3HHTB

A mutant of the nitrile hydratase from geobacillus pallidus having enhanced thermostability
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLALGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFSKKPDTKIPRREDPALVKLVEKALNDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution structure of a Cobalt containing nitrile hydratase
rcsb
source organism Geobacillus pallidus
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 65
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hhtB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hhtB02
1GXIE 3WVEB 2PVOB 4L6V5 2PVDB 2DXCA 2ZPBB 2CZ6B 4ZGEB 5L8RE 4OB2B 3QYGB 2O01E 2WSEE 2PUOB 2ZPHB 3WVDB 2DXBB 1PSEA 2ZCFB 3A8LB 3X20B 2DPPB 2CZ1B 1DJ7B 3VYHB 3QYHB 4XK8E 1UGPB 4OB1B 3A8GB 3QZ5B 2DD5B 2DD4A 3HHTB 2ZPIB 4OB3B 2ZPEB 2AHJB 3A8HB 2CZ0B 2ZZDA 3QZ9B 2ZPFB 2PVGB 3X25B 3VYGA 3X28B 3X26B 2D0QB 2DD4B 2ZZDB 2DD5A 1QP2A 1QP3A 3A8MB 4FM4B 2WSFE 1UGSB 3X24B 1V29B 2DXCB 2PU9B 1AHJB 2WSCE 3QXEB 3A8OB 1UGQB 4ZGDB 2CYZB 4OB0B 2PUKB 1IREB 2DXBA 1UGRB 2ZPGB 4ZGJB 3LW5E 4KT0E 4RKUE 3VYGB 2CZ7B 1JB0E 1PSFA 4Y28E 2QDYB
chains in the Genus database with same CATH superfamily
4JS5A 2FB7A 5GAN4 1VQ6A 4X9DA 1GXIE 2QQ8A 3M0TA 4M78B 1NJIU 2D9TA 4ZTJA 1D1CA 4BCKB 3OYKA 4J5YA 1KD1R 3OBWA 3HZJA 3HTRA 1LJOA 1WQ7A 2JZ2A 2KRNA 3VS7A 3GPLA 3CCST 2A37A 5LJ5f 3CCRT 1KQ1A 3H0IA 5L8RE 2DNUA 4C92B 5FGKB 3CCEQ 2DJQA 3EG9A 3L2ZA 2LT4A 1OV3A 2E64A 4F6SB 3JCMc 2XMFA 1QVFP 4CFVB 1ZLMA 2DZ9A 2AK5A 3BG9A 4NC6A 2CZ1B 1ZBXA 3QWYA 1AD5A 3OYEA 1G3YA 1M27C 2EKHA 4RG8A 1YJWT 2YUQA 1SHGA 1V1CA 4BY7X 4KBMB 3JCMh 4BDYA 1IRXA 3LYIA 4EMGA 3I56T 2LW4A 2HBPA 2RI5A 1FMWA 1M1KR 2FZGB 3O5ZA 1ARKA 2RQWA 2DL7A 3RR6A 4C92C 2EIFA 4E7IA 1RAEB 2C6TB 3OS1A 2RQRA 4BY1X 3QSUA 1SHFA 4E7KA 2OX7A 1QP3A 2JN0A 4M7DF 4LDXA 1MGQA 2JOYA 2M51A 3EG3A 4M75B 4A63B 4FL6A 2NLUA 3KUFA 3OYBA 3VRYA 5IDPB 5HVYB 2ABLA 5IXFA 1VQ9T 3CC2T 1RI9A 2DYBA 3SWNC 1VQ7Q 2CREA 2ZPGB 1D09B 2LJ3A 1FX7A 1K9AA 2EYZA 4Y28E 1JSUB 1Q95G 1N9SA 3CCVT 2FL7A 2V8IA 3I9QA 4K11A 5GMKh 2NWMA 2RB6A 3M54A 4CFNB 3RKWA 5GANd 1VINA 3QWLA 3A5ZB 2P84A 5D7UA 3E2UA 2LNHB 1M9SA 3HRTA 1JKWA 1RAAB 2Y4YA 3CCJT 2CT4A 2D8JA 3EAEA 4CRLB 1GBRA 3N5BB 4QQDA 4AG2C 4C92G 4RTWA 2KXCA 1WNLA 2QG9B 2KROA 1VQ9Q 4YC3B 3SWNB 4BCJB 2CP5A 4R56A 4OB1B 5HQ0B 1PD0A 4GBQA 1YIJA 3CXCA 1H3HA 1NYFA 1I4K1 3TCJA 1YITQ 3WXMB 4TVRA 2QTVA 1M1GA 3LQ5B 3DLMA 1M30A 5GANh 2GF7A 2W2HA 4E7HA 2RQUA 5IH2A 4M7DE 4ZTFA 5LJ3g 1HD3A 2FVUA 3MEVA 1N8RR 1VQMA 3GIBA 2PVGB 4J9GA 2PK9B 4HCBA 1KIKA 5CKEA 3CPFA 2CP7A 2JUFA 2WHBB 2HMAA 4LDUA 1B7TA 1G83A 4PJLA 2G9XB 1K8AU 2C5OB 3J81E 1WHMA 2COZA 2F69A 2HKQB 5KH6A 3O8VA 1I5LA 2X3XD 4C92A 3EHRA 1VQ9A 4M7AF 1SKUB 1YJNQ 3S3MA 1MV0B 1VQKA 4QVZA 2DF6A 2ZGWA 1QVGA 4WF2A 3JCMd 5L2WB 1EZZB 3M0PA 1NPPA 2K79A 5GAOp 2EYWA 4GLMA 3RIRA 1YITT 1H1SB 5FU6C 2DO3A 3ME9A 2WMAB 4JDSA 3ULRB 2OJ2A 4FT4A 2DXUA 3VV0A 5CKDA 2QQRA 1U1SA 2YHTA 3HL8A 3M0SA 2FZCB 1B34B 2RA2A 4M6VA 3JRZA 2GQIA 2FZKB 2UZLB 3QYBA 2GQVA 2E1HA 1KJWA 1PWTA 1ZSZA 3QPHA 3ZBDA 1E7OA 2ED1A 1RI0A 2XKOC 2IN3A 5GAMh 3CMAT 2BKDN 7AT1B 4HVWA 1YJNT 2RJCA 4A4GA 3JB9J 2CCIB 2FPDA 3I35A 3BW1A 5CKBA 5FU6B 3DKMA 3DB3A 4M7AA 2DXTA 3NHNA 3VS2A 1VQLA 2DMEA 1OZ2A 2G6FX 1X6GA 2HD0A 4LD6A 1M1KU 1VQOA 3V7RA 2JVVA 5FROA 2DEUA 1OQKA 4BY6B 1FMVA 5KYNA 1TWBA 4PFPA 2RI2A 4FYVB 4EOQB 4BD3A 5LJ3d 2EGEA 2IIMA 4YOOA 2EBPA 1ABOA 4HVVA 1PKTA 1H26B 3MP1A 1Q81R 1JOWA 5GMKl 2CSIA 3FB9A 4FW1A 3JB9I 2D6FA 3M55A 2CZ0B 4E7JA 2ZPFB 1HJDA 3LWHA 4C8QE 3TQ7P 4IKFA 2W96A 2RPNA 3X26B 1ENWA 4LXCA 3J80E 2O4XA 3CCQQ 3EIDB 3JCMe 4M78E 5GANf 2JW4A 3QG1A 1SG5A 5DLOA 3I5SA 4OGRB 2YRDA 2EVRA 4QT7A 1H25B 4F7NB 5DLQE 1TOVA 2VC8A 1NLOC 1QCNA 2LX7A 2K3XA 1UNHD 1VOLA 1K1ZA 4OVAA 1UGQB 2JM9A 5KYYB 5CCAA 3CPWA 2EYXA 4JRPA 1VQNT 3L2QA 3TNWB 4RTVA 4Y91A 4B6MA 1XO2A 4HCZA 3UA6A 1AZEA 3JB9F 4OR5B 1VQLQ 4X1VA 3GTMS 5I2MA 2BS3A 5I5ZB 3KXTA 3GP8A 4BDZA 1OKWB 1MMNA 3OMGA 1G2BA 5L23A 2CP0A 3JB9G 2GTJA 4F7UE 3CD6A 3TVTA 3PIOA 9ATCB 2F5KA 2E3HA 1PG5B 2ESWA 1M1FA 2EGAA 4JS4A 4OB2B 1X01A 1VQKQ 2M9UA 1UJYA 3F70A 1VQ6Q 3CCVA 3M0QA 4C8QF 3VS1A 2KGTA 5LL6S 2E4HA 4F7UG 1NYGA 2EQUA 3IQLA 3MCAB 2H3JA 4M75F 1MMAA 1RAFB 2XDDA 4M7DB 1U5SA 2NUTB 2UZBB 1TUDA 1ZHIA 4LN2A 4C0FA 4PKCC 1N8RU 4FYXB 4AFZC 1O9KB 3VU3C 1Q7YU 5CQXA 1FYNA 3OS2A 2Y4XA 4PJOB 2RHUA 2RF0A 5LJ3e 3GLXA 3GNFB 1E6HA 1H1PB 1URCB 3MY5B 1BU1A 3OYYA 2CGHA 3CEYA 1GFCA 2HEQA 4BCNB 3MEWA 3VKHA 2D0QB 2VB6A 4DOWA 3P8BB 1X75C 4Y72B 3G6EA 4RTUA 4BCQB 2BS4A 1ZP2A 4AKGA 2ECZA 5C0MA 3JSCA 3CMAA 1AWJA 2RJFA 4MMLA 2KRMA 1QVFA 1AVZC 2EQJA 3G4ST 5C6SA 3OYHA 4M7AD 1NLPC 2PJQA 3CCUT 3ZEHA 1EX4A 1VQ5T 2BIVA 2LRQA 3UDCA 4J9BA 4M77F 2R58A 4QW2A 1VQ7A 2A3LA 3HBLA 2K57A 4LNPA 2BZYA 3MY1B 2LCCA 2CUDA 2C5XB 1O75A 5KYUB 2DERA 2BPMB 4MFDA 1OOTA 3CCMT 3S3OA 4Z88A 2J06A 4EOJB 4NSTB 4M78A 1I0CA 3GF5A 4B9XA 1M1KC 3OW2S 2VYTA 3PTAA 1K4US 1WJSA 3OA6A 1S72A 2EQMA 4KRDB 4QQ6A 3UA7A 3MI9B 1N6AA 2OI3A 3OY9A 2CZ6B 4XQ3A 2O4XB 4UC4A 3EG1A 5FWBA 3QYGB 2A36A 5CAIA 2G77A 4XTZA 1S1NA 1Q7YC 2PUOB 1E9HB 1O9SA 3WVDB 1GUXB 1VYWB 4AKIA 3JB9H 4ATOA 1PSEA 1X6BA 3CMET 2DEQA 2YRCA 3ZL7C 2ATCB 4J9EA 1D3BB 3OSSC 1OZ3A 3C4SA 2C0IA 2EKOA 3QZ5B 3LH0A 4C8QB 1D0XA 4DBFA 1Y96A 1AZGB 4BACA 1FWZA 2DL8A 2DTOA 4LDWA 5EJCA 1NEGA 1H92A 2XDPA 2GCXA 2O9VA 2EFIA 4IUPA 4QQGA 3FJ5A 3OSVA 2KAFA 5FRMA 4PJOC 4BCGB 4OGCA 4D8DA 3G1JA 4HCKA 1GFDA 1Q82R 3E19A 4HNTA 1WJQA 4X34A 4ZN3A 4F7SB 3OW2P 5GAOr 2EYQA 1JBMA 3I5RA 4IIOA 1MHNA 1QVPA 4M4ZA 1WYXA 2DXCB 4BCQD 3LGLA 3TU4K 5GMKm 2I2LA 5A2QE 1YJ9T 1LVKA 1SPKA 1YJ9A 3CQTA 1G3SA 3CCMA 1KQSA 1Y7XA 2K5IA 4O5VA 2XG8D 2RD1A 4ROEA 4M77D 2DTHA 2HDAA 5EG2A 2RH2A 3O0GD 2KDSA 5ACBA 4J83A 3CD6T 2JM8A 2CKKA 5LJ3f 1ZA1B 5KCOA 2MWPA 3CC7Q 4CFWB 2H3EB 3M0RA 3JCMJ 4ZN1A 3L1AA 1M90C 5KYWA 3TSWA 1YCYA 3G6EQ 4II5B 1UNGD 1W98B 1QQJA 2DXCA 3SHWA 3PE0A 4CXAB 2LQWA 2MMPA 5KCHA 2CH4A 1JU5C 2C5NB 4BCIB 2LJ0A 3CBMA 2KMTA 2QK0A 2JTMA 1VQ4Q 2FRYA 3EOCB 4E7LA 4BE0A 1VUBA 4AKHA 3OBYA 2RK2A 2CH4W 1H27B 2OTJQ 3OYDA 1VQPT 4TTHA 3UT1A 4F6WB 1YHQQ 4FSSA 2DPPB 2XDBA 2XD0A 3QDRB 3TNHB 2C0OA 4IUTA 4XK8E 4OMNA 3TW7A 1UE9A 1I81A 5EC7A 4HT8A 5KYXA 2IW9B 2ROTA 1WHJA 2H8HA 2SRCA 3E9GA 3SFMA 2K3YA 3A98A 4OMQA 3TNIB 3Q1JA 3SWNA 3RGFB 3BG5A 4AI6A 4PJNA 2DE0X 1KC8C 1UHFA 2YUOA 4BCFB 1BI3A 2LMJA 5A0GA 2YUPA 3S3NA 1AWXA 2IG0A 2MK5A 2J6KA 5GAN7 3X28B 1IO6A 1OX9A 2OAUA 2DD4B 5IF1B 2P0QA 3LGFA 4C8QA 4EOSB 4EOIB 4PNOA 2HNIA 1OU8A 1UJ0A 4AFSC 2DL4A 3A1PA 2O31A 2IVXA 2QDLA 2GFAA 4OMMA 5GANe 1BCMA 3VS6A 4YOSA 3QIIA 2QI2A 1FINB 1H3ZA 4RMOA 2LZ6B 2JS2A 1OPKA 3TREA 4YOZA 3NPFA 3QXEB 2L5QA 1WFWA 3H4CA 4PLLA 3CXCP 1B34A 4N4GA 3RKYA 1AT1B 1BCOA 1K9MR 4JLIA 5LJ5h 2VXEA 4M77C 3POMA 2AKKA 1K73R 4JZ4A 4L5GA 3WVEB 3RDVA 3CCJA 3FC3A 3CCET 3OYFA 3GOXA 5KYXB 2SEMA 3OMCA 4J6WA 4FX3B 4BCPB 3BFMA 2LVMA 1UGVA 1I07A 2DK3A 2X4JA 8ATCB 1OULA 3M03A 2J05A 2A28A 2ZCFB 2ROLA 4CC7A 3EGXA 2QGGA 2W0ZA 2MCNA 2P4TA 1DJ7B 1QMCA 1AWWA 4M7DG 4P5NA 5LJ5e 1I5OB 4BB7A 1VA7A 2RMOA 1WHHA 3CPWS 