3HHTB

A mutant of the nitrile hydratase from geobacillus pallidus having enhanced thermostability
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLALGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFSKKPDTKIPRREDPALVKLVEKALNDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
publication title The high-resolution structure of a Cobalt containing nitrile hydratase
rcsb
source organism Geobacillus pallidus
total genus 65
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hhtB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hhtB02
3X26B 2DD4B 1JB0E 3A8OB 1IREB 2O01E 2ZPEB 2DXCA 4L6V5 4ZGJB 5L8RE 2DXBA 4ZGDB 2ZPGB 3VYHB 2ZZDB 2CZ1B 2WSEE 2ZCFB 3VYGB 4FM4B 3LW5E 3QZ5B 3QYHB 1AHJB 2D0QB 3QYGB 2CZ6B 4RKUE 3QZ9B 2PVGB 4Y28E 2PU9B 2CZ0B 3WVEB 1PSFA 3QXEB 2DD4A 4OB1B 2QDYB 1GXIE 2ZPHB 4ZGEB 2WSFE 1UGRB 1DJ7B 3X28B 2ZPIB 3X20B 2DD5B 2ZPBB 3HHTB 3A8GB 2DPPB 1V29B 2CYZB 1PSEA 2ZPFB 1QP2A 3X25B 2PVOB 2DXCB 3A8LB 4XK8E 4KT0E 2CZ7B 2DXBB 3A8MB 4OB0B 4OB2B 2WSCE 2ZZDA 4OB3B 1UGQB 2AHJB 2PVDB 3WVDB 3VYGA 2PUKB 3X24B 3A8HB 1UGPB 2PUOB 1UGSB 1QP3A 2DD5A
chains in the Genus database with same CATH superfamily
2DD4B 5LJ5e 2DILA 2DTOA 4F7UG 5J26A 3GPLA 5EC7A 3JAME 4M75E 1VQ6Q 4AKGA 2R5AA 1QVGP 2LDMA 5GAN4 3KXTA 1H25B 1VQ4T 4ZGDB 2CT3A 1OI9B 2DIGA 2DLPA 3RESA 2LW4A 5I2MA 3EFOA 7AT1B 2ZCFB 2BE9B 2FHDA 3POMA 2RHXA 1AEYA 3SHWA 2NLUA 3INZA 2XDPA 5GAMg 4IUUA 4M75G 3CC4T 3UPUA 3CMET 1M90R 1K8AR 5GAN8 5CKDA 5GAMd 5GMKi 2KI7A 1N4MA 2ZPHB 1V76A 2VB6A 4EMHA 3QJ6A 1WA7A 3CEYA 3CXCA 5LJ5h 1TUGB 2RQTA 2FZCB 1D09B 2E1HA 2HEQA 2DRKA 1UGRB 1ZUYA 2KROA 1OGUB 3S6WA 4BY7X 5EG2A 3P8DA 2HAXA 1EIFA 1UTIA 4Y72B 3S3MA 1PSEA 2L3RA 1UB4A 1RI0A 2RJDA 1Q86U 4J9HA 1YHQQ 1X2QA 3QWYA 5GAN6 1VQ5Q 3PIPA 2WHBB 4C8QE 1X6GA 3M57A 1ZA2B 2JM9A 1VQKT 1AD5A 2Y4XA 2V1QA 1KHIA 1JKWA 2YSQA 4JDSA 2X4XA 1YJ9T 2BKZB 1VQMT 4OGCA 1NJIR 2D1XA 4F7JB 2DF6A 2DVJA 2QQRA 3LWHA 4BCGB 3A8HB 3CXCP 4PJLA 3G4ST 2RQRA 2K2MA 1IO6A 3FLGA 1SHGA 3AHUA 2W9ZA 1XOVA 3EJ1B 4YC3B 4C8QG 5GAN2 2VWFA 1VQ9A 2CUDA 4E6RA 3OYIA 2QDLA 3EAEA 4EDUA 4HT9A 1JRIA 4C0DB 2RHIA 1K76A 3REAB 2DZCA 4NL3A 2E5QA 4J7FA 3VS0A 3WXMB 1BU2A 3VV0A 2DL5A 2MK5A 3CC7T 2KRNA 3CD6Q 2WEVB 3BY7A 3G6ET 1YJWT 2DXTA 4N4GA 3P8BB 2PVGB 3EGXA 2EQUA 3HP9A 3VKGA 5GAOl 5CR2A 3JSCA 1KG1A 2KAFA 2K57A 2K3BA 3JCMf 2NUPB 4X9DA 1BCMA 1ZUKA 1M90C 1K8AC 1B34A 3ASKA 1VQNA 2YLBA 1M2VA 2M02A 4J6YA 2E3HA 3OYJA 2VGMA 3G71T 1MMDA 1FX7A 4ZGEB 1QKXA 4J5YA 1HSQA 2EQJA 3P8HA 4AI6A 4V2SA 4MFDA 1M9SA 4CC3A 3X28B 4AFUC 2EJ9A 1JO8A 4RTWA 2H3EB 2F1LA 6AT1B 2KQWA 3VU3C 5I11A 2NUTB 1OIUB 1AWXA 4OMMA 1PC0A 4HLQA 3LLRA 3QG1A 2LP5A 3PE0A 2AZVA 1D0XA 4KRTA 1Q86R 2O31A 4EOKB 1PM3A 4JJDA 4X1VA 1U06A 1ZSZA 2AK5A 4PJOC 2NYSA 2E70A 1X01A 1GCQC 3C95A 1G83A 4O6JA 1JEGA 1OIYB 5D6XA 3PVQA 4OB2B 2RA2A 3SD4A 3DDPB 4L5GA 3OQ5A 4P5NA 1NJIC 1WGSA 3M0TA 4PJMA 1G2BA 4ESRA 1GL5A 2DYIA 4M7AC 2RJFA 3QBYA 2HL3A 4E7SA 2VV5A 3I56A 1YP5A 1YCSB 1C1AA 4EOMB 3MP1A 2QQSA 3H41A 4PFOA 1WZOA 3OW2P 5CQXA 4QKUA 1SEMA 1UEBA 5L8RE 4PJOD 2AKLA 2JUFA 5J3BA 4ZN3A 1B3QA 4TVRA 4KGXB 5GAOr 2HKQB 2QQ9A 3OA6A 3OYCA 3QPHA 1HYOA 2L3SA 1QLYA 1QVFS 2Y4YA 3LW5E 4KRDB 1M2OA 3CMEQ 1RAHB 1AWWA 4M7AD 2LZ6B 1VQ9Q 3QHSA 3E1SA 2KYMA 4XTZA 3RDVA 5GAN5 1K73U 1KC8U 3CCUA 4HNTA 2GBQA 4JX6A 1UDLA 1W4SA 4IURA 4M7DA 3OBYA 2J7IA 3V8JA 1YIJA 1JOWA 3GOXA 3GP8A 1UNGD 3QO3A 2CP5A 3JCMg 1FXXA 5KE2A 4A4FA 1QW1A 4B6MA 4F7SB 4JS5A 3JCMd 3C4SA 1UJ0A 1H1SB 1D0ZA 4ATOA 3OYGA 5A0GA 3F70A 5CAIA 5CKFA 5HBJB 1WHGA 1W2BA 1Q86C 1BI2A 1TUDA 2DERA 4AMCA 5I2SA 4M78C 1YJ9Q 4N4IA 2DXBB 4HVUA 4IIOA 3S3OA 3MP8A 3TCJA 4XU0A 3BDLA 3M0SA 2V22B 1TS9A 3QDRB 1H1QB 4KRCB 2DBMA 3H9NA 3Q1JA 2M51A 3F5XB 4RTVA 1M4ZA 1U8RA 2PVDB 3V8LA 4BY1X 3G4SQ 4ELYC 4XTVA 1TUCA 4BACA 4BI8B 1UG1A 4JJCA 3G33B 3OYAA 1QCFA 1RI9A 3CPWS 2OTJQ 2GFAA 4R55A 2QDJA 4E7ZA 3JCMe 4CI0C 3R6OA 2RB6A 4L6V5 1KQSA 2CDTA 4C92A 4PFPA 3KFVA 3RBBB 4GLKA 4YOZA 1F5QB 4M78D 1BBZA 1W2BP 1H26B 2CKKA 2GQIA 1YJWQ 3HRTA 4M7AB 1RAFB 2I40B 4M77A 2HBWA 1FMWA 1C0MA 2DMEA 1Y7XA 3UT1A 2YWWA 4BCJB 3CBPA 4MMKA 1QVPA 2E41A 2QGSA 3FEOA 2PQWA 1SF9A 4KGZB 3J80E 4BE2A 1K1ZA 2X3XD 4BCMD 1K73R 1KC8R 3JCMb 4C0GA 3T9NA 3H0IA 2RQWA 2KEAA 3M5AA 1VYVA 4JPBW 4C8QB 1BCOA 2KYBA 3CMAA 3EHRA 3IQLA 3CCQA 4JJNK 3JCMh 1O9SA 3PNWC 4YOOA 4FL6A 2DPPB 2MPXC 2DEQA 2KE9A 3RNJA 4IUPA 2KNBB 1OKWB 1E9HB 2RI2A 1ZX6A 2LCLA 4BCHB 2LNHB 2LQ8A 3UWNA 2DO3A 4J6WA 1G3NC 3M9QA 5LMKB 3MPUB 4OB0B 1YIJQ 5KYXA 1VQ8A 3CCVA 3UA7A 1JSTB 3EIDB 3GF5A 2DL8A 2EYWA 4KBMB 4DBRA 1UJYA 1D1CA 1SSFA 2P4TA 4GLMA 3CCSA 2CCIB 4EORB 1UGSB 1XNIA 2W10A 4N0AC 5LJ3j 1WQ7A 1N9RA 1Q95G 1MNEA 3HFNA 1QQJA 1NE8A 4F16A 4FYYB 3CCRA 3M4GA 1VQ6A 2D9TA 2DJQA 2LQWA 4M78B 1MV0B 2ZPEB 2MWPA 2YDLA 3EG1A 4EOOB 3L2QA 5GANj 5FLXE 2OAUA 3TW6A 4OGEA 4ZN1A 3V7RA 3DDQB 2ENMA 2PNIA 4ELLA 4FT4A 1NEGA 1PRLC 1MMAA 1M1KU 1ZP2A 2QI2A 3TN8B 2EIFA 2KMGA 4BCOB 2O88A 4A53A 2FZKB 4XU3A 1NPPA 4CC4B 4PL6A 5KYYA 1YI2T 1H641 4OP0A 2G77A 3LYIA 1JQQA 4RTXA 3L2WA 4BCMB 3EGDA 1IZ6A 4FW1A 1RADB 1OZ3A 1G3SA 1LNXA 2O4XB 3V7SA 5D7UA 5CVIA 1D1BA 2XD0A 4PJOF 2MCNA 1JBMA 3J7AF 3EG9B 4JX5A 1I81A 1OYXA 3VS4A 2DTHA 4OGRB 5IN1A 3L2ZA 4L59A 4JZ3A 2EWNA 2GQVA 2F2VA 2M0OA 3CCEQ 3MEAA 2QA4T 5AT1B 3JCMc 3EHQA 2QEXT 1S72Q 4A4KA 4HT8A 4NC6A 1V29B 3M0QA 4C92F 1YHQA 1BK2A 1VQ5A 4MFEA 4M7AF 2QASA 4LXCA 4EMKA 5GANg 1U3OA 1H27B 4RTTA 2JS2A 4A54A 3TW7A 2EQIA 2M0YA 1AD6A 3PTAA 5GANd 4KT0E 4YOSA 4QVZA 4F04B 1ZLMA 4RTUA 2WMAB 2JMCA 4BE0A 3HO8A 4JX4A 3DOGB 3CMAQ 2ZZDA 3J81E 1OKVB 1RACB 1Q7YU 2AHJB 2BIVA 2KXCA 2MYSA 1M3CA 2VYTA 2PHGA 2L5QA 1ZBXA 2RJCA 4RG2A 3EG3A 3X24B 1UUEA 2JTMA 5CKHA 1QVGA 3OY9A 1WDXA 2LTOA 2BS3A 2PK2A 5GAMj 1GFCA 1TD6A 1NG2A 2BPMB 2HZYA 2F5TX 1IREB 2VGNA 4O5VA 2RF0A 2ROLA 1OZ2A 2DTIA 2COWA 4LDWA 2JOYA 1BKBA 2IVXA 4I3ZB 1TU0B 4FIBA 1SPKA 2Y90A 5LJ3e 4LOCA 2EYXA 3S3NA 3OYLA 2K5FA 1PKTA 4A4EA 1Y57A 2FPEA 4XTXA 4LN2A 2UZLB 2K6DA 1M1KR 4OMPA 5GANe 1YITT 1U5SA 5FWBA 4Y91A 3OS5A 1I1JA 4PNOA 3ZBDA 1YWPA 3QZ9B 2FYKA 1FMKA 4Z02A 4EOIB 3CCRQ 2DD4A 4OB1B 1AWOA 2COZA 4E7HA 4QQGA 3PO3S 3BLRB 4EOJB 1QKWA 4M78F 4Z6YA 1OOTA 2P0PA 3QUIA 2W0ZA 3JB9F 3V8KA 1B7TA 1FINB 3EFOB 5EJCA 5LJ3h 2KT8A 4PJOE 1PCXA 1E7OA 5DQWA 1Z9ZA 4M6VA 2CYZB 1VQOT 1IRXA 5GAOq 3CCMQ 3ER0A 1RAAB 1IHWA 1EX4A 1IGQA 5GANh 5KCOA 3REBB 2PJQA 4BY6B 1M27C 2VXEA 3L2RA 2CZ7B 2DL3A 3D7SB 3OYKA 4DOVA 1ZSZC 4M7AE 3MKDA 4IIMA 3CCLQ 3QWXX 2JT4A 5HK3A 4PJOG 4BD3A 4OB3B 3QHRB 1ENWA 1Q7YR 5FGKB 2EAYA 3VYGA 2PUKB 3JCMV 3BG9A 1H24B 4M4ZA 2J6OA 2PZ1A 2KR6A 3UDCA 1PKDB 1TFBA 1X6BA 4RCBA 1VQ4A 4M7AG 3HRUA 1YCYA 1KD1U 4F6SB 1BI1A 4BCIB 4ZGJB 3M0UA 5GAMe 3BLQB 3TNWB 3L1AA 4D8KA 4IUTA 4D8DA 4RMOA 1MNDA 3BFMA 3E2UA 1K4US 3FJPA 3M0PA 5FU7C 4JS4A 1U1TA 1QMZB 3CMEA 2LT1A 1M1KC 1VQNT 1AZGB 2X35A 3QZ5B 2A3LA 3NTHA 5HQ0B 2W96A 2HKNA 2OI3A 5GAN3 2HSEB 4WTOB 1K9AA 1JXMA 3C94A 4ROCA 2X4WA 1JU5C 4MDWA 1BI3A 3VS5A 5IHNA 3CCJT 1OL1B 2D6FA 1WX6A 3NPFA 5KH6A 2F2CA 1KHCA 3RKYA 5CKEA 5GAOn 2I53A 2QA4Q 4M7DC 3DTOA 4QQDA 