3HHTB

A mutant of the nitrile hydratase from geobacillus pallidus having enhanced thermostability
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLALGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFSKKPDTKIPRREDPALVKLVEKALNDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title The high-resolution structure of a Cobalt containing nitrile hydratase
rcsb
source organism Geobacillus pallidus
molecule tags Lyase
total genus 65
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hhtB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hhtB02
3A8LB 2ZPBB 3A8GB 3VYGA 3WVDB 2CZ1B 3QZ9B 3QZ5B 3A8MB 3X20B 2ZPEB 2ZPFB 4ZGDB 1UGSB 4OB3B 1AHJB 1V29B 2WSFE 1UGQB 2DXCA 1UGRB 2DD4A 2AHJB 4OB1B 4KT0E 3X28B 3QYHB 3X25B 4L6V5 4RKUE 2WSCE 2CZ6B 1QP2A 2O01E 2DXBA 1PSFA 3QYGB 1IREB 3WVEB 2PUKB 3X24B 2QDYB 1JB0E 1PSEA 2DD4B 2ZZDA 5L8RE 4FM4B 2DD5A 4OB2B 1UGPB 3X26B 3VYGB 3HHTB 2CZ0B 2ZPGB 2D0QB 2PVOB 2WSEE 2ZPHB 2ZPIB 4OB0B 1GXIE 2DD5B 2DXCB 2PVDB 3A8OB 4XK8E 2PU9B 4ZGJB 2PUOB 3QXEB 3VYHB 2PVGB 1QP3A 2DPPB 2DXBB 3A8HB 4Y28E 1DJ7B 2CZ7B 3LW5E 2ZZDB 2CYZB 4ZGEB 2ZCFB
chains in the Genus database with same CATH superfamily
3M0QA 2EUFA 2E3HA 3I5RA 4AFUC 4BY7X 3DLLA 2EGAA 2KR6A 3M0PA 3CCUQ 1NE8A 3CPFA 4F6WB 4LDYA 5A0DA 1H3HA 1Y57A 5GMKi 3M53A 1W70A 3MHXA 4JDSA 4E7HA 2K4YA 2J6OA 3CMAQ 3PIOA 1G3WA 2FEIA 2K3XA 4KRDB 1VOLA 1AWWA 2E64A 2LNVA 2DK3A 1UGRB 3BHVB 1UHCA 2VVKA 1OL2B 2WEVB 1SSFA 1X43A 5GAMe 3GPLA 3JCMf 2L3RA 4QQ6A 3BHTB 5KCOA 2RQWA 5GAN2 3X25B 1IGQA 4HCCA 1FWZA 2C06A 4A53A 1VQ4A 4WCIA 2MMPA 1YJ9T 1VQ9A 1OKWB 4NOYA 3MP6A 2ED0A 2DEUA 1XNIA 2DD4B 2GCXA 2QTVA 4HXJA 1J3TA 2V22B 1VQLA 4HVVA 2PNIA 4N4HA 2QYZA 3FC3A 1M27C 3O0GD 4BBSM 2QEXT 3A1PA 1UFFA 2J06A 3HP9A 3OYCA 3BE3A 1YJWT 1PCXA 4Z8AA 2AZSA 2HCKA 1TUDA 4IMYB 1AZGB 3CC2A 2KGTA 3DJBA 1D3UB 3QSUA 1NYGA 1F1BB 1JRIA 1N4MA 4XTVA 2RI3A 2G77A 4KULA 5GMKm 5ICPB 2FRWA 5CIUA 2RJDA 3H4CA 4XU2A 1VQ8A 2KEAA 1WHMA 2XMFA 2RQRA 5CK9A 2W2HA 3OS5A 2LQKA 4HCKA 4Y28E 1YIJT 2XK0A 4EOPB 3MJXA 4C92A 4DEYA 1D0YA 4M78D 1FKMA 2QI2A 3HZJA 3OYKA 4GLMA 4R0KA 1VINA 2BS3A 1M1KR 4ME7A 1F5QB 2O88A 4C8QE 1VQ5Q 3D7SB 5KYWB 2C5OB 3WVDB 1OPKA 5GAN4 3H9NA 1VYUA 3OYHA 2CP0A 2O31A 2LCCA 1QKWA 3RGFB 1H1SB 5A0GA 4HVUA 5GAN6 3VU3C 1UHFA 3CCEQ 3UDCA 2OI3A 2JW4A 1VQPQ 5IN1A 3OW2S 3EG9A 2RK1A 4M78B 1WIEA 4J9IA 1VQ6Q 1GUXA 3GNFB 3RMQA 3F70A 1OKVB 5GJWB 2RJCA 3JB9I 3I56A 5CQYA 1UUEA 4OGRB 3BFMA 5GAOr 4BCKB 3CCMQ 4OGEA 5I5ZB 3DLMA 3I55T 1GCQC 5I2MA 3G71T 2EQMA 4N0AC 3NHNA 3MPUB 3JB9J 1JJ2A 2OAUA 1NEBA 1C9BA 4XTWA 2XHCA 1KD1R 3OYAA 4JX5A 2QF7A 5D6XA 2JTEA 3OS2A 3BDLA 2EJGA 4PJOA 1D1BA 3DB4A 1WYXA 4BE0A 5C0MA 2L8DA 4E47A 1FXXA 4F04B 2MI6A 5LJ3g 2L2PA 4HT9A 1GXIE 2DD5B 3TREA 3HBLA 5GAN5 1M30A 2VWFA 3CD6A 4F6UB 4J9EA 2GTOA 2BZXA 1BU2A 1UJ0A 4MFEA 1VOMA 3VS3A 7AT1B 1SHFA 5FRMA 2K9GA 1WHJA 1FINB 3QWYA 1NJIU 2I0NA 1GFDA 1QP3A 1G3NC 3A8HB 1S72A 4BD3A 5GANd 4Y91A 3VUBA 2CP2A 1BB9A 3HFNA 1QW1A 1D3BB 3SFMA 3CCJT 3HPWA 1MMAA 4OMMA 2M02A 2I2LA 1WXBA 4N4GA 1YJNQ 4FT2A 2KAFA 4BI4A 2LJ0A 3CMAA 2KT1A 4OMOA 3LGFA 1NLPC 5LJ3e 4X34A 2QQAA 4DOWA 1QVGP 3OYGA 2G9XB 4M77A 1BI0A 2GF7A 1OI9B 3REAB 2K5IA 3QHSA 1QCOA 4J8OA 3L2QA 3EGXB 1JOWA 2PTKA 2ATCB 3GBQA 4LXCA 3A5ZB 2EYYA 4NL2A 2V8IA 2FVUA 4X9CA 1TWBA 1H1RB 4RG8A 3JCMJ 1PC0A 4M78C 5LJ5f 3JCMQ 1UE9A 4CFWB 1TOVA 1Y7XA 2KY9A 1M1KU 4ZNXA 1ZSZB 5CEIB 2CDTA 2ENMA 2P4RA 4M75D 2YXYA 4C5EA 1VQLT 4JRPA 4M7DB 4OB2B 1BK2A 3OMCA 3FRNA 1VUBA 3CMET 2JZ2A 4AG2C 5GAMh 2RO0A 1B34B 3G4SA 2ZAEA 2VXEA 5CR2A 3LYIA 2D0QB 3CBOA 3LX7A 1GRIA 1NPPA 2F2CA 3CC2T 3OS0A 5J3BA 3JCMe 2FZGB 3P8BB 2RN8A 2WXVB 1TS9A 3E9GA 3MY5B 4E7SA 3EOCB 3A8OB 2JM9A 1YWPA 4M75B 2WHBB 2VGNA 4BCOB 2WJ9A 3V7CA 3NDQA 1VQ8T 5GMKl 3I55Q 3G71Q 4C8QB 3CCRT 4E2FB 1WQWA 1NG2A 3TNWB 1G3SA 1ZSGA 1K76A 5KH6A 5I21A 4OMFB 3BG9A 4F7JB 4EMGA 4OVAA 2OTLA 1KD1U 1VQ5A 2CYZB 1RAIB 4V2SA 1I5OB 2L5QA 1O9KA 3G33B 4IURA 2KR3A 3OYJA 3BY7A 1QLYA 1Q81U 2CZ1B 3GF5A 2V26A 1G83A 1NBEB 8ATCB 3J81E 3CCEA 4KH0B 5GAMf 2E70A 2LW4A 2VUBA 1V76A 2XIDA 4J6XA 3RMSA 3C4SA 1U3OA 4IUVA 2P4TA 3OBYA 3KHIA 5BNJB 2JS2A 5DM7R 5DLOA 4LD9K 1Q86U 3N5BB 4PLLA 3VS2A 3CCMA 2KVQG 4RTZA 2X4YA 5IF1B 3I56T 1U8RA 3THKA 3CCJQ 1OEBA 2JOYA 9ATCB 2LQWA 4II5B 2EPDA 5I2SA 3EAEA 1BU1A 2BKDN 2F5TX 2RI2A 1LNXA 2WIPB 2BS2A 4CRLB 4FIBA 1VIFA 4HCBA 3QPHA 4X9DA 1M3AA 1KC8U 3OYYA 2ZZDA 2AIRB 2LTOA 5KYYA 5EJCA 1TUCA 1WNLA 1CKBA 1ZSZC 5CKFA 4UC4A 2RHXA 1KJWA 4HVWA 3CBPA 1WHGA 1C6VX 1URCB 5A0LA 4M7DC 2PHGA 3NFCA 2GGRA 2WMBB 1JBMA 1MGQA 2C6TB 2DXCB 2CSQA 2MPXC 4K11A 4Y72B 2PVDB 1VYVA 1YN8A 1GH6B 2RHYA 4XU1A 3VKIA 2HKNA 1NJIC 4FSXA 3JCMW 4A4GA 3CC7T 1S72T 2O4XB 2QAZA 1LOJA 2LCLA 4M75C 2QEXA 3FIFA 2F5KA 1DJ7B 3CMEQ 3CCUT 4OMLA 4M7AB 2LDMA 2C5VB 3QWLA 3JB9G 1VA7A 4AFSC 2F69A 1X6BA 3A8LB 3BG3A 1M2VA 3Q1JA 1K9AA 1TU0B 1VQOT 3CMAT 4MIMA 4KGVB 2F1LA 2KMTA 1C1AA 1OZ2A 3M4GA 4XU3A 2ZPEB 1MNDA 1M4ZA 1UGSB 4A4EA 2DAQA 2ED1A 1R0CB 2HNIA 1QVPA 2D9TA 2R57A 2RB6A 1YIJA 2GTJA 1JJ2S 1ZBJA 4BY1X 2KK4A 3RDVA 3OYNA 4P5NA 1K0XA 1YCYA 4M7DG 5IXBA 1QVGA 3M0RA 5LJ5g 2XG8D 2ROTA 2X9HA 2WPAB 3OS1A 4EIKA 2KRSA 2O01E 2EGEA 4EOLB 2EJFA 2NUTA 5FLXE 1IREB 1RAGB 1NM7A 4RCBA 4HNUA 1GFCA 2B9RA 5LJ3h 2DYIA 2QDYB 1OIUB 4CC7A 1P5EB 2IIMA 2E6ZA 1D0XA 3QYEA 1OU8A 3C12A 4NS5A 5KYXB 2J6KA 3VYGB 1AD6A 1OPLA 1WA7A 2VB6A 1X01A 5HNBB 5CKHA 3RUXA 4D6WA 2CCIB 3VUZA 4C8QG 4YOZA 2I53A 1PRMC 4PJMA 4BXXX 3S6WA 3I35A 3S3NA 1WHKA 1IHVA 1S1NA 4M78E 4LD6A 1WQ7A 3I55A 5GAOm 4ROEA 3G71A 4EOOB 5LJ5e 3EG2A 1OQKA 3MP8A 2FL7A 1JKWA 2X35A 3LH0A 2WACA 3SEMA 3LWHA 3GLXA 4C92D 3PT9A 2UZEB 3HO8A 1K73U 1K9MC 2RQVA 4OP0A 4WTOB 4R55A 2X4XA 1VQ5T 3OA6A 3GTMS 4II1A 1ZX6A 3O8VA 2F2XA 2IPOB 2YWWA 5LJ3f 5FW9A 3JCMh 2DETA 3PE0A 4FT4A 1MMGA 1Q81C 4LDXA 1LVKA 3G7ZA 4M7AC 3TW6A 2CH4A 3CXCA 2EYZA 4OGCA 1VQPT 2E5QA 3META 3JB9F 1UJYA 2EIFA 2M51A 4JRQA 1VQ6T 4C92B 2FO0A 2JNGA 3MEUA 2NYSA 1KQSP 2BS4A 3M5AA 1Q86C 2JJ9A 3CCMT 4BE1A 2EQUA 3CCJA 2UZDB 2FRYA 5D6YA 1OGUB 4QSHA 2LQ8A 4J6WA 5IT9E 4L6V5 1PNJA 4MDXA 4EORB 2CSIA 4ELJA 4PL6A 1K8AC 1PSFA 2COYA 1G2BA 1BYMA 3ZEHA 2YUPA 1KC8C 4M7DF 2JVVA 1VQOQ 4FSSA 4JZ4A 2RH2A 5GAMj 2KDSA 2KYBA 5GAN8 4NC6A 4FM4B 3L2WA 1K1ZA 4PJOD 4F7LB 1QCNA 4JLIA 1YWOA 3SHWA 2CUBA 3NGPA 2Y90A 3VS0A 2HKQB 2VASA 2D1XA 1BI2A 2LT4A 2ZPIB 3OYIA 1T3LA 2B86A 1NJIR 1PKTA 4IKFA 4M7AG 1M1GA 3KBGA 2PU9B 2SEMA 1OV3A 2RPNA 4C8QF 4NL3A 3DOGB 1YITQ 3QBYA 3JB9H 4EMHA 2EYXA 4L59A 2C4GB 2HBPA 1TTHB 3EFOB 3CMEA 2K3YA 3G1JA 5HBJB 4KGXB 3V8JA 3QYBA 2GFAA 1TUGB 1VYTA 2LQNA 1YJNT 2YLCA 2ROLA 4C0DB 5FRNA 4M7DE 3M58A 1KHCA 1H27B 1RLQC 1TSFA 2Z0WA 2RMOA 2XDBA 5IHNA 8AT1B 3RBBB 1VQ7Q 1O9SA 3SB2A 3MEWA 1IRXA 1WHLA 2AZVA 3V7SA 2KRMA 4BB7A 3DL1A 4M77D 3VS4A 1HYOA 2ZPFB 2DRMA 1D1AA 3P8HA 3EH2A 3OYBA 5GAN7 3CCRA 2KXCA 3UPUA 4E7IA 1H3ZA 1AHJB 4RCCA 4JS4A 2QGGA 3L42A 1UGQB 4M75E 3U23A 2GBQA 4MMKA 3OYLA 3VKHA 4PKCC 2DJZA 2QFZA 4C92C 4OB1B 1W98B 2FPEA 3HFOA 3PFSA 3TN8B 4LOCA 3QG1A 2EYWA 4EONB 3SDZA 4CFUD 3MI9B 1WXTA 2BIVA 2VKNA 2QQSA 