA 2K57A 3X28B 3QJYA 1VQ5A 5FU7C 2O4XB 4N0AC 5CIUA 4LOCA 4EMKB 3CCMA 5A2QE 4M7AC 3QBYA 1DJ7B 4L6V5 2VXFA 1KHIA 4OP0A 5GAOq 2HQXA 3N5BB 3LGFA 3LW5E 4YTLA 1N8RU 1KQSA 3LLRA 4JUVA 3BY7A 2OTLA 1LJOA 2V8JA 4IUVA 2LTOA 3OS2A 5LJ5f 2XDPA 1UGPB 3HP9A 4C0FA 3DKMA 3CC2A 4M77G 4HNTA 5GAMd 1WJSA 4HA8A 3PTAA 2EYQA 2QDJA 3META 2LCLA 5GAOm 1E7PA 2A7YA 3H4CA 4KT0E 1VQ6A 3JCMP 3INZA 4GLKA 4XU3A 2DD4B 4JX4A 4OB0B 2CS7A 2DD5B 1FX7A 1HXDA 3JCMX 4IUUA 3PIPA 3LH0A 4VUBA 3CMET 3J81E 1N6AA 1BI3A 4PLIA 4FIBA 5HK0A 5DM7R 2M9UA 1VQ8A 4OMFB 1G3WA 2LX9A 3M59A 1YITT 4ZGDB 5DLOA 1K9MU 4UC4A 3CCSA 2BS4A 5GAN5 1VQNA 4E47A 1BIAA 4BE2A 4HCZA 3QYGB 4L5GA 3JB9F 2KY9A 3TREA 4XU0A 4HT8A 3M5AA 3SDZA 1UB4A 4PL6A 2LT1A 2KVQG 5CKBA 4A4HA 3CCEA 1OYXA 1VQ7A 2LC4A 4JRKA 4NL3A 4M7DG 3CCQT 3QYHB 2D9TA 4LDXA 2EFIA 1QP2A 3JB9J 1X75C 4X9DA 1BI1A 5HK3A 4Z6YA 1U8RA 1VIFA 2KDSA 5LJ3g 3ZEHA 5CVIA 5GAMe 3J80E 4JS5A 3AHUA 5GAMj 1VQMA 3HL8A 2XKOC 3LX7A 3NTHA 5A0GA 3QSUA 3P8DA 4LDWA 2HNIA 1YJWA 4IUQA 1WJRA 3RKWA 5KCHA 2ZZDA 4JJNK 2IVWA 3S3OA 1VQKT 2QQ8A 3RUXA 3HRUA 3UDCA 3QZ5B 3GP8A 2L8DA 2JUFA 3OYCA 3QIIA 2DAQA 3M58A 1AHJB 3QXEB 3SWNB 3HBLA 2MWOA 4KULA 2RH2A 1VQ9T 1M8VA 4OGEA 5GMKl 3WVDB 1XNIA 3JCMc 3L2QA 3JCMg 4BB7A 3S3NA 4ELZC 2JOYA 3JCMQ 2X4YA 2WSEE 4Y91A 3DLMA 3RKXA 2RHZA 2VYTA 3VKIA 3PIOA 3J7AF 3G71T 4M78G 3KXTA 3KHIA 4NL2A 2CZ0B 3C12A 3VUBA 2BS3A 2M16A 3CC4T 2DXBB 1S72A 2RI5A 1YI2A 1K73C 3ME9A 2ZPEB 2ZGWA 1JB0E 4ELJA 4KBMB 5LJ5h 4D6WA 2VUBA 2E5QA 2OAUA 3DB4A 1VUBA 4C0DB 2CYZB 2JNGA 3PMTA 4QVZA 4F7UB 5KE2A 3JCMd 1YJNT 3V7RA 4LD9K 4QQGA 2PVGB 3MEUA 5FU6C 2QEXA 2CGHA 4M78D 4C5HA 2F5TX 3V8JA 3VU3C 4FL6A 2M1HA 2E64A 2RHYA 3KUFA 2RK2A 5EJCA 4OB3B 2ZZDB 4M78E 3MEAA 2EJGA 2P0PA 2PUKB 3MEWA 4M77A 4PJOB 3JRZA 3NTIA 3BG9A 2CZ1B 4C8QB 1Q82U 2QFZA 2QF7A 3TEEA 3OYFA 1UGSB 4EMKA 3GLXA 5M9OA 3OS0A 1IREB 1QVFS 1X6OA 4AKIA 2LQKA 4X9CA 4BUGA 4NOYA 4M7AF 2QI2A 1JJ2S 4J6WA 3QZ9B 4OB1B 2BS2A 2VV5A 5J26A 4A4EA 2VC8A 3PFSA 3JB9I 3OYIA 1BIBA 1EIFA 4XAXB 4C8QG 5GAN8 2K5IA 4BE1A 1WPYA 3L2WA 3HFOA 4C0GA 4J7IA 1Q81U 1RI0A 5D6YA 2PVOB 3JCMb 4RMOA 4A54A 1P92A 2DD5A 3DL1A 1HK9A 3MP1A 4IUTA 4F7UE 3OY9A 2GFUA 2EQKA 3VUZA 1NE8A 1M1KU 3OYJA 5CKFA 1FWZA 2E10A 2P0KA 3FRNA 3OS5A 4C5IA 3JCMJ 1QVFA 4PJOD 2DZ9A 1QP3A 2RI3A 3QPHA 3LYIA 4BY6B 4C8QD 2DJZA 5CKDA 1JJ2A 4P5NA 1WQ7A 3EFSA 5GAOl 2X4JA 3M4GA 2DXCB 2GFAA 2B8AA 4BDYA 3CCUT 4PJOE 1VQPT 4N4IA 2A3LA 5FLXE 4C8QE 3OYHA 2QA4A 2JTFA 4M77B 2EQUA 3BG3A 2EJ9A 2DKGA 4DOVA 2RB6A 5KCOA 3VKGA 1M90C 1H3ZA 5I21A 4EPCA 2DXUA 1JBMA 2YLBA 2BIVA 3MO8A 4XTVA 2OTJT 3PGGA 4HCBA 4JLGA 3G7ZA 3L1AA 4C92C 5GAN4 3CCQA 2DIQA 3X26B 2FL7A 3FIFA 3OYAA 2E12A 1XQHA 2PQWA 4II1A 4M75C 2AHJB 4ELYC 4QQ6A 1K8AC 3BG5A 1KG1A 2P4TA 4HLQA 2V8IA 4MZTA 1NJIC 2LQ8A 2NLUA 4LDVA 3DLLA 4PLLA 4M78A 1YHQA 2EAYA 4BACA 3L42A 3FDRA 1D3BA 2LNVA 2KR6A 3C4SA 3GNGA 3HPWA 4RKUE 4F7UF 3LWIA 1W2BS 3OBYA 3O8VA 4RCCA 4HL4A 1O75A 4XQ3A 3SWNA 5GANe 5C6SA 5CR2A 3X25B 2H3JA 4E7HA 5GANj 1KD1C 2M0OA 1I8FA 4M77D 4M7DB 4HNUA 1VQ9A 3E1SA 3G4ST 4ZTJA 1BKBA 4E7JA 5HKCA 4J6XA 3CD6T 3CC7A 1G3SA 2R57A 4ZN3A 3CCLT 2QQAA 4M77E 2KMGA 3S6WA 2RHXA 2RA2A 3QDRB 3HKSA 2JZ2A 3PMIA 5CO7A 1N8RC 2DXBA 1OZ3A 1UGRB 2RO0A 3QWLA 3CC4A 4OGCA 2WSFE 5FRMA 5IN1A 5L8RE 2CZ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X20 B;  3A8O B;  2CZ0 B;  2DXB B;  4Y28 E;  2ZPE B;  2WSC E;  3VYG A;  1JB0 E;  3HHT B;  2CYZ B;  3VYH B;  3X24 B;  2PVG B;  1V29 B;  2DD4 A;  3VYG B;  4OB3 B;  2ZZD B;  2D0Q B;  4ZGJ B;  2PUK B;  1GXI E;  2CZ1 B;  1UGS B;  1IRE B;  3A8L B;  3QZ9 B;  4OB1 B;  4FM4 B;  3X28 B;  3A8M B;  4XK8 E;  1DJ7 B;  4L6V 5;  3LW5 E;  3WVE B;  2PVO B;  1UGP B;  2DD5 A;  1PSF A;  2DXC A;  2PU9 B;  3A8G B;  4KT0 E;  1QP3 A;  2PUO B;  2DD4 B;  4OB0 B;  2DD5 B;  2DXC B;  4ZGD B;  3QYG B;  3X26 B;  2CZ6 B;  2AHJ B;  3A8H B;  2ZPB B;  4ZGE B;  3QYH B;  2PVD B;  1PSE A;  1QP2 A;  2O01 E;  2ZCF B;  4RKU E;  2ZZD A;  3X25 B;  2QDY B;  3QZ5 B;  2ZPH B;  4OB2 B;  1UGQ B;  1AHJ B;  3QXE B;  2ZPG B;  3WVD B;  2DXB A;  1UGR B;  2ZPI B;  2WSF E;  2WSE E;  2ZPF B;  5L8R E;  2DPP B;  2CZ7 B; 
#chains in the Genus database with same CATH topology