1WXUA 2QEXQ 1QWEA 1TG0A 1RABB 5I22A 4HVVA 5GAMh 3CC2T 1Y96B 4M78E 1QVFP 2FG0A 2R5MA 2FRWA 1VQKA 3MIAB 4RTZA 2GGRA 2OJ2A 2OTLT 4DBQA 1YJNQ 1YJ9A 2DXCB 1JJ2S 1H1RB 2RN8A 4LDYA 4F17A 2P0KA 2NUPA 4MIMA 1SKUB 1M2VB 4BXXX 4HKEA 1BIAA 2E6ZA 1WQWA 5IAYA 2JTFA 3G4SA 4QQ6A 3SB2A 2UZEB 2UZDB 3RKWA 4ROEA 4J9CA 3VS3A 5FWCA 4M78G 3OW2A 3CPWA 1GY3B 1OQKA 1Q7YC 2IIMA 5KCHA 4M7DD 1CSKA 4EMGA 1J3TA 2OTJA 4G6LB 1H3HA 4LDUA 2COYA 5HK0A 4M75C 2KRMA 2WIHB 5KYUA 2YRDA 4KUDK 2BUDA 1WIEA 2A36A 3X26B 2E4HA 4E47A 2ABLA 3C12A 1KD1R 1XO2A 1M8MA 4A4GA 1VQLQ 4BDYA 2CH4A 1GCPA 3QIIA 3G6EA 3I35A 3RGFB 1YJWA 4C92C 3DB4A 4OMLA 4AFSC 4KH0B 3UA6A 5FRNA 2DAQA 2XMFA 5ICPB 3QYGB 4C5GA 1KK7A 1GFDA 2RM4A 4RKUE 2LNVA 1P5EB 5CKBA 4M77C 1AOJA 3CPWP 2DK3A 4RCCA 1X75C 1VQ4Q 1LCKA 1VQ7T 1PSFA 4HVWA 3RERA 4AKHA 5CK9A 4ORZA 1Y71A 1SG5A 2BE7D 1VYTA 2EKOA 2RPNA 1RAEB 2HD0A 3RIRA 2EGEA 1R0CB 1GUXA 1W1FA 5FU7B 3TQ7P 1G3YA 3V7CA 2LC4A 3CC4Q 5I5ZB 2CP0A 3X20B 4C92D 1VIFA 4E7LA 3HHTB 3BHTB 2K3XA 2K79A 1NLPC 2V8IA 2C6TB 3I55T 3CBOA 1RAGB 4M77D 1H4LD 1I8FA 2JJ9A 5DY9A 3FB9A 4FYWB 3A8MB 1JSUB 2XIDA 3JRZA 3NMZC 3HKSA 4C5HA 4FT2A 4BB7A 4EONB 4F7UA 1AT1B 3EG0A 2LRQA 4TTHA 2L89A 2IN3A 3VUZA 1S1NA 2C5XB 2BZYA 4Z8AA 5D6YA 4CFVB 2FPFA 5C6SA 2K9GA 1VQKQ 4CFUD 2EQKA 3GLXA 1VQMQ 2G6FX 1TTHB 2GTOA 5IT9E 3M58A 3OYYA 2O01E 1UNLD 5IXFA 1X27A 3O8VA 2M1HA 1KD1C 4JRIA 3I5SA 2CP6A 2DXBA 1FYNA 3NFCA 3NGPA 2LX7A 4M75A 3DLMA 1BYMA 4IKFA 2B9RA 2DA9A 1I07A 2CZ1B 2BTTA 1WHHA 2RHYA 5HNBB 1MHNA 2VUBA 3OBWA 1UNHD 3VS7A 2W9FA 2DEUA 5GAOp 2CZ6B 4PJOB 2L2PA 2EYQA 3PMIA 4A4HA 2XHCA 2HQHA 1ACMB 1VQPT 2QGGA 3G7ZA 4B9XA 5CIUA 1OEBA 1PWTA 3CCQT 3BW1A 4KUIA 4PFZA 3SEMA 2D0NA 3QXEB 1D3BA 2EVRA 3CCJQ 3CC7Q 2DFUA 3M55A 4C92B 3CCEA 3JB9D 3HFOA 2LJ0A 3G6EQ 3N5BB 1S72A 3FDRA 2WPAB 3PT9A 1EFNA 3A5ZB 4WCIA 1G8XA 2CP2A 2HCKA 2DD5B 1K9MU 4FW2A 4LUEA 3TU4K 2WJ9A 1RAIB 3OMCA 3VJPA 4C5EA 3ME9A 4XU2A 5HCKA 2OTLQ 3CBMA 1KJWA 1D0YA 1IB8A 1PKSA 1T0JA 2YHTA 3G71Q 3PVLA 1FVVB 4EIKA 2C0IA 4EMKC 5IH2A 3TNHB 1QCOA 1UE9A 4J83A 3CCST 2DETA 2IW8B 1PD1A 4J8OA 1HXDA 1PG5B 2MOXA 3H4CA 2XDBA 1T3LA 2ECZA 1X69A 4C8QA 1FKMA 3E19A 3L2UA 1OX9A 3DLLA 2DYBA 4HCCA 1VOLA 4BDZA 4EOSB 4CFUB 2EKHA 4DEXA 3MEWA 2ATCB 3ULRB 4FSSA 3DJBA 3QDFA 5LQFB 2IVWA 2RI3A 4OMQA 5FROA 3HB9A 3A8OB 2DRMA 4C0ZA 5LJ5f 2KBTA 4Z88A 1OPLA 2A37A 1WHJA 1OU8A 3EOCB 4VUBA 3BG3A 4CFWB 3JCMX 1ZSGA 1G3WA 3OB9A 3R6NA 2A08A 3ZFJA 1G3TA 1B07A 1G5VA 3EG2A 4M7DF 4ZNXA 4BI4A 4ELZC 2KDSA 1T0HA 4OR5B 3QYHB 1NYGA 1QMCA 5IHIA 3JCMJ 3PMTA 2L3PA 2EFIA 5A0LA 3I9QA 3QYBA 4D6WA 5C0MA 1ABQA 4F7UF 4N4HA 3M0RA 3OYEA 1O9KB 3RMSA 4DBHA 4NS5A 4OMOA 1MUZA 3O5ZA 3DL1A 4AFZC 1MMGA 3MP6A 1DJ7B 4OVAA 3OSSC 4XTWA 4HNUA 5CEIB 3O0GD 1K9MR 3CCMA 4CFXB 1EZZB 9ATCB 3I55Q 2FPDA 2EYZA 1QP2A 4BE1A 1TWBA 4M75F 2WXVB 3EGDB 1D3UB 3I5RA 3PGGA 1K73C 3M56A 1KC8C 2LJ1A 3MJXA 3CCLA 2O4XA 4J6XA 5GMKm 3VKIA 5A0DA 4JJBA 5CCAA 1UGQB 1WNLA 2RK2A 4AG2C 1UFFA 3PFSA 2VXFA 3OYFA 1W70A 1N8RU 2LCSA 4F14A 5HKCA 3MY5B 5ACBA 5KYWA 2OX7A 3GNGA 3CD6T 2FZGB 3SWNA 4MMLA 1Y0MA 1WJRA 1ABOA 4E7KA 3OYNA 4EMKB 4QSHA 2YRCA 4M77F 5IF1B 4F7NB 2XG8D 3EFRA 3OS0A 2FRYA 3UF4A 1H28B 4JZ4A 2BZ8A 2CGHA 2YRVA 5DQVA 1YI2A 1OU9A 5CO7A 4BBRM 2CREA 3BDUA 1OULA 2LQKA 4DEYA 2ZZDB 2F69A 2JN0A 5IHYA 1X2KA 4DQ2A 5HBHB 2EYYA 4AKIA 2ROTA 1VINA 2LVMA 3MCAB 2XI9A 1AHJB 2FEIA 1XTDA 2W99A 1E6GA 4J9GA 4DA4A 3JCMW 4M7DE 1UHCA 2RH2A 5GAN7 3OYMA 3QSUA 1KSWA 2YLCA 2AZSA 4ZTFA 4JUVA 4EOQB 1PNJA 2QA4A 3BHVB 2I0NA 1E6HA 2QEXA 3E9FA 3A1PA 2RQVA 1Q81U 3ZL7C 4C0DC 1OL2B 2QQAA 2DL7A 2ZPIB 4F70B 3H0FA 2XK0A 1N9SA 5L2WB 3JV3A 2HDAA 4M7DG 1M3BA 2ED1A 3HZJA 5KYNA 1YJNA 1K9MC 5IDNB 2DBKA 3KUFA 3CQTA 2GTJA 1W98B 2K5LA 4J7IA 4CRLB 3NDQA 2KSSA 2O2OA 3VUBA 2QF7A 2J06A 2A28A 4R0KA 2LT4A 1NBEB 4FYXB 5GMKj 2KRSA 4BI3A 2XDDA 3LGLA 2HNIA 1KXUA 2PK9B 1URCB 4LE9A 1JXOA 1C6VX 2DMOA 2M16A 3OS2A 2CUBA 4J9IA 1M1FA 2KY9A 1KFZA 3H8ZA 2EQMA 3HPWA 1I0CA 2FL7A 1NM7A 1VOMA 5FU6C 1N8RR 1BB9A 4PK4A 1W6XA 3FJ5A 1KIKA 2V1RA 1IXDA 1QWFA 1M3AA 2XU8A 2YUNA 4C92E 3MHXA 1VQLA 2DXUA 2X4YA 2G9XB 1A0NB 1JJ2P 2PMIB 2XKOC 2QTXA 3JB9J 2V8JA 2K7AA 1YITA 1HK9A 3OYDA 2DM1A 1MMNA 1VQ9T 4F6UB 1Z9QA 4RG8A 4XAXB 1HD3A 4M77E 2P84A 4Q5WA 1NLOC 3BHUB 3RMQA 4EC9B 4HCKA 3VYGB 4JLGA 1MV3A 4C92G 1IHVA 2KVQG 2QYZA 2DZ9A 4NSTB 4XQ3A 3LGFA 3WVEB 2CP7A 2JZ2A 2OAWA 1YWOA 1QVFA 2P4RA 2EGAA 2IG0A 3EH1A 4M77G 2MAMA 4KULA 1H8KA 4HL4A 1NPRA 3CC4A 1YI2Q 4HCBA 1VQOA 1WHMA 4QVCA 1Q81R 2K5IA 1UHFA 1X43A 2XICA 4X9CA 4BCND 4ZTJA 2ZAEA 1GRIA 2CP3A 4BCQD 5IHKA 2AKKA 1VYUA 4ME7A 4HNVA 2MI6A 3META 1WJSA 1QVGS 2HQEA 2OTJT 1BU1A 2QTVA 4EOPB 8AT1B 5GMKe 2K4YA 1VYWB 3QWLA 2J05A 4PKCC 4PLLA 3M54A 1V1CA 3TVTA 2G3RA 3TREA 1R0BG 3VKHA 3EGXB 1OI1A 5HBEB 1Y07A 2C0OA 1VQMA 4E7IA 2M9UA 2C0TA 1N8RC 2GCXA 1Y96A 8ATCB 3L2VA 3E9GA 1RLQC 2RMOA 3EGUA 1B34B 1JB0E 1QLBA 2WIPB 1BI0A 2MMPA 2YUOA 2O9VA 4DOWA 2DXCA 4FCYA 2BS2A 2JXBA 3M59A 2YUQA 3I56T 5HY6A 1NEBA 2ZPGB 3JB9G 2R57A 4RODA 1YFNA 4II5B 5FU6B 2WSEE 2NUTA 2DL4A 4BCPB 3ZEHA 3H0HA 2F2XA 1OPKA 2WACA 5GMKh 3OYHA 4GY5A 5KYUB 2E3IA 3CCJA 1ZSZB 2NUZA 3CC7A 1YNZA 2LQNA 5J39A 4E7JA 2P0QA 1X6OA 1YITQ 4JLIA 1Q82U 2J6FA 4NOYA 3FRNA 3CC2A 3TSWA 4EC8B 4CC7A 1NYFA 2PTKA 3CCUT 1I4K1 4A63B 3M53A 3PIOA 4BCNB 3CXCS 4LDXA 2AIRB 1Q81C 1YIJT 4PJJA 2OTLA 4FSXA 4BCQB 2IW6B 4AG1C 4M75D 3G71A 1ARKA 1M8VA 3HTRA 2DE0X 5GMKl 2LX9A 2JM8A 2PVOB 3HL8A 3A8LB 4J9EA 1SSHA 4IUVA 2X9HA 3BE3A 3MEVA 5KE3A 2LCCA 4WF2A 1P92A 2VKNA 3K7AM 5LL6S 3RKXA 2V8KA 1VQOQ 1HJDA 3OS1A 1GUXB 1AWJA 3UATA 2KGTA 1YN8A 2QGFB 5GJWB 2QXFA 3FIFA 3GBQA 4C8QC 1WHLA 2PUOB 2HSPA 1D1AA 3HRSA 1XJWB 4IUQA 1WYXA 1AISB 2CT4A 3U23A 3A98A 4F6WB 2EPDA 2DVEA 2D8HA 1GBRA 1N6AA 2X4JA 3AT1B 4M7DB 1WFWA 4EOLB 2UUEB 4JRQA 2O9SA 1BIBA 2E12A 5I21A 1PHTA 1I5OB 3VYHB 2RJEA 1KQ1A 2RQUA 3CPFA 3SFMA 2L8DA 2CSIA 2C5VB 2L0AA 4J9FA 4F7UB 2FB7A 1VQ7A 2EJGA 2HL5C 4CC2A 1LPLA 2DX1A 4OMNA 2A0FB 4CFNB 1GBQA 4C8QD 2JVVA 4Y28E 3CCET 4F7LB 1N5ZA 1VIEA 5D6WA 1S72T 4AFQC 3GIBA 1CKBA 3JCMP 4YTLA 2QDYB 4PJNA 2DNUA 4BBSM 2CJMB 4FU6A 4J9DA 1IGUA 4C0FA 2YXYA 1VQNQ 1Q82R 2K3YA 2UZBB 1ZQ1A 2EBPA 2J6KA 3QJYA 4M75B 2ESWA 3I55A 3VRZA 3OMGA 3MO8A 3A8GB 1AVZC 1SHFA 3CMAT 2X3WD 2KXDA 3LX7A 3NTIA 2Z0WA 1LJOA 2AT1B 5M9OA 2LMJA 3NHNA 2F5KA 2E5KA 4LDVA 4PJOA 2E10A 2BS4A 1GCQA 4JRPA 2V26A 3OW2S 5DLQE 2L3QA 3NTKA 4OF1A 1D3BB 4IMYB 1NZ9A 2C06A 4K11A 3TSZA 3CC2Q 2CSQA 4BCFB 3C0CA 2QQBA 4M7AA 3WVDB 4LUDA 4M77B 1XQHA 4B9WA 1VQ8T 3CCVT 1ZHIA 2VC8A 4GBQA 1QP3A 2DD5A 4Y92A 1WLPB 1TH7A 2HBPA 1YBYA 3VS2A 2EGCA 2F2WA 2MF2A 3LH0A 2X51A 3SWNC 4BCKB 1R8OB 3I56Q 4CRIA 2B8AA 1RUWA 1R77A 1WHKA 2KMTA 2H8HA 3CCRT 3RR6A 1OV3A 1VQ6T 2CS7A 5LJ3f 1MGQA 2FO0A 3LWIA 3URGA 2DIQA 1VQPA 2JS0A 3JB9H 4HXJA 4CFMB 4FM4B 5CYIB 3JCMQ 2C5NB 3GTMS 5IXBA 1LOJA 5GANf 4ANJA 1KQSP 1U1SA 2EJFA 4J9BA 3M03A 4Z89A 2PU9B 2RI5A 1E7PA 4ELJA 3EH2A 4HA8A 3BLHB 2YT6A 5A2QE 3HSBA 4QT7A 2IW9B 5KYXB 1T3SA 1F1BB 3QKJA 3CCMT 2BKDN 5GAOm 1OX8A 3CCUQ 1I5LA 2RK1A 4UC4A 3QYEA 2C4GB 5BNJB 1Q82C 5L23A 1AZEA 2EW3A 