3EFSA 1NEBA 4MFEA 3HP9A 2C4GB 3LLRA 4PJJA 4PJOA 3I56Q 2RI3A 2DD4A 2K6DA 1UFFA 1VQ5Q 4M7AE 1NM7A 4E47A 4EOLB 3EG9B 3UATA 1YBYA 2DMOA 4XTYA 1YWPA 2B9RA 1B07A 1VQ8Q 3KFVA 4JX6A 3GBQA 5CVIA 2D0NA 3UWNA 1KD1U 2AZSA 2VKNA 2C06A 1OX8A 2FRWA 1WJRA 1RLPC 5FWCA 2W9FA 1QP2A 4EOPB 4AG1C 2K4YA 1IB8A 1WXBA 3M59A 2OTJA 1NPRA 4ZNXA 2LP5A 5GAOm 2X1NB 1AD6A 2LCSA 2L3RA 2PU9B 4MDWA 4PLIA 3CMEA 1AHJB 2YSQA 1TSFA 2WSCE 1TTHB 3S6WA 2DFUA 1R0CB 2CP6A 3EH2A 5I21A 4FSXA 4Z89A 1X43A 2X4XA 1YI2Q 2P0PA 2DXBA 2HL5C 4DOVA 5LJ5j 1JJ2P 4UN0A 4V2SA 5GAOn 3OYGA 3UF4A 4A4KA 1M90U 4JRKA 3VYGB 4HLQA 2K7AA 2EPDA 4AFQC 4EPCA 1IHVA 1SSFA 2QDYB 2WIHB 1VQMT 3MEAA 1VYVA 4J8OA 4XTUA 5FLXE 1HXDA 1V76A 5LMKB 3L2RA 2WSEE 2KR3A 3G71A 2QEXT 3CCUA 1D0YA 4F70B 2MF2A 4M75E 5FRNA 1KD1C 3G7ZA 5IXBA 4RTZA 1UGPB 4M78D 5GAOq 1MMDA 3M4YA 3VS0A 2QGSA 4RG2A 2HCKA 2M0YA 4HNUA 4C8QG 1VQPA 1MNDA 3MPUB 2G3RA 1UDLA 2RJEA 3RERA 4C0DC 3EHQA 1WDXA 1FVVB 2E65A 1IHWA 1M3CA 2JT4A 2DA9A 3TN8B 2L8DA 4M75G 2E70A 3JV3A 1IGQA 3QO3A 1KQSP 1WXTA 5DY9A 1NBEB 2R5MA 2E6ZA 2QASA 4DQ2A 1WIEA 2WMBB 2BZXA 5HY6A 1WXUA 1VQOQ 4PL6A 4J9DA 1U1TA 3PNWC 3CC4Q 1Y57A 3VUZA 4GLKA 2P0KA 2YLBA 1QLBA 4C0GA 3QHRB 2GTOA 3BDLA 3NDQA 3META 2EWNA 4FW2A 1GL5A 1ZSZB 2BKZB 1UG1A 2E12A 4R0KA 2AZVA 2KI7A 4DEYA 3DDQB 2WJ9A 2DLPA 2WPAB 2CS7A 2CT3A 2PHGA 3HFNA 1VQ8A 3QJ6A 3R6OA 4JUVA 3BHTB 1UTIA 4KT0E 5HBJB 4M75A 3CCUQ 1K73C 3LH5A 4F17A 1AWOA 3TSZA 1GCQA 4XTWA 4A4EA 4A4HA 3OYNA 1BI2A 1UUEA 4L59A 5HKCA 1YNZA 2F2WA 3M56A 1M3BA 1GH6B 4CC3A 1BYMA 3FIFA 3QHWB 4ZGEB 3QDFA 4OF1A 3OW2A 1U8RA 4M7DA 1Y71A 4ESRA 2CP2A 5D6XA 2WXVB 4RTYA 1YI2A 2DRKA 1Q81U 2UUEB 4EMKC 3DDPB 1YCSB 1YWOA 3NTKA 2MI6A 5GAMd 1U3OA 5CQYA 2EJ9A 2R7GA 1R0BG 1YJ9Q 1D3BA 1H8KA 3HB9A 1Q81C 1VQ8T 3LWIA 5CK9A 1SF9A 4C0DB 1VQ6T 3CBPA 2RNAA 4QVDA 3BLRB 1PKDB 1HK9A 3VS3A 4M78F 1C6VX 1D1AA 5ICPB 2UZEB 2JS0A 4JX4A 5GAOl 1W2BP 2JJ9A 4LD9K 1IXDA 2EAYA 3QWXX 4BCOB 1TUCA 4EMKA 1W4SA 3HRSA 3M5AA 2DL3A 2D1XA 4F7UF 3C95A 5IDNB 2VGNA 3DL1A 3H9NA 2KE9A 2HSPA 2CCHB 1G3TA 2QAZA 4F14A 2W9ZA 3OYMA 3HSBA 1RABB 4E6RA 2DAQA 1RAGB 1GCPA 5D6WA 4XU3A 1FXXA 2DX1A 3JCMX 2R5AA 4ELJA 1OPLA 3OYIA 2WIPB 4CC4B 5KYUA 3EFRA 4C92D 1VQNQ 5GANg 1NJIR 4HCCA 2UZDB 1ZSZC 4YTLA 2L2PA 3SB2A 3CCJQ 3KBGA 3M0UA 3G71Q 1PSFA 3MEUA 5KE2A 1VQLT 1C1AA 2M02A 4RUGA 5HK0A 2RK1A 4DBHA 1W6XA 5M9OA 1T0JA 3BY7A 4JJCA 2WFYB 1ABQA 4EC8B 4LUEA 3C94A 5A0LA 4M78C 1A0NB 4BCHB 1PHTA 4BY6C 2CSQA 4A4FA 1ZUKA 4QKUA 2QTXA 4M77G 2C0TA 4O6JA 4FCYA 2DXBB 2QA4T 3X20B 5LJ3j 2RHXA 4MZPA 3CCSQ 2LQ8A 3HPWA 2KMGA 3FRNA 4XU0A 5GMKj 3NGPA 4JRQA 1EIFA 1T0HA 4M75D 1SEMA 2V1RA 5GMKi 1XTDA 2GFUA 4M77E 1YHQA 4HXJA 1K9MC 2MPXC 5GAN8 3RBBB 1GY3B 3V8JA 1JSTB 5A0DA 2CP3A 1W70A 4C8QD 3J7AF 4KGXB 2VWFA 4N4IA 2LDMA 5CO7A 4E7SA 2KBTA 1HYOA 1XQHA 4C92F 2DBMA 2ZZDB 2DVJA 2HKNA 4E2FB 2KNBB 1PD1A 4FT2A 4LOCA 3HRUA 2QGFB 5LJ5g 2EW3A 3NTHA 1TG0A 1G5VA 5GAMj 1JO8A 5GAN3 2O2OA 4KGZB 1TU0B 4M75C 2WEVB 3JB9D 3TW6A 3BG3A 3L2VA 2O88A 2QFZA 1OYXA 2J7IA 2YXYA 1BKBA 5ECAA 3FDRA 5BNJB 4LUDA 3H0FA 2QEXA 1SRLA 1E6GA 4F16A 4NL2A 1YFNA 3BDUA 2J6OA 5CYIB 4LDVA 2AIRB 4N0AC 2W10A 1KXUA 1M3AA 3QYEA 1OI1A 3SDZA 1CSKA 4DBRA 2CDTA 2DKGA 2QF7A 3MP8A 1QWFA 1X27A 3CBOA 3CC7T 3CC2A 4FYYB 2AT1B 4F04B 1PNJA 2E41A 2O01E 1GCQC 1I8FA 1OU9A 4MIMA 2GNCA 2PZ1A 4GY5A 4DBQA 1TFBA 3L42A 2P4RA 1QMZB 5IN1A 4AT1B 3CC4T 2QQ9A 3BLQB 2V22B 1VQNA 2Y90A 2JMCA 3EGXB 2A08A 2E5KA 4X9CA 2M16A 5AYFA 1GUXA 2RHZA 1N27A 2F5TX 3PVQA 1VIEA 2ZPIB 2EJFA 4D8KA 4M78G 3G4SA 4EONB 4EOKB 1WA7A 2JXBA 4CFUD 1Y0MA 3ZFJA 3CCLQ 1M2VA 1P92A 1YJNA 4PFZA 1VOMA 2X4WA 2FEIA 3EH1A 3BLHB 4BE1A 2XIDA 2LCLA 3X25B 3I56A 2X9HA 2KY9A 4BXXX 1EFNA 2DD5A 1TS9A 3FEOA 1Q82C 1U06A 2XHCA 4BUGA 3JCMg 4AMCA 2BE7D 2MOXA 3LX7A 4BBSM 3BHUB 4KH0B 3V8LA 2I53A 2KRSA 4LE9A 4XU1A 4RCCA 3E1SA 2QEXQ 1UNLD 3M58A 2DJZA 4Z6YA 1X2KA 3B57A 1UEBA 4CRIA 1ZBJA 5IAYA 4KRTA 4EDUA 2V8JA 4PJOG 2KSSA 3EG2A 4ZGDB 4BCND 1KK7A 2E10A 1JQQA 3JCMW 3M53A 1RAHB 1OKVB 1YN8A 1G3NC 3DOGB 4RKUE 4M7DC 2YWWA 5IHIA 1H1RB 1WI7A 4J6YA 3CCVQ 4PK4A 3JCMV 4IUUA 4M7AB 4NS5A 5HCKA 1N8RC 2IW8B 1YI2T 1XJWB 1QKWA 2PVDB 4IURA 3SEMA 3FJPA 3CCQA 3VRZA 1C9BA 2QDJA 3VKIA 4EORB 2COWA 4J9IA 4BI4A 2YT6A 3VKGA 2KXDA 3G4SQ 3VS4A 2L89A 4F7UA 2X35A 1VQ4T 5CKFA 3EFOB 5GAMe 2X4YA 3THKA 4M7AG 4FU6A 4CI0C 3H8ZA 2M0OA 1KHIA 2QYZA 4HKEA 1YIJQ 2EGCA 3PO3S 1H24B 4BI8B 2HBWA 4XTVA 4MMKA 2LNVA 1X6OA 2HQEA 4J7FA 2MIOA 4EOMB 2DETA 2E6NA 1AOJA 2VASA 3JCMQ 4M7AC 4EC9B 3OYLA 2LQNA 3HHTB 1X69A 2YRVA 4JLGA 4A53A 5GAN2 4FIBA 1M5Q1 1T3LA 4EMHA 1QKXA 3I55Q 3CC4A 4DA4A 1Z9ZA 2FHDA 4KULA 3EGUA 2IVWA 3C12A 2DVEA 2EQIA 3CC2Q 5GJVB 4Q5WA 2JGZB 3G71T 2F2CA 1ACMB 4JX5A 2C5VB 3DLLA 2LTOA 5FW9A 2DBKA 2X3WD 2WACA 3KHIA 3R6NA 4B9WA 1UGSB 1MNEA 4CFXB 2RHIA 3C0CA 3INZA 3HKSA 1V29B 3H6ZA 3HFOA 2VVKA 1VQ5A 1BBZA 3BE3A 3TEEA 2CJMB 5KYYA 2OTLT 4RODA 4N4HA 2HAXA 2LT1A 1M90R 1D3UB 3D7SB 4BBRM 1M4ZA 2A0FB 2MAMA 1C0MA 5GMKe 1S72Q 2XI9A 2EJGA 1X2QA 1K73U 1K0XA 5GANj 1ZA2B 3URGA 1VYTA 2QA4Q 4ELZC 4WTOB 4JJDA 4ZGJB 2I0NA 1JB0E 1JXOA 2K2VA 2F1LA 3T9NA 2J6FA 4KGVB 2PTKA 1KC8U 2W99A 5CR2A 1BI0A 3OB9A 2FPFA 2DIGA 2V8KA 4M7DD 1H4LD 2RO0A 4L6V5 3MJXA 1XNIA 1M2VB 2K3BA 2A7YA 1QWEA 2PMIB 1JEGA 3BHVB 1JJ2A 2D8HA 1VQMQ 1WZOA 1WX6A 4PJOD 3CMAQ 2V26A 4R55A 4BCMB 3EGDB 1Y07A 4C0ZA 3MHXA 3VUBA 4KUDK 1N5ZA 2KEAA 1JRIA 1CKBA 3EJ1B 2XICA 2DL5A 4XAXB 1PRLC 4MZMA 5D6YA 1VYUA 1YP5A 1Q86C 1N4MA 1N9RA 4C5HA 3CCMQ 2GBQA 1R77A 1W2BS 1M2OA 4IUVA 3A8GB 1MMGA 2ENMA 3EGDA 1B3QA 3M57A 4MDXA 1ZUUA 4J7IA 2K5FA 1VQKT 2ZPEB 2Z0WA 3PMTA 2AHJB 3CC7A 2DILA 5I11A 1OEBA 2KK4A 3REAB 5J3BA 3CCLT 3VYGA 2LX9A 1WHKA 2DZCA 1QW1A 4JPBW 1PM3A 1TH7A 3E9FA 1TD6A 2HL3A 4HNVA 3RESA 2JTEA 5I22A 2OTJT 1TUGB 4QVCA 1OIYB 4EOOB 2VV5A 3GNGA 1XOVA 4RTTA 6AT1B 4NL3A 1KSWA 3RMSA 2HSEB 1Q86R 4J9HA 2NUPB 2KR6A 2HZYA 3A8OB 5HNBB 1PKSA 4E7ZA 2CYZB 1H641 1W2BA 1K9MU 4OB0B 3ER0A 1SRMA 2PUKB 5GAMg 1LPLA 2E5QA 1PC0A 1UGRB 2RM4A 3G33B 2EUFA 1Q7YR 4PJMA 1VQ4A 2M1HA 2VXFA 3PT9A 3CCRA 1KG1A 4HA8A 1NG2A 5IHNA 1Q86U 1ZSGA 3AHUA 2K9GA 3AT1B 2OTLQ 5HK3A 3NMZC 2RQVA 3NFCA 2XK0A 4OMLA 3V7CA 1E7PA 1BIBA 1QVGP 5IHYA 1K8AC 1RACB 4JRIA 2LC4A 4KUIA 4BCMD 1FKMA 5DM7R 2E3IA 1K0SA 1KQSS 4RTXA 1TXQA 3I55T 1JXMA 4XU2A 4HL4A 2KYMA 1CKAA 4OGEA 5LJ5d 1NZ9A 5J39A 3CCQT 4OMOA 1LOJA 1UHCA 4J6XA 3SD4A 2BE9B 2EQKA 1YJWQ 4F6UB 1UB4A 3A8HB 3P8HA 4PJOF 1VQOT 4C8QC 3U23A 3V8KA 2EYYA 4M77B 4QSHA 2V1QA 1GBQA 3M4GA 3MP6A 1M8VA 4BE2A 1FMKA 4FM4B 2PNIA 4M77A 2FPEA 1MUZA 5DQVA 2FO0A 1D0ZA 3DB4A 5LJ3h 3JCMP 2KQWA 5DQWA 3RUXA 1YITA 5GAN6 4C5EA 2HQHA 4DEXA 2RN8A 3VS5A 4CFMB 2BUDA 1WHGA 5LQFB 5J26A 3QHSA 4MZTA 4I3ZB 1OGUB 2OAWA 2RQTA 1LNXA 4C92E 2JNGA 1RUWA 2XU8A 4OMFB 1RL2A 3REBB 1K8AR 2PQWA 1I1JA 2QQAA 1UECA 3VJPA 2PVOB 2JMAA 3ASKA 2L0AA 1QCOA 2ZPBB 2YLCA 1OIUB 1K76A 2NUZA 1Q82U 5KE3A 1G8XA 4VUBA 1OL2B 4C5GA 4F7LB 1BIAA 1VQ7T 5IHKA 2ZPHB 3PGGA 1T3SA 2K5LA 1JJ2S 3A8LB 3QYHB 4ME7A 1G3WA 5CEIB 5CKHA 3V7SA 4HT9A 1WQWA 2NYSA 3PIPA 1ZX6A 3G6ET 3MO8A 2JTFA 2LJ1A 4F7JB 2DTIA 2YDLA 