 4F7U A;  2R7G A;  2ESW A;  3NTK A;  1TS9 A;  2KK4 A;  1B3Q A;  3C95 A;  4M6V A;  3URG A;  3UA6 A;  2G3R A;  4LE9 A;  5KYU A;  1JEG A;  2R5M A;  1TXQ A;  4FSX A;  4BI4 A;  4PJO A;  4M7D D;  1K9M C;  2K79 A;  2HDA A;  1CSK A;  4M7D E;  4J83 A;  4ZGJ B;  4J6Y A;  1KC8 R;  4M7A G;  5DQV A;  4BCK B;  3WXM B;  1GXI E;  1RAG B;  4C92 G;  1VIE A;  1JU5 C;  2IW9 B;  4CFU D;  4M77 F;  1VQ6 T;  2DL5 A;  4X1V A;  5HNB B;  1G83 A;  1PCX A;  1BU2 A;  3VRY A;  3R6O A;  1QCF A;  4LUE A;  1Q95 G;  2KT1 A;  4NS5 A;  2X1N B;  4M7A D;  2SEM A;  2ED1 A;  4JJD A;  1VQ8 T;  3GTM S;  1JQQ A;  1TU0 B;  2QTX A;  4AG2 C;  4F16 A;  3HSB A;  4M7A E;  4V2S A;  3CCS T;  2EJF A;  2HZY A;  2M02 A;  3CXC S;  1Y96 B;  2C6T B;  5HBJ B;  3E19 A;  1PKT A;  3EAE A;  1TOV A;  3EFR A;  2PUO B;  2ED0 A;  1PD0 A;  5LJ3 e;  4JRP A;  3EG9 B;  5LJ3 j;  3CC7 Q;  3VRZ A;  1BYM A;  5KYY B;  3H0H A;  4JRQ A;  5LJ5 g;  1H4L D;  1CKB A;  2COY A;  2QQ9 A;  2PMI B;  1GFD A;  1UEB A;  1D1B A;  1KC8 U;  1BB9 A;  3OYG A;  3TSZ A;  1WHM A;  1M3A A;  2RK1 A;  2COZ A;  3A8H B;  3OW2 S;  3JB9 H;  1SF9 A;  1F1B B;  4M7D A;  3ASK A;  1TTH B;  3UT1 A;  1Q82 C;  1G3Y A;  2XIC A;  3P8H A;  4WF2 A;  3I56 T;  5HVY B;  2NUP A;  2DTI A;  5FRN A;  5I2S A;  5GAM h;  1I4K 1;  4BCI B;  1H26 B;  1ZP2 A;  3DJB A;  2NUT B;  4QQD A;  2RJC A;  1ZBJ A;  5KYW A;  1VIN A;  1UGQ B;  1MV0 B;  3E9F A;  1KQS S;  2ZPG B;  3MP6 A;  2QEX T;  2E1H A;  3Q1J A;  4OVA A;  5GMK i;  4M7A A;  2AIR B;  4HCK A;  1H1P B;  5HBH B;  1JXM A;  1M1K C;  5IXB A;  2MMP A;  1VQK A;  4AI6 A;  3VYG A;  2J7I A;  2XHC A;  4RTZ A;  5ECA A;  3A98 A;  3TN8 B;  3NPF A;  3BLH B;  3RIR A;  2LCS A;  3I55 T;  3C0C A;  4PJO F;  3JCM V;  3L2U A;  1U3O A;  1J3T A;  5GAN f;  1B34 A;  4DA4 A;  2HEQ A;  4ZTF A;  4KRT A;  2QQS A;  2CH4 W;  2AKL A;  1UDL A;  1X27 A;  3HRT A;  2XG8 D;  5LL6 S;  3UWN A;  1XTD A;  1PRL C;  1D3U B;  3CME Q;  3WVE B;  4EOO B;  2LNH B;  1P5E B;  1Y7X A;  3H6Z A;  5A0L A;  4BBS M;  2Y90 A;  4EDU A;  3EOC B;  2LQW A;  3JCM h;  4EOI B;  8AT1 B;  3QYB A;  4CFX B;  5EFQ B;  2EGC A;  2RHU A;  2HQE A;  3REA B;  2VGM A;  5DY9 A;  4CC3 A;  2KR3 A;  2HCK A;  1ZLM A;  1H64 1;  3CBP A;  4ROC A;  1QWF A;  4M75 D;  2CP7 A;  4KH1 B;  3OYD A;  2DLP A;  3CC7 T;  1X69 A;  4LDY A;  2L3R A;  4M75 E;  3I56 A;  3CCU A;  1VYT A;  4A4F A;  3NHN A;  1M27 C;  1HYO A;  2DER A;  1M2O A;  1TFB A;  2YWW A;  3CPF A;  4EMH A;  1N9S A;  2X4X A;  2BKZ B;  2BKD N;  3BW1 A;  1D0X A;  4AKG A;  1FYN A;  2F1L A;  1QVG S;  2HKN A;  3TNH B;  2DL3 A;  1NEB A;  2W99 A;  2HBW A;  2K5F A;  3VS5 A;  1Q7Y C;  1C0M A;  1YNZ A;  4PNO A;  1AIS B;  4MZM A;  1M1G A;  2AZV A;  2ZPF B;  2YHT A;  1N8R R;  2DPP B;  2LT4 A;  5J39 A;  4AFQ C;  2A37 A;  1EZZ B;  4M7A F;  3S3M A;  4PKC C;  3OYE A;  1B7T A;  1WA7 A;  1GUX A;  4HNV A;  2LDM A;  4C92 F;  5FW9 A;  5GAN g;  3I55 A;  3CXC P;  1NLO C;  1EX4 A;  3FLG A;  4ORZ A;  1M5Q 1;  3HB9 A;  3M0T A;  3EG1 A;  2OAW A;  3CPW A;  5A0D A;  2YLC A;  1UHC A;  4M75 A;  1VQ5 A;  4OGR B;  2DRK A;  5DQW A;  1E7O A;  4LOC A;  3CCM A;  2K2M A;  2J6K A;  3M0S A;  2ATC B;  2VXF A;  4KRC B;  4ROD A;  3MY5 B;  1MNE A;  1N8R U;  1PHT A;  3BY7 A;  1H28 B;  1LJO A;  2V8J A;  4IUV A;  4JZ3 A;  1UGP B;  4EC8 B;  4ROE A;  2J06 A;  4HNT A;  1IB8 A;  1TUD A;  1YFN A;  4HA8 A;  5GAM d;  2CCH B;  4EON B;  2OTJ Q;  3ZL7 C;  4KT0 E;  2MYS A;  1FX7 A;  1HXD A;  1AWX A;  1OX9 A;  2XMF A;  3CME T;  4PLI A;  1BI3 A;  1KK7 A;  1KQS P;  2W96 A;  1G3W A;  2AK5 A;  2LX9 A;  3EH2 A;  4ZGD B;  3M59 A;  5DLO A;  2W9F A;  2BS4 A;  5GAN 5;  2WHB B;  4HCZ A;  3QYG B;  4L5G A;  1UUE A;  3TRE A;  2LW4 A;  3SDZ A;  1UB4 A;  4PL6 A;  5CKB A;  2LC4 A;  4NL3 A;  2FRW A;  2RMO A;  4LDX A;  3GBQ A;  1X75 C;  4X9D A;  3J80 E;  3AHU A;  3QSU A;  1YJW A;  2JMA A;  1RAH B;  4JJN K;  4RTV A;  4F14 A;  2HL5 C;  4DBR A;  1WHK A;  2CP3 A;  3HRU A;  1OKV B;  3QZ5 B;  3GP8 A;  2L8D A;  2CP5 A;  1MMG A;  3HBL A;  4FSS A;  1WXT A;  2QG9 B;  4Y91 A;  3O0G D;  2RHZ A;  3PIO A;  2EYW A;  3C12 A;  2BS3 A;  1ZX6 A;  2M16 A;  2DXB B;  2RI5 A;  2PK9 B;  2OTL Q;  4D6W A;  2VUB A;  2UZL B;  2CYZ B;  3PMT A;  4F7U B;  5KE2 A;  3JCM d;  4C5H A;  1TD6 A;  3VU3 C;  2DIL A;  4FL6 A;  2M1H A;  2E64 A;  1RUW A;  5EJC A;  1BCM A;  4OB3 B;  4PJM A;  5KYU B;  2P0P A;  3MEW A;  4PJO B;  1X6G A;  3NTI A;  3BG9 A;  3THK A;  2CP6 A;  3D7S B;  4EMK A;  5M9O A;  2DL4 A;  4X9C A;  3CCV Q;  4BUG A;  2D8J A;  3H9N A;  2AT1 B;  3QZ9 B;  5J26 A;  2GTO A;  2VC8 A;  2K5I A;  4C0G A;  5D6Y A;  1K0S A;  2DD5 A;  3OY9 A;  2V1Q A;  1NE8 A;  2J6O A;  3OYJ A;  1FWZ A;  1WHH A;  3FRN A;  3OS5 A;  1K76 A;  4BY6 B;  3LYI A;  1JJ2 A;  1WQ7 A;  2JGZ B;  2X4J A;  4BDY A;  2B8A A;  5FLX E;  3OYH A;  3VS7 A;  1OL1 B;  1K1Z A;  2UZE B;  2DKG A;  2DET A;  2OI3 A;  5I21 A;  4EPC A;  2OTJ T;  4EOK B;  1SEM A;  1LCK A;  3PGG A;  4JLG A;  5GAN 