4NC6A

Tbc domain of human rab gtpase-activating protein 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
ETWGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab GTPase-activating protein 1
publication title Tbc domain of human rab gtpase-activating protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 113
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4nc6A02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 4nc6A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4nc6A03
4HLQA 1FKMA 2G77A 4Z6YA 4NC6A 2QFZA 4HL4A 3QWLA 5EJCA 3QYEA 4P17A 2QQ8A 3QYBA 3HZJA
chains in the Genus database with same CATH superfamily
3EJ1B 2KRUA 4JXJA 3BR0A 4G4RA 2BHYA 5LMNM 5JI6A 3KSJA 3H36A 3FM5A 3I4VA 3NEUA 5JFRA 1KXUA 3LSIA 4OU7A 3JAMS 2P4WA 5KAFC 1BU2A 2DZOB 3GTGJ 4TTHA 5CEIB 3K1JA 5FLXS 3SFIA 3QAUA 2FX0A 3K4MA 3ILKA 3SATA 4G3OA 1XXHA 3PSIA 3B6CA 4GDFA 4BCJB 4CDGA 4S04A 3D5RC 5E3MA 7CATA 1EE8A 2XZFA 3TMOA 4E7IA 1S5LC 3FKJA 4W1UA 4WURA 5H6QA 3SC3A 4BBRM 1IN6A 3BJ6A 3T6PA 1MBJA 4KYWA 3S1MJ 2DT7B 3RE8A 4JX5A 2PK9B 4LCBA 1FX7A 4M3EA 2ZM6M 3KX2A 1PGYA 2M5WA 4HBLA 2FS1A 3B7QA 5ITRA 3MJ5A 3CDIA 2ZANA 2F6CA 5E3OA 2ZMEB 4ABZA 1MMNA 1DGWY 2RV8A 1NJFA 3LW5F 4BQAA 3OYHA 3E6CC 2M34A 3S2DJ 3KOYE 2HPIA 2DT6A 3NARA 4BU2A 2RGOA 2UUCM 1SVMA 4IBIA 3I9V2 4HRIA 4A6EA 1EH8A 4F7NB 2LH0A 1F4IA 3FHNA 3PO3J 1H1QB 2PQ8A 3U6OA 4E7SA 2DAGA 2DAMA 2UUBM 1X1AA 2AHJB 1BI3A 2DYSH 2XUBA 3VSKA 5DS9A 4OMYA 4BCNB 1E9HB 1SAUA 1W4MA 4HV6A 1SG9A 2DMPA 4BE0A 2LSOA 1PUFB 3FISA 1PUEE 1VEJA 5F04A 3WTTC 4HA8A 3VKGA 1T39A 3MEXA 2Y9YA 4OIOF 2UZBB 3DL1A 4DUZM 3VK8A 1I4WA 4OW0A 2BVLA 1VF9A 4YIFA 5HBHB 2XAQA 4BCKB 1JUPA 3JR9A 2QQ8A 2Q8KA 2XAFA 2LOOA 2X8AA 3GWZA 1Z59A 3W3CA 4GKKM 1K83J 1Z91A 4IOCF 3ZQJA 3KYCB 2J5OA 2VF8A 1D5YA 2OOAA 3PNYA 5KO3A 4ZGEB 3R61A 3BG9A 4EOJB 1FOYA 1JSTB 3BTIA 3KCCA 3I0TA 4XLPF 1MBKA 2QZ4A 2IW8B 1Z5BA 5L8RF 3X28B 3QHRB 5D5VB 1FMVA 5K1YA 1ZR4A 2ZPHB 3GX4X 3NWTA 2R6FA 4LJ9A 3S2HJ 2PMHA 4LD5A 1TTEA 3W0FA 2DWNA 1ORKA 3CCVI 4EOLB 4E7LA 4Y7NJ 4FE4A 5M3MJ 5IT3A 2QGUA 4Y72B 2GOMA 5H37D 2HGCA 4G7ZF 1DV0A 4QPOA 4MTDA 5ICPB 1QVUA 3K4CA 4N9HA 4BY7J 5B66C 4L9NA 5CVJA 2IGMA 2F5VA 5BMZA 4EM2A 3HRSA 4AVZA 3A42A 3WG9A 3LVVA 3MHVC 5EP3A 2W24A 2R65A 3H5AA 3QPSA 4BHPA 3FE3A 1ETOA 2F5FA 1TWFJ 5EXPA 4X62M 1HW5A 3L26A 3KHIA 1YI2I 1DDNA 5F3WA 4II3A 5F27A 4BHCA 3OS0A 1H28B 1X19A 3I53A 4WX9A 2EPFA 3E0JB 1ETKA 4HQEA 5J1RA 3B89A 2E2JJ 4CICA 2Y48A 1ZMVA 3CLQA 1AD6A 3U6CA 2QFZA 4XORA 4DV2M 3IHUA 5F1RA 1YTYA 2WV0A 4N0BA 1QAOA 2XKPA 4MQ9F 4RM2A 1LQ1A 2ZPIB 5FKOA 4BY1X 1HKQA 4M3FA 2B9RA 1FBUA 2H1LA 2VJ4A 4HX4A 4CA0A 3C58A 4HNTA 3NBIA 4GO1A 4C2TA 1ENWA 1DGFA 5FLVA 2ZSHB 1JB0F 4XMYA 4G6ZA 1QVTA 1YHQI 3R9XB 1W5TA 1OFHA 3VYRB 2HVRA 3MKYB 1D8KA 3QOPA 1WXQA 2A61A 3I3LA 3V4GA 2DLLA 2CW8A 2OAZA 1QVRA 1K4TA 1QYRA 3FZVA 3D0SA 4LJ8A 1RU3A 5IP6A 4E7JA 1S8NA 4G7OF 1U0JA 4LF7M 2M9HA 2Y0SA 3ZP5A 2DENA 2NOGA 3ESWB 1DP3A 2JMWA 2A3SA 2YU9J 1P4XA 4EVIA 2G0EA 4RB2C 3S3MA 3JSOA 2HQRA 3DDPB 2L09A 3JRIA 1GABA 5HNFA 3QWLA 2EA0A 1BW6A 2LF7A 1V5EA 2OTLI 1F5QB 5L3BA 3W6VA 4OR5B 2P0WA 1J5EM 1P92A 3CUOA 4ZJZA 2JJ7A 4BHBA 4RKUF 3CCQI 2H1RA 2PMZN 3S16J 3HUGB 3BLRB 1FTZA 2ESHA 3AAFA 2QSHX 1VDLA 3A0HC 4AW4A 2QVOA 2BOLA 3GCMA 2KW0A 2H6BA 4P96A 4RBOA 1L3LA 4A93J 4QNMA 3BHUB 1D0LA 2EINH 1VQ1A 4B3SM 4RAZA 4Y52J 1MU5A 3K10A 2DNAA 1FP1D 3LAJA 4KMFA 2XSZA 1QZZA 5LMUM 2BS3A 1FBQA 2W4SA 4A3DJ 1AWCA 4RDUA 4BBSJ 1ETWA 2MSYA 2HDDA 5ICFA 1YITI 1D5VA 3PM1A 2P5LC 3EETA 4JK1X 2ELKA 2LY2A 4DUYM 1X2NA 1ZAOA 2O03A 1XGSA 4BJ6C 5IOYA 2WY7Q 3H9JA 1R7RA 1G4DA 2PK2A 3X25B 2W25A 2W85A 1MMGA 4B3XA 2DOEA 2K6BA 1U9NA 2DKLA 4LG2A 2WBMA 5LRRA 4C3IJ 3M3YJ 4DJAA 3R4KA 2MABA 4CYCA 4HQMA 4CCJA 4CXFA 1NHAA 1XS9A 1JKWA 2W99A 3P9IA 1RC9A 4EJWA 3H0DA 2VQCA 2R7TA 1LEAA 3GFIA 2JA7J 3QQAA 5JHUA 3QZ9B 1QNTA 3BTCA 5GAHJ 4YY3M 4UB6C 3WGGA 1RZ4A 2VJIA 2WIHB 2F5EA 3NDQA 3K4KA 4LF9M 2EFPA 2L9VA 4FCYA 1H1RB 4GH9A 5FKNA 1L1TA 1OKVB 1WJBA 3DOGB 2UZEB 1PVEA 5DNYA 4CYDA 4LFBM 4LGWA 2HVSA 4XRSG 3OOUA 3A98B 1J9IA 3MZYA 2DMNA 4L9VA 2J7NA 3CJQB 3BDDA 4HLXA 3SEQA 2GZWA 3ECHA 2E36A 2LP0A 2P81A 3DEWA 2D45A 2DQLA 3DPLC 4ETSA 1IN4A 2H27A 5LQFB 1O7FA 1R5ID 3AOEC 2FOWA 3M8FA 4KN4X 4AIKA 2F5QA 4JYAM 4R7GA 2DPPB 2E5ZA 3UK6A 3TE6A 2XRLA 1QHGA 5F0HA 3PNTA 3JRDA 4ENNA 1T3TA 4IXAA 4C9YA 4LZZA 1HKSA 1ULYA 1GJSA 4AI6A 1BOBA 1N25A 2CFOA 2Z4RA 4KO8A 2JTVA 5DCMA 1IW7F 1D0YA 2L7FP 3KDSE 3KOZE 2M87A 3BC8A 4IEJA 2F2CA 1JTXA 4BGDA 1QU3A 2VT2A 3HKPA 3N4MA 1C1KA 2VQFM 2ZNYA 5EF6A 2R45A 1Q1VA 2DDBA 5C1BA 2QP9X 2JP7A 4Q5SF 2O25A 2W1OA 3T0YA 4G94A 1Z9CA 2HVQA 1JR3E 1DGHA 2V1XA 3CO7C 1AKHB 1X37A 1QDTA 2E71A 3HHWA 1TQPA 3E46A 1DGGA 3I58A 2DOAA 3IC7A 3JW4A 3LSPA 4CGZA 2RC4A 1ETYA 4IRGA 2R18A 3HG9A 3L2QA 2EFOA 3JRBA 1W36C 3S1NJ 1MH4A 3OYIA 3TO7A 2JPCA 2JRTA 2XFSA 1Y1WJ 1BI2A 1QAQA 1R4GA 5M5WJ 4ZC3A 2BWBA 3RKQA 2B3TA 3I54A 3BLQB 1PKDB 1W36D 1Y56A 1UGPB 2JZ1A 2HQNA 1OISA 1U6GA 3KZIC 5LLQA 3C1DA 4GEWA 3ABUA 3RZOJ 2HYGD 3KFWX 3JRAA 3DF8A 2MG4A 5HDKA 5FFXA 4MFDA 1ONVA 1I50J 3U60B 4CH7A 2IS1A 3SHGB 2HKXA 4BJTA 4A3GJ 3NRVA 2IXSA 4NQWA 1UNGD 1N77A 2HOSA 1TQIA 1IM2A 4HL4A 3AKZA 1ZLJA 2C99A 3U6DA 5D6FA 3VOEA 1T0FC 2RGVA 2DODA 2V6EA 3RGFB 1EIJA 2CMPA 1CQTA 4G4OA 2P6SA 1U5TC 1G6NA 2ZBKB 2RN7A 3C3WA 4U87A 1GH6B 1H1SB 1DO0A 1DP7P 4UUVA 1I6HJ 5HOOA 1VQPI 2CS3A 3DP7A 4RB0A 2VONA 4A2UA 2HDCA 2WFYB 1IV8A 2X48A 1U3EM 4LB6B 2VJ5A 4BXFA 3KOWE 3K9OA 1X1CA 4LFAM 4PJ0C 4FVMA 4OIQF 2FBKA 4JI6M 1L2BA 2BW3B 1ON2A 1XGMA 2GXBA 1BI0A 2P8TA 1G3IA 4U88A 4RMNA 1F43A 3OTOM 1OYWA 4EGZA 2L7KA 3GLLA 3CC4I 3ZH9B 2H5XA 2CUZA 2FMYA 3GO5A 4ZYAA 4QWQA 5E3NA 1Y39A 1XNQM 1FJGM 3RPUD 3JAMK 1KA8A 1G3YA 4QPQA 4GC9A 1Z5CA 4YC3B 5M5XJ 1R9TJ 5FLXK 2A6TA 5HLIA 3AOGA 2ECBA 2V22B 4OIPF 4F6WB 1DO2A 2NYXA 2Y20A 3BG5A 3HEFA 2Z7JA 2L7MP 3DKYA 3ZQ7A 5LHIA 3FXQA 2ISZA 2H6CA 4YELA 2D5VA 5D5XB 1SMTA 1H25B 2CUEA 1ETVA 2F5DA 4UV8A 1TP4A 1N33M 3NAUA 2C5RA 1Z3YA 4AYBN 4OB3B 3SZPA 4FHTA 4FX4A 1HNXM 3GLFA 4L18B 1S7AA 4XN3A 4B7GA 1ZG1A 2EH3A 4XRMA 4A3LJ 2GOXB 1ZYRF 1JKOC 2EV5A 2IS2A 3FIWA 4U0WA 3EIEA 4O6JA 2G3QA 1FIAA 2K9NA 2IN3A 4GGGA 3FUTA 5BPVA 3I01M 1O9KB 2VLAA 1UGSB 1YLFA 1YSYA 4Y4RA 1L0OC 2MFZA 4QSHA 3ZRGA 1NK3P 2XRNA 5FKMA 4DR4M 3MD2A 3LSTA 4PFPA 4D7MA 3FMSA 2BXYA 5FFZA 3JR4A 4ANJA 5IYBJ 3C3DA 4DR2M 2LKPA 2YFQA 2DN0A 3WVDB 4B47A 3WTSC 1U5TB 3OV8A 3TWMA 4A5MA 1MBFA 5HNBB 4A3EJ 3BHVB 3PO2J 2QQBA 3V8JA 1IC8A 2F5PA 4XSXF 2P7CB 2DW4A 3OYAA 2OTJI 4U0YA 4FWDA 2ELHA 3A8HB 2CV1A 1O3SA 3CF2A 2VBYA 3H9QA 2NVUB 4ZYEA 1AHDP 2OZUA 1GXQA 2DZLA 2DAEA 4ZTFA 5AONA 2ZJQF 2W82A 5FTLA 1OCPA 1F36A 3RPQA 1GO5A 1R1VA 3BT9A 4EJTA 1VQNI 4ROCA 1XDSA 1REPC 5C4JJ 5K5QA 4RS8A 3A01B 2WIPB 4CCKA 1MDMA 1R6BX 3GQ3A 2LY9A 3HJSA 1R6RA 3QYBA 3K4JA 4HX7A 4DR7M 3JTGA 4LGMA 4JI4M 2XC7A 1UAAA 2VASA 4RLFA 1K6OA 4PD2A 1GJTA 2B9SA 2L2DA 3ASNH 2PJRB 4OVZA 5GKNA 1R4MB 2WAQN 4HSRA 2VL8A 2B0LA 1VQ9I 2LK2A 2DFHA 1I3AA 2IP2A 3FXUA 3RKYA 3T1YM 1QZYA 1WRJA 2W48A 4EATA 1MSFC 2C5OB 5HQ0B 2A5YB 4M0WA 1DPRA 1FPQA 1RRJA 3BOSA 4RGSA 3UNGC 2V9PA 2X6OA 1YYVA 4M6VA 2ZFWA 3GTMJ 1NVMA 3TN8B 4RF1A 3K2LA 3DEEA 5EG0B 4D5CA 2NS0A 3POMA 4A3BJ 2LBFA 4KIFA 3EYYA 5IY5H 1HCRA 1X4PA 2FXAA 4BS9A 2UU9M 1BM9A 4CJ6A 3ELKA 1J75A 4EOOB 4E7KA 2LWXA 1DU6A 4BCFB 1M1EB 2KNZA 5IREB 2KJBA 2HTSA 2FNPA 3EDPA 4OMZA 3BZCA 1JJ8C 5J4VA 2E60A 3K69A 4M73A 2GM4A 4FISA 1B4AA 3QYGB 5L3FA 3B73A 1OCRH 1E17A 1YFHA 2NNNA 5ICCA 1PP7U 2QCOA 2CQXA 2XFTA 1B72B 4HG2A 4F7LB 2EK5A 3ZQQA 2Z1DA 3H35A 2GXAA 4HX8A 3I5UA 3CTAA 1HNWM 5BS6A 3J80K 3CZ6A 1D0MA 1LDDA 3KIOA 1MBGA 3CC7I 3ZMDA 5IYDJ 4JYKA 1XO2A 2L01A 2HPMA 2VDBB 1I1GA 3BY6A 3CUQA 1QUSA 2DPUA 2KEBA 1X4OA 2KHHA 3FXKA 4UUTA 4I02A 4IHSA 3CTWB 3Q9VA 5E79C 3S3OA 1Q3CA 1IQPA 4I0AA 4C2MJ 2R3SA 2O8XA 1TW2A 4ZYGA 3HBLA 4A12A 2FMLA 4PCZA 2LG4A 4L0YB 2HHHM 2JVHA 3TP0A 3KEYA 2Z3YA 1YW9A 5C4XJ 4FCVA 3P7NA 1H9GA 4UXNA 3BCBA 4PJNA 5IF1B 2GIZA 3ZC7B 1X2MA 3CJRB 5KNLA 2XDVA 1IUYA 2MA3A 2AQFA 4GKJM 3CLOA 1E0EA 4XLHA 4LF8M 2Q2EB 2VI6A 3HU2A 1B8IA 3GLHA 2XGXA 4DV7M 3F21A 4XGIA 2VBZA 3JSPA 2L2OA 1UZCA 3LFKA 3X2QH 2JK3A 1TWCJ 2E1MC 5HVYB 3KEQA 1YS7A 3A0BC 1ZQ3P 3W2WA 5LMKB 2M7AA 1S72I 2V4JC 3FHZA 2DA2A 1IBKM 1QQWA 2X6YA 3J7AY 1TC3C 3IH2A 3VYGB 5H20A 1QLBA 2HQAA 2R4JA 4JOMA 3K70C 1GXPA 2R44A 1Z7UA 3J81Z 2KDLA 3Q0WA 5IP9J 5D5UB 1LKXA 1GVJA 4R8HA 2VKDA 5D5WB 2KFDA 4D80A 1BBYA 2CP8A 3K70D 4A0ZA 1MH3A 1K78B 2O5RA 3GLGB 1V92A 1V3FA 1WJFA 2Z8YM 4B08A 1SD7A 1ZK8A 1PJRA 1R4NB 1VQ7I 1WWXA 5FJ8J 3G1OA 3G2BA 4L5EA 3A8LB 4HF1A 2LVPC 1H24B 1OFIA 4KJZA 4D0PA 1GV5A 4YFKF 1HT1E 5M3FJ 4KLNA 3RIRA 4MB7A 1ZG5A 4DYRA 1OKRA 2HU9A 1K3WA 4XLEA 4G8XA 4E6KG 3DDQB 5ERIA 3GFJA 1E32A 1IRFA 1Y8QB 3LCUA 5F64A 1XC8A 4Q4ZF 