3DDQB

Structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor roscovitine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title CR8, a potent and selective, roscovitine-derived inhibitor of cyclin-dependent kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 97
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ddqB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ddqB02
2UZLB 3TN8B 3TNIB 4EC8B 2I53A 4BCND 2C6TB 4CFUD 4BCGB 2CCHB 1OKVB 3BLRB 1H4LD 2WXVB 4CRLB 2IW8B 1UNLD 3RGFB 1JSTB 2W2HA 1H26B 4G6LB 1H1RB 4EOMB 2WMBB 2W99A 4CFWB 1H28B 2X1NB 5ICPB 4EOQB 1FVVB 4NSTB 1OKWB 2BKZB 2CJMB 3F5XB 3TNWB 4CFUB 1W98B 3MY5B 2WIPB 5FGKB 4EONB 2PHGA 1GH6B 1TFBA 1FINB 4OGRB 2C5NB 4F6WB 3BHTB 4RODA 5ACBA 2WIHB 4CFVB 3K7AM 4F7NB 4ROEA 2C4GB 1OI9B 1GUXB 1BU2A 3BLHB 4EOJB 5LMKB 2BPMB 2UZEB 1XO2A 5HNBB 4CFNB 2W9ZA 2UZDB 4KRDB 4UN0A 1H24B 1H1SB 1JOWA 4BCFB 1OL2B 4BCHB 5CEIB 4EOLB 5HBEB 3M03A 1VOLA 4CFXB 2JGZB 1PKDB 1ZP2A 2G9XB 4EORB 3MIAB 5IDPB 4EOIB 1GY3B 2IVXA 3DDPB 2PMIB 4ELLA 2I40B 1QMZB 4I3ZB 3BLQB 4F6SB 2WFYB 2WHBB 1OIUB 1GUXA 1VYWB 4BCMB 2F2CA 4YC3B 1C9BA 3QHWB 4YOZA 3MY1B 3QHRB 4BCQD 1AD6A 5EFQB 4ROCA 4EOKB 2IW6B 2C5VB 1VINA 1OIYB 2R7GA 3DDQB 1H25B 1KXUA 1OGUB 4ELJA 3G33B 2UZBB 2WEVB 4BCMD 4BCQB 2QDJA 3O0GD 4F7LB 1G3NC 5HBHB 5BNJB 5HQ0B 1N4MA 4YOOA 4F6UB 3H4CA 2CCIB 1UNHD 1H27B 2EUFA 4TTHA 1H1QB 4BCJB 5IF1B 3EJ1B 1D3UB 3LQ5B 4OR5B 4CXAB 1JSUB 1URCB 2IW9B 4EC9B 4EOSB 2B9RA 5LQFB 2WPAB 2UUEB 2C5OB 4F7SB 4BCPB 3POMA 4IMYB 3TNHB 2W96A 4BCKB 4BCIB 2WMAB 3BHUB 5HVYB 3EIDB 2V22B 2PK9B 2W9FA 4F7JB 4YOSA 3EOCB 4EOOB 4FX3B 4EOPB 1H1PB 2PK2A 4BCNB 5IDNB 5I5ZB 1AISB 1UNGD 1O9KA 1F5QB 1E9HB 4CFMB 2C5XB 4KRCB 5L2WB 4F70B 1OL1B 3BHVB 1JKWA 1O9KB 3DOGB 4BCOB 4II5B 5HBJB 1P5EB 3MI9B 4Y72B 5CYIB
chains in the Genus database with same CATH superfamily
2UZLB 2C6TB 2CCHB 3VYGB 2QQ8A 1H4LD 2WXVB 3DJBA 4JX5A 2IW8B 2X1NB 2ZPGB 3QYBA 3F5XB 4HNUA 4EONB 2WIPB 1FINB 3HBLA 4F6WB 4RODA 3VKHA 3BLHB 2BPMB 2ZZDB 2PJQA 5HNBB 2DXCB 1H24B 1JOWA 4BY7X 5HBEB 4OB2B 2G9XB 1UGRB 2QFZA 2PMIB 1QMZB 2WFYB 1VYWB 4BCMB 2F2CA 1C9BA 4BBRM 2CZ7B 2IW6B 2R7GA 1OIYB 3A8OB 1UGQB 3G33B 2UZBB 4BCMD 