4NC6A

Tbc domain of human rab gtpase-activating protein 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
ETWGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tbc domain of human rab gtpase-activating protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords Rab GTPase-activating protein 1
total genus 113
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4nc6A02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 4nc6A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4nc6A03
4Z6YA 2QFZA 3QWLA 4P17A 4NC6A 5EJCA 3QYBA 4HL4A 3HZJA 3QYEA 4HLQA 2QQ8A 2G77A 1FKMA
chains in the Genus database with same CATH superfamily
4RB3C 2R7VA 4DYCA 5A2QS 4MNUA 2CV2A 4O5VA 1O9KB 1ZKGA 1IW7F 4I02A 3O8HA 1SD5A 2QCOA 3ROUA 4ENKA 3HKPA 3D1NI 2V1CA 5FO5A 2Z3XA 1IN7A 2JTVA 3MZYA 2LHCA 3QZ9B 1A04A 4AIHA 3BR1A 4EOIB 2VPLA 5D8LB 1HF0A 4CDGA 4UUVA 2I53A 1K4TA 4V2FA 3S1MJ 2H1LA 2AHJB 1I3QJ 3VDPA 1Z77A 3QPSA 4N4NB 3KW6A 2IVXA 5DUIA 4N0BA 1WGLA 4P17A 1SD7A 1B72B 2MLGA 3H9GA 4LB6B 3RGSA 4KLNA 2EIMH 2BKZB 3A01A 4WWCA 1XGOA 2NS0A 1ZN2A 1HDPA 2L7FP 2X6YA 2YSRA 3CCQI 1WQ2A 4WK8F 3HPGA 4LFAM 4NXMM 4YFXF 3CP2A 5JVGF 2XGXA 1C0WA 2I7PA 2PEXA 1UNLD 2LMDA 2LH0A 4LJ9A 3K2LA 5L2WB 5D5VB 5TISC 3RPUD 3OYFA 2C96A 2HZDA 4FCTA 1FPQA 2DK8A 2YR2A 3KP2A 4B43A 3E6CC 2LFBA 4JX6A 2H1KA 3JR4A 3U21A 3I3LA 1GXPA 4BBSM 1ONVA 1FTTA 1L0OC 4NNJA 2CWEA 3ZQQA 1QBJA 5GPCA 1OL1B 2VPRA 2FJ1A 5EGOA 1TQMA 4WXCA 4RGSA 1IV8A 5E3LA 3O2PE 5FROA 1FC3A 1WJCA 1ZAOA 2Z9OA 3WHKA 2OZUA 1IXSA 4P55A 4W97A 2V1UA 1F4KA 2GXBA 4JI5M 3CDHA 3Q3SA 2V1XA 5BNGA 1NH3A 2CZ6B 1KSFX 3GTMS 2F5NA 1NNJA 3JW4A 3TQSA 1Z3XA 2F5EA 2JPCA 1GH6B 1UGSB 4CYDA 2DW4A 1KQ0A 5CLSA 1WHUA 1LDKB 1TDHA 2GZWA 4CA0A 1HNXM 3IC7A 3BR3A 2CW7A 1YHQI 3I01M 4IBKA 1ZTRA 3IHUA 2EFQA 5LEJA 3MMYB 3FYCA 5IDPB 1PJQA 2DFFA 4DV2M 1XMKA 5GTHC 4JI8M 2HXIA 1RKTA 2LY2A 4YY3M 5LGTA 4ZYHA 3J81S 5DUKA 1XC8A 2L54A 1RU3A 2VF7A 4Q47A 2H09A 2IS6A 2DWMA 2VI6A 3FHNA 5IT3A 4P9UA 2RNJA 2MBFA 5KPRA 2B9SA 2KEBA 4DGWB 3FZVA 3Q0UA 1H27B 1ZMWA 2V4JC 1V5GA 2XH9A 2WAQN 2E2IJ 2BS3A 3OMYA 1T6SA 2A07F 1XDSA 2GA2A 5J6XA 2COBA 3K4CA 3AJIB 2D7HA 1QVTA 4A69C 2A5YB 2NQ8C 4LF4M 3LNQA 1AKHA 3VYGB 1UCRA 2CUZA 2R7SA 3T1HM 1YW8A 3TW7A 3C2HA 2O8XA 2W24A 1IF1A 2L7ZA 2ZC2A 3X20B 4FE4A 4A3EJ 2XLJA 1X1CA 5EP2A 3RDIA 3LVWA 3G1MA 1IN4A 2DZLA 1JUSA 5TGTA 3VYRB 4BCQD 2UZEB 2KIUA 2JXNA 3VB2A 1QNTA 4Y52J 5KPZA 3LA2A 3HUGA 2FS1A 1BR1A 2I8DA 4UHTA 1T2KA 4KMUX 3KP7A 5DD8A 3QZ5B 3GO5A 4JXJA 1D3YA 2ESNA 4AIJA 1RUOA 3OIPA 2MR9A 2ZFUA 2BE5F 1P5EB 3DF8A 4BH9A 1UHWA 2WBMA 2YQZA 4ZYAA 2O61A 1OYWA 3I4VA 3HHGA 1O7FA 4ZGJB 2GIVA 2M0CA 2A6EF 3N05A 3L2WA 1IXRC 3FE3A 2EQRA 2QVOA 2LNBA 1U2WA 2RGHA 1VDDA 2LREA 3GFJA 3ZQCA 1SXJE 4YHHM 2APLA 4EJOA 3BHUB 1V92A 2Y30A 3S17J 2CZ0B 3DOAA 4IL6C 2F5OA 2C98A 2K6BA 5CVUA 1YO5C 3U6EA 2QCUA 2B7EA 3D5SC 4KICA 1UZCA 2TRTA 2IGMA 4G6LB 3KCCA 1H26B 2WTEA 2K9NA 2WAFA 2M30A 1OCZH 1Q02A 4ROCA 2A6TA 1FY7A 5LLQA 2R46A 1MBGA 2PX9A 3G3ZA 3N4MA 5HVYB 3ZMVA 2DWZB 3SYKA 2P5VA 5EXPA 1N75A 3RI4A 1N4MA 4EIWA 5IP6A 4REZA 2MC3A 4MGZE 1PJTA 1EH8A 1ETXA 2XVCA 3BJAA 3S15J 5H6QA 2BY0A 3ZQHA 3WTUC 4LJ8A 3WG7H 1WIVA 1UB9A 1D8KA 4QLCU 1IDYA 3FKJA 4Y72B 2LYCA 4G6QA 1LVKA 1R1VA 3VYHB 2IN3A 1Y0NA 5EEHA 3DJBA 5LMKB 3JAMZ 5KAIC 3TO9A 2XF3A 1V34A 1VFCA 3TNWB 4IBBA 2PG4A 4KDPA 2CYZB 4AC0A 1IRGA 1WH7A 2CZ7B 2LVPC 1GV5A 1A6QA 4AM3A 4IBEA 4HLYA 4BE2A 1YUBA 3E0JB 4IZZA 5K5QA 2UZLB 3CJNA 3KZZA 4A3VB 4UN0A 3BG5A 2EO2A 1H1RB 3B02A 4PUSA 2VOPA 1MX0A 1Y6IA 4RBOA 3HRUA 1FOKA 2H27A 3UKGA 2GNOA 1BOBA 2C9OA 5B1AH 4NOOB 2LD5A 4NL4H 3K2ZA 3GLHE 1WKMA 3OL4A 3W68A 3JTHA 4HSTA 4BY7X 4BEHA 3U6SA 1JHFA 3CC7I 2O3FA 1ZRCA 3BJ6A 4WP2A 2F4OB 1ZGJA 3DEWA 4CHUA 5FRNA 3GLHB 2IS1A 1LEAA 3EDPA 3BP8A 3BT9A 3LSJA 1MJBA 3B89A 2CV1A 4A5MA 4G7HF 3ZCBB 2HFHA 1FVVB 1SFOJ 5FFXA 2GXAA 1QLBA 2Y0TA 2F4VM 1A31A 1IXZA 4IBDA 2ME0A 2XROA 4XBOA 2K4JA 1W5TA 5E79C 5ILVA 3GX4X 2QQ9A 2QLZA 1FZPB 1X58A 2A61A 3ECOA 3H9QA 1BI3A 4AU7A 4A3MJ 3TQNA 3PIOF 1Y0UA 2AS5F 1P6RA 3BQZA 2XFTA 4AIKA 2MA3A 3HHXA 1XMQM 2L4AA 2HPIA 1W36C 3F8BA 1JHHA 1UHMA 3U60A 1SD4A 2X0LA 1IRXA 4G7ZF 2X9DA 2DVWB 4ON0A 1VQ4I 3D5RC 2UZBB 4XSXF 2DAGA 3N97A 1NK2P 1S9HA 4XLHA 3PFIA 4FD2A 2OCCH 4RB2C 1MMAA 2M3AA 2XC7A 3BR2A 4C2UA 4MGKE 1D0MA 1HOMA 2F5CA 4Y13A 4EOMB 1MBEA 1NHAA 4BCMD 3NEUA 5HBEB 1I4WA 3I0TA 3DTIA 5JVTA 4AVZA 3HIFA 4PJMA 1FBQA 5HLTA 2DFIA 1VQ1A 2EBIA 1ENHA 3LSGA 3VOEA 5HOOA 1MNMC 2CH0A 2L7KA 1OIZA 3NWLA 3FBIB 3Q9SA 3LWFA 3WU1B 2MD0A 2MH8A 2X1DA 3ZRGA 2FQ3A 2Y21A 4LF5M 1K3WA 1B9MA 3K10A 2IPQX 1R22A 2TCTA 1IBMM 4JYKA 3X2QH 1JR3D 1HNWM 1BW5A 2ZPBB 2CG4A 2DQLA 1NG6A 3I59A 2BW3B 4KN7X 4YEJA 1AHDP 2CU7A 5FKLA 3J2PB 1GL6A 5BNJB 3QOEA 3EETA 3RQIA 2IW6B 2WZJA 3ZMDA 1R7RA 3VKGA 1JUMA 3ZQLA 4PJNA 3GLHA 3L2AA 4M6XA 1FT9A 3LMMA 1V33A 2V26A 4II5B 3TP0A 2K40A 2STWA 2ZB9A 4OIOF 4Y17A 1G3IA 4IBIA 4A5NA 3CCJI 4KRDB 2BS4A 1XB4A 5J8FA 4RLQA 2JSCA 3GTJJ 3H5AA 2VQFM 4WXHA 1TW2A 1B6AA 2DNAA 2C6TB 4R79A 3SZGA 3C9PA 3MKZA 2FFJA 4H0EA 4GDFA 1DGBA 2OTJI 3HJQA 2RDPA 4XR6A 4BCFB 2VIIA 2XRNA 1EA3A 1MJ9A 3FM5A 3M1EA 4L0YB 2F4MB 3AG1H 4XMYA 3VSLA 4IBJA 2NRAC 1WJ7A 4EGYA 2HAKA 1R5HA 5I5ZB 3TOAA 2XSDC 2R7DA 2GA1A 3KLOA 2W96A 4G8XA 5GTIC 5FJ8J 1JOWA 3U2RA 1JKQC 5EXXA 5FD6A 4E7HA 2R4EA 4BCOB 5ICEA 3HRSA 1I3AA 3HBLA 4QOZC 2XPUA 3GP1A 1X2NA 4KMFA 2J5YA 1TH3A 2UXXA 3S16J 2XF7A 4FW9A 3E21A 1E0EA 1BI0A 1W7PB 2FE3A 3LQ5B 2Y0SN 3Q9VA 1E3OC 3AL0B 4LG3A 3FTFA 3JSOA 2OF7A 1PJRA 1JGGA 2LTPA 3E7LA 2ZPGB 3J7AO 3OS2A 1XMXA 3LA3A 3G1LA 3W67A 2BY3A 3HOYJ 2OZ6A 5FTKA 3SHGB 3OYBA 3F92A 3T1YM 2EFPA 4O3MA 3H4CA 2DAOA 1R4MB 2L09A 3IH2A 1SC7A 2K27A 5K5RA 2JSPA 2HPMA 4OIQF 3H5NA 1S7EA 3OR1C 2RRUA 1UJ8A 2VXZA 1GUUA 2VKHA 4MFEA 3LCUA 2XHKA 4PT5A 3MVPA 4RMNA 4UV8A 4S12A 1OKVB 1T43A 1IXCA 3K4NA 2ZJPF 5L8RF 4EC9B 4XORA 2HDWA 3MKYB 1F5TA 1T0FC 3BZ6A 3DLAA 2UUEB 1ZREA 4B7FA 2JPBA 4XLFA 3TWLA 4IJFA 1XSVA 2K9LA 2DHRA 2E1MC 4ESJA 2VBXA 4I4LA 3LFUA 2XPWA 3V76A 1IV6A 2CRGA 2BVMA 3VSKA 3T8TA 3H4JA 5ITYA 2CJJA 2HKXA 2TDXA 5EZGA 3CMYA 1H28B 1USTA 4PJLA 5E8GA 4UUSB 3K9OA 2Y0MA 3E3VA 4M74A 1VOLA 2M60A 2OJED 4NRWA 5JFRA 3BTJA 1LE8A 3D5LA 1Z6TA 4J01A 1Q3BA 4IPAA 3R8FA 1NO1A 1OTRA 4AWXB 1B8IA 4I81A 3FXMA 1E3PA 4UVBA 4LK1F 3HJ8A 1R58A 2FD5A 1X1DA 4R71A 1F9NA 3B6AA 1DU0A 2MLKA 3FUXA 4FCVA 1DGGA 4KUMA 3RSNA 3K7AM 2RNGA 2DMNA 3L9FA 2XF6A 3QU3A 4RB1A 3FM3A 3P5JA 1FEXA 2JRTA 1FOWA 2KPMA 1YJ9I 2VC1A 4C3JJ 4I98B 1IG7A 1UNHD 4GH9A 3DCFA 4M9SA 4DUYM 3CCYA 1WGNA 4DV1M 1SVOA 2H5XA 2RC4A 4BCMB 4D9JA 1SD6A 3HG9A 3DZDA 4I5SA 2UXDM 4PSXA 4JI3M 2V7FA 4GC5A 5CKTA 4ZYDA 1K7AA 5IZ7D 4DR4M 2KHMA 4OVZA 1B1BA 2BVLA 2CW0F 3PO2J 1JKWA 4HAMA 3EUAA 2K47A 1S72I 2UUAM 1KYZA 5FFZA 1VEKA 1WPKA 2J5OA 3F8CA 1JJ6C 2HYJA 1IGNA 4CFMB 5CJ9A 3JSPA 3JR5A 2XGEA 4CCJA 2MROB 1JGSA 5E1XA 1ON2A 3JRGA 4CYCA 3GMEA 1P7IA 2LKSA 4L5IA 4MQVA 1KXUA 3LQQA 1Q39A 3M4OJ 2O25A 2VKDA 5E8IA 1E2XA 5FKMA 1QQWA 1GO5A 4LOCA 1R9TJ 3A8OB 4BCNB 5ITTA 5CVVA 2VIXA 5ED4A 4MGHA 2E5LM 4X1EA 4FX4A 1Z6RA 2XB5A 2DKLA 5F64A 3A03A 4U0WA 1IRZA 2WAQA 3HU3A 1P4XA 3CQZJ 3NRVA 4UB8C 2D5VA 2DAEA 3ABLH 2Z16A 3PUBA 3RIRA 3MAJA 2ZPEB 4H4KC 5E6JA 1UGPB 2QFZA 4ANJA 4CSWA 3FXOA 2HVSA 3G33B 3HZJA 4A12A 1QU3A 4XKVA 3A0HC 4LJZF 2WIHB 2BNKA 3CUOA 2FXAA 2KIMA 1BW6A 2X4HA 1TC3C 5DCFA 1MZBA 3HTSB 1XNRM 3WTZA 4R3DA 4UY8I 2L02A 3GFLA 4MHGA 1V3FA 2PBIA 1QDRA 2AO9A 4BQAA 5BPVA 2L01A 2C5RA 4F91B 3H3VK 3IRRA 4YELA 1OCRH 3VWBA 2MH2A 2DMQA 5AONA 1Z5CA 3JRAA 2VKEA 2ZXHA 3DLLF 1RESA 3CUQA 4PFPA 2W00A 2DYSH 1ETOA 2E7XA 2FF4A 3HHWA 1GV2A 3MJ5A 4CHTB 3H0DA 4YRVA 1DGHB 2BOLA 4OX9M 2DN0A 5F6FA 3OSFA 4IRGA 4U88A 2DAMA 1ZGWA 2RV8A 1ETWA 1WJ5A 4NHJA 3S3OA 3GLIA 3J81K 2YU3A 2ZPHB 4B8XA 3GBGA 5IYBJ 4XGIA 4XQFA 1Z0XA 3I71A 2ZXWH 3DU5A 4XN0A 3VKHA 4QIWN 1VQMI 1SMYF 1SFUA 5EXTA 3U6OA 1NVMA 4LF8M 3TNIB 1J2XA 5DDGA 2K9QA 2JY8A 3CCSI 2QSGX 4PDIA 4A0XA 1L1TA 4E7SA 1A35A 5CVIA 4DNCA 1RR7A 1VNDA 1ETYA 4YG2F 2LC2A 5FTNA 4RF0A 2WA0A 4XLEA 3K1JA 3M7GA 1FYMA 1SAXA 4QNRA 4FM4B 1OPCA 3DWLE 2LP0A 2G0EA 3WE3A 3F5XB 2M5WA 2ZNZA 2XGDA 2VJIA 2EK5A 1FLIA 3KOZE 3LAJA 3SJMA 3M07A 2DPUA 4FQGA 5CPRB 5FLXK 3GZNB 2HQAA 1YITI 2FX0A 2HQ5A 3RKYA 4C2MJ 4XONA 3DTKA 1XS9A 1O3TA 2OPFA 2COMA 3QOPA 1YFHA 4NSOB 5L3GA 2VASA 3QP6A 3JAMK 4DR5M 4BNCA 4BBSJ 5K7FA 2K9DA 1ZR2A 4LLNA 4C30A 1A36A 4G3OA 3U61B 1L2BA 1HCRA 3TW6A 4L78A 2XKPA 2JZ0A 2HQNA 3FTDA 3FDYA 4RGXA 4IEJA 2EIJH 2O01F 3OYEA 9ANTA 3ZQIA 1TQIA 3JRFA 5FKOA 3MKWB 1REPC 1WRJA 3E6BA 1R6BX 5FRMA 3HOVJ 1BI1A 1DUXC 2DHYA 1D5VA 1U6GA 2GIZA 5KAFC 1Q1HA 4G4NA 3FTEA 1D1BA 4LK0F 2P5TA 3LQRA 1F5QB 3HHTB 3HO8A 1KU9A 1E32A 4B7HA 1AD6A 1YW7A 5J3LA 3I55I 2AXLA 3IRQA 2E71A 3CCRI 2XAFA 1JUPA 1BI2A 2HU9A 3L2CA 1IN5A 3GLFB 4S05A 4LF7M 1J5EM 3DPLC 4DZPA 1VINA 2N8GA 1QZEA 3HHYA 