2UZKA 2EUFA 5D8LB 1UNHD 2MR9A 4IHVA 3FTDA 4RLQA 2ZCWA 2R92J 2OV7A 3OS1A 1V5GA 3WHKA 2EIJH 2VXDA 3MZHA 2Y21A 5DQWA 3E4RA 1CF7B 1VQLI 4GC5A 3H3ZA 1Z6RA 2WSEF 4MGYE 2R5YA 4Q7JA 3ZPLA 2ZC2A 2E1OA 5ED4A 4NC6A 1XTAA 4XM3A 1E7PA 4YOSA 5KK1A 1IO2A 4Y3OA 4LRTA 2APLA 1YO5C 3KZZA 1LUJB 3VLFB 3W2VA 1YJ9I 1IJWC 2I7PA 3SMPA 3U6EA 2G7HA 4G9YA 1VQ4I 2HFHA 3ONQA 1LJ9A 2YR2A 3M1EA 3HOYJ 2G77A 3EIDB 4FX3B 4LMYA 3HHHA 3D1NI 4QHSA 1PYVA 3OL3A 2JA2A 1VEGA 1H27B 2DAKA 5IHYA 1AIPC 1R1TA 2FBIA 4MTEA 3MKZA 1GUXB 3KP1E 4U7DA 1Z7LA 2C5XB 4IBJA 2NVQJ 2W9FA 4XLFA 4HF2A 2K0BX 5HLGA 3HTSB 1W7PB 2CV2A 3WTYC 5IDPB 2PG4A 2AS5F 3MI9B 5HS8A 2O7OA 3LCVB 4EORB 2UXBM 3HL2A 3GPYA 2K86A 3M8JA 3GW2A 1U78A 2CZ7B 2JSPA 1YLAA 3UJNA 1B1BA 3LSKA 1XB2B 3R60A 3VODA 3J7AO 2ZXHA 4RGUA 2D0QB 4I7HA 1KYZA 3FUXA 1QZMA 5KPTA 4CIZA 2LNBA 3NQOA 5IPAA 3B57A 2NVYJ 4QHTA 3CJTB 4KIGA 3S3NA 5B1AH 2PI0A 4GXOA 3KP5A 4OB1B 3G1MA 4XN0A 3WHLA 5KPRA 3DLAA 3FUWA 1MMSA 3MIAB 4KODA 2ZJ2A 1H9TA 2CE7A 4KITB 2QBYA 1H1PB 1MNDA 3WGIA 1DQUA 1E9SA 1FMWA 4BEHA 1UMQA 1VTNC 3DJBA 4QOZC 1Q1HA 1FBSA 1B9NA 5B3SH 2KDZA 1ZR2A 2ETHA 2AHMA 1A6QA 1ZGAA 3VYUB 3E3VA 2EZLA 4DGWB 4IQ4A 3WTWC 3DZDA 1HNZM 2HS5A 5DV5A 3U61A 4EMSA 2LNHC 1MMDA 2HYFA 3HJ8A 2LTPA 4DQ2A 1BW5A 3EUKL 3OYDA 1J5YA 3E97A 4IJEA 1LFBA 1WJ5A 1R36A 4Y17A 3W68A 4AUXA 5CVIA 1UG2A 4PCQA 4EJUA 2EB7A 3LMMA 4YIRX 3FRHA 1FYMA 3QZ5B 3GLIE 2A69F 3AG3H 2ACJA 5ITTA 3F8BA 1C0WA 3HPHA 1BI1A 4F3QA 4OU0A 1ZH5A 3Q5FA 3OYMA 3DWLE 1MBEA 3WGHA 2X4HA 1NO1A 4XKBA 2XF5A 4BQNA 2O6GE 1OYYA 2L9RA 4E70A 2OQGA 5EP2A 1TL8A 3TP3A 5CVRA 1EKEA 2CW0F 1TDZA 2P5VA 2QQ9A 2K47A 3A46A 4HV5A 3OYEA 2JY5A 3TQSA 4HOBA 3CMAI 3HU3A 1IN8A 3LSRA 4AKIA 2QDJA 3QOEA 3SDGA 1P6RA 2KZVA 4PGHA 1T6OA 4V19K 1IXRC 2MJ5B 2MH2A 4NC7A 1IY0A 5JI2E 3SQNA 4PDGA 1D3YA 2LF8A 4II2A 4S12A 2PLYA 3DQVC 5EXXA 3BLHB 4CRLB 3FF5A 3IAS2 4UN0A 2WSCF 1EV7A 4NUBA 1LE8B 2LVOC 4G6TB 2OQ4A 2I8DA 4F7JB 1NG6A 4Q48A 1ZKGA 5LEKA 3T38A 1EJ9A 1IXCA 4L5JA 2V1CA 1X1PA 2R62A 4NXMM 1OAIA 3ABLH 1LV7A 1IXSB 3ZR8X 4BQQA 4GMQA 1C7YA 5BR8M 2HI3A 1XXHE 3A03A 4FETA 2MH9A 2P6TA 2PEXA 3BR1A 3DLLF 2CJJA 1UFZA 3K4BA 4BYYA 4LFUA 4EOPB 4X64M 4B7HA 3RYPA 3I56I 2ZTCA 2Z3XA 2CV0A 2ESNA 3F8FA 4B8XA 2DMEA 5GTIC 3V76A 2RQPA 3K4LA 4DV6M 4FW9A 1UGRB 3IKVA 1XG1A 3CCMI 3HDDA 3G1LA 3DBRB 1O7LA 1AUAA 4PJLA 3ZQFA 3JRFA 2JWSA 1XMQM 4YHHM 3BR2A 1G2HA 2FQ4A 3K9PA 3DPTA 2JY6B 5ITXA 3E5XA 3OY9A 1K61A 3O0GD 2DJIA 3TQNA 3RTRA 3H3VK 4BCMD 1MJBA 4YEJA 3J81S 3TW7A 4NRVA 5DDGA 2RGHA 5FTJA 1MBHA 2ADUA 2K40A 3M9AA 1KFVA 1GL6A 3E5QA 2D2WA 4F7SB 2JY7A 4GYGA 4XKVA 1V29B 3B7NA 1XMKA 2STTA 1VNDA 4L9TA 2YNMD 4RM3A 4IBDA 4CFNB 1OQYA 1YW7A 2CHVA 1JGSA 5LEJA 1ORYB 2BE5F 1G4AE 4A6DA 4GITA 2DA6A 1JE8A 2C6TB 3PNVA 3C2GA 4M3GA 5HS7A 2DZNB 5CVVA 3GBGA 4L8RC 2ID6A 3FXMA 3ASOH 3VPRA 2GNOA 4FD2A 2ICWG 3ZOBA 2ZJRF 3AOEA 4Z2YA 1GDTA 1KYIA 1T6SA 3FXLA 5E8GA 1R22A 1CUKA 3ZMVA 1L8QA 3VDXA 1B9MA 1VQ6I 1D1AA 3TOAA 5EEAA 4UUSB 2R5ZB 4LG0B 1GL7A 3ZCOA 2EA4A 1VQOI 1D8JA 1OIZA 4N4NB 2AO9A 2DQRA 1QPIA 2KIQA 2XPWA 5DUKA 1B6AA 4NSTB 4BY1J 3J7BA 2E7WA 2VIIA 2FH0A 2O3FA 2OCCH 4M3DA 1MGTA 1G8XA 1T08B 4BBAA 4BB9A 3LSJA 3KPHA 2VOOA 2IGKA 3OYJA 2VC0A 2XSJC 4NDLA 4WXHA 4OAZA 3GLIB 2WV1A 4XONA 3BZ6A 3JCUC 4JI5M 2M4KA 5E1ZB 2W9ZA 1DGBA 4IBEA 2IJLA 4KT5C 5CYIB 4FCTA 3FD9A 2X6XA 4ASNA 1SFOJ 4IBFA 4LFCM 5HODA 1IGNA 1HDDC 3C3EA 3VYHB 4HZFA 3BROA 3OYLA 1HOMA 5HDNA 4BCMB 1TH2A 1NH3A 3M7GA 3SYTA 1P3QQ 4CCLA 3W67A 1ZGJA 2E7XA 3KS4A 5KVRA 1Z5AA 1RR7A 2MBFA 3HPGA 4M6XA 2IVXA 4KUMA 4HAMA 4M71A 3ML6A 3HRUA 3TO9A 3PIPF 2ZPFB 4ZGJB 2LBCA 2DMUA 3BCAA 1XMXA 2FE8A 3F22A 2M4GA 4JX4A 2QA4I 1YQAA 4FCWA 2IAIA 2ZO4A 3GF2A 3AG4H 5JLXA 5EGOB 1YRNB 3I4MJ 4A3FJ 4B3TM 2EZIA 2Y9ZA 2ISYA 1H26B 5IDNB 1FEXA 1FVVB 3FTFA 5M5YJ 3PSFA 2FOIC 4MLOA 2E1NA 4JN6A 3HJEA 2DCEA 4PJJA 1TBXA 4A3IJ 1ZRDA 5DCFA 4X66M 4CHUA 4I2OA 4FX0A 5EQTA 4A0XA 2E5LM 3A2KA 3DKXA 2DBBA 3ROUA 5K7ZA 4KIBA 1OFCX 3SAVA 3DCFA 5HNHA 1XXHB 2M45A 3BG3A 3DA1A 1IY1A 2OQRA 4BBSM 5ACBA 4EV0A 3IHPA 3FTCA 4DZJA 4BE1A 1DPUA 3U6PA 4HDUA 3L28A 2FNAA 3CQZJ 3ULQB 4Y13A 1PDNC 3IP4B 2QWWA 2WSFF 5IZ7D 3BR6A 1YS6A 5IT9K 4ANRA 4LG3A 2M0CA 5TJJA 1YG2A 1R71A 3AL0C 2IW5A 2KRFA 4F92B 3HY5A 3PL8A 1IRZA 2KZUA 1QQIA 1TT0A 2AQEA 3RYRA 3LA7A 1G3SA 2BHZA 1Z3XA 3TOBA 4LJZF 5ILUA 4BXXX 3KYLA 4IKFA 4I8OA 4L78A 1MSEC 1BR2A 1TLHB 4RAGA 4A3KJ 5A2QK 1QHHD 3RI4A 1G8PA 2DTZA 1X1DA 2XHKA 4XLAA 1K3XA 5FTMA 3U21A 5LBQA 3HXLA 3WODF 3TO6A 4ENMA 4L6V6 3BG7A 3C2HA 3FWEA 3TDUC 3U5ZA 5HVQC 1V5FA 2F5CA 4IBBA 2EO2A 1D1BA 5F0CA 3GRUA 5DYIA 3LQRA 2BEOA 2XGEA 2R4GA 3KETA 4IZZA 1F5TA 3CC2I 4KNYA 4EONB 4L4UA 2DWZB 3A45A 3JR5A 2OU2A 3VKHA 2LREA 2E19A 2JWTA 3GZ5A 1WR1B 1QDRA 5FLMJ 1PRBA 1CGPA 3E21A 3CD6I 3IWZA 3TPZA 4I81A 1P4WA 2KRKA 3NWLA 2V1UA 4K0KM 2R7ZJ 3G33B 4G6DA 4HYEA 3SDBA 2E2HJ 3I71A 3KFUG 2J5YA 5LGNA 4HF0A 2DA5A 2A5WA 1T8IA 2XGNA 1YE9A 2XF6A 4X6AJ 3H4MA 5DD4A 5EEGA 2EILH 4M9XA 3K7AM 1R00A 4HEOA 3KLNA 1VOLA 5ICEA 2WMAB 4MIMA 1WGXA 3GLXA 3MK6A 1S7OA 4UY8I 3I59B 1OCZH 3FMRA 2C9OA 1UCRA 3W6KB 5DYMA 1OI9B 1VDDA 4BCQD 4HPQA 3T15A 2VBWA 2IEKA 2OPFA 2OZ6A 4IMYB 5EEHA 2Y2ZA 1BC7C 3HGGA 3E7LA 3HHYA 5KPZA 1Q02A 1P4AA 3HIFA 3LWFA 5BNGA 4D9JA 4JI3M 1V4RA 2V1DA 3KXEC 3BOQA 2NRAC 4RGRA 4CCMA 3HM5A 1JT6A 4B44A 1TDHA 4Y33A 1HJPA 2QYOA 2MC4A 2XAUA 3BJOA 2XROA 2HOAA 5FRMA 1JOWA 4CISA 5FO5A 1MNMC 4YOZA 2DO7A 3AFHA 4AD9A 3AL0B 4A69C 1LB2A 3I55I 5E6JA 4M9ZA 2KZSA 1ZN2A 1LFUP 5CJ9A 3ZMZA 1XCBA 1N36M 2DVWB 2P5KA 2C5NB 4EQQA 2DOFA 1PJQA 2WY8Q 1JR3D 3M1CA 4P16A 4R71A 3VEPA 5K7FA 2FRHA 5E17F 2XAJA 1WHUA 2RKHA 2EZKA 2EZHA 3KS8A 4HLYA 2CCIB 2CO5A 4EGYA 1WCMJ 4PJMA 4WXDA 3QPLA 4JBAA 3IAM2 3QPHA 3DU5A 3KSXA 2KQRA 3PJRA 4OX9M 5CYVA 1RESA 4DNCA 1VZ0A 3KP3A 3CCUI 2PJQA 2L54A 2P7VB 5KCMA 2N35A 2H09A 3PIOF 2KIUA 2DK8A 5LHGA 2R7OA 3OYFA 1Y8GA 4CGYB 1WPKA 2CU7A 1WJDA 2DMTA 3H5NA 3KP7A 2EKFA 1ZRCA 4ZGDB 2HOTA 2YUSA 1JUSA 4CUGA 1BJZA 1IV6A 2WMBB 4EOKB 1N32M 4EOQB 2DA7A 2BY2A 4BE2A 4F6UB 2R7XA 3B7ZA 1XSVA 2DU9A 4Q47A 3Q3SA 3WTUC 4LB5A 1RNLA 1GKIA 2QCUA 5FRNA 3HB9A 4WP2A 1FNNA 3S17J 2PN6A 2X1NB 1IRXA 3WTXC 5FGKB 2BXZA 4ROEA 2CRGA 2G5GX 1SXJA 4BCQB 1J0RA 3L25A 5DTDA 1OCTC 4YFNF 4XICA 4I98B 4NC8A 4H4KC 1FOWA 3X26B 2CUFA 2HKJA 1NV8A 3M6AA 2HTJA 4M0DA 1QGPA 3V42A 1VQ5I 3OSFA 3S1QJ 2L3DA 2ZKZA 4BCIB 3F8MA 2EFWA 5C18A 2JZYA 2HWVA 2FF4A 1A31A 1K7AA 2HL7A 1UGQB 3M4OJ 1Q3BA 2HXOA 1XMOM 4F6SB 2BS2A 3E9SA 4UVAA 3J2PB 2MD0A 4ZDLA 4NL4H 2BKZB 2EIKH 5LFAA 4I3ZB 1R5GA 2M8GX 4UN2B 3DFZA 4M9SA 1YUBA 1KU9A 3NWSA 2E35A 4EJOA 3K6GA 3VYSB 3LNQA 3QU3A 1WZ2A 1ERDA 1OL2B 1I1SA 1WFXA 1PM5A 3KLOA 3TW6A 5IOZA 2L02A 1H88C 4XLNF 4OWRB 1TF0B 3SHFA 2O9LA 4XL9A 1OR7C 4L9JA 1RETA 4BCGB 1NHWC 2Y0TA 5EXSA 3X24B 2VE8A 4I0BA 1UHMA 3JRCA 4EC9B 4XOTA 3GLGE 5GPAA 1USSA 2IBDA 3L29A 3GQ4A 2XB0X 2JQ7A 2M60A 2I5UA 2LH9A 2M5ZA 3HGYA 3TGNA 3RQ4A 2K3FA 2DFIA 4OINF 4B09A 3ABKH 2V7FA 1HDPA 1IFYA 4XBOA 4AG5A 1S7EA 2ID3A 3KP2A 4XK4A 5E3LA 4D7NA 2G8LA 1R23A 3CCLI 2LHGA 3B9PA 3GLFE 4DR1M 1QA6A 3F8NA 4J01A 2MLGA 1YIOA 2LYCA 4ITVA 3WE2A 3ZN0A 3OYKA 2W7NA 3QHWB 2R46A 3L2UA 4KRDB 1YJWI 1OAOC 1UFMA 1QAMA 1Z05A 3C9PA 2K9LA 3CP2A 1TZLA 2MC3A 4A3VB 1I6XA 1BA5A 3MMYB 4I09A 2UXXA 3KZYA 3TL4X 5BNJB 1LDKB 1WHCA 2HKOA 2IRFG 1KU2A 1S29A 2WEVB 3WHCA 1NHGC 2FA5A 4UVBA 4G6QA 3FXOA 1G3NC 5CLSA 2K4BA 3A8GB 2DYRH 2X1DA 1KZHA 2QSGX 1MJ9A 3S1RJ 1UNLD 2WJ9A 4FQGA 1Z1DA 3QP6A 3I04M 4FE7A 1MNEA 5DCMB 4U7BA 4LLNA 2GA2A 1C9BA 2QENA 2R7SA 2DFFA 3H1CA 2ME6A 4S0HB 3FMQA 5C3EJ 2LC2A 1GT0C 2O61A 2Y31A 2PMZA 1MN3A 3CP8A 4ON0A 3S8PA 4QTRA 1RUNA 3QYEA 2C6YA 5GAEJ 3DTIA 1JGGA 4MGHA 3HKZA 1BR4A 1Z0XA 4M6YA 2JVGA 2QSFX 1RIOH 1TQMA 2EWNA 2M3AA 5E18F 4JQFA 1XMAA 2BYVE 1DGHB 1SVLA 3CF6E 2N8GA 2JY8A 4IX7A 4X1EA 3PFIA 2VC1A 4NBQA 4AWXB 2L7HA 3CCSI 1IAWA 3V8LA 1WJ7A 2W96A 4EOIB 1BOAA 3SYKA 2DD5B 3QXEB 5GP9A 3TBIA 3KW6A 4JI0M 2D7GA 3DXJF 4FM4B 1N4MA 1XC5A 2DAIA 2QUFA 2ZMEA 2NNYA 3SXYA 3D8BA 2ZSIB 2HCBA 2BGCA 1EFUB 2YQZA 1NTCA 5KQDA 2BVMA 3OS2A 3DPUA 3F5XB 4KDPA 3GQ5A 2KLOA 1QANA 4LITA 1U9OA 1KU7A 2DXBB 2F5NA 2KRHA 4OB0B 1O4XA 4BCOB 1V55H 5F1JA 4MFEA 4XRSA 4LY6A 2EFQA 2JZ0A 4QIWN 1IDYA 3HTUA 1WH5A 2VUMJ 3WTZA 3KEOA 1U8RA 3SARA 2NOJB 1PUFA 1GV2A 2VXZA 4HNUA 1ETQA 2O8KA 2L6OA 2IW6B 4MGIE 3F9KA 3GXOA 3I4YA 2LFBA 4J19A 3AG1H 3SZTA 1TNTA 4G12A 4HEA2 3WHBA 3ZCBB 4EOMB 2EKKA 3BPVA 4ENJA 4K2EA 2Y0SN 5FGMA 5GADJ 5E20A 4NOOB 4JI1M 2WADA 1SD6A 2AXTC 3OL4A 1XDUA 4R79A 5JI3E 1LE8A 2TCTA 4M72A 1TH4A 1KGSA 2JA6J 4DR6M 2Z9OA 3GTLJ 2YPRA 1WQ2A 1I5ZA 4JP0A 2IA2A 4LJ6A 1IXSA 2WAFA 3E1SA 2HYJA 1W7PD 5EP1A 1I39A 4C3JJ 1O3RA 2MGQA 2KJCA 1JSUB 3IUOA 2KNAA 2DAOA 2UUZA 3V7CA 4H0EA 2BPMB 1Z77A 1SC7A 2H1KA 3PUFA 5D4SA 1X1BA 1XGNA 4CCOA 2LKXA 1KQ8A 