3DDQB

Structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor roscovitine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords Cell division protein kinase 2
publication title CR8, a potent and selective, roscovitine-derived inhibitor of cyclin-dependent kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ddqB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ddqB02
4EOKB 3DDPB 1W98B 2UUEB 1H4LD 1ZP2A 2CCIB 1JOWA 1OIYB 3EIDB 1H1SB 5LQFB 4BCFB 2QDJA 2CCHB 4EOJB 2IVXA 4F6SB 4I3ZB 1C9BA 1GY3B 1VYWB 2F2CA 2B9RA 4BCND 1QMZB 2C6TB 2CJMB 1GUXA 2G9XB 4G6LB 5HBHB 4BCKB 4OGRB 1UNGD 5HQ0B 1XO2A 3BHVB 1H25B 2PHGA 1JSTB 1H28B 2V22B 4BCMB 3TN8B 1URCB 4CXAB 4ELLA 2W96A 3O0GD 3EJ1B 1E9HB 1P5EB 5HNBB 4BCQB 5CYIB 1OKVB 4EOQB 4CFXB 1G3NC 2W9ZA 1UNHD 1VINA 4EC9B 4CFUB 4BCHB 2UZDB 1D3UB 1OIUB 3M03A 2C5NB 5BNJB 3TNWB 4YC3B 4II5B 4EORB 2EUFA 1H26B 2C5VB 5ACBA 4EOMB 4YOOA 4CFVB 1H24B 1H1QB 2WMAB 4BCMD 5HBJB 4F6WB 4EC8B 5FGKB 3POMA 4OR5B 3TNIB 4BCQD 2WIHB 1BU2A 2IW9B 3F5XB 3MI9B 4BCPB 2JGZB 4EOOB 4F7NB 1KXUA 1OL2B 5IDPB 1OI9B 2WMBB 4CFUD 3BHUB 5IDNB 2UZEB 2UZLB 4KRCB 3MY5B 1AD6A 4EOPB 3EOCB 3BLRB 5EFQB 1PKDB 3K7AM 4CFNB 1OL1B 3QHRB 4EOSB 2R7GA 1UNLD 1FVVB 4Y72B 2IW8B 4RODA 2WPAB 2X1NB 1FINB 1N4MA 3BLQB 4TTHA 5HBEB 1O9KA 2C4GB 3H4CA 4YOZA 4F70B 2W2HA 4BCIB 4F7SB 3MIAB 4CFMB 3TNHB 5LMKB 5HVYB 2W99A 1O9KB 1JSUB 2C5OB 3RGFB 4ELJA 5CEIB 1OKWB 4YOSA 5I5ZB 1H1PB 2WXVB 4BCOB 3DOGB 5ICPB 1TFBA 4BCGB 2WEVB 3QHWB 4NSTB 5L2WB 3BHTB 1F5QB 2I40B 2WIPB 2WFYB 1AISB 5IF1B 4F7LB 1OGUB 2W9FA 4FX3B 4F7JB 3MY1B 4KRDB 4UN0A 3DDQB 4F6UB 2PK2A 4IMYB 2C5XB 4ROEA 4EOIB 1VOLA 2BPMB 2WHBB 1GH6B 4EOLB 2PMIB 4CFWB 4BCNB 3G33B 4EONB 1H27B 3BLHB 1GUXB 4BCJB 4ROCA 2UZBB 2I53A 3LQ5B 4CRLB 2BKZB 2IW6B 1H1RB 2PK9B 1JKWA
chains in the Genus database with same CATH superfamily
4HNTA 3VYGB 1FKMA 4BCFB 4F6SB 1VYWB 2B9RA 4MFDA 1QMZB 2CJMB 4M6VA 1AHJB 2ZPBB 3TN8B 3EJ1B 2ZZDB 1E9HB 5CYIB 4BCQB 1UGSB 1OIUB 3X24B 3DTOA 3TNWB 4YC3B 4YOOA 2QGSA 3A8LB 5HBJB 5FGKB 2KR6A 2ZCFB 1OI9B 2WMBB 5IDNB 2D0QB 3MY5B 1AD6A 2PJQA 1PKDB 3QHRB 2DPPB 2WPAB 4JX6A 5HBEB 3H4CA 2ZPHB 4CFMB 5HVYB 5CEIB 1JSUB 3X25B 1OKWB 3QXEB 