4BXXX 3O0GD 4YOOA 2EUFA 4TTHA 4BCJB 5IF1B 4OR5B 4EC9B 1URCB 5LQFB 4AKGA 3KHIA 3EIDB 2PK9B 2W9FA 2QGSA 4YOSA 3EOCB 2PK2A 2ZPBB 5I5ZB 4JX6A 2C5XB 3DL1A 5L2WB 4F70B 3A8MB 4BCOB 3QXEB 4NC6A 4EOLB 2CZ0B 4Z6YA 3TNIB 2ZCFB 3HZJA 4EC8B 2BS3A 1OKVB 2D0QB 3RGFB 2W2HA 4EOMB 2WMBB 4CFWB 4NSTB 1OKWB 2CJMB 2DD5B 3MY5B 1GH6B 1TFBA 3BG9A 2C5NB 4ROEA 1OI9B 1GUXB 4EOJB 5LMKB 2W9ZA 4KRDB 4UN0A 1OL2B 3WVDB 2BS4A 5CEIB 3VKGA 4CFXB 1PKDB 1ENWA 4HNTA 4AI6A 2DXBB 3X20B 4I3ZB 1GUXA 4YC3B 4YOZA 4ZGEB 3PO3S 5EFQB 3A8HB 1VINA 4M6VA 2LW4A 5DQWA 2CYZB 2QDJA 2ZPFB 2QF7A 1G3NC 3A8LB 3H4CA 1H27B 2ZPHB 3LQ5B 1JSUB 4EOSB 4QSHA 3TW7A 4F7SB 3POMA 4IMYB 2W96A 1UGPB 2V22B 4EOOB 4EOPB 1H1PB 3B57A 5IDNB 4KRCB 2QDYB 3GTMS 1OL1B 1JKWA 5HBJB 3TN8B 2I53A 4CFUD 3QZ9B 4CRLB 1UNLD 1H26B 4G6LB 1H1RB 4OB0B 3X26B 2CZ6B 1H28B 5ICPB 4EOQB 2BKZB 1W98B 5FGKB 3X28B 5IHYA 4OGRB 3BHTB 2G77A 4CFVB 4F7NB 2DMEA 2AHJB 1BU2A 4CFNB 2UZDB 1H1SB 4MFEA 4BCHB 2KMGA 4JX4A 2JGZB 1ZP2A 3MIAB 5IDPB 2IVXA 3DDPB 4ELLA 1AHJB 4F6SB 1OIUB 3MY1B 3QHRB 4BCQD 1AD6A 4ZGJB 4EOKB 3DDQB 2C5VB 4ELJA 1H25B 1KXUA 1E7PA 2DPPB 3QYHB 1FKMA 2WEVB 3QWLA 4BY1X 5BNJB 1N4MA 2CCIB 2ZPEB 1TD6A 1D3UB 3EJ1B 4CXAB 2IW9B 2B9RA 4HL4A 2UUEB 3X24B 3X25B 4OB3B 4BCKB 4BCIB 3BG3A 4MFDA 4FX3B 3HHTB 4BCNB 4LOCA 1O9KA 4CFMB 4FM4B 4HNVA 4AKHA 3DOGB 4II5B 1P5EB 5CYIB 5DQVA 4BBSM 4ZGDB 4HLQA 1V29B 4BCND 4BCGB 3BLRB 1JSTB 2W99A 1FVVB 2ZPIB 3TNWB 4CFUB 2PHGA 5ACBA 2WIHB 1UGSB 3K7AM 3QYEA 2C4GB 2CZ1B 2UZEB 1XO2A 2WJ9A 4BCFB 3BG5A 3M03A 1VOLA 3NDQA 4EORB 4EOIB 1GY3B 4AKIA 1QLBA 4MIMA 2I40B 3BLQB 2WHBB 3QHWB 4ROCA 2BS2A 1OGUB 3HB9A 3HO8A 3TW6A 3QYGB 2IN3A 4BCQB 4F7LB 5HBHB 5HQ0B 4F6UB 1UNHD 1H1QB 3WVEB 4OB1B 2WPAB 2C5OB 3A8GB 4BCPB 3TNHB 2WMAB 3BHUB 5HVYB 4F7JB 3QZ5B 1IREB 1AISB 1UNGD 1F5QB 5EJCA 1E9HB 3DTOA 3BHVB 1O9KB 2DD4B 2KR6A 3VYHB 3MI9B 4Y72B
chains in the Genus database with same CATH topology