1FMVA 1ZUUA 4BUGA 4MZMA 3LH5A 2ZGWA 3OSVA 2ZPBB 1VQ7Q 3CCLT 2ED0A 1QCNA 2H3JA 4RTYA 4AT1B 3HBLA 2NWMA 2MWOA 4UN0A 1PD0A 4NL2A 4M78A 4OMFB 2X1NB 3M4YA 3RUXA 2IPOB 1YHQT 3GNFB 1M1GA 2KT1A 1VQ5T 2RD1A 1O9KA 4C5IA 1VA7A 4FX3B 1ZA1B 1W2BS 5EFQB 1VUBA 3THKA 5ECAA 1WPYA 3MEUA 1TSFA 5CQYA 5KYYB 4LD6A 5LJ5j 1O75A 1SRLA 2JNGA 2E6NA 1UGPB 3TNIB 4MZTA 4XTYA 2JTEA 1H92A 2JW4A 2R7GA 5GJVB 1ZBJA 2VASA 2A7YA 2LJ3A 2GF7A 2R58A 5HVYB 3EG9A 2GFUA 1H3ZA 1WJQA 4QW2A 1RLPC 4DBFA 3VRYA 3VS1A 2C5OB 2SEMA 4BY6C 5GAMf 2DKGA 1KQSS 1FWZA 3FC3A 5FW9A 2HQXA 4XU1A 5DLOA 5AYFA 2YUPA 5IDPB 4QVDA 1TXQA 2QAZA 2CCHB 2CH4W 2D0QB 5LJ3g 2KK4A 2KR3A 4FYVB 5KYWB 2QFZA 2CZ0B 1M90U 1K8AU 1M30A 1C9BA 5LJ3d 1H1PB 2WMBB 3SWNB 3VS6A 3B57A 4EPCA 2QQ8A 4II1A 5DM7R 3EFSA 1GXIE 2VVKA 1K0XA 3DKMA 1GH6B 5LJ5g 2W2HA 2JGZB 2GNCA 2RNAA 3TEEA 1TOVA 4XTUA 3SDZA 1YJNT 3MI9B 2WSFE 3KBGA 5LJ5d 1N27A 2B86A 2QG9B 2SRCA 4E2FB 1VQPQ 2K2VA 2RHZA 4KGVB 4KH1B 3CCQQ 2JMAA 2D8JA 3H6ZA 2BZXA 2HMAA 2E64A 4C8QF 4MDXA 1LVKA 2ZPFB 1PRMC 1WXBA 4HCZA 3X25B 3DB3A 3OYBA 2RHUA 5FRMA 2I2LA 2WFYB 3QHWB 1UECA 4XK8E 4CXAB 1RL2A 3G1JA 2QK0A 2E65A 3LQ5B 2RO0A 4LD9K 1M5Q1 4PLIA 3JB9I 4F7UE 3L42A 2FVUA 1NJIU 4LNPA 3KHIA 2WSCE 1SRMA 2MIOA 4R56A 3BG5A 1CKAA 1WXTA 1JJ2A 1KQ2A 1VQ8Q 3CCVQ 3CD6A 1VQLT 1WI7A 4N0AA 2DJZA 4MZPA 2EUFA 4RUGA 4X34A 1K0SA 3MY1B 1UGVA 4JRKA 3CCSQ
chains in the Genus database with same CATH topology
3HFNA 3L2VA 3E9GA 1NE8A 2DD4B 5LJ5e 3CCRA 1B34B 1JB0E 1QLBA 2DTOA 1BI0A 2EQKA 2MMPA 2D9TA 3GLXA 3M4GA 4F7UG 1VQ6A 5IT9E 3M58A 3OYYA 2O01E 5J26A 1N9RA 4M78B 3GPLA 4DOWA 2ZPEB 2DXCA 2MWPA 2BS2A 4M75E 3JAME 3O8VA 3L2QA 5GANj 2M1HA 5FLXE 2OAUA 3M59A 1KD1C 4AKGA 2R5AA 4JRIA 3TW6A 4OGEA 2LDMA 3I56T 4ZN1A 5GAN4 3KXTA 3V7RA 5HY6A 1VQ4T 2DXBA 4ZGDB 2ZPGB 3NFCA 4M75A 1BYMA 3DLMA 2DIGA 4FT4A 3RESA 2R57A 3JB9G 4IKFA 1M1KU 5I2MA 2QI2A 2EIFA 2KMGA 4A53A 4XU3A 5FU6B 2CZ1B 1NPPA 2WSEE 2ZCFB 2FHDA 4PL6A 2RHXA 2RHYA 1MHNA 2VUBA 3OBWA 1YI2T 3ZEHA 2NLUA 1H641 4OP0A 2G77A 3LYIA 5GAOp 3INZA 2CZ6B 4PJOB 2XDPA 5GAMg 2WACA 2EYQA 3PMIA 5GMKh 4A4HA 4IUUA 2XHCA 3OYHA 4M75G 3L2WA 3CC4T 3UPUA 1VQPT 4GY5A 1IZ6A 3G7ZA 4B9XA 5CIUA 3CMET 3CCJA 1OZ3A 3CCQT 3BW1A 4KUIA 5GAN8 3CC7A 1G3SA 5CKDA 3QXEB 1LNXA 2O4XB 5GMKi 3V7SA 1D3BA 5GAMd 5J39A 4E7JA 2ZPHB 2P0QA 4EMHA 5CVIA 1X6OA 3QJ6A 3CEYA 3CXCA 2XD0A 4JLIA 4PJOF 1JBMA 3J7AF 3M55A 1Q82U 4C92B 3CCEA 4NOYA 3JB9D 4JX5A 1I81A 3FRNA 3HFOA 5LJ5h 3CC2A 1OYXA 2DTHA 2E1HA 5IN1A 3L2ZA 3N5BB 4L59A 1I4K1 3FDRA 2EWNA 3M53A 2GQVA 1UGRB 3PT9A 3PIOA 3CCUT 2M0OA 3A5ZB 3MEAA 3S6WA 3CXCS 2QA4T 5EG2A 4LDXA 3P8DA 3JCMc 1Q81C 1YIJT 2DD5B 1K9MU 2HAXA 2QEXT 2OTLA 1EIFA 4FSXA 4A4KA 2WJ9A 3TU4K 4HT8A 4NC6A 1V29B 3OMCA 3VJPA 3S3MA 4C5EA 4M75D 3ME9A 4XU2A 1PSEA 4C92F 3G71A 1YHQA 2L3RA 1M8VA 1VQ5A 1UB4A 3CBMA 4MFEA 4M7AF 1RI0A 2RJDA 5GANg 4EMKA 2YHTA 5GMKl 1Q86U 2LX9A 4M7DA 2PVOB 3HL8A 4A54A 3TW7A 3A8LB 5GAN6 3PIPA 4IUVA 4EMKC 3PTAA 5GANd 4KT0E 3MEVA 5KE3A 4QVZA 4J83A 4C8QE 3M57A 3CCST 2LCCA 1VQKT 4WF2A 4BE0A 4J8OA 3HO8A 4JX4A 1HXDA 2Y4XA 1KHIA 1P92A 4JDSA 3H4CA 2X4XA 5LL6S 1YJ9T 3RKXA 1VQMT 2XDBA 2V8KA 2ZZDA 4OGCA 3J81E 1Q7YU 4C8QA 3OS1A 2AHJB 2BIVA 1FKMA 3E19A 3L2UA 4HCCA 2L5QA 2VYTA 3DLLA 2RJCA 1ZBXA 2QXFA 4BDZA 2QQRA 3FIFA 4RG2A 3X24B 2JTMA 3A8HB 5CKHA 4C8QC 3LWHA 1QVGA 3OY9A 3G4ST 2PUOB 2LTOA 3MEWA 2BS3A 3HRSA 3FLGA 4IUQA 3AHUA 1XOVA 2IVWA 5GAMj 2RI3A 2DVEA 4C8QG 5FROA 5GAN2 1VQ9A 1N6AA 2F5TX 3HB9A 3A8OB 1IREB 1M90C 2VGNA 4O5VA 3OYIA 2X4JA 1OZ2A 2DTIA 4C0ZA 5LJ5f 4M7DB 3EAEA 4EDUA 4HT9A 4LDWA 1JRIA 2JOYA 1BKBA 2RHIA 4FIBA 4C0DB 4JRQA 3S3NA 2Y90A 5LJ3e 4LOCA 3OYLA 1BIBA 2E12A 5I21A 2DZCA 2K5FA 4VUBA 3BG3A 3VYHB 2RJEA 1KQ1A 4A4EA 3JCMX 3CPFA 2E5QA 4J7FA 4XTXA 1G3WA 3OB9A 3SFMA 2L8DA 3WXMB 3ZFJA 3VV0A 1G3TA 1G5VA 3CC7T 3BY7A 5GANe 1YITT 4M7DF 4F7UB 4BI4A 4Y91A 2FB7A 4ELZC 1VQ7A 2KDSA 2EJGA 3G6ET 3QYHB 3OS5A 3JCMJ 1YJWT 2DXTA 4PNOA 3PMTA 4N4GA 3ZBDA 3P8BB 4C8QD 3QZ9B 2EFIA 2FYKA 2JVVA 2M9UA 2PVGB 2EQUA 4Y28E 3CCET 3HP9A 4Z02A 3VKGA 5A0LA 5GAOl 5CR2A 1VIEA 3QYBA 3JSCA 5D6WA 4D6WA 1KG1A 2KAFA 1S72T 5C0MA 2K57A 3GIBA 3JCMf 2DD4A 4X9DA 4OB1B 4N4HA 4YTLA 4F7UF 3OYEA 1B34A 3JCMP 2QDYB 3ASKA 2YLBA 3RMSA 1K8AC 4BBSM 4NS5A 4E7HA 4J6YA 1VQNA 4FU6A 4QQGA 4C0FA 4NL3A 3OYJA 3DL1A 2VGMA 3G71T 1FX7A 4ZGEB 2K3YA 4M78F 4J5YA 4Z6YA 2EQJA 2P0PA 3P8HA 4AI6A 1ZQ1A 3QUIA 4V2SA 4MFDA 3QJYA 3MP6A 1M9SA 1DJ7B 4M75B 3X28B 4OVAA 3OSSC 3V8KA 3I55A 2EJ9A 4XTWA 4HNUA 5EJCA 5LJ3h 3OMGA 3MO8A 4PJOE 3A8GB 3CCMA 2KQWA 3VU3C 3CMAT 4M6VA 2CYZB 3LX7A 3NTIA 1VQOT 4HLQA 3LLRA 3QG1A 1LJOA 5M9OA 5GAOq 2F5KA 3ER0A 4LDVA 1QP2A 4PJOA 4BE1A 4M75F 2E10A 2BS4A 5GANh 4JRPA 3OW2S 5KCOA 3PGGA 1K73C 1KC8C 3M56A 5DLQE 4PJOC 4BY6B 3CCLA 3NTKA 2VXEA 1D3BB 2O4XA 4OF1A 2E70A 1NZ9A 1X01A 3L2RA 2CZ7B 3C95A 2C06A 4O6JA 3OYKA 4DOVA 4J6XA 5GMKm 3VKIA 4M7AE 5A0DA 5D6XA 4OB2B 2RA2A 3SD4A 5HK3A 5CCAA 4PJOG 4BD3A 4OB3B 4L5GA 1UGQB 1WNLA 3OQ5A 2RK2A 2QQBA 4P5NA 1WGSA 2EAYA 3WVDB 1NJIC 3VYGA 3PFSA 4M7AA 4M77B 2PUKB 1XQHA 3JCMV 4B9WA 2VXFA 3OYFA 3CCVT 3BG9A 1VQ8T 1N8RU 1ZHIA 2VC8A 4M7AC 1QP3A 2DD5A 5HKCA 2KR6A 1TH7A 2RJFA 3UDCA 2HBPA 1YBYA 3GNGA 3QBYA 3CD6T 2VV5A 3SWNA 4MMLA 2MF2A 3I56A 1WJRA 4RCBA 4E7KA 3OYNA 1VQ4A 3LH0A 4QSHA 3MP1A 2QQSA 4EMKB 4M7AG 4M77F 3HRUA 1YCYA 1KD1U 3SWNC 1R8OB 1BI1A 5CQXA 2XG8D 3EFRA 4CRIA 2B8AA 3OS0A 4ZGJB 1UEBA 5L8RE 5GAMe 3L1AA 4PJOD 2KMTA 3CCRT 2CGHA 2JUFA 4IUTA 5J3BA 2YRVA 1VQ6T 1YI2A 5CO7A 4ZN3A 4RMOA 2CS7A 4TVRA 3BFMA 5LJ3f 5GAOr 3FJPA 4BBRM 3BDUA 2QQ9A 1MGQA 2LQKA 3LWIA 2ZZDB 3OA6A 2F69A 3QPHA 3URGA 3OYCA 2JN0A 5FU7C 4DQ2A 1U1TA 4JS4A 2DIQA 1VQPA 3JB9H 4AKIA 3CMEA 1M1KC 2LT1A 1QVFS 2Y4YA 4FM4B 2LVMA 3LW5E 2X35A 3JCMQ 1VQNT 3QZ5B 3MCAB 2XI9A 1AHJB 5GANf 1LOJA 2A3LA 1XTDA 1U1SA 2EJFA 3NTHA 2PU9B 2RI5A 4DA4A 1E7PA 4M7AD 4ELJA 4HA8A 3JCMW 4M7DE 2RH2A 3JB9F 5GAN3 3QHSA 5GAN7 3E1SA 3OYMA 3QSUA 4XTZA 5GAN5 5A2QE 1K73U 1KC8U 3CCUA 2YLCA 3C94A 4HNTA 4ZTFA 3HSBA 4JUVA 3QKJA 4JX6A 2QA4A 3CCMT 1W4SA 2BKDN 2X4WA 4IURA 3OBYA 3V8JA 5GAOm 4MDWA 1BI3A 3CCJT 1YIJA 3GOXA 3GP8A 2QEXA 2D6FA 3QO3A 1I5LA 5KH6A 2RK1A 1KHCA 3QYEA 4UC4A 3RKYA 3E9FA 5CKEA 5GAOn 3JCMg 1FXXA 4M7DC 5KE2A 1Q82C 4QQDA 4A4FA 1Q81U 4C0DC 2QQAA 4BUGA 1QW1A 2ZPIB 4MZMA 2XK0A 1N9SA 2ZGWA 3OSVA 4JS5A 2ZPBB 3JCMd 3C4SA 3CCLT 5GAMh 3CC2T 4M7DG 4ATOA 1Y96B 3HZJA 4M78E 1YJNA 3OYGA 2H3JA 1K9MC 2R5MA 3KUFA 5A0GA 3F70A 4J7IA 2K5LA 5CAIA 3HBLA 5CKFA 2KSSA 1VQKA 3VUBA 2MWOA 2QF7A 2OTLT 4NL2A 2LT4A 4M78A 2DXCB 5GMKj 4BI3A 2XDDA 1YJ9A 1W2BA 1JJ2S 3LGLA 1Q86C 4LDYA 2HNIA 4OMFB 3M4YA 2P0KA 1BI2A 3RUXA 1YHQT 3GNFB 1M1GA 1VQ5T 5I2SA 4MIMA 4M78C 4N4IA 2RD1A 2DXBB 4C5IA 2M16A 3OS2A 4HKEA 3S3OA 1BIAA 3MP8A 2E6ZA 1M1FA 1WQWA 5IAYA 2JTFA 2KY9A 4XU0A 4QQ6A 3SB2A 3TCJA 3G4SA 1VUBA 3BDLA 1W2BS 3RKWA 3H8ZA 3QDRB 3Q1JA 1WPYA 3MEUA 1M4ZA 4M78G 1U8RA 2PVDB 5CQYA 3V8LA 2EQMA 3OW2A 4LD6A 5LJ5j 3CPWA 1O75A 4ELYC 1Q7YC 4M7DD 2JNGA 3HPWA 4XTVA 5KCHA 2E6NA 1UGPB 4EMGA 2FL7A 5FU6C 4MZTA 4XTYA 4BACA 2OTJA 4BI8B 4LDUA 3OYAA 5HK0A 4M75C 4KUDK 