4;  2DIQ A;  3OYA A;  4CFM B;  2PQW A;  4II1 A;  1GL5 A;  1YWP A;  1KG1 A;  2ROL A;  4HLQ A;  2EKH A;  4LDV A;  4PLL A;  2W10 A;  1YHQ A;  1O9K A;  3FDR A;  1D3B A;  4BXX X;  1QCO A;  2LX7 A;  2MK5 A;  3O8V A;  2PZ1 A;  2LQN A;  2C0T A;  4M77 D;  3VS1 A;  4M7D B;  2EYZ A;  4DBQ A;  5KYN A;  3E1S A;  2QQA A;  2RPN A;  2KMG A;  4M77 E;  2NUP B;  3QDR B;  2DVJ A;  1WDX A;  1OZ3 A;  1TSF A;  1UGR B;  2EW3 A;  2P84 A;  4CFU B;  5L8R E;  4EOR B;  1WHL A;  1W2B A;  1BI2 A;  2JT4 A;  4J5Y A;  1VQ4 Q;  3QG1 A;  2IIM A;  2O31 A;  2VKN A;  1ZA1 B;  4D8K A;  1D09 B;  1IXD A;  4M78 B;  3RR6 A;  2DYB A;  4JLI A;  3VYG B;  1I81 A;  5HBE B;  5GAM f;  4FT4 A;  4FYY B;  5LJ3 d;  2CUB A;  2QA4 Q;  2OTL T;  1QLB A;  3ER0 A;  2FPD A;  3M57 A;  1FMV A;  1MV3 A;  3CCR A;  1NBE B;  1WQW A;  4CC4 B;  1H1S B;  3M9Q A;  1WX6 A;  2MI6 A;  1TUG B;  4RTW A;  5KE3 A;  1Y57 A;  1G8X A;  3OQ5 A;  1QLY A;  4BCF B;  5CQY A;  4F04 B;  3CC2 Q;  4DOW A;  1AWO A;  2C5V B;  1GRI A;  3TCJ A;  2E6Z A;  4FU6 A;  4R55 A;  4F7J B;  1W4S A;  4RCB A;  3CCV T;  4XTW A;  2K4Y A;  3RNJ A;  4Z88 A;  4NC6 A;  1R8O B;  1NYF A;  4BY6 C;  5ACB A;  4F6U B;  2OTJ A;  2YUQ A;  1MGQ A;  4BCN D;  4BCM B;  5I2M A;  1WNL A;  1RL2 A;  1I07 A;  4MFD A;  1D1A A;  3JAM E;  1X6B A;  1WHG A;  4AG1 C;  3CXC A;  1WGS A;  5IDN B;  4BCO B;  4F6S B;  3JCM e;  2R5A A;  1SHG A;  3OYB A;  4E7I A;  2XDB A;  1OOT A;  2C5N B;  3VS4 A;  1YIT A;  2VXE A;  2WIH B;  2JN0 A;  4OMP A;  2KSS A;  4MFE A;  5FU6 B;  1KSW A;  3QUI A;  2BUD A;  2ZPH B;  1G3N C;  4AFU C;  4PJJ A;  4MZP A;  4HCC A;  3OW2 A;  2HQH A;  1FIN B;  4FT2 A;  5GAN 7;  5L2W B;  1KQ2 A;  4PFZ A;  1YBY A;  5D6W A;  5C0M A;  3L2R A;  2JJ9 A;  3A8O B;  3QWY A;  5LJ5 e;  1ENW A;  5LJ5 j;  1O9S A;  1UHF A;  1YCY A;  4Q5W A;  3OYL A;  5GJW B;  1C6V X;  2RJF A;  1VYW B;  1NPR A;  1BBZ A;  5DLQ E;  2YT6 A;  3OB9 A;  4M78 C;  4EOL B;  2LCC A;  4IUR A;  4EOP B;  1GUX B;  3JSC A;  2C4G B;  5J3B A;  3G71 A;  3SWN C;  1VQ4 T;  1MUZ A;  2DO3 A;  3M0R A;  3A5Z B;  5ICP B;  1KJW A;  1MHN A;  3UF4 A;  4N4G A;  1F5Q B;  1ARK A;  3V7S A;  3VS2 A;  4RG2 A;  5CAI A;  3LGL A;  3FC3 A;  1YJN A;  3LH5 A;  3KBG A;  4HVU A;  3HFN A;  3VV0 A;  3PO3 S;  3VS6 A;  4XK8 E;  4CC2 A;  1ZQ1 A;  4BCQ B;  3CCV A;  2QA4 T;  1OV3 A;  2PHG A;  4BCG B;  4M75 B;  1OIY B;  4JJB A;  4B6M A;  2I2L A;  2IW8 B;  4J9G A;  4XTX A;  4EOJ B;  3ZFJ A;  2CKK A;  5CKH A;  4C8Q C;  3CC2 T;  3E2U A;  3HO8 A;  1E9H B;  1TH7 A;  3MIA B;  2F5K A;  3MHX A;  3EG0 A;  2DNU A;  2C5O B;  3RER A;  4JX6 A;  2HAX A;  2UUE B;  4OMN A;  2VGN A;  4AT1 B;  3OYK A;  4WCI A;  3EGD B;  4M4Z A;  3GF5 A;  3BDU A;  2JXB A;  1GY3 B;  2CUD A;  2JM9 A;  2RQR A;  4C92 D;  1M90 R;  4E7K A;  1GCQ C;  3EGX B;  4C92 E;  3GPL A;  1OPK A;  5IT9 E;  1WJQ A;  3M53 A;  5CQX A;  1JKW A;  3EFO A;  2DFU A;  2FB7 A;  4C5G A;  2YRC A;  2Y4X A;  3HRS A;  2D1X A;  2FRY A;  2QK0 A;  3MKD A;  4HXJ A;  3OMC A;  4JJC A;  2L5Q A;  1VQM T;  2LZ6 B;  5GMK m;  4OB2 B;  3OYM A;  1H3H A;  1AVZ C;  5LJ3 f;  4ZN1 A;  4BI8 B;  2YRV A;  2ZPI B;  2J6F A;  2FVU A;  1JO8 A;  3M0Q A;  5EG2 A;  4KUI A;  4A4G A;  5GAO p;  4Y28 E;  3RGF B;  3FB9 A;  1M90 U;  4HKE A;  3CD6 A;  2GBQ A;  2CSI A;  3OSV A;  3KFV A;  5IHY A;  1ZA2 B;  2EWN A;  1S72 T;  4QKU A;  2DYI A;  1QVG A;  4B9X A;  1OIU B;  1HD3 A;  5IAY A;  1VQ4 A;  2R58 A;  1HJD A;  1ZSG A;  1KC8 C;  3RKY A;  2PJQ A;  3EHQ A;  4LXC A;  4FYX B;  1ZSZ A;  2DME A;  1X2K A;  2PNI A;  2EKO A;  5BNJ B;  5I5Z B;  3CMA Q;  1ABQ A;  2G77 A;  1UNL D;  5CKE A;  4C92 A;  4NST B;  3UPU A;  1UTI A;  4FM4 B;  2K57 A;  3X28 B;  1OUL A;  1PKS A;  2YRD A;  2O4X B;  4N0A C;  5CIU A;  4EMK B;  2HKQ B;  2HQX A;  3N5B B;  1VQP Q;  3LLR A;  1WIE A;  1FMW A;  2YUO A;  3CC2 A;  1WJS A;  2EYQ A;  3MET A;  5I22 A;  4ZNX A;  3UAT A;  1VQ6 A;  3JCM P;  6AT1 B;  4XU3 A;  2DD4 B;  2CS7 A;  2DD5 B;  4GBQ A;  4IUU A;  2FEI A;  3PIP A;  5LQF B;  2FPE A;  2YUP A;  4DEY A;  1VQ8 A;  2I53 A;  3CCS A;  2YXY A;  2BZ8 A;  1BIA A;  4HT8 A;  2KVQ G;  3DDQ B;  3CCL Q;  4FW1 A;  2KT8 A;  1BI1 A;  1H25 B;  2KDS A;  5LJ3 g;  3ZEH A;  3QDF A;  4JS5 A;  1VQM A;  3HL8 A;  3NTH A;  4LDW A;  4E6R A;  3RKW A;  1I5O B;  2IVW A;  1IGQ A;  3TQ7 P;  3S3O A;  4KRD B;  3RUX A;  3UDC A;  1O9K B;  2L3Q A;  3RBB B;  2PTK A;  3OYC A;  2M51 A;  3QII A;  3M58 A;  4BCP B;  4OML A;  2ENM A;  4RTY A;  3S3N A;  4ELZ C;  3JCM Q;  2WSE E;  4BY1 X;  3VKI A;  1D0Y A;  4OMQ A;  1FVV B;  1NEG A;  3KXT A;  1Q81 R;  