2JA8J 3MN2A 4DYQA 1FKMA 4X65M 4IBCA 3KE2A 3N97A 1WIVA 2UZLB 1WGNA 1A6IA 1FYLA 1W98B 3I4PA 1NJGA 4BXUA 2K85A 4F91B 1GUUA 4I76A 5EXTA 2CSOA 4UHTA 1T95A 3EUAA 1TWHJ 3PXGA 1OLTA 5IYCJ 2EV6A 2MLKA 3GLFB 3BWGA 2GQQA 3OOPA 2D1HA 4LJ5A 4EJVA 1P9QC 2JN6A 2NS7A 3SAUA 3VDPA 3U9GA 3MY5B 2PMIB 3KOXE 1B59A 3P9CA 2LW4A 3A8OB 5ITUA 2V1NA 1Y0UA 4II7A 3EUHC 4HW0A 2FUG2 4I4LA 3BHTB 4B7FA 1R5LA 2DFEA 5FTKA 3E5UA 1OPCA 3HHZA 4U0VA 4UVCA 1RKWA 4B1RA 1FIPA 3J7YJ 1ZHFA 5GPCA 3GLHE 5FSWA 2H8RA 2KA6B 4G6LB 1ZV1A 4UB8C 3D5LA 1K79A 3L2VA 1LPQA 3CESA 3IH3A 4HSTA 2CWBA 4F7ZA 1F4KA 2L4AA 1AU7A 4LIVA 3J80Z 3H3UA 3IG8A 5TGTA 3B74A 2X9DA 4AU7A 3OR2C 3ABTA 2RVCA 1XGOA 4ESFA 3TNWB 3L9FA 4WF2A 2KT0A 3LOCA 4P17A 3IH4A 4M3BA 5C44J 2EQRA 3BXWA 2AXLA 2F4MB 3FKEA 5KHDA 3EYIA 3WU0A 5FD6A 1OGUB 1I94M 1TTYA 3LFUA 4DV3M 3JRHA 3S15J 4I5SA 4MNUA 4IIWA 2WB1A 4A0YA 5LHHA 1U8BA 3HO8A 4KN7X 5FB2A 5EFQB 5LGTA 2EJRA 3BPXA 1FTTA 2R7GA 3IWFA 3HOUJ 4RAFA 1NV9A 3GLIA 2PHGA 1IN7A 3O3KA 3HUGA 3E6BA 5EDNA 1MDMB 1BL0A 4S05A 2R7RA 3AJIB 4KHPM 3Q9SA 4AIHA 5J8FA 4PFOA 4F55A 3F23A 2VOPA 1X3UA 2WTEA 2JUJA 4AC0A 2VQGA 3FDYA 5E1XA 4DIQA 2VKHA 4ZYDA 1VQ8I 4CFMB 4DZPA 4OVZB 1J59A 3FRIA 3FXJA 3CMYA 2LHCA 4IVNA 4MEXF 2FBHA 2PFBA 1XPXA 1SMYF 3K0LA 2CG4A 1UM8A 3IG5A 1FP2A 1KSFX 1D1CA 1D0ZA 2QQAA 1MMAA 2D1VA 3GRYA 2K5CA 4BBRJ 3ERED 3HOWJ 2IS6A 2X4AA 4XK8F 3TWKA 4DV4M 1D0XA 3JREA 4I99C 1IRGA 1NY6A 4NNJA 4ELJA 3CDLA 1PJSA 3I64A 1YRNA 1I27A 4IHWA 2LBFB 4IHTA 2WZJA 1GHCA 1VEKA 2LLKA 4OOIA 4XRFA 1G3TA 2ZFUA 2WWYA 3KP4A 3F92A 2YSRA 3KP6A 3OIOA 5IP7J 1XWIA 5DQVA 2LD5A 3OYBA 1IN5A 4FWGA 4MGZE 3BQYA 4LF4M 4LGYA 3PQJA 4B4CA 1JKPC 4IQJA 2DHYA 4HNVA 1XX5A 3C7JA 4CFVB 1TGUA 2F4VM 1PP8F 1NK2P 2XV4S 4OIRF 4CXAB 2QLZA 5LRSA 1J7KA 5KQ8A 2M8EA 2NVXJ 3HHXA 1JKRC 2CWEA 2OO9A 4P5OA 1A04A 2CQQA 2BJWA 2QKMB 3BTJA 3O8HA 1ZTRA 4BL0B 2Z4SA 1WI9A 2HAKA 4AIDA 2X49A 2DI3A 3F72A 1QBJA 3HC7A 1O3TA 2R7VA 1VINA 3RQIA 2W2HA 1PJJA 4RF0A 1KQ9A 3HSEA 2UUAM 3MAJA 5ILSA 2A05A 2BY3A 3TKYA 3QPTA 4D1QA 1XB4A 1HT2E 1O57A 2OF7A 2RNGA 4C2UA 3CUQB 1XHBA 1HKTA 4BNCA 2IA0A 4D81A 3PFYA 4N9IA 4WWCA 3CMMA 5ITYA 2Q1ZB 3L2AA 5HLHA 2R7FA 2WPAB 2IA1A 3KYDB 2ZJPF 3I4NJ 4P9FA 4LZJA 3TNHB 3R0AA 1G59A 1TWGJ 2M0MA 3Q8GA 4R3DA 1J09A 2UV1A 3U6MA 2CQ7A 4EM1A 2LVSA 2VPRA 2XPUA 2R7DA 2EUCA 2JSCA 4A5NA 3F8CA 4QNRA 2L0KA 3DEUA 4QLCU 2DTRA 4B48A 4ZDPA 2VT3A 3HSFA 5FTNA 2QHOB 1IBLM 1RI7A 1V54H 2HDWA 2V26A 4LF6M 2XVCA 4F93B 3SAWA 3WG7H 1OKWB 5HBEB 3CGWA 4YRVA 1WJCA 1AKHA 2WAQA 2BY1A 1EF4A 2E2IJ 2XGDA 4TV7A 4DV1M 1B8IB 3GLHB 4CCNA 1IG7A 1ZRFA 2G9XB 4IJAA 4QOSA 3HHTB 2VBXA 2L9NA 1FSHA 4RB1A 3FBNB 2JXNA 3U1DA 5JLWA 3VDUA 1WSUA 1BIBA 4KA4A 1D2NA 4LLLA 2Z99A 3BP8A 3P5JA 2LXEA 4BY7X 2YU3A 1U2WA 2XH9A 2QF7A 3G71I 2ZZDB 3M03A 3TEDA 2BV6A 1HR0M 3K9TA 3B6AA 3I59A 3LSMA 3O6BB 1IY2A 4XIDA 2V6ZM 4GYIA 1H89C 4NRWA 2EV0A 1F1ZA 1W1WE 3U60A 5CKTA 2ERCA 3IRRA 3CF5F 1BVSA 2LTUA 4BCPB 1G41A 1HW2A 4JI2M 3CCJI 2L9SA 3SZGA 1X3WB 4DR5M 3U6LA 1LFPA 2B7EA 1T98A 2ZXJA 3GMEA 5HS9A 1R58A 4E4HA 1FY7A 1HLVA 4B3MM 2NQ8C 3J27B 1Z21A 2E5NA 1P2FA 2XF3A 2ZBKA 4IF4A 3O8GA 4LIUA 2Y69H 2KPMA 1ZMWA 4W97A 3JRGA 1ZQ9A 3AG2H 3ISPA 4ZZLA 5L3GA 4FWHA 4BQOA 1R1UA 4ZZDA 4GIPA 3BR3A 2C5VB 2STWA 2CH0A 1D3UB 1W5SA 1VQKI 4AKHA 2JUCA 1ZLKA 2RAEA 3EIHA 2BW3A 2VQHA 3QYFA 2NVTJ 1X58A 1S9HA 2ECCA 2CHGA 3M07A 3TDZC 2CZ1B 3CDHA 2W57A 2LRDA 2FQ3A 1UELB 2CW7A 2HEOA 4ENKA 1LVAA 1XCVA 4PDIA 4XNFA 2R5YB 3R6SA 4AQYM 2IW9B 5JVTA 1IREB 1X3ZB 5HLTA 3S32A 2ZPEB 3RKWA 2MYSA 2EBIA 1WI3A 3GPUA 2C4GB 4PZJA 2X1CA 1TWAJ 1STZA 5H6RA 3J80S 3OR1C 1TD6A 1WJAA 4BACA 2DXCB 3M0EA 3DOAA 2F48A 2UXDM 2CHQA 4L16A 1Y0NA 5ITXE 5GTHC 2NS8A 1ZELA 2VJJA 3QU6A 4XQFA 2JT1A 2LDUA 2V79A 2L4FA 3DTEA 2FFJA 3LL7A 1TFBA 2HZDA 3SASA 1WH7A 1W5CC 3WU2C 4X0GA 1E94E 1FYKA 5CQEA 2BWEA 2BY0A 2VB6A 1XSXA 3S2WA 1UG0A 1O9KA 1V34A 2CQNA 5J8CA 2VE9A 4Y15A 5DM7F 3AV0A 1HSTA 1S3JA 4O3MA 4HDVA 3RFWA 4GRIA 1A5TA 2R7QA 1W0TA 4CZCA 5JR3A 4KFCA 4D82A 2M1BA 1USTA 2KXEA 3DBHB 3HKZN 4LLGF 3CF0A 3LSHA 4C3HJ 3B02A 2COMA 5F0FA 1JXSA 3HX3A 4G4NA 1T0FA 3HGIA 4DYCA 2R7WA 2UWMA 1GLNA 1U5TA 1IBMM 2ZAOA 2H8WA 4JV5M 2K9QA 3F3XA 2OC6A 1T38A 2NXNB 3VWBA 3GTQJ 2QBYB 2VPLA 4BH9A 2EFNA 1OTRA 4JX6A 1I3QJ 5L3CA 3HRTA 4BEHB 1JT0A 1FJLA 1JR3A 4LRSA 4UNOA 5D8KB 3VYTB 1H6UA 5E8IA 4E7ZA 3LAPA 1VI0A 2V9KA 2UUEB 4E7HA 2I53A 2ZPGB 1MKMA 2WAEA 2XEPA 4ZTJA 2LMDA 2GWRA 3U61B 2DDAA 3REOA 4A3JJ 3K1NA 3RPUA 4JI8M 6PAXA 3GUDA 1AHJB 5DYGA 4OGRB 1FSEA 4BAYA 2LKSA 3A01A 3K1PA 3W6JB 3V7SA 4AZFA 1HBXG 1JHHA 1E9RA 1MJGM 1QUTA 4LOCA 4RAYA 3U6QA 3GP1A 3L09A 1VG5A 3RGPA 1PJIA 2A6HF 4G7HF 2CEAA 3ZQGA 1GVDA 2LR8A 3GRVA 1FT9A 5D4RA 2PJRA 3HOZJ 2P5TA 3A8MB 2KDOA 3VFDA 3K92A 2XLJA 1SFKA 1RUOA 3UGJA 3NBXX 4LK1F 2CZ0B 3QYHB 3IRQA 3MKWB 1OKSA 4CZZA 5DFLA 1VQMI 5J1UA 3HHGA 2Y0QA 3MZ8A 4NB5A 2DHRA 5F08A 3IKTA 2HWJA 4MM3B 1L2CA 3BQZA 2CCHB 2E34A 2KISA 2CZ6B 3PVSA 3J7ZI 5ITQA 4ZH4F 1G71A 5EG0A 1KQ0A 4KICA 2OA4A 2F2EA 4B43A 4BXXJ 1H0MA 2GXGA 1IZ1A 4OB2B 2RRUA 2K9SA 3C2BA 2XIGA 3F0CA 3F6OA 4PGGA 1OCCH 4A3CJ 4C30A 1XNRM 1IUFA 9ANTA 2QEXI 1NNJA 4F52A 2FOKA 4ITQA 3UMMA 1O3QA 3E6DA 1WGLA 2C9CA 2J7OA 3HZJA 3K7AJ 1GVNA 4LJ4A 2RDPA 2XGCA 3T8TA 2F5OA 3ZQIA 1WJEA 3L27A 3T1BA 4WK8F 3QP5A 5DEQA 4BDZA 2OPTA 1RR8C 2CJMB 2JNHA 4IL6C 4IHXA 1TR8A 3BZKA 2XASA 2VF7A 3FX3A 4MQVA 3IL2A 4DV0M 4DV5M 1LNWA 1E3HA 5D6EA 3R8FA 3RCOA 5LD2C 1B72A 4Z8XA 2GBYA 1FLIA 3MMPA 3U2RA 3HOXJ 4EIWA 2GAUA 3BTLA 3W0LB 1OYIA 1VYWB 1YIJI 4BJ5C 2FSWA 5FKKA 4PSXA 5AIPA 2K02A 4DW6A 4NSRA 3PQKA 2DI0A 3L2CA 2KKOA 1K4SA 4M74A 1SANA 2A6EF 4IOAF 2L5QA 1FOXA 2KNVA 1OR7A 3QRFF 4IJFA 5L3EA 1L2DA 2WA0A 5JVGF 1K6YA 3TNIB 1H8AC 2BNKA 3ABMH 4YFXF 2XSZD 1T33A 2HNHA 5CVUA 2XSDC 2YX7A 2QPAA 1FZPB 1FOKA 3GTOJ 4N4OB 1AISB 1ODDA 3P9KA 4LJAA 3RZDJ 4F70B 1BC8C 3GFMA 3WE3A 1YX3A 2Q2EA 3COAC 2DA4A 3K2AA 3GVAA 2MROB 3LQ5B 2ELJA 4OAYA 1ITYA 3WVEB 3L2RA 4JI7M 4BUPA 3FK6A 4BLCA 3WTVC 4YOOA 4ESJA 3HOSA 2ZTDA 4G4QA 4I01A 5ICGA 1QMZB 5IT9Z 1SEUA 2WB1N 5CPRB 3GO8A 2B63J 3V8KA 5J6XA 4B3RM 4CO8A 3UZUA 1LVKA 3GTKJ 4RA2A 1R2ZA 2Z33A 2F5SA 1LEBA 4WCGA 4ELLA 1ON1A 2L7ZA 2QZ8A 3ZQCA 1N75A 3VSLA 3X20B 2OCEA 1WVRA 4A3MJ 1APLC 2Y30A 1ACIA 1K78A 5A2QZ 3GLGA 4GCVA 3CCYA 1MIJA 1BJAA 1XD7A 1HW1A 4P9UA 2XB5A 4MGKE 3J7AS 3L2WA 5EZGA 1R49A 1JI8A 2IVMA 2V9VA 3ZMTA 1R7JA 2X85A 1QO0D 3VB2A 4B3AA 3OYNA 2UXNA 2DK5A 3RJPA 3GTMS 4ESBA 4NHJA 2OUMA 3ZGKA 1XSDA 1EA3A 5GAGJ 1JHFA 3HRMA 4II5B 3SYLA 2VQEM 1BN5A 1ZG3A 2DA3A 2C96A 2Z2SB 4IPAA 2QKLB 1MZBA 2Z5UA 2GIVA 2J5PA 2FEZA 4F2LA 1MX0A 1JUMA 1CF7A 2L4EA 4REZA 3Q8XA 2X51A 2DA1A 4GFBA 1E3OC 2DXIA 3OIQA 4KRCB 2JRMA 2QDYB 3I51A 2JUGA 5E26A 2Y0MA 2GA1A 2M30A 3A1YA 5BOXA 2NAZA 5BPIA 3GTJJ 3MY1B 2CYYA 1OIPA 1ENHA 3S93A 3Q0UA 2H94A 4CYCB 2HXIA 4YG2F 4I6ZA 4AIJA 3GEZA 1OCOH 1AA7A 3MWMA 5CQGA 1ZARA 4KISA 4ZYHA 2O0YA 1IXZA 2GQFA 3HOVJ 4GHAA 2XAHA 3HWSA 3FBIB 3K2ZA 3A4CA 2IPQX 1GUXA 5K7HA 4NSOB 3OSGA 4KMUX 3BG6A 5BPDA 2L4MA 1P7IA 2K27A 2HOEA 2ZNZA 3SBJA 1Y1VJ 3MVPA 4EOSB 4NXNM 3HYIA 4TUWA 5TISC 4L15A 1W7PA 5K5RA 4D5FA 4DBQA 2BBYA 2D7EA 1ZP2A 3RSNA 2WC2A 4BKXA 2Y75A 3ZXSA 3G6EI 1SXJE 3QAHA 1Y6IA 4IRIA 3RDIA 1NSFA 4MH0E 3H4JA 2I7NA 1SFEA 2QM3A 2XZUA 2X1EA 4HLQA 5FROA 2W00A 5DM6F 2DWLA 2JGZB 2X0LA 2EJSA 3J81K 3GPPA 4MEYF 2DT5A 5EYRA 5EP4A 2LVQD 1YX5A 3IV5A 1ZGWA 1OIUB 4IBKA 2UXCM 4WXCA 3F6VA 3ZMUA 2MGWA 2FJ1A 1SFXA 3Q0VA 5AIQA 5LGUA 1DGRM 3FUVA 4PT5A 1MW7A 4AG6A 4PUSA 4XLCA 3JAMZ 4LJ7A 3HSRA 4DBRA 3OYCA 3E6MA 8CATA 5FLXZ 2O01F 3BJAA 5KAIC 1BR1A 3U5ZB 1UJ8A 3ZN1A 3GFLA 1HF0A 1QZEA 2FE3A 3FYCA 1KYWA 2L7IA 3THGA 1P7JA 1T56A 2LY1A 3FM3A 1RKTA 2RREA 3K4NA 4RGXA 3LA3A 3BLYA 2I10A 2CQKA 4V2FA 2G7UA 3GRRA 3H9GA 1D0KA 2GLOA 5H2FC 5I5ZB 1OMIA 3LSGA 4YIIA 2KL4A 3T5XA 1NG7A 2KMGA 1GY3B 3K8ZA 2KRCA 2KZGA 3DTKA 1SAXA 2FU4A 2K9DA 1NNUC 2M7BA 1T43A 3L7WA 3EUHA 4IRHA 2KMUA 4MGRA 3GTPJ 5EJCA 2K9MA 2VKEA 1UHSA 3HOTA 5DD8A 3H4CA 2R0QC 4R1HA 2VODA 5L2WB 3SJMA 5E1WA 2WHBB 1SXJC 2ZPBB 5J3LA 5FKLA 2R7UA 1L1ZA 5K5OA 1AOYA 2EA2A 2QGSA 1MJAA 1FC3A 2DPDA 1OL1B 2CYZB 4CFUD 2G9WA 2F4IA 3VK7A 4W5WA 2M2EA 3KVWA 1HSJA 1SXJD 1POGA 2UZDB 2CFXA 2IGOA 2RNJA 1V33A 2OOBA 3GZ6A 3CO6C 1PJTA 3KP0E 4NQWB 4MO7A 4RNAA 1IF1A 3T1HM 2EIMH 3L00A 4EM0B 1A5JA 4DR3M 2MW8A 1YOVB 1Z67A 3LVWA 2KIMA 5J40A 1ZREA 3H0GJ 2F4OB 3OIPA 4BCHB 1FINB 2KR6A 1XN7A 2ZXIA 1FWZA 3VFZA 5JHFA 4RB3C 1R2YA 4V2GA 3UKGA 5TRDA 2K7LA 3MQ0A 4J00A 4L0ZB 4L5IA 1ETXA 3CMEI 4LK0F 1IDZA 3A02A 2ZAMA 1QRYA 2DJNA 3FKIJ 2Z16A 1Z6TA 4Z6YA 1BIAA 3EQLF 1P5EB 3GPXA 3HU1A 1Y8RB 2ZXWH 2PJPA 2ZCFB 2HQ5A 2IS4A 2XKOA 3R0JA 2VIXA 1A35A 3T8RA 1HXDA 2OJED 5EZHA 3RKXA 2A07F 2DMQA 3H5RA 1H4LD 3LQQA 5J47A 1SD4A 3GZNB 1EH6A 4EC8B 4Y28F 4AKGA 1DUXC 1LTMA 1J2XA 4XOPA 