3CPWS 2BUDA 2GFAA 3X26B 4R55A 2QDJA 2XU8A 2A7YA 4C92E 3MHXA 4E47A 1VQLA 2DXUA 3C12A 2X4YA 3JCMe 4CI0C 2GF7A 3R6OA 2R58A 2RB6A 4L6V5 2XKOC 1KQSA 2QTXA 4A4GA 3JB9J 2GFUA 2V8JA 4BDYA 4C92A 1YITA 1H3ZA 1WJQA 1HK9A 4QW2A 3OYDA 4GLKA 1VQ9T 4RG8A 4XAXB 3QIIA 3G6EA 4M78D 1YJWA 4C92C 4BY6C 3DB4A 4M77E 5GAMf 2DKGA 2CKKA 4Q5WA 1KQSS 1FWZA 3FC3A 2HQXA 4XU1A 5DLOA 5AYFA 3RMQA 3HRTA 4M7AB 5FRNA 2DAQA 3VYGB 4QVDA 4JLGA 4C92G 4M77A 1Y7XA 3UT1A 2D0QB 3QYGB 4C5GA 2KK4A 2KVQG 5LJ3g 2RM4A 4RKUE 2LNVA 3CBPA 4MMKA 1QVPA 2DZ9A 2E41A 2QFZA 4M77C 2CZ0B 5CKBA 4XQ3A 1M90U 3LGFA 3FEOA 2PQWA 1K8AU 3WVEB 2DK3A 4RCCA 1X75C 5LJ3d 3SWNB 2JZ2A 1PSFA 3J80E 1VQ7T 4BE2A 3RERA 4AKHA 4EPCA 2QQ8A 4II1A 5CK9A 3EFSA 5DM7R 1S72A 1QVFA 1GXIE 2IG0A 1Y71A 4M77G 2MAMA 4C0GA 4KULA 3JCMb 2EKOA 3T9NA 3DKMA 2HD0A 3RIRA 5LJ5g 4HL4A 3M5AA 3TEEA 1NPRA 4C8QB 4XTUA 3SDZA 1YJNT 3CC4A 3CMAA 2WSFE 3KBGA 4HCBA 4JJNK 5FU7B 3CCQA 1VQOA 4QVCA 1G3YA 3V7CA 5LJ5d 3JCMh 1N27A 2LC4A 3X20B 2K2VA 1O9SA 2K5IA 1VIFA 2RHZA 3PNWC 4C92D 4FL6A 4E7LA 3HHTB 2DPPB 2XICA 4X9CA 3H6ZA 2K3XA 2E64A 4C8QF 2DEQA 2V8IA 4ZTJA 4MDXA 4IUPA 2ZPFB 3I55T 4HCZA 2RI2A 3X25B 3DB3A 3OYBA 2RHUA 5FRMA 2I2LA 4ME7A 2LCLA 3CBOA 4XK8E 2LQ8A 3UWNA 4HNVA 2DO3A 4J6WA 1RL2A 4M77D 2E65A 2MI6A 3META 1I8FA 1WJSA 1QVGS 5DY9A 2RO0A 3M9QA 4LD9K 2HQEA 3FB9A 1M5Q1 3A8MB 4PLIA 3JB9I 2OTJT 4F7UE 1VQMA 2XIDA 4OB0B 3JRZA 3L42A 2FVUA 3HKSA 4C5HA 4FT2A 3CCVA 1VQ8A 1NJIU 3KHIA 2WSCE 4R56A 4BB7A 5GMKe 2K4YA 3BG5A 3GF5A 3QWLA 4PKCC 4PLLA 1JJ2A 4F7UA 1KQ2A 3CD6A 1VQLT 2LRQA 3M54A 4KBMB 2G3RA 4N0AA 3TREA 2DJZA 2L89A 1SSFA 2P4TA 4MZPA 3CCSA 3VUZA 3VKHA 4X34A 1UGSB 1OI1A 1XNIA 5D6YA 1Y07A 4JRKA 4N0AC 5LJ3j 5C6SA 4E7IA 1WQ7A 1N8RC 2GCXA 1Y96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X26 B;  2DD4 B;  1JB0 E;  3A8O B;  1IRE B;  2O01 E;  2ZPE B;  2DXC A;  4L6V 5;  4ZGJ B;  5L8R E;  2DXB A;  4ZGD B;  2ZPG B;  3VYH B;  2ZZD B;  2CZ1 B;  2WSE E;  2ZCF B;  3VYG B;  4FM4 B;  3LW5 E;  3QZ5 B;  3QYH B;  1AHJ B;  2D0Q B;  3QYG B;  2CZ6 B;  4RKU E;  3QZ9 B;  2PVG B;  4Y28 E;  2PU9 B;  2CZ0 B;  3WVE B;  1PSF A;  3QXE B;  2DD4 A;  4OB1 B;  2QDY B;  1GXI E;  2ZPH B;  4ZGE B;  2WSF E;  1UGR B;  1DJ7 B;  3X28 B;  2ZPI B;  3X20 B;  2DD5 B;  2ZPB B;  3HHT B;  3A8G B;  2DPP B;  1V29 B;  2CYZ B;  1PSE A;  2ZPF B;  1QP2 A;  3X25 B;  2PVO B;  2DXC B;  3A8L B;  4XK8 E;  4KT0 E;  2CZ7 B;  2DXB B;  3A8M B;  4OB0 B;  4OB2 B;  2WSC E;  2ZZD A;  4OB3 B;  1UGQ B;  2AHJ B;  2PVD B;  3WVD B;  3VYG A;  2PUK B;  3X24 B;  3A8H B;  1UGP B;  2PUO B;  1UGS B;  1QP3 A;  2DD5 A; 
#chains in the Genus database with same CATH topology
 2DD4 B;  5LJ5 e;  2DIL A;  2DTO A;  4F7U G;  5J26 A;  3GPL A;  5EC7 A;  3JAM E;  4M75 E;  1VQ6 Q;  4AKG A;  2R5A A;  1QVG P;  2LDM A;  5GAN 4;  3KXT A;  1H25 B;  1VQ4 T;  4ZGD B;  2CT3 A;  1OI9 B;  2DIG A;  2DLP A;  3RES A;  2LW4 A;  5I2M A;  3EFO A;  7AT1 B;  2ZCF B;  2BE9 B;  2FHD A;  3POM A;  2RHX A;  1AEY A;  3SHW A;  2NLU A;  3INZ A;  2XDP A;  5GAM g;  4IUU A;  4M75 G;  3CC4 T;  3UPU A;  3CME T;  1M90 R;  1K8A R;  5GAN 8;  5CKD A;  5GAM d;  5GMK i;  2KI7 A;  1N4M A;  2ZPH B;  1V76 A;  2VB6 A;  4EMH A;  3QJ6 A;  1WA7 A;  3CEY A;  3CXC A;  5LJ5 h;  1TUG B;  2RQT A;  2FZC B;  1D09 B;  2E1H A;  2HEQ A;  2DRK A;  1UGR B;  1ZUY A;  2KRO A;  1OGU B;  3S6W A;  4BY7 X;  5EG2 A;  3P8D A;  2HAX A;  1EIF A;  1UTI A;  4Y72 B;  3S3M A;  1PSE A;  2L3R A;  1UB4 A;  1RI0 A;  2RJD A;  1Q86 U;  4J9H A;  1YHQ Q;  1X2Q A;  3QWY A;  5GAN 6;  1VQ5 Q;  3PIP A;  2WHB B;  4C8Q E;  1X6G A;  3M57 A;  1ZA2 B;  2JM9 A;  1VQK T;  1AD5 A;  2Y4X A;  2V1Q A;  1KHI A;  1JKW A;  2YSQ A;  4JDS A;  2X4X A;  1YJ9 T;  2BKZ B;  1VQM T;  4OGC A;  1NJI R;  2D1X A;  4F7J B;  2DF6 A;  2DVJ A;  2QQR A;  3LWH A;  4BCG B;  3A8H B;  3CXC P;  4PJL A;  3G4S T;  2RQR A;  2K2M A;  1IO6 A;  3FLG A;  1SHG A;  3AHU A;  2W9Z A;  1XOV A;  3EJ1 B;  4YC3 B;  4C8Q G;  5GAN 2;  2VWF A;  1VQ9 A;  2CUD A;  4E6R A;  3OYI A;  2QDL A;  3EAE A;  4EDU A;  4HT9 A;  1JRI A;  4C0D B;  2RHI A;  1K76 A;  3REA B;  2DZC A;  4NL3 A;  2E5Q A;  4J7F A;  3VS0 A;  3WXM B;  1BU2 A;  3VV0 A;  2DL5 A;  2MK5 A;  3CC7 T;  2KRN A;  3CD6 Q;  2WEV B;  3BY7 A;  3G6E T;  1YJW T;  2DXT A;  4N4G A;  3P8B B;  2PVG B;  3EGX A;  2EQU A;  3HP9 A;  3VKG A;  5GAO l;  5CR2 A;  3JSC A;  1KG1 A;  2KAF A;  2K57 A;  2K3B A;  3JCM f;  2NUP B;  4X9D A;  1BCM A;  1ZUK A;  1M90 C;  1K8A C;  1B34 A;  3ASK A;  1VQN A;  2YLB A;  1M2V A;  2M02 A;  4J6Y A;  2E3H A;  3OYJ A;  2VGM A;  3G71 T;  1MMD A;  1FX7 A;  4ZGE B;  1QKX A;  4J5Y A;  1HSQ A;  2EQJ A;  3P8H A;  4AI6 A;  4V2S A;  4MFD A;  1M9S A;  4CC3 A;  3X28 B;  4AFU C;  2EJ9 A;  1JO8 A;  4RTW A;  2H3E B;  2F1L A;  6AT1 B;  2KQW A;  3VU3 C;  5I11 A;  2NUT B;  1OIU B;  1AWX A;  4OMM A;  1PC0 A;  4HLQ A;  3LLR A;  3QG1 A;  2LP5 A;  3PE0 A;  2AZV A;  1D0X A;  4KRT A;  1Q86 R;  2O31 A;  4EOK B;  1PM3 A;  4JJD A;  4X1V A;  1U06 A;  1ZSZ A;  2AK5 A;  4PJO C;  2NYS A;  2E70 A;  1X01 A;  1GCQ C;  3C95 A;  1G83 A;  4O6J A;  1JEG A;  1OIY B;  5D6X A;  3PVQ A;  4OB2 B;  2RA2 A;  3SD4 A;  3DDP B;  4L5G A;  3OQ5 A;  4P5N A;  1NJI C;  1WGS A;  3M0T A;  4PJM A;  1G2B A;  4ESR A;  1GL5 A;  2DYI A;  4M7A C;  2RJF A;  3QBY A;  2HL3 A;  4E7S A;  2VV5 A;  3I56 A;  1YP5 A;  1YCS B;  1C1A A;  4EOM B;  3MP1 A;  2QQS A;  3H41 A;  4PFO A;  1WZO A;  3OW2 P;  5CQX A;  4QKU A;  1SEM A;  1UEB A;  5L8R E;  4PJO D;  2AKL A;  2JUF A;  5J3B A;  4ZN3 A;  1B3Q A;  4TVR A;  4KGX B;  5GAO r;  2HKQ B;  2QQ9 A;  3OA6 A;  3OYC A;  3QPH A;  1HYO A;  2L3S A;  1QLY A;  1QVF S;  2Y4Y A;  3LW5 E;  4KRD B;  1M2O A;  3CME Q;  1RAH B;  1AWW A;  4M7A D;  2LZ6 B;  1VQ9 Q;  3QHS A;  3E1S A;  2KYM A;  4XTZ A;  3RDV A;  5GAN 5;  1K73 U;  1KC8 U;  3CCU A;  4HNT A;  2GBQ A;  4JX6 A;  1UDL A;  1W4S A;  4IUR A;  4M7D A;  3OBY A;  2J7I A;  3V8J A;  1YIJ A;  1JOW A;  3GOX A;  3GP8 A;  1UNG D;  3QO3 A;  2CP5 A;  3JCM g;  1FXX A;  5KE2 A;  4A4F A;  1QW1 A;  4B6M A;  4F7S B;  4JS5 A;  3JCM d;  3C4S A;  1UJ0 A;  1H1S B;  1D0Z A;  4ATO A;  3OYG A;  5A0G A;  3F70 A;  5CAI A;  5CKF A;  5HBJ B;  1WHG A;  1W2B A;  1Q86 C;  1BI2 A;  1TUD A;  2DER A;  4AMC A;  5I2S A;  4M78 C;  1YJ9 Q;  4N4I A;  2DXB B;  4HVU A;  4IIO A;  3S3O A;  3MP8 A;  3TCJ A;  4XU0 A;  3BDL A;  3M0S A;  2V22 B;  1TS9 A;  3QDR B;  1H1Q B;  4KRC B;  2DBM A;  3H9N A;  3Q1J A;  2M51 A;  3F5X B;  4RTV A;  1M4Z A;  1U8R A;  2PVD B;  3V8L A;  4BY1 X;  3G4S Q;  4ELY C;  4XTV A;  1TUC A;  4BAC A;  4BI8 B;  1UG1 A;  4JJC A;  3G33 B;  3OYA A;  1QCF A;  1RI9 A;  3CPW S;  2OTJ Q;  2GFA A;  4R55 A;  2QDJ A;  4E7Z A;  3JCM e;  4CI0 C;  3R6O A;  2RB6 A;  4L6V 5;  1KQS A;  2CDT A;  4C92 A;  4PFP A;  3KFV A;  3RBB B;  4GLK A;  4YOZ A;  1F5Q B;  4M78 D;  1BBZ A;  1W2B P;  1H26 B;  2CKK A;  2GQI A;  1YJW Q;  3HRT A;  4M7A B;  1RAF B;  2I40 B;  4M77 A;  2HBW A;  1FMW A;  1C0M A;  2DME A;  1Y7X A;  3UT1 A;  2YWW A;  4BCJ B;  3CBP