2UZLB 3TN8B 3TNIB 4EC8B 2I53A 4BCND 2C6TB 4CFUD 4BCGB 2CCHB 1OKVB 3BLRB 1H4LD 2WXVB 4CRLB 2IW8B 1UNLD 3RGFB 1JSTB 2W2HA 1H26B 4G6LB 1H1RB 4EOMB 2WMBB 2W99A 4CFWB 1H28B 2X1NB 5ICPB 4EOQB 1FVVB 4NSTB 1OKWB 2BKZB 2CJMB 3F5XB 3TNWB 4CFUB 1W98B 3MY5B 2WIPB 5FGKB 4EONB 2PHGA 1GH6B 1TFBA 1FINB 4OGRB 2C5NB 4F6WB 3BHTB 4RODA 5ACBA 2WIHB 4CFVB 3K7AM 4F7NB 4ROEA 2C4GB 1OI9B 1GUXB 1BU2A 3BLHB 4EOJB 5LMKB 2BPMB 2UZEB 1XO2A 5HNBB 4CFNB 2W9ZA 2UZDB 4KRDB 4UN0A 1H24B 1H1SB 1JOWA 4BCFB 1OL2B 4BCHB 5CEIB 4EOLB 5HBEB 3M03A 1VOLA 4CFXB 2JGZB 1PKDB 1ZP2A 2G9XB 4EORB 3MIAB 5IDPB 4EOIB 1GY3B 2IVXA 3DDPB 2PMIB 4ELLA 2I40B 1QMZB 4I3ZB 3BLQB 4F6SB 2WFYB 2WHBB 1OIUB 1GUXA 1VYWB 4BCMB 2F2CA 4YC3B 1C9BA 3QHWB 4YOZA 3MY1B 3QHRB 4BCQD 1AD6A 5EFQB 4ROCA 4EOKB 2IW6B 2C5VB 1VINA 1OIYB 2R7GA 3DDQB 1H25B 1KXUA 1OGUB 4ELJA 3G33B 2UZBB 2WEVB 4BCMD 4BCQB 2QDJA 3O0GD 4F7LB 1G3NC 5HBHB 5BNJB 5HQ0B 1N4MA 4YOOA 4F6UB 3H4CA 2CCIB 1UNHD 1H27B 2EUFA 4TTHA 1H1QB 4BCJB 5IF1B 3EJ1B 1D3UB 3LQ5B 4OR5B 4CXAB 1JSUB 1URCB 2IW9B 4EC9B 4EOSB 2B9RA 5LQFB 2WPAB 2UUEB 2C5OB 4F7SB 4BCPB 3POMA 4IMYB 3TNHB 2W96A 4BCKB 4BCIB 2WMAB 3BHUB 5HVYB 3EIDB 2V22B 2PK9B 2W9FA 4F7JB 4YOSA 3EOCB 4EOOB 4FX3B 4EOPB 1H1PB 2PK2A 4BCNB 5IDNB 5I5ZB 1AISB 1UNGD 1O9KA 1F5QB 1E9HB 4CFMB 2C5XB 4KRCB 5L2WB 4F70B 1OL1B 3BHVB 1JKWA 1O9KB 3DOGB 4BCOB 4II5B 5HBJB 1P5EB 3MI9B 4Y72B 5CYIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZL B;  3TN8 B;  3TNI B;  4EC8 B;  2I53 A;  4BCN D;  2C6T B;  4CFU D;  4BCG B;  2CCH B;  1OKV B;  3BLR B;  1H4L D;  2WXV B;  4CRL B;  2IW8 B;  1UNL D;  3RGF B;  1JST B;  2W2H A;  1H26 B;  4G6L B;  1H1R B;  4EOM B;  2WMB B;  2W99 A;  4CFW B;  1H28 B;  2X1N B;  5ICP B;  4EOQ B;  1FVV B;  4NST B;  1OKW B;  2BKZ B;  2CJM B;  3F5X B;  3TNW B;  4CFU B;  1W98 B;  3MY5 B;  2WIP B;  5FGK B;  4EON B;  2PHG A;  1GH6 B;  1TFB A;  1FIN B;  4OGR B;  2C5N B;  4F6W B;  3BHT B;  4ROD A;  5ACB A;  2WIH B;  4CFV B;  3K7A M;  4F7N B;  4ROE A;  2C4G B;  1OI9 B;  1GUX B;  1BU2 A;  3BLH B;  4EOJ B;  5LMK B;  2BPM B;  2UZE B;  1XO2 A;  5HNB B;  4CFN B;  2W9Z A;  2UZD B;  4KRD B;  4UN0 A;  1H24 B;  1H1S B;  1JOW A;  4BCF B;  1OL2 B;  4BCH B;  5CEI B;  4EOL B;  5HBE B;  3M03 A;  1VOL A;  4CFX B;  2JGZ B;  1PKD B;  1ZP2 A;  2G9X B;  4EOR B;  3MIA B;  5IDP B;  4EOI B;  1GY3 B;  2IVX A;  3DDP B;  2PMI B;  4ELL A;  2I40 B;  1QMZ B;  4I3Z B;  3BLQ B;  4F6S B;  2WFY B;  2WHB B;  1OIU B;  1GUX A;  1VYW