2HYGD 4HLXA 4LMYA 1R4NB 3LFKA 1HQCA 2RVCA 2R18A 3UMMA 3GTPJ 2UUZA 2HTJA 5L3CA 2V1NA 3GRYA 4M9XA 1A6IA 1YTYA 3IH3A 4E7IA 1LFBA 4CCOA 4GXOA 2DQRA 4AKHA 3A42A 5IF1B 3T5XA 3I54A 3BZCA 4KFCA 1ZLKA 2ZCWA 2HGCA 3JTGA 4BE1A 3KOXE 3BLQB 4YOOA 5LRRA 1RR8C 2BXYA 5GAHJ 3OYJA 2EA0A 3ZCOA 4YFNF 1WVRA 2MGQA 4F93B 4MGRA 3SZTA 2XDVA 2EKFA 2LR8A 2KT0A 1NHGC 2D1HA 2H6CA 4EJTA 1J0RA 4JQFA 3AOEA 4ZDOA 5EF6A 5E18F 3F23A 3L09A 4ENMA 3BC8A 5ITXE 1VG5A 1L1ZA 3K7AJ 4LRSA 3LSTA 1RIOH 3K69A 1GDTA 4RKUF 1KYIA 1LDJA 5DNYA 4DBQA 1GT0C 4HYEA 4BU2A 1JTYA 1YRNA 4BL0B 2GWRA 2E36A 5CQEA 1ZG5A 2O8KA 2V1DA 4GFBA 1H9GA 1I6XA 4C2TA 5JR3A 2BWBA 4LJ6A 1ON1A 4I6ZA 4U0VA 2K86A 2M8EA 1SVLA 5ERIA 1VZ0A 4BXXJ 4U87A 3SAVA 2HVQA 4F7LB 3M8JA 3SC3A 4XK4A 2WMBB 2VQLA 1Z21A 1X3WB 7CATA 1ZLJA 3FUWA 1OFIA 1RKWA 4EEFG 3J27B 1HKQA 3RGFB 4ELJA 2P5LC 4BY1J 5JLWA 4BDYA 5F3WA 1G41A 2P0WA 3FXRA 3A2KA 4A3JJ 2BHZA 2DA1A 2OC6A 4NXNM 2Z1DA 3KZIC 4XOTA 4LF6M 1F1ZA 2DJIA 2L9RA 2L9VA 1OMIA 5H6RA 4NC7A 4IHVA 1G71A 4UUTA 3QYHB 3E1SA 4K0KM 1OR7C 3F6VA 4CFUB 1MMDA 3DKXA 4OVZB 5HQ0B 4B4CA 4KT0F 2KRCA 4A93J 3C3DA 3ABKH 3B6CA 5GP9A 1ZARA 3QYBA 3SQNA 3T8RA 2Y9ZA 2H8RA 4BS9A 1TBXA 2Q1ZB 2DA2A 1XPXA 2DLLA 3OWTA 1R5LA 2DI3A 2WSEF 2ID3A 3LW5F 2ZJRF 1BN5A 2IS4A 4QNMA 5B66C 1R49A 5IPAA 2NVUB 3HGGA 4EC8B 3ABTA 3PO3S 2R5YA 3K4LA 1CF7A 3A8GB 5IWAM 3JRCA 4A3KJ 3C3EA 2UUCM 1N78A 2JP7A 2CUFA 1HLVA 2K3FA 2XFSA 1T3TA 3LA7A 4NB5A 3U61A 1D1AA 3WHBA 5LD2C 1HDDC 3CCVI 4B3RM 3DL1A 4OGRB 1U8RA 1AISB 1DPUA 2X85A 2X4AA 4L8RC 1ZR4A 2DTZA 2IA0A 4BQNA 2V9PA 3TGNA 2FH0A 5ITXA 3FK6A 4UVCA 4XLPF 3DA1A 3W3CA 1ZYRF 2DBBA 3V7RA 3JRHA 4BHPA 3F22A 3BPVA 2XV4S 2KQRA 2ZJQF 4YOSA 1LE8B 1VQ6I 1WGXA 3WU2C 1O3QA 4B09A 4DV4M 2LVOC 2VOOA 4KITB 1UM8A 3WODF 3HL2A 2H94A 1HW2A 1R1UA 4Z2YA 5F0HA 5DS9A 2KRKA 1TTEA 4RAGA 5K7ZA 3OYDA 5A2QK 1BOAA 2WJ9A 4CCNA 1IBKM 5C18A 3QU6A 2GXGA 1ORYB 4LJ4A 2EA2A 2FOWA 2QENA 1OQYA 4W5WA 4TUWA 2MH9A 2ZMEB 4KISA 2CMPA 1W7PD 2DWNA 4ZYGA 2P4WA 1E94E 2I10A 2KDOA 2PK2A 2KP6A 4BUPA 1Z59A 1TZLA 3CF6E 5E3OA 1LV7A 3GLIB 1Z67A 1VQ5I 1OKWB 1OL2B 2OQ4A 3OYNA 1O57A 3ONQA 1JKRC 3OYAA 1QMZB 3K2AA 4HNUA 1PP8F 3FKIJ 4P9FA 3ULQB 2I40B 4Z8XA 4HF0A 1B72A 3ZXSA 4ENJA 1B9NA 1Z91A 4B3TM 4M3DA 3AL0C 3UNGC 4MTDA 1R2YA 4D81A 3WTYC 4D82A 5BQTA 2BPMB 1DGFA 4IRIA 2L9SA 2HDDA 1WJBA 1XGSA 2X51A 1X37A 2EWNA 1JXSA 2VLAA 1TT5B 2IGNA 4EONB 4LF9M 4NQWB 2F6CA 3BR6A 3HKZN 4KIGA 4B3XA 3J7BA 1JE8A 1R4GA 2DENA 3A98B 1I1GA 3F3XA 3L2RA 3NDQA 3EOCB 1O4XA 4CFVB 4QHSA 4RA2A 2R7UA 4CFUD 4EGZA 4KT5C 4ZYEA 1BIBA 5IY5H 3EYYA 1VTNC 3S1NJ 5DCMA 4GITA 5KHDA 1QHGA 2W2HA 1FBUA 2M0MA 4TV7A 3I4NJ 4M73A 1UHSA 2P7VB 3KP4A 1TT0A 1HT1E 4AZFA 1UMQA 1HKSA 3Q8GA 4ZH4F 4KO8A 2O03A 3U9GA 3CC2I 2CQNA 1X2MA 3WVEB 3SAWA 1TWGJ 2G5GX 3QYEA 4LGYA 1KU3A 3BLHB 2HZTA 4FE7A 2M1BA 2EFWA 1AWCA 1Y56A 1GJTA 4ZZLA 4BCKB 4HV6A 1YSYA 3LL7A 4IJAA 4AI6A 4KIBA 3AV0A 2L2DA 2VE9A 2KDZA 3QAUA 4BQOA 4PGGA 1B59A 1HC8A 5JI2E 1ZG1A 1WJAA 5F27A 2STTA 2R7ZJ 4CXFA 1MSFC 3CTWB 2WV1A 4RLFA 3H3ZA 4XIDA 4CO8A 5EZHA 1EIJA 4GGGA 2W1OA 4OW0A 3ILKA 2A6HF 4IOAF 3K92A 2CRUA 2DODA 1J7KA 1JT6A 1T56A 2P6SA 4RDUA 1SFKA 2QEXI 4PSWA 5ICGA 3ZGKA 3JRBA 3GZ5A 1QPMA 1NY6A 4BDZA 1FMWA 4LFCM 2HCBA 4D5FA 2DMPA 3PNVA 2ID6A 1GXQA 2Z2SB 4AVPA 5DV5A 1OAOC 1TP4A 5LGUA 1TL8A 1UNGD 3DQVC 4G6ZA 4BYYA 3HDDA 2JT1A 1P9QC 4I0BA 3S14J 1IAWA 5EXSA 1NHWC 2W48A 3MD2A 2F2EA 2GQQA 4M6VA 4ENNA 4DBRA 1DGHA 3V7CA 3GQ5A 1WHCA 5FSWA 1X1PA 1PJSA 3CDLA 4AIDA 2ZMEC 2QPAA 2NOJB 1Z3YA 3J7ZI 3CZ6A 2NOGA 2XAGA 3FKEA 3UR3C 2EJSA 4M0DA 3I51A 2BGCA 2J5PA 3AKZA 2ZXIA 4LGWA 4BCPB 3OR2C 4JI6M 2YX4A 2M87A 4M3EA 2DA4A 1QZMA 4IX7A 1VEJA 3ABUA 4Z6YA 3IWFA 4IO9F 4F6SB 3H5RA 4PCZA 2ZFWA 2AQEA 4DJAA 3X26B 4ZJZA 4F92B 1EF4A 2WXVB 2A5WA 3IG8A 3ERED 5D8KB 4BY7J 1H8AC 2XGNA 4LLLA 1RUNA 2E5ZA 3E9SA 2Y0SA 4BJ6C 5LGNA 4HZFA 4OOIA 1B8IB 4F6UB 1SXJB 5IREB 1PJIA 2E1CA 2JVGA 4HV5A 4FCWA 3GTMJ 3QP5A 2C5XB 3UK6A 1OKRA 4LIUA 5GPAA 1E7PA 4BEHB 4PD2A 5BR8M 2KRUA 1YRNB 3D8LA 4F6WB 3MZ8A 2BYVE 2KZGA 2KW0A 1OIPA 2W4SA 2R93J 3MCZA 1XDUA 4A6EA 4ZPXA 2ISZA 2DA5A 3CMEI 4WX9A 2BY2A 4OMZA 3GW2A 3EIEA 3OYGA 1SFXA 3VPRA 5LHHA 5E3MA 4PDGA 3FK7A 1BC8C 1QANA 2L2OA 2Y75A 3IH4A 4EM1A 2DXBB 4EJUA 3MWMA 4LCBA 1XGNA 3SYLA 1GVNA 1FYLA 1PDNC 3B7QA 4DZJA 3KP5A 4CISA 2QA4I 1FWZA 2FE8A 3A46A 2R65A 4ASNA 3CCUI 1F36A 2HWJA 1D5YA 5D6FA 2Y9YA 1YS7A 3K1MA 4R1HA 4BBRM 2VXDA 3SDGA 1WZ2A 1G3YA 1KYWA 3G2BA 2RQPA 2B9RA 2RN7A 3GF2A 3DBRB 3WHCA 1H88C 3CD6I 3HSEA 2XIGA 4JI2M 3ZPLA 1PYVA 5D4RA 4GHLA 3NBIA 2XZFA 2JWTA 3U1KA 2GM4A 1J9IA 1TNTA 3VYUB 1W98B 5C1BA 3Q0VA 5DD4A 2E60A 2RAEA 4FWDA 2AQFA 2ADUA 4ZZDA 3KYLA 3GUDA 1WJDA 2NXNB 3J80S 2UV1A 3C2GA 2IW5A 4KN4X 1D0YA 2DTRA 4JI7M 5CVRA 1U8BA 2Z33A 3POMA 5IDNB 2JN6A 2A3SA 2KIQA 2EKKA 4OAYA 1PP7U 1EFUB 1OI9B 1LJ9A 3BJOA 4IQ4A 3HJEA 4FX0A 4QPQA 1V55H 2EIKH 2MG4A 5J1RA 1HQYE 4MM3B 1IFYA 2JMWA 5IT9S 2QM3A 4JOMA 5B5EC 2JA2A 2R7FA 4CICA 2QNJA 1ETVA 5FLXS 1YIOA 4KIFA 4F70B 1LFPA 3LSPA 1QUSA 3LOCA 4HQMA 3GO8A 4B1RA 2D0QB 3TO7A 5F08A 1DU6A 3MZHA 2WWYA 3JAMS 1FIAA 4EATA 1O3SA 3SZPA 2C99A 4LJ7A 2XEPA 3BTIA 2KZSA 2BY1A 2JRMA 4IOCF 3E5QA 1H24B 2JK3A 2QZ8A 2LY9A 2FNPA 4BXFA 2P7CB 4HDUA 1FSEA 2JUCA 2UUBM 1K78A 4NRVA 3COAC 3AAFA 3ISPA 5EP1A 3BQYA 4JBAA 2JZ1A 1IRFA 2HXOA 3FHZA 3IP4B 1BU2A 4LB5A 3FIWA 3GVAA 3GCMA 1DO0A 1JSTB 3U60B 2ZPFB 5HODA 4FISA 5E3NA 3DXJF 4V2GA 4XRFA 2BW3A 1S8NA 4BJ5C 2W7NA 1TF0B 1S3JA 3QPTA 3MQ0A 5TRDA 5HBJB 5KVRA 4HA8A 3K4KA 3RKXA 2XAQA 2DOEA 4JX4A 3KS4A 5ILSA 2QQ8A 3REOA 4ETSA 1FOXA 1XSDA 5FLVA 2V9KA 4NC8A 4NUBA 4XL9A 3BR5A 2FRHA 1TW3A 3PNTA 5EEGA 3OYLA 1Q1VA 2BJWA 1TDZA 3HXLA 1OYYA 2KKOA 2QSHX 1WSUA 4EOPB 2W25A 3HGIA 4DQ2A 4LLGF 3L26A 3ABMH 1S29A 3BCAA 3ZMTA 4YFKF 2CZ1B 5FKNA 3ERMA 2CHVA 4DR7M 4CRLB 2QBYA 2C9CA 4OIRF 3L2UA 1QRYA 2EINH 1RRJA 2M7BA 1NV8A 1KGSA 2XSZD 2QSFX 4UN2B 4D80A 1N32M 3ZQFA 2DZOB 2KRHA 3NWSA 3P9KA 3RTRA 4L18B 1IUFA 2M4GA 3I53A 1R1TA 1S3SA 1OFHA 3H1CA 5FGMA 3SDBA 4G9YA 1TR8A 2LHGA 3V42A 1VQ7I 2QZ4A 2B63J 4GCVA 1TWCJ 2ICWG 5H2FC 1APLC 1RZ4A 3R60A 4NBQA 3TP3A 3ML6A 5HLGA 5M5WJ 5CYIB 3DBHB 3HOWJ 4F52A 5FD5A 3BG6A 4L9TA 2Z4SA 1SVMA 1FP2A 1LFUP 2F2CA 4WCGA 1R71A 3PJRA 5H37D 2DA7A 4EMSA 3AFHA 2HDCA 3JCUC 4GIPA 2OCEA 1T33A 4L5JA 3DPUA 4A3GJ 1MW7A 3M1CA 3F21A 1ZMVA 2KA6B 1X19A 2DOFA 4BKXA 4PDKA 4RGUA 2DFEA 4F55A 3IV5A 3M6AA 4KODA 2V22B 1ORKA 5HBHB 3M8FA 1ZV1A 2F5DA 5DQWA 2CCHB 3IKTA 1GVJA 2YNMD 2JY7A 3M8EA 2K5CA 2F5VA 2EZLA 1U9OA 1Y1WJ 4A0YA 4EQQA 1ETQA 2ZSHB 5EGOB 1MBFA 1S7AA 3X24B 4ITVA 2NNYA 1WCMJ 2IP2A 1P7JA 5ICCA 1FKMA 4EORB 3AG3H 5DM6F 2QWWA 2YU9J 3J80Z 3BOSA 2JY6B 5IHYA 2K9SA 2OD5A 2DT7B 3LSKA 2R44A 1EH6A 1SXJA 3ASNH 4NDLA 3M9AA 1IY1A 3OIQA 3G1OA 2BEOA 1M1EB 2X6WA 2M8GX 2PMZA 1UFZA 2VT2A 4YC3B 4HEA2 2KDLA 3PVSA 2HQRA 1MMGA 4M3BA 2GAUA 4LJ5A 3OIOA 2Q8KA 2L7HA 3C3WA 3A01B 4IVNA 3WGGA 1XN7A 3FXQA 4DUZM 3K9PA 2ZANA 3VK7A 2OU2A 4L9JA 2O5RA 4L6V6 3KIOA 3Q5FA 3EJ1B 3FUTA 2EFOA 3T15A 2PJRA 3MY1B 3OYHA 2FUG2 2AHMA 2ZJ2A 1FOYA 2CP8A 3KXEC 1SANA 4D7MA 2YPRA 4DIQA 4CGYB 2KHHA 3KP6A 1JSUB 1V54H 2KJCA 1W0TA 2R7TA 4FTHA 2C4GB 1PJJA 1HSTA 2R92J 2Y48A 3UJNA 1QYRA 2JUGA 4IIWA 2NS7A 3S93A 2W84A 3QHWB 1ITYA 1YE9A 3SASA 1QHHD 2DPDA 1O9KA 1SFEA 1PKDB 2ELHA 1S6LA 5JI3E 2GOMA 4MO7A 2NVXJ 5EQTA 3TNHB 5EP4A 3U6MA 3L7WA 4E7KA 1LUJB 2XF5A 2PQ8A 2Q2EB 1G3TA 3PXGA 4Y15A 3E6MA 3FWEA 4DR3M 3GPPA 1Z7LA 5IP7J 2XRLA 5L3BA 4KA4A 3E97A 4LFUA 2WMAB 2X6XA 3HJSA 3Q0WA 3ELKA 3PUFA 4AKIA 3SBJA 3PL8A 4RF1A 3MHVC 1NJGA 4X62M 1ETKA 1XMOM 3E5XA 1H1PB 1TGUA 2YFQA 4M72A 4MQ9F 1MN3A 3BHTB 1T39A 3B57A 5M5YJ 3U6CA 2IJLA 3VK8A 2FOIC 1H4LD 4DV7M 1L8QA 3GRVA 1ZMUA 3HC7A 1H6UA 1G8PA 1LTMA 1KU2A 2LDUA 3A45A 2FBHA 4OWRB 3AG2H 2IGOA 1FTZA 3QYGB 1USSA 3GXOA 3L25A 2N35A 3HRTA 1CGPA 1Y8RB 1TWFJ 3CESA 4JK1X 2CE7A 4UVAA 3HWSA 2DD4B 4U0YA 3LSRA 3L00A 2F48A 5JI6A 2CUJA 4AYBN 3GQ4A 4AW4A 4RAFA 1U5TB 1R23A 4BXUA 5C4JJ 2JVHA 2EV0A 2ZBKB 3W6KB 5F04A 3PNYA 2QYOA 3FXKA 1POGA 1N34M 2H8WA 1TFBA 2M45A 5EDNA 1R36A 3GEZA 4HX4A 5J1UA 1NV9A 1YJNI 4HG2A 1L2DA 3PSFA 4MGIE 3VODA 1BJAA 2R45A 2IEKA 1MH3A 2NVQJ 3HOXJ 3FMQA 1W0UA 1XX5A 1AU7A 1H0MA 4R7GA 1T38A 4OMYA 4BCJB 3CJRB 4ZTFA 3HHHA 3QQAA 4IJEA 3RFWA 3AG4H 4BHCA 4NQWA 4F2LA 2MJ5B 2K3PA 3IL2A 1X3ZB 3BTLA 2LXEA 4FVMA 5FTLA 2ACJA 3BR0A 4IHXA 1V5EA 1WJEA 1IQPA 3O8GA 2DD5B 3G71I 3FBNB 5E1ZB 2W85A 2WADA 4LGMA 4RODA 3SFZA 4FWGA 4UV9A 2DMTA 2AXTC 2ECBA 2EZHA 1KFVA 2EJRA 2NYXA 2VQHA 4HOBA 1FIPA 3KEYA 4MEYF 3GLFE 3T0YA 4IHSA 3MI9B 3W2AA 4EVIA 1E17A 2HKJA 3VYSB 1SG9A 1P3QQ 4G4QA 2ZPIB 1JT0A 5KQ8A 3GPXA 4N9HA 4YIRX 3DOGB 4Y33A 4HQEA 3GZ6A 2EUFA 4ABZA 1OISA 4F7ZA 4P1WA 2HYFA 1K79A 1VQ8I 4R8HA 1OGUB 3W0LB 5J1YA 3QWLA 1V29B 3D0SA 2FOKA 4X6AJ 2EPFA 1E3HA 5D5XB 4KHPM 4OB1B 5CEIB 1PM5A 1LKXA 4XLAA 3DU6A 3C1DA 3U6LA 