1GL5A 3HTRA 4RTYA 2ECZA 4ESRA 2M0OA 2HD0A 4A4KA 5DQVA 2A7YA 2LJ3A 5EC7A 1TG0A 2D6FA 5I11A 4ATOA 1FYNA 4HL4A 1M3BA 2LX7A 4BE2A 1H25B 3KUFA 1N27A 4LE9A 3M0SA 4ROCA 5CAIA 1VQNQ 3GOXA 3HL8A 2BZ8A 3EFSA 4XK8E 3OSSC 1Y07A 5GAOl 3CCQQ 3OYMA 2JS0A 1BKBA 1K9MR 4DBFA 2JTMA 2DJQA 5IDPB 2H3EB 1SRLA 4BI3A 1WHHA 5GAN3 4RTXA 2PVGB 4IIMA 1K73C 4E7ZA 1M90U 2DXBB 2JM8A 3LH5A 4M7AF 4J7FA 2A28A 1I1JA 5KE2A 1NZ9A 2E3IA 3LWIA 2X4JA 1Q81R 4LN2A 3VRYA 3M59A 5GANf 4ZGEB 4B9XA 4XQ3A 2DVEA 1ZUKA 1QVGS 2KBTA 2CKKA 3DTOA 2OX7A 2LP5A 4FU6A 1WPYA 2IW8B 2QQ8A 4C0DC 1U1TA 1OOTA 4I3ZB 3TQ7P 3VRZA 3ULRB 5LJ5h 4UN0A 1IZ6A 3V7RA 4JUVA 5L23A 3PGGA 3F5XB 3CC7A 4RTVA 1NEGA 1Q86R 2XKOC 2PMIB 2KSSA 2WSFE 1UNLD 1UNHD 3CCUA 3B57A 3ZL7C 1O9KB 1MHNA 1K8AR 4JJNK 5LJ3j 3M55A 4AI6A 3PNWC 1H8KA 1KC8R 2HEQA 4FYVB 2RI5A 1VQOA 3TSZA 2LC4A 3E2UA 1YP5A 1KQSA 1WXUA 4M7AE 3JCMP 4EMKB 4AKIA 3BLHB 3OSVA 2JXBA 3NTKA 5KE3A 4EOIB 3RKYA 2PJQA 2B8AA 2PQWA 4JRIA 2GQIA 2YHTA 1BIAA 4HKEA 5KYWA 3OQ5A 4DOVA 5GAOn 4KRCB 3C0CA 1IB8A 2C0IA 1AT1B 1YHQQ 3CCLQ 4BCND 2C0TA 4A4HA 2WMAB 4XAXB 1QQJA 1XTDA 3RKWA 4ELLA 3RERA 2RNAA 4RTUA 1QWFA 4D8KA 2DTOA 5KYYB 1YITA 1I07A 4KH1B 5DY9A 3QHWB 4PFZA 3JCMV 4C5HA 2KMGA 3EHQA 1QVFP 3CXCS 2J7IA 1WX6A 1E7OA 1X27A 3DDPB 4F7NB 1LJOA 4Z88A 4EOQB 3EGDB 2YRVA 4PK4A 1VQMT 2RHUA 4Z89A 1VQKT 1GCPA 1JU5C 4BCIB 2NUPB 1VIEA 2GQVA 2JN0A 2X3WD 3OYFA 2W10A 4XTYA 1Y71A 1E9HB 1H28B 3M0UA 1D1CA 1JEGA 1SG5A 3VS6A 1ENWA 1BIBA 2HQEA 4EOMB 2XU8A 3MEAA 1OIYB 2PK9B 1Z9ZA 1X75C 2HL3A 4GLKA 1M8VA 1K9MU 3CXCP 2DBKA 3DKMA 1ABQA 2P0KA 5IHIA 4PJNA 4VUBA 4JJBA 4PLIA 1FMVA 4KT0E 2DZ9A 3QYHB 5GMKe 4M78G 2RK2A 3CCVT 1Q95G 4RKUE 2YUOA 2A37A 5IHKA 1N8RC 1MV3A 2FB7A 4JLGA 3TEEA 2LRQA 4CC2A 1I5LA 2R5MA 2BZYA 2DO3A 2RHIA 1VQPA 4HNVA 4J9DA 2KXDA 1W2BA 3X24B 4CFXB 2M16A 3JRZA 5KYUB 1D3BA 4L5GA 1VQ6A 3QIIA 4J9BA 4HT8A 4AT1B 3JAME 4EMKC 4F17A 4EOSB 1OX9A 1EZZB 1SRMA 3QJ6A 4MMLA 4C5IA 2JMCA 1PM3A 3OBWA 2KI7A 2P0PA 5FU6B 4C92E 1BCOA 6AT1B 2BE7D 2NUTB 1VQNA 2COWA 4YTLA 4EOKB 1K8AU 2DXTA 1LCKA 2DL8A 3CCQA 1UB4A 2K3BA 3NTHA 3BHUB 4QW2A 2P0QA 1X6OA 1G3TA 1K73R 3FLGA 5GAMd 1RUWA 1M90C 1RADB 5HBHB 2MK5A 2QGSA 1XO2A 2FHDA 4IUQA 5LQFB 3GNGA 4J7IA 5FWCA 5GANg 3DDQB 4F7UB 2KNBB 5A2QE 2YUQA 4OR5B 4RUGA 2DMOA 2EFIA 2FZKB 1QMZB 1WFWA 1X2KA 1PRLC 4M7DA 4XTXA 4A54A 2E12A 1PWTA 3S3MA 1YCSB 4J9GA 3IQLA 3A8MB 2VV5A 2O2OA 1B34A 3BG5A 2XDPA 1HK9A 3PIPA 1YNZA 5IHYA 1MUZA 2V1RA 1AZEA 1IHWA 2DL4A 5HY6A 1YJNA 2K5FA 1VQ9Q 1D0ZA 1Q7YC 1XQHA 4EC8B 2LJ1A 1VQMQ 4BY6B 5GANj 2F2VA 3EG1A 1M5Q1 1VQKQ 2Y4YA 1RI9A 2JGZB 2SRCA 2CZ6B 4C8QA 2FG0A 5GANe 3SWNA 2EQKA 2DL7A 1U06A 2MAMA 2QQBA 2QA4T 3WVEB 4WF2A 4FX3B 1T3SA 2K5LA 2DFUA 2BPMB 2MIOA 2V1QA 2WIHB 3M9QA 4M78F 1RAFB 1UGPB 4FW2A 3CCLA 3PO3S 2R58A 3C94A 3M4YA 3QJYA 1PG5B 2DTIA 2EVRA 4E7JA 4QKUA 2VYTA 1ARKA 3CCSQ 2UUEB 1YITT 3MY1B 2HSEB 4QVCA 2F2WA 4XTUA 3CCVQ 2FZCB 5HK0A 5LL6S 5FU6C 3UA7A 1TD6A 4ZN1A 3TVTA 4Y92A 5KYNA 1FMWA 1G5VA 4FL6A 4FCYA 4ZGJB 4BCQD 1I81A 1QLBA 2PZ1A 3TCJA 4M75G 2KRNA 4FYWB 2DL3A 3EGUA 4DEXA 2X1NB 1YBYA 3GP8A 3G6ET 3K7AM 1VQ7T 1B3QA 1E6HA 1UGVA 2HDAA 3OMGA 1QVFA 3RKXA 2DA9A 3VS5A 4PFOA 3LGLA 5LJ5j 1AEYA 1AWOA 1T0HA 4M6VA 4GBQA 3HB9A 2H8HA 1SSHA 2EBPA 4HCZA 1KQSS 1G3YA 2DM1A 4DBRA 1EIFA 5FU7B 5CKEA 1AWJA 2O9VA 4CFMB 3UWNA 3J7AF 3MKDA 1U5SA 4EOJB 3NTIA 4CFVB 2DXCA 2CREA 2DLPA 1ZBXA 4A4FA 2D0NA 1N8RR 2FYKA 3JCMb 4HNTA 1OYXA 2YSQA 5GAOp 2O9SA 3R6OA 2IVWA 1C0MA 2NWMA 2EJ9A 2WSCE 4G6LB 2BE9B 1ZP2A 5IDNB 4CRIA 4BY6C 4J83A 1PD0A 3CPWA 3GIBA 1W1FA 1JB0E 4RG2A 4M7AA 3INZA 2CT3A 2QGFB 4CI0C 2CCHB 1R0BG 2HAXA 2V8KA 1E7PA 3H0IA 5DQWA 2L3QA 1X6GA 3RIRA 1WDXA 5HBEB 2Y4XA 2DILA 1VQNT 2LCSA 4F14A 1RLPC 2ZPGB 4A63B 5GMKh 3CCQT 3VKGA 1WGSA 2VC8A 5D7UA 4B6MA 1YI2T 3J80E 2E41A 3BDUA 4PNOA 2FPFA 1RAEB 2L3PA 4J9CA 4F7UG 1M90R 3EG9B 4KUIA 3S3OA 4ANJA 2RHZA 2QA4Q 1GUXB 1OU9A 2PUOB 2DIGA 1RABB 2CGHA 2DTHA 3JV3A 4C0GA 2DMEA 3QKJA 2EKOA 4F16A 1WI7A 5CKDA 1KG1A 1UNGD 1JSTB 3PTAA 1ACMB 4IIOA 4LUEA 3LW5E 3MP1A 5HCKA 4M75F 2KYMA 3EG0A 4RTTA 2JT4A 5KYXA 4F7SB 2DVJA 3VYGA 4OF1A 1FMKA 2FPDA 3JCMc 2DRKA 4AKHA 4F6SB 4PJOB 3BW1A 1ZHIA 3ME9A 1D09B 1A0NB 1W2BS 2MF2A 4CC3A 2VXFA 1Q7YR 1K0SA 2UZBB 1XJWB 1H1PB 1UEBA 3JCMd 2LX9A 1VQMA 2E10A 2CUDA 2ESWA 4MDWA 1VQKA 2CP6A 5FU7C 3G6EQ 5FGKB 5L2WB 3L2UA 1Y96A 2QQ9A 1U1SA 4PJLA 1WZOA 3VS1A 5ACBA 2DXUA 3G4SQ 4ZTJA 1Q82U 2PUKB 1OZ3A 1NYFA 4BCHB 4C0FA 1TH7A 4IUPA 1YHQT 3CCLT 1W2BP 3CC4Q 1M8MA 1I4K1 1G8XA 2L3SA 1CKAA 1AISB 2RQUA 3EH1A 5HVYB 4TVRA 2RQTA 4ZN3A 1KSWA 3CCSA 1EX4A 1PKSA 2E65A 3CCVA 2JMAA 2XD0A 2RF0A 3HSBA 1N8RU 1I0CA 4R56A 4M77B 3CQTA 4J9HA 5GANh 1MMNA 4DQ2A 4XTZA 4EDUA 2OTLQ 4DBHA 2KE9A 4IUTA 3FEOA 4O5VA 1M1FA 5EG2A 3H6ZA 5CCAA 4FYXB 2EGCA 4XU0A 3QHRB 4FYYB 1K4US 2DNUA 1HXDA 3BLQB 3HRUA 3QUIA 4F7UF 3OY9A 2DPPB 1RI0A 4BDZA 3MEVA 3TU4K 3TW7A 3KFVA 1IO6A 4EC9B 3H8ZA 1AWXA 4E6RA 2OTJQ 2ZCFB 2IVXA 4KGZB 4CFUB 2J6FA 2KROA 2DYBA 2DE0X 1RAHB 2NLUA 1YI2Q 3QZ9B 1H24B 5EFQB 3TNHB 1Z9QA 1UECA 1VYWB 4BCMD 4JS5A 1GCQA 3T9NA 5IXFA 4NSTB 1JSUB 2LVMA 4QT7A 2NUZA 5D6WA 2EKHA 2CP5A 4J5YA 4N0AA 3L2VA 1HSQA 3NPFA 2MWPA 4KBMB 4PJOC 3EFRA 4YOOA 4C92G 3C95A 4D8DA 2DD4A 2EAYA 3SD4A 4C0ZA 2M9UA 1OULA 2MWOA 1NPRA 2DKGA 4DBQA 3H41A 3EFOA 3L2ZA 3FJPA 1QP2A 3OW2P 4AFZC 4F7UE 4QQGA 4BCMB 3RESA 1OI1A 1JQQA 2DIQA 4GY5A 3H0HA 1PSEA 2LZ6B 2W9ZA 2RM4A 1IXDA 3URGA 5IAYA 3L1AA 3UATA 2OAWA 4TTHA 1YJ9Q 1JXOA 2CZ0B 1Q7YU 2X4WA 3EJ1B 3I9QA 3QDFA 1BCMA 2IW6B 3R6NA 2C0OA 3JB9D 2YUNA 1QVFS 4E7KA 2IW9B 1V1CA 3AHUA 2ZPHB 4MFDA 1KK7A 1UTIA 2W96A 2E5KA 4KUDK 1XOVA 4OB0B 2COZA 3JSCA 3MCAB 2QEXQ 5M9OA 2QA4A 2M0YA 2DL5A 1H26B 1MNEA 1M9SA 2E6NA 2DF6A 1YJWQ 2H3JA 3RNJA 1SPKA 1N9SA 4M77C 1KIKA 2XDDA 2LT1A 2K2MA 4RTWA 3VYHB 2XICA 2C5NB 4PJOG 4AKGA 3L2RA 1UDLA 2QG9B 3FJ5A 1ZUYA 4M7DD 4YOSA 4PFPA 3JCMg 1BBZA 2ZZDB 4PJJA 1R77A 2A36A 4Z6YA 3M57A 2CS7A 3M0TA 1YIJQ 3A8GB 4M78A 2AT1B 4BBRM 1O75A 3QZ5B 2QTXA 1VQ4T 3CBMA 5HK3A 3CPWS 2QASA 4ZGDB 2EQIA 2G3RA 3ER0A 1VQ9T 1PKDB 4OB3B 4AG1C 4RMOA 4IUUA 4RODA 2HQHA 2P84A 4M4ZA 3G6EA 5HQ0B 4BCNB 2CP7A 2JTFA 1JO8A 1VQ7A 1RACB 1ZA1B 2AHJB 2QK0A 1M2OA 4C8QD 3QO3A 1SKUB 4BI8B 5LJ5d 2UZLB 1W6XA 3PVQA 2HSPA 2XI9A 4CFNB 4KRTA 4C92F 1SF9A 2EYQA 1R8OB 2DXBA 3QYGB 2CT4A 5DLQE 4LDWA 1Q82C 3OYEA 1X2QA 3CC4A 5CO7A 4LNPA 3P8DA 1AOJA 4M77G 4CXAB 4C5GA 5L8RE 2DD5A 2D8HA 2GFUA 2W0ZA 3OYDA 5GMKj 3CPWP 4JPBW 1M2VB 3X26B 3CCST 1QCFA 3EIDB 2MCNA 2ABLA 2VGMA 3SWNB 1W4SA 4AMCA 1H1QB 1I8FA 2PVOB 2WSEE 1WJQA 1ZQ1A 5KCHA 4Q5WA 4N4IA 2LNHB 4BCFB 2E1HA 2CP3A 2BTTA 2D8JA 2PK2A 3QDRB 2R7GA 2OJ2A 3M03A 2RA2A 3PMIA 1H92A 1M3CA 3ZBDA 1NLOC 3JCMX 3O5ZA 2DBMA 4OMQA 4FW1A 4ZTFA 3PVLA 1SHGA 3RR6A 1P92A 2HQXA 1MMDA 2BUDA 3AT1B 2I40B 2OTJA 5LMKB 1AD5A 4EMKA 4HA8A 2CZ7B 2EWNA 5HKCA 3EHRA 2X3XD 3TNIB 2HL5C 1YI2A 3EGXA 4PJOF 4OMPA 5ECAA 2K6DA 1GBQA 4MZMA 1UG1A 1QMCA 2AKLA 2V8JA 2WFYB 4LUDA 2ZGWA 4MZTA 1KXUA 1RL2A 2DERA 3ZFJA 4F70B 1EFNA 1ZSZA 5GJVB 1V29B 1MV0B 1KHIA 4LDVA 5CYIB 3HKSA 5FWBA 1PHTA 2A08A 3X28B 1Y0MA 2E4HA 3FDRA 2HZYA 