B;  4BCM B;  2F2C A;  4YC3 B;  1C9B A;  3QHW B;  4YOZ A;  3MY1 B;  3QHR B;  4BCQ D;  1AD6 A;  5EFQ B;  4ROC A;  4EOK B;  2IW6 B;  2C5V B;  1VIN A;  1OIY B;  2R7G A;  3DDQ B;  1H25 B;  1KXU A;  1OGU B;  4ELJ A;  3G33 B;  2UZB B;  2WEV B;  4BCM D;  4BCQ B;  2QDJ A;  3O0G D;  4F7L B;  1G3N C;  5HBH B;  5BNJ B;  5HQ0 B;  1N4M A;  4YOO A;  4F6U B;  3H4C A;  2CCI B;  1UNH D;  1H27 B;  2EUF A;  4TTH A;  1H1Q B;  4BCJ B;  5IF1 B;  3EJ1 B;  1D3U B;  3LQ5 B;  4OR5 B;  4CXA B;  1JSU B;  1URC B;  2IW9 B;  4EC9 B;  4EOS B;  2B9R A;  5LQF B;  2WPA B;  2UUE B;  2C5O B;  4F7S B;  4BCP B;  3POM A;  4IMY B;  3TNH B;  2W96 A;  4BCK B;  4BCI B;  2WMA B;  3BHU B;  5HVY B;  3EID B;  2V22 B;  2PK9 B;  2W9F A;  4F7J B;  4YOS A;  3EOC B;  4EOO B;  4FX3 B;  4EOP B;  1H1P B;  2PK2 A;  4BCN B;  5IDN B;  5I5Z B;  1AIS B;  1UNG D;  1O9K A;  1F5Q B;  1E9H B;  4CFM B;  2C5X B;  4KRC B;  5L2W B;  4F70 B;  1OL1 B;  3BHV B;  1JKW A;  1O9K B;  3DOG B;  4BCO B;  4II5 B;  5HBJ B;  1P5E B;  3MI9 B;  4Y72 B;  5CYI B; 
#chains in the Genus database with same CATH topology
 2UZL B;  2C6T B;  2CCH B;  3VYG B;  2QQ8 A;  1H4L D;  2WXV B;  3DJB A;  4JX5 A;  2IW8 B;  2X1N B;  2ZPG B;  3QYB A;  3F5X B;  4HNU A;  4EON B;  2WIP B;  1FIN B;  3HBL A;  4F6W B;  4ROD A;  3VKH A;  3BLH B;  2BPM B;  2ZZD B;  2PJQ A;  5HNB B;  2DXC B;  1H24 B;  1JOW A;  4BY7 X;  5HBE B;  4OB2 B;  2G9X B;  1UGR B;  2QFZ A;  2PMI B;  1QMZ B;  2WFY B;  1VYW B;  4BCM B;  2F2C A;  1C9B A;  4BBR M;  2CZ7 B;  2IW6 B;  2R7G A;  1OIY B;  3A8O B;  1UGQ B;  3G33 B;  2UZB B;  4BCM D;  4BXX X;  3O0G D;  4YOO A;  2EUF A;  4TTH A;  4BCJ B;  5IF1 B;  4OR5 B;  4EC9 B;  1URC B;  5LQF B;  4AKG A;  3KHI A;  3EID B;  2PK9 B;  2W9F A;  2QGS A;  4YOS A;  3EOC B;  2PK2 A;  2ZPB B;  5I5Z B;  4JX6 A;  2C5X B;  3DL1 A;  5L2W B;  4F70 B;  3A8M B;  4BCO B;  3QXE B;  4NC6 A;  4EOL B;  2CZ0 B;  4Z6Y A;  3TNI B;  2ZCF B;  3HZJ A;  4EC8 B;  2BS3 A;  1OKV B;  2D0Q B;  3RGF B;  2W2H A;  4EOM B;  2WMB B;  4CFW B;  4NST B;  1OKW B;  2CJM B;  2DD5 B;  3MY5 B;  1GH6 B;  1TFB A;  3BG9 A;  2C5N B;  4ROE A;  1OI9 B;  1GUX B;  4EOJ B;  5LMK B;  2W9Z A;  4KRD B;  