4OB3B 3QKJA 2L3PA 3OYAA 1VIFA 4G6LB 5EFQB 2L3QA 2KT8A 3L2UA 2ZZDA 3QZ9B 2OTLA 5FU7C 3JCMb 2K2MA 1BI1A 1WGSA 1YHQT 1VQPQ 3F5XB 1F5QB 1H1QB 2COYA 3CPWP 3EFOA 2MWOA 1W1FA 2FG0A 2HQXA 3CCSA 1J3TA 1ZQ1A 2NUTA 3QUIA 2BZ8A 3CCLA 1AISB 5GAMf 3HO8A 2GGRA 2WSFE 4BI3A 1QVFS 2FYKA 3QBYA 4ANJA 3X24B 4AFUC 3RMQA 4RCBA 1KC8R 2I40B 2B8AA 4KH1B 4IUQA 4ORZA 4Y92A 1WHLA 1WPYA 2F2XA 4Z8AA 1P5EB 3FLGA 3CD6Q 4LDYA 4ELYC 2QQBA 4F7UB 1OI9B 2KVQG 2L3SA 2VGMA 4PFOA 3H41A 4FYWB 2VUBA 3LW5E 3MKDA 2DYIA 3CMEQ 2DM1A 3PFSA 1KQ2A 4N0AA 2ED0A 1H28B 4J9FA 1IZ6A 4IMYB 3OYJA 1GRIA 1RLQC 1Y96B 3CXCS 2DRMA 1Z9QA 5GJWB 1OL1B 3OS5A 1RAIB 3NTIA 3H0HA 3JCMf 4EMKB 2PK2A 2QXFA 1YJWA 3PMIA 3JAME 2IW6B 5HBEB 3DTOA 1NE8A 2F2VA 4EIKA 3MIAB 1QLYA 4II1A 4NOYA 3VYHB 1QCFA 1F1BB 1LCKA 1S72T 2LQKA 4C5IA 4OP0A 3QJYA 3OS0A 5AT1B 4CC2A 5GAN5 3L2WA 3I55A 4XTXA 2R57A 1QVGS 1IGUA 2DD5B 1HSQA 1RADB 5I2SA 1PCXA 1BB9A 4HVUA 4J9CA 2QA4A 4D6WA 2CUBA 4JZ3A 4Z02A 3RNJA 1D1BA 2KT1A 3P8DA 1WLPB 2KYBA 4CFUB 1SSHA 2BS2A 1AEYA 2ZAEA 4PJOE 4A54A 1PRMC 3A8MB 3DJBA 3K7AM 1NJIC 5FU7B 2X51A 3OYCA 5KYWB 1KHCA 2IPOB 4IIMA 3EG0A 4JJBA 3CCEA 1ZUYA 2O9SA 3OQ5A 2QQSA 2RHYA 2DIQA 4WCIA 1M8MA 4KRCB 4OMPA 4ELLA 4JJNK 4ROCA 2AKLA 2B86A 3RKXA 3M9QA 1YIJT 3UPUA 2MYSA 2RJDA 1MV3A 1IREB 5HBHB 1O9KA 1BU2A 1R8OB 1KFZA 3CCRQ 5IT9E 2YUNA 2BTTA 8AT1B 2CZ7B 2NUPA 1BK2A 3PVLA 5CIUA
chains in the Genus database with same CATH topology
4JS5A 2FB7A 1KC8U 5GAN4 5CR2A 4X9DA 1VQ6A 1M1KC 1GXIE 1BI0A 3OB9A 3OW2S 4XTWA 2QQ8A 2VYTA 4M78B 4A4EA 2D9TA 1WJSA 4A4HA 1BI2A 3OYNA 3OA6A 2EQMA 2DIGA 3OYKA 2V8KA 4J5YA 4L59A 4ZTJA 4QQ6A 4M7DD 1K9MU 2RO0A 3OBWA 5HKCA 4L6V5 3HZJA 3M56A 1N6AA 1LJOA 1WQ7A 2JZ2A 3OY9A 1XNIA 3GPLA 3CCST 2CZ6B 4XQ3A 1BYMA 5LJ5f 2O4XB 4UC4A 3FIFA 3CCRT 4ZGEB 1KQ1A 5L8RE 2A7YA 4OF1A 3OW2A 4C92B 1U8RA 4M7DA 3QYGB 1Y71A 1JJ2A 5CAIA 2G77A 4PJOD 3L2ZA 4XTZA 4R55A 2PUOB 1Q7YC 2LT4A 2E64A 1O9SA 1Y07A 3WVDB 3MHXA 3JCMc 3VUBA 4C0ZA 4KUDK 5D6XA 4AKIA 3JB9H 4ATOA 1PSEA 3CMET 1JRIA 2DZ9A 2XICA 3BG9A 4NC6A 1VQ9T 2CZ1B 2DEQA 1YI2A 4XAXB 1ZBXA 4MZMA 3OYEA 5D6YA 1Q81U 1G3YA 1N9RA 4EMKC 1Q86C 1D3BB 4C5HA 3NTKA 4RG8A 1YJWT 1W2BS 3OSSC 1OZ3A 2MI6A 3C4SA 5GAMd 5CQYA 4IUVA 3A8GB 4KBMB 2EKOA 2EJ9A 3JCMh 3QZ5B 3LH0A 4BDYA 4C8QB 1D3BA 3LYIA 3M57A 4EMGA 4MDXA 3HB9A 1Y96A 3I56T 4J7IA 3LWIA 2K5FA 4BACA 1FWZA 4LDWA 2DTOA 1Q81C 2HBPA 2RI5A 1VQKT 2ZPEB 5EJCA 3PMTA 2AHJB 3CC7A 5CK9A 2XDPA 2KK4A 5J3BA 4C0DB 3CCLT 4C92C 1VQ6T 3CBPA 2GCXA 2EIFA 4QVDA 2EFIA 4IUPA 4E7IA 4QQGA 3OSVA 1HK9A 2KAFA 3VYGA 5FRMA 3OS1A 4M78F 2LX9A 3QSUA 4PJOC 4OGCA 4JX4A 5GAOl 4E7KA 4LD9K 2DZCA 1QW1A 1QP3A 1TH7A 2JN0A 3E19A 3E9FA 2EAYA 4M7DF 4LDXA 4EMKA 4HNVA 4HNTA 1MGQA 1W4SA 1WJQA 2JOYA 3HRSA 3M5AA 4M75B 4X34A 3RESA 2OTJT 5GAOr 2EYQA 4FL6A 4F7UF 2NLUA 1JBMA 3C95A 3KUFA 1MHNA 1QVPA 2VGNA 4QVCA 3DL1A 3GNGA 2VV5A 1XOVA 3OYBA 2DXCB 3LGLA 3RMSA 4NL3A 1G3TA 3TU4K 3OYMA 3HSBA 5GMKm 2I2LA 2KR6A 3A8OB 5A2QE 2DAQA 1YJ9T 1YJ9A 1G3SA 3CCMA 1KQSA 1Y7XA 2K5IA 2CYZB 1H641 5D6WA 1W2BA 4XU3A 1FXXA 4OB0B 4O5VA 2PUKB 2R5AA 4ELJA 2RD1A 2XG8D 3ER0A 4M77D 3JCMX 5GAMg 3EFRA 2DTHA 3OYIA 1S72A 5EG2A 3CC2T 4C92D 2E5QA 3SWNC 5GANg 2RH2A 4HCCA 1UGRB 2ZPGB 2RM4A 2KDSA 4YTLA 4J83A 1FX7A 3SB2A 3KBGA 3CD6T 2CKKA 5LJ3f 1PSFA 4Y28E 1N9SA 3MEUA 2FL7A 2V8IA 5KCOA 3CCVT 2MWPA 2M1HA 5GMKh 1VQ4A 2RB6A 5KE2A 1VQLT 3M54A 5HK0A 3RKWA 2VXFA 3PT9A 2RK1A 4ZN1A 5GANd 3JCMJ 3QWLA 3A5ZB 3CCRA 1KG1A 3L1AA 5M9OA 1M90C 4HA8A 1YCYA 1Q86U 3BY7A 1M9SA 3AHUA 2DXCA 5KCHA 3HRTA 2MMPA 5HK3A 2Y4YA 3CCJT 3NFCA 2XK0A 3C94A 5A0LA 3CBMA 2KMTA 4M78C 2JTMA 3EAEA 4BY6C 3N5BB 4E7LA 4A4FA 4QQDA 4BE0A 1VUBA 4C92G 4AKHA 3OBYA 2RK2A 3V7CA 1E7PA 1BIBA 2QTXA 4M77G 4O6JA 3OYDA 2DXBB 2QA4T 1VQPT 3UT1A 1WNLA 1K8AC 3X20B 3SWNB 5LJ3j 2DPPB 2RHXA 4JRIA 4MZPA 2XDBA 3QDRB 2XD0A 4R56A 2LC4A 2LQ8A 4IUTA 3HPWA 4KUIA 4XK8E 1FKMA 2KMGA 3FRNA 4OB1B 4XU0A 5DM7R 1YIJA 5GMKj 3CXCA 4JRQA 1KQSS 3TW7A 1I4K1 1I81A 1EIFA 4HT8A 4M75D 3TCJA 3WXMB 4TVRA 5GMKi 3I55T 4XU2A 1M1GA 1XTDA 4HL4A 2GFUA 4M77E 3E9GA 4OGEA 2K3YA 3SFMA 3DLMA 5LJ5d 1NZ9A 1YHQA 5J39A 5GANh 3CCQT 1K9MC 2GF7A 5GAN8 1LOJA 3Q1JA 3SWNA 4E7HA 3V8JA 4J6XA 3SD4A 3BG5A 4AI6A 2EQKA 4C8QD 5A0DA 5LJ3g 4ZTFA 3J7AF 2FVUA 1UB4A 1KC8C 3A8HB 3MEVA 1BI3A 3P8HA 4PJOF 1VQOT 4C8QC 1VQMA 3V8KA 2PVGB 4N4IA 3GIBA 4HCBA 5A0GA 2LDMA 5CO7A 3S3NA 2IG0A 2JUFA 3CPFA 5CKEA 3X28B 4QSHA 1XQHA 4M77B 4C92F 5GAN7 2OAUA 4LDUA 2DD4B 2ZZDB 2P0QA 3LGFA 4C8QA 3M4GA 3MP6A 1M8VA 1K8AU 4PNOA 2HNIA 4BE2A 3J81E 4FM4B 4FT2A 2F69A 4M77A 5KH6A 4LOCA 3O8VA 1I5LA 3HRUA 2GFAA 4C92A 5LJ5g 5GANe 3NTHA 1VQ9A 4M7AF 3QIIA 2QI2A 3S3MA 1G5VA 5GAMj 1VQKA 1H3ZA 4QVZA 4RMOA 2ZGWA 3DB4A 5LJ3h 5GAN3 3TREA 4WF2A 3JCMd 2KQWA 3JCMP 1QVGA 3RUXA 1NPPA 5GAOp 3RIRA 4M75C 3QXEB 3JB9D 3TW6A 1YITT 1YITA 5FU6C 3BG3A 2DO3A 5GAN6 2L5QA 3ME9A 3PTAA 4C5EA 4JDSA 3H4CA 4PLLA 3L2VA 4FT4A 2DXUA 2QFZA 1OYXA 3VV0A 2QQRA 2BUDA 5CKDA 1B34A 4N4GA 3RKYA 1BKBA 1U1SA 2YHTA 3HL8A 3FDRA 5J26A 4JLIA 5LJ5h 3QHSA 4MZTA 2VXEA 4M77C 2QEXA 1B34B 2RA2A 4M6VA 4NL2A 3BDUA 3JRZA 4LDVA 1LNXA 4L5GA 4N0AC 4C92E 3QYBA 3WVEB 2GQVA 2E1HA 2JNGA 2XU8A 4OMFB 3CCJA 3FC3A 1RL2A 3QYEA 1OI1A 3SDZA 2PQWA 3QPHA 3ZBDA 2DKGA 2QQAA 3VJPA 2QF7A 2PVOB 3CCET 3MP8A 1RI0A 3OYFA 3GOXA 2XKOC 3ASKA 5GAMh 3CMAT 2BKDN 2ZPBB 2YLCA 4J6WA 3OMCA 1YJNT 1Q82U 2RJCA 4A4GA 5KE3A 3CBOA 3JB9J 3CC7T 3CC2A 4VUBA 3BFMA 2LVMA 4C5GA 2E41A 3BW1A 5CKBA 2O01E 3DKMA 5FU6B 3DB3A 1I8FA 1BIAA 2DK3A 2DXTA 2X4JA 1NJIU 1VQ7T 4MIMA 4GY5A 1VQLA 1OZ2A 2ZPHB 3PGGA 2HD0A 2K5LA 1JJ2S 3L42A 4LD6A 2ZCFB 3A8LB 1M1KU 1VQOA 2P4TA 5IN1A 1DJ7B 3V7RA 2JVVA 3CC4T 5FROA 2QQ9A 3QYHB 4ME7A 4P5NA 5LJ5e 4M7DG 1G3WA 4BY6B 5CKHA 4BB7A 1VQNA 3V7SA 3CPWS 4HT9A 2Y90A 3EFSA 2RI2A 4MFEA 3HP9A 1WQWA 5LJ3d 4BD3A 3PIPA 3G6ET 3LLRA 3MO8A 2JTFA 4X9CA 4PJOA 2M16A 5AYFA 2RI3A 2DD4A 2RHZA 1N27A 2F5TX 4M7AE 1VIEA 2ZPIB 2EJFA 3MP1A 4M78G 4E47A 2DTIA 1YBYA 4XTYA 4OB3B 5GMKl 3G4SA 3FB9A 3QKJA 3JB9I 3ZFJA 3OYAA 4JX6A 1P92A 1YJNA 1VIFA 2D6FA 2X4WA 3L2UA 5CVIA 3M55A 2CZ0B 2ZZDA 4E7JA 4BE1A 3QZ9B 2ZPFB 5FU7C 3UWNA 3JCMb 1KD1U 2XIDA 2LCLA 3LWHA 2C06A 4C8QE 4IKFA 1BI1A 3X25B 1WGSA 3I56A 1YHQT 3X26B 1WJRA 2KY9A 3J80E 2DD5A 2O4XA 3FEOA 2MWOA 2HQXA 1QP2A 3CCSA 1Q82C 1ZQ1A 2XHCA 4BUGA 3JCMg 3JCMe 2OTLA 4M78E 5GANf 2K4YA 3QUIA 3LX7A 4BBSM 3QG1A 3V8LA 3M59A 5DLOA 3CCLA 1NPRA 2OTJA 5GAMf 3HO8A 4XU1A 2WSFE 4RCCA 3E1SA 4BI3A 5GAOm 1QVFS 2FYKA 3M58A 2DJZA 3QBYA 5DLQE 4Z6YA 2VC8A 3X24B 2L3RA 1UEBA 3RMQA 2PU9B 4MDWA 4PLIA 4RCBA 1AHJB 4CRIA 3CMEA 2K3XA 2B8AA 2WSCE 5IAYA 4EDUA 4IUQA 4OVAA 3S6WA 1WPYA 2V8JA 1UGQB 4PJOG 2KSSA 5CCAA 5I21A 4ZGDB 4FSXA 3CPWA 4JRPA 1VQNT 3L2QA 2E10A 2X4XA 4Y91A 2P0PA 2DXBA 3JCMW 3FLGA 4DOVA 3M53A 4HCZA 5LJ5j 4V2SA 4LDYA 5GAOn 3JB9F 4ELYC 3OYGA 2QQBA 4F7UB 2KVQG 2VGMA 4A4KA 1M90U 2VUBA 3LW5E 4JRKA 4RKUE 3VYGB 4HLQA 5I2MA 4EPCA 3PFSA 2BS3A 3GP8A 3KXTA 4M7DC 4BDZA 1KQ2A 4N0AA 1SSFA 2QDYB 4J6YA 3OMGA 3JCMV 1VQMT 4IUUA 4M7AB 4NS5A 1IZ6A 3JB9G 1N8RC 3MEAA 4F7UE 3OYJA 3CXCS 1Y96B 1YI2T 3CD6A 3PIOA 