4JZ3A 1ABOA 2EW3A 3EGDA 4M7AD 5GAOq 3CEYA 3VV0A 1LPLA 2G6FX 5IH2A 1AVZC 2QXFA 3CD6T 2NUPA 1YJ9A 1YFNA 1VQ4Q 1WJRA 2EQJA 2YT6A 2M1HA 4E7LA 1KFZA 4PJOE 3HHTB 4M75A 3OW2A 4BDYA 1KQ2A 4J9FA 4M77F 1VQLQ 3POMA 3UF4A 4QQDA 1QWEA 5CQXA 4AFQC 1PD1A 3I5SA 1B7TA 1YJWA 1ZLMA 4DA4A 2YLBA 2KT8A 4C8QC 3SWNC 5AYFA 1TFBA 1GY3B 3CC2Q 3VJPA 1JXMA 2MYSA 4O6JA 1IGUA 1YHQA 1OX8A 2J05A 3QXEB 2HBWA 2YRCA 4BCGB 2K79A 3H0FA 4JX4A 1VQ8Q 1GBRA 5KYUA 3V8LA 4QVDA 3UT1A 3CCRQ 5C6SA 2X51A 1N9RA 2JUFA 2IG0A 5J26A 3ASKA 1HD3A 1BI3A 4CC4B 2ZPBB 2QDLA 4BACA 2DX1A 1FVVB 2QDJA 1HJDA 3UA6A 1WJSA 3E19A 4BCPB 5AT1B 3X20B 1H4LD 4ELYC 1M1KC 1N5ZA 4M77E 4OMNA 4B9WA 2RJFA 2IN3A 4YC3B 3LLRA 2L89A 5J39A 4X1VA 4BCJB 1QKXA 2MOXA 2K57A 1BI1A 3A98A 3E1SA 4HLQA 3LQ5B 3QWXX 3KXTA 3G4ST 1Q82R 2DEQA 2CJMB 1TXQA 2CH4W 2YDLA 3V8KA 2AKKA 2LMJA 1JJ2P 2RJEA 4BCQB 4ELZC 3NMZC 1KQ1A 3CC4T 4MZPA 3I56Q 2W99A 3WXMB 4F7UA 1ZUUA 4JJCA 5FROA 1OL1B 2A0FB 1B07A 1Y96B 4QVZA 4J6YA 1CSKA 3M56A 2A3LA 2AK5A 2O4XA 2OTLT 1H641 4JRKA 2K7AA 1KD1C 2GNCA 2K2VA 1T0JA 4ORZA 2QQRA 5CKBA 4BUGA 3MIAB 2BKZB 2DZCA 2YRDA 4LDUA 4JX6A 2C5XB 2W9FA 3BLRB 1ZA2B 3PMTA 2RD1A 1E6GA 2HMAA 3DB3A 3FB9A 3REBB 3CCET 2R5AA 4JJDA 4Z02A 5GAMg 4EPCA 3CD6Q 1SEMA 2OTJT 3TSWA 2L0AA 3OB9A 2KQWA 5LJ3d 5I22A 3HRTA 3EG3A 5CVIA 3VS7A 3E9FA 1N6AA 3MO8A 1X69A 3CC7Q 1RAAB 1S72Q 1FX7A 3HRSA 1WLPB 3M54A
chains in the Genus database with same CATH topology
4XTYA 2F69A 1Y71A 3A8LB 3BG3A 3DLLA 3Q1JA 2KR6A 1VQOT 3CMAT 4MIMA 2NLUA 2KMTA 3QZ9B 1OZ2A 1BIBA 3M4GA 1NE8A 3CPFA 2HQEA 4XU3A 3T9NA 4JS5A 2ZPEB 4LDYA 2XU8A 2LVMA 5A0DA 5GMKi 3MEAA 5D6WA 3M53A 1M4ZA 1UGSB 3MHXA 4J5YA 4JDSA 2DAQA 4N0AA 2K4YA 4A4EA 1X75C 4E7HA 4GLKA 3L2VA 1M8VA 2HNIA 3PIOA 1G3WA 1K9MU 1QVPA 2K3XA 2MWPA 2D9TA 2R57A 2RB6A 3DKMA 4KBMB 3EFRA 1YIJA 2P0KA 2E64A 2LNVA 2DK3A 4C92G 1UGRB 3C95A 4JJNK 2DD4A 2KK4A 2EAYA 3SD4A 3OYNA 4P5NA 4C0ZA 2M9UA 1SSFA 4VUBA 5GAMe 3GPLA 1YCYA 3JCMf 2L3RA 4PLIA 4QQ6A 4M7DG 4KT0E 2DZ9A 1QVGA 2MWOA 5KCOA 5GAN2 3QYHB 3X25B 1NPRA 4M78G 5GMKe 1FWZA 2DKGA 2RK2A 3CCVT 4HCCA 4RKUE 5LJ5g 2XG8D 3L2ZA 2C06A 1N8RC 3FJPA 3OS1A 2FB7A 1QP2A 4JLGA 2LRQA 2O01E 3TEEA 1I5LA 2R5MA 4F7UE 2DO3A 2RHIA 4A53A 2EJFA 4QQGA 5FLXE 1VQ4A 1VQPA 2MMPA 1IREB 4HNVA 1OI1A 4RCBA 4HNUA 3RESA 1W2BA 5LJ3h 1YJ9T 2DIQA 1VQ9A 4NOYA 3X24B 2QDYB 2M16A 3MP6A 3JRZA 4GY5A 1XNIA 1PSEA 2DD4B 1D3BA 4L5GA 1VQ6A 2GCXA 2RM4A 3QIIA 3URGA 4HT8A 5IAYA 3L1AA 2E6ZA 3JAME 1VQLA 4EMKC 3QYEA 3C12A 4NS5A 3VYGB 2CZ0B 4N4HA 1Q7YU 2X4WA 4MMLA 3QJ6A 3FC3A 4C5IA 4BBSM 1X01A 2QEXT 3OBWA 5CKHA 2P0PA 5FU6B 3RUXA 4C92E 3HP9A 4D6WA 3OYCA 3JB9D 1VQNA 3VUZA 4C8QG 1YJWT 1QVFS 4E7KA 4YTLA 3AHUA 2ZPHB 3S6WA 1K8AU 2DXTA 4MFDA 3S3NA 4KUDK 3CCQA 1XOVA 3CC2A 4OB0B 1UB4A 3JSCA 3MCAB 5M9OA 4M78E 2QA4A 3NTHA 4LD6A 3QSUA 4QW2A 2P0QA 1X6OA 1G3TA 1WQ7A 3I55A 1M9SA 2E6NA 5GAOm 1JRIA 2H3JA 3G71A 3FLGA 4XTVA 2RI3A 2G77A 1N9SA 4KULA 5LJ5e 4M77C 5GAMd 5GMKm 3MP8A 5CIUA 2XDDA 2FL7A 2LT1A 2RJDA 3VYHB 2X35A 3LH0A 3H4CA 2WACA 1M90C 4XU2A 2XICA 1VQ8A 3LWHA 3GLXA 2FHDA 4C92D 3PT9A 4PJOG 3HO8A 1K73U 1K9MC 4AKGA 3L2RA 5CK9A 4IUQA 3OS5A 4OP0A 2LQKA 4Y28E 1YIJT 2XK0A 4R55A 2X4XA 1VQ5T 3GNGA 4J7IA 5GANg 3OA6A 4M7DD 4C92A 4II1A 4F7UB 3O8VA 5A2QE 3JCMg 4M78D 1FKMA 2ZZDB 2QI2A 2EFIA 5LJ3f 3JCMh 3HZJA 3OYKA 4Z6YA 3M57A 4M7DA 2CS7A 4XTXA 2BS3A 4FT4A 4A54A 2E12A 4ME7A 4C8QE 1Q81C 3A8GB 4M78A 3S3MA 3WVDB 4LDXA 5GAN4 4BBRM 1O75A 3G7ZA 4M7AC 3QZ5B 3A8MB 3TW6A 2VV5A 3CXCA 3OYHA 2QTXA 1VQ4T 3CBMA 1B34A 3BG5A 2XDPA 4OGCA 5HK3A 1VQPT 1HK9A 2E5QA 2LCCA 3PIPA 3META 4ZGDB 3ER0A 2G3RA 3CPWS 3CCMA 1VQ9T 3JB9F 4OB3B 2EIFA 5A0GA 4IUUA 4RMOA 4JRQA 1VQ6T 4C92B 3VU3C 5GAN6 2JNGA 3UDCA 3MEUA 3G6EA 5HY6A 2JTFA 2BS4A 1VQ7A 1YJNA 3M5AA 5IN1A 2K5FA 2AHJB 3OW2S 1Q86C 3CCMT 4BE1A 1XQHA 1Q7YC 2EQUA 2RK1A 4M78B 3CCJA 4C8QD 4BY6B 5GANj 3QO3A 3RMQA 3GNFB 1M5Q1 3F70A 5D6YA 2LQ8A 4QSHA 2Y4YA 4BI8B 5LJ5d 4J6WA 2RJCA 5IT9E 4L6V5 3JB9I 2XI9A 3I56A 4MDXA 5CQYA 2CZ6B 4C8QA 3BFMA 4C92F 4ELJA 4PL6A 5GANe 5GAOr 2EYQA 1R8OB 2DXBA 2EQKA 3SWNA 1K8AC 1PSFA 2MAMA 2QQBA 3QYGB 5DLQE 3ZEHA 4LDWA 1Q82C 2QA4T 1BYMA 3WVEB 4OGEA 1KC8C 4M7DF 2JVVA 3DLMA 3OYEA 4WF2A 2RH2A 3I55T 2K5LA 5CO7A 2KDSA 5GAMj 3CC4A 3P8DA 5I2MA 3G71T 4M78F 3M9QA 4M77G 4C5GA 5L8RE 5GAN8 4NC6A 4FM4B 2DD5A 2EQMA 3L2WA 4N0AC 2GFUA 3OYDA 3JB9J 5GMKj 1JJ2A 4PJOD 1UGPB 4JLIA 3X26B 3CCST 2OAUA 3CCLA 4XTWA 2XHCA 3OYAA 2VGMA 4JX5A 2QF7A 2R58A 5D6XA 3OS2A 2Y90A 3BDLA 2EJGA 3JB9G 4PJOA 3C94A 3DB4A 3SWNB 1W4SA 3M4YA 3QJYA 2DTIA 4BE0A 4E7JA 5C0MA 1I8FA 2L8DA 2PVOB 2VYTA 2WSEE 4E47A 1WJQA 1ZQ1A 1FXXA 2MI6A 5LJ3g 1BI2A 2LT4A 5KCHA 4Q5WA 1YITT 4HT9A 4N4IA 2ZPIB 4QVCA 2E1HA 3OYIA 4XTUA 1GXIE 2DD5B 5HK0A 5LL6S 3HBLA 3TREA 5GAN5 4IKFA 3QDRB 5FU6C 4ZN1A 2RA2A 3PMIA 3ZBDA 1M1GA 3KBGA 4M7AG 1G5VA 3JCMX 3CD6A 2PU9B 4FL6A 4ZGJB 4C8QF 4ZTFA 1I81A 4NL3A 1QLBA 3QBYA 3JB9H 4MFEA 4EMHA 4L59A 5FRMA 3TCJA 4M75G 2HBPA 1NJIU 1P92A 2HQXA 2BUDA 2K3YA 1QP3A 3CMEA 3A8HB 1S72A 1YBYA 4BD3A 3GP8A 3G6ET 3V8JA 3QYBA 5GANd 2OTJA 2GFAA 4EMKA 4Y91A 3VUBA 1VQ7T 1YJNT 2YLCA 4C0DB 4HA8A 2CZ7B 2EWNA 3M58A 3OMGA 5HKCA 3HFNA 5FRNA 1QVFA 4M7DE 1KHCA 1D3BB 1QW1A 3RKXA 3SFMA 5LJ5j 3HPWA 3LGLA 3CCJT 1YI2A 2I2LA 4PJOF 2XDBA 4M6VA 3HB9A 4N4GA 4MZMA 1O9SA 3SB2A 3MEWA 2V8JA 4FT2A 2KAFA 4BI4A 1KQSS 4HCZA 1G3YA 3V7SA 2ZGWA 4MZTA 4BB7A 3CMAA 3DL1A 4M77D 3LGFA 1EIFA 5LJ3e 1RL2A 2ZPFB 4X34A 2QQAA 4DOWA 5FU7B 3ZFJA 3P8HA 5CKEA 3OYBA 5GAN7 3CCRA 3OYGA 3J7AF 3UWNA 3UPUA 4E7IA 4M77A 1AHJB 1BI0A 2GF7A 1H3ZA 4RCCA 3NTIA 4JS4A 1V29B 3L42A 1UGQB 1KHIA 2DXCA 2K5IA 3QHSA 4J8OA 4LDVA 4M75E 3L2QA 1JJ2S 4MMKA 1ZBXA 3HKSA 3OYLA 3VKHA 4A4FA 4PKCC 2DJZA 2FYKA 3JCMb 2QFZA 4HNTA 1OYXA 4OB1B 3A5ZB 4C92C 2ZCFB 3X28B 5GAOp 3R6OA 2IVWA 4NL2A 2V8IA 3FDRA 2EJ9A 2FVUA 2WSCE 3HFOA 4X9CA 3PFSA 4RG8A 3JCMJ 4M7AD 3JCMQ 4M78C 4LOCA 4CRIA 5LJ5f 3CEYA 5GAOq 3QG1A 2KY9A 1Y7XA 3VV0A 4J83A 4BY6C 1M1KU 3CPWA 3GIBA 4PJOC 3SDZA 1JB0E 2BIVA 4RG2A 2QXFA 3CD6T 4M7AA 3INZA 2QQSA 4M75D 1YJ9A 4C5EA 4CI0C 1WJRA 1VQLT 2EQJA 2HAXA 4JRPA 4M7DB 2M0OA 4OB2B 3OMCA 2HD0A 1E7PA 2V8KA 4A4KA 2A7YA 3FRNA 2M1HA 1VUBA 4E7LA 4PJOE 3HHTB 4M75A 3OW2A 3CMET 2D6FA 4BDYA 2JZ2A 3RIRA 4ATOA 2Y4XA 5GAMh 4HL4A 2RO0A 4BE2A 1B34B 1KQ2A 4M77F 1VQNT 3G4SA 3KUFA 2VXEA 1N27A 5CR2A 2ZPGB 3LYIA 2D0QB 3CBOA 4QQDA 5GMKh 3LX7A 1NPPA 5CQXA 3CCQT 3OS0A 3VKGA 1WGSA 2VC8A 5J3BA 3JCMe 3CC2T 1YJWA 1YI2T 3J80E 2E41A 4DA4A 2YLBA 3BDUA 4PNOA 4C8QC 5CAIA 3P8BB 3GOXA 3HL8A 3E9GA 3SWNC 5AYFA 4F7UG 3EFSA 4KUIA 3S3OA 3A8OB 4XK8E 3OSSC 1Y07A 5GAOl 4M75B 3OYMA 3VJPA 1BKBA 2RHZA 2VGNA 2WJ9A 2JTMA 4O6JA 3V7CA 1YHQA 2PUOB 1VQ8T 2DIGA 5GMKl 4BI3A 2CGHA 2DTHA 5GAN3 3QXEB 4C0GA 4C8QB 2PVGB 3CCRT 1K73C 3QKJA 2EKOA 1M90U 1WQWA 2DXBB 4M7AF 4JX4A 4J7FA 5CKDA 1KG1A 1G3SA 5KE2A 5KH6A 1NZ9A 3LWIA 5I21A 3PTAA 4OMFB 3BG9A 2X4JA 4EMGA 4OVAA 2OTLA 1KD1U 3LW5E 3MP1A 1VQ5A 3M59A 4M75F 3V8LA 4QVDA 3UT1A 2CYZB 5GANf 4ZGEB 4B9XA 5C6SA 4XQ3A 1N9RA 4V2SA 2DVEA 2JUFA 2IG0A 5J26A 3ASKA 2CKKA 2L5QA 1BI3A 1QVGS 4FU6A 2ZPBB 1WPYA 