3A8MB 2WXVB 5ICPB 3QHWB 4BY7X 2ZPEB 3DJBA 2WIPB 2WFYB 1UGRB 5IF1B 2W9FA 4F7JB 4UN0A 4F6UB 2PK2A 2PMIB 4BBSM 3GTMS 2BKZB 4OB0B 2IW6B 2DXBB 2CZ0B 2DXCB 2ZPFB 5LQFB 2QDJA 4I3ZB 2QQ8A 2BS4A 4BCND 1QLBA 2QDYB 2G9XB 4OGRB 3BHVB 1H25B 2PHGA 1JSTB 2V22B 4BCMB 4CXAB 1URCB 4ELLA 3HZJA 4OB1B 1G3NC 4Z6YA 1VINA 4CFUB 2UZDB 3TW6A 3VKGA 1H26B 2C5VB 5ACBA 4EOMB 3BG3A 4F6WB 4EC8B 2WJ9A 3TNIB 5DQVA 3F5XB 4BCPB 2ZPIB 2LW4A 1UGPB 4LOCA 3QYGB 3BG9A 4JX5A 1OL1B 2QF7A 2R7GA 3WVEB 1FVVB 4Y72B 4RODA 1FINB 1N4MA 4ZGDB 3NDQA 5EJCA 4BCIB 4AKHA 5LMKB 3VYHB 1O9KB 4HLQA 3RGFB 4HNUA 3X28B 1TFBA 4BCGB 2CZ7B 2WEVB 4FM4B 4MIMA 2I40B 2CZ6B 2DD4B 2BS3A 3A8HB 4FX3B 4KRDB 4IMYB 2C5XB 4ROEA 2BPMB 1GH6B 4EOLB 1IREB 4OB2B 2IN3A 3MY1B 1H1RB 1V29B 3BHTB 2PK9B 3DDPB 2UUEB 1H4LD 1JOWA 1OIYB 3EIDB 1H1SB 2IVXA 3QYHB 1GY3B 2F2CA 3HO8A 1GUXA 5DQWA 5HQ0B 1E7PA 2W96A 3O0GD 4HL4A 1P5EB 3TW7A 1OKVB 3KHIA 3QZ5B 4CFXB 3BG5A 4QSHA 1D3UB 3M03A 3QYEA 4II5B 4EORB 4NC6A 1H24B 1H1QB 3HB9A 4OR5B 4BCQD 2WIHB 3MI9B 3QZ9B 3WVDB 4EOOB 2JGZB 5IDPB 2BS2A 2ZPGB 2UZLB 4BY1X 4EOPB 3EOCB 4CFNB 3K7AM 4EOSB 1UNLD 2IW8B 3BLQB 5IHYA 2AHJB 4TTHA 3A8OB 4YOZA 3MIAB 4AKGA 3TNHB 2KMGA 2W99A 3X20B 4ELJA 3HHTB 4YOSA 5I5ZB 3DOGB 4AI6A 5L2WB 2CZ1B 4F7LB 1OGUB 3DDQB 4CFWB 4BCNB 3G33B 4EONB 1H27B 1GUXB 4BCJB 2UZBB 2I53A 1JKWA 2QFZA 4EOKB 1W98B 3A8GB 3QYBA 1ZP2A 2CCIB 2CCHB 4EOJB 1C9BA 2C6TB 4G6LB 5HBHB 4BCKB 1UNGD 2CYZB 1XO2A 1H28B 5HNBB 4EOQB 2W9ZA 1UNHD 4EC9B 4BCHB 2C5NB 5BNJB 2EUFA 1TD6A 4CFVB 2WMAB 2DMEA 4BCMD 3DL1A 4BXXX 4BBRM 3POMA 1BU2A 2IW9B 4F7NB 1KXUA 1OL2B 4JX4A 4CFUD 3BHUB 3X26B 2UZEB 3B57A 4KRCB 3PO3S 4OB3B 3BLRB 5EFQB 1ENWA 2X1NB 4MFEA 2DD5B 3HBLA 1O9KA 2C4GB 4F70B 2W2HA 4F7SB 2C5OB 4ZGJB 4HNVA 4BCOB 1UGQB 4NSTB 2G77A 3VKHA 1F5QB 1AISB 4AKIA 3QWLA 4EOIB 1VOLA 2WHBB 4ZGEB 3BLHB 4ROCA 3LQ5B 4CRLB 1H1PB
chains in the Genus database with same CATH topology