3QODA 1YW8A 2KP6A 3D8LA 1LDJA 2IT0A 2R4EA 2W84A 4LF5M 3JTHA 1T2KA 1QPMA 5IT9S 2JA5J 4AM3A 2LVAA 1A36A 3BBZA 1KONA 3SMSA 2WXVB 1K82A 2KIFA 4BDYA 1URCB 1F9NA 3ECOA 1NY5A 1YJNI 3ZQLA 1JTYA 3G73A 2MH8A 2D7HA 2K3PA 1SVOA 2A68F 2VN2A 2ZB9A 3ERMA 4CFUB 3C18A 2K4JA 2RKOA 2TDXA 1N78A 3DV8A 2OBPA 2BJVA 4XKWA 5A2QS 2COBA 1ZMUA 2PX9A 1SXJB 2AHQA 1S6LA 5BQTA 3BR5A 4FTHA 3DU6A 1JJ6C 1HA8A 1RPWA 3IECA 2DWMA 3OMYA 1HC8A 3W2AA 2LVNC 3G4SI 4XBFA 2CGPA 1TT5B 4EEFG 2TRTA 4GHLA 2C98A 3ZQHA 4CFXB 5J1YA 1HQCA 2PMUA 1SFUA 3H92A 3M8EA 4RODA 2VQLA 3EPZA 5HBJB 1VFCA 1UB9A 1E3PA 3ZMSA 4WW0A 2VKVA 3V7RA 2IGNA 2V6CA 1S3SA 2BZTA 3CJNA 3MFKA 3S14J 5F6FA 3L1PA 2X6WA 2R0IA 4ZDOA 2CRUA 4PDKA 4IO9F 3FK7A 3OYGA 3WU1B 4ZPXA 2R5ZA 1TH3A 4LG0A 4MHGA 3SEZA 5J4YA 4UUSA 1TNSA 2YS9A 2YR0A 1MD0A 2KHMA 2R93J 5HDGA 3FYDA 1DU0A 5L3DA 3D5SC 3G3ZA 4AVPA 2ZMEC 2MD5A 3CUQC 4XSZF 4PK4A 5B1BH 2QNJA 4KT0F 1EH7A 2YX4A 3N05A 4P55A 1G3WA 2ME0A 3CCRI 5FD5A 1TW3A 1E2XA 1JKQC 1HQYE 2XPVA 3DKWA 4FT8A 3EOCB 3PO3S 3RGSA 3FTEA 4KT6A 3TWLA 1N34M 4FASD 3HJQA 3DBLB 3GYHX 2HZTA 3OWTA 2HR3A 3SFZA 4IBGA 5IWAM 1R5HA 2E1CA 1SD5A 3DFGA 2E1MB 4IHYA 4O5VA 1Q39A 5DUIA 1ZAEA 3UR3C 3MCZA 3PUBA 2I40B 2PBIA 3FXRA 2XF7A 3CCEI 4DBGB 2BS4A 4CFWB 1UHWA 3K1MA 4UV9A 2CUJA 4BCND 2OD5A 3O2PE 1JQJC 1WKMA 4PSWA 4XR6A 3FUUA 1KU3A 2FD5A 2Q0OA 2RQQA 3MKLA 3LA2A 5ILVA 1W0UA 4P1WA 4XKCA 1OIYB 4AYBA 3U6SA 1OJLA 3DTOA 4F1IA 4CHTB 4DOZA 2DD4B 5EGOA 5B5EC 2JPBA 4CSWA 2XAGA 3U1KA
chains in the Genus database with same CATH topology
2DPPB 3A8GB 2WJ9A 3QYHB 2QFZA 1UGRB 3A8OB 4AI6A 4AKGA 1UGSB 3BG3A 2ZPIB 4QSHA 4BBSM 3QYEA 3HBLA 4HNTA 4BBRM 2CZ7B 4ZGDB 3TW7A 4JX5A 2D0QB 4HLQA 3WVDB 1V29B 3HB9A 4OB1B 2DD5B 3QXEB 4FM4B 3HHTB 4P17A 3A8HB 4JX6A 1UGPB 3WVEB 3QWLA 3X26B 2QF7A 2ZZDB 3HO8A 2DXBB 4OB0B 2ZCFB 2ZPGB 4MFEA 2AHJB 4MFDA 3VKHA 1UGQB 1QLBA 1AHJB 2KMGA 4HL4A 3VKGA 2BS2A 3DL1A 4HNUA 3QYBA 4LOCA 3X20B 5EJCA 3QZ5B 2BS3A 3H4CA 2QQ8A 3A8MB 2ZPBB 3A8LB 3TW6A 2CZ0B 4ZGEB 3BG9A 2CYZB 4MIMA 3X25B 4ELJA 4M6VA 3X28B 3X24B 2CZ6B 4AKHA 2ZPHB 2CZ1B 4OB2B 3VYHB 4AKIA 2QDJA 3QZ9B 2KR6A 4HNVA 2BS4A 3HZJA 1IREB 1FKMA 4NC6A 3QYGB 3BG5A 1E7PA 2ZPFB 4ZGJB 3VYGB 2ZPEB 2QDYB 4JX4A 4Z6YA 2DD4B 3KHIA 4OB3B 2G77A 2DXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLQ A;  1FKM A;  2G77 A;  4Z6Y A;  4NC6 A;  2QFZ A;  4HL4 A;  3QWL A;  5EJC A;  3QYE A;  4P17 A;  2QQ8 A;  3QYB A;  3HZJ A; 
#chains in the Genus database with same CATH topology
 3EJ1 B;  2KRU A;  4JXJ A;  3BR0 A;  4G4R A;  2BHY A;  5LMN M;  5JI6 A;  3KSJ A;  3H36 A;  3FM5 A;  3I4V A;  3NEU A;  5JFR A;  1KXU A;  3LSI A;  4OU7 A;  3JAM S;  2P4W A;  5KAF C;  1BU2 A;  2DZO B;  3GTG J;  4TTH A;  5CEI B;  3K1J A;  5FLX S;  3SFI A;  3QAU A;  2FX0 A;  3K4M A;  3ILK A;  3SAT A;  4G3O A;  1XXH A;  3PSI A;  3B6C A;  4GDF A;  4BCJ B;  4CDG A;  4S04 A;  3D5R C;  5E3M A;  7CAT A;  1EE8 A;  2XZF A;  3TMO A;  4E7I A;  1S5L C;  3FKJ A;  4W1U A;  4WUR A;  5H6Q A;  3SC3 A;  4BBR M;  1IN6 A;  3BJ6 A;  3T6P A;  1MBJ A;  4KYW A;  3S1M J;  2DT7 B;  3RE8 A;  4JX5 A;  2PK9 B;  4LCB A;  1FX7 A;  4M3E A;  2ZM6 M;  3KX2 A;  1PGY A;  2M5W A;  4HBL A;  2FS1 A;  3B7Q A;  5ITR A;  3MJ5 A;  3CDI A;  2ZAN A;  2F6C A;  5E3O A;  2ZME B;  4ABZ A;  1MMN A;  1DGW Y;  2RV8 A;  1NJF A;  3LW5 F;  4BQA A;  3OYH A;  3E6C C;  2M34 A;  3S2D J;  3KOY E;  2HPI A;  2DT6 A;  3NAR A;  4BU2 A;  2RGO A;  2UUC M;  1SVM A;  4IBI A;  3I9V 2;  4HRI A;  4A6E A;  1EH8 A;  4F7N B;  2LH0 A;  1F4I A;  3FHN A;  3PO3 J;  1H1Q B;  2PQ8 A;  3U6O A;  4E7S A;  2DAG A;  2DAM A;  2UUB M;  1X1A A;  2AHJ B;  1BI3 A;  2DYS H;  2XUB A;  3VSK A;  5DS9 A;  4OMY A;  4BCN B;  1E9H B;  1SAU A;  1W4M A;  4HV6 A;  1SG9 A;  2DMP A;  4BE0 A;  2LSO A;  1PUF B;  3FIS A;  1PUE E;  1VEJ A;  5F04 A;  3WTT C;  4HA8 A;  3VKG A;  1T39 A;  3MEX A;  2Y9Y A;  4OIO F;  2UZB B;  3DL1 A;  4DUZ M;  3VK8 A;  1I4W A;  4OW0 A;  2BVL A;  1VF9 A;  4YIF A;  5HBH B;  2XAQ A;  4BCK B;  1JUP A;  3JR9 A;  2QQ8 A;  2Q8K A;  2XAF A;  2LOO A;  2X8A A;  3GWZ A;  1Z59 A;  3W3C A;  4GKK M;  1K83 J;  1Z91 A;  4IOC F;  3ZQJ A;  3KYC B;  2J5O A;  2VF8 A;  1D5Y A;  2OOA A;  3PNY A;  5KO3 A;  4ZGE B;  3R61 A;  3BG9 A;  4EOJ B;  1FOY A;  1JST B;  3BTI A;  3KCC A;  3I0T A;  4XLP F;  1MBK A;  2QZ4 A;  2IW8 B;  1Z5B A;  5L8R F;  3X28 B;  3QHR B;  5D5V B;  1FMV A;  5K1Y A;  1ZR4 A;  2ZPH B;  3GX4 X;  3NWT A;  2R6F A;  4LJ9 A;  3S2H J;  2PMH A;  4LD5 A;  1TTE A;  3W0F A;  2DWN A;  1ORK A;  3CCV I;  4EOL B;  4E7L A;  4Y7N J;  4FE4 A;  5M3M J;  5IT3 A;  2QGU A;  4Y72 B;  2GOM A;  5H37 D;  2HGC A;  4G7Z F;  1DV0 A;  4QPO A;  4MTD A;  5ICP B;  1QVU A;  3K4C A;  4N9H A;  4BY7 J;  5B66 C;  4L9N A;  5CVJ A;  2IGM A;  2F5V A;  5BMZ A;  4EM2 A;  3HRS A;  4AVZ A;  3A42 A;  3WG9 A;  3LVV A;  3MHV C;  5EP3 A;  2W24 A;  2R65 A;  3H5A A;  3QPS A;  4BHP A;  3FE3 A;  1ETO A;  2F5F A;  1TWF J;  5EXP A;  4X62 M;  1HW5 A;  3L26 A;  3KHI A;  1YI2 I;  1DDN A;  5F3W A;  4II3 A;  5F27 A;  4BHC A;  3OS0 A;  1H28 B;  1X19 A;  3I53 A;  4WX9 A;  2EPF A;  3E0J B;  1ETK A;  4HQE A;  5J1R A;  3B89 A;  2E2J J;  4CIC A;  2Y48 A;  1ZMV A;  3CLQ A;  1AD6 A;  3U6C A;  2QFZ A;  4XOR A;  4DV2 M;  3IHU A;  5F1R A;  1YTY A;  2WV0 A;  4N0B A;  1QAO A;  2XKP A;  4MQ9 F;  4RM2 A;  1LQ1 A;  2ZPI B;  5FKO A;  4BY1 X;  1HKQ A;  4M3F A;  2B9R A;  1FBU A;  2H1L A;  2VJ4 A;  4HX4 A;  4CA0 A;  3C58 A;  4HNT A;  3NBI A;  4GO1 A;  4C2T A;  1ENW A;  1DGF A;  5FLV A;  2ZSH B;  1JB0 F;  4XMY A;  4G6Z A;  1QVT A;  1YHQ I;  3R9X B;  1W5T A;  1OFH A;  3VYR B;  2HVR A;  3MKY B;  1D8K A;  3QOP A;  1WXQ A;  2A61 A;  3I3L A;  3V4G A;  2DLL A;  2CW8 A;  2OAZ A;  1QVR A;  1K4T A;  1QYR A;  3FZV A;  3D0S A;  4LJ8 A;  1RU3 A;  5IP6 A;  4E7J A;  1S8N A;  4G7O F;  1U0J A;  4LF7 M;  2M9H A;  2Y0S A;  3ZP5 A;  2DEN A;  2NOG A;  3ESW B;  1DP3 A;  2JMW A;  2A3S A;  2YU9 J;  1P4X A;  4EVI A;  2G0E A;  4RB2 C;  3S3M A;  3JSO A;  2HQR A;  3DDP B;  2L09 A;  3JRI A;  1GAB A;  5HNF A;  3QWL A;  2EA0 A;  1BW6 A;  2LF7 A;  1V5E A;  2OTL I;  1F5Q B;  5L3B A;  3W6V A;  4OR5 B;  2P0W A;  1J5E M;  1P92 A;  3CUO A;  4ZJZ A;  2JJ7 A;  4BHB A;  4RKU F;  3CCQ I;  2H1R A;  2PMZ N;  3S16 J;  3HUG B;  3BLR B;  1FTZ A;  2ESH A;  3AAF A;  2QSH X;  1VDL A;  3A0H C;  4AW4 A;  2QVO A;  2BOL A;  3GCM A;  2KW0 A;  2H6B A;  4P96 A;  4RBO A;  1L3L A;  4A93 J;  4QNM A;  3BHU B;  1D0L A;  2EIN H;  1VQ1 A;  4B3S M;  4RAZ A;  4Y52 J;  1MU5 A;  3K10 A;  2DNA A;  1FP1 D;  3LAJ A;  4KMF A;  2XSZ A;  1QZZ A;  5LMU M;  2BS3 A;  1FBQ A;  2W4S A;  4A3D J;  1AWC A;  4RDU A;  4BBS J;  1ETW A;  2MSY A;  2HDD A;  5ICF A;  1YIT I;  1D5V A;  3PM1 A;  2P5L C;  3EET A;  4JK1 X;  2ELK A;  2LY2 A;  4DUY M;  1X2N A;  1ZAO A;  2O03 A;  1XGS A;  4BJ6 C;  5IOY A;  2WY7 Q;  3H9J A;  1R7R A;  1G4D A;  2PK2 A;  3X25 B;  2W25 A;  2W85 A;  1MMG A;  4B3X A;  2DOE A;  2K6B A;  1U9N A;  2DKL A;  4LG2 A;  2WBM A;  5LRR A;  4C3I J;  3M3Y J;  4DJA A;  3R4K A;  2MAB A;  4CYC A;  4HQM A;  4CCJ A;  4CXF A;  1NHA A;  1XS9 A;  1JKW A;  2W99 A;  3P9I A;  1RC9 A;  4EJW A;  3H0D A;  2VQC A;  2R7T A;  1LEA A;  3GFI A;  2JA7 J;  3QQA A;  5JHU A;  3QZ9 B;  1QNT A;  3BTC A;  5GAH J;  4YY3 M;  4UB6 C;  3WGG A;  1RZ4 A;  2VJI A;  2WIH B;  2F5E A;  3NDQ A;  3K4K A;  4LF9 M;  2EFP A;  2L9V A;  4FCY A;  1H1R B;  4GH9 A;  5FKN A;  1L1T A;  1OKV B;  1WJB A;  3DOG B;  2UZE B;  1PVE A;  5DNY A;  4CYD A;  4LFB M;  4LGW A;  2HVS A;  4XRS G;  3OOU A;  3A98 B;  1J9I A;  3MZY A;  2DMN A;  4L9V A;  2J7N A;  3CJQ B;  3BDD A;  4HLX A;  3SEQ A;  2GZW A;  3ECH A;  2E36 A;  2LP0 A;  2P81 A;  3DEW A;  2D45 A;  2DQL A;  3DPL C;  4ETS A;  1IN4 A;  2H27 A;  5LQF B;  1O7F A;  1R5I D;  3AOE C;  2FOW A;  3M8F A;  4KN4 X;  4AIK A;  2F5Q A;  4JYA M;  4R7G A;  2DPP B;  2E5Z A;  3UK6 A;  3TE6 A;  2XRL A;  1QHG A;  5F0H A;  3PNT A;  3JRD A;  4ENN A;  1T3T A;  4IXA A;  4C9Y A;  4LZZ A;  1HKS A;  1ULY A;  1GJS A;  4AI6 A;  1BOB A;  1N25 A;  2CFO A;  2Z4R A;  4KO8 A;  2JTV A;  5DCM A;  1IW7 F;  1D0Y A;  2L7F P;  3KDS E;  3KOZ E;  2M87 A;  3BC8 A;  4IEJ A;  2F2C A;  1JTX A;  4BGD A;  1QU3 A;  2VT2 A;  3HKP A;  3N4M A;  1C1K A;  2VQF M;  2ZNY A;  5EF6 A;  2R45 A;  1Q1V A;  2DDB A;  5C1B A;  2QP9 X;  2JP7 A;  4Q5S F;  2O25 A;  2W1O A;  3T0Y A;  4G94 A;  1Z9C A;  2HVQ A;  1JR3 E;  1DGH A;  2V1X A;  3CO7 C;  1AKH B;  1X37 A;  1QDT A;  2E71 A;  3HHW A;  1TQP A;  3E46 A;  1DGG A;  3I58 A;  2DOA A;  3IC7 A;  3JW4 A;  3LSP A;  4CGZ A;  2RC4 A;  1ETY A;  4IRG A;  2R18 A;  3HG9 A;  3L2Q A;  2EFO A;  3JRB A;  1W36 C;  3S1N J;  1MH4 A;  3OYI A;  3TO7 A;  2JPC