A;  4MMK A;  1QVP A;  2E41 A;  2QGS A;  3FEO A;  2PQW A;  1SF9 A;  4KGZ B;  3J80 E;  4BE2 A;  1K1Z A;  2X3X D;  4BCM D;  1K73 R;  1KC8 R;  3JCM b;  4C0G A;  3T9N A;  3H0I A;  2RQW A;  2KEA A;  3M5A A;  1VYV A;  4JPB W;  4C8Q B;  1BCO A;  2KYB A;  3CMA A;  3EHR A;  3IQL A;  3CCQ A;  4JJN K;  3JCM h;  1O9S A;  3PNW C;  4YOO A;  4FL6 A;  2DPP B;  2MPX C;  2DEQ A;  2KE9 A;  3RNJ A;  4IUP A;  2KNB B;  1OKW B;  1E9H B;  2RI2 A;  1ZX6 A;  2LCL A;  4BCH B;  2LNH B;  2LQ8 A;  3UWN A;  2DO3 A;  4J6W A;  1G3N C;  3M9Q A;  5LMK B;  3MPU B;  4OB0 B;  1YIJ Q;  5KYX A;  1VQ8 A;  3CCV A;  3UA7 A;  1JST B;  3EID B;  3GF5 A;  2DL8 A;  2EYW A;  4KBM B;  4DBR A;  1UJY A;  1D1C A;  1SSF A;  2P4T A;  4GLM A;  3CCS A;  2CCI B;  4EOR B;  1UGS B;  1XNI A;  2W10 A;  4N0A C;  5LJ3 j;  1WQ7 A;  1N9R A;  1Q95 G;  1MNE A;  3HFN A;  1QQJ A;  1NE8 A;  4F16 A;  4FYY B;  3CCR A;  3M4G A;  1VQ6 A;  2D9T A;  2DJQ A;  2LQW A;  4M78 B;  1MV0 B;  2ZPE B;  2MWP A;  2YDL A;  3EG1 A;  4EOO B;  3L2Q A;  5GAN j;  5FLX E;  2OAU A;  3TW6 A;  4OGE A;  4ZN1 A;  3V7R A;  3DDQ B;  2ENM A;  2PNI A;  4ELL A;  4FT4 A;  1NEG A;  1PRL C;  1MMA A;  1M1K U;  1ZP2 A;  2QI2 A;  3TN8 B;  2EIF A;  2KMG A;  4BCO B;  2O88 A;  4A53 A;  2FZK B;  4XU3 A;  1NPP A;  4CC4 B;  4PL6 A;  5KYY A;  1YI2 T;  1H64 1;  4OP0 A;  2G77 A;  3LYI A;  1JQQ A;  4RTX A;  3L2W A;  4BCM B;  3EGD A;  1IZ6 A;  4FW1 A;  1RAD B;  1OZ3 A;  1G3S A;  1LNX A;  2O4X B;  3V7S A;  5D7U A;  5CVI A;  1D1B A;  2XD0 A;  4PJO F;  2MCN A;  1JBM A;  3J7A F;  3EG9 B;  4JX5 A;  1I81 A;  1OYX A;  3VS4 A;  2DTH A;  4OGR B;  5IN1 A;  3L2Z A;  4L59 A;  4JZ3 A;  2EWN A;  2GQV A;  2F2V A;  2M0O A;  3CCE Q;  3MEA A;  2QA4 T;  5AT1 B;  3JCM c;  3EHQ A;  2QEX T;  1S72 Q;  4A4K A;  4HT8 A;  4NC6 A;  1V29 B;  3M0Q A;  4C92 F;  1YHQ A;  1BK2 A;  1VQ5 A;  4MFE A;  4M7A F;  2QAS A;  4LXC A;  4EMK A;  5GAN g;  1U3O A;  1H27 B;  4RTT A;  2JS2 A;  4A54 A;  3TW7 A;  2EQI A;  2M0Y A;  1AD6 A;  3PTA A;  5GAN d;  4KT0 E;  4YOS A;  4QVZ A;  4F04 B;  1ZLM A;  4RTU A;  2WMA B;  2JMC A;  4BE0 A;  3HO8 A;  4JX4 A;  3DOG B;  3CMA Q;  2ZZD A;  3J81 E;  1OKV B;  1RAC B;  1Q7Y U;  2AHJ B;  2BIV A;  2KXC A;  2MYS A;  1M3C A;  2VYT A;  2PHG A;  2L5Q A;  1ZBX A;  2RJC A;  4RG2 A;  3EG3 A;  3X24 B;  1UUE A;  2JTM A;  5CKH A;  1QVG A;  3OY9 A;  1WDX A;  2LTO A;  2BS3 A;  2PK2 A;  5GAM j;  1GFC A;  1TD6 A;  1NG2 A;  2BPM B;  2HZY A;  2F5T X;  1IRE B;  2VGN A;  4O5V A;  2RF0 A;  2ROL A;  1OZ2 A;  2DTI A;  2COW A;  4LDW A;  2JOY A;  1BKB A;  2IVX A;  4I3Z B;  1TU0 B;  4FIB A;  1SPK A;  2Y90 A;  5LJ3 e;  4LOC A;  2EYX A;  3S3N A;  3OYL A;  2K5F A;  1PKT A;  4A4E A;  1Y57 A;  2FPE A;  4XTX A;  4LN2 A;  2UZL B;  2K6D A;  1M1K R;  4OMP A;  5GAN e;  1YIT T;  1U5S A;  5FWB A;  4Y91 A;  3OS5 A;  1I1J A;  4PNO A;  3ZBD A;  1YWP A;  3QZ9 B;  2FYK A;  1FMK A;  4Z02 A;  4EOI B;  3CCR Q;  2DD4 A;  4OB1 B;  1AWO A;  2COZ A;  4E7H A;  4QQG A;  3PO3 S;  3BLR B;  4EOJ B;  1QKW A;  4M78 F;  4Z6Y A;  1OOT A;  2P0P A;  3QUI A;  2W0Z A;  3JB9 F;  3V8K A;  1B7T A;  1FIN B;  3EFO B;  5EJC A;  5LJ3 h;  2KT8 A;  4PJO E;  1PCX A;  1E7O A;  5DQW A;  1Z9Z A;  4M6V A;  2CYZ B;  1VQO T;  1IRX A;  5GAO q;  3CCM Q;  3ER0 A;  1RAA B;  1IHW A;  1EX4 A;  1IGQ A;  5GAN h;  5KCO A;  3REB B;  2PJQ A;  4BY6 B;  1M27 C;  2VXE A;  3L2R A;  2CZ7 B;  2DL3 A;  3D7S B;  3OYK A;  4DOV A;  1ZSZ C;  4M7A E;  3MKD A;  4IIM A;  3CCL Q;  3QWX X;  2JT4 A;  5HK3 A;  4PJO G;  4BD3 A;  4OB3 B;  3QHR B;  1ENW A;  1Q7Y R;  5FGK B;  2EAY A;  3VYG A;  2PUK B;  3JCM V;  3BG9 A;  1H24 B;  4M4Z A;  2J6O A;  2PZ1 A;  2KR6 A;  3UDC A;  1PKD B;  1TFB A;  1X6B A;  4RCB A;  1VQ4 A;  4M7A G;  3HRU A;  1YCY A;  1KD1 U;  4F6S B;  1BI1 A;  4BCI B;  4ZGJ B;  3M0U A;  5GAM e;  3BLQ B;  3TNW B;  3L1A A;  4D8K A;  4IUT A;  4D8D A;  4RMO A;  1MND A;  3BFM A;  3E2U A;  1K4U S;  3FJP A;  3M0P A;  5FU7 C;  4JS4 A;  1U1T A;  1QMZ B;  3CME A;  2LT1 A;  1M1K C;  1VQN T;  1AZG B;  2X35 A;  3QZ5 B;  2A3L A;  3NTH A;  5HQ0 B;  2W96 A;  2HKN A;  2OI3 A;  5GAN 3;  2HSE B;  4WTO B;  1K9A A;  1JXM A;  3C94 A;  4ROC A;  2X4W A;  1JU5 C;  4MDW A;  1BI3 A;  3VS5 A;  5IHN A;  3CCJ T;  1OL1 B;  2D6F A;  1WX6 A;  3NPF A;  5KH6 A;  2F2C A;  1KHC A;  3RKY A;  5CKE A;  5GAO n;  2I53 A;  2QA4 Q;  4M7D C;  3DTO A;  4QQD A;  1WXU A;  2QEX Q;  1QWE A;  1TG0 A;  1RAB B;  5I22 A;  4HVV A;  5GAM h;  3CC2 T;  1Y96 B;  4M78 E;  1QVF P;  2FG0 A;  2R5M A;  2FRW A;  1VQK A;  3MIA B;  4RTZ A;  2GGR A;  2OJ2 A;  2OTL T;  4DBQ A;  1YJN Q;  1YJ9 A;  2DXC B;  1JJ2 S;  1H1R B;  2RN8 A;  4LDY A;  4F17 A;  2P0K A;  2NUP A;  4MIM A;  1SKU B;  1M2V B;  4BXX X;  4HKE A;  1BIA A;  2E6Z A;  1WQW A;  5IAY A;  2JTF A;  3G4S A;  4QQ6 A;  3SB2 A;  2UZE B;  2UZD B;  3RKW A;  4ROE A;  4J9C A;  3VS3 A;  5FWC A;  4M78 G;  3OW2 A;  3CPW A;  1GY3 B;  1OQK A;  1Q7Y C;  2IIM A;  5KCH A;  4M7D D;  1CSK A;  4EMG A;  1J3T A;  2OTJ A;  4G6L B;  1H3H A;  4LDU A;  2COY A;  5HK0 A;  4M75 C;  2KRM A;  2WIH B;  5KYU A;  2YRD A;  4KUD K;  2BUD A;  1WIE A;  2A36 A;  3X26 B;  2E4H A;  4E47 A;  2ABL A;  3C12 A;  1KD1 R;  1XO2 A;  1M8M A;  4A4G A;  1VQL Q;  4BDY A;  2CH4 A;  1GCP A;  3QII A;  3G6E A;  3I35 A;  3RGF B;  1YJW A;  4C92 C;  3DB4 A;  4OML A;  4AFS C;  4KH0 B;  3UA6 A;  5FRN A;  2DAQ A;  2XMF A;  5ICP B;  3QYG B;  4C5G A;  1KK7 A;  1GFD A;  2RM4 A;  4RKU E;  2LNV A;  1P5E B;  5CKB A;  4M77 C;  1AOJ A;  3CPW P;  2DK3 A;  4RCC A;  1X75 C;  1VQ4 Q;  1LCK A;  1VQ7 T;  1PSF A;  4HVW A;  3RER A;  4AKH A;  5CK9 A;  4ORZ A;  1Y71 A;  1SG5 A;  2BE7 D;  1VYT A;  2EKO A;  2RPN A;  1RAE B;  2HD0 A;  3RIR A;  2EGE A;  1R0C B;  1GUX A;  1W1F A;  5FU7 B;  3TQ7 P;  1G3Y A;  3V7C A;  2LC4 A;  3CC4 Q;  5I5Z B;  2CP0 A;  3X20 B;  4C92 D;  1VIF A;  4E7L A;  3HHT B;  3BHT B;  2K3X A;  2K79 A;  1NLP C;  2V8I A;  2C6T B;  3I55 T;  3CBO A;  1RAG B;  4M77 D;  1H4L D;  1I8F A;  2JJ9 A;  5DY9 A;  3FB9 A;  4FYW B;  3A8M B;  1JSU B;  2XID A;  3JRZ A;  3NMZ C;  3HKS A;  4C5H A;  4FT2 A;  4BB7 A;  4EON B;  4F7U A;  1AT1 B;  3EG0 A;  2LRQ A;  4TTH A;  2L89 A;  2IN3 A;  3VUZ A;  1S1N A;  2C5X B;  2BZY A;  4Z8A A;  5D6Y A;  4CFV B;  2FPF A;  5C6S A;  2K9G A;  1VQK Q;  4CFU D;  2EQK A;  3GLX A;  1VQM Q;  2G6F X;  1TTH B;  2GTO A;  5IT9 E;  3M58 A;  3OYY A;  2O01 E;  1UNL D;  5IXF A;  1X27 A;  3O8V A;  2M1H A;  1KD1 C;  4JRI A;  3I5S A;  2CP6 A;  2DXB A;  1FYN A;  3NFC A;  3NGP A;  2LX7 A;  4M75 A;  3DLM A;  1BYM A;  4IKF A;  2B9R A;  2DA9 A;  1I07 A;  2CZ1 B;  2BTT A;  1WHH A;  2RHY A;  5HNB B;  1MHN A;  2VUB A;  3OBW A;  1UNH D;  3VS7 A;  2W9F A;  2DEU A;  5GAO p;  2CZ6 B;  4PJO B;  2L2P A;  2EYQ A;  3PMI A;  4A4H A;  2XHC A;  2HQH A;  1ACM B;  1VQP T;  2QGG A;  3G7Z A;  4B9X A;  5CIU A;  1OEB A;  1PWT A;  3CCQ T;  3BW1 A;  4KUI A;  4PFZ A;  3SEM A;  2D0N A;  3QXE B;  1D3B A;  2EVR A;  3CCJ Q;  3CC7 Q;  2DFU A;  3M55 A;  4C92 B;  3CCE A;  