4EOKB 3DDPB 1W98B 2UUEB 1H4LD 1ZP2A 2CCIB 1JOWA 1OIYB 3EIDB 1H1SB 5LQFB 4BCFB 2QDJA 2CCHB 4EOJB 2IVXA 4F6SB 4I3ZB 1C9BA 1GY3B 1VYWB 2F2CA 2B9RA 4BCND 1QMZB 2C6TB 2CJMB 1GUXA 2G9XB 4G6LB 5HBHB 4BCKB 4OGRB 1UNGD 5HQ0B 1XO2A 3BHVB 1H25B 2PHGA 1JSTB 1H28B 2V22B 4BCMB 3TN8B 1URCB 4CXAB 4ELLA 2W96A 3O0GD 3EJ1B 1E9HB 1P5EB 5HNBB 4BCQB 5CYIB 1OKVB 4EOQB 4CFXB 1G3NC 2W9ZA 1UNHD 1VINA 4EC9B 4CFUB 4BCHB 2UZDB 1D3UB 1OIUB 3M03A 2C5NB 5BNJB 3TNWB 4YC3B 4II5B 4EORB 2EUFA 1H26B 2C5VB 5ACBA 4EOMB 4YOOA 4CFVB 1H24B 1H1QB 2WMAB 4BCMD 5HBJB 4F6WB 4EC8B 5FGKB 3POMA 4OR5B 3TNIB 4BCQD 2WIHB 1BU2A 2IW9B 3F5XB 3MI9B 4BCPB 2JGZB 4EOOB 4F7NB 1KXUA 1OL2B 5IDPB 1OI9B 2WMBB 4CFUD 3BHUB 5IDNB 2UZEB 2UZLB 4KRCB 3MY5B 1AD6A 4EOPB 3EOCB 3BLRB 5EFQB 1PKDB 3K7AM 4CFNB 1OL1B 3QHRB 4EOSB 2R7GA 1UNLD 1FVVB 4Y72B 2IW8B 4RODA 2WPAB 2X1NB 1FINB 1N4MA 3BLQB 4TTHA 5HBEB 1O9KA 2C4GB 3H4CA 4YOZA 4F70B 2W2HA 4BCIB 4F7SB 3MIAB 4CFMB 3TNHB 5LMKB 5HVYB 2W99A 1O9KB 1JSUB 2C5OB 3RGFB 4ELJA 5CEIB 1OKWB 4YOSA 5I5ZB 1H1PB 2WXVB 4BCOB 3DOGB 5ICPB 1TFBA 4BCGB 2WEVB 3QHWB 4NSTB 5L2WB 3BHTB 1F5QB 2I40B 2WIPB 2WFYB 1AISB 5IF1B 4F7LB 1OGUB 2W9FA 4FX3B 4F7JB 3MY1B 4KRDB 4UN0A 3DDQB 4F6UB 2PK2A 4IMYB 2C5XB 4ROEA 4EOIB 1VOLA 2BPMB 2WHBB 1GH6B 4EOLB 2PMIB 4CFWB 4BCNB 3G33B 4EONB 1H27B 3BLHB 1GUXB 4BCJB 4ROCA 2UZBB 2I53A 3LQ5B 4CRLB 2BKZB 2IW6B 1H1RB 2PK9B 1JKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EOK B;  3DDP B;  1W98 B;  2UUE B;  1H4L D;  1ZP2 A;  2CCI B;  1JOW A;  1OIY B;  3EID B;  1H1S B;  5LQF B;  4BCF B;  2QDJ A;  2CCH B;  4EOJ B;  2IVX A;  4F6S B;  4I3Z B;  1C9B A;  1GY3 B;  1VYW B;  2F2C A;  2B9R A;  4BCN D;  1QMZ B;  2C6T B;  2CJM B;  1GUX A;  2G9X B;  4G6L B;  5HBH B;  4BCK B;  4OGR B;  1UNG D;  5HQ0 B;  1XO2 A;  3BHV B;  1H25 B;  2PHG A;  1JST B;  1H28 B;  2V22 B;  4BCM B;  3TN8 B;  1URC B;  4CXA B;  4ELL A;  2W96 A;  3O0G D;  3EJ1 B;  1E9H B;  1P5E B;  5HNB B;  4BCQ B;  5CYI B;  1OKV B;  4EOQ B;  4CFX B;  1G3N C;  2W9Z A;  1UNH D;  1VIN A;  4EC9 B;  4CFU B;  4BCH B;  2UZD B;  1D3U B;  1OIU B;  3M03 A;  2C5N B;  5BNJ B;  3TNW B;  4YC3 B;  4II5 B;  4EOR B;  2EUF A;  1H26 B;  2C5V B;  5ACB A;  4EOM B;  4YOO A;  4CFV B;  1H24 B;  1H1Q B;  2WMA B;  4BCM D;  5HBJ B;  4F6W B;  4EC8 B;  5FGK B;  3POM A;  4OR5 B;  3TNI B;  4BCQ D;  2WIH B;  1BU2 A;  2IW9 B;  3F5X B;  3MI9 B;  4BCP B;  2JGZ B;  4EOO B;  4F7N B;  1KXU A;  1OL2 B;  5IDP B;  1OI9 B;  2WMB B;  4CFU D;  