A;  2JRT A;  2XFS A;  1Y1W J;  1BI2 A;  1QAQ A;  1R4G A;  5M5W J;  4ZC3 A;  2BWB A;  3RKQ A;  2B3T A;  3I54 A;  3BLQ B;  1PKD B;  1W36 D;  1Y56 A;  1UGP B;  2JZ1 A;  2HQN A;  1OIS A;  1U6G A;  3KZI C;  5LLQ A;  3C1D A;  4GEW A;  3ABU A;  3RZO J;  2HYG D;  3KFW X;  3JRA A;  3DF8 A;  2MG4 A;  5HDK A;  5FFX A;  4MFD A;  1ONV A;  1I50 J;  3U60 B;  4CH7 A;  2IS1 A;  3SHG B;  2HKX A;  4BJT A;  4A3G J;  3NRV A;  2IXS A;  4NQW A;  1UNG D;  1N77 A;  2HOS A;  1TQI A;  1IM2 A;  4HL4 A;  3AKZ A;  1ZLJ A;  2C99 A;  3U6D A;  5D6F A;  3VOE A;  1T0F C;  2RGV A;  2DOD A;  2V6E A;  3RGF B;  1EIJ A;  2CMP A;  1CQT A;  4G4O A;  2P6S A;  1U5T C;  1G6N A;  2ZBK B;  2RN7 A;  3C3W A;  4U87 A;  1GH6 B;  1H1S B;  1DO0 A;  1DP7 P;  4UUV A;  1I6H J;  5HOO A;  1VQP I;  2CS3 A;  3DP7 A;  4RB0 A;  2VON A;  4A2U A;  2HDC A;  2WFY B;  1IV8 A;  2X48 A;  1U3E M;  4LB6 B;  2VJ5 A;  4BXF A;  3KOW E;  3K9O A;  1X1C A;  4LFA M;  4PJ0 C;  4FVM A;  4OIQ F;  2FBK A;  4JI6 M;  1L2B A;  2BW3 B;  1ON2 A;  1XGM A;  2GXB A;  1BI0 A;  2P8T A;  1G3I A;  4U88 A;  4RMN A;  1F43 A;  3OTO M;  1OYW A;  4EGZ A;  2L7K A;  3GLL A;  3CC4 I;  3ZH9 B;  2H5X A;  2CUZ A;  2FMY A;  3GO5 A;  4ZYA A;  4QWQ A;  5E3N A;  1Y39 A;  1XNQ M;  1FJG M;  3RPU D;  3JAM K;  1KA8 A;  1G3Y A;  4QPQ A;  4GC9 A;  1Z5C A;  4YC3 B;  5M5X J;  1R9T J;  5FLX K;  2A6T A;  5HLI A;  3AOG A;  2ECB A;  2V22 B;  4OIP F;  4F6W B;  1DO2 A;  2NYX A;  2Y20 A;  3BG5 A;  3HEF A;  2Z7J A;  2L7M P;  3DKY A;  3ZQ7 A;  5LHI A;  3FXQ A;  2ISZ A;  2H6C A;  4YEL A;  2D5V A;  5D5X B;  1SMT A;  1H25 B;  2CUE A;  1ETV A;  2F5D A;  4UV8 A;  1TP4 A;  1N33 M;  3NAU A;  2C5R A;  1Z3Y A;  4AYB N;  4OB3 B;  3SZP A;  4FHT A;  4FX4 A;  1HNX M;  3GLF A;  4L18 B;  1S7A A;  4XN3 A;  4B7G A;  1ZG1 A;  2EH3 A;  4XRM A;  4A3L J;  2GOX B;  1ZYR F;  1JKO C;  2EV5 A;  2IS2 A;  3FIW A;  4U0W A;  3EIE A;  4O6J A;  2G3Q A;  1FIA A;  2K9N A;  2IN3 A;  4GGG A;  3FUT A;  5BPV A;  3I01 M;  1O9K B;  2VLA A;  1UGS B;  1YLF A;  1YSY A;  4Y4R A;  1L0O C;  2MFZ A;  4QSH A;  3ZRG A;  1NK3 P;  2XRN A;  5FKM A;  4DR4 M;  3MD2 A;  3LST A;  4PFP A;  4D7M A;  3FMS A;  2BXY A;  5FFZ A;  3JR4 A;  4ANJ A;  5IYB J;  3C3D A;  4DR2 M;  2LKP A;  2YFQ A;  2DN0 A;  3WVD B;  4B47 A;  3WTS C;  1U5T B;  3OV8 A;  3TWM A;  4A5M A;  1MBF A;  5HNB B;  4A3E J;  3BHV B;  3PO2 J;  2QQB A;  3V8J A;  1IC8 A;  2F5P A;  4XSX F;  2P7C B;  2DW4 A;  3OYA A;  2OTJ I;  4U0Y A;  4FWD A;  2ELH A;  3A8H B;  2CV1 A;  1O3S A;  3CF2 A;  2VBY A;  3H9Q A;  2NVU B;  4ZYE A;  1AHD P;  2OZU A;  1GXQ A;  2DZL A;  2DAE A;  4ZTF A;  5AON A;  2ZJQ F;  2W82 A;  5FTL A;  1OCP A;  1F36 A;  3RPQ A;  1GO5 A;  1R1V A;  3BT9 A;  4EJT A;  1VQN I;  4ROC A;  1XDS A;  1REP C;  5C4J J;  5K5Q A;  4RS8 A;  3A01 B;  2WIP B;  4CCK A;  1MDM A;  1R6B X;  3GQ3 A;  2LY9 A;  3HJS A;  1R6R A;  3QYB A;  3K4J A;  4HX7 A;  4DR7 M;  3JTG A;  4LGM A;  4JI4 M;  2XC7 A;  1UAA A;  2VAS A;  4RLF A;  1K6O A;  4PD2 A;  1GJT A;  2B9S A;  2L2D A;  3ASN H;  2PJR B;  4OVZ A;  5GKN A;  1R4M B;  2WAQ N;  4HSR A;  2VL8 A;  2B0L A;  1VQ9 I;  2LK2 A;  2DFH A;  1I3A A;  2IP2 A;  3FXU A;  3RKY A;  3T1Y M;  1QZY A;  1WRJ A;  2W48 A;  4EAT A;  1MSF C;  2C5O B;  5HQ0 B;  2A5Y B;  4M0W A;  1DPR A;  1FPQ A;  1RRJ A;  3BOS A;  4RGS A;  3UNG C;  2V9P A;  2X6O A;  1YYV A;  4M6V A;  2ZFW A;  3GTM J;  1NVM A;  3TN8 B;  4RF1 A;  3K2L A;  3DEE A;  5EG0 B;  4D5C A;  2NS0 A;  3POM A;  4A3B J;  2LBF A;  4KIF A;  3EYY A;  5IY5 H;  1HCR A;  1X4P A;  2FXA A;  4BS9 A;  2UU9 M;  1BM9 A;  4CJ6 A;  3ELK A;  1J75 A;  4EOO B;  4E7K A;  2LWX A;  1DU6 A;  4BCF B;  1M1E B;  2KNZ A;  5IRE B;  2KJB A;  2HTS A;  2FNP A;  3EDP A;  4OMZ A;  3BZC A;  1JJ8 C;  5J4V A;  2E60 A;  3K69 A;  4M73 A;  2GM4 A;  4FIS A;  1B4A A;  3QYG B;  5L3F A;  3B73 A;  1OCR H;  1E17 A;  1YFH A;  2NNN A;  5ICC A;  1PP7 U;  2QCO A;  2CQX A;  2XFT A;  1B72 B;  4HG2 A;  4F7L B;  2EK5 A;  3ZQQ A;  2Z1D A;  3H35 A;  2GXA A;  4HX8 A;  3I5U A;  3CTA A;  1HNW M;  5BS6 A;  3J80 K;  3CZ6 A;  1D0M A;  1LDD A;  3KIO A;  1MBG A;  3CC7 I;  3ZMD A;  5IYD J;  4JYK A;  1XO2 A;  2L01 A;  2HPM A;  2VDB B;  1I1G A;  3BY6 A;  3CUQ A;  1QUS A;  2DPU A;  2KEB A;  1X4O A;  2KHH A;  3FXK A;  4UUT A;  4I02 A;  4IHS A;  3CTW B;  3Q9V A;  5E79 C;  3S3O A;  1Q3C A;  1IQP A;  4I0A A;  4C2M J;  2R3S A;  2O8X A;  1TW2 A;  4ZYG A;  3HBL A;  4A12 A;  2FML A;  4PCZ A;  2LG4 A;  4L0Y B;  2HHH M;  2JVH A;  3TP0 A;  3KEY A;  2Z3Y A;  1YW9 A;  5C4X J;  4FCV A;  3P7N A;  1H9G A;  4UXN A;  3BCB A;  4PJN A;  5IF1 B;  2GIZ A;  3ZC7 B;  1X2M A;  3CJR B;  5KNL A;  2XDV A;  1IUY A;  2MA3 A;  2AQF A;  4GKJ M;  3CLO A;  1E0E A;  4XLH A;  4LF8 M;  2Q2E B;  2VI6 A;  3HU2 A;  1B8I A;  3GLH A;  2XGX A;  4DV7 M;  3F21 A;  4XGI A;  2VBZ A;  3JSP A;  2L2O A;  1UZC A;  3LFK A;  3X2Q H;  2JK3 A;  1TWC J;  2E1M C;  5HVY B;  3KEQ A;  1YS7 A;  3A0B C;  1ZQ3 P;  3W2W A;  5LMK B;  2M7A A;  1S72 I;  2V4J C;  3FHZ A;  2DA2 A;  1IBK M;  1QQW A;  2X6Y A;  3J7A Y;  1TC3 C;  3IH2 A;  3VYG B;  5H20 A;  1QLB A;  2HQA A;  2R4J A;  4JOM A;  3K70 C;  1GXP A;  2R44 A;  1Z7U A;  3J81 Z;  2KDL A;  3Q0W A;  5IP9 J;  5D5U B;  1LKX A;  1GVJ A;  4R8H A;  2VKD A;  5D5W B;  2KFD A;  4D80 A;  1BBY A;  2CP8 A;  3K70 D;  4A0Z A;  1MH3 A;  1K78 B;  2O5R A;  3GLG B;  1V92 A;  1V3F A;  1WJF A;  2Z8Y M;  4B08 A;  1SD7 A;  1ZK8 A;  1PJR A;  1R4N B;  1VQ7 I;  1WWX A;  5FJ8 J;  3G1O A;  3G2B A;  4L5E A;  3A8L B;  4HF1 A;  2LVP C;  1H24 B;  1OFI A;  4KJZ A;  4D0P A;  1GV5 A;  4YFK F;  1HT1 E;  5M3F J;  4KLN A;  3RIR A;  4MB7 A;  1ZG5 A;  4DYR A;  1OKR A;  2HU9 A;  1K3W A;  4XLE A;  4G8X A;  4E6K G;  3DDQ B;  5ERI A;  3GFJ A;  1E32 A;  1IRF A;  1Y8Q B;  3LCU A;  5F64 A;  1XC8 A;  4Q4Z F;  2UZK A;  2EUF A;  5D8L B;  1UNH D;  2MR9 A;  4IHV A;  3FTD A;  4RLQ A;  2ZCW A;  2R92 J;  2OV7 A;  3OS1 A;  1V5G A;  3WHK A;  2EIJ H;  2VXD A;  3MZH A;  2Y21 A;  5DQW A;  3E4R A;  1CF7 B;  1VQL I;  4GC5 A;  3H3Z A;  1Z6R A;  2WSE F;  4MGY E;  2R5Y A;  4Q7J A;  3ZPL A;  2ZC2 A;  2E1O A;  5ED4 A;  4NC6 A;  1XTA A;  4XM3 A;  1E7P A;  4YOS A;  5KK1 A;  1IO2 A;  4Y3O A;  4LRT A;  2APL A;  1YO5 C;  3KZZ A;  1LUJ B;  3VLF B;  3W2V A;  1YJ9 I;  1IJW C;  2I7P A;  3SMP A;  3U6E A;  2G7H A;  4G9Y A;  1VQ4 I;  2HFH A;  3ONQ A;  1LJ9 A;  2YR2 A;  3M1E A;  3HOY J;  2G77 A;  3EID B;  4FX3 B;  4LMY A;  3HHH A;  3D1N I;  4QHS A;  1PYV A;  3OL3 A;  2JA2 A;  1VEG A;  1H27 B;  2DAK A;  5IHY A;  1AIP C;  1R1T A;  2FBI A;  4MTE A;  3MKZ A;  1GUX B;  3KP1 E;  4U7D A;  1Z7L A;  2C5X B;  4IBJ A;  2NVQ J;  2W9F A;  4XLF A;  4HF2 A;  2K0B X;  5HLG A;  3HTS B;  1W7P B;  2CV2 A;  3WTY C;  5IDP B;  2PG4 A;  2AS5 F;  3MI9 B;  5HS8 A;  2O7O A;  3LCV B;  4EOR B;  2UXB M;  3HL2 A;  3GPY A;  2K86 A;  3M8J A;  3GW2 A;  1U78 A;  2CZ7 B;  2JSP A;  1YLA A;  3UJN A;  1B1B A;  3LSK A;  1XB2 B;  3R60 A;  3VOD A;  3J7A O;  2ZXH A;  4RGU A;  2D0Q B;  4I7H A;  1KYZ A;  3FUX A;  1QZM A;  5KPT A;  4CIZ A;  2LNB A;  3NQO A;  5IPA A;  3B57 A;  2NVY J;  4QHT A;  3CJT B;  4KIG A;  3S3N A;  5B1A H;  2PI0 A;  4GXO A;  3KP5 A;  4OB1 B;  3G1M A;  4XN0 A;  3WHL A;  5KPR A;  3DLA A;  3FUW A;  1MMS A;  3MIA B;  4KOD A;  2ZJ2 A;  1H9T A;  2CE7 A;  4KIT B;  2QBY A;  1H1P B;  1MND A;  3WGI A;  1DQU A;  1E9S A;  1FMW A;  4BEH A;  1UMQ A;  1VTN C;  3DJB A;  4QOZ C;  1Q1H A;  1FBS A;  1B9N A;  5B3S H;  2KDZ A;  1ZR2 A;  2ETH A;  2AHM A;  1A6Q A;  1ZGA A;  3VYU B;  3E3V A;  2EZL A;  4DGW B;  4IQ4 A;  3WTW C;  3DZD A;  1HNZ M;  2HS5 A;  5DV5 A;  3U61 A;  4EMS A;  2LNH C;  1MMD A;  2HYF A;  3HJ8 A;  2LTP A;  4DQ2 A;  1BW5 A;  3EUK L;  3OYD A;  1J5Y A;  3E97 A;  4IJE A;  1LFB A;  1WJ5 A;  1R36 A;  4Y17 A;  3W68 A;  4AUX A;  5CVI A;  1UG2 A;  4PCQ A;  4EJU A;  2EB7 A;  3LMM A;  4YIR X;  3FRH A;  1FYM A;  3QZ5 B;  3GLI E;  2A69 F;  3AG3 H;  2ACJ A;  5ITT A;  3F8B A;  1C0W A;  3HPH A;  1BI1 A;  4F3Q A;  4OU0 A;  1ZH5 A;  3Q5F A;  3OYM A;  3DWL E;  1MBE A;  3WGH A;  2X4H A;  1NO1 A;  4XKB A;  2XF5 A;  4BQN A;  2O6G E;  1OYY A;  2L9R A;  4E70 A;  2OQG A;  5EP2 A;  1TL8 A;  3TP3 A;  5CVR A;  1EKE A;  2CW0 F;  1TDZ A;  2P5V A;  2QQ9 A;  2K47 A;  3A46 A;  4HV5 A;  3OYE A;  2JY5 A;  3TQS A;  4HOB A;  3CMA I;  3HU3 A;  1IN8 A;  3LSR A;  4AKI A;  2QDJ A;  3QOE A;  3SDG A;  1P6R A;  2KZV A;  4PGH A;  1T6O A;  4V19 K;  1IXR C;  2MJ5 B;  2MH2 A;  4NC7 A;  1IY0 A;  5JI2 E;  3SQN A;  4PDG A;  1D3Y A;  2LF8 A;  4II2 A;  4S12 A;  2PLY A;  3DQV C;  5EXX A;  3BLH B;  4CRL B;  3FF5 A;  3IAS 2;  4UN0 A;  2WSC F;  1EV7 A;  4NUB A;  1LE8 B;  2LVO C;  4G6T B;  2OQ4 