3JB9 D;  3HFO A;  2LJ0 A;  3G6E Q;  3N5B B;  1S72 A;  3FDR A;  2WPA B;  3PT9 A;  1EFN A;  3A5Z B;  4WCI A;  1G8X A;  2CP2 A;  2HCK A;  2DD5 B;  1K9M U;  4FW2 A;  4LUE A;  3TU4 K;  2WJ9 A;  1RAI B;  3OMC A;  3VJP A;  4C5E A;  3ME9 A;  4XU2 A;  5HCK A;  2OTL Q;  3CBM A;  1KJW A;  1D0Y A;  1IB8 A;  1PKS A;  1T0J A;  2YHT A;  3G71 Q;  3PVL A;  1FVV B;  4EIK A;  2C0I A;  4EMK C;  5IH2 A;  3TNH B;  1QCO A;  1UE9 A;  4J83 A;  3CCS T;  2DET A;  2IW8 B;  1PD1 A;  4J8O A;  1HXD A;  1PG5 B;  2MOX A;  3H4C A;  2XDB A;  1T3L A;  2ECZ A;  1X69 A;  4C8Q A;  1FKM A;  3E19 A;  3L2U A;  1OX9 A;  3DLL A;  2DYB A;  4HCC A;  1VOL A;  4BDZ A;  4EOS B;  4CFU B;  2EKH A;  4DEX A;  3MEW A;  2ATC B;  3ULR B;  4FSS A;  3DJB A;  3QDF A;  5LQF B;  2IVW A;  2RI3 A;  4OMQ A;  5FRO A;  3HB9 A;  3A8O B;  2DRM A;  4C0Z A;  5LJ5 f;  2KBT A;  4Z88 A;  1OPL A;  2A37 A;  1WHJ A;  1OU8 A;  3EOC B;  4VUB A;  3BG3 A;  4CFW B;  3JCM X;  1ZSG A;  1G3W A;  3OB9 A;  3R6N A;  2A08 A;  3ZFJ A;  1G3T A;  1B07 A;  1G5V A;  3EG2 A;  4M7D F;  4ZNX A;  4BI4 A;  4ELZ C;  2KDS A;  1T0H A;  4OR5 B;  3QYH B;  1NYG A;  1QMC A;  5IHI A;  3JCM J;  3PMT A;  2L3P A;  2EFI A;  5A0L A;  3I9Q A;  3QYB A;  4D6W A;  5C0M A;  1ABQ A;  4F7U F;  4N4H A;  3M0R A;  3OYE A;  1O9K B;  3RMS A;  4DBH A;  4NS5 A;  4OMO A;  1MUZ A;  3O5Z A;  3DL1 A;  4AFZ C;  1MMG A;  3MP6 A;  1DJ7 B;  4OVA A;  3OSS C;  4XTW A;  4HNU A;  5CEI B;  3O0G D;  1K9M R;  3CCM A;  4CFX B;  1EZZ B;  9ATC B;  3I55 Q;  2FPD A;  2EYZ A;  1QP2 A;  4BE1 A;  1TWB A;  4M75 F;  2WXV B;  3EGD B;  1D3U B;  3I5R A;  3PGG A;  1K73 C;  3M56 A;  1KC8 C;  2LJ1 A;  3MJX A;  3CCL A;  2O4X A;  4J6X A;  5GMK m;  3VKI A;  5A0D A;  4JJB A;  5CCA A;  1UGQ B;  1WNL A;  2RK2 A;  4AG2 C;  1UFF A;  3PFS A;  2VXF A;  3OYF A;  1W70 A;  1N8R U;  2LCS A;  4F14 A;  5HKC A;  3MY5 B;  5ACB A;  5KYW A;  2OX7 A;  3GNG A;  3CD6 T;  2FZG B;  3SWN A;  4MML A;  1Y0M A;  1WJR A;  1ABO A;  4E7K A;  3OYN A;  4EMK B;  4QSH A;  2YRC A;  4M77 F;  5IF1 B;  4F7N B;  2XG8 D;  3EFR A;  3OS0 A;  2FRY A;  3UF4 A;  1H28 B;  4JZ4 A;  2BZ8 A;  2CGH A;  2YRV A;  5DQV A;  1YI2 A;  1OU9 A;  5CO7 A;  4BBR M;  2CRE A;  3BDU A;  1OUL A;  2LQK A;  4DEY A;  2ZZD B;  2F69 A;  2JN0 A;  5IHY A;  1X2K A;  4DQ2 A;  5HBH B;  2EYY A;  4AKI A;  2ROT A;  1VIN A;  2LVM A;  3MCA B;  2XI9 A;  1AHJ B;  2FEI A;  1XTD A;  2W99 A;  1E6G A;  4J9G A;  4DA4 A;  3JCM W;  4M7D E;  1UHC A;  2RH2 A;  5GAN 7;  3OYM A;  3QSU A;  1KSW A;  2YLC A;  2AZS A;  4ZTF A;  4JUV A;  4EOQ B;  1PNJ A;  2QA4 A;  3BHV B;  2I0N A;  1E6H A;  2QEX A;  3E9F A;  3A1P A;  2RQV A;  1Q81 U;  3ZL7 C;  4C0D C;  1OL2 B;  2QQA A;  2DL7 A;  2ZPI B;  4F70 B;  3H0F A;  2XK0 A;  1N9S A;  5L2W B;  3JV3 A;  2HDA A;  4M7D G;  1M3B A;  2ED1 A;  3HZJ A;  5KYN A;  1YJN A;  1K9M C;  5IDN B;  2DBK A;  3KUF A;  3CQT A;  2GTJ A;  1W98 B;  2K5L A;  4J7I A;  4CRL B;  3NDQ A;  2KSS A;  2O2O A;  3VUB A;  2QF7 A;  2J06 A;  2A28 A;  4R0K A;  2LT4 A;  1NBE B;  4FYX B;  5GMK j;  2KRS A;  4BI3 A;  2XDD A;  3LGL A;  2HNI A;  1KXU A;  2PK9 B;  1URC B;  4LE9 A;  1JXO A;  1C6V X;  2DMO A;  2M16 A;  3OS2 A;  2CUB A;  4J9I A;  1M1F A;  2KY9 A;  1KFZ A;  3H8Z A;  2EQM A;  3HPW A;  1I0C A;  2FL7 A;  1NM7 A;  1VOM A;  5FU6 C;  1N8R R;  1BB9 A;  4PK4 A;  1W6X A;  3FJ5 A;  1KIK A;  2V1R A;  1IXD A;  1QWF A;  1M3A A;  2XU8 A;  2YUN A;  4C92 E;  3MHX A;  1VQL A;  2DXU A;  2X4Y A;  2G9X B;  1A0N B;  1JJ2 P;  2PMI B;  2XKO C;  2QTX A;  3JB9 J;  2V8J A;  2K7A A;  1YIT A;  1HK9 A;  3OYD A;  2DM1 A;  1MMN A;  1VQ9 T;  4F6U B;  1Z9Q A;  4RG8 A;  4XAX B;  1HD3 A;  4M77 E;  2P84 A;  4Q5W A;  1NLO C;  3BHU B;  3RMQ A;  4EC9 B;  4HCK A;  3VYG B;  4JLG A;  1MV3 A;  4C92 G;  1IHV A;  2KVQ G;  2QYZ A;  2DZ9 A;  4NST B;  4XQ3 A;  3LGF A;  3WVE B;  2CP7 A;  2JZ2 A;  2OAW A;  1YWO A;  1QVF A;  2P4R A;  2EGA A;  2IG0 A;  3EH1 A;  4M77 G;  2MAM A;  4KUL A;  1H8K A;  4HL4 A;  1NPR A;  3CC4 A;  1YI2 Q;  4HCB A;  1VQO A;  1WHM A;  4QVC A;  1Q81 R;  2K5I A;  1UHF A;  1X43 A;  2XIC A;  4X9C A;  4BCN D;  4ZTJ A;  2ZAE A;  1GRI A;  2CP3 A;  4BCQ D;  5IHK A;  2AKK A;  1VYU A;  4ME7 A;  4HNV A;  2MI6 A;  3MET A;  1WJS A;  1QVG S;  2HQE A;  2OTJ T;  1BU1 A;  2QTV A;  4EOP B;  8AT1 B;  5GMK e;  2K4Y A;  1VYW B;  3QWL A;  2J05 A;  4PKC C;  4PLL A;  3M54 A;  1V1C A;  3TVT A;  2G3R A;  3TRE A;  1R0B G;  3VKH A;  3EGX B;  1OI1 A;  5HBE B;  1Y07 A;  2C0O A;  1VQM A;  4E7I A;  2M9U A;  2C0T A;  1N8R C;  2GCX A;  1Y96 A;  8ATC B;  3L2V A;  3E9G A;  1RLQ C;  2RMO A;  3EGU A;  1B34 B;  1JB0 E;  1QLB A;  2WIP B;  1BI0 A;  2MMP A;  2YUO A;  2O9V A;  4DOW A;  2DXC A;  4FCY A;  2BS2 A;  2JXB A;  3M59 A;  2YUQ A;  3I56 T;  5HY6 A;  1NEB A;  2ZPG B;  3JB9 G;  2R57 A;  4ROD A;  1YFN A;  4II5 B;  5FU6 B;  2WSE E;  2NUT A;  2DL4 A;  4BCP B;  3ZEH A;  3H0H A;  2F2X A;  1OPK A;  2WAC A;  5GMK h;  3OYH A;  4GY5 A;  5KYU B;  2E3I A;  3CCJ A;  1ZSZ B;  2NUZ A;  3CC7 A;  1YNZ A;  2LQN A;  5J39 A;  4E7J A;  2P0Q A;  1X6O A;  1YIT Q;  4JLI A;  1Q82 U;  2J6F A;  4NOY A;  3FRN A;  3CC2 A;  3TSW A;  4EC8 B;  4CC7 A;  1NYF A;  2PTK A;  3CCU T;  1I4K 1;  4A63 B;  3M53 A;  3PIO A;  4BCN B;  3CXC S;  4LDX A;  2AIR B;  1Q81 C;  1YIJ T;  4PJJ A;  2OTL A;  4FSX A;  4BCQ B;  2IW6 B;  4AG1 C;  4M75 D;  3G71 A;  1ARK A;  1M8V A;  3HTR A;  2DE0 X;  5GMK l;  2LX9 A;  2JM8 A;  2PVO B;  3HL8 A;  3A8L B;  4J9E A;  1SSH A;  4IUV A;  2X9H A;  3BE3 A;  3MEV A;  5KE3 A;  2LCC A;  4WF2 A;  1P92 A;  2VKN A;  3K7A M;  5LL6 S;  3RKX A;  2V8K A;  1VQO Q;  1HJD A;  3OS1 A;  1GUX B;  1AWJ A;  3UAT A;  2KGT A;  1YN8 A;  2QGF B;  5GJW B;  2QXF A;  3FIF A;  3GBQ A;  4C8Q C;  1WHL A;  2PUO B;  2HSP A;  1D1A A;  3HRS A;  1XJW B;  4IUQ A;  1WYX A;  1AIS B;  2CT4 A;  3U23 A;  3A98 A;  4F6W B;  2EPD A;  2DVE A;  2D8H A;  1GBR A;  1N6A A;  2X4J A;  3AT1 B;  4M7D B;  1WFW A;  4EOL B;  2UUE B;  4JRQ A;  2O9S A;  1BIB A;  2E12 A;  5I21 A;  1PHT A;  1I5O B;  3VYH B;  2RJE A;  1KQ1 A;  2RQU A;  3CPF A;  3SFM A;  2L8D A;  2CSI A;  2C5V B;  2L0A A;  4J9F A;  4F7U B;  2FB7 A;  1VQ7 A;  2EJG A;  2HL5 C;  4CC2 A;  1LPL A;  2DX1 A;  4OMN A;  2A0F B;  4CFN B;  1GBQ A;  4C8Q D;  2JVV A;  4Y28 E;  3CCE T;  4F7L B;  1N5Z A;  1VIE A;  5D6W A;  1S72 T;  4AFQ C;  3GIB A;  1CKB A;  3JCM P;  4YTL A;  2QDY B;  4PJN A;  2DNU A;  4BBS M;  2CJM B;  4FU6 A;  4J9D A;  1IGU A;  4C0F A;  2YXY A;  1VQN Q;  1Q82 R;  2K3Y A;  2UZB B;  1ZQ1 A;  2EBP A;  2J6K A;  3QJY A;  4M75 B;  2ESW A;  3I55 A;  3VRZ A;  3OMG A;  3MO8 A;  3A8G B;  1AVZ C;  1SHF A;  3CMA T;  2X3W D;  2KXD A;  3LX7 A;  3NTI A;  2Z0W A;  1LJO A;  2AT1 B;  5M9O A;  2LMJ A;  3NHN A;  2F5K A;  2E5K A;  4LDV A;  4PJO A;  2E10 A;  2BS4 A;  1GCQ A;  4JRP A;  2V26 A;  3OW2 S;  5DLQ E;  2L3Q A;  3NTK A;  4OF1 A;  1D3B B;  4IMY B;  1NZ9 A;  2C06 A;  4K11 A;  3TSZ A;  3CC2 Q;  2CSQ A;  4BCF B;  3C0C A;  2QQB A;  4M7A A;  3WVD B;  4LUD A;  4M77 B;  