4BACA 4IURA 2QDJA 3VYGA 2QQ8A 3BY7A 4OF1A 4C0DC 3OYJA 1WJSA 3E19A 2CZ1B 1U1TA 3JCMc 3GF5A 1Q81U 4AKHA 4PJOB 3BW1A 3X20B 4ELYC 5LJ5h 1IZ6A 3J81E 1ZHIA 3ME9A 4JUVA 4M77E 3PGGA 3V7RA 3CCEA 1W2BS 1M1KC 5GAMf 2E70A 4B9WA 3CC7A 2VUBA 2MF2A 2VXFA 2XIDA 2RJFA 4J6XA 3RMSA 3C4SA 3LLRA 2XKOC 2L89A 5J39A 1UEBA 3JCMd 2LX9A 4IUVA 3CXCS 1VQMA 2K57A 2E10A 1BI1A 2KSSA 2P4TA 2WSFE 4MDWA 1VQKA 3OBYA 3KHIA 5DM7R 3CCUA 5DLOA 4LD9K 5FU7C 3E1SA 1MHNA 1Q86U 4HLQA 3N5BB 4PLLA 3L2UA 5LJ3j 1Y96A 3KXTA 3G4ST 2KVQG 3M55A 4AI6A 2DEQA 2QQ9A 2X4YA 3PNWC 3I56T 1U1SA 1U8RA 3V8KA 2RI5A 2RJEA 1VQOA 2JOYA 2LC4A 4ELZC 5I2SA 3EAEA 1KQSA 2BKDN 2F5TX 2RI2A 1LNXA 1KQ1A 4M7AE 3CC4T 3JCMP 4EMKB 2BS2A 4AKIA 2DXUA 4FIBA 3OSVA 1VIFA 4MZPA 4ZTJA 4HCBA 1Q82U 3QPHA 2PUKB 1OZ3A 4X9DA 3NTKA 1KC8U 3WXMB 4F7UA 3OYYA 5KE3A 2ZZDA 4C0FA 3RKYA 2LTOA 1TH7A 5FROA 2B8AA 2PQWA 4IUPA 4JRIA 1YHQT 3CCLT 5EJCA 1WNLA 1Y96B 1BIAA 2YHTA 4HKEA 1I4K1 4QVZA 3OQ5A 4ZN3A 4TVRA 4DOVA 5CKFA 4UC4A 5GAOn 2RHXA 3CCSA 3CBPA 4J6YA 3M56A 2A3LA 2O4XA 5A0LA 4M7DC 4A4HA 2E65A 3HSBA 4XAXB 3CCVA 2OTLT 2XD0A 1H641 3NFCA 4JRKA 1N8RU 4R56A 1KD1C 2K2VA 1XTDA 4M77B 3RKWA 3RERA 5GANh 1JBMA 1MGQA 2QQRA 2DTOA 5CKBA 4BUGA 2DXCB 1YITA 2PVDB 4DQ2A 5DY9A 2DZCA 4LDUA 4XTZA 4EDUA 4JX6A 3JCMV 3PMTA 4C5HA 2KMGA 2RD1A 2RHYA 3FEOA 3DB3A 4IUTA 4O5VA 1M1FA 3FB9A 3H6ZA 4XU1A 5EG2A 5CCAA 3CCET 2R5AA 3VKIA 4Z02A 5GAMg 4FSXA 4XU0A 4A4GA 4EPCA 3JCMW 1NJIC 3CC7T 1S72T 2O4XB 1HXDA 1LJOA 1LOJA 2OTJT 3HRUA 3OB9A 3QUIA 4F7UF 2DPPB 1RI0A 3OY9A 4BDZA 2LCLA 2YRVA 2KQWA 3MEVA 4M75C 2QEXA 3TU4K 1VQMT 5LJ3d 3TW7A 3FIFA 3HRTA 5CVIA 2RHUA 2F5KA 3E9FA 1VQKT 1DJ7B 1N6AA 3CCUT 3MO8A 3H8ZA 4M7AB 1FX7A 2LDMA 3HRSA 3QWLA 1VIEA 3M54A 2GQVA 2JN0A 3OYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8L B;  2ZPB B;  3A8G B;  3VYG A;  3WVD B;  2CZ1 B;  3QZ9 B;  3QZ5 B;  3A8M B;  3X20 B;  2ZPE B;  2ZPF B;  4ZGD B;  1UGS B;  4OB3 B;  1AHJ B;  1V29 B;  2WSF E;  1UGQ B;  2DXC A;  1UGR B;  2DD4 A;  2AHJ B;  4OB1 B;  4KT0 E;  3X28 B;  3QYH B;  3X25 B;  4L6V 5;  4RKU E;  2WSC E;  2CZ6 B;  1QP2 A;  2O01 E;  2DXB A;  1PSF A;  3QYG B;  1IRE B;  3WVE B;  2PUK B;  3X24 B;  2QDY B;  1JB0 E;  1PSE A;  2DD4 B;  2ZZD A;  5L8R E;  4FM4 B;  2DD5 A;  4OB2 B;  1UGP B;  3X26 B;  3VYG B;  3HHT B;  2CZ0 B;  2ZPG B;  2D0Q B;  2PVO B;  2WSE E;  2ZPH B;  2ZPI B;  4OB0 B;  1GXI E;  2DD5 B;  2DXC B;  2PVD B;  3A8O B;  4XK8 E;  2PU9 B;  4ZGJ B;  2PUO B;  3QXE B;  3VYH B;  2PVG B;  1QP3 A;  2DPP B;  2DXB B;  3A8H B;  4Y28 E;  1DJ7 B;  2CZ7 B;  3LW5 E;  2ZZD B;  2CYZ B;  4ZGE B;  2ZCF B; 
#chains in the Genus database with same CATH topology
 3M0Q A;  2EUF A;  2E3H A;  3I5R A;  4AFU C;  4BY7 X;  3DLL A;  2EGA A;  2KR6 A;  3M0P A;  3CCU Q;  1NE8 A;  3CPF A;  4F6W B;  4LDY A;  5A0D A;  1H3H A;  1Y57 A;  5GMK i;  3M53 A;  1W70 A;  3MHX A;  4JDS A;  4E7H A;  2K4Y A;  2J6O A;  3CMA Q;  3PIO A;  1G3W A;  2FEI A;  2K3X A;  4KRD B;  1VOL A;  1AWW A;  2E64 A;  2LNV A;  2DK3 A;  1UGR B;  3BHV B;  1UHC A;  2VVK A;  1OL2 B;  2WEV B;  1SSF A;  1X43 A;  5GAM e;  3GPL A;  3JCM f;  2L3R A;  4QQ6 A;  3BHT B;  5KCO A;  2RQW A;  5GAN 2;  3X25 B;  1IGQ A;  4HCC A;  1FWZ A;  2C06 A;  4A53 A;  1VQ4 A;  4WCI A;  2MMP A;  1YJ9 T;  1VQ9 A;  1OKW B;  4NOY A;  3MP6 A;  2ED0 A;  2DEU A;  1XNI A;  2DD4 B;  2GCX A;  2QTV A;  4HXJ A;  1J3T A;  2V22 B;  1VQL A;  4HVV A;  2PNI A;  4N4H A;  2QYZ A;  3FC3 A;  1M27 C;  3O0G D;  4BBS M;  2QEX T;  3A1P A;  1UFF A;  2J06 A;  3HP9 A;  3OYC A;  3BE3 A;  1YJW T;  1PCX A;  4Z8A A;  2AZS A;  2HCK A;  1TUD A;  4IMY B;  1AZG B;  3CC2 A;  2KGT A;  3DJB A;  1D3U B;  3QSU A;  1NYG A;  1F1B B;  1JRI A;  1N4M A;  4XTV A;  2RI3 A;  2G77 A;  4KUL A;  5GMK m;  5ICP B;  2FRW A;  5CIU A;  2RJD A;  3H4C A;  4XU2 A;  1VQ8 A;  2KEA A;  1WHM A;  2XMF A;  2RQR A;  5CK9 A;  2W2H A;  3OS5 A;  2LQK A;  4HCK A;  4Y28 E;  1YIJ T;  2XK0 A;  4EOP B;  3MJX A;  4C92 A;  4DEY A;  1D0Y A;  4M78 D;  1FKM A;  2QI2 A;  3HZJ A;  3OYK A;  4GLM A;  4R0K A;  1VIN A;  2BS3 A;  1M1K R;  4ME7 A;  1F5Q B;  2O88 A;  4C8Q E;  1VQ5 Q;  3D7S B;  5KYW B;  2C5O B;  3WVD B;  1OPK A;  5GAN 4;  3H9N A;  1VYU A;  3OYH A;  2CP0 A;  2O31 A;  2LCC A;  1QKW A;  3RGF B;  1H1S B;  5A0G A;  4HVU A;  5GAN 6;  3VU3 C;  1UHF A;  3CCE Q;  3UDC A;  2OI3 A;  2JW4 A;  1VQP Q;  5IN1 A;  3OW2 S;  3EG9 A;  2RK1 A;  4M78 B;  1WIE A;  4J9I A;  1VQ6 Q;  1GUX A;  3GNF B;  3RMQ A;  3F70 A;  1OKV B;  5GJW B;  2RJC A;  3JB9 I;  3I56 A;  5CQY A;  1UUE A;  4OGR B;  3BFM A;  5GAO r;  4BCK B;  3CCM Q;  4OGE A;  5I5Z B;  3DLM A;  3I55 T;  1GCQ C;  5I2M A;  3G71 T;  2EQM A;  4N0A C;  3NHN A;  3MPU B;  3JB9 J;  1JJ2 A;  2OAU A;  1NEB A;  1C9B A;  4XTW A;  2XHC A;  1KD1 R;  3OYA A;  4JX5 A;  2QF7 A;  5D6X A;  2JTE A;  3OS2 A;  3BDL A;  2EJG A;  4PJO A;  1D1B A;  3DB4 A;  1WYX A;  4BE0 A;  5C0M A;  2L8D A;  4E47 A;  1FXX A;  4F04 B;  2MI6 A;  5LJ3 g;  2L2P A;  4HT9 A;  1GXI E;  2DD5 B;  3TRE A;  3HBL A;  5GAN 5;  1M30 A;  2VWF A;  3CD6 A;  4F6U B;  4J9E A;  2GTO A;  2BZX A;  1BU2 A;  1UJ0 A;  4MFE A;  1VOM A;  3VS3 A;  7AT1 B;  1SHF A;  5FRM A;  2K9G A;  1WHJ A;  1FIN B;  3QWY A;  1NJI U;  2I0N A;  1GFD A;  1QP3 A;  1G3N C;  3A8H B;  1S72 A;  4BD3 A;  5GAN d;  4Y91 A;  3VUB A;  2CP2 A;  1BB9 A;  3HFN A;  1QW1 A;  1D3B B;  3SFM A;  3CCJ T;  3HPW A;  1MMA A;  4OMM A;  2M02 A;  2I2L A;  1WXB A;  4N4G A;  1YJN Q;  4FT2 A;  2KAF A;  4BI4 A;  2LJ0 A;  3CMA A;  2KT1 A;  4OMO A;  3LGF A;  1NLP C;  5LJ3 e;  4X34 A;  2QQA A;  4DOW A;  1QVG P;  3OYG A;  2G9X B;  4M77 A;  1BI0 A;  2GF7 A;  1OI9 B;  3REA B;  2K5I A;  3QHS A;  1QCO A;  4J8O A;  3L2Q A;  3EGX B;  1JOW A;  2PTK A;  2ATC B;  3GBQ A;  4LXC A;  3A5Z B;  2EYY A;  4NL2 A;  2V8I A;  2FVU A;  4X9C A;  1TWB A;  1H1R B;  4RG8 A;  3JCM J;  1PC0 A;  4M78 C;  5LJ5 f;  3JCM Q;  1UE9 A;  4CFW B;  1TOV A;  1Y7X A;  2KY9 A;  1M1K U;  4ZNX A;  1ZSZ B;  5CEI B;  2CDT A;  2ENM A;  2P4R A;  4M75 D;  2YXY A;  4C5E A;  1VQL T;  4JRP A;  4M7D B;  4OB2 B;  1BK2 A;  3OMC A;  3FRN A;  1VUB A;  3CME T;  2JZ2 A;  4AG2 C;  5GAM h;  2RO0 A;  1B34 B;  3G4S A;  2ZAE A;  2VXE A;  5CR2 A;  3LYI A;  2D0Q B;  3CBO A;  3LX7 A;  1GRI A;  1NPP A;  2F2C A;  3CC2 T;  3OS0 A;  5J3B A;  3JCM e;  2FZG B;  3P8B B;  2RN8 A;  2WXV B;  1TS9 A;  3E9G A;  3MY5 B;  4E7S A;  3EOC B;  3A8O B;  2JM9 A;  1YWP A;  4M75 B;  2WHB B;  2VGN A;  4BCO B;  2WJ9 A;  3V7C A;  3NDQ A;  1VQ8 T;  5GMK l;  3I55 Q;  3G71 Q;  4C8Q B;  3CCR T;  4E2F B;  1WQW A;  1NG2 A;  3TNW B;  1G3S A;  1ZSG A;  1K76 A;  5KH6 A;  5I21 A;  4OMF B;  3BG9 A;  4F7J B;  4EMG A;  4OVA A;  2OTL A;  1KD1 U;  1VQ5 A;  2CYZ B;  1RAI B;  4V2S A;  1I5O B;  2L5Q A;  1O9K A;  3G33 B;  4IUR A;  2KR3 A;  3OYJ A;  3BY7 A;  1QLY A;  1Q81 U;  2CZ1 B;  3GF5 A;  2V26 A;  1G83 A;  1NBE B;  8ATC B;  3J81 E;  3CCE A;  4KH0 B;  5GAM f;  2E70 A;  2LW4 A;  2VUB A;  1V76 A;  2XID A;  4J6X A;  3RMS A;  3C4S A;  1U3O A;  4IUV A;  