A;  2I8D A;  4F7J B;  1NG6 A;  4Q48 A;  1ZKG A;  5LEK A;  3T38 A;  1EJ9 A;  1IXC A;  4L5J A;  2V1C A;  1X1P A;  2R62 A;  4NXM M;  1OAI A;  3ABL H;  1LV7 A;  1IXS B;  3ZR8 X;  4BQQ A;  4GMQ A;  1C7Y A;  5BR8 M;  2HI3 A;  1XXH E;  3A03 A;  4FET A;  2MH9 A;  2P6T A;  2PEX A;  3BR1 A;  3DLL F;  2CJJ A;  1UFZ A;  3K4B A;  4BYY A;  4LFU A;  4EOP B;  4X64 M;  4B7H A;  3RYP A;  3I56 I;  2ZTC A;  2Z3X A;  2CV0 A;  2ESN A;  3F8F A;  4B8X A;  2DME A;  5GTI C;  3V76 A;  2RQP A;  3K4L A;  4DV6 M;  4FW9 A;  1UGR B;  3IKV A;  1XG1 A;  3CCM I;  3HDD A;  3G1L A;  3DBR B;  1O7L A;  1AUA A;  4PJL A;  3ZQF A;  3JRF A;  2JWS A;  1XMQ M;  4YHH M;  3BR2 A;  1G2H A;  2FQ4 A;  3K9P A;  3DPT A;  2JY6 B;  5ITX A;  3E5X A;  3OY9 A;  1K61 A;  3O0G D;  2DJI A;  3TQN A;  3RTR A;  3H3V K;  4BCM D;  1MJB A;  4YEJ A;  3J81 S;  3TW7 A;  4NRV A;  5DDG A;  2RGH A;  5FTJ A;  1MBH A;  2ADU A;  2K40 A;  3M9A A;  1KFV A;  1GL6 A;  3E5Q A;  2D2W A;  4F7S B;  2JY7 A;  4GYG A;  4XKV A;  1V29 B;  3B7N A;  1XMK A;  2STT A;  1VND A;  4L9T A;  2YNM D;  4RM3 A;  4IBD A;  4CFN B;  1OQY A;  1YW7 A;  2CHV A;  1JGS A;  5LEJ A;  1ORY B;  2BE5 F;  1G4A E;  4A6D A;  4GIT A;  2DA6 A;  1JE8 A;  2C6T B;  3PNV A;  3C2G A;  4M3G A;  5HS7 A;  2DZN B;  5CVV A;  3GBG A;  4L8R C;  2ID6 A;  3FXM A;  3ASO H;  3VPR A;  2GNO A;  4FD2 A;  2ICW G;  3ZOB A;  2ZJR F;  3AOE A;  4Z2Y A;  1GDT A;  1KYI A;  1T6S A;  3FXL A;  5E8G A;  1R22 A;  1CUK A;  3ZMV A;  1L8Q A;  3VDX A;  1B9M A;  1VQ6 I;  1D1A A;  3TOA A;  5EEA A;  4UUS B;  2R5Z B;  4LG0 B;  1GL7 A;  3ZCO A;  2EA4 A;  1VQO I;  1D8J A;  1OIZ A;  4N4N B;  2AO9 A;  2DQR A;  1QPI A;  2KIQ A;  2XPW A;  5DUK A;  1B6A A;  4NST B;  4BY1 J;  3J7B A;  2E7W A;  2VII A;  2FH0 A;  2O3F A;  2OCC H;  4M3D A;  1MGT A;  1G8X A;  1T08 B;  4BBA A;  4BB9 A;  3LSJ A;  3KPH A;  2VOO A;  2IGK A;  3OYJ A;  2VC0 A;  2XSJ C;  4NDL A;  4WXH A;  4OAZ A;  3GLI B;  2WV1 A;  4XON A;  3BZ6 A;  3JCU C;  4JI5 M;  2M4K A;  5E1Z B;  2W9Z A;  1DGB A;  4IBE A;  2IJL A;  4KT5 C;  5CYI B;  4FCT A;  3FD9 A;  2X6X A;  4ASN A;  1SFO J;  4IBF A;  4LFC M;  5HOD A;  1IGN A;  1HDD C;  3C3E A;  3VYH B;  4HZF A;  3BRO A;  3OYL A;  1HOM A;  5HDN A;  4BCM B;  1TH2 A;  1NH3 A;  3M7G A;  3SYT A;  1P3Q Q;  4CCL A;  3W67 A;  1ZGJ A;  2E7X A;  3KS4 A;  5KVR A;  1Z5A A;  1RR7 A;  2MBF A;  3HPG A;  4M6X A;  2IVX A;  4KUM A;  4HAM A;  4M71 A;  3ML6 A;  3HRU A;  3TO9 A;  3PIP F;  2ZPF B;  4ZGJ B;  2LBC A;  2DMU A;  3BCA A;  1XMX A;  2FE8 A;  3F22 A;  2M4G A;  4JX4 A;  2QA4 I;  1YQA A;  4FCW A;  2IAI A;  2ZO4 A;  3GF2 A;  3AG4 H;  5JLX A;  5EGO B;  1YRN B;  3I4M J;  4A3F J;  4B3T M;  2EZI A;  2Y9Z A;  2ISY A;  1H26 B;  5IDN B;  1FEX A;  1FVV B;  3FTF A;  5M5Y J;  3PSF A;  2FOI C;  4MLO A;  2E1N A;  4JN6 A;  3HJE A;  2DCE A;  4PJJ A;  1TBX A;  4A3I J;  1ZRD A;  5DCF A;  4X66 M;  4CHU A;  4I2O A;  4FX0 A;  5EQT A;  4A0X A;  2E5L M;  3A2K A;  3DKX A;  2DBB A;  3ROU A;  5K7Z A;  4KIB A;  1OFC X;  3SAV A;  3DCF A;  5HNH A;  1XXH B;  2M45 A;  3BG3 A;  3DA1 A;  1IY1 A;  2OQR A;  4BBS M;  5ACB A;  4EV0 A;  3IHP A;  3FTC A;  4DZJ A;  4BE1 A;  1DPU A;  3U6P A;  4HDU A;  3L28 A;  2FNA A;  3CQZ J;  3ULQ B;  4Y13 A;  1PDN C;  3IP4 B;  2QWW A;  2WSF F;  5IZ7 D;  3BR6 A;  1YS6 A;  5IT9 K;  4ANR A;  4LG3 A;  2M0C A;  5TJJ A;  1YG2 A;  1R71 A;  3AL0 C;  2IW5 A;  2KRF A;  4F92 B;  3HY5 A;  3PL8 A;  1IRZ A;  2KZU A;  1QQI A;  1TT0 A;  2AQE A;  3RYR A;  3LA7 A;  1G3S A;  2BHZ A;  1Z3X A;  3TOB A;  4LJZ F;  5ILU A;  4BXX X;  3KYL A;  4IKF A;  4I8O A;  4L78 A;  1MSE C;  1BR2 A;  1TLH B;  4RAG A;  4A3K J;  5A2Q K;  1QHH D;  3RI4 A;  1G8P A;  2DTZ A;  1X1D A;  2XHK A;  4XLA A;  1K3X A;  5FTM A;  3U21 A;  5LBQ A;  3HXL A;  3WOD F;  3TO6 A;  4ENM A;  4L6V 6;  3BG7 A;  3C2H A;  3FWE A;  3TDU C;  3U5Z A;  5HVQ C;  1V5F A;  2F5C A;  4IBB A;  2EO2 A;  1D1B A;  5F0C A;  3GRU A;  5DYI A;  3LQR A;  2BEO A;  2XGE A;  2R4G A;  3KET A;  4IZZ A;  1F5T A;  3CC2 I;  4KNY A;  4EON B;  4L4U A;  2DWZ B;  3A45 A;  3JR5 A;  2OU2 A;  3VKH A;  2LRE A;  2E19 A;  2JWT A;  3GZ5 A;  1WR1 B;  1QDR A;  5FLM J;  1PRB A;  1CGP A;  3E21 A;  3CD6 I;  3IWZ A;  3TPZ A;  4I81 A;  1P4W A;  2KRK A;  3NWL A;  2V1U A;  4K0K M;  2R7Z J;  3G33 B;  4G6D A;  4HYE A;  3SDB A;  2E2H J;  3I71 A;  3KFU G;  2J5Y A;  5LGN A;  4HF0 A;  2DA5 A;  2A5W A;  1T8I A;  2XGN A;  1YE9 A;  2XF6 A;  4X6A J;  3H4M A;  5DD4 A;  5EEG A;  2EIL H;  4M9X A;  3K7A M;  1R00 A;  4HEO A;  3KLN A;  1VOL A;  5ICE A;  2WMA B;  4MIM A;  1WGX A;  3GLX A;  3MK6 A;  1S7O A;  4UY8 I;  3I59 B;  1OCZ H;  3FMR A;  2C9O A;  1UCR A;  3W6K B;  5DYM A;  1OI9 B;  1VDD A;  4BCQ D;  4HPQ A;  3T15 A;  2VBW A;  2IEK A;  2OPF A;  2OZ6 A;  4IMY B;  5EEH A;  2Y2Z A;  1BC7 C;  3HGG A;  3E7L A;  3HHY A;  5KPZ A;  1Q02 A;  1P4A A;  3HIF A;  3LWF A;  5BNG A;  4D9J A;  4JI3 M;  1V4R A;  2V1D A;  3KXE C;  3BOQ A;  2NRA C;  4RGR A;  4CCM A;  3HM5 A;  1JT6 A;  4B44 A;  1TDH A;  4Y33 A;  1HJP A;  2QYO A;  2MC4 A;  2XAU A;  3BJO A;  2XRO A;  2HOA A;  5FRM A;  1JOW A;  4CIS A;  5FO5 A;  1MNM C;  4YOZ A;  2DO7 A;  3AFH A;  4AD9 A;  3AL0 B;  4A69 C;  1LB2 A;  3I55 I;  5E6J A;  4M9Z A;  2KZS A;  1ZN2 A;  1LFU P;  5CJ9 A;  3ZMZ A;  1XCB A;  1N36 M;  2DVW B;  2P5K A;  2C5N B;  4EQQ A;  2DOF A;  1PJQ A;  2WY8 Q;  1JR3 D;  3M1C A;  4P16 A;  4R71 A;  3VEP A;  5K7F A;  2FRH A;  5E17 F;  2XAJ A;  1WHU A;  2RKH A;  2EZK A;  2EZH A;  3KS8 A;  4HLY A;  2CCI B;  2CO5 A;  4EGY A;  1WCM J;  4PJM A;  4WXD A;  3QPL A;  4JBA A;  3IAM 2;  3QPH A;  3DU5 A;  3KSX A;  2KQR A;  3PJR A;  4OX9 M;  5CYV A;  1RES A;  4DNC A;  1VZ0 A;  3KP3 A;  3CCU I;  2PJQ A;  2L54 A;  2P7V B;  5KCM A;  2N35 A;  2H09 A;  3PIO F;  2KIU A;  2DK8 A;  5LHG A;  2R7O A;  3OYF A;  1Y8G A;  4CGY B;  1WPK A;  2CU7 A;  1WJD A;  2DMT A;  3H5N A;  3KP7 A;  2EKF A;  1ZRC A;  4ZGD B;  2HOT A;  2YUS A;  1JUS A;  4CUG A;  1BJZ A;  1IV6 A;  2WMB B;  4EOK B;  1N32 M;  4EOQ B;  2DA7 A;  2BY2 A;  4BE2 A;  4F6U B;  2R7X A;  3B7Z A;  1XSV A;  2DU9 A;  4Q47 A;  3Q3S A;  3WTU C;  4LB5 A;  1RNL A;  1GKI A;  2QCU A;  5FRN A;  3HB9 A;  4WP2 A;  1FNN A;  3S17 J;  2PN6 A;  2X1N B;  1IRX A;  3WTX C;  5FGK B;  2BXZ A;  4ROE A;  2CRG A;  2G5G X;  1SXJ A;  4BCQ B;  1J0R A;  3L25 A;  5DTD A;  1OCT C;  4YFN F;  4XIC A;  4I98 B;  4NC8 A;  4H4K C;  1FOW A;  3X26 B;  2CUF A;  2HKJ A;  1NV8 A;  3M6A A;  2HTJ A;  4M0D A;  1QGP A;  3V42 A;  1VQ5 I;  3OSF A;  3S1Q J;  2L3D A;  2ZKZ A;  4BCI B;  3F8M A;  2EFW A;  5C18 A;  2JZY A;  2HWV A;  2FF4 A;  1A31 A;  1K7A A;  2HL7 A;  1UGQ B;  3M4O J;  1Q3B A;  2HXO A;  1XMO M;  4F6S B;  2BS2 A;  3E9S A;  4UVA A;  3J2P B;  2MD0 A;  4ZDL A;  4NL4 H;  2BKZ B;  2EIK H;  5LFA A;  4I3Z B;  1R5G A;  2M8G X;  4UN2 B;  3DFZ A;  4M9S A;  1YUB A;  1KU9 A;  3NWS A;  2E35 A;  4EJO A;  3K6G A;  3VYS B;  3LNQ A;  3QU3 A;  1WZ2 A;  1ERD A;  1OL2 B;  1I1S A;  1WFX A;  1PM5 A;  3KLO A;  3TW6 A;  5IOZ A;  2L02 A;  1H88 C;  4XLN F;  4OWR B;  1TF0 B;  3SHF A;  2O9L A;  4XL9 A;  1OR7 C;  4L9J A;  1RET A;  4BCG B;  1NHW C;  2Y0T A;  5EXS A;  3X24 B;  2VE8 A;  4I0B A;  1UHM A;  3JRC A;  4EC9 B;  4XOT A;  3GLG E;  5GPA A;  1USS A;  2IBD A;  3L29 A;  3GQ4 A;  2XB0 X;  2JQ7 A;  2M60 A;  2I5U A;  2LH9 A;  2M5Z A;  3HGY A;  3TGN A;  3RQ4 A;  2K3F A;  2DFI A;  4OIN F;  4B09 A;  3ABK H;  2V7F A;  1HDP A;  1IFY A;  4XBO A;  4AG5 A;  1S7E A;  2ID3 A;  3KP2 A;  4XK4 A;  5E3L A;  4D7N A;  2G8L A;  1R23 A;  3CCL I;  2LHG A;  3B9P A;  3GLF E;  4DR1 M;  1QA6 A;  3F8N A;  4J01 A;  2MLG A;  1YIO A;  2LYC A;  4ITV A;  3WE2 A;  3ZN0 A;  3OYK A;  2W7N A;  3QHW B;  2R46 A;  3L2U A;  4KRD B;  1YJW I;  1OAO C;  1UFM A;  1QAM A;  1Z05 A;  3C9P A;  2K9L A;  3CP2 A;  1TZL A;  2MC3 A;  4A3V B;  1I6X A;  1BA5 A;  3MMY B;  4I09 A;  2UXX A;  3KZY A;  3TL4 X;  5BNJ B;  1LDK B;  1WHC A;  2HKO A;  2IRF G;  1KU2 A;  1S29 A;  2WEV B;  3WHC A;  1NHG C;  2FA5 A;  4UVB A;  4G6Q A;  3FXO A;  1G3N C;  5CLS A;  2K4B A;  3A8G B;  2DYR H;  2X1D A;  1KZH A;  2QSG X;  1MJ9 A;  3S1R J;  1UNL D;  2WJ9 A;  4FQG A;  1Z1D A;  3QP6 A;  3I04 M;  4FE7 A;  1MNE A;  5DCM B;  4U7B A;  4LLN A;  2GA2 A;  1C9B A;  2QEN A;  2R7S A;  2DFF A;  3H1C A;  2ME6 A;  4S0H B;  3FMQ A;  5C3E J;  2LC2 A;  1GT0 C;  2O61 A;  2Y31 A;  2PMZ A;  1MN3 A;  3CP8 A;  4ON0 A;  3S8P A;  4QTR A;  1RUN A;  3QYE A;  2C6Y A;  5GAE J;  3DTI A;  1JGG A;  4MGH A;  3HKZ A;  1BR4 A;  1Z0X A;  4M6Y A;  2JVG A;  2QSF X;  1RIO H;  1TQM A;  2EWN A;  2M3A A;  5E18 F;  4JQF A;  1XMA A;  2BYV E;  1DGH B;  1SVL A;  3CF6 E;  2N8G A;  2JY8 A;  4IX7 A;  