1S72 A;  2BTT A;  4II5 B;  3ME9 A;  2ZGW A;  4ELJ A;  1XO2 A;  5LJ5 h;  2E5Q A;  4C0D B;  1TG0 A;  1VUB A;  4QVZ A;  4R0K A;  3V7R A;  4QQG A;  3MEU A;  1SRL A;  3F5X B;  2QEX A;  4HVV A;  1XJW B;  3KUF A;  2RK2 A;  1NM7 A;  2ZZD B;  3MPU B;  5I11 A;  2CH4 A;  2MOX A;  2EJG A;  3JRZ A;  2VVK A;  3OYF A;  3EHR A;  4BCH B;  4UN0 A;  1VQN Q;  4AKI A;  1OU9 A;  2FZG B;  2QI2 A;  1VQL Q;  1WXU A;  4J6W A;  2KGT A;  3CCJ Q;  1QKW A;  1RAD B;  3G6E Q;  1Q81 U;  1HK9 A;  4IUT A;  2C0I A;  2FO0 A;  3VUZ A;  1K0X A;  1QWE A;  2E10 A;  4C5I A;  1BCO A;  2L0A A;  3MJX A;  4F7L B;  1QP3 A;  2KXD A;  5CKD A;  4P5N A;  2MCN A;  5GAO l;  1VQP T;  1YJ9 Q;  2DF6 A;  4M77 B;  5KCO A;  2B9R A;  1M3C A;  2DXU A;  1JBM A;  2YLB A;  1QVF P;  3X26 B;  1XQH A;  4YOO A;  1YI2 Q;  1T0J A;  2LJ3 A;  1K9A A;  2O9S A;  2P4T A;  1H1Q B;  1R0C B;  2ECZ A;  1AD6 A;  4BAC A;  4IMY B;  4EOM B;  2LNV A;  3C4S A;  3GNG A;  4XQ3 A;  4HL4 A;  4E7H A;  5KYX B;  2O9V A;  4ZTJ A;  3CC7 A;  4J9F A;  2WXV B;  2R57 A;  4EIK A;  3CCL T;  3G33 B;  3S6W A;  2RHX A;  3HKS A;  2JZ2 A;  3PMI A;  5CO7 A;  1N8R C;  2CSQ A;  2RO0 A;  2WSF E;  2QYZ A;  4ME7 A;  1VQO Q;  3OBW A;  2MPX C;  4AKH A;  4J8O A;  2A36 A;  2HBP A;  1FMK A;  2BE9 B;  1Q86 R;  3VKH A;  4QVD A;  1GCP A;  4KUD K;  4LDU A;  1NLP C;  2XD0 A;  4BE0 A;  3PT9 A;  1V76 A;  1LPL A;  4ELL A;  3B57 A;  1G3T A;  4BY7 X;  2XID A;  2CT4 A;  4X34 A;  4HT9 A;  2FZC B;  3POM A;  4QVC A;  1SKU B;  4XTU A;  4GY5 A;  4BCN B;  3O5Z A;  4ANJ A;  1IHW A;  2GQV A;  1QQJ A;  2KQW A;  2L89 A;  1VQN T;  4B9W A;  1VQL T;  3CCJ T;  2KI7 A;  3ULR B;  1MMA A;  1RLQ C;  1RLP C;  2GQI A;  3TNI B;  2FHD A;  3HZJ A;  1GBQ A;  3PVQ A;  5D6X A;  1Q86 U;  3G6E T;  2DXT A;  2E6N A;  4BCJ B;  2X51 A;  4M77 C;  2JTE A;  4FCY A;  5GAN h;  3CCE Q;  2VWF A;  5GJV B;  1VQ7 Q;  2LMJ A;  4QT7 A;  2CZ6 B;  2G9X B;  4XTY A;  1RAI B;  1U1T A;  2DA9 A;  3GNF B;  5LJ5 d;  3SEM A;  3SB2 A;  1JXO A;  1YN8 A;  4LN2 A;  1YJ9 T;  2PVD B;  3M0U A;  3CME A;  3GOX A;  3H8Z A;  1LOJ A;  2I0N A;  4IUP A;  3C94 A;  2EUF A;  1ZHI A;  2WMA B;  2RQT A;  4DBH A;  3JB9 G;  1UJY A;  3EFO B;  1YI2 T;  2C5X B;  1M3B A;  1IRX A;  1YWO A;  1M2V A;  1IGU A;  2LJ1 A;  1LVK A;  1OU8 A;  2L3P A;  2RJE A;  3JB9 D;  2DL7 A;  1QKX A;  2WAC A;  2B86 A;  1PWT A;  2MF2 A;  1RAB B;  1HSQ A;  1I1J A;  1QMC A;  3OYN A;  4JS4 A;  2K3X A;  3HHT B;  2Z0W A;  3PNW C;  1K73 R;  3X24 B;  2D0N A;  2E5K A;  1H27 B;  2E41 A;  3NFC A;  4MMK A;  2QAZ A;  2W9Z A;  3CBO A;  4JDS A;  1M9S A;  1VQO T;  1GH6 B;  1RI9 A;  2ZAE A;  1IHV A;  2MIO A;  1ZBX A;  3ZBD A;  4CFW B;  2X4W A;  2RD1 A;  4O5V A;  4DQ2 A;  1Y07 A;  5KYW B;  4C0Z A;  2UZD B;  1UFF A;  1PNJ A;  1FXX A;  1ZSZ B;  1K4U S;  4IIM A;  2EGA A;  2YDL A;  2WMB B;  3R6N A;  2M0Y A;  2QTV A;  4M7A B;  4DBF A;  1VOM A;  5CK9 A;  4F6W B;  3FJP A;  5KH6 A;  4BDZ A;  1VOL A;  1OZ2 A;  4C92 B;  1VQL A;  1AZG B;  2QQR A;  3CCJ A;  3CBM A;  2MAM A;  3BLR B;  1C1A A;  1PSF A;  2F2W A;  1AD5 A;  1G5V A;  2DZC A;  3A8G B;  2P0Q A;  3RMS A;  2ABL A;  4OR5 B;  2QAS A;  4CRI A;  1T0H A;  3G6E A;  4PJO C;  1W1F A;  3TU4 K;  1NZ9 A;  1K73 U;  4PFO A;  1I0C A;  1OX8 A;  5FRO A;  3MEV A;  1W98 B;  1N9R A;  1PC0 A;  2E65 A;  3CCQ Q;  1SPK A;  2DIG A;  1B34 B;  1BU1 A;  4HVW A;  4CRL B;  1E6H A;  1TUC A;  4JX5 A;  2RF0 A;  3MCA B;  1KIK A;  2DRM A;  3V8K A;  1YJ9 A;  4E7S A;  2RM4 A;  1D0Z A;  1VQK Q;  2LVM A;  4OF1 A;  5CCA A;  1PSE A;  4N4H A;  2P4R A;  1K8A R;  2XK0 A;  3CCE T;  2WIP B;  3IQL A;  7AT1 B;  1VQ7 T;  3VJP A;  1GBR A;  1NJI R;  4LD6 A;  4QSH A;  2KAF A;  3H0F A;  3M56 A;  2EIF A;  2W0Z A;  2QDY B;  1RAA B;  2XI9 A;  1M1F A;  1PRM C;  2E70 A;  1KD1 R;  1KHC A;  2D8H A;  2DTO A;  2F69 A;  4E7L A;  1JOW A;  2EVR A;  2DEQ A;  1OKW B;  2EQJ A;  4XU1 A;  4RG8 A;  3BLQ B;  4A53 A;  4F7U G;  1PM3 A;  5AYF A;  3X20 B;  3OSS C;  3TSW A;  4EC9 B;  4PFP A;  2RNA A;  1SSF A;  2DL8 A;  2GCX A;  2L2P A;  2KE9 A;  2V22 B;  2ROT A;  4PJO G;  3JCM f;  4AFZ C;  5HQ0 B;  2O2O A;  4MDW A;  2QXF A;  1QMZ B;  5GAN 3;  3MP8 A;  5GMK e;  1VQO A;  2CP0 A;  5GMK j;  4JPB W;  3DOG B;  2C06 A;  4M7D C;  4IIO A;  1I5L A;  2DTH A;  3E9G A;  1K8A U;  1VA7 A;  2CJM B;  5FGK B;  1NJI U;  2V1R A;  2CCI B;  2D0Q B;  2H3E B;  1K9M R;  4C5E A;  5GAN d;  3NDQ A;  4JZ4 A;  3MY1 B;  3FEO A;  4FW2 A;  2DK3 A;  1KD1 U;  5GAM g;  4CC7 A;  4M7A C;  3QBY A;  1SRM A;  4L6V 5;  1KHI A;  4OP0 A;  4F17 A;  5GAO q;  3CCU Q;  3LGF A;  1N5Z