1XQH A;  4B9W A;  1VQ8 T;  3CCV T;  1ZHI A;  2VC8 A;  4GBQ A;  1QP3 A;  2DD5 A;  4Y92 A;  1WLP B;  1TH7 A;  2HBP A;  1YBY A;  3VS2 A;  2EGC A;  2F2W A;  2MF2 A;  3LH0 A;  2X51 A;  3SWN C;  4BCK B;  1R8O B;  3I56 Q;  4CRI A;  2B8A A;  1RUW A;  1R77 A;  1WHK A;  2KMT A;  2H8H A;  3CCR T;  3RR6 A;  1OV3 A;  1VQ6 T;  2CS7 A;  5LJ3 f;  1MGQ A;  2FO0 A;  3LWI A;  3URG A;  2DIQ A;  1VQP A;  2JS0 A;  3JB9 H;  4HXJ A;  4CFM B;  4FM4 B;  5CYI B;  3JCM Q;  2C5N B;  3GTM S;  5IXB A;  1LOJ A;  5GAN f;  4ANJ A;  1KQS P;  1U1S A;  2EJF A;  4J9B A;  3M03 A;  4Z89 A;  2PU9 B;  2RI5 A;  1E7P A;  4ELJ A;  3EH2 A;  4HA8 A;  3BLH B;  2YT6 A;  5A2Q E;  3HSB A;  4QT7 A;  2IW9 B;  5KYX B;  1T3S A;  1F1B B;  3QKJ A;  3CCM T;  2BKD N;  5GAO m;  1OX8 A;  3CCU Q;  1I5L A;  2RK1 A;  4UC4 A;  3QYE A;  2C4G B;  5BNJ B;  1Q82 C;  5L23 A;  1AZE A;  2EW3 A;  1FMV A;  1ZUU A;  4BUG A;  4MZM A;  3LH5 A;  2ZGW A;  3OSV A;  2ZPB B;  1VQ7 Q;  3CCL T;  2ED0 A;  1QCN A;  2H3J A;  4RTY A;  4AT1 B;  3HBL A;  2NWM A;  2MWO A;  4UN0 A;  1PD0 A;  4NL2 A;  4M78 A;  4OMF B;  2X1N B;  3M4Y A;  3RUX A;  2IPO B;  1YHQ T;  3GNF B;  1M1G A;  2KT1 A;  1VQ5 T;  2RD1 A;  1O9K A;  4C5I A;  1VA7 A;  4FX3 B;  1ZA1 B;  1W2B S;  5EFQ B;  1VUB A;  3THK A;  5ECA A;  1WPY A;  3MEU A;  1TSF A;  5CQY A;  5KYY B;  4LD6 A;  5LJ5 j;  1O75 A;  1SRL A;  2JNG A;  2E6N A;  1UGP B;  3TNI B;  4MZT A;  4XTY A;  2JTE A;  1H92 A;  2JW4 A;  2R7G A;  5GJV B;  1ZBJ A;  2VAS A;  2A7Y A;  2LJ3 A;  2GF7 A;  2R58 A;  5HVY B;  3EG9 A;  2GFU A;  1H3Z A;  1WJQ A;  4QW2 A;  1RLP C;  4DBF A;  3VRY A;  3VS1 A;  2C5O B;  2SEM A;  4BY6 C;  5GAM f;  2DKG A;  1KQS S;  1FWZ A;  3FC3 A;  5FW9 A;  2HQX A;  4XU1 A;  5DLO A;  5AYF A;  2YUP A;  5IDP B;  4QVD A;  1TXQ A;  2QAZ A;  2CCH B;  2CH4 W;  2D0Q B;  5LJ3 g;  2KK4 A;  2KR3 A;  4FYV B;  5KYW B;  2QFZ A;  2CZ0 B;  1M90 U;  1K8A U;  1M30 A;  1C9B A;  5LJ3 d;  1H1P B;  2WMB B;  3SWN B;  3VS6 A;  3B57 A;  4EPC A;  2QQ8 A;  4II1 A;  5DM7 R;  3EFS A;  1GXI E;  2VVK A;  1K0X A;  3DKM A;  1GH6 B;  5LJ5 g;  2W2H A;  2JGZ B;  2GNC A;  2RNA A;  3TEE A;  1TOV A;  4XTU A;  3SDZ A;  1YJN T;  3MI9 B;  2WSF E;  3KBG A;  5LJ5 d;  1N27 A;  2B86 A;  2QG9 B;  2SRC A;  4E2F B;  1VQP Q;  2K2V A;  2RHZ A;  4KGV B;  4KH1 B;  3CCQ Q;  2JMA A;  2D8J A;  3H6Z A;  2BZX A;  2HMA A;  2E64 A;  4C8Q F;  4MDX A;  1LVK A;  2ZPF B;  1PRM C;  1WXB A;  4HCZ A;  3X25 B;  3DB3 A;  3OYB A;  2RHU A;  5FRM A;  2I2L A;  2WFY B;  3QHW B;  1UEC A;  4XK8 E;  4CXA B;  1RL2 A;  3G1J A;  2QK0 A;  2E65 A;  3LQ5 B;  2RO0 A;  4LD9 K;  1M5Q 1;  4PLI A;  3JB9 I;  4F7U E;  3L42 A;  2FVU A;  1NJI U;  4LNP A;  3KHI A;  2WSC E;  1SRM A;  2MIO A;  4R56 A;  3BG5 A;  1CKA A;  1WXT A;  1JJ2 A;  1KQ2 A;  1VQ8 Q;  3CCV Q;  3CD6 A;  1VQL T;  1WI7 A;  4N0A A;  2DJZ A;  4MZP A;  2EUF A;  4RUG A;  4X34 A;  1K0S A;  3MY1 B;  1UGV A;  4JRK A;  3CCS Q; 
#chains in the Genus database with same CATH homology
 3HFN A;  3L2V A;  3E9G A;  1NE8 A;  2DD4 B;  5LJ5 e;  3CCR A;  1B34 B;  1JB0 E;  1QLB A;  2DTO A;  1BI0 A;  2EQK A;  2MMP A;  2D9T A;  3GLX A;  3M4G A;  4F7U G;  1VQ6 A;  5IT9 E;  3M58 A;  3OYY A;  2O01 E;  5J26 A;  1N9R A;  4M78 B;  3GPL A;  4DOW A;  2ZPE B;  2DXC A;  2MWP A;  2BS2 A;  4M75 E;  3JAM E;  3O8V A;  3L2Q A;  5GAN j;  2M1H A;  5FLX E;  2OAU A;  3M59 A;  1KD1 C;  4AKG A;  2R5A A;  4JRI A;  3TW6 A;  4OGE A;  2LDM A;  3I56 T;  4ZN1 A;  5GAN 4;  3KXT A;  3V7R A;  5HY6 A;  1VQ4 T;  2DXB A;  4ZGD B;  2ZPG B;  3NFC A;  4M75 A;  1BYM A;  3DLM A;  2DIG A;  4FT4 A;  3RES A;  2R57 A;  3JB9 G;  4IKF A;  1M1K U;  5I2M A;  2QI2 A;  2EIF A;  2KMG A;  4A53 A;  4XU3 A;  5FU6 B;  2CZ1 B;  1NPP A;  2WSE E;  2ZCF B;  2FHD A;  4PL6 A;  2RHX A;  2RHY A;  1MHN A;  2VUB A;  3OBW A;  1YI2 T;  3ZEH A;  2NLU A;  1H64 1;  4OP0 A;  2G77 A;  3LYI A;  5GAO p;  3INZ A;  2CZ6 B;  4PJO B;  2XDP A;  5GAM g;  2WAC A;  2EYQ A;  3PMI A;  5GMK h;  4A4H A;  4IUU A;  2XHC A;  3OYH A;  4M75 G;  3L2W A;  3CC4 T;  3UPU A;  1VQP T;  4GY5 A;  1IZ6 A;  3G7Z A;  4B9X A;  5CIU A;  3CME T;  3CCJ A;  1OZ3 A;  3CCQ T;  3BW1 A;  4KUI A;  5GAN 8;  3CC7 A;  1G3S A;  5CKD A;  3QXE B;  1LNX A;  2O4X B;  5GMK i;  3V7S A;  1D3B A;  5GAM d;  5J39 A;  4E7J A;  2ZPH B;  2P0Q A;  4EMH A;  5CVI A;  1X6O A;  3QJ6 A;  3CEY A;  3CXC A;  2XD0 A;  4JLI A;  4PJO F;  1JBM A;  3J7A F;  3M55 A;  1Q82 U;  4C92 B;  3CCE A;  4NOY A;  3JB9 D;  4JX5 A;  1I81 A;  3FRN A;  3HFO A;  5LJ5 h;  3CC2 A;  1OYX A;  2DTH A;  2E1H A;  5IN1 A;  3L2Z A;  3N5B B;  4L59 A;  1I4K 1;  3FDR A;  2EWN A;  3M53 A;  2GQV A;  1UGR B;  3PT9 A;  3PIO A;  3CCU T;  2M0O A;  3A5Z B;  3MEA A;  3S6W A;  3CXC S;  2QA4 T;  5EG2 A;  4LDX A;  3P8D A;  3JCM c;  1Q81 C;  1YIJ T;  2DD5 B;  1K9M U;  2HAX A;  2QEX T;  2OTL A;  1EIF A;  4FSX A;  4A4K A;  2WJ9 A;  3TU4 K;  4HT8 A;  4NC6 A;  1V29 B;  3OMC A;  3VJP A;  3S3M A;  4C5E A;  4M75 D;  3ME9 A;  4XU2 A;  1PSE A;  4C92 F;  3G71 A;  1YHQ A;  2L3R A;  1M8V A;  1VQ5 A;  1UB4 A;  3CBM A;  4MFE A;  4M7A F;  1RI0 A;  2RJD A;  5GAN g;  4EMK A;  2YHT A;  5GMK l;  1Q86 U;  2LX9 A;  4M7D A;  2PVO B;  3HL8 A;  4A54 A;  3TW7 A;  3A8L B;  5GAN 6;  3PIP A;  4IUV A;  4EMK C;  3PTA A;  5GAN d;  4KT0 E;  3MEV A;  5KE3 A;  4QVZ A;  4J83 A;  4C8Q E;  3M57 A;  3CCS T;  2LCC A;  1VQK T;  4WF2 A;  4BE0 A;  4J8O A;  3HO8 A;  4JX4 A;  1HXD A;  2Y4X A;  1KHI A;  1P92 A;  4JDS A;  3H4C A;  2X4X A;  5LL6 S;  1YJ9 T;  3RKX A;  1VQM T;  2XDB A;  2V8K A;  2ZZD A;  4OGC A;  3J81 E;  1Q7Y U;  4C8Q A;  3OS1 A;  2AHJ B;  2BIV A;  1FKM A;  3E19 A;  3L2U A;  4HCC A;  2L5Q A;  2VYT A;  3DLL A;  2RJC A;  1ZBX A;  2QXF A;  4BDZ A;  2QQR A;  3FIF A;  4RG2 A;  3X24 B;  2JTM A;  3A8H B;  5CKH A;  4C8Q C;  3LWH A;  1QVG A;  3OY9 A;  3G4S T;  2PUO B;  2LTO A;  3MEW A;  2BS3 A;  3HRS A;  3FLG A;  4IUQ A;  3AHU A;  1XOV A;  2IVW A;  5GAM j;  2RI3 A;  2DVE A;  4C8Q G;  5FRO A;  5GAN 2;  1VQ9 A;  1N6A A;  2F5T X;  3HB9 A;  3A8O B;  1IRE B;  1M90 C;  2VGN A;  4O5V A;  3OYI A;  2X4J A;  1OZ2 A;  2DTI A;  4C0Z A;  5LJ5 f;  4M7D B;  3EAE A;  4EDU A;  4HT9 A;  4LDW A;  1JRI A;  2JOY A;  1BKB A;  2RHI A;  4FIB A;  4C0D B;  4JRQ A;  3S3N A;  2Y90 A;  5LJ3 e;  4LOC A;  3OYL A;  1BIB A;  2E12 A;  5I21 A;  2DZC A;  2K5F A;  4VUB A;  3BG3 A;  3VYH B;  2RJE A;  1KQ1 A;  4A4E A;  3JCM X;  3CPF A;  2E5Q A;  4J7F A;  4XTX A;  1G3W A;  3OB9 A;  3SFM A;  2L8D A;  3WXM B;  3ZFJ A;  3VV0 A;  1G3T A;  1G5V A;  3CC7 T;  3BY7 A;  5GAN e;  1YIT T;  4M7D F;  4F7U B;  4BI4 A;  4Y91 A;  2FB7 A;  4ELZ C;  1VQ7 A;  2KDS A;  2EJG A;  3G6E T;  3QYH B;  3OS5 A;  3JCM J;  1YJW T;  2DXT A;  4PNO A;  3PMT A;  4N4G A;  3ZBD A;  3P8B B;  4C8Q D;  3QZ9 B;  2EFI A;  2FYK A;  2JVV A;  2M9U A;  2PVG B;  2EQU A;  4Y28 E;  3CCE T;  3HP9 A;  4Z02 A;  3VKG A;  5A0L A;  5GAO l;  5CR2 A;  1VIE A;  3QYB A;  3JSC A;  5D6W A;  4D6W A;  1KG1 A;  2KAF A;  1S72 T;  5C0M A;  2K57 A;  3GIB A;  