4X1E A;  3PFI A;  2VC1 A;  4NBQ A;  4AWX B;  2L7H A;  3CCS I;  1IAW A;  3V8L A;  1WJ7 A;  2W96 A;  4EOI B;  1BOA A;  3SYK A;  2DD5 B;  3QXE B;  5GP9 A;  3TBI A;  3KW6 A;  4JI0 M;  2D7G A;  3DXJ F;  4FM4 B;  1N4M A;  1XC5 A;  2DAI A;  2QUF A;  2ZME A;  2NNY A;  3SXY A;  3D8B A;  2ZSI B;  2HCB A;  2BGC A;  1EFU B;  2YQZ A;  1NTC A;  5KQD A;  2BVM A;  3OS2 A;  3DPU A;  3F5X B;  4KDP A;  3GQ5 A;  2KLO A;  1QAN A;  4LIT A;  1U9O A;  1KU7 A;  2DXB B;  2F5N A;  2KRH A;  4OB0 B;  1O4X A;  4BCO B;  1V55 H;  5F1J A;  4MFE A;  4XRS A;  4LY6 A;  2EFQ A;  2JZ0 A;  4QIW N;  1IDY A;  3HTU A;  1WH5 A;  2VUM J;  3WTZ A;  3KEO A;  1U8R A;  3SAR A;  2NOJ B;  1PUF A;  1GV2 A;  2VXZ A;  4HNU A;  1ETQ A;  2O8K A;  2L6O A;  2IW6 B;  4MGI E;  3F9K A;  3GXO A;  3I4Y A;  2LFB A;  4J19 A;  3AG1 H;  3SZT A;  1TNT A;  4G12 A;  4HEA 2;  3WHB A;  3ZCB B;  4EOM B;  2EKK A;  3BPV A;  4ENJ A;  4K2E A;  2Y0S N;  5FGM A;  5GAD J;  5E20 A;  4NOO B;  4JI1 M;  2WAD A;  1SD6 A;  2AXT C;  3OL4 A;  1XDU A;  4R79 A;  5JI3 E;  1LE8 A;  2TCT A;  4M72 A;  1TH4 A;  1KGS A;  2JA6 J;  4DR6 M;  2Z9O A;  3GTL J;  2YPR A;  1WQ2 A;  1I5Z A;  4JP0 A;  2IA2 A;  4LJ6 A;  1IXS A;  2WAF A;  3E1S A;  2HYJ A;  1W7P D;  5EP1 A;  1I39 A;  4C3J J;  1O3R A;  2MGQ A;  2KJC A;  1JSU B;  3IUO A;  2KNA A;  2DAO A;  2UUZ A;  3V7C A;  4H0E A;  2BPM B;  1Z77 A;  1SC7 A;  2H1K A;  3PUF A;  5D4S A;  1X1B A;  1XGN A;  4CCO A;  2LKX A;  1KQ8 A;  2JA8 J;  3MN2 A;  4DYQ A;  1FKM A;  4X65 M;  4IBC A;  3KE2 A;  3N97 A;  1WIV A;  2UZL B;  1WGN A;  1A6I A;  1FYL A;  1W98 B;  3I4P A;  1NJG A;  4BXU A;  2K85 A;  4F91 B;  1GUU A;  4I76 A;  5EXT A;  2CSO A;  4UHT A;  1T95 A;  3EUA A;  1TWH J;  3PXG A;  1OLT A;  5IYC J;  2EV6 A;  2MLK A;  3GLF B;  3BWG A;  2GQQ A;  3OOP A;  2D1H A;  4LJ5 A;  4EJV A;  1P9Q C;  2JN6 A;  2NS7 A;  3SAU A;  3VDP A;  3U9G A;  3MY5 B;  2PMI B;  3KOX E;  1B59 A;  3P9C A;  2LW4 A;  3A8O B;  5ITU A;  2V1N A;  1Y0U A;  4II7 A;  3EUH C;  4HW0 A;  2FUG 2;  4I4L A;  3BHT B;  4B7F A;  1R5L A;  2DFE A;  5FTK A;  3E5U A;  1OPC A;  3HHZ A;  4U0V A;  4UVC A;  1RKW A;  4B1R A;  1FIP A;  3J7Y J;  1ZHF A;  5GPC A;  3GLH E;  5FSW A;  2H8R A;  2KA6 B;  4G6L B;  1ZV1 A;  4UB8 C;  3D5L A;  1K79 A;  3L2V A;  1LPQ A;  3CES A;  3IH3 A;  4HST A;  2CWB A;  4F7Z A;  1F4K A;  2L4A A;  1AU7 A;  4LIV A;  3J80 Z;  3H3U A;  3IG8 A;  5TGT A;  3B74 A;  2X9D A;  4AU7 A;  3OR2 C;  3ABT A;  2RVC A;  1XGO A;  4ESF A;  3TNW B;  3L9F A;  4WF2 A;  2KT0 A;  3LOC A;  4P17 A;  3IH4 A;  4M3B A;  5C44 J;  2EQR A;  3BXW A;  2AXL A;  2F4M B;  3FKE A;  5KHD A;  3EYI A;  3WU0 A;  5FD6 A;  1OGU B;  1I94 M;  1TTY A;  3LFU A;  4DV3 M;  3JRH A;  3S15 J;  4I5S A;  4MNU A;  4IIW A;  2WB1 A;  4A0Y A;  5LHH A;  1U8B A;  3HO8 A;  4KN7 X;  5FB2 A;  5EFQ B;  5LGT A;  2EJR A;  3BPX A;  1FTT A;  2R7G A;  3IWF A;  3HOU J;  4RAF A;  1NV9 A;  3GLI A;  2PHG A;  1IN7 A;  3O3K A;  3HUG A;  3E6B A;  5EDN A;  1MDM B;  1BL0 A;  4S05 A;  2R7R A;  3AJI B;  4KHP M;  3Q9S A;  4AIH A;  5J8F A;  4PFO A;  4F55 A;  3F23 A;  2VOP A;  1X3U A;  2WTE A;  2JUJ A;  4AC0 A;  2VQG A;  3FDY A;  5E1X A;  4DIQ A;  2VKH A;  4ZYD A;  1VQ8 I;  4CFM B;  4DZP A;  4OVZ B;  1J59 A;  3FRI A;  3FXJ A;  3CMY A;  2LHC A;  4IVN A;  4MEX F;  2FBH A;  2PFB A;  1XPX A;  1SMY F;  3K0L A;  2CG4 A;  1UM8 A;  3IG5 A;  1FP2 A;  1KSF X;  1D1C A;  1D0Z A;  2QQA A;  1MMA A;  2D1V A;  3GRY A;  2K5C A;  4BBR J;  3ERE D;  3HOW J;  2IS6 A;  2X4A A;  4XK8 F;  3TWK A;  4DV4 M;  1D0X A;  3JRE A;  4I99 C;  1IRG A;  1NY6 A;  4NNJ A;  4ELJ A;  3CDL A;  1PJS A;  3I64 A;  1YRN A;  1I27 A;  4IHW A;  2LBF B;  4IHT A;  2WZJ A;  1GHC A;  1VEK A;  2LLK A;  4OOI A;  4XRF A;  1G3T A;  2ZFU A;  2WWY A;  3KP4 A;  3F92 A;  2YSR A;  3KP6 A;  3OIO A;  5IP7 J;  1XWI A;  5DQV A;  2LD5 A;  3OYB A;  1IN5 A;  4FWG A;  4MGZ E;  3BQY A;  4LF4 M;  4LGY A;  3PQJ A;  4B4C A;  1JKP C;  4IQJ A;  2DHY A;  4HNV A;  1XX5 A;  3C7J A;  4CFV B;  1TGU A;  2F4V M;  1PP8 F;  1NK2 P;  2XV4 S;  4OIR F;  4CXA B;  2QLZ A;  5LRS A;  1J7K A;  5KQ8 A;  2M8E A;  2NVX J;  3HHX A;  1JKR C;  2CWE A;  2OO9 A;  4P5O A;  1A04 A;  2CQQ A;  2BJW A;  2QKM B;  3BTJ A;  3O8H A;  1ZTR A;  4BL0 B;  2Z4S A;  1WI9 A;  2HAK A;  4AID A;  2X49 A;  2DI3 A;  3F72 A;  1QBJ A;  3HC7 A;  1O3T A;  2R7V A;  1VIN A;  3RQI A;  2W2H A;  1PJJ A;  4RF0 A;  1KQ9 A;  3HSE A;  2UUA M;  3MAJ A;  5ILS A;  2A05 A;  2BY3 A;  3TKY A;  3QPT A;  4D1Q A;  1XB4 A;  1HT2 E;  1O57 A;  2OF7 A;  2RNG A;  4C2U A;  3CUQ B;  1XHB A;  1HKT A;  4BNC A;  2IA0 A;  4D81 A;  3PFY A;  4N9I A;  4WWC A;  3CMM A;  5ITY A;  2Q1Z B;  3L2A A;  5HLH A;  2R7F A;  2WPA B;  2IA1 A;  3KYD B;  2ZJP F;  3I4N J;  4P9F A;  4LZJ A;  3TNH B;  3R0A A;  1G59 A;  1TWG J;  2M0M A;  3Q8G A;  4R3D A;  1J09 A;  2UV1 A;  3U6M A;  2CQ7 A;  4EM1 A;  2LVS A;  2VPR A;  2XPU A;  2R7D A;  2EUC A;  2JSC A;  4A5N A;  3F8C A;  4QNR A;  2L0K A;  3DEU A;  4QLC U;  2DTR A;  4B48 A;  4ZDP A;  2VT3 A;  3HSF A;  5FTN A;  2QHO B;  1IBL M;  1RI7 A;  1V54 H;  2HDW A;  2V26 A;  4LF6 M;  2XVC A;  4F93 B;  3SAW A;  3WG7 H;  1OKW B;  5HBE B;  3CGW A;  4YRV A;  1WJC A;  1AKH A;  2WAQ A;  2BY1 A;  1EF4 A;  2E2I J;  2XGD A;  4TV7 A;  4DV1 M;  1B8I B;  3GLH B;  4CCN A;  1IG7 A;  1ZRF A;  2G9X B;  4IJA A;  4QOS A;  3HHT B;  2VBX A;  2L9N A;  1FSH A;  4RB1 A;  3FBN B;  2JXN A;  3U1D A;  5JLW A;  3VDU A;  1WSU A;  1BIB A;  4KA4 A;  1D2N A;  4LLL A;  2Z99 A;  3BP8 A;  3P5J A;  2LXE A;  4BY7 X;  2YU3 A;  1U2W A;  2XH9 A;  2QF7 A;  3G71 I;  2ZZD B;  3M03 A;  3TED A;  2BV6 A;  1HR0 M;  3K9T A;  3B6A A;  3I59 A;  3LSM A;  3O6B B;  1IY2 A;  4XID A;  2V6Z M;  4GYI A;  1H89 C;  4NRW A;  2EV0 A;  1F1Z A;  1W1W E;  3U60 A;  5CKT A;  2ERC A;  3IRR A;  3CF5 F;  1BVS A;  2LTU A;  4BCP B;  1G41 A;  1HW2 A;  4JI2 M;  3CCJ I;  2L9S A;  3SZG A;  1X3W B;  4DR5 M;  3U6L A;  1LFP A;  2B7E A;  1T98 A;  2ZXJ A;  3GME A;  5HS9 A;  1R58 A;  4E4H A;  1FY7 A;  1HLV A;  4B3M M;  2NQ8 C;  3J27 B;  1Z21 A;  2E5N A;  1P2F A;  2XF3 A;  2ZBK A;  4IF4 A;  3O8G A;  4LIU A;  2Y69 H;  2KPM A;  1ZMW A;  4W97 A;  3JRG A;  1ZQ9 A;  3AG2 H;  3ISP A;  4ZZL A;  5L3G A;  4FWH A;  4BQO A;  1R1U A;  4ZZD A;  4GIP A;  3BR3 A;  2C5V B;  2STW A;  2CH0 A;  1D3U B;  1W5S A;  1VQK I;  4AKH A;  2JUC A;  1ZLK A;  2RAE A;  3EIH A;  2BW3 A;  2VQH A;  3QYF A;  2NVT J;  1X58 A;  1S9H A;  2ECC A;  2CHG A;  3M07 A;  3TDZ C;  2CZ1 B;  3CDH A;  2W57 A;  2LRD A;  2FQ3 A;  1UEL B;  2CW7 A;  2HEO A;  4ENK A;  1LVA A;  1XCV A;  4PDI A;  4XNF A;  2R5Y B;  3R6S A;  4AQY M;  2IW9 B;  5JVT A;  1IRE B;  1X3Z B;  5HLT A;  3S32 A;  2ZPE B;  3RKW A;  2MYS A;  2EBI A;  1WI3 A;  3GPU A;  2C4G B;  4PZJ A;  2X1C A;  1TWA J;  1STZ A;  5H6R A;  3J80 S;  3OR1 C;  1TD6 A;  1WJA A;  4BAC A;  2DXC B;  3M0E A;  3DOA A;  2F48 A;  2UXD M;  2CHQ A;  4L16 A;  1Y0N A;  5ITX E;  5GTH C;  2NS8 A;  1ZEL A;  2VJJ A;  3QU6 A;  4XQF A;  2JT1 A;  2LDU A;  2V79 A;  2L4F A;  3DTE A;  2FFJ A;  3LL7 A;  1TFB A;  2HZD A;  3SAS A;  1WH7 A;  1W5C C;  3WU2 C;  4X0G A;  1E94 E;  1FYK A;  5CQE A;  2BWE A;  2BY0 A;  2VB6 A;  1XSX A;  3S2W A;  1UG0 A;  1O9K A;  1V34 A;  2CQN A;  5J8C A;  2VE9 A;  4Y15 A;  5DM7 F;  3AV0 A;  1HST A;  1S3J A;  4O3M A;  4HDV A;  3RFW A;  4GRI A;  1A5T A;  2R7Q A;  1W0T A;  4CZC A;  5JR3 A;  4KFC A;  4D82 A;  2M1B A;  1UST A;  2KXE A;  3DBH B;  3HKZ N;  4LLG F;  3CF0 A;  3LSH A;  4C3H J;  3B02 A;  2COM A;  5F0F A;  1JXS A;  3HX3 A;  4G4N A;  1T0F A;  3HGI A;  4DYC A;  2R7W A;  2UWM A;  1GLN A;  1U5T A;  1IBM M;  2ZAO A;  2H8W A;  4JV5 M;  2K9Q A;  3F3X A;  2OC6 A;  1T38 A;  2NXN B;  3VWB A;  3GTQ J;  2QBY B;  2VPL A;  4BH9 A;  2EFN A;  1OTR A;  4JX6 A;  1I3Q J;  5L3C A;  3HRT A;  4BEH B;  1JT0 A;  1FJL A;  1JR3 A;  4LRS A;  4UNO A;  5D8K B;  3VYT B;  1H6U A;  5E8I A;  4E7Z A;  3LAP A;  1VI0 A;  2V9K A;  2UUE B;  4E7H A;  2I53 A;  2ZPG B;  1MKM A;  2WAE A;  2XEP A;  4ZTJ A;  2LMD A;  2GWR A;  3U61 B;  2DDA A;  3REO A;  4A3J J;  3K1N A;  3RPU A;  4JI8 M;  6PAX A;  3GUD A;  1AHJ B;  5DYG A;  4OGR B;  1FSE A;  4BAY A;  2LKS A;  3A01 A;  3K1P A;  3W6J B;  3V7S A;  4AZF A;  1HBX G;  1JHH A;  1E9R A;  1MJG M;  1QUT A;  4LOC A;  4RAY A;  3U6Q A;  3GP1 A;  3L09 A;  1VG5 A;  3RGP A;  1PJI A;  2A6H F;  4G7H F;  2CEA A;  3ZQG A;  1GVD A;  2LR8 A;  3GRV A;  1FT9 A;  5D4R A;  2PJR A;  3HOZ J;  2P5T A;  3A8M B;  2KDO A;  3VFD A;  3K92 A;  2XLJ A;  1SFK A;  1RUO A;  3UGJ A;  3NBX X;  4LK1 F;  2CZ0 B;  3QYH B;  3IRQ A;  3MKW B;  1OKS A;  4CZZ A;  5DFL A;  1VQM I;  5J1U A;  3HHG A;  2Y0Q A;  3MZ8 A;  4NB5 