2P4T A;  3OBY A;  3KHI A;  5BNJ B;  2JS2 A;  5DM7 R;  5DLO A;  4LD9 K;  1Q86 U;  3N5B B;  4PLL A;  3VS2 A;  3CCM A;  2KVQ G;  4RTZ A;  2X4Y A;  5IF1 B;  3I56 T;  1U8R A;  3THK A;  3CCJ Q;  1OEB A;  2JOY A;  9ATC B;  2LQW A;  4II5 B;  2EPD A;  5I2S A;  3EAE A;  1BU1 A;  2BKD N;  2F5T X;  2RI2 A;  1LNX A;  2WIP B;  2BS2 A;  4CRL B;  4FIB A;  1VIF A;  4HCB A;  3QPH A;  4X9D A;  1M3A A;  1KC8 U;  3OYY A;  2ZZD A;  2AIR B;  2LTO A;  5KYY A;  5EJC A;  1TUC A;  1WNL A;  1CKB A;  1ZSZ C;  5CKF A;  4UC4 A;  2RHX A;  1KJW A;  4HVW A;  3CBP A;  1WHG A;  1C6V X;  1URC B;  5A0L A;  4M7D C;  2PHG A;  3NFC A;  2GGR A;  2WMB B;  1JBM A;  1MGQ A;  2C6T B;  2DXC B;  2CSQ A;  2MPX C;  4K11 A;  4Y72 B;  2PVD B;  1VYV A;  1YN8 A;  1GH6 B;  2RHY A;  4XU1 A;  3VKI A;  2HKN A;  1NJI C;  4FSX A;  3JCM W;  4A4G A;  3CC7 T;  1S72 T;  2O4X B;  2QAZ A;  1LOJ A;  2LCL A;  4M75 C;  2QEX A;  3FIF A;  2F5K A;  1DJ7 B;  3CME Q;  3CCU T;  4OML A;  4M7A B;  2LDM A;  2C5V B;  3QWL A;  3JB9 G;  1VA7 A;  4AFS C;  2F69 A;  1X6B A;  3A8L B;  3BG3 A;  1M2V A;  3Q1J A;  1K9A A;  1TU0 B;  1VQO T;  3CMA T;  4MIM A;  4KGV B;  2F1L A;  2KMT A;  1C1A A;  1OZ2 A;  3M4G A;  4XU3 A;  2ZPE B;  1MND A;  1M4Z A;  1UGS B;  4A4E A;  2DAQ A;  2ED1 A;  1R0C B;  2HNI A;  1QVP A;  2D9T A;  2R57 A;  2RB6 A;  1YIJ A;  2GTJ A;  1JJ2 S;  1ZBJ A;  4BY1 X;  2KK4 A;  3RDV A;  3OYN A;  4P5N A;  1K0X A;  1YCY A;  4M7D G;  5IXB A;  1QVG A;  3M0R A;  5LJ5 g;  2XG8 D;  2ROT A;  2X9H A;  2WPA B;  3OS1 A;  4EIK A;  2KRS A;  2O01 E;  2EGE A;  4EOL B;  2EJF A;  2NUT A;  5FLX E;  1IRE B;  1RAG B;  1NM7 A;  4RCB A;  4HNU A;  1GFC A;  2B9R A;  5LJ3 h;  2DYI A;  2QDY B;  1OIU B;  4CC7 A;  1P5E B;  2IIM A;  2E6Z A;  1D0X A;  3QYE A;  1OU8 A;  3C12 A;  4NS5 A;  5KYX B;  2J6K A;  3VYG B;  1AD6 A;  1OPL A;  1WA7 A;  2VB6 A;  1X01 A;  5HNB B;  5CKH A;  3RUX A;  4D6W A;  2CCI B;  3VUZ A;  4C8Q G;  4YOZ A;  2I53 A;  1PRM C;  4PJM A;  4BXX X;  3S6W A;  3I35 A;  3S3N A;  1WHK A;  1IHV A;  1S1N A;  4M78 E;  4LD6 A;  1WQ7 A;  3I55 A;  5GAO m;  4ROE A;  3G71 A;  4EOO B;  5LJ5 e;  3EG2 A;  1OQK A;  3MP8 A;  2FL7 A;  1JKW A;  2X35 A;  3LH0 A;  2WAC A;  3SEM A;  3LWH A;  3GLX A;  4C92 D;  3PT9 A;  2UZE B;  3HO8 A;  1K73 U;  1K9M C;  2RQV A;  4OP0 A;  4WTO B;  4R55 A;  2X4X A;  1VQ5 T;  3OA6 A;  3GTM S;  4II1 A;  1ZX6 A;  3O8V A;  2F2X A;  2IPO B;  2YWW A;  5LJ3 f;  5FW9 A;  3JCM h;  2DET A;  3PE0 A;  4FT4 A;  1MMG A;  1Q81 C;  4LDX A;  1LVK A;  3G7Z A;  4M7A C;  3TW6 A;  2CH4 A;  3CXC A;  2EYZ A;  4OGC A;  1VQP T;  2E5Q A;  3MET A;  3JB9 F;  1UJY A;  2EIF A;  2M51 A;  4JRQ A;  1VQ6 T;  4C92 B;  2FO0 A;  2JNG A;  3MEU A;  2NYS A;  1KQS P;  2BS4 A;  3M5A A;  1Q86 C;  2JJ9 A;  3CCM T;  4BE1 A;  2EQU A;  3CCJ A;  2UZD B;  2FRY A;  5D6Y A;  1OGU B;  4QSH A;  2LQ8 A;  4J6W A;  5IT9 E;  4L6V 5;  1PNJ A;  4MDX A;  4EOR B;  2CSI A;  4ELJ A;  4PL6 A;  1K8A C;  1PSF A;  2COY A;  1G2B A;  1BYM A;  3ZEH A;  2YUP A;  1KC8 C;  4M7D F;  2JVV A;  1VQO Q;  4FSS A;  4JZ4 A;  2RH2 A;  5GAM j;  2KDS A;  2KYB A;  5GAN 8;  4NC6 A;  4FM4 B;  3L2W A;  1K1Z A;  4PJO D;  4F7L B;  1QCN A;  4JLI A;  1YWO A;  3SHW A;  2CUB A;  3NGP A;  2Y90 A;  3VS0 A;  2HKQ B;  2VAS A;  2D1X A;  1BI2 A;  2LT4 A;  2ZPI B;  3OYI A;  1T3L A;  2B86 A;  1NJI R;  1PKT A;  4IKF A;  4M7A G;  1M1G A;  3KBG A;  2PU9 B;  2SEM A;  1OV3 A;  2RPN A;  4C8Q F;  4NL3 A;  3DOG B;  1YIT Q;  3QBY A;  3JB9 H;  4EMH A;  2EYX A;  4L59 A;  2C4G B;  2HBP A;  1TTH B;  3EFO B;  3CME A;  2K3Y A;  3G1J A;  5HBJ B;  4KGX B;  3V8J A;  3QYB A;  2GFA A;  1TUG B;  1VYT A;  2LQN A;  1YJN T;  2YLC A;  2ROL A;  4C0D B;  5FRN A;  4M7D E;  3M58 A;  1KHC A;  1H27 B;  1RLQ C;  1TSF A;  2Z0W A;  2RMO A;  2XDB A;  5IHN A;  8AT1 B;  3RBB B;  1VQ7 Q;  1O9S A;  3SB2 A;  3MEW A;  1IRX A;  1WHL A;  2AZV A;  3V7S A;  2KRM A;  4BB7 A;  3DL1 A;  4M77 D;  3VS4 A;  1HYO A;  2ZPF B;  2DRM A;  1D1A A;  3P8H A;  3EH2 A;  3OYB A;  5GAN 7;  3CCR A;  2KXC A;  3UPU A;  4E7I A;  1H3Z A;  1AHJ B;  4RCC A;  4JS4 A;  2QGG A;  3L42 A;  1UGQ B;  4M75 E;  3U23 A;  2GBQ A;  4MMK A;  3OYL A;  3VKH A;  4PKC C;  2DJZ A;  2QFZ A;  4C92 C;  4OB1 B;  1W98 B;  2FPE A;  3HFO A;  3PFS A;  3TN8 B;  4LOC A;  3QG1 A;  2EYW A;  4EON B;  3SDZ A;  4CFU D;  3MI9 B;  1WXT A;  2BIV A;  2VKN A;  2QQS A;  1GL5 A;  3HTR A;  4RTY A;  2ECZ A;  4ESR A;  2M0O A;  2HD0 A;  4A4K A;  5DQV A;  2A7Y A;  2LJ3 A;  5EC7 A;  1TG0 A;  2D6F A;  5I11 A;  4ATO A;  1FYN A;  4HL4 A;  1M3B A;  2LX7 A;  4BE2 A;  1H25 B;  3KUF A;  1N27 A;  4LE9 A;  3M0S A;  4ROC A;  5CAI A;  1VQN Q;  3GOX A;  3HL8 A;  2BZ8 A;  3EFS A;  4XK8 E;  3OSS C;  1Y07 A;  5GAO l;  3CCQ Q;  3OYM A;  2JS0 A;  1BKB A;  1K9M R;  4DBF A;  2JTM A;  2DJQ A;  5IDP B;  2H3E B;  1SRL A;  4BI3 A;  1WHH A;  5GAN 3;  4RTX A;  2PVG B;  4IIM A;  1K73 C;  4E7Z A;  1M90 U;  2DXB B;  2JM8 A;  3LH5 A;  4M7A F;  4J7F A;  2A28 A;  1I1J A;  5KE2 A;  1NZ9 A;  2E3I A;  3LWI A;  2X4J A;  1Q81 R;  4LN2 A;  3VRY A;  3M59 A;  5GAN f;  4ZGE B;  4B9X A;  4XQ3 A;  2DVE A;  1ZUK A;  1QVG S;  2KBT A;  2CKK A;  3DTO A;  2OX7 A;  2LP5 A;  4FU6 A;  1WPY A;  2IW8 B;  2QQ8 A;  4C0D C;  1U1T A;  1OOT A;  4I3Z B;  3TQ7 P;  3VRZ A;  3ULR B;  5LJ5 h;  4UN0 A;  1IZ6 A;  3V7R A;  4JUV A;  5L23 A;  3PGG A;  3F5X B;  3CC7 A;  4RTV A;  1NEG A;  1Q86 R;  2XKO C;  2PMI B;  2KSS A;  2WSF E;  1UNL D;  1UNH D;  3CCU A;  3B57 A;  3ZL7 C;  1O9K B;  1MHN A;  1K8A R;  4JJN K;  5LJ3 j;  3M55 A;  4AI6 A;  3PNW C;  1H8K A;  1KC8 R;  2HEQ A;  4FYV B;  2RI5 A;  1VQO A;  3TSZ A;  2LC4 A;  3E2U A;  1YP5 A;  1KQS A;  1WXU A;  4M7A E;  3JCM P;  4EMK B;  4AKI A;  3BLH B;  3OSV A;  2JXB A;  3NTK A;  5KE3 A;  4EOI B;  3RKY A;  2PJQ A;  2B8A A;  2PQW A;  4JRI A;  2GQI A;  2YHT A;  1BIA A;  4HKE A;  5KYW A;  3OQ5 A;  4DOV A;  5GAO n;  4KRC B;  3C0C A;  1IB8 A;  2C0I A;  1AT1 B;  1YHQ Q;  3CCL Q;  4BCN D;  2C0T A;  4A4H A;  2WMA B;  4XAX B;  1QQJ A;  1XTD A;  3RKW A;  4ELL A;  3RER A;  2RNA A;  4RTU A;  1QWF A;  4D8K A;  2DTO A;  5KYY B;  1YIT A;  1I07 A;  4KH1 B;  5DY9 A;  3QHW B;  4PFZ A;  3JCM V;  4C5H A;  2KMG A;  3EHQ A;  1QVF P;  3CXC S;  2J7I A;  1WX6 A;  1E7O A;  1X27 A;  3DDP B;  4F7N B;  1LJO A;  4Z88 A;  4EOQ B;  3EGD B;  2YRV A;  4PK4 A;  1VQM T;  2RHU A;  4Z89 A;  1VQK T;  1GCP A;  1JU5 C;  4BCI B;  2NUP B;  1VIE A;  2GQV A;  2JN0 A;  2X3W D;  3OYF A;  2W10 A;  4XTY A;  1Y71 A;  1E9H B;  1H28 B;  3M0U A;  1D1C A;  1JEG A;  1SG5 A;  3VS6 A;  1ENW A;  1BIB A;  2HQE A;  4EOM B;  2XU8 A;  3MEA A;  1OIY B;  2PK9 B;  1Z9Z A;  1X75 C;  2HL3 A;  4GLK A;  1M8V A;  1K9M U;  3CXC P;  2DBK A;  3DKM A;  1ABQ A;  2P0K A;  5IHI A;  4PJN A;  4VUB A;  4JJB A;  4PLI A;  1FMV A;  4KT0 E;  2DZ9 A;  3QYH B;  5GMK e;  4M78 G;  2RK2 A;  3CCV T;  1Q95 G;  4RKU E;  2YUO A;  2A37 A;  5IHK A;  1N8R C;  1MV3 A;  2FB7 A;  4JLG A;  3TEE A;  2LRQ A;  4CC2 A;  1I5L A;  2R5M A;  2BZY A;  2DO3 A;  