1TTYA 2KLOA 2JNHA 4A3CJ 2CJMB 3DFGA 4XICA 1RNLA 3OYMA 3HOSA 1D0XA 3PSIA 1MU5A 3K70C 2MFZA 2VC0A 1GUXA 3DTOA 1X3UA 4BB9A 4GYGA 2KISA 5BMZA 1P92A 4Q5SF 3OYCA 1FYKA 4QWQA 1Y8GA 2ZM6M 2CEAA 2IXSA 3ZQJA 2Y31A 4YIIA 3CTAA 4RM3A 5J47A 3ZH9B 4MB7A 2ZAOA 3OOPA 2HOSA 2L3DA 1T08B 3F72A 4EV0A 2UZDB 3V8LA 1S5LC 1PUFB 4X64M 1ZRDA 3W0FA 3K4JA 3VDUA 2CWBA 2DPPB 1YX5A 3R0JA 5LHIA 1GUXB 1XNQM 3B9PA 4I76A 1R5ID 1KQ9A 2HTSA 3SEZA 1LEBA 1QZZA 2L4FA 4OAZA 2E1NA 5C3EJ 1P2FA 4II3A 3L2QA 4CZZA 2E7WA 1K6YA 4XN3A 1ZRFA 5FTJA 1VF9A 2R7XA 1XXHE 5HS9A 1BM9A 3SYTA 5JHFA 1MJAA 2KZUA 5KCMA 5EEAA 4HBLA 1K82A 1WI3A 2CCIB 2LBCA 2KFDA 4MLOA 1XD7A 5HDKA 4CGZA 1R6RA 1Y8QB 5DFLA 2E5NA 2MD5A 4HSRA 1FNNA 3FF5A 3EYIA 3OS1A 1T6OA 2A68F 4IBGA 2J7NA 1ZGAA 2VQCA 4K2EA 4JI0M 4QOSA 3KLNA 2E1OA 2VQEM 2FU4A 2BJVA 1T98A 5KNLA 4EJVA 3CO6C 1MDMA 5EG0A 4EOKB 5ICFA 4LRTA 2VBYA 1STZA 2ME6A 2HOAA 3BBZA 4L0ZB 1RPWA 3UGJA 1JKPC 3QPLA 3MK6A 2Z7JA 3R0AA 4HPQA 4AG6A 4Y4RA 1OCOH 5LRSA 4IKFA 4G4OA 4D0PA 3U6DA 3HB9A 4ELLA 5ITUA 2WB1N 2G3QA 3H4MA 2KJBA 2VBWA 3K9TA 3TE6A 3H9JA 2KMGA 1QDTA 1DV0A 2X1EA 2E34A 1EJ9A 1MGTA 2YS9A 3U5ZA 1D1CA 3KSJA 1IO2A 3RYPA 4EOSB 1HW1A 1D0KA 3CLQA 1NTCA 1I27A 4ESBA 1E9RA 2K85A 5J40A 2R5ZB 3IKVA 2R62A 1LVAA 3DKYA 3EUKL 4XKCA 5ITQA 5LMNM 3B7NA 1ZK8A 2CQKA 2LBFB 1UFMA 1SEUA 1DQUA 4BY1X 3W2VA 2CW8A 1VQLI 3OV8A 1CQTA 5L3FA 2BHYA 3FXLA 3K0LA 3CCLI 4DBGB 3E4RA 4Q7JA 3L27A 3LSIA 2HOEA 5F1RA 1O3RA 3VLFB 4UNOA 2UXBM 3RCOA 4A3FJ 1D3UB 4HL4A 2DO7A 4II2A 1IN8A 4BJTA 1Y1VJ 1LNWA 2JUJA 5LQFB 4IF4A 4XKBA 5DYMA 1NG7A 4HF2A 4EOJB 3HU1A 3KP1E 2ELJA 5K1YA 4II7A 5F0CA 2V6ZM 2L7MP 3EIDB 2LVAA 1TNSA 3DEEA 2R7WA 2LBFA 3THGA 1XO2A 3CF0A 1TWAJ 5ILUA 2JA6J 2XAHA 3V8KA 1B4AA 5M3FJ 1HXDA 5ACBA 5DCMB 2IA1A 2G77A 1FJLA 2XSZA 1WI9A 4QSHA 2P5KA 2H1RA 3M0EA 1OCCH 3KP0E 3FX3A 5D6EA 1LB2A 2IRFG 1DP3A 2OV7A 3I04M 3NWTA 1YQAA 2QUFA 4MH0E 3KFUG 2VB6A 4PJJA 3S32A 5HLIA 3K6GA 4QTRA 3OOUA 4B3MM 4I8OA 3E5UA 1L2CA 4IRHA 2R0QC 4FCYA 2AHQA 3FD9A 3J7AS 4PGHA 2OPTA 4U7BA 1GL7A 4G4RA 3MEXA 2GLOA 1MJGM 2WY8Q 2I5UA 2P8TA 3W6JB 4E7ZA 4MGYE 3K70D 3RZDJ 4A3DJ 1XCVA 5IT9K 3EUHC 3GLFA 2F4IA 2Y69H 3KSXA 1VQPI 2I7NA 2F5FA 2VT3A 2OO9A 2LKPA 4DV3M 1JKOC 2LVQD 3SAUA 4IXAA 3OYKA 3HUGB 4I3ZB 1KU7A 2CFXA 4GKJM 1G4DA 1QPIA 2KIFA 3ECHA 1ZQ9A 4YOZA 3FMSA 2PJRB 3CJTB 4BACA 1FX7A 1JI8A 2LW4A 1A5JA 3L29A 2NVTJ 4IHWA 2ZNYA 2QDYB 1XGMA 1BIAA 1G59A 2XB0X 2WV0A 4HEOA 3KFWX 1HA8A 3HEFA 2VDBB 3H36A 2XPVA 2RQQA 3JRDA 5KO3A 1HNZM 2RGVA 3LVVA 3O0GD 1AKHB 2QHOB 5KK1A 1MDMB 4M3GA 3WG9A 3I4YA 1D0ZA 1IDZA 2HR3A 1TLHB 2DT6A 5DYIA 4I7HA 1F43A 1Z7UA 2WY7Q 1X1BA 3F0CA 1XSXA 3KYCB 1MMSA 2ZZDB 4KRCB 4X0GA 4GC9A 4I99C 4FX3B 2FNAA 4FETA 3CMAI 3KZYA 2PI0A 4G7OF 2XZUA 3RPQA 4DW6A 4CFNB 1BR2A 2R3SA 1E9HB 1QUTA 2QP9X 5D4SA 2R5YB 3SARA 2BBYA 3BOQA 5LHGA 2LF7A 2DAIA 2W57A 3BWGA 2PHGA 3WGIA 4M3FA 2R7OA 2JA5J 3TBIA 4HX8A 3GLLA 3LAPA 2OTLI 4ZGDB 4IBCA 4DV0M 1H89C 1OIYB 1PVEA 4IBFA 5CQGA 2PN6A 1QO0D 2LNHC 2BWEA 3S1QJ 4ESFA 2QF7A 2O9LA 2WIPB 1VQ9I 4M6YA 2FMLA 4DR2M 3A8HB 1TQPA 4MIMA 4XSZF 4L15A 1YLFA 4O6JA 1DP7P 3G4SI 2V9VA 4UUSA 2R7RA 1GKIA 3PQKA 2ZCFB 1RI7A 3KOWE 2DDAA 2BS2A 5E17F 1XCBA 2VJ4A 1I50J 2CHGA 2LVSA 3EQLF 4U7DA 2A69F 1K4SA 1SXJC 1YG2A 2PMHA 1IUYA 1H25B 2PMZN 2PMIB 1JQJC 4FT8A 1J59A 1MBJA 2D7GA 2UXNA 2Z99A 5EYRA 3ZN1A 4Q4ZF 1W5SA 2QBYB 3KS8A 2CUEA 4LZJA 3I9V2 4B7GA 4WXDA 5BS6A 4I01A 4JYAM 1ZELA 2P81A 4PZJA 1H1QB 4ITQA 5GKNA 5HS7A 2HKOA 1V5FA 5JHUA 1IJWC 3RZOJ 4CUGA 2R4JA 3PIPF 1OYIA 2DK5A 2GOXB 4XLCA 1WH5A 4W1UA 1YI2I 1XHBA 4OIPF 1R7JA 5HNBB 4RAZA 5J4YA 1VQKI 2VE8A 1J09A 2D1VA 3HYIA 3BLRB 1DDNA 2C5VB 1GY3B 4BAYA 3I56I 2WEVB 2ZBKA 3I58A 3H0GJ 1XMAA 5IYCJ 3DKWA 3S1RJ 3ESWB 4GRIA 2OOAA 1Z05A 4CCMA 3L28A 1FBSA 2OA4A 1GABA 4DV6M 2OBPA 5GADJ 4OB0B 2F5QA 4BE0A 1IC8A 2R7GA 3TOBA 1W7PA 4XNFA 3QPHA 4E6KG 1SXJD 2LWXA 1W4MA 2EZIA 1HSJA 3BG3A 2E1MB 1QAMA 2FBKA 3IAM2 4EM2A 1QQIA 3J7YJ 4L4UA 4LITA 4G94A 3WGHA 3TL4X 1N36M 2IA2A 2M34A 4IQJA 5DYGA 1FMVA 4CCKA 2CV0A 2DXIA 1BR4A 3ZMSA 4HX7A 2OUMA 5M5XJ 4CFXB 3M03A 3TPZA 1QAQA 4M0WA 3V8JA 1MNEA 4DR6M 3PQJA 4E7LA 3CCEI 5B3SH 3G6EI 2M7AA 2WAEA 3FYDA 5IP9J 2L6OA 4FWHA 3T1BA 3TDUC 4KT6A 1IY0A 2XAUA 2WB1A 2MC4A 3CMMA 3P7NA 5IYDJ 3KVWA 2K7LA 3HKZA 5HLHA 2Z3YA 4I0AA 3WTSC 2F5SA 2LTUA 2Q2EA 1KA8A 2L4EA 2KZVA 3FRIA 2R4GA 3SFIA 5HDGA 3DFZA 4JI4M 3EUHA 3KPHA 4RAYA 3BZKA 2CQQA 4TTHA 4CJ6A 3FUUA 1X1AA 2JJ7A 2Z5UA 3RPUA 5FLMJ 1GHCA 1MMNA 1WJFA 1V4RA 4B08A 1ULYA 4PCQA 4AG5A 4X65M 3TMOA 3WE2A 3ZQGA 4D7NA 2ZTCA 4XK8F 3X25B 4GYIA 3TKYA 2CFOA 1GJSA 2FEZA 2M4KA 4G6DA 4KNYA 3I59B 3R9XB 5L3EA 5F0FA 1K6OA 4KJZA 2DA3A 4NSTB 1LQ1A 1G3WA 1OR7A 1NNUC 3DTEA 4P16A 5LMUM 4DR1M 3VDXA 3NQOA 5FB2A 1ERDA 1EH7A 1P4AA 3LSHA 1UGRB 3DBLB 3EPZA 1NSFA 2VF8A 4E70A 5K7HA 5ITRA 1ZHFA 1VEGA 1UELB 4L9NA 4HNVA 1ZAEA 2HI3A 1VDLA 3K1NA 2WSCF 3U6PA 3C2BA 5J8CA 3L1PA 3FTCA 2ERCA 5KPTA 2M2EA 2MW8A 2OQRA 4G12A 4EJWA 5HNFA 2B3TA 4EOOB 3H3UA 2PMUA 2DT5A 1DGRM 4Y7NJ 3CUQB 1F4IA 3B73A 2VQGA 3B7ZA 3RJPA 1C1KA 1PRBA 1MD0A 1HKTA 1IN6A 4C3HJ 4F7JB 4GEWA 3OTOM 1AHJB 4BGDA 2XAJA 1XWIA 4XLNF 3OSGA 2PJQA 2YUSA 4N9IA 5CYVA 1LPQA 3X28B 2UZKA 2IT0A 2WHBB 1XB2B 1HBXG 4XRSA 3NAUA 3HOZJ 3WU0A 1X4PA 3H35A 1T0FA 4ZC3A 2VN2A 3F8NA 3GTGJ 3GTOJ 1N25A 5GAEJ 2RKHA 4IMYB 3FUVA 2JZYA 3PM1A 3FISA 3S3NA 2C5OB 3CGWA 2DI0A 1EKEA 2G7HA 3BTCA 4F7SB 1XXHB 2QQBA 4A0ZA 5F1JA 3CC4I 3CJQB 3GLGB 4CH7A 2BXZA 3S2HJ 5IT9Z 1FSHA 2CGPA 2C5NB 2KNAA 2WPAB 1NK3P 2DAKA 1QZYA 3GTLJ 1N77A 3M3YJ 2IW9B 1IZ1A 2EH3A 2IAIA 5A2QZ 1T8IA 3L2VA 1VQOI 2KNZA 3ASOH 3SXYA 4CYCB 2JGZB 1R00A 1W5CC 3IUOA 4RB0A 5L3DA 4B3SM 2MABA 3ZQ7A 4BCND 2ESHA 2WC2A 2OOBA 1S7OA 2M9HA 4BQQA 5D5UB 1AIPC 2L0KA 4WF2A 3W2WA 3GFIA 1IREB 2Z4RA 6PAXA 3GRRA 1TH2A 2IW8B 2DA6A 4M71A 3AOGA 4KYWA 4OU7A 3RGPA 1MBHA 1SAUA 4S04A 4BBRJ 3J80K 5BOXA 2VONA 2O0YA 3ZMZA 1HT2E 4PK4A 1YS6A 1FJGM 1N33M 2X6OA 2QKLB 3FMRA 1ZH5A 3GPUA 1DGWY 2LLKA 3SEQA 2R6FA 3JRIA 1UG2A 1DO2A 3FXUA 3HM5A 4RS8A 2L5QA 4JI1M 2LF8A 3O3KA 4J00A 1G3NC 2BZTA 5DM7F 2Y0QA 4BLCA 1IM2A 3GFMA 2EZKA 3CLOA 4AYBA 1G6NA 2DWLA 1U3EM 4BHBA 3WTVC 1QVUA 4E4HA 2MGWA 3HSRA 4A3BJ 1D8JA 2HVRA 4LJAA 1QAOA 3ZN0A 3OS0A 2X8AA 4EOLB 4L16A 4IHYA 3IAS2 3MFKA 2JY5A 3KE2A 2QKMB 2NAZA 3A8MB 2LRDA 4P5OA 2VUMJ 1G8XA 2O6GE 3V4GA 1RETA 2LY1A 2CSOA 4LG0B 3DEUA 4CZCA 3GWZA 1K61A 3WTWC 3VEPA 3RE8A 1XTAA 3BHVB 5FKKA 3OY9A 3GPYA 2LVNC 3K4MA 1OIUB 1TH4A 1ZG3A 3C18A 1X4OA 3VYTB 1OJLA 5J4VA 3R4KA 2KNVA 2JA8J 1PGYA 2DFHA 3MKLA 4NSRA 3QAHA 2QGSA 1G4AE 4L9VA 3ZC7B 1TWHJ 1VI0A 4DV5M 1C7YA 2JWSA 1RC9A 2XGCA 3NBXX 5GAGJ 2D45A 4XOPA 3R6SA 2JA7J 1UGQB 4PFOA 3I64A 3P9CA 1XG1A 1I5ZA 2V6EA 3LCVB 4DOZA 3CO7C 1K78B 3O6BB 2IBDA 1HW5A 3HSFA 2DU9A 3WTXC 4ZTJA 3KP3A 1T95A 2HEOA 2G9WA 4BCQB 4P96A 1QVRA 2L9NA 2EUCA 5H20A 4AKGA 3F9KA 2IVMA 1OCTC 2H6BA 2VJJA 3CUQC 4RGRA 4G6TB 4F3QA 2Y20A 4A3LJ 1J75A 4I09A 1HR0M 2EV5A 3R61A 2G8LA 2HHHM 3OYIA 2LKXA 2LOOA 2FMYA 4XRSG 3BLYA 3BCBA 2HWVA 2ZXJA 2K4BA 4LY6A 1XXHA 1YOVB 5B1BH 4B47A 3KX2A 5LEKA 5E1WA 3GTQJ 1G2HA 3U6QA 3DDQB 1U5TC 2LSOA 3UZUA 1JJ8C 1MBKA 4Y3OA 2RKOA 2OAZA 3GRUA 3NARA 3RYRA 3VFDA 4RM2A 1BVSA 3MN2A 3RKWA 4XBFA 2EA4A 4GKKM 3BG9A 4D1QA 3GTKJ 1KQ8A 3T38A 4XKWA 4AD9A 1JR3E 3J7AY 1I1SA 2FQ4A 1IY2A 2NVYJ 1AUAA 1QA6A 4HDVA 2X1CA 2PJPA 3S2WA 2VL8A 4D5CA 4YIFA 3SHFA 2YX7A 3A1YA 1YX3A 3TWKA 1K3XA 4AQYM 1QGPA 1G3SA 4F7NB 4BBAA 1W36D 8CATA 2CQXA 4HW0A 4LIVA 3S8PA 1UG0A 3TDZC 4C3IJ 1Q3CA 1Z5BA 2GQFA 2M5ZA 3C7JA 2L4MA 1TD6A 2FBIA 5HNHA 1PUEE 2E19A 2EV6A 1I39A 5DTDA 2UXCM 2R5ZA 1H1SB 2W99A 1C9BA 3U5ZB 2NNNA 2FA5A 1U9NA 2LG4A 2Q0OA 5EP3A 4Y28F 5JLXA 1MKMA 3S3MA 5D5WB 1YW9A 3JR9A 4BCHB 1IXSB 3KHIA 4ZDLA 5LBQA 1BJZA 5HS8A 4GHAA 2C6YA 1JTXA 2DYRH 2EFNA 4XRMA 2WSFF 2YR0A 2Z8YM 4LG0A 1URCB 4HLQA 1H9TA 3BY6A 4DYQA 3CP8A 2UU9M 2HS5A 3SMPA 4JV5M 3K4BA 4BXXX 2ZSIB 2ETHA 2VBZA 1IBLM 2K0BX 4MTEA 3S2DJ 5ICPB 2E35A 1J5YA 1YJWI 4I2OA 2P6TA 4A3IJ 4F1IA 2XASA 3C58A 2ZKZA 3IHPA 2HNHA 5FLXZ 3HGYA 2CYYA 4LD5A 5FGKB 4Q48A 5BPDA 3PFYA 2ELKA 4JP0A 1WFXA 3A0BC 3KYDB 3BROA 5C44J 5DQVA 4EOQB 3MIAB 3GLXA 5IOYA 3W6VA 1JR3A 3K8ZA 2HL7A 2UWMA 4MEXF 3SATA 3TO6A 5EJCA 1YYVA 3QXEB 4M9ZA 2W9ZA 3HOUJ 4QPOA 3RQ4A 2CS3A 4OINF 1A5TA 4BCIB 3ZMUA 1L3LA 2DOAA 1NJFA 4V19K 3DV8A 1MNDA 3GYHX 1VYWB 2B0LA 3HPHA 3U1DA 1WXQA 3Q8XA 5KQDA 2J7OA 1PUFA 2DMEA 3J81Z 3GQ3A 2O7OA 5CVJA 4B44A 1Z9CA 3DDPB 1EE8A 4ZGEB 2EILH 4AUXA 5FTMA 1I94M 2MSYA 3QRFF 1BL0A 2BV6A 4CCLA 1D2NA 1JB0F 2KXEA 1DPRA 2NS8A 2E2HJ 4DYRA 2F5PA 3G73A 2XUBA 2XSJC 4MFDA 3BPXA 3T6PA 3BDDA 3A8LB 2W82A 3PO3J 3HY5A 2GBYA 3SMSA 3MMPA 5IOZA 4OB2B 3HX3A 1K83J 3HHZA 3F8FA 2EB7A 1ZQ3P 2KRFA 4HRIA 3I4MJ 2X1NB 1SMTA 2KL4A 2VODA 3MY5B 2ECCA 3WVDB 1BA5A 5E26A 1I6HJ 3GLGA 2X48A 1Z1DA 3F8MA 2FSWA 2PLYA 4UB6C 3A02A 2G9XB 4BCGB 3K1PA 1OKSA 1NY5A 2K9MA 1O7LA 3IWZA 4IHTA 2ZO4A 4A6DA 2DDBA 1GLNA 2IGKA 2LK2A 1OAIA 1OCPA 5LFAA 1HJPA 5E20A 3HRMA 4CFWB 1W1WE 4A2UA 1E9SA 2DZNB 1EV7A 2D7EA 3CDIA 3I4PA 4RNAA 2QGUA 1WR1B 2R0IA 3F6OA 2RREA 4PJ0C 1R2ZA 2MYSA 1P4WA 4ANRA 3HTUA 3BXWA 1UAAA 2W9FA 3E46A 3KDSE 2KMUA 3LSMA 3JREA 3RKQA 3AOEC 4E7JA 2A05A 1CUKA 4C9YA 2Y2ZA 1YLAA 5K5OA 2DCEA 5TJJA 4CXAB 3DP7A 3BG7A 1U78A 2DMUA 3H92A 1MIJA 2DXCB 1Z5AA 2ISYA 2ZAMA 5HVQC 2L7IA 4HF1A 1BC7C 2OQGA 3ZR8X 3TN8B 4JX5A 3CF5F 1LDDA 2ZTDA 4B3AA 2ZMEA 2QQAA 1WWXA 1XC5A 1U0JA 2R7QA 2PFBA 3CF2A 2V79A 3HOTA 2V6CA 2KR6A 1ENWA 1OLTA 2LH9A 4OB3B 1YIJI 1U5TA 2XKOA 2CQ7A 1MSEC 2CHQA 4ROEA 4WW0A 2HOTA 2G7UA 4WURA 3EIHA 3VFZA 4LG2A 1KONA 5DEQA 3KOYE 2DJNA 4GO1A 5EG0B 2X49A 3IECA 3HU2A 3QYFA 4OR5B 1MH4A 5AIPA 3TWMA 3V7SA 3ZOBA 4FASD 1FINB 3FRHA 3QODA 5M3MJ 3DPTA 4GMQA 4S0HB 1ZP2A 2WFYB 2JQ7A 3WHLA 5BPIA 3IG5A 2D2WA 4FHTA 1VQNI 5C4XJ 1D0LA 3I5UA 1AA7A 1Y39A 1ACIA 3GLGE 4HNTA 4UXNA 1AOYA 3A4CA 4LFBM 3E6DA 3CCMI 2E2JJ 2QDJA 4QHTA 4ZDPA 4B48A 3ZP5A 5EFQB 3OL3A 1GVDA 3B74A 5AIQA 4X66M 1BBYA 2PK9B 2K02A 3KEOA 4XM3A 4LZZA 3TEDA 1CF7B 4NC6A 1R5GA 3KEQA 2RGOA 4OU0A 3WTTC 3QHRB 2IS2A 3D8BA 4N4OB 4L5EA 4JN6A 3GLIE 3FXJA 3KETA 5HDNA 3P9IA 4EM0B 4CIZA 1FP1D 1ODDA 2CO5A 1OFCX 2VKVA 1KZHA 2VJ5A 4J19A