3JCM f;  2DD4 A;  4X9D A;  4OB1 B;  4N4H A;  4YTL A;  4F7U F;  3OYE A;  1B34 A;  3JCM P;  2QDY B;  3ASK A;  2YLB A;  3RMS A;  1K8A C;  4BBS M;  4NS5 A;  4E7H A;  4J6Y A;  1VQN A;  4FU6 A;  4QQG A;  4C0F A;  4NL3 A;  3OYJ A;  3DL1 A;  2VGM A;  3G71 T;  1FX7 A;  4ZGE B;  2K3Y A;  4M78 F;  4J5Y A;  4Z6Y A;  2EQJ A;  2P0P A;  3P8H A;  4AI6 A;  1ZQ1 A;  3QUI A;  4V2S A;  4MFD A;  3QJY A;  3MP6 A;  1M9S A;  1DJ7 B;  4M75 B;  3X28 B;  4OVA A;  3OSS C;  3V8K A;  3I55 A;  2EJ9 A;  4XTW A;  4HNU A;  5EJC A;  5LJ3 h;  3OMG A;  3MO8 A;  4PJO E;  3A8G B;  3CCM A;  2KQW A;  3VU3 C;  3CMA T;  4M6V A;  2CYZ B;  3LX7 A;  3NTI A;  1VQO T;  4HLQ A;  3LLR A;  3QG1 A;  1LJO A;  5M9O A;  5GAO q;  2F5K A;  3ER0 A;  4LDV A;  1QP2 A;  4PJO A;  4BE1 A;  4M75 F;  2E10 A;  2BS4 A;  5GAN h;  4JRP A;  3OW2 S;  5KCO A;  3PGG A;  1K73 C;  1KC8 C;  3M56 A;  5DLQ E;  4PJO C;  4BY6 B;  3CCL A;  3NTK A;  2VXE A;  1D3B B;  2O4X A;  4OF1 A;  2E70 A;  1NZ9 A;  1X01 A;  3L2R A;  2CZ7 B;  3C95 A;  2C06 A;  4O6J A;  3OYK A;  4DOV A;  4J6X A;  5GMK m;  3VKI A;  4M7A E;  5A0D A;  5D6X A;  4OB2 B;  2RA2 A;  3SD4 A;  5HK3 A;  5CCA A;  4PJO G;  4BD3 A;  4OB3 B;  4L5G A;  1UGQ B;  1WNL A;  3OQ5 A;  2RK2 A;  2QQB A;  4P5N A;  1WGS A;  2EAY A;  3WVD B;  1NJI C;  3VYG A;  3PFS A;  4M7A A;  4M77 B;  2PUK B;  1XQH A;  3JCM V;  4B9W A;  2VXF A;  3OYF A;  3CCV T;  3BG9 A;  1VQ8 T;  1N8R U;  1ZHI A;  2VC8 A;  4M7A C;  1QP3 A;  2DD5 A;  5HKC A;  2KR6 A;  1TH7 A;  2RJF A;  3UDC A;  2HBP A;  1YBY A;  3GNG A;  3QBY A;  3CD6 T;  2VV5 A;  3SWN A;  4MML A;  2MF2 A;  3I56 A;  1WJR A;  4RCB A;  4E7K A;  3OYN A;  1VQ4 A;  3LH0 A;  4QSH A;  3MP1 A;  2QQS A;  4EMK B;  4M7A G;  4M77 F;  3HRU A;  1YCY A;  1KD1 U;  3SWN C;  1R8O B;  1BI1 A;  5CQX A;  2XG8 D;  3EFR A;  4CRI A;  2B8A A;  3OS0 A;  4ZGJ B;  1UEB A;  5L8R E;  5GAM e;  3L1A A;  4PJO D;  2KMT A;  3CCR T;  2CGH A;  2JUF A;  4IUT A;  5J3B A;  2YRV A;  1VQ6 T;  1YI2 A;  5CO7 A;  4ZN3 A;  4RMO A;  2CS7 A;  4TVR A;  3BFM A;  5LJ3 f;  5GAO r;  3FJP A;  4BBR M;  3BDU A;  2QQ9 A;  1MGQ A;  2LQK A;  3LWI A;  2ZZD B;  3OA6 A;  2F69 A;  3QPH A;  3URG A;  3OYC A;  2JN0 A;  5FU7 C;  4DQ2 A;  1U1T A;  4JS4 A;  2DIQ A;  1VQP A;  3JB9 H;  4AKI A;  3CME A;  1M1K C;  2LT1 A;  1QVF S;  2Y4Y A;  4FM4 B;  2LVM A;  3LW5 E;  2X35 A;  3JCM Q;  1VQN T;  3QZ5 B;  3MCA B;  2XI9 A;  1AHJ B;  5GAN f;  1LOJ A;  2A3L A;  1XTD A;  1U1S A;  2EJF A;  3NTH A;  2PU9 B;  2RI5 A;  4DA4 A;  1E7P A;  4M7A D;  4ELJ A;  4HA8 A;  3JCM W;  4M7D E;  2RH2 A;  3JB9 F;  5GAN 3;  3QHS A;  5GAN 7;  3E1S A;  3OYM A;  3QSU A;  4XTZ A;  5GAN 5;  5A2Q E;  1K73 U;  1KC8 U;  3CCU A;  2YLC A;  3C94 A;  4HNT A;  4ZTF A;  3HSB A;  4JUV A;  3QKJ A;  4JX6 A;  2QA4 A;  3CCM T;  1W4S A;  2BKD N;  2X4W A;  4IUR A;  3OBY A;  3V8J A;  5GAO m;  4MDW A;  1BI3 A;  3CCJ T;  1YIJ A;  3GOX A;  3GP8 A;  2QEX A;  2D6F A;  3QO3 A;  1I5L A;  5KH6 A;  2RK1 A;  1KHC A;  3QYE A;  4UC4 A;  3RKY A;  3E9F A;  5CKE A;  5GAO n;  3JCM g;  1FXX A;  4M7D C;  5KE2 A;  1Q82 C;  4QQD A;  4A4F A;  1Q81 U;  4C0D C;  2QQA A;  4BUG A;  1QW1 A;  2ZPI B;  4MZM A;  2XK0 A;  1N9S A;  2ZGW A;  3OSV A;  4JS5 A;  2ZPB B;  3JCM d;  3C4S A;  3CCL T;  5GAM h;  3CC2 T;  4M7D G;  4ATO A;  1Y96 B;  3HZJ A;  4M78 E;  1YJN A;  3OYG A;  2H3J A;  1K9M C;  2R5M A;  3KUF A;  5A0G A;  3F70 A;  4J7I A;  2K5L A;  5CAI A;  3HBL A;  5CKF A;  2KSS A;  1VQK A;  3VUB A;  2MWO A;  2QF7 A;  2OTL T;  4NL2 A;  2LT4 A;  4M78 A;  2DXC B;  5GMK j;  4BI3 A;  2XDD A;  1YJ9 A;  1W2B A;  1JJ2 S;  3LGL A;  1Q86 C;  4LDY A;  2HNI A;  4OMF B;  3M4Y A;  2P0K A;  1BI2 A;  3RUX A;  1YHQ T;  3GNF B;  1M1G A;  1VQ5 T;  5I2S A;  4MIM A;  4M78 C;  4N4I A;  2RD1 A;  2DXB B;  4C5I A;  2M16 A;  3OS2 A;  4HKE A;  3S3O A;  1BIA A;  3MP8 A;  2E6Z A;  1M1F A;  1WQW A;  5IAY A;  2JTF A;  2KY9 A;  4XU0 A;  4QQ6 A;  3SB2 A;  3TCJ A;  3G4S A;  1VUB A;  3BDL A;  1W2B S;  3RKW A;  3H8Z A;  3QDR B;  3Q1J A;  1WPY A;  3MEU A;  1M4Z A;  4M78 G;  1U8R A;  2PVD B;  5CQY A;  3V8L A;  2EQM A;  3OW2 A;  4LD6 A;  5LJ5 j;  3CPW A;  1O75 A;  4ELY C;  1Q7Y C;  4M7D D;  2JNG A;  3HPW A;  4XTV A;  5KCH A;  2E6N A;  1UGP B;  4EMG A;  2FL7 A;  5FU6 C;  4MZT A;  4XTY A;  4BAC A;  2OTJ A;  4BI8 B;  4LDU A;  3OYA A;  5HK0 A;  4M75 C;  4KUD K;  3CPW S;  2BUD A;  2GFA A;  3X26 B;  4R55 A;  2QDJ A;  2XU8 A;  2A7Y A;  4C92 E;  3MHX A;  4E47 A;  1VQL A;  2DXU A;  3C12 A;  2X4Y A;  3JCM e;  4CI0 C;  2GF7 A;  3R6O A;  2R58 A;  2RB6 A;  4L6V 5;  2XKO C;  1KQS A;  2QTX A;  4A4G A;  3JB9 J;  2GFU A;  2V8J A;  4BDY A;  4C92 A;  1YIT A;  1H3Z A;  1WJQ A;  1HK9 A;  4QW2 A;  3OYD A;  4GLK A;  1VQ9 T;  4RG8 A;  4XAX B;  3QII A;  3G6E A;  4M78 D;  1YJW A;  4C92 C;  4BY6 C;  3DB4 A;  4M77 E;  5GAM f;  2DKG A;  2CKK A;  4Q5W A;  1KQS S;  1FWZ A;  3FC3 A;  2HQX A;  4XU1 A;  5DLO A;  5AYF A;  3RMQ A;  3HRT A;  4M7A B;  5FRN A;  2DAQ A;  3VYG B;  4QVD A;  4JLG A;  4C92 G;  4M77 A;  1Y7X A;  3UT1 A;  2D0Q B;  3QYG B;  4C5G A;  2KK4 A;  2KVQ G;  5LJ3 g;  2RM4 A;  4RKU E;  2LNV A;  3CBP A;  4MMK A;  1QVP A;  2DZ9 A;  2E41 A;  2QFZ A;  4M77 C;  2CZ0 B;  5CKB A;  4XQ3 A;  1M90 U;  3LGF A;  3FEO A;  2PQW A;  1K8A U;  3WVE B;  2DK3 A;  4RCC A;  1X75 C;  5LJ3 d;  3SWN B;  2JZ2 A;  1PSF A;  3J80 E;  1VQ7 T;  4BE2 A;  3RER A;  4AKH A;  4EPC A;  2QQ8 A;  4II1 A;  5CK9 A;  3EFS A;  5DM7 R;  1S72 A;  1QVF A;  1GXI E;  2IG0 A;  1Y71 A;  4M77 G;  2MAM A;  4C0G A;  4KUL A;  3JCM b;  2EKO A;  3T9N A;  3DKM A;  2HD0 A;  3RIR A;  5LJ5 g;  4HL4 A;  3M5A A;  3TEE A;  1NPR A;  4C8Q B;  4XTU A;  3SDZ A;  1YJN T;  3CC4 A;  3CMA A;  2WSF E;  3KBG A;  4HCB A;  4JJN K;  5FU7 B;  3CCQ A;  1VQO A;  4QVC A;  1G3Y A;  3V7C A;  5LJ5 d;  3JCM h;  1N27 A;  2LC4 A;  3X20 B;  2K2V A;  1O9S A;  2K5I A;  1VIF A;  2RHZ A;  3PNW C;  4C92 D;  4FL6 A;  4E7L A;  3HHT B;  2DPP B;  2XIC A;  4X9C A;  3H6Z A;  2K3X A;  2E64 A;  4C8Q F;  2DEQ A;  2V8I A;  4ZTJ A;  4MDX A;  4IUP A;  2ZPF B;  3I55 T;  4HCZ A;  2RI2 A;  3X25 B;  3DB3 A;  3OYB A;  2RHU A;  5FRM A;  2I2L A;  4ME7 A;  2LCL A;  3CBO A;  4XK8 E;  2LQ8 A;  3UWN A;  4HNV A;  2DO3 A;  4J6W A;  1RL2 A;  4M77 D;  2E65 A;  2MI6 A;  3MET A;  1I8F A;  1WJS A;  1QVG S;  5DY9 A;  2RO0 A;  3M9Q A;  4LD9 K;  2HQE A;  3FB9 A;  1M5Q 1;  3A8M B;  4PLI A;  3JB9 I;  2OTJ T;  4F7U E;  1VQM A;  2XID A;  4OB0 B;  3JRZ A;  3L42 A;  2FVU A;  3HKS A;  4C5H A;  4FT2 A;  3CCV A;  1VQ8 A;  1NJI U;  3KHI A;  2WSC E;  4R56 A;  4BB7 A;  5GMK e;  2K4Y A;  3BG5 A;  3GF5 A;  3QWL A;  4PKC C;  4PLL A;  1JJ2 A;  4F7U A;  1KQ2 A;  3CD6 A;  1VQL T;  2LRQ A;  3M54 A;  4KBM B;  2G3R A;  4N0A A;  3TRE A;  2DJZ A;  2L89 A;  1SSF A;  2P4T A;  4MZP A;  3CCS A;  3VUZ A;  3VKH A;  4X34 A;  1UGS B;  1OI1 A;  1XNI A;  5D6Y A;  1Y07 A;  4JRK A;  4N0A C;  5LJ3 j;  5C6S A;  4E7I A;  1WQ7 A;  1N8R C;  2GCX A;  1Y96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...