2RHI A;  1VQP A;  4HNV A;  4J9D A;  2KXD A;  1W2B A;  3X24 B;  4CFX B;  2M16 A;  3JRZ A;  5KYU B;  1D3B A;  4L5G A;  1VQ6 A;  3QII A;  4J9B A;  4HT8 A;  4AT1 B;  3JAM E;  4EMK C;  4F17 A;  4EOS B;  1OX9 A;  1EZZ B;  1SRM A;  3QJ6 A;  4MML A;  4C5I A;  2JMC A;  1PM3 A;  3OBW A;  2KI7 A;  2P0P A;  5FU6 B;  4C92 E;  1BCO A;  6AT1 B;  2BE7 D;  2NUT B;  1VQN A;  2COW A;  4YTL A;  4EOK B;  1K8A U;  2DXT A;  1LCK A;  2DL8 A;  3CCQ A;  1UB4 A;  2K3B A;  3NTH A;  3BHU B;  4QW2 A;  2P0Q A;  1X6O A;  1G3T A;  1K73 R;  3FLG A;  5GAM d;  1RUW A;  1M90 C;  1RAD B;  5HBH B;  2MK5 A;  2QGS A;  1XO2 A;  2FHD A;  4IUQ A;  5LQF B;  3GNG A;  4J7I A;  5FWC A;  5GAN g;  3DDQ B;  4F7U B;  2KNB B;  5A2Q E;  2YUQ A;  4OR5 B;  4RUG A;  2DMO A;  2EFI A;  2FZK B;  1QMZ B;  1WFW A;  1X2K A;  1PRL C;  4M7D A;  4XTX A;  4A54 A;  2E12 A;  1PWT A;  3S3M A;  1YCS B;  4J9G A;  3IQL A;  3A8M B;  2VV5 A;  2O2O A;  1B34 A;  3BG5 A;  2XDP A;  1HK9 A;  3PIP A;  1YNZ A;  5IHY A;  1MUZ A;  2V1R A;  1AZE A;  1IHW A;  2DL4 A;  5HY6 A;  1YJN A;  2K5F A;  1VQ9 Q;  1D0Z A;  1Q7Y C;  1XQH A;  4EC8 B;  2LJ1 A;  1VQM Q;  4BY6 B;  5GAN j;  2F2V A;  3EG1 A;  1M5Q 1;  1VQK Q;  2Y4Y A;  1RI9 A;  2JGZ B;  2SRC A;  2CZ6 B;  4C8Q A;  2FG0 A;  5GAN e;  3SWN A;  2EQK A;  2DL7 A;  1U06 A;  2MAM A;  2QQB A;  2QA4 T;  3WVE B;  4WF2 A;  4FX3 B;  1T3S A;  2K5L A;  2DFU A;  2BPM B;  2MIO A;  2V1Q A;  2WIH B;  3M9Q A;  4M78 F;  1RAF B;  1UGP B;  4FW2 A;  3CCL A;  3PO3 S;  2R58 A;  3C94 A;  3M4Y A;  3QJY A;  1PG5 B;  2DTI A;  2EVR A;  4E7J A;  4QKU A;  2VYT A;  1ARK A;  3CCS Q;  2UUE B;  1YIT T;  3MY1 B;  2HSE B;  4QVC A;  2F2W A;  4XTU A;  3CCV Q;  2FZC B;  5HK0 A;  5LL6 S;  5FU6 C;  3UA7 A;  1TD6 A;  4ZN1 A;  3TVT A;  4Y92 A;  5KYN A;  1FMW A;  1G5V A;  4FL6 A;  4FCY A;  4ZGJ B;  4BCQ D;  1I81 A;  1QLB A;  2PZ1 A;  3TCJ A;  4M75 G;  2KRN A;  4FYW B;  2DL3 A;  3EGU A;  4DEX A;  2X1N B;  1YBY A;  3GP8 A;  3G6E T;  3K7A M;  1VQ7 T;  1B3Q A;  1E6H A;  1UGV A;  2HDA A;  3OMG A;  1QVF A;  3RKX A;  2DA9 A;  3VS5 A;  4PFO A;  3LGL A;  5LJ5 j;  1AEY A;  1AWO A;  1T0H A;  4M6V A;  4GBQ A;  3HB9 A;  2H8H A;  1SSH A;  2EBP A;  4HCZ A;  1KQS S;  1G3Y A;  2DM1 A;  4DBR A;  1EIF A;  5FU7 B;  5CKE A;  1AWJ A;  2O9V A;  4CFM B;  3UWN A;  3J7A F;  3MKD A;  1U5S A;  4EOJ B;  3NTI A;  4CFV B;  2DXC A;  2CRE A;  2DLP A;  1ZBX A;  4A4F A;  2D0N A;  1N8R R;  2FYK A;  3JCM b;  4HNT A;  1OYX A;  2YSQ A;  5GAO p;  2O9S A;  3R6O A;  2IVW A;  1C0M A;  2NWM A;  2EJ9 A;  2WSC E;  4G6L B;  2BE9 B;  1ZP2 A;  5IDN B;  4CRI A;  4BY6 C;  4J83 A;  1PD0 A;  3CPW A;  3GIB A;  1W1F A;  1JB0 E;  4RG2 A;  4M7A A;  3INZ A;  2CT3 A;  2QGF B;  4CI0 C;  2CCH B;  1R0B G;  2HAX A;  2V8K A;  1E7P A;  3H0I A;  5DQW A;  2L3Q A;  1X6G A;  3RIR A;  1WDX A;  5HBE B;  2Y4X A;  2DIL A;  1VQN T;  2LCS A;  4F14 A;  1RLP C;  2ZPG B;  4A63 B;  5GMK h;  3CCQ T;  3VKG A;  1WGS A;  2VC8 A;  5D7U A;  4B6M A;  1YI2 T;  3J80 E;  2E41 A;  3BDU A;  4PNO A;  2FPF A;  1RAE B;  2L3P A;  4J9C A;  4F7U G;  1M90 R;  3EG9 B;  4KUI A;  3S3O A;  4ANJ A;  2RHZ A;  2QA4 Q;  1GUX B;  1OU9 A;  2PUO B;  2DIG A;  1RAB B;  2CGH A;  2DTH A;  3JV3 A;  4C0G A;  2DME A;  3QKJ A;  2EKO A;  4F16 A;  1WI7 A;  5CKD A;  1KG1 A;  1UNG D;  1JST B;  3PTA A;  1ACM B;  4IIO A;  4LUE A;  3LW5 E;  3MP1 A;  5HCK A;  4M75 F;  2KYM A;  3EG0 A;  4RTT A;  2JT4 A;  5KYX A;  4F7S B;  2DVJ A;  3VYG A;  4OF1 A;  1FMK A;  2FPD A;  3JCM c;  2DRK A;  4AKH A;  4F6S B;  4PJO B;  3BW1 A;  1ZHI A;  3ME9 A;  1D09 B;  1A0N B;  1W2B S;  2MF2 A;  4CC3 A;  2VXF A;  1Q7Y R;  1K0S A;  2UZB B;  1XJW B;  1H1P B;  1UEB A;  3JCM d;  2LX9 A;  1VQM A;  2E10 A;  2CUD A;  2ESW A;  4MDW A;  1VQK A;  2CP6 A;  5FU7 C;  3G6E Q;  5FGK B;  5L2W B;  3L2U A;  1Y96 A;  2QQ9 A;  1U1S A;  4PJL A;  1WZO A;  3VS1 A;  5ACB A;  2DXU A;  3G4S Q;  4ZTJ A;  1Q82 U;  2PUK B;  1OZ3 A;  1NYF A;  4BCH B;  4C0F A;  1TH7 A;  4IUP A;  1YHQ T;  3CCL T;  1W2B P;  3CC4 Q;  1M8M A;  1I4K 1;  1G8X A;  2L3S A;  1CKA A;  1AIS B;  2RQU A;  3EH1 A;  5HVY B;  4TVR A;  2RQT A;  4ZN3 A;  1KSW A;  3CCS A;  1EX4 A;  1PKS A;  2E65 A;  3CCV A;  2JMA A;  2XD0 A;  2RF0 A;  3HSB A;  1N8R U;  1I0C A;  4R56 A;  4M77 B;  3CQT A;  4J9H A;  5GAN h;  1MMN A;  4DQ2 A;  4XTZ A;  4EDU A;  2OTL Q;  4DBH A;  2KE9 A;  4IUT A;  3FEO A;  4O5V A;  1M1F A;  5EG2 A;  3H6Z A;  5CCA A;  4FYX B;  2EGC A;  4XU0 A;  3QHR B;  4FYY B;  1K4U S;  2DNU A;  1HXD A;  3BLQ B;  3HRU A;  3QUI A;  4F7U F;  3OY9 A;  2DPP B;  1RI0 A;  4BDZ A;  3MEV A;  3TU4 K;  3TW7 A;  3KFV A;  1IO6 A;  4EC9 B;  3H8Z A;  1AWX A;  4E6R A;  2OTJ Q;  2ZCF B;  2IVX A;  4KGZ B;  4CFU B;  2J6F A;  2KRO A;  2DYB A;  2DE0 X;  1RAH B;  2NLU A;  1YI2 Q;  3QZ9 B;  1H24 B;  5EFQ B;  3TNH B;  1Z9Q A;  1UEC A;  1VYW B;  4BCM D;  4JS5 A;  1GCQ A;  3T9N A;  5IXF A;  4NST B;  1JSU B;  2LVM A;  4QT7 A;  2NUZ A;  5D6W A;  2EKH A;  2CP5 A;  4J5Y A;  4N0A A;  3L2V A;  1HSQ A;  3NPF A;  2MWP A;  4KBM B;  4PJO C;  3EFR A;  4YOO A;  4C92 G;  3C95 A;  4D8D A;  2DD4 A;  2EAY A;  3SD4 A;  4C0Z A;  2M9U A;  1OUL A;  2MWO A;  1NPR A;  2DKG A;  4DBQ A;  3H41 A;  3EFO A;  3L2Z A;  3FJP A;  1QP2 A;  3OW2 P;  4AFZ C;  4F7U E;  4QQG A;  4BCM B;  3RES A;  1OI1 A;  1JQQ A;  2DIQ A;  4GY5 A;  3H0H A;  1PSE A;  2LZ6 B;  2W9Z A;  2RM4 A;  1IXD A;  3URG A;  5IAY A;  3L1A A;  3UAT A;  2OAW A;  4TTH A;  1YJ9 Q;  1JXO A;  2CZ0 B;  1Q7Y U;  2X4W A;  3EJ1 B;  3I9Q A;  3QDF A;  1BCM A;  2IW6 B;  3R6N A;  2C0O A;  3JB9 D;  2YUN A;  1QVF S;  4E7K A;  2IW9 B;  1V1C A;  3AHU A;  2ZPH B;  4MFD A;  1KK7 A;  1UTI A;  2W96 A;  2E5K A;  4KUD K;  1XOV A;  4OB0 B;  2COZ A;  3JSC A;  3MCA B;  2QEX Q;  5M9O A;  2QA4 A;  2M0Y A;  2DL5 A;  1H26 B;  1MNE A;  1M9S A;  2E6N A;  2DF6 A;  1YJW Q;  2H3J A;  3RNJ A;  1SPK A;  1N9S A;  4M77 C;  1KIK A;  2XDD A;  2LT1 A;  2K2M A;  4RTW A;  3VYH B;  2XIC A;  2C5N B;  4PJO G;  4AKG A;  3L2R A;  1UDL A;  2QG9 B;  3FJ5 A;  1ZUY A;  4M7D D;  4YOS A;  4PFP A;  3JCM g;  1BBZ A;  2ZZD B;  4PJJ A;  1R77 A;  2A36 A;  4Z6Y A;  3M57 A;  2CS7 A;  3M0T A;  1YIJ Q;  3A8G B;  4M78 A;  2AT1 B;  4BBR M;  1O75 A;  3QZ5 B;  2QTX A;  1VQ4 T;  3CBM A;  5HK3 A;  3CPW S;  2QAS A;  4ZGD B;  2EQI A;  2G3R A;  3ER0 A;  1VQ9 T;  1PKD B;  4OB3 B;  4AG1 C;  4RMO A;  4IUU A;  4ROD A;  2HQH A;  2P84 A;  4M4Z A;  3G6E A;  5HQ0 B;  4BCN B;  2CP7 A;  2JTF A;  1JO8 A;  1VQ7 A;  1RAC B;  1ZA1 B;  2AHJ B;  2QK0 A;  1M2O A;  4C8Q D;  3QO3 A;  1SKU B;  4BI8 B;  5LJ5 d;  2UZL B;  1W6X A;  3PVQ A;  2HSP A;  2XI9 A;  4CFN B;  4KRT A;  4C92 F;  1SF9 A;  2EYQ A;  1R8O B;  2DXB A;  3QYG B;  2CT4 A;  5DLQ E;  4LDW A;  1Q82 C;  3OYE A;  1X2Q A;  3CC4 A;  5CO7 A;  4LNP A;  3P8D A;  1AOJ A;  4M77 G;  4CXA B;  4C5G A;  5L8R E;  2DD5 A;  2D8H A;  2GFU A;  2W0Z A;  3OYD A;  5GMK j;  3CPW P;  4JPB W;  1M2V B;  3X26 B;  3CCS T;  1QCF A;  3EID B;  2MCN A;  2ABL A;  2VGM A;  3SWN B;  1W4S A;  