chains in the Genus database with same CATH topology
2ZPFB 4Z6YA 3X20B 4MFDA 3X26B 4MFEA 3A8LB 4HNUA 3QZ9B 4JX4A 4OB2B 2QQ8A 3WVDB 2DPPB 3QZ5B 4AKIA 2ZPHB 2AHJB 1E7PA 3VKHA 4OB0B 3BG9A 2CZ1B 4P17A 4ZGJB 3BG3A 3QYGB 4FM4B 2CZ0B 2QDYB 4ELJA 3X28B 2DXBB 2DD4B 1IREB 2ZPBB 4JX6A 3WVEB 3QYEA 4BBSM 4BBRM 2ZZDB 3QYHB 2DXCB 4AI6A 3VKGA 3TW6A 3HB9A 3KHIA 4JX5A 3QYBA 2CZ6B 2KMGA 3VYHB 3X24B 4HLQA 2BS4A 2KR6A 3X25B 3HO8A 1UGSB 1FKMA 3HHTB 4OB3B 3A8GB 4ZGDB 3DL1A 3A8MB 4LOCA 3A8OB 2CYZB 2CZ7B 2DD5B 2QF7A 1UGRB 3BG5A 3A8HB 4HL4A 4MIMA 4HNVA 2D0QB 4HNTA 2ZCFB 2ZPEB 3HBLA 4M6VA 2ZPIB 1UGPB 2QDJA 2BS2A 2QFZA 5EJCA 3QXEB 2BS3A 3HZJA 1UGQB 2WJ9A 4AKHA 3QWLA 1V29B 4NC6A 2ZPGB 2G77A 4OB1B 4QSHA 1AHJB 3VYGB 3H4CA 4ZGEB 4AKGA 3TW7A 1QLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6Y A;  2QFZ A;  3QWL A;  4P17 A;  4NC6 A;  5EJC A;  3QYB A;  4HL4 A;  3HZJ A;  3QYE A;  4HLQ A;  2QQ8 A;  2G77 A;  1FKM A; 
#chains in the Genus database with same CATH topology
 4RB3 C;  2R7V A;  4DYC A;  5A2Q S;  4MNU A;  2CV2 A;  4O5V A;  1O9K B;  1ZKG A;  1IW7 F;  4I02 A;  3O8H A;  1SD5 A;  2QCO A;  3ROU A;  4ENK A;  3HKP A;  3D1N I;  2V1C A;  5FO5 A;  2Z3X A;  1IN7 A;  2JTV A;  3MZY A;  2LHC A;  3QZ9 B;  1A04 A;  4AIH A;  3BR1 A;  4EOI B;  2VPL A;  5D8L B;  1HF0 A;  4CDG A;  4UUV A;  2I53 A;  1K4T A;  4V2F A;  3S1M J;  2H1L A;  2AHJ B;  1I3Q J;  3VDP A;  1Z77 A;  3QPS A;  4N4N B;  3KW6 A;  2IVX A;  5DUI A;  4N0B A;  1WGL A;  4P17 A;  1SD7 A;  1B72 B;  2MLG A;  3H9G A;  4LB6 B;  3RGS A;  4KLN A;  2EIM H;  2BKZ B;  3A01 A;  4WWC A;  1XGO A;  2NS0 A;  1ZN2 A;  1HDP A;  2L7F P;  2X6Y A;  2YSR A;  3CCQ I;  1WQ2 A;  4WK8 F;  3HPG A;  4LFA M;  4NXM M;  4YFX F;  3CP2 A;  5JVG F;  2XGX A;  1C0W A;  2I7P A;  2PEX A;  1UNL D;  2LMD A;  2LH0 A;  4LJ9 A;  3K2L A;  5L2W B;  5D5V B;  5TIS C;  3RPU D;  3OYF A;  2C96 A;  2HZD A;  4FCT A;  1FPQ A;  2DK8 A;  2YR2 A;  3KP2 A;  4B43 A;  3E6C C;  2LFB A;  4JX6 A;  2H1K A;  3JR4 A;  3U21 A;  3I3L A;  1GXP A;  4BBS M;  1ONV A;  1FTT A;  1L0O C;  4NNJ A;  2CWE A;  3ZQQ A;  1QBJ A;  5GPC A;  1OL1 B;  2VPR A;  2FJ1 A;  5EGO A;  1TQM A;  4WXC A;  4RGS A;  1IV8 A;  5E3L A;  3O2P E;  5FRO A;  1FC3 A;  1WJC A;  1ZAO A;  2Z9O A;  3WHK A;  2OZU A;  1IXS A;  4P55 A;  4W97 A;  2V1U A;  1F4K A;  2GXB A;  4JI5 M;  3CDH A;  3Q3S A;  2V1X A;  5BNG A;  1NH3 A;  2CZ6 B;  1KSF X;  3GTM S;  2F5N A;  1NNJ A;  3JW4 A;  3TQS A;  1Z3X A;  2F5E A;  2JPC A;  1GH6 B;  1UGS B;  4CYD A;  2DW4 A;  1KQ0 A;  5CLS A;  1WHU A;  1LDK B;  1TDH A;  2GZW A;  4CA0 A;  1HNX M;  3IC7 A;  3BR3 A;  2CW7 A;  1YHQ I;  3I01 M;  4IBK A;  1ZTR A;  3IHU A;  2EFQ A;  5LEJ A;  3MMY B;  3FYC A;  5IDP B;  1PJQ A;  2DFF A;  4DV2 M;  1XMK A;  5GTH C;  4JI8 M;  2HXI A;  1RKT A;  2LY2 A;  4YY3 M;  5LGT A;  4ZYH A;  3J81 S;  5DUK A;  1XC8 A;  2L54 A;  1RU3 A;  2VF7 A;  4Q47 A;  2H09 A;  2IS6 A;  2DWM A;  2VI6 A;  3FHN A;  5IT3 A;  4P9U A;  2RNJ A;  2MBF A;  5KPR A;  2B9S A;  2KEB A;  4DGW B;  3FZV A;  3Q0U A;  1H27 B;  1ZMW A;  2V4J C;  1V5G A;  2XH9 A;  2WAQ N;  2E2I J;  2BS3 A;  3OMY A;  1T6S A;  2A07 F;  1XDS A;  2GA2 A;  5J6X A;  2COB A;  3K4C A;  3AJI B;  2D7H A;  1QVT A;  4A69 C;  2A5Y B;  2NQ8 C;  4LF4 M;  3LNQ A;  1AKH A;  3VYG B;  1UCR A;  2CUZ A;  2R7S A;  3T1H M;  1YW8 A;  3TW7 A;  3C2H A;  2O8X A;  2W24 A;  1IF1 A;  2L7Z A;  2ZC2 A;  3X20 B;  4FE4 A;  4A3E J;  2XLJ A;  1X1C A;  5EP2 A;  3RDI A;  3LVW A;  3G1M A;  1IN4 A;  2DZL A;  1JUS A;  5TGT A;  3VYR B;  4BCQ D;  2UZE B;  2KIU A;  2JXN A;  3VB2 A;  1QNT A;  4Y52 J;  5KPZ A;  3LA2 A;  3HUG A;  2FS1 A;  1BR1 A;  2I8D A;  4UHT A;  1T2K A;  4KMU X;  3KP7 A;  5DD8 A;  3QZ5 B;  3GO5 A;  4JXJ A;  1D3Y A;  2ESN A;  4AIJ A;  1RUO A;  3OIP A;  2MR9 A;  2ZFU A;  2BE5 F;  1P5E B;  3DF8 A;  4BH9 A;  1UHW A;  2WBM A;  2YQZ A;  4ZYA A;  2O61 A;  1OYW A;  3I4V A;  3HHG A;  1O7F A;  4ZGJ B;  2GIV A;  2M0C A;  2A6E F;  3N05 A;  3L2W A;  1IXR C;  3FE3 A;  2EQR A;  2QVO A;  2LNB A;  1U2W A;  2RGH A;  1VDD A;  2LRE A;  3GFJ A;  3ZQC A;  1SXJ E;  4YHH M;  2APL A;  4EJO A;  3BHU B;  1V92 A;  2Y30 A;  3S17 J;  2CZ0 B;  3DOA A;  4IL6 C;  2F5O A;  2C98 A;  2K6B A;  5CVU A;  1YO5 C;  3U6E A;  2QCU A;  2B7E A;  3D5S C;  4KIC A;  1UZC A;  2TRT A;  2IGM A;  4G6L B;  3KCC A;  1H26 B;  2WTE A;  2K9N A;  2WAF A;  2M30 A;  1OCZ H;  1Q02 A;  4ROC A;  2A6T A;  1FY7 A;  5LLQ A;  2R46 A;  1MBG A;  2PX9 A;  3G3Z A;  3N4M A;  5HVY B;  3ZMV A;  2DWZ B;  3SYK A;  2P5V A;  5EXP A;  1N75 A;  3RI4 A;  1N4M A;  4EIW A;  5IP6 A;  4REZ A;  2MC3 A;  4MGZ E;  1PJT A;  1EH8 A;  1ETX A;  2XVC A;  3BJA A;  3S15 J;  5H6Q A;  2BY0 A;  3ZQH A;  3WTU C;  4LJ8 A;  3WG7 H;  1WIV A;  1UB9 A;  1D8K A;  4QLC U;  1IDY A;  3FKJ A;  4Y72 B;  2LYC A;  4G6Q A;  1LVK A;  1R1V A;  3VYH B;  2IN3 A;  1Y0N A;  5EEH A;  3DJB A;  5LMK B;  3JAM Z;  5KAI C;  3TO9 A;  2XF3 A;  1V34 A;  1VFC A;  3TNW B;  4IBB A;  2PG4 A;  4KDP A;  2CYZ B;  4AC0 A;  1IRG A;  1WH7 A;  2CZ7 B;  2LVP C;  1GV5 A;  1A6Q A;  4AM3 A;  4IBE A;  4HLY A;  4BE2 A;  1YUB A;  3E0J B;  4IZZ A;  5K5Q A;  2UZL B;  3CJN A;  3KZZ A;  4A3V B;  4UN0 A;  3BG5 A;  2EO2 A;  1H1R B;  3B02 A;  4PUS A;  2VOP A;  1MX0 A;  1Y6I A;  4RBO A;  3HRU A;  1FOK A;  2H27 A;  3UKG A;  2GNO A;  1BOB A;  2C9O A;  5B1A H;  4NOO B;  2LD5 A;  4NL4 H;  3K2Z A;  3GLH E;  1WKM A;  3OL4 A;  3W68 A;  3JTH A;  4HST A;  4BY7 X;  4BEH A;  3U6S A;  1JHF A;  3CC7 I;  2O3F A;  1ZRC A;  3BJ6 A;  4WP2 A;  2F4O B;  1ZGJ A;  3DEW A;  4CHU A;  5FRN A;  3GLH B;  2IS1 A;  1LEA A;  3EDP A;  3BP8 A;  3BT9 A;  3LSJ A;  1MJB A;  3B89 A;  2CV1 A;  4A5M A;  4G7H F;  3ZCB B;  2HFH A;  1FVV B;  1SFO J;  5FFX A;  2GXA A;  1QLB A;  2Y0T A;  2F4V M;  1A31 A;  1IXZ A;  4IBD A;  2ME0 A;  2XRO A;  4XBO A;  2K4J A;  1W5T A;  5E79 C;  5ILV A;  3GX4 X;  2QQ9 A;  2QLZ A;  1FZP B;  1X58 A;  2A61 A;  3ECO A;  3H9Q A;  1BI3 A;  4AU7 A;  4A3M J;  3TQN A;  3PIO F;  1Y0U A;  2AS5 F;  1P6R A;  3BQZ A;  2XFT A;  4AIK A;  2MA3 A;  3HHX A;  1XMQ M;  2L4A A;  2HPI A;  1W36 C;  3F8B A;  1JHH A;  1UHM A;  3U60 A;  1SD4 A;  2X0L A;  1IRX A;  4G7Z F;  2X9D A;  2DVW B;  4ON0 A;  1VQ4 I;  3D5R C;  2UZB B;  4XSX F;  2DAG A;  3N97 A;  1NK2 P;  1S9H A;  4XLH A;  3PFI A;  4FD2 A;  2OCC H;  4RB2 C;  1MMA A;  2M3A A;  2XC7 A;  3BR2 A;  4C2U A;  4MGK E;  1D0M A;  1HOM A;  2F5C A;  4Y13 A;  4EOM B;  1MBE A;  1NHA A;  4BCM D;  3NEU A;  5HBE B;  1I4W A;  3I0T A;  3DTI A;  5JVT A;  4AVZ A;  3HIF A;  4PJM A;  1FBQ A;  5HLT A;  2DFI A;  1VQ1 A;  2EBI A;  1ENH A;  3LSG A;  3VOE A;  5HOO A;  1MNM C;  2CH0 A;  2L7K A;  1OIZ A;  3NWL A;  3FBI B;  3Q9S A;  3LWF A;  3WU1 B;  2MD0 A;  2MH8 A;  2X1D A;  3ZRG A;  2FQ3 A;  2Y21 A;  4LF5 M;  1K3W A;  1B9M A;  3K10 A;  2IPQ X;  1R22 A;  2TCT A;  1IBM M;  4JYK A;  3X2Q H;  1JR3 D;  1HNW M;  1BW5 A;  2ZPB B;  2CG4 A;  2DQL A;  1NG6 A;  3I59 A;  2BW3 B;  4KN7 X;  4YEJ A;  1AHD P;  2CU7 A;  5FKL A;  3J2P B;  1GL6 A;  5BNJ B;  3QOE A;  3EET A;  3RQI A;  2IW6 B;  2WZJ A;  3ZMD A;  1R7R A;  3VKG A;  1JUM A;  3ZQL A;  4PJN A;  3GLH A;  3L2A A;  4M6X A;  1FT9 A;  3LMM A;  1V33 A;  2V26 A;  4II5 B;  3TP0 A;  2K40 A;  2STW A;  2ZB9 A;  4OIO F;  4Y17 A;  1G3I A;  4IBI A;  4A5N A;  3CCJ I;  4KRD B;  2BS4 A;  1XB4 A;  5J8F A;  4RLQ A;  2JSC A;  3GTJ J;  3H5A A;  2VQF M;  4WXH A;  1TW2 A;  1B6A A;  2DNA A;  2C6T B;  4R79 A;  