4XTUA 4J8OA 2PVDB 2F5KA 4IURA 3CCQA 3FJPA 2QDJA 3VKIA 5FLXE 1HXDA 1M1FA 4JS4A 4OB2B 1X01A 3OS5A 3NTIA 4BI4A 3L2RA 2M9UA 3VKGA 3JCMf 3F70A 4EMKB 2L89A 2WSEE 4F7UA 3CCVA 4C8QF 2QXFA 3G71A 2X35A 3PMIA 1VQ4T 1YJWA 3JAME 5CKFA 5GAMe 2QEXT 5LL6S 3CCUA 2X4YA 4M7AG 4FU6A 4CI0C 1NE8A 4F7UG 2MF2A 2EQUA 3H8ZA 4M75E 4II1A 4NOYA 2M0OA 3VYHB 1KD1C 3G7ZA 5FRNA 1KHIA 2LQKA 3MCAB 4HKEA 4C5IA 2H3JA 1UGPB 4M75F 1S72T 4M78D 4OP0A 4BI8B 3QJYA 3M4YA 5GAOq 4XTVA 2XDDA 4M7DB 4RG2A 4MMKA 4HNUA 2LNVA 1X6OA 4C8QG 2HQEA 5GAN5 4J7FA 3OS0A 3L2WA 1VQPA 2G3RA 1ZHIA 3I55A 4XTXA 2RJEA 2E6NA 2R57A 1QVGS 4C0DC 4C0FA 3RERA 3JCMQ 2DD5B 4M7AC 2E65A 4PKCC 1N8RU 3OYLA 2YRVA 3HHTB 4JLGA 3VU3C 1Q7YU 5CQXA 4A53A 5I2SA 4ZN3A 5GAN2 2L8DA 1M5Q1 2Y4XA 4FIBA 4M75G 2E70A 3OS2A 4PJOB 2RHUA 2QA4A 4D6WA 4EMHA 3GLXA 3GNFB 5LJ3e 4M7DE 3CC4A 4DA4A 2FHDA 3QO3A 4Z02A 3P8DA 4KULA 3OYYA 2CGHA 2IVWA 3CEYA 5DY9A 4M7AA 3C12A 2DVEA 2R5MA 2E6ZA 3MEWA 4DQ2A 4Q5WA 3VKHA 2D0QB 3G71T 4DOWA 2BS2A 3P8BB 5HY6A 4PJOE 4A54A 4PL6A 1X75C 1U1TA 4JX5A 3A8MB 3PNWC 2LTOA 3G6EA 3VUZA 3DLLA 4GLKA 2P0KA 2BS4A 5FU7B 2YLBA 1QLBA 1NJIC 3OYCA 4C0GA 4AKGA 1KHCA 2WACA 5C0MA 3JSCA 3CMAA 3KHIA 2RJFA 4MMLA 4B9WA 3BDLA 1UGSB 2RHIA 1QVFA 2EQJA 3CCEA 3INZA 5C6SA 3OQ5A 3HKSA 1V29B 2QQSA 3OYHA 3G4ST 3META 2EWNA 3H6ZA 2RHYA 2DIQA 4M7AD 3HFOA 3CCUT 3ZEHA 1VQ5T 1VQ5A 2BIVA 2LRQA 3TEEA 3UDCA 4M77F 2R58A 4QW2A 1VQ7A 2A3LA 2E12A 2OTLT 3HBLA 2K57A 4N4HA 2HAXA 2LT1A 4JJNK 4BBRM 3RKXA 1M4ZA 2MAMA 3M9QA 5GMKe 3UPUA 1YIJT 2EJGA 2RJDA 2XI9A 2LCCA 1K73U 1IREB 1O75A 2WJ9A 5GANj 3URGA 4MFDA 2CS7A 4ELZC 3HFNA 1R8OB 1VQ8A 3CCMT 3QJ6A 3R6OA 4JUVA 3S3OA 4ZGJB 5IT9E 4KT0E 1JB0E 2CZ7B 4M75A 1VQ8T 4M78A 2K2VA 3GF5A 4B9XA 1K73C 3T9NA 5CIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXI E;  3WVE B;  2PVO B;  4L6V 5;  2PVD B;  2DXC A;  2ZPB B;  2CZ6 B;  4ZGE B;  5L8R E;  4OB2 B;  3QYG B;  2O01 E;  2WSE E;  2PUO B;  2ZPH B;  3WVD B;  2DXB B;  1PSE A;  2ZCF B;  3A8L B;  3X20 B;  2DPP B;  2CZ1 B;  1DJ7 B;  3VYH B;  3QYH B;  4XK8 E;  1UGP B;  4OB1 B;  3A8G B;  3QZ5 B;  2DD5 B;  2DD4 A;  3HHT B;  2ZPI B;  4OB3 B;  2ZPE B;  2AHJ B;  3A8H B;  2CZ0 B;  2ZZD A;  3QZ9 B;  2ZPF B;  2PVG B;  3X25 B;  3VYG A;  3X28 B;  3X26 B;  2D0Q B;  2DD4 B;  2ZZD B;  2DD5 A;  1QP2 A;  1QP3 A;  3A8M B;  4FM4 B;  2WSF E;  1UGS B;  3X24 B;  1V29 B;  2DXC B;  2PU9 B;  1AHJ B;  2WSC E;  3QXE B;  3A8O B;  1UGQ B;  4ZGD B;  2CYZ B;  4OB0 B;  2PUK B;  1IRE B;  2DXB A;  1UGR B;  2ZPG B;  4ZGJ B;  3LW5 E;  4KT0 E;  4RKU E;  3VYG B;  2CZ7 B;  1JB0 E;  1PSF A;  4Y28 E;  2QDY B; 
#chains in the Genus database with same CATH topology
 4JS5 A;  2FB7 A;  5GAN 4;  1VQ6 A;  4X9D A;  1GXI E;  2QQ8 A;  3M0T A;  4M78 B;  1NJI U;  2D9T A;  4ZTJ A;  1D1C A;  4BCK B;  3OYK A;  4J5Y A;  1KD1 R;  3OBW A;  3HZJ A;  3HTR A;  1LJO A;  1WQ7 A;  2JZ2 A;  2KRN A;  3VS7 A;  3GPL A;  3CCS T;  2A37 A;  5LJ5 f;  3CCR T;  1KQ1 A;  3H0I A;  5L8R E;  2DNU A;  4C92 B;  5FGK B;  3CCE Q;  2DJQ A;  3EG9 A;  3L2Z A;  2LT4 A;  1OV3 A;  2E64 A;  4F6S B;  3JCM c;  2XMF A;  1QVF P;  4CFV B;  1ZLM A;  2DZ9 A;  2AK5 A;  3BG9 A;  4NC6 A;  2CZ1 B;  1ZBX A;  3QWY A;  1AD5 A;  3OYE A;  1G3Y A;  1M27 C;  2EKH A;  4RG8 A;  1YJW T;  2YUQ A;  1SHG A;  1V1C A;  4BY7 X;  4KBM B;  3JCM h;  4BDY A;  1IRX A;  3LYI A;  4EMG A;  3I56 T;  2LW4 A;  2HBP A;  2RI5 A;  1FMW A;  1M1K R;  2FZG B;  3O5Z A;  1ARK A;  2RQW A;  2DL7 A;  3RR6 A;  4C92 C;  2EIF A;  4E7I A;  1RAE B;  2C6T B;  3OS1 A;  2RQR A;  4BY1 X;  3QSU A;  1SHF A;  4E7K A;  2OX7 A;  1QP3 A;  2JN0 A;  4M7D F;  4LDX A;  1MGQ A;  2JOY A;  2M51 A;  3EG3 A;  4M75 B;  4A63 B;  4FL6 A;  2NLU A;  3KUF A;  3OYB A;  3VRY A;  5IDP B;  5HVY B;  2ABL A;  5IXF A;  1VQ9 T;  3CC2 T;  1RI9 A;  2DYB A;  3SWN C;  1VQ7 Q;  2CRE A;  2ZPG B;  1D09 B;  2LJ3 A;  1FX7 A;  1K9A A;  2EYZ A;  4Y28 E;  1JSU B;  1Q95 G;  1N9S A;  3CCV T;  2FL7 A;  2V8I A;  3I9Q A;  4K11 A;  5GMK h;  2NWM A;  2RB6 A;  3M54 A;  4CFN B;  3RKW A;  5GAN d;  1VIN A;  3QWL A;  3A5Z B;  2P84 A;  5D7U A;  3E2U A;  2LNH B;  1M9S A;  3HRT A;  1JKW A;  1RAA B;  2Y4Y A;  3CCJ T;  2CT4 A;  2D8J A;  3EAE A;  4CRL B;  1GBR A;  3N5B B;  4QQD A;  4AG2 C;  4C92 G;  4RTW A;  2KXC A;  1WNL A;  2QG9 B;  2KRO A;  1VQ9 Q;  4YC3 B;  3SWN B;  4BCJ B;  2CP5 A;  4R56 A;  4OB1 B;  5HQ0 B;  1PD0 A;  4GBQ A;  1YIJ A;  3CXC A;  1H3H A;  1NYF A;  1I4K 1;  3TCJ A;  1YIT Q;  3WXM B;  4TVR A;  2QTV A;  1M1G A;  3LQ5 B;  3DLM A;  1M30 A;  5GAN h;  2GF7 A;  2W2H A;  4E7H A;  2RQU A;  5IH2 A;  4M7D E;  4ZTF A;  5LJ3 g;  1HD3 A;  2FVU A;  3MEV A;  1N8R R;  1VQM A;  3GIB A;  2PVG B;  4J9G A;  2PK9 B;  4HCB A;  1KIK A;  5CKE A;  3CPF A;  2CP7 A;  2JUF A;  2WHB B;  2HMA A;  4LDU A;  1B7T A;  1G83 A;  4PJL A;  2G9X B;  1K8A U;  2C5O B;  3J81 E;  1WHM A;  2COZ A;  2F69 A;  2HKQ B;  5KH6 A;  3O8V A;  1I5L A;  2X3X D;  4C92 A;  3EHR A;  1VQ9 A;  4M7A F;  1SKU B;  1YJN Q;  3S3M A;  1MV0 B;  1VQK A;  4QVZ A;  2DF6 A;  2ZGW A;  1QVG A;  4WF2 A;  3JCM d;  5L2W B;  1EZZ B;  3M0P A;  1NPP A;  2K79 A;  5GAO p;  2EYW A;  4GLM A;  3RIR A;  1YIT T;  1H1S B;  5FU6 C;  2DO3 A;  3ME9 A;  2WMA B;  4JDS A;  3ULR B;  2OJ2 A;  4FT4 A;  2DXU A;  3VV0 A;  5CKD A;  2QQR A;  1U1S A;  2YHT A;  3HL8 A;  3M0S A;  2FZC B;  1B34 B;  2RA2 A;  4M6V A;  3JRZ A;  2GQI A;  2FZK B;  2UZL B;  3QYB A;  2GQV A;  2E1H A;  1KJW A;  1PWT A;  1ZSZ A;  3QPH A;  3ZBD A;  1E7O A;  2ED1 A;  1RI0 A;  2XKO C;  2IN3 A;  5GAM h;  3CMA T;  2BKD N;  7AT1 B;  4HVW A;  1YJN T;  2RJC A;  4A4G A;  3JB9 J;  2CCI B;  2FPD A;  3I35 A;  3BW1 A;  5CKB A;  5FU6 B;  3DKM A;  3DB3 A;  4M7A A;  2DXT A;  3NHN A;  3VS2 A;  1VQL A;  2DME A;  1OZ2 A;  2G6F X;  1X6G A;  2HD0 A;  4LD6 A;  1M1K U;  1VQO A;  3V7R A;  2JVV A;  5FRO A;  2DEU A;  1OQK A;  4BY6 B;  1FMV A;  5KYN A;  1TWB A;  4PFP A;  2RI2 A;  4FYV B;  4EOQ B;  4BD3 A;  5LJ3 d;  2EGE A;  2IIM A;  4YOO A;  2EBP A;  1ABO A;  4HVV A;  1PKT A;  1H26 B;  3MP1 A;  1Q81 R;  1JOW A;  5GMK l;  2CSI A;  3FB9 A;  4FW1 A;  3JB9 I;  2D6F A;  3M55 A;  2CZ0 B;  4E7J A;  2ZPF B;  1HJD A;  3LWH A;  4C8Q E;  3TQ7 P;  4IKF A;  2W96 A;  2RPN A;  3X26 B;  1ENW A;  4LXC A;  3J80 E;  2O4X A;  3CCQ Q;  3EID B;  3JCM e;  4M78 E;  5GAN f;  2JW4 A;  3QG1 A;  1SG5 A;  5DLO A;  3I5S A;  4OGR B;  2YRD A;  2EVR A;  4QT7 A;  1H25 B;  4F7N B;  5DLQ E;  1TOV A;  2VC8 A;  1NLO C;  1QCN A;  2LX7 A;  2K3X A;  1UNH D;  1VOL A;  1K1Z A;  4OVA A;  1UGQ B;  2JM9 A;  5KYY B;  5CCA A;  3CPW A;  2EYX A;  4JRP A;  1VQN T;  3L2Q A;  3TNW B;  4RTV A;  4Y91 A;  4B6M A;  1XO2 A;  4HCZ A;  3UA6 A;  1AZE A;  3JB9 F;  4OR5 B;  1VQL Q;  4X1V A;  3GTM S;  5I2M A;  2BS3 A;  5I5Z B;  3KXT A;  3GP8 A;  4BDZ A;  1OKW B;  1MMN A;  3OMG A;  1G2B A;  5L23 A;  2CP0 A;  3JB9 G;  2GTJ A;  4F7U E;  3CD6 A;  3TVT A;  3PIO A;  9ATC B;  2F5K A;  2E3H A;  1PG5 B;  2ESW A;  1M1F A;  2EGA A;  4JS4 A;  4OB2 B;  1X01 A;  1VQK Q;  2M9U A;  1UJY A;  