A;  1KQS A;  4JUV A;  2OTL A;  1NG2 A;  5LJ5 f;  2DMO A;  1X2Q A;  3HP9 A;  4C0F A;  3DKM A;  2QDJ A;  1R77 A;  2A7Y A;  3H4C A;  3INZ A;  4GLK A;  1OQK A;  2DBK A;  3JCM X;  4VUB A;  2COW A;  5HK0 A;  4FIB A;  2M9U A;  5L23 A;  1OI9 B;  1ZUY A;  4OMF B;  1K9M U;  5FWB A;  3I35 A;  3JB9 F;  4J9I A;  1M8M A;  2KYB A;  2QGG A;  4A4H A;  3G4S Q;  3CCE A;  1OYX A;  2DEU A;  1VQ7 A;  1H8K A;  4JRK A;  4M7D G;  3CCQ T;  2G6F X;  2EFI A;  1QP2 A;  3JB9 J;  2KNB B;  1U8R A;  5HK3 A;  4Z6Y A;  5CVI A;  2XKO C;  4EOQ B;  2KRS A;  1WJR A;  4IUQ A;  5KCH A;  1Q82 R;  5IDP B;  1VQK T;  2QQ8 A;  1T3S A;  1H24 B;  2JUF A;  1AHJ B;  2MWO A;  4KUL A;  3RDV A;  1ZUU A;  2RH2 A;  5HCK A;  4OGE A;  1M8V A;  1UE9 A;  3JCM c;  3L2Q A;  3JCM g;  1VQ5 Q;  2JOY A;  4E2F B;  3CCM Q;  3J7A F;  4M78 G;  1YCS B;  4A63 B;  3KHI A;  4NL2 A;  3VUB A;  2IVX A;  4J9C A;  4KGX B;  2ZPE B;  1U06 A;  1H92 A;  1M1K R;  3DB4 A;  2D6F A;  4LD9 K;  1B07 A;  2PVG B;  5FU6 C;  3REB B;  3M03 A;  4M78 D;  2F5T X;  3V8J A;  4FYV B;  2RHY A;  2K7A A;  4M78 E;  3MEA A;  1BK2 A;  2PUK B;  2CZ1 B;  1Q82 U;  2QFZ A;  2QF7 A;  5AT1 B;  3TEE A;  2WEV B;  1UGS B;  5EC7 A;  3VS3 A;  3OS0 A;  1IRE B;  1QVF S;  4NOY A;  2WPA B;  1R0B G;  4A4E A;  3PFS A;  1BIB A;  2E3H A;  1EIF A;  2O88 A;  4XAX B;  4C8Q G;  2AZS A;  4BE1 A;  2CP2 A;  4J9H A;  2PVO B;  4A54 A;  1A0N B;  3DL1 A;  2GFU A;  2EQK A;  2CDT A;  1M1K U;  1YJW Q;  2P0K A;  2DZ9 A;  2RI3 A;  4C8Q D;  2DJZ A;  1TWB A;  3M4G A;  2GFA A;  3CCU T;  4N4I A;  2A3L A;  4C8Q E;  2QA4 A;  2JTF A;  2EQU A;  3BG3 A;  3BE3 A;  2NUZ A;  1MMD A;  4DOV A;  2RB6 A;  1M90 C;  1H3Z A;  4BCM D;  2EPD A;  4XTV A;  4HCB A;  3G7Z A;  1YIJ Q;  2YSQ A;  3CCQ A;  2FL7 A;  4M75 C;  1JJ2 P;  1UGV A;  4D8D A;  4ELY C;  1AWW A;  3BG5 A;  3EG3 A;  1WXB A;  2V8I A;  3PE0 A;  4M78 A;  2EAY A;  3I5R A;  3L42 A;  2KR6 A;  3HPW A;  3LWI A;  2OX7 A;  1UNH D;  4F7U F;  3EGU A;  4RCC A;  5GAN e;  3SWN A;  5GAN j;  1I8F A;  4HNU A;  2KYM A;  3G4S T;  1BKB A;  5HKC A;  4J6X A;  3LQ5 B;  4ZN3 A;  2RA2 A;  1PKD B;  1MMN A;  1UNG D;  1SSH A;  5FRM A;  5IN1 A;  1Q7Y R;  2CZ7 B;  1M2V B;  2RQV A;  2JS0 A;  4CFN B;  2K5L A;  3OMG A;  5IHN A;  2WSC E;  1MND A;  1N27 A;  2X35 A;  2RJD A;  2BZX A;  1AT1 B;  2WFY B;  4BBR M;  1NYG A;  4FYW B;  3RES A;  3AT1 B;  3I9Q A;  1VQ5 T;  1V29 B;  2LRQ A;  4KH0 B;  4C8Q A;  2E3I A;  4OMO A;  2I40 B;  1D3B B;  3CCM T;  5GMK h;  4QW2 A;  3GIB A;  1W2B P;  2IW6 B;  2EQI A;  3VS0 A;  4TVR A;  2JM8 A;  4M75 G;  3L2V A;  3T9N A;  3A8L B;  2HMA A;  1RAE B;  2QGS A;  3V7C A;  1GCQ A;  1H1R B;  2W2H A;  4BCQ D;  1GFC A;  1EFN A;  1Q7Y U;  1KQ1 A;  1YHQ Q;  2EQM A;  4MML A;  2DXC A;  1T3L A;  3I5S A;  4PJN A;  2PU9 B;  4EMG A;  2YUN A;  3L2Z A;  4Z02 A;  1ZUK A;  2IG0 A;  1LNX A;  2X3X D;  1N4M A;  2MWP A;  2NYS A;  4M7D F;  3BHV B;  4L59 A;  1ACM B;  5GAO n;  5LMK B;  5D7U A;  4EMK C;  1V1C A;  1YJW T;  4PJL A;  3CMA T;  2JTM A;  1IO6 A;  2RQU A;  4JRI A;  5HY6 A;  4F70 B;  2IPO B;  3OA6 A;  4MIM A;  2FZK B;  2JS2 A;  1OL2 B;  4MDX A;  1JRI A;  2QGF B;  2ZCF B;  2L3S A;  3G4S A;  3EJ1 B;  3HTR A;  1YIJ T;  4G6L B;  3TW6 A;  4M78 F;  4OMM A;  2LJ0 A;  1Z9Q A;  4RTT A;  3CCR Q;  1AZE A;  4XTZ A;  4F7S B;  1M30 A;  1Q81 C;  1Z9Z A;  4N0A A;  1U5S A;  2WJ9 A;  3MI9 B;  4O6J A;  2RI2 A;  2VB6 A;  2DM1 A;  4XU2 A;  2QQB A;  4J7F A;  5GAN 2;  4IKF A;  1Y71 A;  3PVL A;  3OW2 P;  3VYH B;  1XOV A;  3TNW B;  2K6D A;  2X9H A;  3TW7 A;  9ATC B;  1WZO A;  1OGU B;  4C8Q F;  4EOS B;  5IXF A;  2HD0 A;  3BFM A;  3EGD A;  1ABO A;  3UA7 A;  3P8B B;  1JSU B;  2XDD A;  2BE7 D;  5LJ3 h;  2HSE B;  5FU7 B;  2BPM B;  2F2X A;  3SFM A;  2K3B A;  2K9G A;  3A8M B;  3EGX A;  4R56 A;  1W6X A;  1Y96 A;  3SD4 A;  4ESR A;  1U1S A;  4C0D C;  2RQW A;  3BHT B;  4Y72 B;  5IHI A;  4E7Z A;  2KRO A;  4Y92 A;  3EG9 A;  2JVV A;  1YIT Q;  2A28 A;  3DB3 A;  5KYY A;  2KBT A;  4ATO A;  1AOJ A;  1QW1 A;  4KGV B;  4GLM A;  4J9B A;  2C0O A;  3QO3 A;  3M4Y A;  2F2V A;  2KMT A;  3F70 A;  3CMA A;  1YHQ T;  3NMZ C;  1FKM A;  4RTU A;  2V8K A;  2RN8 A;  3QKJ A;  3V8L A;  3TVT A;  1AWJ A;  3JCM W;  5GAO r;  1C9B A;  3NGP A;  2K2V A;  4BD3 A;  2ZPB B;  1WYX A;  4ZGE B;  1IZ6 A;  2DX1 A;  2RHI A;  3QHR B;  4AMC A;  1Y0M A;  4A4K A;  1YIJ A;  1VQP A;  5CEI B;  1VQ9 Q;  4DEX A;  2NUT A;  2O01 E;  3K7A M;  2JMC A;  4BI3 A;  1D1C A;  4CI0 C;  1NPP A;  2SRC A;  1QCN A;  2AKK A;  3G71 Q;  1BI0 A;  3OYY A;  3QWX X;  3QJ6 A;  2UZB B;  1YP5 A;  