3SZG A;  3C9P A;  3MKZ A;  2FFJ A;  4H0E A;  4GDF A;  1DGB A;  2OTJ I;  3HJQ A;  2RDP A;  4XR6 A;  4BCF B;  2VII A;  2XRN A;  1EA3 A;  1MJ9 A;  3FM5 A;  3M1E A;  4L0Y B;  2F4M B;  3AG1 H;  4XMY A;  3VSL A;  4IBJ A;  2NRA C;  1WJ7 A;  4EGY A;  2HAK A;  1R5H A;  5I5Z B;  3TOA A;  2XSD C;  2R7D A;  2GA1 A;  3KLO A;  2W96 A;  4G8X A;  5GTI C;  5FJ8 J;  1JOW A;  3U2R A;  1JKQ C;  5EXX A;  5FD6 A;  4E7H A;  2R4E A;  4BCO B;  5ICE A;  3HRS A;  1I3A A;  3HBL A;  4QOZ C;  2XPU A;  3GP1 A;  1X2N A;  4KMF A;  2J5Y A;  1TH3 A;  2UXX A;  3S16 J;  2XF7 A;  4FW9 A;  3E21 A;  1E0E A;  1BI0 A;  1W7P B;  2FE3 A;  3LQ5 B;  2Y0S N;  3Q9V A;  1E3O C;  3AL0 B;  4LG3 A;  3FTF A;  3JSO A;  2OF7 A;  1PJR A;  1JGG A;  2LTP A;  3E7L A;  2ZPG B;  3J7A O;  3OS2 A;  1XMX A;  3LA3 A;  3G1L A;  3W67 A;  2BY3 A;  3HOY J;  2OZ6 A;  5FTK A;  3SHG B;  3OYB A;  3F92 A;  3T1Y M;  2EFP A;  4O3M A;  3H4C A;  2DAO A;  1R4M B;  2L09 A;  3IH2 A;  1SC7 A;  2K27 A;  5K5R A;  2JSP A;  2HPM A;  4OIQ F;  3H5N A;  1S7E A;  3OR1 C;  2RRU A;  1UJ8 A;  2VXZ A;  1GUU A;  2VKH A;  4MFE A;  3LCU A;  2XHK A;  4PT5 A;  3MVP A;  4RMN A;  4UV8 A;  4S12 A;  1OKV B;  1T43 A;  1IXC A;  3K4N A;  2ZJP F;  5L8R F;  4EC9 B;  4XOR A;  2HDW A;  3MKY B;  1F5T A;  1T0F C;  3BZ6 A;  3DLA A;  2UUE B;  1ZRE A;  4B7F A;  2JPB A;  4XLF A;  3TWL A;  4IJF A;  1XSV A;  2K9L A;  2DHR A;  2E1M C;  4ESJ A;  2VBX A;  4I4L A;  3LFU A;  2XPW A;  3V76 A;  1IV6 A;  2CRG A;  2BVM A;  3VSK A;  3T8T A;  3H4J A;  5ITY A;  2CJJ A;  2HKX A;  2TDX A;  5EZG A;  3CMY A;  1H28 B;  1UST A;  4PJL A;  5E8G A;  4UUS B;  3K9O A;  2Y0M A;  3E3V A;  4M74 A;  1VOL A;  2M60 A;  2OJE D;  4NRW A;  5JFR A;  3BTJ A;  1LE8 A;  3D5L A;  1Z6T A;  4J01 A;  1Q3B A;  4IPA A;  3R8F A;  1NO1 A;  1OTR A;  4AWX B;  1B8I A;  4I81 A;  3FXM A;  1E3P A;  4UVB A;  4LK1 F;  3HJ8 A;  1R58 A;  2FD5 A;  1X1D A;  4R71 A;  1F9N A;  3B6A A;  1DU0 A;  2MLK A;  3FUX A;  4FCV A;  1DGG A;  4KUM A;  3RSN A;  3K7A M;  2RNG A;  2DMN A;  3L9F A;  2XF6 A;  3QU3 A;  4RB1 A;  3FM3 A;  3P5J A;  1FEX A;  2JRT A;  1FOW A;  2KPM A;  1YJ9 I;  2VC1 A;  4C3J J;  4I98 B;  1IG7 A;  1UNH D;  4GH9 A;  3DCF A;  4M9S A;  4DUY M;  3CCY A;  1WGN A;  4DV1 M;  1SVO A;  2H5X A;  2RC4 A;  4BCM B;  4D9J A;  1SD6 A;  3HG9 A;  3DZD A;  4I5S A;  2UXD M;  4PSX A;  4JI3 M;  2V7F A;  4GC5 A;  5CKT A;  4ZYD A;  1K7A A;  5IZ7 D;  4DR4 M;  2KHM A;  4OVZ A;  1B1B A;  2BVL A;  2CW0 F;  3PO2 J;  1JKW A;  4HAM A;  3EUA A;  2K47 A;  1S72 I;  2UUA M;  1KYZ A;  5FFZ A;  1VEK A;  1WPK A;  2J5O A;  3F8C A;  1JJ6 C;  2HYJ A;  1IGN A;  4CFM B;  5CJ9 A;  3JSP A;  3JR5 A;  2XGE A;  4CCJ A;  2MRO B;  1JGS A;  5E1X A;  1ON2 A;  3JRG A;  4CYC A;  3GME A;  1P7I A;  2LKS A;  4L5I A;  4MQV A;  1KXU A;  3LQQ A;  1Q39 A;  3M4O J;  2O25 A;  2VKD A;  5E8I A;  1E2X A;  5FKM A;  1QQW A;  1GO5 A;  4LOC A;  1R9T J;  3A8O B;  4BCN B;  5ITT A;  5CVV A;  2VIX A;  5ED4 A;  4MGH A;  2E5L M;  4X1E A;  4FX4 A;  1Z6R A;  2XB5 A;  2DKL A;  5F64 A;  3A03 A;  4U0W A;  1IRZ A;  2WAQ A;  3HU3 A;  1P4X A;  3CQZ J;  3NRV A;  4UB8 C;  2D5V A;  2DAE A;  3ABL H;  2Z16 A;  3PUB A;  3RIR A;  3MAJ A;  2ZPE B;  4H4K C;  5E6J A;  1UGP B;  2QFZ A;  4ANJ A;  4CSW A;  3FXO A;  2HVS A;  3G33 B;  3HZJ A;  4A12 A;  1QU3 A;  4XKV A;  3A0H C;  4LJZ F;  2WIH B;  2BNK A;  3CUO A;  2FXA A;  2KIM A;  1BW6 A;  2X4H A;  1TC3 C;  5DCF A;  1MZB A;  3HTS B;  1XNR M;  3WTZ A;  4R3D A;  4UY8 I;  2L02 A;  3GFL A;  4MHG A;  1V3F A;  2PBI A;  1QDR A;  2AO9 A;  4BQA A;  5BPV A;  2L01 A;  2C5R A;  4F91 B;  3H3V K;  3IRR A;  4YEL A;  1OCR H;  3VWB A;  2MH2 A;  2DMQ A;  5AON A;  1Z5C A;  3JRA A;  2VKE A;  2ZXH A;  3DLL F;  1RES A;  3CUQ A;  4PFP A;  2W00 A;  2DYS H;  1ETO A;  2E7X A;  2FF4 A;  3HHW A;  1GV2 A;  3MJ5 A;  4CHT B;  3H0D A;  4YRV A;  1DGH B;  2BOL A;  4OX9 M;  2DN0 A;  5F6F A;  3OSF A;  4IRG A;  4U88 A;  2DAM A;  1ZGW A;  2RV8 A;  1ETW A;  1WJ5 A;  4NHJ A;  3S3O A;  3GLI A;  3J81 K;  2YU3 A;  2ZPH B;  4B8X A;  3GBG A;  5IYB J;  4XGI A;  4XQF A;  1Z0X A;  3I71 A;  2ZXW H;  3DU5 A;  4XN0 A;  3VKH A;  4QIW N;  1VQM I;  1SMY F;  1SFU A;  5EXT A;  3U6O A;  1NVM A;  4LF8 M;  3TNI B;  1J2X A;  5DDG A;  2K9Q A;  2JY8 A;  3CCS I;  2QSG X;  4PDI A;  4A0X A;  1L1T A;  4E7S A;  1A35 A;  5CVI A;  4DNC A;  1RR7 A;  1VND A;  1ETY A;  4YG2 F;  2LC2 A;  5FTN A;  4RF0 A;  2WA0 A;  4XLE A;  3K1J A;  3M7G A;  1FYM A;  1SAX A;  4QNR A;  4FM4 B;  1OPC A;  3DWL E;  2LP0 A;  2G0E A;  3WE3 A;  3F5X B;  2M5W A;  2ZNZ A;  2XGD A;  2VJI A;  2EK5 A;  1FLI A;  3KOZ E;  3LAJ A;  3SJM A;  3M07 A;  2DPU A;  4FQG A;  5CPR B;  5FLX K;  3GZN B;  2HQA A;  1YIT I;  2FX0 A;  2HQ5 A;  3RKY A;  4C2M J;  4XON A;  3DTK A;  1XS9 A;  1O3T A;  2OPF A;  2COM A;  3QOP A;  1YFH A;  4NSO B;  5L3G A;  2VAS A;  3QP6 A;  3JAM K;  4DR5 M;  4BNC A;  4BBS J;  5K7F A;  2K9D A;  1ZR2 A;  4LLN A;  4C30 A;  1A36 A;  4G3O A;  3U61 B;  1L2B A;  1HCR A;  3TW6 A;  4L78 A;  2XKP A;  2JZ0 A;  2HQN A;  3FTD A;  3FDY A;  4RGX A;  4IEJ A;  2EIJ H;  2O01 F;  3OYE A;  9ANT A;  3ZQI A;  1TQI A;  3JRF A;  5FKO A;  3MKW B;  1REP C;  1WRJ A;  3E6B A;  1R6B X;  5FRM A;  3HOV J;  1BI1 A;  1DUX C;  2DHY A;  1D5V A;  1U6G A;  2GIZ A;  5KAF C;  1Q1H A;  4G4N A;  3FTE A;  1D1B A;  4LK0 F;  2P5T A;  3LQR A;  1F5Q B;  3HHT B;  3HO8 A;  1KU9 A;  1E32 A;  4B7H A;  1AD6 A;  1YW7 A;  5J3L A;  3I55 I;  2AXL A;  3IRQ A;  2E71 A;  3CCR I;  2XAF A;  1JUP A;  1BI2 A;  2HU9 A;  3L2C A;  1IN5 A;  3GLF B;  4S05 A;  4LF7 M;  1J5E M;  3DPL C;  4DZP A;  1VIN A;  2N8G A;  1QZE A;  3HHY A;  2HYG D;  4HLX A;  4LMY A;  1R4N B;  3LFK A;  1HQC A;  2RVC A;  2R18 A;  3UMM A;  3GTP J;  2UUZ A;  2HTJ A;  5L3C A;  2V1N A;  3GRY A;  4M9X A;  1A6I A;  1YTY A;  3IH3 A;  4E7I A;  1LFB A;  4CCO A;  4GXO A;  2DQR A;  4AKH A;  3A42 A;  5IF1 B;  3T5X A;  3I54 A;  3BZC A;  4KFC A;  1ZLK A;  2ZCW A;  2HGC A;  3JTG A;  4BE1 A;  3KOX E;  3BLQ B;  4YOO A;  5LRR A;  1RR8 C;  2BXY A;  5GAH J;  3OYJ A;  2EA0 A;  3ZCO A;  4YFN F;  1WVR A;  2MGQ A;  4F93 B;  4MGR A;  3SZT A;  2XDV A;  2EKF A;  2LR8 A;  2KT0 A;  1NHG C;  2D1H A;  2H6C A;  4EJT A;  1J0R A;  4JQF A;  3AOE A;  4ZDO A;  5EF6 A;  5E18 F;  3F23 A;  3L09 A;  4ENM A;  3BC8 A;  5ITX E;  1VG5 A;  1L1Z A;  3K7A J;  4LRS A;  3LST A;  1RIO H;  3K69 A;  1GDT A;  4RKU F;  1KYI A;  1LDJ A;  5DNY A;  4DBQ A;  1GT0 C;  4HYE A;  4BU2 A;  1JTY A;  1YRN A;  4BL0 B;  2GWR A;  2E36 A;  5CQE A;  1ZG5 A;  2O8K A;  2V1D A;  4GFB A;  1H9G A;  1I6X A;  4C2T A;  5JR3 A;  2BWB A;  4LJ6 A;  1ON1 A;  4I6Z A;  4U0V A;  2K86 A;  2M8E A;  1SVL A;  5ERI A;  1VZ0 A;  4BXX J;  4U87 A;  3SAV A;  2HVQ A;  4F7L B;  3M8J A;  3SC3 A;  4XK4 A;  2WMB B;  2VQL A;  1Z21 A;  1X3W B;  7CAT A;  1ZLJ A;  3FUW A;  1OFI A;  1RKW A;  4EEF G;  3J27 B;  1HKQ A;  3RGF B;  4ELJ A;  2P5L C;  4BY1 J;  5JLW A;  4BDY A;  5F3W A;  1G41 A;  2P0W A;  3FXR A;  3A2K A;  4A3J J;  2BHZ A;  2DA1 A;  2OC6 A;  4NXN M;  2Z1D A;  3KZI C;  4XOT A;  4LF6 M;  1F1Z A;  2DJI A;  2L9R A;  2L9V A;  1OMI A;  5H6R A;  4NC7 A;  4IHV A;  1G71 A;  4UUT A;  3QYH B;  3E1S A;  4K0K M;  1OR7 C;  3F6V A;  4CFU B;  1MMD A;  3DKX A;  4OVZ B;  5HQ0 B;  4B4C A;  4KT0 F;  2KRC A;  4A93 J;  3C3D A;  3ABK H;  3B6C A;  5GP9 A;  1ZAR A;  3QYB A;  3SQN A;  3T8R A;  2Y9Z A;  2H8R A;  4BS9 A;  1TBX A;  2Q1Z B;  2DA2 A;  1XPX A;  2DLL A;  3OWT A;  1R5L A;  2DI3 A;  2WSE F;  2ID3 A;  3LW5 F;  2ZJR F;  1BN5 A;  2IS4 A;  4QNM A;  5B66 C;  1R49 A;  5IPA A;  2NVU B;  3HGG A;  4EC8 B;  3ABT A;  3PO3 S;  2R5Y A;  3K4L A;  1CF7 A;  3A8G B;  5IWA M;  3JRC A;  4A3K J;  3C3E A;  2UUC M;  1N78 A;  2JP7 A;  2CUF A;  1HLV A;  2K3F A;  2XFS A;  1T3T A;  3LA7 A;  4NB5 A;  3U61 A;  1D1A A;  3WHB A;  5LD2 C;  1HDD C;  3CCV I;  4B3R M;  3DL1 A;  4OGR B;  1U8R A;  1AIS B;  1DPU A;  2X85 A;  2X4A A;  4L8R C;  1ZR4 A;  2DTZ A;  2IA0 A;  4BQN A;  2V9P A;  3TGN A;  2FH0 A;  5ITX A;  3FK6 A;  4UVC A;  4XLP F;  3DA1 A;  3W3C A;  1ZYR F;  2DBB A;  3V7R A;  3JRH A;  4BHP A;  3F22 A;  3BPV A;  2XV4 S;  2KQR A;  2ZJQ F;  4YOS A;  1LE8 B;  1VQ6 I;  1WGX A;  3WU2 C;  1O3Q A;  4B09 A;  4DV4 M;  2LVO C;  2VOO A;  4KIT B;  1UM8 A;  3WOD F;  3HL2 A;  2H94 A;  1HW2 A;  1R1U A;  4Z2Y A;  5F0H A;  5DS9 A;  2KRK A;  1TTE A;  4RAG A;  5K7Z A;  3OYD A;  5A2Q K;  1BOA A;  2WJ9 A;  4CCN A;  1IBK M;  5C18 A;  3QU6 A;  2GXG A;  1ORY B;  4LJ4 A;  2EA2 A;  2FOW A;  2QEN A;  1OQY A;  4W5W A;  4TUW A;  2MH9 A;  2ZME B;  4KIS A;  2CMP A;  1W7P D;  2DWN A;  4ZYG A;  2P4W A;  1E94 E;  2I10 A;  2KDO A;  2PK2 A;  2KP6 A;  4BUP A;  1Z59 A;  1TZL A;  3CF6 E;  5E3O A;  1LV7 A;  3GLI B;  1Z67 