3F70 A;  1VQ6 Q;  3CCV A;  3M0Q A;  4C8Q F;  3VS1 A;  2KGT A;  5LL6 S;  2E4H A;  4F7U G;  1NYG A;  2EQU A;  3IQL A;  3MCA B;  2H3J A;  4M75 F;  1MMA A;  1RAF B;  2XDD A;  4M7D B;  1U5S A;  2NUT B;  2UZB B;  1TUD A;  1ZHI A;  4LN2 A;  4C0F A;  4PKC C;  1N8R U;  4FYX B;  4AFZ C;  1O9K B;  3VU3 C;  1Q7Y U;  5CQX A;  1FYN A;  3OS2 A;  2Y4X A;  4PJO B;  2RHU A;  2RF0 A;  5LJ3 e;  3GLX A;  3GNF B;  1E6H A;  1H1P B;  1URC B;  3MY5 B;  1BU1 A;  3OYY A;  2CGH A;  3CEY A;  1GFC A;  2HEQ A;  4BCN B;  3MEW A;  3VKH A;  2D0Q B;  2VB6 A;  4DOW A;  3P8B B;  1X75 C;  4Y72 B;  3G6E A;  4RTU A;  4BCQ B;  2BS4 A;  1ZP2 A;  4AKG A;  2ECZ A;  5C0M A;  3JSC A;  3CMA A;  1AWJ A;  2RJF A;  4MML A;  2KRM A;  1QVF A;  1AVZ C;  2EQJ A;  3G4S T;  5C6S A;  3OYH A;  4M7A D;  1NLP C;  2PJQ A;  3CCU T;  3ZEH A;  1EX4 A;  1VQ5 T;  2BIV A;  2LRQ A;  3UDC A;  4J9B A;  4M77 F;  2R58 A;  4QW2 A;  1VQ7 A;  2A3L A;  3HBL A;  2K57 A;  4LNP A;  2BZY A;  3MY1 B;  2LCC A;  2CUD A;  2C5X B;  1O75 A;  5KYU B;  2DER A;  2BPM B;  4MFD A;  1OOT A;  3CCM T;  3S3O A;  4Z88 A;  2J06 A;  4EOJ B;  4NST B;  4M78 A;  1I0C A;  3GF5 A;  4B9X A;  1M1K C;  3OW2 S;  2VYT A;  3PTA A;  1K4U S;  1WJS A;  3OA6 A;  1S72 A;  2EQM A;  4KRD B;  4QQ6 A;  3UA7 A;  3MI9 B;  1N6A A;  2OI3 A;  3OY9 A;  2CZ6 B;  4XQ3 A;  2O4X B;  4UC4 A;  3EG1 A;  5FWB A;  3QYG B;  2A36 A;  5CAI A;  2G77 A;  4XTZ A;  1S1N A;  1Q7Y C;  2PUO B;  1E9H B;  1O9S A;  3WVD B;  1GUX B;  1VYW B;  4AKI A;  3JB9 H;  4ATO A;  1PSE A;  1X6B A;  3CME T;  2DEQ A;  2YRC A;  3ZL7 C;  2ATC B;  4J9E A;  1D3B B;  3OSS C;  1OZ3 A;  3C4S A;  2C0I A;  2EKO A;  3QZ5 B;  3LH0 A;  4C8Q B;  1D0X A;  4DBF A;  1Y96 A;  1AZG B;  4BAC A;  1FWZ A;  2DL8 A;  2DTO A;  4LDW A;  5EJC A;  1NEG A;  1H92 A;  2XDP A;  2GCX A;  2O9V A;  2EFI A;  4IUP A;  4QQG A;  3FJ5 A;  3OSV A;  2KAF A;  5FRM A;  4PJO C;  4BCG B;  4OGC A;  4D8D A;  3G1J A;  4HCK A;  1GFD A;  1Q82 R;  3E19 A;  4HNT A;  1WJQ A;  4X34 A;  4ZN3 A;  4F7S B;  3OW2 P;  5GAO r;  2EYQ A;  1JBM A;  3I5R A;  4IIO A;  1MHN A;  1QVP A;  4M4Z A;  1WYX A;  2DXC B;  4BCQ D;  3LGL A;  3TU4 K;  5GMK m;  2I2L A;  5A2Q E;  1YJ9 T;  1LVK A;  1SPK A;  1YJ9 A;  3CQT A;  1G3S A;  3CCM A;  1KQS A;  1Y7X A;  2K5I A;  4O5V A;  2XG8 D;  2RD1 A;  4ROE A;  4M77 D;  2DTH A;  2HDA A;  5EG2 A;  2RH2 A;  3O0G D;  2KDS A;  5ACB A;  4J83 A;  3CD6 T;  2JM8 A;  2CKK A;  5LJ3 f;  1ZA1 B;  5KCO A;  2MWP A;  3CC7 Q;  4CFW B;  2H3E B;  3M0R A;  3JCM J;  4ZN1 A;  3L1A A;  1M90 C;  5KYW A;  3TSW A;  1YCY A;  3G6E Q;  4II5 B;  1UNG D;  1W98 B;  1QQJ A;  2DXC A;  3SHW A;  3PE0 A;  4CXA B;  2LQW A;  2MMP A;  5KCH A;  2CH4 A;  1JU5 C;  2C5N B;  4BCI B;  2LJ0 A;  3CBM A;  2KMT A;  2QK0 A;  2JTM A;  1VQ4 Q;  2FRY A;  3EOC B;  4E7L A;  4BE0 A;  1VUB A;  4AKH A;  3OBY A;  2RK2 A;  2CH4 W;  1H27 B;  2OTJ Q;  3OYD A;  1VQP T;  4TTH A;  3UT1 A;  4F6W B;  1YHQ Q;  4FSS A;  2DPP B;  2XDB A;  2XD0 A;  3QDR B;  3TNH B;  2C0O A;  4IUT A;  4XK8 E;  4OMN A;  3TW7 A;  1UE9 A;  1I81 A;  5EC7 A;  4HT8 A;  5KYX A;  2IW9 B;  2ROT A;  1WHJ A;  2H8H A;  2SRC A;  3E9G A;  3SFM A;  2K3Y A;  3A98 A;  4OMQ A;  3TNI B;  3Q1J A;  3SWN A;  3RGF B;  3BG5 A;  4AI6 A;  4PJN A;  2DE0 X;  1KC8 C;  1UHF A;  2YUO A;  4BCF B;  1BI3 A;  2LMJ A;  5A0G A;  2YUP A;  3S3N A;  1AWX A;  2IG0 A;  2MK5 A;  2J6K A;  5GAN 7;  3X28 B;  1IO6 A;  1OX9 A;  2OAU A;  2DD4 B;  5IF1 B;  2P0Q A;  3LGF A;  4C8Q A;  4EOS B;  4EOI B;  4PNO A;  2HNI A;  1OU8 A;  1UJ0 A;  4AFS C;  2DL4 A;  3A1P A;  2O31 A;  2IVX A;  2QDL A;  2GFA A;  4OMM A;  5GAN e;  1BCM A;  3VS6 A;  4YOS A;  3QII A;  2QI2 A;  1FIN B;  1H3Z A;  4RMO A;  2LZ6 B;  2JS2 A;  1OPK A;  3TRE A;  4YOZ A;  3NPF A;  3QXE B;  2L5Q A;  1WFW A;  3H4C A;  4PLL A;  3CXC P;  1B34 A;  4N4G A;  3RKY A;  1AT1 B;  1BCO A;  1K9M R;  4JLI A;  5LJ5 h;  2VXE A;  4M77 C;  3POM A;  2AKK A;  1K73 R;  4JZ4 A;  4L5G A;  3WVE B;  3RDV A;  3CCJ A;  3FC3 A;  3CCE T;  3OYF A;  3GOX A;  5KYX B;  2SEM A;  3OMC A;  4J6W A;  4FX3 B;  4BCP B;  3BFM A;  2LVM A;  1UGV A;  1I07 A;  2DK3 A;  2X4J A;  8ATC B;  1OUL A;  3M03 A;  2J05 A;  2A28 A;  2ZCF B;  2ROL A;  4CC7 A;  3EGX A;  2QGG A;  2W0Z A;  2MCN A;  2P4T A;  1DJ7 B;  1QMC A;  1AWW A;  4M7D G;  4P5N A;  5LJ5 e;  1I5O B;  4BB7 A;  1VA7 A;  2RMO A;  1WHH A;  3CPW S;  3EFS A;  1NEB A;  4MFE A;  3HP9 A;  2C4G B;  3LLR A;  4PJJ A;  4PJO A;  3I56 Q;  2RI3 A;  2DD4 A;  2K6D A;  1UFF A;  1VQ5 Q;  4M7A E;  1NM7 A;  4E47 A;  4EOL B;  3EG9 B;  3UAT A;  1YBY A;  2DMO A;  4XTY A;  1YWP A;  2B9R A;  1B07 A;  1VQ8 Q;  3KFV A;  4JX6 A;  3GBQ A;  5CVI A;  2D0N A;  3UWN A;  1KD1 U;  2AZS A;  2VKN A;  2C06 A;  1OX8 A;  2FRW A;  1WJR A;  1RLP C;  5FWC A;  2W9F A;  1QP2 A;  4EOP B;  4AG1 C;  2K4Y A;  1IB8 A;  1WXB A;  3M59 A;  2OTJ A;  1NPR A;  4ZNX A;  2LP5 A;  5GAO m;  2X1N B;  1AD6 A;  2LCS A;  2L3R A;  2PU9 B;  4MDW A;  4PLI A;  3CME A;  1AHJ B;  2YSQ A;  1TSF A;  2WSC E;  1TTH B;  3S6W A;  2DFU A;  1R0C B;  2CP6 A;  3EH2 A;  5I21 A;  4FSX A;  4Z89 A;  1X43 A;  2X4X A;  1YI2 Q;  2P0P A;  2DXB A;  2HL5 C;  4DOV A;  5LJ5 j;  1JJ2 P;  4UN0 A;  4V2S A;  5GAO n;  3OYG A;  3UF4 A;  4A4K A;  1M90 U;  4JRK A;  3VYG B;  4HLQ A;  2K7A A;  2EPD A;  4AFQ C;  4EPC A;  1IHV A;  1SSF A;  2QDY B;  2WIH B;  1VQM T;  3MEA A;  1VYV A;  4J8O A;  4XTU A;  5FLX E;  1HXD A;  1V76 A;  5LMK B;  3L2R A;  2WSE E;  2KR3 A;  3G71 A;  2QEX T;  3CCU A;  1D0Y A;  4F70 B;  2MF2 A;  4M75 E;  5FRN A;  1KD1 C;  3G7Z A;  5IXB A;  4RTZ A;  1UGP B;  4M78 D;  5GAO q;  1MMD A;  3M4Y A;  3VS0 A;  2QGS A;  4RG2 A;  2HCK A;  2M0Y A;  4HNU A;  4C8Q G;  1VQP A;  1MND A;  3MPU B;  2G3R A;  1UDL A;  2RJE A;  3RER A;  4C0D C;  3EHQ A;  1WDX A;  1FVV B;  2E65 A;  1IHW A;  1M3C A;  2JT4 A;  2DA9 A;  3TN8 B;  2L8D A;  4M75 G;  2E70 A;  3JV3 A;  1IGQ A;  3QO3 A;  1KQS P;  1WXT A;  5DY9 A;  1NBE B;  2R5M A;  2E6Z A;  2QAS A;  4DQ2 A;  1WIE A;  2WMB B;  2BZX A;  5HY6 A;  1WXU A;  1VQO Q;  4PL6 A;  4J9D A;  1U1T A;  3PNW C;  3CC4 Q;  1Y57 A;  3VUZ A;  4GLK A;  2P0K A;  2YLB A;  1QLB A;  4C0G A;  3QHR B;  2GTO A;  3BDL A;  3NDQ A;  3MET A;  2EWN A;  4FW2 A;  1GL5 A;  1ZSZ B;  2BKZ B;  1UG1 A;  2E12 A;  4R0K A;  2AZV A;  2KI7 A;  4DEY A;  3DDQ B;  2WJ9 A;  2DLP A;  2WPA B;  2CS7 A;  2CT3 A;  2PHG A;  3HFN A;  1VQ8 A;  3QJ6 A;  3R6O A;  4JUV A;  3BHT B;  1UTI A;  4KT0 E;  5HBJ B;  4M75 A;  3CCU Q;  1K73 C;  3LH5 A;  4F17 A;  1AWO A;  3TSZ A;  1GCQ A;  4XTW A;  4A4E A;  4A4H A;  3OYN A;  1BI2 A;  1UUE A;  4L59 A;  5HKC A;  1YNZ A;  2F2W A;  3M56 A;  1M3B A;  1GH6 B;  4CC3 A;  1BYM A;  3FIF A;  3QHW B;  4ZGE B;  3QDF A;  4OF1 A;  3OW2 A;  1U8R A;  4M7D A;  1Y71 A;  4ESR A;  2CP2 A;  5D6X A;  2WXV B;  4RTY A;  1YI2 A;  2DRK A;  1Q81 U;  2UUE B;  4EMK C;  3DDP B;  1YCS B;  1YWO A;  3NTK A;  2MI6 A;  5GAM d;  1U3O A;  5CQY A;  2EJ9 A;  2R7G A;  1R0B G;  1YJ9 Q;  1D3B A;  1H8K A;  3HB9 A;  1Q81 C;  