3BHU B;  5IDN B;  2UZE B;  2UZL B;  4KRC B;  3MY5 B;  1AD6 A;  4EOP B;  3EOC B;  3BLR B;  5EFQ B;  1PKD B;  3K7A M;  4CFN B;  1OL1 B;  3QHR B;  4EOS B;  2R7G A;  1UNL D;  1FVV B;  4Y72 B;  2IW8 B;  4ROD A;  2WPA B;  2X1N B;  1FIN B;  1N4M A;  3BLQ B;  4TTH A;  5HBE B;  1O9K A;  2C4G B;  3H4C A;  4YOZ A;  4F70 B;  2W2H A;  4BCI B;  4F7S B;  3MIA B;  4CFM B;  3TNH B;  5LMK B;  5HVY B;  2W99 A;  1O9K B;  1JSU B;  2C5O B;  3RGF B;  4ELJ A;  5CEI B;  1OKW B;  4YOS A;  5I5Z B;  1H1P B;  2WXV B;  4BCO B;  3DOG B;  5ICP B;  1TFB A;  4BCG B;  2WEV B;  3QHW B;  4NST B;  5L2W B;  3BHT B;  1F5Q B;  2I40 B;  2WIP B;  2WFY B;  1AIS B;  5IF1 B;  4F7L B;  1OGU B;  2W9F A;  4FX3 B;  4F7J B;  3MY1 B;  4KRD B;  4UN0 A;  3DDQ B;  4F6U B;  2PK2 A;  4IMY B;  2C5X B;  4ROE A;  4EOI B;  1VOL A;  2BPM B;  2WHB B;  1GH6 B;  4EOL B;  2PMI B;  4CFW B;  4BCN B;  3G33 B;  4EON B;  1H27 B;  3BLH B;  1GUX B;  4BCJ B;  4ROC A;  2UZB B;  2I53 A;  3LQ5 B;  4CRL B;  2BKZ B;  2IW6 B;  1H1R B;  2PK9 B;  1JKW A; 
#chains in the Genus database with same CATH topology
 4HNT A;  3VYG B;  1FKM A;  4BCF B;  4F6S B;  1VYW B;  2B9R A;  4MFD A;  1QMZ B;  2CJM B;  4M6V A;  1AHJ B;  2ZPB B;  3TN8 B;  3EJ1 B;  2ZZD B;  1E9H B;  5CYI B;  4BCQ B;  1UGS B;  1OIU B;  3X24 B;  3DTO A;  3TNW B;  4YC3 B;  4YOO A;  2QGS A;  3A8L B;  5HBJ B;  5FGK B;  2KR6 A;  2ZCF B;  1OI9 B;  2WMB B;  5IDN B;  2D0Q B;  3MY5 B;  1AD6 A;  2PJQ A;  1PKD B;  3QHR B;  2DPP B;  2WPA B;  4JX6 A;  5HBE B;  3H4C A;  2ZPH B;  4CFM B;  5HVY B;  5CEI B;  1JSU B;  3X25 B;  1OKW B;  3QXE B;  3A8M B;  2WXV B;  5ICP B;  3QHW B;  4BY7 X;  2ZPE B;  3DJB A;  2WIP B;  2WFY B;  1UGR B;  5IF1 B;  2W9F A;  4F7J B;  4UN0 A;  4F6U B;  2PK2 A;  2PMI B;  4BBS M;  3GTM S;  2BKZ B;  4OB0 B;  2IW6 B;  2DXB B;  2CZ0 B;  2DXC B;  2ZPF B;  5LQF B;  2QDJ A;  4I3Z B;  2QQ8 A;  2BS4 A;  4BCN D;  1QLB A;  2QDY B;  2G9X B;  4OGR B;  3BHV B;  1H25 B;  2PHG A;  1JST B;  2V22 B;  4BCM B;  4CXA B;  1URC B;  4ELL A;  3HZJ A;  4OB1 B;  1G3N C;  4Z6Y A;  1VIN A;  4CFU B;  2UZD B;  3TW6 A;  3VKG A;  1H26 B;  2C5V B;  5ACB A;  4EOM B;  3BG3 A;  4F6W B;  4EC8 B;  2WJ9 