A;  1VQ5 I;  1OKW B;  1OL2 B;  2OQ4 A;  3OYN A;  1O57 A;  3ONQ A;  1JKR C;  3OYA A;  1QMZ B;  3K2A A;  4HNU A;  1PP8 F;  3FKI J;  4P9F A;  3ULQ B;  2I40 B;  4Z8X A;  4HF0 A;  1B72 A;  3ZXS A;  4ENJ A;  1B9N A;  1Z91 A;  4B3T M;  4M3D A;  3AL0 C;  3UNG C;  4MTD A;  1R2Y A;  4D81 A;  3WTY C;  4D82 A;  5BQT A;  2BPM B;  1DGF A;  4IRI A;  2L9S A;  2HDD A;  1WJB A;  1XGS A;  2X51 A;  1X37 A;  2EWN A;  1JXS A;  2VLA A;  1TT5 B;  2IGN A;  4EON B;  4LF9 M;  4NQW B;  2F6C A;  3BR6 A;  3HKZ N;  4KIG A;  4B3X A;  3J7B A;  1JE8 A;  1R4G A;  2DEN A;  3A98 B;  1I1G A;  3F3X A;  3L2R A;  3NDQ A;  3EOC B;  1O4X A;  4CFV B;  4QHS A;  4RA2 A;  2R7U A;  4CFU D;  4EGZ A;  4KT5 C;  4ZYE A;  1BIB A;  5IY5 H;  3EYY A;  1VTN C;  3S1N J;  5DCM A;  4GIT A;  5KHD A;  1QHG A;  2W2H A;  1FBU A;  2M0M A;  4TV7 A;  3I4N J;  4M73 A;  1UHS A;  2P7V B;  3KP4 A;  1TT0 A;  1HT1 E;  4AZF A;  1UMQ A;  1HKS A;  3Q8G A;  4ZH4 F;  4KO8 A;  2O03 A;  3U9G A;  3CC2 I;  2CQN A;  1X2M A;  3WVE B;  3SAW A;  1TWG J;  2G5G X;  3QYE A;  4LGY A;  1KU3 A;  3BLH B;  2HZT A;  4FE7 A;  2M1B A;  2EFW A;  1AWC A;  1Y56 A;  1GJT A;  4ZZL A;  4BCK B;  4HV6 A;  1YSY A;  3LL7 A;  4IJA A;  4AI6 A;  4KIB A;  3AV0 A;  2L2D A;  2VE9 A;  2KDZ A;  3QAU A;  4BQO A;  4PGG A;  1B59 A;  1HC8 A;  5JI2 E;  1ZG1 A;  1WJA A;  5F27 A;  2STT A;  2R7Z J;  4CXF A;  1MSF C;  3CTW B;  2WV1 A;  4RLF A;  3H3Z A;  4XID A;  4CO8 A;  5EZH A;  1EIJ A;  4GGG A;  2W1O A;  4OW0 A;  3ILK A;  2A6H F;  4IOA F;  3K92 A;  2CRU A;  2DOD A;  1J7K A;  1JT6 A;  1T56 A;  2P6S A;  4RDU A;  1SFK A;  2QEX I;  4PSW A;  5ICG A;  3ZGK A;  3JRB A;  3GZ5 A;  1QPM A;  1NY6 A;  4BDZ A;  1FMW A;  4LFC M;  2HCB A;  4D5F A;  2DMP A;  3PNV A;  2ID6 A;  1GXQ A;  2Z2S B;  4AVP A;  5DV5 A;  1OAO C;  1TP4 A;  5LGU A;  1TL8 A;  1UNG D;  3DQV C;  4G6Z A;  4BYY A;  3HDD A;  2JT1 A;  1P9Q C;  4I0B A;  3S14 J;  1IAW A;  5EXS A;  1NHW C;  2W48 A;  3MD2 A;  2F2E A;  2GQQ A;  4M6V A;  4ENN A;  4DBR A;  1DGH A;  3V7C A;  3GQ5 A;  1WHC A;  5FSW A;  1X1P A;  1PJS A;  3CDL A;  4AID A;  2ZME C;  2QPA A;  2NOJ B;  1Z3Y A;  3J7Z I;  3CZ6 A;  2NOG A;  2XAG A;  3FKE A;  3UR3 C;  2EJS A;  4M0D A;  3I51 A;  2BGC A;  2J5P A;  3AKZ A;  2ZXI A;  4LGW A;  4BCP B;  3OR2 C;  4JI6 M;  2YX4 A;  2M87 A;  4M3E A;  2DA4 A;  1QZM A;  4IX7 A;  1VEJ A;  3ABU A;  4Z6Y A;  3IWF A;  4IO9 F;  4F6S B;  3H5R A;  4PCZ A;  2ZFW A;  2AQE A;  4DJA A;  3X26 B;  4ZJZ A;  4F92 B;  1EF4 A;  2WXV B;  2A5W A;  3IG8 A;  3ERE D;  5D8K B;  4BY7 J;  1H8A C;  2XGN A;  4LLL A;  1RUN A;  2E5Z A;  3E9S A;  2Y0S A;  4BJ6 C;  5LGN A;  4HZF A;  4OOI A;  1B8I B;  4F6U B;  1SXJ B;  5IRE B;  1PJI A;  2E1C A;  2JVG A;  4HV5 A;  4FCW A;  3GTM J;  3QP5 A;  2C5X B;  3UK6 A;  1OKR A;  4LIU A;  5GPA A;  1E7P A;  4BEH B;  4PD2 A;  5BR8 M;  2KRU A;  1YRN B;  3D8L A;  4F6W B;  3MZ8 A;  2BYV E;  2KZG A;  2KW0 A;  1OIP A;  2W4S A;  2R93 J;  3MCZ A;  1XDU A;  4A6E A;  4ZPX A;  2ISZ A;  2DA5 A;  3CME I;  4WX9 A;  2BY2 A;  4OMZ A;  3GW2 A;  3EIE A;  3OYG A;  1SFX A;  3VPR A;  5LHH A;  5E3M A;  4PDG A;  3FK7 A;  1BC8 C;  1QAN A;  2L2O A;  2Y75 A;  3IH4 A;  4EM1 A;  2DXB B;  4EJU A;  3MWM A;  4LCB A;  1XGN A;  3SYL A;  1GVN A;  1FYL A;  1PDN C;  3B7Q A;  4DZJ A;  3KP5 A;  4CIS A;  2QA4 I;  1FWZ A;  2FE8 A;  3A46 A;  2R65 A;  4ASN A;  3CCU I;  1F36 A;  2HWJ A;  1D5Y A;  5D6F A;  2Y9Y A;  1YS7 A;  3K1M A;  4R1H A;  4BBR M;  2VXD A;  3SDG A;  1WZ2 A;  1G3Y A;  1KYW A;  3G2B A;  2RQP A;  2B9R A;  2RN7 A;  3GF2 A;  3DBR B;  3WHC A;  1H88 C;  3CD6 I;  3HSE A;  2XIG A;  4JI2 M;  3ZPL A;  1PYV A;  5D4R A;  4GHL A;  3NBI A;  2XZF A;  2JWT A;  3U1K A;  2GM4 A;  1J9I A;  1TNT A;  3VYU B;  1W98 B;  5C1B A;  3Q0V A;  5DD4 A;  2E60 A;  2RAE A;  4FWD A;  2AQF A;  2ADU A;  4ZZD A;  3KYL A;  3GUD A;  1WJD A;  2NXN B;  3J80 S;  2UV1 A;  3C2G A;  2IW5 A;  4KN4 X;  1D0Y A;  2DTR A;  4JI7 M;  5CVR A;  1U8B A;  2Z33 A;  3POM A;  5IDN B;  2JN6 A;  2A3S A;  2KIQ A;  2EKK A;  4OAY A;  1PP7 U;  1EFU B;  1OI9 B;  1LJ9 A;  3BJO A;  4IQ4 A;  3HJE A;  4FX0 A;  4QPQ A;  1V55 H;  2EIK H;  2MG4 A;  5J1R A;  1HQY E;  4MM3 B;  1IFY A;  2JMW A;  5IT9 S;  2QM3 A;  4JOM A;  5B5E C;  2JA2 A;  2R7F A;  4CIC A;  2QNJ A;  1ETV A;  5FLX S;  1YIO A;  4KIF A;  4F70 B;  1LFP A;  3LSP A;  1QUS A;  3LOC A;  4HQM A;  3GO8 A;  4B1R A;  2D0Q B;  3TO7 A;  5F08 A;  1DU6 A;  3MZH A;  2WWY A;  3JAM S;  1FIA A;  4EAT A;  1O3S A;  3SZP A;  2C99 A;  4LJ7 A;  2XEP A;  3BTI A;  2KZS A;  2BY1 A;  2JRM A;  4IOC F;  3E5Q A;  1H24 B;  2JK3 A;  2QZ8 A;  2LY9 A;  2FNP A;  4BXF A;  2P7C B;  4HDU A;  1FSE A;  2JUC A;  2UUB M;  1K78 A;  4NRV A;  3COA C;  3AAF A;  3ISP A;  5EP1 A;  3BQY A;  4JBA A;  2JZ1 A;  1IRF A;  2HXO A;  3FHZ A;  3IP4 B;  1BU2 A;  4LB5 A;  3FIW A;  3GVA A;  3GCM A;  1DO0 A;  1JST B;  3U60 B;  2ZPF B;  5HOD A;  4FIS A;  5E3N A;  3DXJ F;  4V2G A;  4XRF A;  2BW3 A;  1S8N A;  4BJ5 C;  2W7N A;  1TF0 B;  1S3J A;  3QPT A;  3MQ0 A;  5TRD A;  5HBJ B;  5KVR A;  4HA8 A;  3K4K A;  3RKX A;  2XAQ A;  2DOE A;  4JX4 A;  3KS4 A;  5ILS A;  2QQ8 A;  3REO A;  4ETS A;  1FOX A;  1XSD A;  5FLV A;  2V9K A;  4NC8 A;  4NUB A;  4XL9 A;  3BR5 A;  2FRH A;  1TW3 A;  3PNT A;  5EEG A;  3OYL A;  1Q1V A;  2BJW A;  1TDZ A;  3HXL A;  1OYY A;  2KKO A;  2QSH X;  1WSU A;  4EOP B;  2W25 A;  3HGI A;  4DQ2 A;  4LLG F;  3L26 A;  3ABM H;  1S29 A;  3BCA A;  3ZMT A;  4YFK F;  2CZ1 B;  5FKN A;  3ERM A;  2CHV A;  4DR7 M;  4CRL B;  2QBY A;  2C9C A;  4OIR F;  3L2U A;  1QRY A;  2EIN H;  1RRJ A;  2M7B A;  1NV8 A;  1KGS A;  2XSZ D;  2QSF X;  4UN2 B;  4D80 A;  1N32 M;  3ZQF A;  2DZO B;  2KRH A;  3NWS A;  3P9K A;  3RTR A;  4L18 B;  1IUF A;  2M4G A;  3I53 A;  1R1T A;  1S3S A;  1OFH A;  3H1C A;  5FGM A;  3SDB A;  4G9Y A;  1TR8 A;  2LHG A;  3V42 A;  1VQ7 I;  2QZ4 A;  2B63 J;  4GCV A;  1TWC J;  2ICW G;  5H2F C;  1APL C;  1RZ4 A;  3R60 A;  4NBQ A;  3TP3 A;  3ML6 A;  5HLG A;  5M5W J;  5CYI B;  3DBH B;  3HOW J;  4F52 A;  5FD5 A;  3BG6 A;  4L9T A;  2Z4S A;  1SVM A;  1FP2 A;  1LFU P;  2F2C A;  4WCG A;  1R71 A;  3PJR A;  5H37 D;  2DA7 A;  4EMS A;  3AFH A;  2HDC A;  3JCU C;  4GIP A;  2OCE A;  1T33 A;  4L5J A;  3DPU A;  4A3G J;  1MW7 A;  3M1C A;  3F21 A;  1ZMV A;  2KA6 B;  1X19 A;  2DOF A;  4BKX A;  4PDK A;  4RGU A;  2DFE A;  4F55 A;  3IV5 A;  3M6A A;  4KOD A;  2V22 B;  1ORK A;  5HBH B;  3M8F A;  1ZV1 A;  2F5D A;  5DQW A;  2CCH B;  3IKT A;  1GVJ A;  2YNM D;  2JY7 A;  3M8E A;  2K5C A;  2F5V A;  2EZL A;  1U9O A;  1Y1W J;  4A0Y A;  4EQQ A;  1ETQ A;  2ZSH B;  5EGO B;  1MBF A;  1S7A A;  3X24 B;  4ITV A;  2NNY A;  1WCM J;  2IP2 A;  1P7J A;  5ICC A;  1FKM A;  4EOR B;  3AG3 H;  5DM6 F;  2QWW A;  2YU9 J;  3J80 Z;  3BOS A;  2JY6 B;  5IHY A;  2K9S A;  2OD5 A;  2DT7 B;  3LSK A;  2R44 A;  1EH6 A;  1SXJ A;  3ASN H;  4NDL A;  3M9A A;  1IY1 A;  3OIQ A;  3G1O A;  2BEO A;  1M1E B;  2X6W A;  2M8G X;  2PMZ A;  1UFZ A;  2VT2 A;  4YC3 B;  4HEA 2;  2KDL A;  3PVS A;  2HQR A;  1MMG A;  4M3B A;  2GAU A;  4LJ5 A;  3OIO A;  2Q8K A;  2L7H A;  3C3W A;  3A01 B;  4IVN A;  3WGG A;  1XN7 A;  3FXQ A;  4DUZ M;  3K9P A;  2ZAN A;  3VK7 A;  2OU2 A;  4L9J A;  2O5R A;  4L6V 6;  3KIO A;  3Q5F A;  3EJ1 B;  3FUT A;  2EFO A;  3T15 A;  2PJR A;  3MY1 B;  3OYH A;  2FUG 2;  2AHM A;  2ZJ2 A;  1FOY A;  2CP8 A;  3KXE C;  1SAN A;  4D7M A;  2YPR A;  4DIQ A;  4CGY B;  2KHH A;  3KP6 A;  1JSU B;  1V54 H;  2KJC A;  1W0T A;  2R7T A;  4FTH A;  2C4G B;  1PJJ A;  1HST A;  2R92 J;  2Y48 A;  3UJN A;  1QYR A;  2JUG A;  4IIW A;  2NS7 A;  3S93 A;  2W84 A;  3QHW B;  1ITY A;  1YE9 A;  3SAS A;  1QHH D;  2DPD A;  1O9K A;  1SFE A;  1PKD B;  2ELH A;  1S6L A;  5JI3 E;  2GOM A;  4MO7 A;  2NVX J;  5EQT A;  3TNH B;  5EP4 A;  3U6M A;  3L7W A;  4E7K A;  1LUJ B;  2XF5 A;  2PQ8 A;  2Q2E B;  1G3T A;  3PXG A;  4Y15 A;  3E6M A;  3FWE A;  4DR3 M;  3GPP A;  1Z7L A;  5IP7 J;  2XRL A;  5L3B A;  4KA4 A;  3E97 A;  4LFU A;  2WMA B;  2X6X A;  3HJS A;  3Q0W A;  3ELK A;  3PUF A;  4AKI A;  3SBJ A;  3PL8 A;  4RF1 A;  3MHV C;  1NJG A;  4X62 M;  1ETK A;  1XMO M;  3E5X A;  1H1P B;  1TGU A;  2YFQ A;  4M72 A;  4MQ9 F;  1MN3 A;  3BHT B;  1T39 A;  3B57 A;  5M5Y J;  3U6C A;  2IJL A;  3VK8 A;  2FOI C;  1H4L D;  4DV7 M;  1L8Q A;  3GRV A;  1ZMU A;  3HC7 A;  1H6U A;  1G8P A;  1LTM A;  1KU2 A;  2LDU A;  3A45 A;  2FBH A;  4OWR B;  3AG2 H;  2IGO A;  1FTZ A;  3QYG B;  1USS A;  3GXO A;  3L25 A;  2N35 A;  3HRT A;  1CGP A;  1Y8R B;  1TWF J;  3CES A;  4JK1 X;  2CE7 A;  4UVA A;  3HWS A;  2DD4 B;  4U0Y A;  3LSR A;  3L00 A;  2F48 A;  5JI6 A;  2CUJ A;  4AYB N;  3GQ4 A;  4AW4 A;  4RAF A;  1U5T B;  1R23 A;  4BXU A;  5C4J J;  2JVH A;  2EV0 A;  2ZBK B;  3W6K B;  5F04 A;  