1VQ8 T;  3LWI A;  5CK9 A;  1SF9 A;  4C0D B;  1VQ6 T;  3CBP A;  2RNA A;  4QVD A;  3BLR B;  1PKD B;  1HK9 A;  3VS3 A;  4M78 F;  1C6V X;  1D1A A;  5ICP B;  2UZE B;  2JS0 A;  4JX4 A;  5GAO l;  1W2B P;  2JJ9 A;  4LD9 K;  1IXD A;  2EAY A;  3QWX X;  4BCO B;  1TUC A;  4EMK A;  1W4S A;  3HRS A;  3M5A A;  2DL3 A;  2D1X A;  4F7U F;  3C95 A;  5IDN B;  2VGN A;  3DL1 A;  3H9N A;  2KE9 A;  2HSP A;  2CCH B;  1G3T A;  2QAZ A;  4F14 A;  2W9Z A;  3OYM A;  3HSB A;  1RAB B;  4E6R A;  2DAQ A;  1RAG B;  1GCP A;  5D6W A;  4XU3 A;  1FXX A;  2DX1 A;  3JCM X;  2R5A A;  4ELJ A;  1OPL A;  3OYI A;  2WIP B;  4CC4 B;  5KYU A;  3EFR A;  4C92 D;  1VQN Q;  5GAN g;  1NJI R;  4HCC A;  2UZD B;  1ZSZ C;  4YTL A;  2L2P A;  3SB2 A;  3CCJ Q;  3KBG A;  3M0U A;  3G71 Q;  1PSF A;  3MEU A;  5KE2 A;  1VQL T;  1C1A A;  2M02 A;  4RUG A;  5HK0 A;  2RK1 A;  4DBH A;  1W6X A;  5M9O A;  1T0J A;  3BY7 A;  4JJC A;  2WFY B;  1ABQ A;  4EC8 B;  4LUE A;  3C94 A;  5A0L A;  4M78 C;  1A0N B;  4BCH B;  1PHT A;  4BY6 C;  2CSQ A;  4A4F A;  1ZUK A;  4QKU A;  2QTX A;  4M77 G;  2C0T A;  4O6J A;  4FCY A;  2DXB B;  2QA4 T;  3X20 B;  5LJ3 j;  2RHX A;  4MZP A;  3CCS Q;  2LQ8 A;  3HPW A;  2KMG A;  3FRN A;  4XU0 A;  5GMK j;  3NGP A;  4JRQ A;  1EIF A;  1T0H A;  4M75 D;  1SEM A;  2V1R A;  5GMK i;  1XTD A;  2GFU A;  4M77 E;  1YHQ A;  4HXJ A;  1K9M C;  2MPX C;  5GAN 8;  3RBB B;  1GY3 B;  3V8J A;  1JST B;  5A0D A;  2CP3 A;  1W70 A;  4C8Q D;  3J7A F;  4KGX B;  2VWF A;  4N4I A;  2LDM A;  5CO7 A;  4E7S A;  2KBT A;  1HYO A;  1XQH A;  4C92 F;  2DBM A;  2ZZD B;  2DVJ A;  2HKN A;  4E2F B;  2KNB B;  1PD1 A;  4FT2 A;  4LOC A;  3HRU A;  2QGF B;  5LJ5 g;  2EW3 A;  3NTH A;  1TG0 A;  1G5V A;  5GAM j;  1JO8 A;  5GAN 3;  2O2O A;  4KGZ B;  1TU0 B;  4M75 C;  2WEV B;  3JB9 D;  3TW6 A;  3BG3 A;  3L2V A;  2O88 A;  2QFZ A;  1OYX A;  2J7I A;  2YXY A;  1BKB A;  5ECA A;  3FDR A;  5BNJ B;  4LUD A;  3H0F A;  2QEX A;  1SRL A;  1E6G A;  4F16 A;  4NL2 A;  1YFN A;  3BDU A;  2J6O A;  5CYI B;  4LDV A;  2AIR B;  4N0A C;  2W10 A;  1KXU A;  1M3A A;  3QYE A;  1OI1 A;  3SDZ A;  1CSK A;  4DBR A;  2CDT A;  2DKG A;  2QF7 A;  3MP8 A;  1QWF A;  1X27 A;  3CBO A;  3CC7 T;  3CC2 A;  4FYY B;  2AT1 B;  4F04 B;  1PNJ A;  2E41 A;  2O01 E;  1GCQ C;  1I8F A;  1OU9 A;  4MIM A;  2GNC A;  2PZ1 A;  4GY5 A;  4DBQ A;  1TFB A;  3L42 A;  2P4R A;  1QMZ B;  5IN1 A;  4AT1 B;  3CC4 T;  2QQ9 A;  3BLQ B;  2V22 B;  1VQN A;  2Y90 A;  2JMC A;  3EGX B;  2A08 A;  2E5K A;  4X9C A;  2M16 A;  5AYF A;  1GUX A;  2RHZ A;  1N27 A;  2F5T X;  3PVQ A;  1VIE A;  2ZPI B;  2EJF A;  4D8K A;  4M78 G;  3G4S A;  4EON B;  4EOK B;  1WA7 A;  2JXB A;  4CFU D;  1Y0M A;  3ZFJ A;  3CCL Q;  1M2V A;  1P92 A;  1YJN A;  4PFZ A;  1VOM A;  2X4W A;  2FEI A;  3EH1 A;  3BLH B;  4BE1 A;  2XID A;  2LCL A;  3X25 B;  3I56 A;  2X9H A;  2KY9 A;  4BXX X;  1EFN A;  2DD5 A;  1TS9 A;  3FEO A;  1Q82 C;  1U06 A;  2XHC A;  4BUG A;  3JCM g;  4AMC A;  2BE7 D;  2MOX A;  3LX7 A;  4BBS M;  3BHU B;  4KH0 B;  3V8L A;  2I53 A;  2KRS A;  4LE9 A;  4XU1 A;  4RCC A;  3E1S A;  2QEX Q;  1UNL D;  3M58 A;  2DJZ A;  4Z6Y A;  1X2K A;  3B57 A;  1UEB A;  4CRI A;  1ZBJ A;  5IAY A;  4KRT A;  4EDU A;  2V8J A;  4PJO G;  2KSS A;  3EG2 A;  4ZGD B;  4BCN D;  1KK7 A;  2E10 A;  1JQQ A;  3JCM W;  3M53 A;  1RAH B;  1OKV B;  1YN8 A;  1G3N C;  3DOG B;  4RKU E;  4M7D C;  2YWW A;  5IHI A;  1H1R B;  1WI7 A;  4J6Y A;  3CCV Q;  4PK4 A;  3JCM V;  4IUU A;  4M7A B;  4NS5 A;  5HCK A;  1N8R C;  2IW8 B;  1YI2 T;  1XJW B;  1QKW A;  2PVD B;  4IUR A;  3SEM A;  3FJP A;  3CCQ A;  3VRZ A;  1C9B A;  2QDJ A;  3VKI A;  4EOR B;  2COW A;  4J9I A;  4BI4 A;  2YT6 A;  3VKG A;  2KXD A;  3G4S Q;  3VS4 A;  2L89 A;  4F7U A;  2X35 A;  1VQ4 T;  5CKF A;  3EFO B;  5GAM e;  2X4Y A;  3THK A;  4M7A G;  4FU6 A;  4CI0 C;  3H8Z A;  2M0O A;  1KHI A;  2QYZ A;  4HKE A;  1YIJ Q;  2EGC A;  3PO3 S;  1H24 B;  4BI8 B;  2HBW A;  4XTV A;  4MMK A;  2LNV A;  1X6O A;  2HQE A;  4J7F A;  2MIO A;  4EOM B;  2DET A;  2E6N A;  1AOJ A;  2VAS A;  3JCM Q;  4M7A C;  4EC9 B;  3OYL A;  2LQN A;  3HHT B;  1X69 A;  2YRV A;  4JLG A;  4A53 A;  5GAN 2;  4FIB A;  1M5Q 1;  1T3L A;  4EMH A;  1QKX A;  3I55 Q;  3CC4 A;  4DA4 A;  1Z9Z A;  2FHD A;  4KUL A;  3EGU A;  2IVW A;  3C12 A;  2DVE A;  2EQI A;  3CC2 Q;  5GJV B;  4Q5W A;  2JGZ B;  3G71 T;  2F2C A;  1ACM B;  4JX5 A;  2C5V B;  3DLL A;  2LTO A;  5FW9 A;  2DBK A;  2X3W D;  2WAC A;  3KHI A;  3R6N A;  4B9W A;  1UGS B;  1MNE A;  4CFX B;  2RHI A;  3C0C A;  3INZ A;  3HKS A;  1V29 B;  3H6Z A;  3HFO A;  2VVK A;  1VQ5 A;  1BBZ A;  3BE3 A;  3TEE A;  2CJM B;  5KYY A;  2OTL T;  4ROD A;  4N4H A;  2HAX A;  2LT1 A;  1M90 R;  1D3U B;  3D7S B;  4BBR M;  1M4Z A;  2A0F B;  2MAM A;  1C0M A;  5GMK e;  1S72 Q;  2XI9 A;  2EJG A;  1X2Q A;  1K73 U;  1K0X A;  5GAN j;  1ZA2 B;  3URG A;  1VYT A;  2QA4 Q;  4ELZ C;  4WTO B;  4JJD A;  4ZGJ B;  2I0N A;  1JB0 E;  1JXO A;  2K2V A;  2F1L A;  3T9N A;  2J6F A;  4KGV B;  2PTK A;  1KC8 U;  2W99 A;  5CR2 A;  1BI0 A;  3OB9 A;  2FPF A;  2DIG A;  2V8K A;  4M7D D;  1H4L D;  2RO0 A;  4L6V 5;  3MJX A;  1XNI A;  1M2V B;  2K3B A;  2A7Y A;  1QWE A;  2PMI B;  1JEG A;  3BHV B;  1JJ2 A;  2D8H A;  1VQM Q;  1WZO A;  1WX6 A;  4PJO D;  3CMA Q;  2V26 A;  4R55 A;  4BCM B;  3EGD B;  1Y07 A;  4C0Z A;  3MHX A;  3VUB A;  4KUD K;  1N5Z A;  2KEA A;  1JRI A;  1CKB A;  3EJ1 B;  2XIC A;  2DL5 A;  4XAX B;  1PRL C;  4MZM A;  5D6Y A;  1VYU A;  1YP5 A;  1Q86 C;  1N4M A;  1N9R A;  4C5H A;  3CCM Q;  2GBQ A;  1R77 A;  1W2B S;  1M2O A;  4IUV A;  3A8G B;  1MMG A;  2ENM A;  3EGD A;  1B3Q A;  3M57 A;  4MDX A;  1ZUU A;  4J7I A;  2K5F A;  1VQK T;  2ZPE B;  2Z0W A;  3PMT A;  2AHJ B;  3CC7 A;  2DIL A;  5I11 A;  1OEB A;  2KK4 A;  3REA B;  5J3B A;  3CCL T;  3VYG A;  2LX9 A;  1WHK A;  2DZC A;  1QW1 A;  4JPB W;  1PM3 A;  1TH7 A;  3E9F A;  1TD6 A;  2HL3 A;  4HNV A;  3RES A;  2JTE A;  5I22 A;  2OTJ T;  1TUG B;  4QVC A;  1OIY B;  4EOO B;  2VV5 A;  3GNG A;  1XOV A;  4RTT A;  6AT1 B;  4NL3 A;  1KSW A;  3RMS A;  2HSE B;  1Q86 R;  4J9H A;  2NUP B;  2KR6 A;  2HZY A;  3A8O B;  5HNB B;  1PKS A;  4E7Z A;  2CYZ B;  1H64 1;  1W2B A;  1K9M U;  4OB0 B;  3ER0 A;  1SRM A;  2PUK B;  5GAM g;  1LPL A;  2E5Q A;  1PC0 A;  1UGR B;  2RM4 A;  3G33 B;  2EUF A;  1Q7Y R;  4PJM A;  1VQ4 A;  2M1H A;  2VXF A;  3PT9 A;  3CCR A;  1KG1 A;  4HA8 A;  1NG2 A;  5IHN A;  1Q86 U;  1ZSG A;  3AHU A;  2K9G A;  3AT1 B;  2OTL Q;  5HK3 A;  3NMZ C;  2RQV A;  3NFC A;  2XK0 A;  4OML A;  3V7C A;  1E7P A;  1BIB A;  1QVG P;  5IHY A;  1K8A C;  1RAC B;  4JRI A;  2LC4 A;  4KUI A;  4BCM D;  1FKM A;  5DM7 R;  2E3I A;  1K0S A;  1KQS S;  4RTX A;  1TXQ A;  3I55 T;  1JXM A;  4XU2 A;  4HL4 A;  2KYM A;  1CKA A;  4OGE A;  5LJ5 d;  1NZ9 A;  5J39 A;  3CCQ T;  4OMO A;  1LOJ A;  1UHC A;  4J6X A;  3SD4 A;  2BE9 B;  2EQK A;  1YJW Q;  4F6U B;  1UB4 A;  3A8H B;  3P8H A;  4PJO F;  1VQO T;  4C8Q C;  3U23 A;  3V8K A;  2EYY A;  4M77 B;  4QSH A;  2V1Q A;  1GBQ A;  3M4G A;  3MP6 A;  1M8V A;  