4UN0 A;  1OL2 B;  3WVD B;  2BS4 A;  5CEI B;  3VKG A;  4CFX B;  1PKD B;  1ENW A;  4HNT A;  4AI6 A;  2DXB B;  3X20 B;  4I3Z B;  1GUX A;  4YC3 B;  4YOZ A;  4ZGE B;  3PO3 S;  5EFQ B;  3A8H B;  1VIN A;  4M6V A;  2LW4 A;  5DQW A;  2CYZ B;  2QDJ A;  2ZPF B;  2QF7 A;  1G3N C;  3A8L B;  3H4C A;  1H27 B;  2ZPH B;  3LQ5 B;  1JSU B;  4EOS B;  4QSH A;  3TW7 A;  4F7S B;  3POM A;  4IMY B;  2W96 A;  1UGP B;  2V22 B;  4EOO B;  4EOP B;  1H1P B;  3B57 A;  5IDN B;  4KRC B;  2QDY B;  3GTM S;  1OL1 B;  1JKW A;  5HBJ B;  3TN8 B;  2I53 A;  4CFU D;  3QZ9 B;  4CRL B;  1UNL D;  1H26 B;  4G6L B;  1H1R B;  4OB0 B;  3X26 B;  2CZ6 B;  1H28 B;  5ICP B;  4EOQ B;  2BKZ B;  1W98 B;  5FGK B;  3X28 B;  5IHY A;  4OGR B;  3BHT B;  2G77 A;  4CFV B;  4F7N B;  2DME A;  2AHJ B;  1BU2 A;  4CFN B;  2UZD B;  1H1S B;  4MFE A;  4BCH B;  2KMG A;  4JX4 A;  2JGZ B;  1ZP2 A;  3MIA B;  5IDP B;  2IVX A;  3DDP B;  4ELL A;  1AHJ B;  4F6S B;  1OIU B;  3MY1 B;  3QHR B;  4BCQ D;  1AD6 A;  4ZGJ B;  4EOK B;  3DDQ B;  2C5V B;  4ELJ A;  1H25 B;  1KXU A;  1E7P A;  2DPP B;  3QYH B;  1FKM A;  2WEV B;  3QWL A;  4BY1 X;  5BNJ B;  1N4M A;  2CCI B;  2ZPE B;  1TD6 A;  1D3U B;  3EJ1 B;  4CXA B;  2IW9 B;  2B9R A;  4HL4 A;  2UUE B;  3X24 B;  3X25 B;  4OB3 B;  4BCK B;  4BCI B;  3BG3 A;  4MFD A;  4FX3 B;  3HHT B;  4BCN B;  4LOC A;  1O9K A;  4CFM B;  4FM4 B;  4HNV A;  4AKH A;  3DOG B;  4II5 B;  1P5E B;  5CYI B;  5DQV A;  4BBS M;  4ZGD B;  4HLQ A;  1V29 B;  4BCN D;  4BCG B;  3BLR B;  1JST B;  2W99 A;  1FVV B;  2ZPI B;  3TNW B;  4CFU B;  2PHG A;  5ACB A;  2WIH B;  1UGS B;  3K7A M;  3QYE A;  2C4G B;  2CZ1 B;  2UZE B;  1XO2 A;  2WJ9 A;  4BCF B;  3BG5 A;  3M03 A;  1VOL A;  3NDQ A;  4EOR B;  4EOI B;  1GY3 B;  4AKI A;  1QLB A;  4MIM A;  2I40 B;  3BLQ B;  2WHB B;  3QHW B;  4ROC A;  2BS2 A;  1OGU B;  3HB9 A;  3HO8 A;  3TW6 A;  3QYG B;  2IN3 A;  4BCQ B;  4F7L B;  5HBH B;  5HQ0 B;  4F6U B;  1UNH D;  1H1Q B;  3WVE B;  4OB1 B;  2WPA B;  2C5O B;  3A8G B;  4BCP B;  3TNH B;  2WMA B;  3BHU B;  5HVY B;  4F7J B;  3QZ5 B;  1IRE B;  1AIS B;  1UNG D;  1F5Q B;  5EJC A;  1E9H B;  3DTO A;  3BHV B;  1O9K B;  2DD4 B;  2KR6 A;  3VYH B;  3MI9 B;  4Y72 B; 