4AMC A;  1H1Q B;  1I8F A;  2PVO B;  2WSE E;  1WJQ A;  1ZQ1 A;  5KCH A;  4Q5W A;  4N4I A;  2LNH B;  4BCF B;  2E1H A;  2CP3 A;  2BTT A;  2D8J A;  2PK2 A;  3QDR B;  2R7G A;  2OJ2 A;  3M03 A;  2RA2 A;  3PMI A;  1H92 A;  1M3C A;  3ZBD A;  1NLO C;  3JCM X;  3O5Z A;  2DBM A;  4OMQ A;  4FW1 A;  4ZTF A;  3PVL A;  1SHG A;  3RR6 A;  1P92 A;  2HQX A;  1MMD A;  2BUD A;  3AT1 B;  2I40 B;  2OTJ A;  5LMK B;  1AD5 A;  4EMK A;  4HA8 A;  2CZ7 B;  2EWN A;  5HKC A;  3EHR A;  2X3X D;  3TNI B;  2HL5 C;  1YI2 A;  3EGX A;  4PJO F;  4OMP A;  5ECA A;  2K6D A;  1GBQ A;  4MZM A;  1UG1 A;  1QMC A;  2AKL A;  2V8J A;  2WFY B;  4LUD A;  2ZGW A;  4MZT A;  1KXU A;  1RL2 A;  2DER A;  3ZFJ A;  4F70 B;  1EFN A;  1ZSZ A;  5GJV B;  1V29 B;  1MV0 B;  1KHI A;  4LDV A;  5CYI B;  3HKS A;  5FWB A;  1PHT A;  2A08 A;  3X28 B;  1Y0M A;  2E4H A;  3FDR A;  2HZY A;  4JZ3 A;  1ABO A;  2EW3 A;  3EGD A;  4M7A D;  5GAO q;  3CEY A;  3VV0 A;  1LPL A;  2G6F X;  5IH2 A;  1AVZ C;  2QXF A;  3CD6 T;  2NUP A;  1YJ9 A;  1YFN A;  1VQ4 Q;  1WJR A;  2EQJ A;  2YT6 A;  2M1H A;  4E7L A;  1KFZ A;  4PJO E;  3HHT B;  4M75 A;  3OW2 A;  4BDY A;  1KQ2 A;  4J9F A;  4M77 F;  1VQL Q;  3POM A;  3UF4 A;  4QQD A;  1QWE A;  5CQX A;  4AFQ C;  1PD1 A;  3I5S A;  1B7T A;  1YJW A;  1ZLM A;  4DA4 A;  2YLB A;  2KT8 A;  4C8Q C;  3SWN C;  5AYF A;  1TFB A;  1GY3 B;  3CC2 Q;  3VJP A;  1JXM A;  2MYS A;  4O6J A;  1IGU A;  1YHQ A;  1OX8 A;  2J05 A;  3QXE B;  2HBW A;  2YRC A;  4BCG B;  2K79 A;  3H0F A;  4JX4 A;  1VQ8 Q;  1GBR A;  5KYU A;  3V8L A;  4QVD A;  3UT1 A;  3CCR Q;  5C6S A;  2X51 A;  1N9R A;  2JUF A;  2IG0 A;  5J26 A;  3ASK A;  1HD3 A;  1BI3 A;  4CC4 B;  2ZPB B;  2QDL A;  4BAC A;  2DX1 A;  1FVV B;  2QDJ A;  1HJD A;  3UA6 A;  1WJS A;  3E19 A;  4BCP B;  5AT1 B;  3X20 B;  1H4L D;  4ELY C;  1M1K C;  1N5Z A;  4M77 E;  4OMN A;  4B9W A;  2RJF A;  2IN3 A;  4YC3 B;  3LLR A;  2L89 A;  5J39 A;  4X1V A;  4BCJ B;  1QKX A;  2MOX A;  2K57 A;  1BI1 A;  3A98 A;  3E1S A;  4HLQ A;  3LQ5 B;  3QWX X;  3KXT A;  3G4S T;  1Q82 R;  2DEQ A;  2CJM B;  1TXQ A;  2CH4 W;  2YDL A;  3V8K A;  2AKK A;  2LMJ A;  1JJ2 P;  2RJE A;  4BCQ B;  4ELZ C;  3NMZ C;  1KQ1 A;  3CC4 T;  4MZP A;  3I56 Q;  2W99 A;  3WXM B;  4F7U A;  1ZUU A;  4JJC A;  5FRO A;  1OL1 B;  2A0F B;  1B07 A;  1Y96 B;  4QVZ A;  4J6Y A;  1CSK A;  3M56 A;  2A3L A;  2AK5 A;  2O4X A;  2OTL T;  1H64 1;  4JRK A;  2K7A A;  1KD1 C;  2GNC A;  2K2V A;  1T0J A;  4ORZ A;  2QQR A;  5CKB A;  4BUG A;  3MIA B;  2BKZ B;  2DZC A;  2YRD A;  4LDU A;  4JX6 A;  2C5X B;  2W9F A;  3BLR B;  1ZA2 B;  3PMT A;  2RD1 A;  1E6G A;  2HMA A;  3DB3 A;  3FB9 A;  3REB B;  3CCE T;  2R5A A;  4JJD A;  4Z02 A;  5GAM g;  4EPC A;  3CD6 Q;  1SEM A;  2OTJ T;  3TSW A;  2L0A A;  3OB9 A;  2KQW A;  5LJ3 d;  5I22 A;  3HRT A;  3EG3 A;  5CVI A;  3VS7 A;  3E9F A;  1N6A A;  3MO8 A;  1X69 A;  3CC7 Q;  1RAA B;  1S72 Q;  1FX7 A;  3HRS A;  1WLP B;  3M54 A; 
#chains in the Genus database with same CATH homology
 4XTY A;  2F69 A;  1Y71 A;  3A8L B;  3BG3 A;  3DLL A;  3Q1J A;  2KR6 A;  1VQO T;  3CMA T;  4MIM A;  2NLU A;  2KMT A;  3QZ9 B;  1OZ2 A;  1BIB A;  3M4G A;  1NE8 A;  3CPF A;  2HQE A;  4XU3 A;  3T9N A;  4JS5 A;  2ZPE B;  4LDY A;  2XU8 A;  2LVM A;  5A0D A;  5GMK i;  3MEA A;  5D6W A;  3M53 A;  1M4Z A;  1UGS B;  3MHX A;  4J5Y A;  4JDS A;  2DAQ A;  4N0A A;  2K4Y A;  4A4E A;  1X75 C;  4E7H A;  4GLK A;  3L2V A;  1M8V A;  2HNI A;  3PIO A;  1G3W A;  1K9M U;  1QVP A;  2K3X A;  2MWP A;  2D9T A;  2R57 A;  2RB6 A;  3DKM A;  4KBM B;  3EFR A;  1YIJ A;  2P0K A;  2E64 A;  2LNV A;  2DK3 A;  4C92 G;  1UGR B;  3C95 A;  4JJN K;  2DD4 A;  2KK4 A;  2EAY A;  3SD4 A;  3OYN A;  4P5N A;  4C0Z A;  2M9U A;  1SSF A;  4VUB A;  5GAM e;  3GPL A;  1YCY A;  3JCM f;  2L3R A;  4PLI A;  4QQ6 A;  4M7D G;  4KT0 E;  2DZ9 A;  1QVG A;  2MWO A;  5KCO A;  5GAN 2;  3QYH B;  3X25 B;  1NPR A;  4M78 G;  5GMK e;  1FWZ A;  2DKG A;  2RK2 A;  3CCV T;  4HCC A;  4RKU E;  5LJ5 g;  2XG8 D;  3L2Z A;  2C06 A;  1N8R C;  3FJP A;  3OS1 A;  2FB7 A;  1QP2 A;  4JLG A;  2LRQ A;  2O01 E;  3TEE A;  1I5L A;  2R5M A;  4F7U E;  2DO3 A;  2RHI A;  4A53 A;  2EJF A;  4QQG A;  5FLX E;  1VQ4 A;  1VQP A;  2MMP A;  1IRE B;  4HNV A;  1OI1 A;  4RCB A;  4HNU A;  3RES A;  1W2B A;  5LJ3 h;  1YJ9 T;  2DIQ A;  1VQ9 A;  4NOY A;  3X24 B;  2QDY B;  2M16 A;  3MP6 A;  3JRZ A;  4GY5 A;  1XNI A;  1PSE A;  2DD4 B;  1D3B A;  4L5G A;  1VQ6 A;  2GCX A;  2RM4 A;  3QII A;  3URG A;  4HT8 A;  5IAY A;  3L1A A;  2E6Z A;  3JAM E;  1VQL A;  4EMK C;  3QYE A;  3C12 A;  4NS5 A;  3VYG B;  2CZ0 B;  4N4H A;  1Q7Y U;  2X4W A;  4MML A;  3QJ6 A;  3FC3 A;  4C5I A;  4BBS M;  1X01 A;  2QEX T;  3OBW A;  5CKH A;  2P0P A;  5FU6 B;  3RUX A;  4C92 E;  3HP9 A;  4D6W A;  3OYC A;  3JB9 D;  1VQN A;  3VUZ A;  4C8Q G;  1YJW T;  1QVF S;  4E7K A;  4YTL A;  3AHU A;  2ZPH B;  3S6W A;  1K8A U;  2DXT A;  4MFD A;  3S3N A;  4KUD K;  3CCQ A;  1XOV A;  3CC2 A;  4OB0 B;  1UB4 A;  3JSC A;  3MCA B;  5M9O A;  4M78 E;  2QA4 A;  3NTH A;  4LD6 A;  3QSU A;  4QW2 A;  2P0Q A;  1X6O A;  1G3T A;  1WQ7 A;  3I55 A;  1M9S A;  2E6N A;  5GAO m;  1JRI A;  2H3J A;  3G71 A;  3FLG A;  4XTV A;  2RI3 A;  2G77 A;  1N9S A;  4KUL A;  5LJ5 e;  4M77 C;  5GAM d;  5GMK m;  3MP8 A;  5CIU A;  2XDD A;  2FL7 A;  2LT1 A;  2RJD A;  3VYH B;  2X35 A;  3LH0 A;  3H4C A;  2WAC A;  1M90 C;  4XU2 A;  2XIC A;  1VQ8 A;  3LWH A;  3GLX A;  2FHD A;  4C92 D;  3PT9 A;  4PJO G;  3HO8 A;  1K73 U;  1K9M C;  4AKG A;  3L2R A;  5CK9 A;  4IUQ A;  3OS5 A;  4OP0 A;  2LQK A;  4Y28 E;  1YIJ T;  2XK0 A;  4R55 A;  2X4X A;  1VQ5 T;  3GNG A;  4J7I A;  5GAN g;  3OA6 A;  4M7D D;  4C92 A;  4II1 A;  4F7U B;  3O8V A;  5A2Q E;  3JCM g;  4M78 D;  1FKM A;  2ZZD B;  2QI2 A;  2EFI A;  5LJ3 f;  3JCM h;  3HZJ A;  3OYK A;  4Z6Y A;  3M57 A;  4M7D A;  2CS7 A;  4XTX A;  2BS3 A;  4FT4 A;  4A54 A;  2E12 A;  4ME7 A;  4C8Q E;  1Q81 C;  3A8G B;  4M78 A;  3S3M A;  3WVD B;  4LDX A;  5GAN 4;  4BBR M;  1O75 A;  3G7Z A;  4M7A C;  3QZ5 B;  3A8M B;  3TW6 A;  2VV5 A;  3CXC A;  3OYH A;  2QTX A;  1VQ4 T;  3CBM A;  1B34 A;  3BG5 A;  2XDP A;  4OGC A;  5HK3 A;  1VQP T;  1HK9 A;  2E5Q A;  2LCC A;  3PIP A;  3MET A;  4ZGD B;  3ER0 A;  2G3R A;  3CPW S;  3CCM A;  1VQ9 T;  3JB9 F;  4OB3 B;  2EIF A;  5A0G A;  4IUU A;  4RMO A;  4JRQ A;  1VQ6 T;  4C92 B;  3VU3 C;  5GAN 6;  2JNG A;  3UDC A;  3MEU A;  3G6E A;  5HY6 A;  2JTF A;  2BS4 A;  1VQ7 A;  1YJN A;  3M5A A;  5IN1 A;  2K5F A;  2AHJ B;  3OW2 S;  1Q86 C;  3CCM T;  4BE1 A;  1XQH A;  1Q7Y C;  2EQU A;  2RK1 A;  4M78 B;  3CCJ A;  4C8Q D;  4BY6 B;  5GAN j;  3QO3 A;  3RMQ A;  3GNF B;  1M5Q 1;  3F70 A;  5D6Y A;  2LQ8 A;  4QSH A;  2Y4Y A;  4BI8 B;  5LJ5 d;  4J6W A;  2RJC A;  5IT9 E;  4L6V 5;  3JB9 I;  2XI9 A;  3I56 A;  4MDX A;  5CQY A;  2CZ6 B;  4C8Q A;  3BFM A;  4C92 F;  4ELJ A;  4PL6 A;  5GAN e;  5GAO r;  2EYQ A;  1R8O B;  2DXB A;  2EQK A;  3SWN A;  1K8A C;  1PSF A;  2MAM A;  2QQB A;  3QYG B;  5DLQ E;  3ZEH A;  4LDW A;  1Q82 C;  2QA4 T;  1BYM