4BE2 A;  1FMK A;  4FM4 B;  2PNI A;  4M77 A;  2FPE A;  1MUZ A;  5DQV A;  2FO0 A;  1D0Z A;  3DB4 A;  5LJ3 h;  3JCM P;  2KQW A;  5DQW A;  3RUX A;  1YIT A;  5GAN 6;  4C5E A;  2HQH A;  4DEX A;  2RN8 A;  3VS5 A;  4CFM B;  2BUD A;  1WHG A;  5LQF B;  5J26 A;  3QHS A;  4MZT A;  4I3Z B;  1OGU B;  2OAW A;  2RQT A;  1LNX A;  4C92 E;  2JNG A;  1RUW A;  2XU8 A;  4OMF B;  1RL2 A;  3REB B;  1K8A R;  2PQW A;  1I1J A;  2QQA A;  1UEC A;  3VJP A;  2PVO B;  2JMA A;  3ASK A;  2L0A A;  1QCO A;  2ZPB B;  2YLC A;  1OIU B;  1K76 A;  2NUZ A;  1Q82 U;  5KE3 A;  1G8X A;  4VUB A;  1OL2 B;  4C5G A;  4F7L B;  1BIA A;  1VQ7 T;  5IHK A;  2ZPH B;  3PGG A;  1T3S A;  2K5L A;  1JJ2 S;  3A8L B;  3QYH B;  4ME7 A;  1G3W A;  5CEI B;  5CKH A;  3V7S A;  4HT9 A;  1WQW A;  2NYS A;  3PIP A;  1ZX6 A;  3G6E T;  3MO8 A;  2JTF A;  2LJ1 A;  4F7J B;  2DTI A;  2YDL A;  4OB3 B;  3QKJ A;  2L3P A;  3OYA A;  1VIF A;  4G6L B;  5EFQ B;  2L3Q A;  2KT8 A;  3L2U A;  2ZZD A;  3QZ9 B;  2OTL A;  5FU7 C;  3JCM b;  2K2M A;  1BI1 A;  1WGS A;  1YHQ T;  1VQP Q;  3F5X B;  1F5Q B;  1H1Q B;  2COY A;  3CPW P;  3EFO A;  2MWO A;  1W1F A;  2FG0 A;  2HQX A;  3CCS A;  1J3T A;  1ZQ1 A;  2NUT A;  3QUI A;  2BZ8 A;  3CCL A;  1AIS B;  5GAM f;  3HO8 A;  2GGR A;  2WSF E;  4BI3 A;  1QVF S;  2FYK A;  3QBY A;  4ANJ A;  3X24 B;  4AFU C;  3RMQ A;  4RCB A;  1KC8 R;  2I40 B;  2B8A A;  4KH1 B;  4IUQ A;  4ORZ A;  4Y92 A;  1WHL A;  1WPY A;  2F2X A;  4Z8A A;  1P5E B;  3FLG A;  3CD6 Q;  4LDY A;  4ELY C;  2QQB A;  4F7U B;  1OI9 B;  2KVQ G;  2L3S A;  2VGM A;  4PFO A;  3H41 A;  4FYW B;  2VUB A;  3LW5 E;  3MKD A;  2DYI A;  3CME Q;  2DM1 A;  3PFS A;  1KQ2 A;  4N0A A;  2ED0 A;  1H28 B;  4J9F A;  1IZ6 A;  4IMY B;  3OYJ A;  1GRI A;  1RLQ C;  1Y96 B;  3CXC S;  2DRM A;  1Z9Q A;  5GJW B;  1OL1 B;  3OS5 A;  1RAI B;  3NTI A;  3H0H A;  3JCM f;  4EMK B;  2PK2 A;  2QXF A;  1YJW A;  3PMI A;  3JAM E;  2IW6 B;  5HBE B;  3DTO A;  1NE8 A;  2F2V A;  4EIK A;  3MIA B;  1QLY A;  4II1 A;  4NOY A;  3VYH B;  1QCF A;  1F1B B;  1LCK A;  1S72 T;  2LQK A;  4C5I A;  4OP0 A;  3QJY A;  3OS0 A;  5AT1 B;  4CC2 A;  5GAN 5;  3L2W A;  3I55 A;  4XTX A;  2R57 A;  1QVG S;  1IGU A;  2DD5 B;  1HSQ A;  1RAD B;  5I2S A;  1PCX A;  1BB9 A;  4HVU A;  4J9C A;  2QA4 A;  4D6W A;  2CUB A;  4JZ3 A;  4Z02 A;  3RNJ A;  1D1B A;  2KT1 A;  3P8D A;  1WLP B;  2KYB A;  4CFU B;  1SSH A;  2BS2 A;  1AEY A;  2ZAE A;  4PJO E;  4A54 A;  1PRM C;  3A8M B;  3DJB A;  3K7A M;  1NJI C;  5FU7 B;  2X51 A;  3OYC A;  5KYW B;  1KHC A;  2IPO B;  4IIM A;  3EG0 A;  4JJB A;  3CCE A;  1ZUY A;  2O9S A;  3OQ5 A;  2QQS A;  2RHY A;  2DIQ A;  4WCI A;  1M8M A;  4KRC B;  4OMP A;  4ELL A;  4JJN K;  4ROC A;  2AKL A;  2B86 A;  3RKX A;  3M9Q A;  1YIJ T;  3UPU A;  2MYS A;  2RJD A;  1MV3 A;  1IRE B;  5HBH B;  1O9K A;  1BU2 A;  1R8O B;  1KFZ A;  3CCR Q;  5IT9 E;  2YUN A;  2BTT A;  8AT1 B;  2CZ7 B;  2NUP A;  1BK2 A;  3PVL A;  5CIU A; 
#chains in the Genus database with same CATH homology
 4JS5 A;  2FB7 A;  1KC8 U;  5GAN 4;  5CR2 A;  4X9D A;  1VQ6 A;  1M1K C;  1GXI E;  1BI0 A;  3OB9 A;  3OW2 S;  4XTW A;  2QQ8 A;  2VYT A;  4M78 B;  4A4E A;  2D9T A;  1WJS A;  4A4H A;  1BI2 A;  3OYN A;  3OA6 A;  2EQM A;  2DIG A;  3OYK A;  2V8K A;  4J5Y A;  4L59 A;  4ZTJ A;  4QQ6 A;  4M7D D;  1K9M U;  2RO0 A;  3OBW A;  5HKC A;  4L6V 5;  3HZJ A;  3M56 A;  1N6A A;  1LJO A;  1WQ7 A;  2JZ2 A;  3OY9 A;  1XNI A;  3GPL A;  3CCS T;  2CZ6 B;  4XQ3 A;  1BYM A;  5LJ5 f;  2O4X B;  4UC4 A;  3FIF A;  3CCR T;  4ZGE B;  1KQ1 A;  5L8R E;  2A7Y A;  4OF1 A;  3OW2 A;  4C92 B;  1U8R A;  4M7D A;  3QYG B;  1Y71 A;  1JJ2 A;  5CAI A;  2G77 A;  4PJO D;  3L2Z A;  4XTZ A;  4R55 A;  2PUO B;  1Q7Y C;  2LT4 A;  2E64 A;  1O9S A;  1Y07 A;  3WVD B;  3MHX A;  3JCM c;  3VUB A;  4C0Z A;  4KUD K;  5D6X A;  4AKI A;  3JB9 H;  4ATO A;  1PSE A;  3CME T;  1JRI A;  2DZ9 A;  2XIC A;  3BG9 A;  4NC6 A;  1VQ9 T;  2CZ1 B;  2DEQ A;  1YI2 A;  4XAX B;  1ZBX A;  4MZM A;  3OYE A;  5D6Y A;  1Q81 U;  1G3Y A;  1N9R A;  4EMK C;  1Q86 C;  1D3B B;  4C5H A;  3NTK A;  4RG8 A;  1YJW T;  1W2B S;  3OSS C;  1OZ3 A;  2MI6 A;  3C4S A;  5GAM d;  5CQY A;  4IUV A;  3A8G B;  4KBM B;  2EKO A;  2EJ9 A;  3JCM h;  3QZ5 B;  3LH0 A;  4BDY A;  4C8Q B;  1D3B A;  3LYI A;  3M57 A;  4EMG A;  4MDX A;  3HB9 A;  1Y96 A;  3I56 T;  4J7I A;  3LWI A;  2K5F A;  4BAC A;  1FWZ A;  4LDW A;  2DTO A;  1Q81 C;  2HBP A;  2RI5 A;  1VQK T;  2ZPE B;  5EJC A;  3PMT A;  2AHJ B;  3CC7 A;  5CK9 A;  2XDP A;  2KK4 A;  5J3B A;  4C0D B;  3CCL T;  4C92 C;  1VQ6 T;  3CBP A;  2GCX A;  2EIF A;  4QVD A;  2EFI A;  4IUP A;  4E7I A;  4QQG A;  3OSV A;  1HK9 A;  2KAF A;  3VYG A;  5FRM A;  3OS1 A;  4M78 F;  2LX9 A;  3QSU A;  4PJO C;  4OGC A;  4JX4 A;  5GAO l;  4E7K A;  4LD9 K;  2DZC A;  1QW1 A;  1QP3 A;  1TH7 A;  2JN0 A;  3E19 A;  3E9F A;  2EAY A;  4M7D F;  4LDX A;  4EMK A;  4HNV A;  4HNT A;  1MGQ A;  1W4S A;  1WJQ A;  2JOY A;  3HRS A;  3M5A A;  4M75 B;  4X34 A;  3RES A;  2OTJ T;  5GAO r;  2EYQ A;  4FL6 A;  4F7U F;  2NLU A;  1JBM A;  3C95 A;  3KUF A;  1MHN A;  1QVP A;  2VGN A;  4QVC A;  3DL1 A;  3GNG A;  2VV5 A;  1XOV A;  3OYB A;  2DXC B;  3LGL A;  3RMS A;  4NL3 A;  1G3T A;  3TU4 K;  3OYM A;  3HSB A;  5GMK m;  2I2L A;  2KR6 A;  3A8O B;  5A2Q E;  2DAQ A;  1YJ9 T;  1YJ9 A;  1G3S A;  3CCM A;  1KQS A;  1Y7X A;  2K5I A;  2CYZ B;  1H64 1;  5D6W A;  1W2B A;  4XU3 A;  1FXX A;  4OB0 B;  4O5V A;  2PUK B;  2R5A A;  4ELJ A;  2RD1 A;  2XG8 D;  3ER0 A;  4M77 D;  3JCM X;  5GAM g;  3EFR A;  2DTH A;  3OYI A;  1S72 A;  5EG2 A;  3CC2 T;  4C92 D;  2E5Q A;  3SWN C;  5GAN g;  2RH2 A;  4HCC A;  1UGR B;  2ZPG B;  2RM4 A;  2KDS A;  4YTL A;  4J83 A;  1FX7 A;  3SB2 A;  3KBG A;  3CD6 T;  2CKK A;  5LJ3 f;  1PSF A;  4Y28 E;  1N9S A;  3MEU A;  2FL7 A;  2V8I A;  5KCO A;  3CCV T;  2MWP A;  2M1H A;  5GMK h;  1VQ4 A;  2RB6 A;  5KE2 A;  1VQL T;  3M54 A;  5HK0 A;  3RKW A;  2VXF A;  3PT9 A;  2RK1 A;  4ZN1 A;  5GAN d;  3JCM J;  3QWL A;  3A5Z B;  3CCR A;  1KG1 A;  3L1A A;  5M9O A;  1M90 C;  4HA8 A;  1YCY A;  1Q86 U;  3BY7 A;  1M9S A;  3AHU A;  2DXC A;  5KCH A;  3HRT A;  2MMP A;  5HK3 A;  2Y4Y A;  3CCJ T;  3NFC A;  2XK0 A;  3C94 A;  5A0L A;  3CBM A;  2KMT A;  4M78 C;  2JTM A;  3EAE A;  4BY6 C;  3N5B B;  4E7L A;  4A4F A;  4QQD A;  4BE0 A;  1VUB A;  4C92 G;  4AKH A;  3OBY A;  2RK2 A;  3V7C A;  1E7P A;  1BIB A;  2QTX A;  4M77 G;  4O6J A;  3OYD A;  2DXB B;  2QA4 T;  1VQP T;  3UT1 A;  1WNL A;  1K8A C;  3X20 B;  3SWN B;  5LJ3 j;  2DPP B;  2RHX A;  4JRI A;  4MZP A;  2XDB A;  3QDR B;  2XD0 A;  4R56 A;  2LC4 A;  2LQ8 A;  4IUT A;  3HPW A;  4KUI A;  4XK8 E;  1FKM A;  2KMG A;  3FRN A;  4OB1 B;  4XU0 A;  5DM7 R;  1YIJ A;  5GMK j;  3CXC A;  4JRQ A;  1KQS S;  3TW7 A;  1I4K 1;  1I81 A;  1EIF A;  4HT8 A;  4M75 D;  3TCJ A;  3WXM B;  4TVR A;  5GMK i;  3I55 T;  4XU2 A;  1M1G A;  1XTD A;  4HL4 A;  2GFU A;  4M77 E;  3E9G A;  4OGE A;  2K3Y A;  3SFM A;  3DLM A;  5LJ5 d;  1NZ9 A;  1YHQ A;  5J39 A;  5GAN h;  3CCQ T;  1K9M C;  2GF7 