3CC4 Q;  2EBP A;  3QYE A;  3EID B;  1JST B;  1YJN Q;  4YOS A;  2O4X A;  3M55 A;  4TTH A;  1X01 A;  2Y4Y A;  3BDL A;  3BHU B;  3LWH A;  2GGR A;  3EG2 A;  3CEY A;  1OI1 A;  3M54 A;  2XU8 A;  3CPW S;  2GF7 A;  3CCR T;  3FJ5 A;  3CCL A;  1Q86 C;  4M75 F;  4CFV B;  1RAC B;  2GTJ A;  5GAN 6;  2DD4 A;  3OS1 A;  2A0F B;  2CRE A;  1WI7 A;  2FYK A;  1M4Z A;  1QVP A;  4AFS C;  3RMQ A;  1KXU A;  2DVE A;  3QHS A;  1QVG P;  1OPL A;  4Z89 A;  3QJY A;  2K3Y A;  2KRM A;  5FU7 C;  1X43 A;  2FPF A;  5A2Q E;  1RAF B;  1OEB A;  1DJ7 B;  2FG0 A;  4YTL A;  3LW5 E;  2DE0 X;  3OS2 A;  2LTO A;  2XDP A;  1SG5 A;  4M77 G;  8ATC B;  3PTA A;  5GAO m;  1E7P A;  5IF1 B;  3EH1 A;  4JX4 A;  4OB0 B;  2KRN A;  2HSP A;  5CYI B;  4RUG A;  3LH0 A;  3J81 E;  1N6A A;  1SHF A;  5DM7 R;  4K11 A;  2EYY A;  1WLP B;  1YIT T;  2OJ2 A;  1VYV A;  4UC4 A;  3U23 A;  2LP5 A;  1VQN A;  4E47 A;  4BE2 A;  4KGZ B;  2KY9 A;  4XU0 A;  5IH2 A;  3M5A A;  3SHW A;  2HL3 A;  1E6G A;  3H0I A;  1WHJ A;  2LT1 A;  3CD6 Q;  1W70 A;  3QYH B;  2D9T A;  1VYU A;  1PG5 B;  3CQT A;  1VIF A;  5GAM e;  5GAM j;  3LX7 A;  5A0G A;  3P8D A;  2HNI A;  2ZZD A;  2VAS A;  5IHK A;  2J05 A;  3QHW B;  1AEY A;  2DAQ A;  3QXE B;  3SWN B;  1VQ9 T;  5GMK l;  2BZY A;  3WVD B;  1XNI A;  1UG1 A;  4BB7 A;  2X4Y A;  3DLM A;  3RKX A;  2VYT A;  3G71 T;  2CT3 A;  1KFZ A;  4I3Z B;  2CZ0 B;  2DBM A;  3CC4 T;  4WTO B;  1YI2 A;  1K73 C;  4YOZ A;  1JB0 E;  4KBM B;  3M0P A;  2OAU A;  1YJN T;  2JNG A;  2QDL A;  1VQ6 Q;  2X3W D;  2E4H A;  2CGH A;  1CKA A;  2EGE A;  3DDP B;  1PD1 A;  4M77 A;  1VQ8 Q;  4C8Q B;  1UEC A;  4F7N B;  3GLX A;  3CCS Q;  4YC3 B;  3H41 A;  4LUD A;  1X6O A;  2GNC A;  2LQK A;  4PK4 A;  3G1J A;  1JJ2 S;  4OB1 B;  1URC B;  2BS2 A;  2VV5 A;  3JB9 I;  3OYI A;  1WFW A;  2PK2 A;  4J9E A;  5GAN 8;  4Z8A A;  1WPY A;  3L2W A;  3HFO A;  4J7I A;  4J9D A;  1RI0 A;  3JCM b;  4RMO A;  1P92 A;  3MP1 A;  4F7U E;  1VQM Q;  5CKF A;  5KYX A;  3JCM J;  1QVF A;  3JV3 A;  5FWC A;  4RTX A;  2EYX A;  4PJO D;  3QPH A;  3EFS A;  2DXC B;  2KXC A;  4PJO E;  3DTO A;  1ZSZ C;  2EJ9 A;  3VKG A;  3MO8 A;  2BIV A;  3I56 Q;  3L1A A;  4C92 C;  3FIF A;  2E12 A;  1S72 Q;  2AHJ B;  4LNP A;  4CXA B;  2V26 A;  4QQ6 A;  3CPW P;  1K8A C;  4MZT A;  2DJQ A;  2LQ8 A;  1NJI C;  2NLU A;  3DLL A;  2F2C A;  2QEX Q;  3A1P A;  4RKU E;  1W2B S;  3OBY A;  5C6S A;  5CR2 A;  1O75 A;  2H8H A;  1G2B A;  3X25 B;  2H3J A;  1KD1 C;  2IN3 A;  2JW4 A;  2M0O A;  1VQ9 A;  3CD6 T;  4E7J A;  4FX3 B;  1G3S A;  1S1N A;  2KEA A;  2DXB A;  3QWL A;  3CC4 A;  4OGC A;  1UJ0 A;  2NWM A;  3I55 Q;  2LCL A;  2A08 A; 
#chains in the Genus database with same CATH homology
 4F7U A;  4ME7 A;  1W2B A;  3NTK A;  1BI2 A;  2K5L A;  2KK4 A;  3OMG A;  3C95 A;  4J5Y A;  3OBW A;  3QG1 A;  4AKH A;  2WSC E;  4M6V A;  1N27 A;  2X35 A;  3URG A;  2RJD A;  4J8O A;  2G3R A;  4BBR M;  2R5M A;  3RES A;  4FSX A;  4BI4 A;  4PJO A;  2HBP A;  1VQ5 T;  4M7D D;  1V29 B;  2LRQ A;  4M78 B;  4C8Q A;  3VKH A;  3VYG B;  1D3B B;  1I81 A;  4JLI A;  4QVD A;  4LDU A;  5GMK h;  3CCM T;  1K9M C;  4QW2 A;  4FT4 A;  5GAM f;  3GIB A;  4M7D E;  4J83 A;  5LJ3 d;  2XD0 A;  4ZGJ B;  4BE0 A;  3PT9 A;  4J6Y A;  2OTL T;  4M7A G;  1GXI E;  3WXM B;  1QLB A;  3ER0 A;  1G3T A;  3M57 A;  4C92 G;  2XID A;  4X34 A;  4HT9 A;  4TVR A;  3CCR A;  1VIE A;  4M75 G;  3L2V A;  4QVC A;  1WQW A;  4M77 F;  3T9N A;  3A8L B;  1VQ6 T;  3M9Q A;  4XTU A;  2MI6 A;  4GY5 A;  3V7C A;  3R6O A;  5KE3 A;  2D6F A;  3OQ5 A;  4NS5 A;  5CQY A;  4DOW A;  2GQV A;  4M7A D;  3TCJ A;  2E6Z A;  4FU6 A;  4R55 A;  1VQ8 T;  1Q7Y U;  1W4S A;  1KQ1 A;  2QTX A;  3HSB A;  4M7A E;  4V2S A;  3CCS T;  2KQW A;  2EQM A;  2EJF A;  2L89 A;  4RCB A;  4MML A;  3CCV T;  4XTW A;  2DXC A;  2K4Y A;  1VQN T;  3CXC S;  1Y96 B;  4B9W A;  1VQL T;  2PU9 B;  4EMG A;  3L2Z A;  3E19 A;  4NC6 A;  3EAE A;  3CCJ T;  1R8O B;  4Z02 A;  2IG0 A;  3EFR A;  2PUO B;  5LJ3 e;  4BY6 C;  4JRP A;  2FHD A;  1LNX A;  5LJ3 j;  3HZJ A;  5D6X A;  1Q86 U;  1BYM A;  2MWP A;  4JRQ A;  5LJ5 g;  4L59 A;  4M7D F;  2OTJ A;  3G6E T;  2DXT A;  2E6N A;  2QQ9 A;  4M77 C;  1MGQ A;  5GAO n;  1UEB A;  5I2M A;  5GAN h;  1WNL A;  1KC8 U;  4EMK C;  1RL2 A;  1YJW T;  4MFD A;  3OYG A;  3JAM E;  3CMA T;  3CXC A;  2CZ6 B;  2JTM A;  4XTY A;  2RK1 A;  1WGS A;  3A8H B;  1U1T A;  3GNF B;  4JRI A;  3JCM e;  5HY6 A;  5LJ5 d;  3SB2 A;  3OA6 A;  3OW2 S;  1YJ9 T;  3JB9 H;  4MIM A;  2PVD B;  2R5A A;  3OYB A;  3CME A;  4E7I A;  4M7D A;  3GOX A;  2XDB A;  3H8Z A;  3ASK A;  1LOJ A;  3UT1 