3PNY A;  2QYO A;  3FXK A;  1POG A;  1N34 M;  2H8W A;  1TFB A;  2M45 A;  5EDN A;  1R36 A;  3GEZ A;  4HX4 A;  5J1U A;  1NV9 A;  1YJN I;  4HG2 A;  1L2D A;  3PSF A;  4MGI E;  3VOD A;  1BJA A;  2R45 A;  2IEK A;  1MH3 A;  2NVQ J;  3HOX J;  3FMQ A;  1W0U A;  1XX5 A;  1AU7 A;  1H0M A;  4R7G A;  1T38 A;  4OMY A;  4BCJ B;  3CJR B;  4ZTF A;  3HHH A;  3QQA A;  4IJE A;  3RFW A;  3AG4 H;  4BHC A;  4NQW A;  4F2L A;  2MJ5 B;  2K3P A;  3IL2 A;  1X3Z B;  3BTL A;  2LXE A;  4FVM A;  5FTL A;  2ACJ A;  3BR0 A;  4IHX A;  1V5E A;  1WJE A;  1IQP A;  3O8G A;  2DD5 B;  3G71 I;  3FBN B;  5E1Z B;  2W85 A;  2WAD A;  4LGM A;  4ROD A;  3SFZ A;  4FWG A;  4UV9 A;  2DMT A;  2AXT C;  2ECB A;  2EZH A;  1KFV A;  2EJR A;  2NYX A;  2VQH A;  4HOB A;  1FIP A;  3KEY A;  4MEY F;  3GLF E;  3T0Y A;  4IHS A;  3MI9 B;  3W2A A;  4EVI A;  1E17 A;  2HKJ A;  3VYS B;  1SG9 A;  1P3Q Q;  4G4Q A;  2ZPI B;  1JT0 A;  5KQ8 A;  3GPX A;  4N9H A;  4YIR X;  3DOG B;  4Y33 A;  4HQE A;  3GZ6 A;  2EUF A;  4ABZ A;  1OIS A;  4F7Z A;  4P1W A;  2HYF A;  1K79 A;  1VQ8 I;  4R8H A;  1OGU B;  3W0L B;  5J1Y A;  3QWL A;  1V29 B;  3D0S A;  2FOK A;  4X6A J;  2EPF A;  1E3H A;  5D5X B;  4KHP M;  4OB1 B;  5CEI B;  1PM5 A;  1LKX A;  4XLA A;  3DU6 A;  3C1D A;  3U6L A;  1TTY A;  2KLO A;  2JNH A;  4A3C J;  2CJM B;  3DFG A;  4XIC A;  1RNL A;  3OYM A;  3HOS A;  1D0X A;  3PSI A;  1MU5 A;  3K70 C;  2MFZ A;  2VC0 A;  1GUX A;  3DTO A;  1X3U A;  4BB9 A;  4GYG A;  2KIS A;  5BMZ A;  1P92 A;  4Q5S F;  3OYC A;  1FYK A;  4QWQ A;  1Y8G A;  2ZM6 M;  2CEA A;  2IXS A;  3ZQJ A;  2Y31 A;  4YII A;  3CTA A;  4RM3 A;  5J47 A;  3ZH9 B;  4MB7 A;  2ZAO A;  3OOP A;  2HOS A;  2L3D A;  1T08 B;  3F72 A;  4EV0 A;  2UZD B;  3V8L A;  1S5L C;  1PUF B;  4X64 M;  1ZRD A;  3W0F A;  3K4J A;  3VDU A;  2CWB A;  2DPP B;  1YX5 A;  3R0J A;  5LHI A;  1GUX B;  1XNQ M;  3B9P A;  4I76 A;  1R5I D;  1KQ9 A;  2HTS A;  3SEZ A;  1LEB A;  1QZZ A;  2L4F A;  4OAZ A;  2E1N A;  5C3E J;  1P2F A;  4II3 A;  3L2Q A;  4CZZ A;  2E7W A;  1K6Y A;  4XN3 A;  1ZRF A;  5FTJ A;  1VF9 A;  2R7X A;  1XXH E;  5HS9 A;  1BM9 A;  3SYT A;  5JHF A;  1MJA A;  2KZU A;  5KCM A;  5EEA A;  4HBL A;  1K82 A;  1WI3 A;  2CCI B;  2LBC A;  2KFD A;  4MLO A;  1XD7 A;  5HDK A;  4CGZ A;  1R6R A;  1Y8Q B;  5DFL A;  2E5N A;  2MD5 A;  4HSR A;  1FNN A;  3FF5 A;  3EYI A;  3OS1 A;  1T6O A;  2A68 F;  4IBG A;  2J7N A;  1ZGA A;  2VQC A;  4K2E A;  4JI0 M;  4QOS A;  3KLN A;  2E1O A;  2VQE M;  2FU4 A;  2BJV A;  1T98 A;  5KNL A;  4EJV A;  3CO6 C;  1MDM A;  5EG0 A;  4EOK B;  5ICF A;  4LRT A;  2VBY A;  1STZ A;  2ME6 A;  2HOA A;  3BBZ A;  4L0Z B;  1RPW A;  3UGJ A;  1JKP C;  3QPL A;  3MK6 A;  2Z7J A;  3R0A A;  4HPQ A;  4AG6 A;  4Y4R A;  1OCO H;  5LRS A;  4IKF A;  4G4O A;  4D0P A;  3U6D A;  3HB9 A;  4ELL A;  5ITU A;  2WB1 N;  2G3Q A;  3H4M A;  2KJB A;  2VBW A;  3K9T A;  3TE6 A;  3H9J A;  2KMG A;  1QDT A;  1DV0 A;  2X1E A;  2E34 A;  1EJ9 A;  1MGT A;  2YS9 A;  3U5Z A;  1D1C A;  3KSJ A;  1IO2 A;  3RYP A;  4EOS B;  1HW1 A;  1D0K A;  3CLQ A;  1NTC A;  1I27 A;  4ESB A;  1E9R A;  2K85 A;  5J40 A;  2R5Z B;  3IKV A;  2R62 A;  1LVA A;  3DKY A;  3EUK L;  4XKC A;  5ITQ A;  5LMN M;  3B7N A;  1ZK8 A;  2CQK A;  2LBF B;  1UFM A;  1SEU A;  1DQU A;  4BY1 X;  3W2V A;  2CW8 A;  1VQL I;  3OV8 A;  1CQT A;  5L3F A;  2BHY A;  3FXL A;  3K0L A;  3CCL I;  4DBG B;  3E4R A;  4Q7J A;  3L27 A;  3LSI A;  2HOE A;  5F1R A;  1O3R A;  3VLF B;  4UNO A;  2UXB M;  3RCO A;  4A3F J;  1D3U B;  4HL4 A;  2DO7 A;  4II2 A;  1IN8 A;  4BJT A;  1Y1V J;  1LNW A;  2JUJ A;  5LQF B;  4IF4 A;  4XKB A;  5DYM A;  1NG7 A;  4HF2 A;  4EOJ B;  3HU1 A;  3KP1 E;  2ELJ A;  5K1Y A;  4II7 A;  5F0C A;  2V6Z M;  2L7M P;  3EID B;  2LVA A;  1TNS A;  3DEE A;  2R7W A;  2LBF A;  3THG A;  1XO2 A;  3CF0 A;  1TWA J;  5ILU A;  2JA6 J;  2XAH A;  3V8K A;  1B4A A;  5M3F J;  1HXD A;  5ACB A;  5DCM B;  2IA1 A;  2G77 A;  1FJL A;  2XSZ A;  1WI9 A;  4QSH A;  2P5K A;  2H1R A;  3M0E A;  1OCC H;  3KP0 E;  3FX3 A;  5D6E A;  1LB2 A;  2IRF G;  1DP3 A;  2OV7 A;  3I04 M;  3NWT A;  1YQA A;  2QUF A;  4MH0 E;  3KFU G;  2VB6 A;  4PJJ A;  3S32 A;  5HLI A;  3K6G A;  4QTR A;  3OOU A;  4B3M M;  4I8O A;  3E5U A;  1L2C A;  4IRH A;  2R0Q C;  4FCY A;  2AHQ A;  3FD9 A;  3J7A S;  4PGH A;  2OPT A;  4U7B A;  1GL7 A;  4G4R A;  3MEX A;  2GLO A;  1MJG M;  2WY8 Q;  2I5U A;  2P8T A;  3W6J B;  4E7Z A;  4MGY E;  3K70 D;  3RZD J;  4A3D J;  1XCV A;  5IT9 K;  3EUH C;  3GLF A;  2F4I A;  2Y69 H;  3KSX A;  1VQP I;  2I7N A;  2F5F A;  2VT3 A;  2OO9 A;  2LKP A;  4DV3 M;  1JKO C;  2LVQ D;  3SAU A;  4IXA A;  3OYK A;  3HUG B;  4I3Z B;  1KU7 A;  2CFX A;  4GKJ M;  1G4D A;  1QPI A;  2KIF A;  3ECH A;  1ZQ9 A;  4YOZ A;  3FMS A;  2PJR B;  3CJT B;  4BAC A;  1FX7 A;  1JI8 A;  2LW4 A;  1A5J A;  3L29 A;  2NVT J;  4IHW A;  2ZNY A;  2QDY B;  1XGM A;  1BIA A;  1G59 A;  2XB0 X;  2WV0 A;  4HEO A;  3KFW X;  1HA8 A;  3HEF A;  2VDB B;  3H36 A;  2XPV A;  2RQQ A;  3JRD A;  5KO3 A;  1HNZ M;  2RGV A;  3LVV A;  3O0G D;  1AKH B;  2QHO B;  5KK1 A;  1MDM B;  4M3G A;  3WG9 A;  3I4Y A;  1D0Z A;  1IDZ A;  2HR3 A;  1TLH B;  2DT6 A;  5DYI A;  4I7H A;  1F43 A;  1Z7U A;  2WY7 Q;  1X1B A;  3F0C A;  1XSX A;  3KYC B;  1MMS A;  2ZZD B;  4KRC B;  4X0G A;  4GC9 A;  4I99 C;  4FX3 B;  2FNA A;  4FET A;  3CMA I;  3KZY A;  2PI0 A;  4G7O F;  2XZU A;  3RPQ A;  4DW6 A;  4CFN B;  1BR2 A;  2R3S A;  1E9H B;  1QUT A;  2QP9 X;  5D4S A;  2R5Y B;  3SAR A;  2BBY A;  3BOQ A;  5LHG A;  2LF7 A;  2DAI A;  2W57 A;  3BWG A;  2PHG A;  3WGI A;  4M3F A;  2R7O A;  2JA5 J;  3TBI A;  4HX8 A;  3GLL A;  3LAP A;  2OTL I;  4ZGD B;  4IBC A;  4DV0 M;  1H89 C;  1OIY B;  1PVE A;  4IBF A;  5CQG A;  2PN6 A;  1QO0 D;  2LNH C;  2BWE A;  3S1Q J;  4ESF A;  2QF7 A;  2O9L A;  2WIP B;  1VQ9 I;  4M6Y A;  2FML A;  4DR2 M;  3A8H B;  1TQP A;  4MIM A;  4XSZ F;  4L15 A;  1YLF A;  4O6J A;  1DP7 P;  3G4S I;  2V9V A;  4UUS A;  2R7R A;  1GKI A;  3PQK A;  2ZCF B;  1RI7 A;  3KOW E;  2DDA A;  2BS2 A;  5E17 F;  1XCB A;  2VJ4 A;  1I50 J;  2CHG A;  2LVS A;  3EQL F;  4U7D A;  2A69 F;  1K4S A;  1SXJ C;  1YG2 A;  2PMH A;  1IUY A;  1H25 B;  2PMZ N;  2PMI B;  1JQJ C;  4FT8 A;  1J59 A;  1MBJ A;  2D7G A;  2UXN A;  2Z99 A;  5EYR A;  3ZN1 A;  4Q4Z F;  1W5S A;  2QBY B;  3KS8 A;  2CUE A;  4LZJ A;  3I9V 2;  4B7G A;  4WXD A;  5BS6 A;  4I01 A;  4JYA M;  1ZEL A;  2P81 A;  4PZJ A;  1H1Q B;  4ITQ A;  5GKN A;  5HS7 A;  2HKO A;  1V5F A;  5JHU A;  1IJW C;  3RZO J;  4CUG A;  2R4J A;  3PIP F;  1OYI A;  2DK5 A;  2GOX B;  4XLC A;  1WH5 A;  4W1U A;  1YI2 I;  1XHB A;  4OIP F;  1R7J A;  5HNB B;  4RAZ A;  5J4Y A;  1VQK I;  2VE8 A;  1J09 A;  2D1V A;  3HYI A;  3BLR B;  1DDN A;  2C5V B;  1GY3 B;  4BAY A;  3I56 I;  2WEV B;  2ZBK A;  3I58 A;  3H0G J;  1XMA A;  5IYC J;  3DKW A;  3S1R J;  3ESW B;  4GRI A;  2OOA A;  1Z05 A;  4CCM A;  3L28 A;  1FBS A;  2OA4 A;  1GAB A;  4DV6 M;  2OBP A;  5GAD J;  4OB0 B;  2F5Q A;  4BE0 A;  1IC8 A;  2R7G A;  3TOB A;  1W7P A;  4XNF A;  3QPH A;  4E6K G;  1SXJ D;  2LWX A;  1W4M A;  2EZI A;  1HSJ A;  3BG3 A;  2E1M B;  1QAM A;  2FBK A;  3IAM 2;  4EM2 A;  1QQI A;  3J7Y J;  4L4U A;  4LIT A;  4G94 A;  3WGH A;  3TL4 X;  1N36 M;  2IA2 A;  2M34 A;  4IQJ A;  5DYG A;  1FMV A;  4CCK A;  2CV0 A;  2DXI A;  1BR4 A;  3ZMS A;  4HX7 A;  2OUM A;  5M5X J;  4CFX B;  3M03 A;  3TPZ A;  1QAQ A;  4M0W A;  3V8J A;  1MNE A;  4DR6 M;  3PQJ A;  4E7L A;  3CCE I;  5B3S H;  3G6E I;  2M7A A;  2WAE A;  3FYD A;  5IP9 J;  2L6O A;  4FWH A;  3T1B A;  3TDU C;  4KT6 A;  1IY0 A;  2XAU A;  2WB1 A;  2MC4 A;  3CMM A;  3P7N A;  5IYD J;  3KVW A;  2K7L A;  3HKZ A;  5HLH A;  2Z3Y A;  4I0A A;  3WTS C;  2F5S A;  2LTU A;  2Q2E A;  1KA8 A;  2L4E A;  2KZV A;  3FRI A;  2R4G A;  3SFI A;  5HDG A;  3DFZ A;  4JI4 M;  3EUH A;  3KPH A;  4RAY A;  3BZK A;  2CQQ A;  4TTH A;  4CJ6 A;  3FUU A;  1X1A A;  2JJ7 A;  2Z5U A;  3RPU A;  5FLM J;  1GHC A;  1MMN A;  1WJF A;  1V4R A;  4B08 A;  1ULY A;  4PCQ A;  4AG5 A;  4X65 M;  3TMO A;  3WE2 A;  3ZQG A;  4D7N A;  2ZTC A;  4XK8 F;  3X25 B;  4GYI A;  3TKY A;  2CFO A;  1GJS A;  2FEZ A;  2M4K A;  4G6D A;  4KNY A;  3I59 B;  3R9X B;  5L3E A;  5F0F A;  1K6O A;  4KJZ A;  2DA3 A;  4NST B;  1LQ1 A;  1G3W A;  1OR7 A;  1NNU C;  3DTE A;  4P16 A;  5LMU M;  4DR1 M;  3VDX A;  3NQO A;  5FB2 A;  1ERD A;  1EH7 A;  1P4A A;  3LSH A;  1UGR B;  3DBL B;  3EPZ A;  1NSF A;  2VF8 A;  4E70 A;  5K7H A;  5ITR A;  1ZHF A;  1VEG A;  1UEL B;  4L9N A;  4HNV A;  1ZAE A;  2HI3 A;  1VDL A;  3K1N A;  2WSC F;  3U6P A;  3C2B A;  5J8C A;  3L1P A;  3FTC A;  2ERC A;  5KPT A;  2M2E A;  2MW8 A;  2OQR A;  4G12 A;  4EJW A;  5HNF A;  2B3T A;  4EOO B;  3H3U A;  2PMU A;  2DT5 A;  1DGR M;  4Y7N J;  3CUQ B;  1F4I A;  3B73 A;  2VQG A;  