A;  5GAN 8;  1LOJ A;  3Q1J A;  3SWN A;  4E7H A;  3V8J A;  4J6X A;  3SD4 A;  3BG5 A;  4AI6 A;  2EQK A;  4C8Q D;  5A0D A;  5LJ3 g;  4ZTF A;  3J7A F;  2FVU A;  1UB4 A;  1KC8 C;  3A8H B;  3MEV A;  1BI3 A;  3P8H A;  4PJO F;  1VQO T;  4C8Q C;  1VQM A;  3V8K A;  2PVG B;  4N4I A;  3GIB A;  4HCB A;  5A0G A;  2LDM A;  5CO7 A;  3S3N A;  2IG0 A;  2JUF A;  3CPF A;  5CKE A;  3X28 B;  4QSH A;  1XQH A;  4M77 B;  4C92 F;  5GAN 7;  2OAU A;  4LDU A;  2DD4 B;  2ZZD B;  2P0Q A;  3LGF A;  4C8Q A;  3M4G A;  3MP6 A;  1M8V A;  1K8A U;  4PNO A;  2HNI A;  4BE2 A;  3J81 E;  4FM4 B;  4FT2 A;  2F69 A;  4M77 A;  5KH6 A;  4LOC A;  3O8V A;  1I5L A;  3HRU A;  2GFA A;  4C92 A;  5LJ5 g;  5GAN e;  3NTH A;  1VQ9 A;  4M7A F;  3QII A;  2QI2 A;  3S3M A;  1G5V A;  5GAM j;  1VQK A;  1H3Z A;  4QVZ A;  4RMO A;  2ZGW A;  3DB4 A;  5LJ3 h;  5GAN 3;  3TRE A;  4WF2 A;  3JCM d;  2KQW A;  3JCM P;  1QVG A;  3RUX A;  1NPP A;  5GAO p;  3RIR A;  4M75 C;  3QXE B;  3JB9 D;  3TW6 A;  1YIT T;  1YIT A;  5FU6 C;  3BG3 A;  2DO3 A;  5GAN 6;  2L5Q A;  3ME9 A;  3PTA A;  4C5E A;  4JDS A;  3H4C A;  4PLL A;  3L2V A;  4FT4 A;  2DXU A;  2QFZ A;  1OYX A;  3VV0 A;  2QQR A;  2BUD A;  5CKD A;  1B34 A;  4N4G A;  3RKY A;  1BKB A;  1U1S A;  2YHT A;  3HL8 A;  3FDR A;  5J26 A;  4JLI A;  5LJ5 h;  3QHS A;  4MZT A;  2VXE A;  4M77 C;  2QEX A;  1B34 B;  2RA2 A;  4M6V A;  4NL2 A;  3BDU A;  3JRZ A;  4LDV A;  1LNX A;  4L5G A;  4N0A C;  4C92 E;  3QYB A;  3WVE B;  2GQV A;  2E1H A;  2JNG A;  2XU8 A;  4OMF B;  3CCJ A;  3FC3 A;  1RL2 A;  3QYE A;  1OI1 A;  3SDZ A;  2PQW A;  3QPH A;  3ZBD A;  2DKG A;  2QQA A;  3VJP A;  2QF7 A;  2PVO B;  3CCE T;  3MP8 A;  1RI0 A;  3OYF A;  3GOX A;  2XKO C;  3ASK A;  5GAM h;  3CMA T;  2BKD N;  2ZPB B;  2YLC A;  4J6W A;  3OMC A;  1YJN T;  1Q82 U;  2RJC A;  4A4G A;  5KE3 A;  3CBO A;  3JB9 J;  3CC7 T;  3CC2 A;  4VUB A;  3BFM A;  2LVM A;  4C5G A;  2E41 A;  3BW1 A;  5CKB A;  2O01 E;  3DKM A;  5FU6 B;  3DB3 A;  1I8F A;  1BIA A;  2DK3 A;  2DXT A;  2X4J A;  1NJI U;  1VQ7 T;  4MIM A;  4GY5 A;  1VQL A;  1OZ2 A;  2ZPH B;  3PGG A;  2HD0 A;  2K5L A;  1JJ2 S;  3L42 A;  4LD6 A;  2ZCF B;  3A8L B;  1M1K U;  1VQO A;  2P4T A;  5IN1 A;  1DJ7 B;  3V7R A;  2JVV A;  3CC4 T;  5FRO A;  2QQ9 A;  3QYH B;  4ME7 A;  4P5N A;  5LJ5 e;  4M7D G;  1G3W A;  4BY6 B;  5CKH A;  4BB7 A;  1VQN A;  3V7S A;  3CPW S;  4HT9 A;  2Y90 A;  3EFS A;  2RI2 A;  4MFE A;  3HP9 A;  1WQW A;  5LJ3 d;  4BD3 A;  3PIP A;  3G6E T;  3LLR A;  3MO8 A;  2JTF A;  4X9C A;  4PJO A;  2M16 A;  5AYF A;  2RI3 A;  2DD4 A;  2RHZ A;  1N27 A;  2F5T X;  4M7A E;  1VIE A;  2ZPI B;  2EJF A;  3MP1 A;  4M78 G;  4E47 A;  2DTI A;  1YBY A;  4XTY A;  4OB3 B;  5GMK l;  3G4S A;  3FB9 A;  3QKJ A;  3JB9 I;  3ZFJ A;  3OYA A;  4JX6 A;  1P92 A;  1YJN A;  1VIF A;  2D6F A;  2X4W A;  3L2U A;  5CVI A;  3M55 A;  2CZ0 B;  2ZZD A;  4E7J A;  4BE1 A;  3QZ9 B;  2ZPF B;  5FU7 C;  3UWN A;  3JCM b;  1KD1 U;  2XID A;  2LCL A;  3LWH A;  2C06 A;  4C8Q E;  4IKF A;  1BI1 A;  3X25 B;  1WGS A;  3I56 A;  1YHQ T;  3X26 B;  1WJR A;  2KY9 A;  3J80 E;  2DD5 A;  2O4X A;  3FEO A;  2MWO A;  2HQX A;  1QP2 A;  3CCS A;  1Q82 C;  1ZQ1 A;  2XHC A;  4BUG A;  3JCM g;  3JCM e;  2OTL A;  4M78 E;  5GAN f;  2K4Y A;  3QUI A;  3LX7 A;  4BBS M;  3QG1 A;  3V8L A;  3M59 A;  5DLO A;  3CCL A;  1NPR A;  2OTJ A;  5GAM f;  3HO8 A;  4XU1 A;  2WSF E;  4RCC A;  3E1S A;  4BI3 A;  5GAO m;  1QVF S;  2FYK A;  3M58 A;  2DJZ A;  3QBY A;  5DLQ E;  4Z6Y A;  2VC8 A;  3X24 B;  2L3R A;  1UEB A;  3RMQ A;  2PU9 B;  4MDW A;  4PLI A;  4RCB A;  1AHJ B;  4CRI A;  3CME A;  2K3X A;  2B8A A;  2WSC E;  5IAY A;  4EDU A;  4IUQ A;  4OVA A;  3S6W A;  1WPY A;  2V8J A;  1UGQ B;  4PJO G;  2KSS A;  5CCA A;  5I21 A;  4ZGD B;  4FSX A;  3CPW A;  4JRP A;  1VQN T;  3L2Q A;  2E10 A;  2X4X A;  4Y91 A;  2P0P A;  2DXB A;  3JCM W;  3FLG A;  4DOV A;  3M53 A;  4HCZ A;  5LJ5 j;  4V2S A;  4LDY A;  5GAO n;  3JB9 F;  4ELY C;  3OYG A;  2QQB A;  4F7U B;  2KVQ G;  2VGM A;  4A4K A;  1M90 U;  2VUB A;  3LW5 E;  4JRK A;  4RKU E;  3VYG B;  4HLQ A;  5I2M A;  4EPC A;  3PFS A;  2BS3 A;  3GP8 A;  3KXT A;  4M7D C;  4BDZ A;  1KQ2 A;  4N0A A;  1SSF A;  2QDY B;  4J6Y A;  3OMG A;  3JCM V;  1VQM T;  4IUU A;  4M7A B;  4NS5 A;  1IZ6 A;  3JB9 G;  1N8R C;  3MEA A;  4F7U E;  3OYJ A;  3CXC S;  1Y96 B;  1YI2 T;  3CD6 A;  3PIO A;  4XTU A;  4J8O A;  2PVD B;  2F5K A;  4IUR A;  3CCQ A;  3FJP A;  2QDJ A;  3VKI A;  5FLX E;  1HXD A;  1M1F A;  4JS4 A;  4OB2 B;  1X01 A;  3OS5 A;  3NTI A;  4BI4 A;  3L2R A;  2M9U A;  3VKG A;  3JCM f;  3F70 A;  4EMK B;  2L89 A;  2WSE E;  4F7U A;  3CCV A;  4C8Q F;  2QXF A;  3G71 A;  2X35 A;  3PMI A;  1VQ4 T;  1YJW A;  3JAM E;  5CKF A;  5GAM e;  2QEX T;  5LL6 S;  3CCU A;  2X4Y A;  4M7A G;  4FU6 A;  4CI0 C;  1NE8 A;  4F7U G;  2MF2 A;  2EQU A;  3H8Z A;  4M75 E;  4II1 A;  4NOY A;  2M0O A;  3VYH B;  1KD1 C;  3G7Z A;  5FRN A;  1KHI A;  2LQK A;  3MCA B;  4HKE A;  4C5I A;  2H3J A;  1UGP B;  4M75 F;  1S72 T;  4M78 D;  4OP0 A;  4BI8 B;  3QJY A;  3M4Y A;  5GAO q;  4XTV A;  2XDD A;  4M7D B;  4RG2 A;  4MMK A;  4HNU A;  2LNV A;  1X6O A;  4C8Q G;  2HQE A;  5GAN 5;  4J7F A;  3OS0 A;  3L2W A;  1VQP A;  2G3R A;  1ZHI A;  3I55 A;  4XTX A;  2RJE A;  2E6N A;  2R57 A;  1QVG S;  4C0D C;  4C0F A;  3RER A;  3JCM Q;  2DD5 B;  4M7A C;  2E65 A;  4PKC C;  1N8R U;  3OYL A;  2YRV A;  3HHT B;  4JLG A;  3VU3 C;  1Q7Y U;  5CQX A;  4A53 A;  5I2S A;  4ZN3 A;  5GAN 2;  2L8D A;  1M5Q 1;  2Y4X A;  4FIB A;  4M75 G;  2E70 A;  3OS2 A;  4PJO B;  2RHU A;  2QA4 A;  4D6W A;  4EMH A;  3GLX A;  3GNF B;  5LJ3 e;  4M7D E;  3CC4 A;  4DA4 A;  2FHD A;  3QO3 A;  4Z02 A;  3P8D A;  4KUL A;  3OYY A;  2CGH A;  2IVW A;  3CEY A;  5DY9 A;  4M7A A;  3C12 A;  2DVE A;  2R5M A;  2E6Z A;  3MEW A;  4DQ2 A;  4Q5W A;  3VKH A;  2D0Q B;  3G71 T;  4DOW A;  2BS2 A;  3P8B B;  5HY6 A;  4PJO E;  4A54 A;  4PL6 A;  1X75 C;  1U1T A;  4JX5 A;  3A8M B;  3PNW C;  2LTO A;  3G6E A;  3VUZ A;  3DLL A;  4GLK A;  2P0K A;  2BS4 A;  5FU7 B;  2YLB A;  1QLB A;  1NJI C;  3OYC A;  4C0G A;  4AKG A;  1KHC A;  2WAC A;  5C0M A;  3JSC A;  3CMA A;  3KHI A;  2RJF A;  4MML A;  4B9W A;  3BDL A;  1UGS B;  2RHI A;  1QVF A;  2EQJ A;  3CCE A;  3INZ A;  5C6S A;  3OQ5 A;  3HKS A;  1V29 B;  2QQS A;  3OYH A;  3G4S T;  3MET A;  2EWN A;  3H6Z A;  2RHY A;  2DIQ A;  4M7A D;  3HFO A;  3CCU T;  3ZEH A;  1VQ5 T;  1VQ5 A;  2BIV A;  2LRQ A;  3TEE A;  3UDC A;  4M77 F;  2R58 A;  4QW2 A;  1VQ7 A;  2A3L A;  2E12 A;  2OTL T;  3HBL A;  2K57 A;  4N4H A;  2HAX A;  2LT1 A;  4JJN K;  4BBR M;  3RKX A;  1M4Z A;  2MAM A;  3M9Q A;  5GMK e;  3UPU A;  1YIJ T;  2EJG A;  2RJD A;  2XI9 A;  2LCC A;  1K73 U;  1IRE B;  1O75 A;  2WJ9 A;  5GAN j;  3URG A;  4MFD A;  2CS7 A;  4ELZ C;  3HFN A;  1R8O B;  1VQ8 A;  3CCM T;  3QJ6 A;  3R6O A;  4JUV A;  3S3O A;  4ZGJ B;  5IT9 E;  4KT0 E;  1JB0 E;  2CZ7 B;  4M75 A;  1VQ8 T;  4M78 A;  2K2V A;  3GF5 A;  4B9X A;  1K73 C;  3T9N A;  5CIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...