A;  4MDX A;  1JRI A;  1Q82 C;  2ZCF B;  1YIT A;  2VXE A;  1G3Y A;  2XIC A;  3P8H A;  4IUP A;  4WF2 A;  3G4S A;  3C94 A;  3I56 T;  1ZHI A;  1YIJ T;  2DTI A;  5FRN A;  2JN0 A;  3JB9 G;  5I2S A;  5GAM h;  2KSS A;  3TW6 A;  4M78 F;  4MFE A;  1I4K 1;  5FU6 B;  1YI2 T;  3QUI A;  2BUD A;  2ZPH B;  4QQD A;  2RJC A;  3E9F A;  1UGQ B;  4MZP A;  1KQS S;  4HCC A;  4XTZ A;  2ZPG B;  3MP6 A;  3OW2 A;  2RJE A;  4FT2 A;  5GAN 7;  2QEX T;  1Q81 C;  1KQ2 A;  2E1H A;  3Q1J A;  3JB9 D;  4N0A A;  4OVA A;  1YBY A;  5D6W A;  5GMK i;  4M7A A;  5C0M A;  3L2R A;  2WJ9 A;  2WAC A;  1M1K C;  2MF2 A;  4O6J A;  3A8O B;  2RI2 A;  5LJ5 e;  2MMP A;  1VQK A;  5LJ5 j;  4AI6 A;  3VYG A;  4XU2 A;  1O9S A;  2XHC A;  1YCY A;  2QQB A;  4Q5W A;  3OYN A;  4J7F A;  3OYL A;  2K3X A;  4JS4 A;  3HHT B;  2RJF A;  5GAN 2;  4IKF A;  1Y71 A;  3PNW C;  3VYH B;  3X24 B;  1NPR A;  5DLQ E;  1XOV A;  2E41 A;  3NFC A;  4MMK A;  3OB9 A;  4M78 C;  3RIR A;  3TW7 A;  3CBO A;  3I55 T;  2LCC A;  4JDS A;  4IUR A;  1M9S A;  1VQO T;  4PJO F;  3JSC A;  5J3B A;  3JCM V;  3G71 A;  3L2U A;  3SWN C;  4C8Q F;  1VQ4 T;  3ZBD A;  1ZBX A;  5GAN f;  1B34 A;  2X4W A;  2RD1 A;  4O5V A;  2HD0 A;  4DA4 A;  2DO3 A;  4ZTF A;  3A5Z B;  4DQ2 A;  3BFM A;  1MHN A;  4N4G A;  2QQS A;  3V7S A;  1Y07 A;  4C0Z A;  3P8B B;  2XDD A;  1FXX A;  4RG2 A;  5CAI A;  3LGL A;  3FC3 A;  1YJN A;  5LJ3 h;  3HRT A;  5FU7 B;  3KBG A;  2XG8 D;  3HFN A;  3VV0 A;  5LL6 S;  3SFM A;  3A8M B;  4XK8 E;  4M7A B;  1ZQ1 A;  4R56 A;  1Y96 A;  3SD4 A;  3UWN A;  5CK9 A;  3FJP A;  3CCV A;  1U1S A;  1XTD A;  1OZ2 A;  4C0D C;  4C92 B;  5KH6 A;  2QA4 T;  4BDZ A;  1VQL A;  4M75 B;  2QQR A;  3CCJ A;  3WVE B;  2I2L A;  3CBM A;  2MAM A;  1Y7X A;  3H6Z A;  2JVV A;  5A0L A;  1PSF A;  4BBS M;  3DB3 A;  1G5V A;  2DZC A;  2Y90 A;  4XTX A;  4EDU A;  4ATO A;  1QW1 A;  3A8G B;  2P0Q A;  3RMS A;  3ZFJ A;  3JCM h;  4CRI A;  3G6E A;  3QYB A;  4PJO C;  2CKK A;  5CKH A;  1NZ9 A;  4C8Q C;  3TU4 K;  1K73 U;  3CC2 T;  3QO3 A;  3HO8 A;  3M4Y A;  1TH7 A;  5FRO A;  2RHU A;  2F5K A;  3MHX A;  3MEV A;  2HQE A;  1N9R A;  2E65 A;  2KMT A;  3F70 A;  4JX6 A;  2VGM A;  2DIG A;  3RER A;  5DY9 A;  1B34 B;  3CMA A;  1YHQ T;  2HAX A;  1FKM A;  2VGN A;  4JX5 A;  3OYK A;  2V8K A;  3QKJ A;  3MCA B;  3V8L A;  3GF5 A;  3V8K A;  3BDU A;  1YJ9 A;  4C92 D;  1H64 1;  3CBP A;  3JCM W;  5GAO r;  2RM4 A;  4M75 D;  3OYD A;  2K2V A;  4BD3 A;  2ZPB B;  4E7K A;  4ZGE B;  1IZ6 A;  3CC7 T;  2LVM A;  4C92 E;  3GPL A;  2RHI A;  4LDY A;  5IT9 E;  1WJQ A;  2L3R A;  4M75 E;  4OF1 A;  5CCA A;  1PSE A;  3I56 A;  3M53 A;  5CQX A;  4N4H A;  4A4K A;  3CCU A;  1VQP A;  1YIJ A;  4A4F A;  2FB7 A;  2XK0 A;  4C5G A;  3CCE T;  2O01 E;  1VQ7 T;  3VJP A;  4BI3 A;  2Y4X A;  4LD6 A;  3HRS A;  3CPF A;  4CI0 C;  4QSH A;  1NPP A;  2KAF A;  4EMH A;  1N9S A;  3M56 A;  2X4X A;  2EIF A;  1BI0 A;  2BKD N;  3BW1 A;  3OMC A;  3OYY A;  4AKG A;  2QDY B;  2L5Q A;  3QJ6 A;  1VQM T;  2XI9 A;  5GMK m;  3QYE A;  4OB2 B;  1M1F A;  1QVG S;  2E70 A;  3OYM A;  1KHC A;  5LJ3 f;  2DTO A;  2F69 A;  4ZN1 A;  4E7L A;  4BI8 B;  2YRV A;  2DEQ A;  2K5F A;  1Q7Y C;  2EQJ A;  2ZPI B;  4PNO A;  4XU1 A;  4RG8 A;  2FVU A;  2O4X A;  3M55 A;  4A53 A;  4F7U G;  1X01 A;  2Y4Y A;  1M1G A;  4MZM A;  3BDL A;  2ZPF B;  2YHT A;  3LWH A;  4KUD K;  2DPP B;  5AYF A;  2LT4 A;  3X20 B;  3OSS C;  5EG2 A;  5J39 A;  3CEY A;  1OI1 A;  3M54 A;  4KUI A;  1SSF A;  2GCX A;  2XU8 A;  3FB9 A;  4Y28 E;  4A4G A;  5GAO p;  3CPW S;  3S3M A;  1M90 U;  4HKE A;  3CD6 A;  4PKC C;  2GF7 A;  3OYE A;  3CCR T;  3OSV A;  4C92 F;  5GAN g;  4HNV A;  2LDM A;  4PJO G;  3JCM f;  3I55 A;  2EWN A;  1Q86 C;  4MDW A;  4M75 F;  2QXF A;  5GAN 3;  3FLG A;  3MP8 A;  4B9X A;  5GMK e;  1VQO A;  1S72 T;  1QVG A;  5IAY A;  5GMK j;  1VQ4 A;  2C06 A;  4M7D C;  2R58 A;  5GAN 6;  1I5L A;  2DTH A;  2DD4 A;  1M5Q 1;  3E9G A;  1K8A U;  1KC8 C;  3RKY A;  3OS1 A;  1NJI U;  2D0Q B;  2FYK A;  3HB9 A;  2EKO A;  4C5E A;  1M4Z A;  1QVP A;  5GAN d;  3RMQ A;  3FEO A;  2DVE A;  2G77 A;  3QHS A;  5A0D A;  3CPW A;  5CKE A;  4C92 A;  2DK3 A;  2YLC A;  4M75 A;  5GAM g;  3UPU A;  1KD1 U;  3CCL A;  4FM4 B;  2K3Y A;  2K57 A;  3X28 B;  3QJY A;  1VQ5 A;  5FU7 C;  2O4X B;  4N0A C;  5CIU A;  4LOC A;  4EMK B;  3CCM A;  5A2Q E;  4M7A C;  3QBY A;  1DJ7 B;  4L6V 5;  2VXF A;  1KHI A;  4OP0 A;  5GAO q;  2HQX A;  3N5B B;  3LGF A;  3LW5 E;  4YTL A;  1N8R U;  1KQS A;  3LLR A;  4JUV A;  3BY7 A;  2OTL A;  1LJO A;  2V8J A;  4IUV A;  2LTO A;  3OS2 A;  5LJ5 f;  2XDP A;  1UGP B;  