A;  3TNI B;  5DQV A;  3F5X B;  4BCP B;  2ZPI B;  2LW4 A;  1UGP B;  4LOC A;  3QYG B;  3BG9 A;  4JX5 A;  1OL1 B;  2QF7 A;  2R7G A;  3WVE B;  1FVV B;  4Y72 B;  4ROD A;  1FIN B;  1N4M A;  4ZGD B;  3NDQ A;  5EJC A;  4BCI B;  4AKH A;  5LMK B;  3VYH B;  1O9K B;  4HLQ A;  3RGF B;  4HNU A;  3X28 B;  1TFB A;  4BCG B;  2CZ7 B;  2WEV B;  4FM4 B;  4MIM A;  2I40 B;  2CZ6 B;  2DD4 B;  2BS3 A;  3A8H B;  4FX3 B;  4KRD B;  4IMY B;  2C5X B;  4ROE A;  2BPM B;  1GH6 B;  4EOL B;  1IRE B;  4OB2 B;  2IN3 A;  3MY1 B;  1H1R B;  1V29 B;  3BHT B;  2PK9 B;  3DDP B;  2UUE B;  1H4L D;  1JOW A;  1OIY B;  3EID B;  1H1S B;  2IVX A;  3QYH B;  1GY3 B;  2F2C A;  3HO8 A;  1GUX A;  5DQW A;  5HQ0 B;  1E7P A;  2W96 A;  3O0G D;  4HL4 A;  1P5E B;  3TW7 A;  1OKV B;  3KHI A;  3QZ5 B;  4CFX B;  3BG5 A;  4QSH A;  1D3U B;  3M03 A;  3QYE A;  4II5 B;  4EOR B;  4NC6 A;  1H24 B;  1H1Q B;  3HB9 A;  4OR5 B;  4BCQ D;  2WIH B;  3MI9 B;  3QZ9 B;  3WVD B;  4EOO B;  2JGZ B;  5IDP B;  2BS2 A;  2ZPG B;  2UZL B;  4BY1 X;  4EOP B;  3EOC B;  4CFN B;  3K7A M;  4EOS B;  1UNL D;  2IW8 B;  3BLQ B;  5IHY A;  2AHJ B;  4TTH A;  3A8O B;  4YOZ A;  3MIA B;  4AKG A;  3TNH B;  2KMG A;  2W99 A;  3X20 B;  4ELJ A;  3HHT B;  4YOS A;  5I5Z B;  3DOG B;  4AI6 A;  5L2W B;  2CZ1 B;  4F7L B;  1OGU B;  3DDQ B;  4CFW B;  4BCN B;  3G33 B;  4EON B;  1H27 B;  1GUX B;  4BCJ B;  2UZB B;  2I53 A;  1JKW A;  2QFZ A;  4EOK B;  1W98 B;  3A8G B;  3QYB A;  1ZP2 A;  2CCI B;  2CCH B;  4EOJ B;  1C9B A;  2C6T B;  4G6L B;  5HBH B;  4BCK B;  1UNG D;  2CYZ B;  1XO2 A;  1H28 B;  5HNB B;  4EOQ B;  2W9Z A;  1UNH D;  4EC9 B;  4BCH B;  2C5N B;  5BNJ B;  2EUF A;  1TD6 A;  4CFV B;  2WMA B;  2DME A;  4BCM D;  3DL1 A;  4BXX X;  4BBR M;  3POM A;  1BU2 A;  2IW9 B;  4F7N B;  1KXU A;  1OL2 B;  4JX4 A;  4CFU D;  3BHU B;  3X26 B;  2UZE B;  3B57 A;  4KRC B;  3PO3 S;  4OB3 B;  3BLR B;  5EFQ B;  1ENW A;  2X1N B;  4MFE A;  2DD5 B;  3HBL A;  1O9K A;  2C4G B;  4F70 B;  2W2H A;  4F7S B;  2C5O B;  4ZGJ B;  4HNV A;  4BCO B;  1UGQ B;  4NST B;  2G77 A;  3VKH A;  1F5Q B;  1AIS B;  4AKI A;  3QWL A;  4EOI B;  1VOL A;  2WHB B;  4ZGE B;  3BLH B;  4ROC A;  3LQ5 B;  4CRL B;  1H1P B; 