3B7Z A;  3RJP A;  1C1K A;  1PRB A;  1MD0 A;  1HKT A;  1IN6 A;  4C3H J;  4F7J B;  4GEW A;  3OTO M;  1AHJ B;  4BGD A;  2XAJ A;  1XWI A;  4XLN F;  3OSG A;  2PJQ A;  2YUS A;  4N9I A;  5CYV A;  1LPQ A;  3X28 B;  2UZK A;  2IT0 A;  2WHB B;  1XB2 B;  1HBX G;  4XRS A;  3NAU A;  3HOZ J;  3WU0 A;  1X4P A;  3H35 A;  1T0F A;  4ZC3 A;  2VN2 A;  3F8N A;  3GTG J;  3GTO J;  1N25 A;  5GAE J;  2RKH A;  4IMY B;  3FUV A;  2JZY A;  3PM1 A;  3FIS A;  3S3N A;  2C5O B;  3CGW A;  2DI0 A;  1EKE A;  2G7H A;  3BTC A;  4F7S B;  1XXH B;  2QQB A;  4A0Z A;  5F1J A;  3CC4 I;  3CJQ B;  3GLG B;  4CH7 A;  2BXZ A;  3S2H J;  5IT9 Z;  1FSH A;  2CGP A;  2C5N B;  2KNA A;  2WPA B;  1NK3 P;  2DAK A;  1QZY A;  3GTL J;  1N77 A;  3M3Y J;  2IW9 B;  1IZ1 A;  2EH3 A;  2IAI A;  5A2Q Z;  1T8I A;  3L2V A;  1VQO I;  2KNZ A;  3ASO H;  3SXY A;  4CYC B;  2JGZ B;  1R00 A;  1W5C C;  3IUO A;  4RB0 A;  5L3D A;  4B3S M;  2MAB A;  3ZQ7 A;  4BCN D;  2ESH A;  2WC2 A;  2OOB A;  1S7O A;  2M9H A;  4BQQ A;  5D5U B;  1AIP C;  2L0K A;  4WF2 A;  3W2W A;  3GFI A;  1IRE B;  2Z4R A;  6PAX A;  3GRR A;  1TH2 A;  2IW8 B;  2DA6 A;  4M71 A;  3AOG A;  4KYW A;  4OU7 A;  3RGP A;  1MBH A;  1SAU A;  4S04 A;  4BBR J;  3J80 K;  5BOX A;  2VON A;  2O0Y A;  3ZMZ A;  1HT2 E;  4PK4 A;  1YS6 A;  1FJG M;  1N33 M;  2X6O A;  2QKL B;  3FMR A;  1ZH5 A;  3GPU A;  1DGW Y;  2LLK A;  3SEQ A;  2R6F A;  3JRI A;  1UG2 A;  1DO2 A;  3FXU A;  3HM5 A;  4RS8 A;  2L5Q A;  4JI1 M;  2LF8 A;  3O3K A;  4J00 A;  1G3N C;  2BZT A;  5DM7 F;  2Y0Q A;  4BLC A;  1IM2 A;  3GFM A;  2EZK A;  3CLO A;  4AYB A;  1G6N A;  2DWL A;  1U3E M;  4BHB A;  3WTV C;  1QVU A;  4E4H A;  2MGW A;  3HSR A;  4A3B J;  1D8J A;  2HVR A;  4LJA A;  1QAO A;  3ZN0 A;  3OS0 A;  2X8A A;  4EOL B;  4L16 A;  4IHY A;  3IAS 2;  3MFK A;  2JY5 A;  3KE2 A;  2QKM B;  2NAZ A;  3A8M B;  2LRD A;  4P5O A;  2VUM J;  1G8X A;  2O6G E;  3V4G A;  1RET A;  2LY1 A;  2CSO A;  4LG0 B;  3DEU A;  4CZC A;  3GWZ A;  1K61 A;  3WTW C;  3VEP A;  3RE8 A;  1XTA A;  3BHV B;  5FKK A;  3OY9 A;  3GPY A;  2LVN C;  3K4M A;  1OIU B;  1TH4 A;  1ZG3 A;  3C18 A;  1X4O A;  3VYT B;  1OJL A;  5J4V A;  3R4K A;  2KNV A;  2JA8 J;  1PGY A;  2DFH A;  3MKL A;  4NSR A;  3QAH A;  2QGS A;  1G4A E;  4L9V A;  3ZC7 B;  1TWH J;  1VI0 A;  4DV5 M;  1C7Y A;  2JWS A;  1RC9 A;  2XGC A;  3NBX X;  5GAG J;  2D45 A;  4XOP A;  3R6S A;  2JA7 J;  1UGQ B;  4PFO A;  3I64 A;  3P9C A;  1XG1 A;  1I5Z A;  2V6E A;  3LCV B;  4DOZ A;  3CO7 C;  1K78 B;  3O6B B;  2IBD A;  1HW5 A;  3HSF A;  2DU9 A;  3WTX C;  4ZTJ A;  3KP3 A;  1T95 A;  2HEO A;  2G9W A;  4BCQ B;  4P96 A;  1QVR A;  2L9N A;  2EUC A;  5H20 A;  4AKG A;  3F9K A;  2IVM A;  1OCT C;  2H6B A;  2VJJ A;  3CUQ C;  4RGR A;  4G6T B;  4F3Q A;  2Y20 A;  4A3L J;  1J75 A;  4I09 A;  1HR0 M;  2EV5 A;  3R61 A;  2G8L A;  2HHH M;  3OYI A;  2LKX A;  2LOO A;  2FMY A;  4XRS G;  3BLY A;  3BCB A;  2HWV A;  2ZXJ A;  2K4B A;  4LY6 A;  1XXH A;  1YOV B;  5B1B H;  4B47 A;  3KX2 A;  5LEK A;  5E1W A;  3GTQ J;  1G2H A;  3U6Q A;  3DDQ B;  1U5T C;  2LSO A;  3UZU A;  1JJ8 C;  1MBK A;  4Y3O A;  2RKO A;  2OAZ A;  3GRU A;  3NAR A;  3RYR A;  3VFD A;  4RM2 A;  1BVS A;  3MN2 A;  3RKW A;  4XBF A;  2EA4 A;  4GKK M;  3BG9 A;  4D1Q A;  3GTK J;  1KQ8 A;  3T38 A;  4XKW A;  4AD9 A;  1JR3 E;  3J7A Y;  1I1S A;  2FQ4 A;  1IY2 A;  2NVY J;  1AUA A;  1QA6 A;  4HDV A;  2X1C A;  2PJP A;  3S2W A;  2VL8 A;  4D5C A;  4YIF A;  3SHF A;  2YX7 A;  3A1Y A;  1YX3 A;  3TWK A;  1K3X A;  4AQY M;  1QGP A;  1G3S A;  4F7N B;  4BBA A;  1W36 D;  8CAT A;  2CQX A;  4HW0 A;  4LIV A;  3S8P A;  1UG0 A;  3TDZ C;  4C3I J;  1Q3C A;  1Z5B A;  2GQF A;  2M5Z A;  3C7J A;  2L4M A;  1TD6 A;  2FBI A;  5HNH A;  1PUE E;  2E19 A;  2EV6 A;  1I39 A;  5DTD A;  2UXC M;  2R5Z A;  1H1S B;  2W99 A;  1C9B A;  3U5Z B;  2NNN A;  2FA5 A;  1U9N A;  2LG4 A;  2Q0O A;  5EP3 A;  4Y28 F;  5JLX A;  1MKM A;  3S3M A;  5D5W B;  1YW9 A;  3JR9 A;  4BCH B;  1IXS B;  3KHI A;  4ZDL A;  5LBQ A;  1BJZ A;  5HS8 A;  4GHA A;  2C6Y A;  1JTX A;  2DYR H;  2EFN A;  4XRM A;  2WSF F;  2YR0 A;  2Z8Y M;  4LG0 A;  1URC B;  4HLQ A;  1H9T A;  3BY6 A;  4DYQ A;  3CP8 A;  2UU9 M;  2HS5 A;  3SMP A;  4JV5 M;  3K4B A;  4BXX X;  2ZSI B;  2ETH A;  2VBZ A;  1IBL M;  2K0B X;  4MTE A;  3S2D J;  5ICP B;  2E35 A;  1J5Y A;  1YJW I;  4I2O A;  2P6T A;  4A3I J;  4F1I A;  2XAS A;  3C58 A;  2ZKZ A;  3IHP A;  2HNH A;  5FLX Z;  3HGY A;  2CYY A;  4LD5 A;  5FGK B;  4Q48 A;  5BPD A;  3PFY A;  2ELK A;  4JP0 A;  1WFX A;  3A0B C;  3KYD B;  3BRO A;  5C44 J;  5DQV A;  4EOQ B;  3MIA B;  3GLX A;  5IOY A;  3W6V A;  1JR3 A;  3K8Z A;  2HL7 A;  2UWM A;  4MEX F;  3SAT A;  3TO6 A;  5EJC A;  1YYV A;  3QXE B;  4M9Z A;  2W9Z A;  3HOU J;  4QPO A;  3RQ4 A;  2CS3 A;  4OIN F;  1A5T A;  4BCI B;  3ZMU A;  1L3L A;  2DOA A;  1NJF A;  4V19 K;  3DV8 A;  1MND A;  3GYH X;  1VYW B;  2B0L A;  3HPH A;  3U1D A;  1WXQ A;  3Q8X A;  5KQD A;  2J7O A;  1PUF A;  2DME A;  3J81 Z;  3GQ3 A;  2O7O A;  5CVJ A;  4B44 A;  1Z9C A;  3DDP B;  1EE8 A;  4ZGE B;  2EIL H;  4AUX A;  5FTM A;  1I94 M;  2MSY A;  3QRF F;  1BL0 A;  2BV6 A;  4CCL A;  1D2N A;  1JB0 F;  2KXE A;  1DPR A;  2NS8 A;  2E2H J;  4DYR A;  2F5P A;  3G73 A;  2XUB A;  2XSJ C;  4MFD A;  3BPX A;  3T6P A;  3BDD A;  3A8L B;  2W82 A;  3PO3 J;  3HY5 A;  2GBY A;  3SMS A;  3MMP A;  5IOZ A;  4OB2 B;  3HX3 A;  1K83 J;  3HHZ A;  3F8F A;  2EB7 A;  1ZQ3 P;  2KRF A;  4HRI A;  3I4M J;  2X1N B;  1SMT A;  2KL4 A;  2VOD A;  3MY5 B;  2ECC A;  3WVD B;  1BA5 A;  5E26 A;  1I6H J;  3GLG A;  2X48 A;  1Z1D A;  3F8M A;  2FSW A;  2PLY A;  4UB6 C;  3A02 A;  2G9X B;  4BCG B;  3K1P A;  1OKS A;  1NY5 A;  2K9M A;  1O7L A;  3IWZ A;  4IHT A;  2ZO4 A;  4A6D A;  2DDB A;  1GLN A;  2IGK A;  2LK2 A;  1OAI A;  1OCP A;  5LFA A;  1HJP A;  5E20 A;  3HRM A;  4CFW B;  1W1W E;  4A2U A;  1E9S A;  2DZN B;  1EV7 A;  2D7E A;  3CDI A;  3I4P A;  4RNA A;  2QGU A;  1WR1 B;  2R0I A;  3F6O A;  2RRE A;  4PJ0 C;  1R2Z A;  2MYS A;  1P4W A;  4ANR A;  3HTU A;  3BXW A;  1UAA A;  2W9F A;  3E46 A;  3KDS E;  2KMU A;  3LSM A;  3JRE A;  3RKQ A;  3AOE C;  4E7J A;  2A05 A;  1CUK A;  4C9Y A;  2Y2Z A;  1YLA A;  5K5O A;  2DCE A;  5TJJ A;  4CXA B;  3DP7 A;  3BG7 A;  1U78 A;  2DMU A;  3H92 A;  1MIJ A;  2DXC B;  1Z5A A;  2ISY A;  2ZAM A;  5HVQ C;  2L7I A;  4HF1 A;  1BC7 C;  2OQG A;  3ZR8 X;  3TN8 B;  4JX5 A;  3CF5 F;  1LDD A;  2ZTD A;  4B3A A;  2ZME A;  2QQA A;  1WWX A;  1XC5 A;  1U0J A;  2R7Q A;  2PFB A;  3CF2 A;  2V79 A;  3HOT A;  2V6C A;  2KR6 A;  1ENW A;  1OLT A;  2LH9 A;  4OB3 B;  1YIJ I;  1U5T A;  2XKO A;  2CQ7 A;  1MSE C;  2CHQ A;  4ROE A;  4WW0 A;  2HOT A;  2G7U A;  4WUR A;  3EIH A;  3VFZ A;  4LG2 A;  1KON A;  5DEQ A;  3KOY E;  2DJN A;  4GO1 A;  5EG0 B;  2X49 A;  3IEC A;  3HU2 A;  3QYF A;  4OR5 B;  1MH4 A;  5AIP A;  3TWM A;  3V7S A;  3ZOB A;  4FAS D;  1FIN B;  3FRH A;  3QOD A;  5M3M J;  3DPT A;  4GMQ A;  4S0H B;  1ZP2 A;  2WFY B;  2JQ7 A;  3WHL A;  5BPI A;  3IG5 A;  2D2W A;  4FHT A;  1VQN I;  5C4X J;  1D0L A;  3I5U A;  1AA7 A;  1Y39 A;  1ACI A;  3GLG E;  4HNT A;  4UXN A;  1AOY A;  3A4C A;  4LFB M;  3E6D A;  3CCM I;  2E2J J;  2QDJ A;  4QHT A;  4ZDP A;  4B48 A;  3ZP5 A;  5EFQ B;  3OL3 A;  1GVD A;  3B74 A;  5AIQ A;  4X66 M;  1BBY A;  2PK9 B;  2K02 A;  3KEO A;  4XM3 A;  4LZZ A;  3TED A;  1CF7 B;  4NC6 A;  1R5G A;  3KEQ A;  2RGO A;  4OU0 A;  3WTT C;  3QHR B;  2IS2 A;  3D8B A;  4N4O B;  4L5E A;  4JN6 A;  3GLI E;  3FXJ A;  3KET A;  5HDN A;  3P9I A;  4EM0 B;  4CIZ A;  1FP1 D;  1ODD A;  2CO5 A;  1OFC X;  2VKV A;  1KZH A;  2VJ5 A;  4J19 A; 
#chains in the Genus database with same CATH homology
 2ZPF B;  4Z6Y A;  3X20 B;  4MFD A;  3X26 B;  4MFE A;  3A8L B;  4HNU A;  3QZ9 B;  4JX4 A;  4OB2 B;  2QQ8 A;  3WVD B;  2DPP B;  3QZ5 B;  4AKI A;  2ZPH B;  2AHJ B;  1E7P A;  3VKH A;  4OB0 B;  3BG9 A;  2CZ1 B;  4P17 A;  4ZGJ B;  3BG3 A;  3QYG B;  4FM4 B;  2CZ0 B;  2QDY B;  4ELJ A;  3X28 B;  2DXB B;  2DD4 B;  1IRE B;  2ZPB B;  4JX6 A;  3WVE B;  3QYE A;  4BBS M;  4BBR M;  2ZZD B;  3QYH B;  2DXC B;  4AI6 A;  3VKG A;  3TW6 A;  3HB9 A;  3KHI A;  4JX5 A;  3QYB A;  2CZ6 B;  2KMG A;  3VYH B;  3X24 B;  4HLQ A;  2BS4 A;  2KR6 A;  3X25 B;  3HO8 A;  1UGS B;  1FKM A;  3HHT B;  4OB3 B;  3A8G B;  4ZGD B;  3DL1 A;  3A8M B;  4LOC A;  3A8O B;  2CYZ B;  2CZ7 B;  2DD5 B;  2QF7 A;  1UGR B;  3BG5 A;  3A8H B;  4HL4 A;  4MIM A;  4HNV A;  2D0Q B;  4HNT A;  2ZCF B;  2ZPE B;  3HBL A;  4M6V A;  2ZPI B;  1UGP B;  2QDJ A;  2BS2 A;  2QFZ A;  5EJC A;  3QXE B;  2BS3 A;  3HZJ A;  1UGQ B;  2WJ9 A;  4AKH A;  3QWL A;  1V29 B;  4NC6 A;  2ZPG B;  2G77 A;  4OB1 B;  4QSH A;  1AHJ B;  3VYG B;  3H4C A;  4ZGE B;  4AKG A;  3TW7 A;  1QLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...