#chains in the Genus database with same CATH homology
 2UZL B;  3TN8 B;  3TNI B;  4EC8 B;  2I53 A;  4BCN D;  2C6T B;  4CFU D;  4BCG B;  2CCH B;  1OKV B;  3BLR B;  1H4L D;  2WXV B;  4CRL B;  2IW8 B;  1UNL D;  3RGF B;  1JST B;  2W2H A;  1H26 B;  4G6L B;  1H1R B;  4EOM B;  2WMB B;  2W99 A;  4CFW B;  1H28 B;  2X1N B;  5ICP B;  4EOQ B;  1FVV B;  4NST B;  1OKW B;  2BKZ B;  2CJM B;  3F5X B;  3TNW B;  4CFU B;  1W98 B;  3MY5 B;  2WIP B;  5FGK B;  4EON B;  2PHG A;  1GH6 B;  1TFB A;  1FIN B;  4OGR B;  2C5N B;  4F6W B;  3BHT B;  4ROD A;  5ACB A;  2WIH B;  4CFV B;  3K7A M;  4F7N B;  4ROE A;  2C4G B;  1OI9 B;  1GUX B;  1BU2 A;  3BLH B;  4EOJ B;  5LMK B;  2BPM B;  2UZE B;  1XO2 A;  5HNB B;  4CFN B;  2W9Z A;  2UZD B;  4KRD B;  4UN0 A;  1H24 B;  1H1S B;  1JOW A;  4BCF B;  1OL2 B;  4BCH B;  5CEI B;  4EOL B;  5HBE B;  3M03 A;  1VOL A;  4CFX B;  2JGZ B;  1PKD B;  1ZP2 A;  2G9X B;  4EOR B;  3MIA B;  5IDP B;  4EOI B;  1GY3 B;  2IVX A;  3DDP B;  2PMI B;  4ELL A;  2I40 B;  1QMZ B;  4I3Z B;  3BLQ B;  4F6S B;  2WFY B;  2WHB B;  1OIU B;  1GUX A;  1VYW B;  4BCM B;  2F2C A;  4YC3 B;  1C9B A;  3QHW B;  4YOZ A;  3MY1 B;  3QHR B;  4BCQ D;  1AD6 A;  5EFQ B;  4ROC A;  4EOK B;  2IW6 B;  2C5V B;  1VIN A;  1OIY B;  2R7G A;  3DDQ B;  1H25 B;  1KXU A;  1OGU B;  4ELJ A;  3G33 B;  2UZB B;  2WEV B;  4BCM D;  4BCQ B;  2QDJ A;  3O0G D;  4F7L B;  1G3N C;  5HBH B;  5BNJ B;  5HQ0 B;  1N4M A;  4YOO A;  4F6U B;  3H4C A;  2CCI B;  1UNH D;  1H27 B;  2EUF A;  4TTH A;  1H1Q B;  4BCJ B;  5IF1 B;  3EJ1 B;  1D3U B;  3LQ5 B;  4OR5 B;  4CXA B;  1JSU B;  1URC B;  2IW9 B;  4EC9 B;  4EOS B;  2B9R A;  5LQF B;  2WPA B;  2UUE B;  2C5O B;  4F7S B;  4BCP B;  3POM A;  4IMY B;  3TNH B;  2W96 A;  4BCK B;  4BCI B;  2WMA B;  3BHU B;  5HVY B;  3EID B;  2V22 B;  2PK9 B;  2W9F A;  4F7J B;  4YOS A;  3EOC B;  4EOO B;  4FX3 B;  4EOP B;  1H1P B;  2PK2 A;  4BCN B;  5IDN B;  5I5Z B;  1AIS B;  1UNG D;  1O9K A;  1F5Q B;  1E9H B;  4CFM B;  2C5X B;  4KRC B;  5L2W B;  4F70 B;  1OL1 B;  3BHV B;  1JKW A;  1O9K B;  3DOG B;  4BCO B;  4II5 B;  5HBJ B;  1P5E B;  3MI9 B;  4Y72 B;  5CYI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...