#chains in the Genus database with same CATH homology
 4EOK B;  3DDP B;  1W98 B;  2UUE B;  1H4L D;  1ZP2 A;  2CCI B;  1JOW A;  1OIY B;  3EID B;  1H1S B;  5LQF B;  4BCF B;  2QDJ A;  2CCH B;  4EOJ B;  2IVX A;  4F6S B;  4I3Z B;  1C9B A;  1GY3 B;  1VYW B;  2F2C A;  2B9R A;  4BCN D;  1QMZ B;  2C6T B;  2CJM B;  1GUX A;  2G9X B;  4G6L B;  5HBH B;  4BCK B;  4OGR B;  1UNG D;  5HQ0 B;  1XO2 A;  3BHV B;  1H25 B;  2PHG A;  1JST B;  1H28 B;  2V22 B;  4BCM B;  3TN8 B;  1URC B;  4CXA B;  4ELL A;  2W96 A;  3O0G D;  3EJ1 B;  1E9H B;  1P5E B;  5HNB B;  4BCQ B;  5CYI B;  1OKV B;  4EOQ B;  4CFX B;  1G3N C;  2W9Z A;  1UNH D;  1VIN A;  4EC9 B;  4CFU B;  4BCH B;  2UZD B;  1D3U B;  1OIU B;  3M03 A;  2C5N B;  5BNJ B;  3TNW B;  4YC3 B;  4II5 B;  4EOR B;  2EUF A;  1H26 B;  2C5V B;  5ACB A;  4EOM B;  4YOO A;  4CFV B;  1H24 B;  1H1Q B;  2WMA B;  4BCM D;  5HBJ B;  4F6W B;  4EC8 B;  5FGK B;  3POM A;  4OR5 B;  3TNI B;  4BCQ D;  2WIH B;  1BU2 A;  2IW9 B;  3F5X B;  3MI9 B;  4BCP B;  2JGZ B;  4EOO B;  4F7N B;  1KXU A;  1OL2 B;  5IDP B;  1OI9 B;  2WMB B;  4CFU D;  3BHU B;  5IDN B;  2UZE B;  2UZL B;  4KRC B;  3MY5 B;  1AD6 A;  4EOP B;  3EOC B;  3BLR B;  5EFQ B;  1PKD B;  3K7A M;  4CFN B;  1OL1 B;  3QHR B;  4EOS B;  2R7G A;  1UNL D;  1FVV B;  4Y72 B;  2IW8 B;  4ROD A;  2WPA B;  2X1N B;  1FIN B;  1N4M A;  3BLQ B;  4TTH A;  5HBE B;  1O9K A;  2C4G B;  3H4C A;  4YOZ A;  4F70 B;  2W2H A;  4BCI B;  4F7S B;  3MIA B;  4CFM B;  3TNH B;  5LMK B;  5HVY B;  2W99 A;  1O9K B;  1JSU B;  2C5O B;  3RGF B;  4ELJ A;  5CEI B;  1OKW B;  4YOS A;  5I5Z B;  1H1P B;  2WXV B;  4BCO B;  3DOG B;  5ICP B;  1TFB A;  4BCG B;  2WEV B;  3QHW B;  4NST B;  5L2W B;  3BHT B;  1F5Q B;  2I40 B;  2WIP B;  2WFY B;  1AIS B;  5IF1 B;  4F7L B;  1OGU B;  2W9F A;  4FX3 B;  4F7J B;  3MY1 B;  4KRD B;  4UN0 A;  3DDQ B;  4F6U B;  2PK2 A;  4IMY B;  2C5X B;  4ROE A;  4EOI B;  1VOL A;  2BPM B;  2WHB B;  1GH6 B;  4EOL B;  2PMI B;  4CFW B;  4BCN B;  3G33 B;  4EON B;  1H27 B;  3BLH B;  1GUX B;  4BCJ B;  4ROC A;  2UZB B;  2I53 A;  3LQ5 B;  4CRL B;  2BKZ B;  2IW6 B;  1H1R B;  2PK9 B;  1JKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...