3HP9 A;  4C0F A;  3DKM A;  3CC2 A;  4M77 G;  4HNT A;  5GAM d;  1WJS A;  4HA8 A;  3PTA A;  2EYQ A;  2QDJ A;  3MET A;  2LCL A;  5GAO m;  1E7P A;  2A7Y A;  3H4C A;  4KT0 E;  1VQ6 A;  3JCM P;  3INZ A;  4GLK A;  4XU3 A;  2DD4 B;  4JX4 A;  4OB0 B;  2CS7 A;  2DD5 B;  1FX7 A;  1HXD A;  3JCM X;  4IUU A;  3PIP A;  3LH0 A;  4VUB A;  3CME T;  3J81 E;  1N6A A;  1BI3 A;  4PLI A;  4FIB A;  5HK0 A;  5DM7 R;  2M9U A;  1VQ8 A;  4OMF B;  1G3W A;  2LX9 A;  3M59 A;  1YIT T;  4ZGD B;  5DLO A;  1K9M U;  4UC4 A;  3CCS A;  2BS4 A;  5GAN 5;  1VQN A;  4E47 A;  1BIA A;  4BE2 A;  4HCZ A;  3QYG B;  4L5G A;  3JB9 F;  2KY9 A;  3TRE A;  4XU0 A;  4HT8 A;  3M5A A;  3SDZ A;  1UB4 A;  4PL6 A;  2LT1 A;  2KVQ G;  5CKB A;  4A4H A;  3CCE A;  1OYX A;  1VQ7 A;  2LC4 A;  4JRK A;  4NL3 A;  4M7D G;  3CCQ T;  3QYH B;  2D9T A;  4LDX A;  2EFI A;  1QP2 A;  3JB9 J;  1X75 C;  4X9D A;  1BI1 A;  5HK3 A;  4Z6Y A;  1U8R A;  1VIF A;  2KDS A;  5LJ3 g;  3ZEH A;  5CVI A;  5GAM e;  3J80 E;  4JS5 A;  3AHU A;  5GAM j;  1VQM A;  3HL8 A;  2XKO C;  3LX7 A;  3NTH A;  5A0G A;  3QSU A;  3P8D A;  4LDW A;  2HNI A;  1YJW A;  4IUQ A;  1WJR A;  3RKW A;  5KCH A;  2ZZD A;  4JJN K;  2IVW A;  3S3O A;  1VQK T;  2QQ8 A;  3RUX A;  3HRU A;  3UDC A;  3QZ5 B;  3GP8 A;  2L8D A;  2JUF A;  3OYC A;  3QII A;  2DAQ A;  3M58 A;  1AHJ B;  3QXE B;  3SWN B;  3HBL A;  2MWO A;  4KUL A;  2RH2 A;  1VQ9 T;  1M8V A;  4OGE A;  5GMK l;  3WVD B;  1XNI A;  3JCM c;  3L2Q A;  3JCM g;  4BB7 A;  3S3N A;  4ELZ C;  2JOY A;  3JCM Q;  2X4Y A;  2WSE E;  4Y91 A;  3DLM A;  3RKX A;  2RHZ A;  2VYT A;  3VKI A;  3PIO A;  3J7A F;  3G71 T;  4M78 G;  3KXT A;  3KHI A;  4NL2 A;  2CZ0 B;  3C12 A;  3VUB A;  2BS3 A;  2M16 A;  3CC4 T;  2DXB B;  1S72 A;  2RI5 A;  1YI2 A;  1K73 C;  3ME9 A;  2ZPE B;  2ZGW A;  1JB0 E;  4ELJ A;  4KBM B;  5LJ5 h;  4D6W A;  2VUB A;  2E5Q A;  2OAU A;  3DB4 A;  1VUB A;  4C0D B;  2CYZ B;  2JNG A;  3PMT A;  4QVZ A;  4F7U B;  5KE2 A;  3JCM d;  1YJN T;  3V7R A;  4LD9 K;  4QQG A;  2PVG B;  3MEU A;  5FU6 C;  2QEX A;  2CGH A;  4M78 D;  4C5H A;  2F5T X;  3V8J A;  3VU3 C;  4FL6 A;  2M1H A;  2E64 A;  2RHY A;  3KUF A;  2RK2 A;  5EJC A;  4OB3 B;  2ZZD B;  4M78 E;  3MEA A;  2EJG A;  2P0P A;  2PUK B;  3MEW A;  4M77 A;  4PJO B;  3JRZ A;  3NTI A;  3BG9 A;  2CZ1 B;  4C8Q B;  1Q82 U;  2QFZ A;  2QF7 A;  3TEE A;  3OYF A;  1UGS B;  4EMK A;  3GLX A;  5M9O A;  3OS0 A;  1IRE B;  1QVF S;  1X6O A;  4AKI A;  2LQK A;  4X9C A;  4BUG A;  4NOY A;  4M7A F;  2QI2 A;  1JJ2 S;  4J6W A;  3QZ9 B;  4OB1 B;  2BS2 A;  2VV5 A;  5J26 A;  4A4E A;  2VC8 A;  3PFS A;  3JB9 I;  3OYI A;  1BIB A;  1EIF A;  4XAX B;  4C8Q G;  5GAN 8;  2K5I A;  4BE1 A;  1WPY A;  3L2W A;  3HFO A;  4C0G A;  4J7I A;  1Q81 U;  1RI0 A;  5D6Y A;  2PVO B;  3JCM b;  4RMO A;  4A54 A;  1P92 A;  2DD5 A;  3DL1 A;  1HK9 A;  3MP1 A;  4IUT A;  4F7U E;  3OY9 A;  2GFU A;  2EQK A;  3VUZ A;  1NE8 A;  1M1K U;  3OYJ A;  5CKF A;  1FWZ A;  2E10 A;  2P0K A;  3FRN A;  3OS5 A;  4C5I A;  3JCM J;  1QVF A;  4PJO D;  2DZ9 A;  1QP3 A;  2RI3 A;  3QPH A;  3LYI A;  4BY6 B;  4C8Q D;  2DJZ A;  5CKD A;  1JJ2 A;  4P5N A;  1WQ7 A;  3EFS A;  5GAO l;  2X4J A;  3M4G A;  2DXC B;  2GFA A;  2B8A A;  4BDY A;  3CCU T;  4PJO E;  1VQP T;  4N4I A;  2A3L A;  5FLX E;  4C8Q E;  3OYH A;  2QA4 A;  2JTF A;  4M77 B;  2EQU A;  3BG3 A;  2EJ9 A;  2DKG A;  4DOV A;  2RB6 A;  5KCO A;  3VKG A;  1M90 C;  1H3Z A;  5I21 A;  4EPC A;  2DXU A;  1JBM A;  2YLB A;  2BIV A;  3MO8 A;  4XTV A;  2OTJ T;  3PGG A;  4HCB A;  4JLG A;  3G7Z A;  3L1A A;  4C92 C;  5GAN 4;  3CCQ A;  2DIQ A;  3X26 B;  2FL7 A;  3FIF A;  3OYA A;  2E12 A;  1XQH A;  2PQW A;  4II1 A;  4M75 C;  2AHJ B;  4ELY C;  4QQ6 A;  1K8A C;  3BG5 A;  1KG1 A;  2P4T A;  4HLQ A;  2V8I A;  4MZT A;  1NJI C;  2LQ8 A;  2NLU A;  4LDV A;  3DLL A;  4PLL A;  4M78 A;  1YHQ A;  2EAY A;  4BAC A;  3L42 A;  3FDR A;  1D3B A;  2LNV A;  2KR6 A;  3C4S A;  3GNG A;  3HPW A;  4RKU E;  4F7U F;  3LWI A;  1W2B S;  3OBY A;  3O8V A;  4RCC A;  4HL4 A;  1O75 A;  4XQ3 A;  3SWN A;  5GAN e;  5C6S A;  5CR2 A;  3X25 B;  2H3J A;  4E7H A;  5GAN j;  1KD1 C;  2M0O A;  1I8F A;  4M77 D;  4M7D B;  4HNU A;  1VQ9 A;  3E1S A;  3G4S T;  4ZTJ A;  1BKB A;  4E7J A;  5HKC A;  4J6X A;  3CD6 T;  3CC7 A;  1G3S A;  2R57 A;  4ZN3 A;  3CCL T;  2QQA A;  4M77 E;  2KMG A;  3S6W A;  2RHX A;  2RA2 A;  3QDR B;  3HKS A;  2JZ2 A;  3PMI A;  5CO7 A;  1N8R C;  2DXB A;  1OZ3 A;  1UGR B;  2RO0 A;  3QWL A;  3CC4 A;  4OGC A;  2WSF E;  5FRM A;  5IN1 A;  5L8R E;  2CZ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...