A;  3WVE B;  4OGE A;  1KC8 C;  4M7D F;  2JVV A;  3DLM A;  3OYE A;  4WF2 A;  2RH2 A;  3I55 T;  2K5L A;  5CO7 A;  2KDS A;  5GAM j;  3CC4 A;  3P8D A;  5I2M A;  3G71 T;  4M78 F;  3M9Q A;  4M77 G;  4C5G A;  5L8R E;  5GAN 8;  4NC6 A;  4FM4 B;  2DD5 A;  2EQM A;  3L2W A;  4N0A C;  2GFU A;  3OYD A;  3JB9 J;  5GMK j;  1JJ2 A;  4PJO D;  1UGP B;  4JLI A;  3X26 B;  3CCS T;  2OAU A;  3CCL A;  4XTW A;  2XHC A;  3OYA A;  2VGM A;  4JX5 A;  2QF7 A;  2R58 A;  5D6X A;  3OS2 A;  2Y90 A;  3BDL A;  2EJG A;  3JB9 G;  4PJO A;  3C94 A;  3DB4 A;  3SWN B;  1W4S A;  3M4Y A;  3QJY A;  2DTI A;  4BE0 A;  4E7J A;  5C0M A;  1I8F A;  2L8D A;  2PVO B;  2VYT A;  2WSE E;  4E47 A;  1WJQ A;  1ZQ1 A;  1FXX A;  2MI6 A;  5LJ3 g;  1BI2 A;  2LT4 A;  5KCH A;  4Q5W A;  1YIT T;  4HT9 A;  4N4I A;  2ZPI B;  4QVC A;  2E1H A;  3OYI A;  4XTU A;  1GXI E;  2DD5 B;  5HK0 A;  5LL6 S;  3HBL A;  3TRE A;  5GAN 5;  4IKF A;  3QDR B;  5FU6 C;  4ZN1 A;  2RA2 A;  3PMI A;  3ZBD A;  1M1G A;  3KBG A;  4M7A G;  1G5V A;  3JCM X;  3CD6 A;  2PU9 B;  4FL6 A;  4ZGJ B;  4C8Q F;  4ZTF A;  1I81 A;  4NL3 A;  1QLB A;  3QBY A;  3JB9 H;  4MFE A;  4EMH A;  4L59 A;  5FRM A;  3TCJ A;  4M75 G;  2HBP A;  1NJI U;  1P92 A;  2HQX A;  2BUD A;  2K3Y A;  1QP3 A;  3CME A;  3A8H B;  1S72 A;  1YBY A;  4BD3 A;  3GP8 A;  3G6E T;  3V8J A;  3QYB A;  5GAN d;  2OTJ A;  2GFA A;  4EMK A;  4Y91 A;  3VUB A;  1VQ7 T;  1YJN T;  2YLC A;  4C0D B;  4HA8 A;  2CZ7 B;  2EWN A;  3M58 A;  3OMG A;  5HKC A;  3HFN A;  5FRN A;  1QVF A;  4M7D E;  1KHC A;  1D3B B;  1QW1 A;  3RKX A;  3SFM A;  5LJ5 j;  3HPW A;  3LGL A;  3CCJ T;  1YI2 A;  2I2L A;  4PJO F;  2XDB A;  4M6V A;  3HB9 A;  4N4G A;  4MZM A;  1O9S A;  3SB2 A;  3MEW A;  2V8J A;  4FT2 A;  2KAF A;  4BI4 A;  1KQS S;  4HCZ A;  1G3Y A;  3V7S A;  2ZGW A;  4MZT A;  4BB7 A;  3CMA A;  3DL1 A;  4M77 D;  3LGF A;  1EIF A;  5LJ3 e;  1RL2 A;  2ZPF B;  4X34 A;  2QQA A;  4DOW A;  5FU7 B;  3ZFJ A;  3P8H A;  5CKE A;  3OYB A;  5GAN 7;  3CCR A;  3OYG A;  3J7A F;  3UWN A;  3UPU A;  4E7I A;  4M77 A;  1AHJ B;  1BI0 A;  2GF7 A;  1H3Z A;  4RCC A;  3NTI A;  4JS4 A;  1V29 B;  3L42 A;  1UGQ B;  1KHI A;  2DXC A;  2K5I A;  3QHS A;  4J8O A;  4LDV A;  4M75 E;  3L2Q A;  1JJ2 S;  4MMK A;  1ZBX A;  3HKS A;  3OYL A;  3VKH A;  4A4F A;  4PKC C;  2DJZ A;  2FYK A;  3JCM b;  2QFZ A;  4HNT A;  1OYX A;  4OB1 B;  3A5Z B;  4C92 C;  2ZCF B;  3X28 B;  5GAO p;  3R6O A;  2IVW A;  4NL2 A;  2V8I A;  3FDR A;  2EJ9 A;  2FVU A;  2WSC E;  3HFO A;  4X9C A;  3PFS A;  4RG8 A;  3JCM J;  4M7A D;  3JCM Q;  4M78 C;  4LOC A;  4CRI A;  5LJ5 f;  3CEY A;  5GAO q;  3QG1 A;  2KY9 A;  1Y7X A;  3VV0 A;  4J83 A;  4BY6 C;  1M1K U;  3CPW A;  3GIB A;  4PJO C;  3SDZ A;  1JB0 E;  2BIV A;  4RG2 A;  2QXF A;  3CD6 T;  4M7A A;  3INZ A;  2QQS A;  4M75 D;  1YJ9 A;  4C5E A;  4CI0 C;  1WJR A;  1VQL T;  2EQJ A;  2HAX A;  4JRP A;  4M7D B;  2M0O A;  4OB2 B;  3OMC A;  2HD0 A;  1E7P A;  2V8K A;  4A4K A;  2A7Y A;  3FRN A;  2M1H A;  1VUB A;  4E7L A;  4PJO E;  3HHT B;  4M75 A;  3OW2 A;  3CME T;  2D6F A;  4BDY A;  2JZ2 A;  3RIR A;  4ATO A;  2Y4X A;  5GAM h;  4HL4 A;  2RO0 A;  4BE2 A;  1B34 B;  1KQ2 A;  4M77 F;  1VQN T;  3G4S A;  3KUF A;  2VXE A;  1N27 A;  5CR2 A;  2ZPG B;  3LYI A;  2D0Q B;  3CBO A;  4QQD A;  5GMK h;  3LX7 A;  1NPP A;  5CQX A;  3CCQ T;  3OS0 A;  3VKG A;  1WGS A;  2VC8 A;  5J3B A;  3JCM e;  3CC2 T;  1YJW A;  1YI2 T;  3J80 E;  2E41 A;  4DA4 A;  2YLB A;  3BDU A;  4PNO A;  4C8Q C;  5CAI A;  3P8B B;  3GOX A;  3HL8 A;  3E9G A;  3SWN C;  5AYF A;  4F7U G;  3EFS A;  4KUI A;  3S3O A;  3A8O B;  4XK8 E;  3OSS C;  1Y07 A;  5GAO l;  4M75 B;  3OYM A;  3VJP A;  1BKB A;  2RHZ A;  2VGN A;  2WJ9 A;  2JTM A;  4O6J A;  3V7C A;  1YHQ A;  2PUO B;  1VQ8 T;  2DIG A;  5GMK l;  4BI3 A;  2CGH A;  2DTH A;  5GAN 3;  3QXE B;  4C0G A;  4C8Q B;  2PVG B;  3CCR T;  1K73 C;  3QKJ A;  2EKO A;  1M90 U;  1WQW A;  2DXB B;  4M7A F;  4JX4 A;  4J7F A;  5CKD A;  1KG1 A;  1G3S A;  5KE2 A;  5KH6 A;  1NZ9 A;  3LWI A;  5I21 A;  3PTA A;  4OMF B;  3BG9 A;  2X4J A;  4EMG A;  4OVA A;  2OTL A;  1KD1 U;  3LW5 E;  3MP1 A;  1VQ5 A;  3M59 A;  4M75 F;  3V8L A;  4QVD A;  3UT1 A;  2CYZ B;  5GAN f;  4ZGE B;  4B9X A;  5C6S A;  4XQ3 A;  1N9R A;  4V2S A;  2DVE A;  2JUF A;  2IG0 A;  5J26 A;  3ASK A;  2CKK A;  2L5Q A;  1BI3 A;  1QVG S;  4FU6 A;  2ZPB B;  1WPY A;  4BAC A;  4IUR A;  2QDJ A;  3VYG A;  2QQ8 A;  3BY7 A;  4OF1 A;  4C0D C;  3OYJ A;  1WJS A;  3E19 A;  2CZ1 B;  1U1T A;  3JCM c;  3GF5 A;  1Q81 U;  4AKH A;  4PJO B;  3BW1 A;  3X20 B;  4ELY C;  5LJ5 h;  1IZ6 A;  3J81 E;  1ZHI A;  3ME9 A;  4JUV A;  4M77 E;  3PGG A;  3V7R A;  3CCE A;  1W2B S;  1M1K C;  5GAM f;  2E70 A;  4B9W A;  3CC7 A;  2VUB A;  2MF2 A;  2VXF A;  2XID A;  2RJF A;  4J6X A;  3RMS A;  3C4S A;  3LLR A;  2XKO C;  2L89 A;  5J39 A;  1UEB A;  3JCM d;  2LX9 A;  4IUV A;  3CXC S;  1VQM A;  2K57 A;  2E10 A;  1BI1 A;  2KSS A;  2P4T A;  2WSF E;  4MDW A;  1VQK A;  3OBY A;  3KHI A;  5DM7 R;  3CCU A;  5DLO A;  4LD9 K;  5FU7 C;  3E1S A;  1MHN A;  1Q86 U;  4HLQ A;  3N5B B;  4PLL A;  3L2U A;  5LJ3 j;  1Y96 A;  3KXT A;  3G4S T;  2KVQ G;  3M55 A;  4AI6 A;  2DEQ A;  2QQ9 A;  2X4Y A;  3PNW C;  3I56 T;  1U1S A;  1U8R A;  3V8K A;  2RI5 A;  2RJE A;  1VQO A;  2JOY A;  2LC4 A;  4ELZ C;  5I2S A;  3EAE A;  1KQS A;  2BKD N;  2F5T X;  2RI2 A;  1LNX A;  1KQ1 A;  4M7A E;  3CC4 T;  3JCM P;  4EMK B;  2BS2 A;  4AKI A;  2DXU A;  4FIB A;  3OSV A;  1VIF A;  4MZP A;  4ZTJ A;  4HCB A;  1Q82 U;  3QPH A;  2PUK B;  1OZ3 A;  4X9D A;  3NTK A;  1KC8 U;  3WXM B;  4F7U A;  3OYY A;  5KE3 A;  2ZZD A;  4C0F A;  3RKY A;  2LTO A;  1TH7 A;  5FRO A;  2B8A A;  2PQW A;  4IUP A;  4JRI A;  1YHQ T;  3CCL T;  5EJC A;  1WNL A;  1Y96 B;  1BIA A;  2YHT A;  4HKE A;  1I4K 1;  4QVZ A;  3OQ5 A;  4ZN3 A;  4TVR A;  4DOV A;  5CKF A;  4UC4 A;  5GAO n;  2RHX A;  3CCS A;  3CBP A;  4J6Y A;  3M56 A;  2A3L A;  2O4X A;  5A0L A;  4M7D C;  4A4H A;  2E65 A;  3HSB A;  4XAX B;  3CCV A;  2OTL T;  2XD0 A;  1H64 1;  3NFC A;  4JRK A;  1N8R U;  4R56 A;  1KD1 C;  2K2V A;  1XTD A;  4M77 B;  3RKW A;  3RER A;  5GAN h;  1JBM A;  1MGQ A;  2QQR A;  2DTO A;  5CKB A;  4BUG A;  2DXC B;  1YIT A;  2PVD B;  4DQ2 A;  5DY9 A;  2DZC A;  4LDU A;  4XTZ A;  4EDU A;  4JX6 A;  3JCM V;  3PMT A;  4C5H A;  2KMG A;  2RD1 A;  2RHY A;  3FEO A;  3DB3 A;  4IUT A;  4O5V A;  1M1F A;  3FB9 A;  3H6Z A;  4XU1 A;  5EG2 A;  5CCA A;  3CCE T;  2R5A A;  3VKI A;  4Z02 A;  5GAM g;  4FSX A;  4XU0 A;  4A4G A;  4EPC A;  3JCM W;  1NJI C;  3CC7 T;  1S72 T;  2O4X B;  1HXD A;  1LJO A;  1LOJ A;  2OTJ T;  3HRU A;  3OB9 A;  3QUI A;  4F7U F;  2DPP B;  1RI0 A;  3OY9 A;  4BDZ A;  2LCL A;  2YRV A;  2KQW A;  3MEV A;  4M75 C;  2QEX A;  3TU4 K;  1VQM T;  5LJ3 d;  3TW7 A;  3FIF A;  3HRT A;  5CVI A;  2RHU A;  2F5K A;  3E9F A;  1VQK T;  1DJ7 B;  1N6A A;  3CCU T;  3MO8 A;  3H8Z A;  4M7A B;  1FX7 A;  2LDM A;  3HRS A;  3QWL A;  1VIE A;  3M54 A;  2GQV A;  2JN0 A;  3OYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...