A;  2DHR A;  5F08 A;  3IKT A;  2HWJ A;  4MM3 B;  1L2C A;  3BQZ A;  2CCH B;  2E34 A;  2KIS A;  2CZ6 B;  3PVS A;  3J7Z I;  5ITQ A;  4ZH4 F;  1G71 A;  5EG0 A;  1KQ0 A;  4KIC A;  2OA4 A;  2F2E A;  4B43 A;  4BXX J;  1H0M A;  2GXG A;  1IZ1 A;  4OB2 B;  2RRU A;  2K9S A;  3C2B A;  2XIG A;  3F0C A;  3F6O A;  4PGG A;  1OCC H;  4A3C J;  4C30 A;  1XNR M;  1IUF A;  9ANT A;  2QEX I;  1NNJ A;  4F52 A;  2FOK A;  4ITQ A;  3UMM A;  1O3Q A;  3E6D A;  1WGL A;  2C9C A;  2J7O A;  3HZJ A;  3K7A J;  1GVN A;  4LJ4 A;  2RDP A;  2XGC A;  3T8T A;  2F5O A;  3ZQI A;  1WJE A;  3L27 A;  3T1B A;  4WK8 F;  3QP5 A;  5DEQ A;  4BDZ A;  2OPT A;  1RR8 C;  2CJM B;  2JNH A;  4IL6 C;  4IHX A;  1TR8 A;  3BZK A;  2XAS A;  2VF7 A;  3FX3 A;  4MQV A;  3IL2 A;  4DV0 M;  4DV5 M;  1LNW A;  1E3H A;  5D6E A;  3R8F A;  3RCO A;  5LD2 C;  1B72 A;  4Z8X A;  2GBY A;  1FLI A;  3MMP A;  3U2R A;  3HOX J;  4EIW A;  2GAU A;  3BTL A;  3W0L B;  1OYI A;  1VYW B;  1YIJ I;  4BJ5 C;  2FSW A;  5FKK A;  4PSX A;  5AIP A;  2K02 A;  4DW6 A;  4NSR A;  3PQK A;  2DI0 A;  3L2C A;  2KKO A;  1K4S A;  4M74 A;  1SAN A;  2A6E F;  4IOA F;  2L5Q A;  1FOX A;  2KNV A;  1OR7 A;  3QRF F;  4IJF A;  5L3E A;  1L2D A;  2WA0 A;  5JVG F;  1K6Y A;  3TNI B;  1H8A C;  2BNK A;  3ABM H;  4YFX F;  2XSZ D;  1T33 A;  2HNH A;  5CVU A;  2XSD C;  2YX7 A;  2QPA A;  1FZP B;  1FOK A;  3GTO J;  4N4O B;  1AIS B;  1ODD A;  3P9K A;  4LJA A;  3RZD J;  4F70 B;  1BC8 C;  3GFM A;  3WE3 A;  1YX3 A;  2Q2E A;  3COA C;  2DA4 A;  3K2A A;  3GVA A;  2MRO B;  3LQ5 B;  2ELJ A;  4OAY A;  1ITY A;  3WVE B;  3L2R A;  4JI7 M;  4BUP A;  3FK6 A;  4BLC A;  3WTV C;  4YOO A;  4ESJ A;  3HOS A;  2ZTD A;  4G4Q A;  4I01 A;  5ICG A;  1QMZ B;  5IT9 Z;  1SEU A;  2WB1 N;  5CPR B;  3GO8 A;  2B63 J;  3V8K A;  5J6X A;  4B3R M;  4CO8 A;  3UZU A;  1LVK A;  3GTK J;  4RA2 A;  1R2Z A;  2Z33 A;  2F5S A;  1LEB A;  4WCG A;  4ELL A;  1ON1 A;  2L7Z A;  2QZ8 A;  3ZQC A;  1N75 A;  3VSL A;  3X20 B;  2OCE A;  1WVR A;  4A3M J;  1APL C;  2Y30 A;  1ACI A;  1K78 A;  5A2Q Z;  3GLG A;  4GCV A;  3CCY A;  1MIJ A;  1BJA A;  1XD7 A;  1HW1 A;  4P9U A;  2XB5 A;  4MGK E;  3J7A S;  3L2W A;  5EZG A;  1R49 A;  1JI8 A;  2IVM A;  2V9V A;  3ZMT A;  1R7J A;  2X85 A;  1QO0 D;  3VB2 A;  4B3A A;  3OYN A;  2UXN A;  2DK5 A;  3RJP A;  3GTM S;  4ESB A;  4NHJ A;  2OUM A;  3ZGK A;  1XSD A;  1EA3 A;  5GAG J;  1JHF A;  3HRM A;  4II5 B;  3SYL A;  2VQE M;  1BN5 A;  1ZG3 A;  2DA3 A;  2C96 A;  2Z2S B;  4IPA A;  2QKL B;  1MZB A;  2Z5U A;  2GIV A;  2J5P A;  2FEZ A;  4F2L A;  1MX0 A;  1JUM A;  1CF7 A;  2L4E A;  4REZ A;  3Q8X A;  2X51 A;  2DA1 A;  4GFB A;  1E3O C;  2DXI A;  3OIQ A;  4KRC B;  2JRM A;  2QDY B;  3I51 A;  2JUG A;  5E26 A;  2Y0M A;  2GA1 A;  2M30 A;  3A1Y A;  5BOX A;  2NAZ A;  5BPI A;  3GTJ J;  3MY1 B;  2CYY A;  1OIP A;  1ENH A;  3S93 A;  3Q0U A;  2H94 A;  4CYC B;  2HXI A;  4YG2 F;  4I6Z A;  4AIJ A;  3GEZ A;  1OCO H;  1AA7 A;  3MWM A;  5CQG A;  1ZAR A;  4KIS A;  4ZYH A;  2O0Y A;  1IXZ A;  2GQF A;  3HOV J;  4GHA A;  2XAH A;  3HWS A;  3FBI B;  3K2Z A;  3A4C A;  2IPQ X;  1GUX A;  5K7H A;  4NSO B;  3OSG A;  4KMU X;  3BG6 A;  5BPD A;  2L4M A;  1P7I A;  2K27 A;  2HOE A;  2ZNZ A;  3SBJ A;  1Y1V J;  3MVP A;  4EOS B;  4NXN M;  3HYI A;  4TUW A;  5TIS C;  4L15 A;  1W7P A;  5K5R A;  4D5F A;  4DBQ A;  2BBY A;  2D7E A;  1ZP2 A;  3RSN A;  2WC2 A;  4BKX A;  2Y75 A;  3ZXS A;  3G6E I;  1SXJ E;  3QAH A;  1Y6I A;  4IRI A;  3RDI A;  1NSF A;  4MH0 E;  3H4J A;  2I7N A;  1SFE A;  2QM3 A;  2XZU A;  2X1E A;  4HLQ A;  5FRO A;  2W00 A;  5DM6 F;  2DWL A;  2JGZ B;  2X0L A;  2EJS A;  3J81 K;  3GPP A;  4MEY F;  2DT5 A;  5EYR A;  5EP4 A;  2LVQ D;  1YX5 A;  3IV5 A;  1ZGW A;  1OIU B;  4IBK A;  2UXC M;  4WXC A;  3F6V A;  3ZMU A;  2MGW A;  2FJ1 A;  1SFX A;  3Q0V A;  5AIQ A;  5LGU A;  1DGR M;  3FUV A;  4PT5 A;  1MW7 A;  4AG6 A;  4PUS A;  4XLC A;  3JAM Z;  4LJ7 A;  3HSR A;  4DBR A;  3OYC A;  3E6M A;  8CAT A;  5FLX Z;  2O01 F;  3BJA A;  5KAI C;  1BR1 A;  3U5Z B;  1UJ8 A;  3ZN1 A;  3GFL A;  1HF0 A;  1QZE A;  2FE3 A;  3FYC A;  1KYW A;  2L7I A;  3THG A;  1P7J A;  1T56 A;  2LY1 A;  3FM3 A;  1RKT A;  2RRE A;  3K4N A;  4RGX A;  3LA3 A;  3BLY A;  2I10 A;  2CQK A;  4V2F A;  2G7U A;  3GRR A;  3H9G A;  1D0K A;  2GLO A;  5H2F C;  5I5Z B;  1OMI A;  3LSG A;  4YII A;  2KL4 A;  3T5X A;  1NG7 A;  2KMG A;  1GY3 B;  3K8Z A;  2KRC A;  2KZG A;  3DTK A;  1SAX A;  2FU4 A;  2K9D A;  1NNU C;  2M7B A;  1T43 A;  3L7W A;  3EUH A;  4IRH A;  2KMU A;  4MGR A;  3GTP J;  5EJC A;  2K9M A;  2VKE A;  1UHS A;  3HOT A;  5DD8 A;  3H4C A;  2R0Q C;  4R1H A;  2VOD A;  5L2W B;  3SJM A;  5E1W A;  2WHB B;  1SXJ C;  2ZPB B;  5J3L A;  5FKL A;  2R7U A;  1L1Z A;  5K5O A;  1AOY A;  2EA2 A;  2QGS A;  1MJA A;  1FC3 A;  2DPD A;  1OL1 B;  2CYZ B;  4CFU D;  2G9W A;  2F4I A;  3VK7 A;  4W5W A;  2M2E A;  3KVW A;  1HSJ A;  1SXJ D;  1POG A;  2UZD B;  2CFX A;  2IGO A;  2RNJ A;  1V33 A;  2OOB A;  3GZ6 A;  3CO6 C;  1PJT A;  3KP0 E;  4NQW B;  4MO7 A;  4RNA A;  1IF1 A;  3T1H M;  2EIM H;  3L00 A;  4EM0 B;  1A5J A;  4DR3 M;  2MW8 A;  1YOV B;  1Z67 A;  3LVW A;  2KIM A;  5J40 A;  1ZRE A;  3H0G J;  2F4O B;  3OIP A;  4BCH B;  1FIN B;  2KR6 A;  1XN7 A;  2ZXI A;  1FWZ A;  3VFZ A;  5JHF A;  4RB3 C;  1R2Y A;  4V2G A;  3UKG A;  5TRD A;  2K7L A;  3MQ0 A;  4J00 A;  4L0Z B;  4L5I A;  1ETX A;  3CME I;  4LK0 F;  1IDZ A;  3A02 A;  2ZAM A;  1QRY A;  2DJN A;  3FKI J;  2Z16 A;  1Z6T A;  4Z6Y A;  1BIA A;  3EQL F;  1P5E B;  3GPX A;  3HU1 A;  1Y8R B;  2ZXW H;  2PJP A;  2ZCF B;  2HQ5 A;  2IS4 A;  2XKO A;  3R0J A;  2VIX A;  1A35 A;  3T8R A;  1HXD A;  2OJE D;  5EZH A;  3RKX A;  2A07 F;  2DMQ A;  3H5R A;  1H4L D;  3LQQ A;  5J47 A;  1SD4 A;  3GZN B;  1EH6 A;  4EC8 B;  4Y28 F;  4AKG A;  1DUX C;  1LTM A;  1J2X A;  4XOP A;  3QOD A;  1YW8 A;  2KP6 A;  3D8L A;  1LDJ A;  2IT0 A;  2R4E A;  2W84 A;  4LF5 M;  3JTH A;  1T2K A;  1QPM A;  5IT9 S;  2JA5 J;  4AM3 A;  2LVA A;  1A36 A;  3BBZ A;  1KON A;  3SMS A;  2WXV B;  1K82 A;  2KIF A;  4BDY A;  1URC B;  1F9N A;  3ECO A;  1NY5 A;  1YJN I;  3ZQL A;  1JTY A;  3G73 A;  2MH8 A;  2D7H A;  2K3P A;  1SVO A;  2A68 F;  2VN2 A;  2ZB9 A;  3ERM A;  4CFU B;  3C18 A;  2K4J A;  2RKO A;  2TDX A;  1N78 A;  3DV8 A;  2OBP A;  2BJV A;  4XKW A;  5A2Q S;  2COB A;  1ZMU A;  2PX9 A;  1SXJ B;  2AHQ A;  1S6L A;  5BQT A;  3BR5 A;  4FTH A;  3DU6 A;  1JJ6 C;  1HA8 A;  1RPW A;  3IEC A;  2DWM A;  3OMY A;  1HC8 A;  3W2A A;  2LVN C;  3G4S I;  4XBF A;  2CGP A;  1TT5 B;  4EEF G;  2TRT A;  4GHL A;  2C98 A;  3ZQH A;  4CFX B;  5J1Y A;  1HQC A;  2PMU A;  1SFU A;  3H92 A;  3M8E A;  4ROD A;  2VQL A;  3EPZ A;  5HBJ B;  1VFC A;  1UB9 A;  1E3P A;  3ZMS A;  4WW0 A;  2VKV A;  3V7R A;  2IGN A;  2V6C A;  1S3S A;  2BZT A;  3CJN A;  3MFK A;  3S14 J;  5F6F A;  3L1P A;  2X6W A;  2R0I A;  4ZDO A;  2CRU A;  4PDK A;  4IO9 F;  3FK7 A;  3OYG A;  3WU1 B;  4ZPX A;  2R5Z A;  1TH3 A;  4LG0 A;  4MHG A;  3SEZ A;  5J4Y A;  4UUS A;  1TNS A;  2YS9 A;  2YR0 A;  1MD0 A;  2KHM A;  2R93 J;  5HDG A;  3FYD A;  1DU0 A;  5L3D A;  3D5S C;  3G3Z A;  4AVP A;  2ZME C;  2MD5 A;  3CUQ C;  4XSZ F;  4PK4 A;  5B1B H;  2QNJ A;  4KT0 F;  1EH7 A;  2YX4 A;  3N05 A;  4P55 A;  1G3W A;  2ME0 A;  3CCR I;  5FD5 A;  1TW3 A;  1E2X A;  1JKQ C;  1HQY E;  2XPV A;  3DKW A;  4FT8 A;  3EOC B;  3PO3 S;  3RGS A;  3FTE A;  4KT6 A;  3TWL A;  1N34 M;  4FAS D;  3HJQ A;  3DBL B;  3GYH X;  2HZT A;  3OWT A;  2HR3 A;  3SFZ A;  4IBG A;  5IWA M;  1R5H A;  2E1C A;  1SD5 A;  3DFG A;  2E1M B;  4IHY A;  4O5V A;  1Q39 A;  5DUI A;  1ZAE A;  3UR3 C;  3MCZ A;  3PUB A;  2I40 B;  2PBI A;  3FXR A;  2XF7 A;  3CCE I;  4DBG B;  2BS4 A;  4CFW B;  1UHW A;  3K1M A;  4UV9 A;  2CUJ A;  4BCN D;  2OD5 A;  3O2P E;  1JQJ C;  1WKM A;  4PSW A;  4XR6 A;  3FUU A;  1KU3 A;  2FD5 A;  2Q0O A;  2RQQ A;  3MKL A;  3LA2 A;  5ILV A;  1W0U A;  4P1W A;  4XKC A;  1OIY B;  4AYB A;  3U6S A;  1OJL A;  3DTO A;  4F1I A;  4CHT B;  4DOZ A;  2DD4 B;  5EGO A;  5B5E C;  2JPB A;  4CSW A;  2XAG A;  3U1K A; 
#chains in the Genus database with same CATH homology
 2DPP B;  3A8G B;  2WJ9 A;  3QYH B;  2QFZ A;  1UGR B;  3A8O B;  4AI6 A;  4AKG A;  1UGS B;  3BG3 A;  2ZPI B;  4QSH A;  4BBS M;  3QYE A;  3HBL A;  4HNT A;  4BBR M;  2CZ7 B;  4ZGD B;  3TW7 A;  4JX5 A;  2D0Q B;  4HLQ A;  3WVD B;  1V29 B;  3HB9 A;  4OB1 B;  2DD5 B;  3QXE B;  4FM4 B;  3HHT B;  4P17 A;  3A8H B;  4JX6 A;  1UGP B;  3WVE B;  3QWL A;  3X26 B;  2QF7 A;  2ZZD B;  3HO8 A;  2DXB B;  4OB0 B;  2ZCF B;  2ZPG B;  4MFE A;  2AHJ B;  4MFD A;  3VKH A;  1UGQ B;  1QLB A;  1AHJ B;  2KMG A;  4HL4 A;  3VKG A;  2BS2 A;  3DL1 A;  4HNU A;  3QYB A;  4LOC A;  3X20 B;  5EJC A;  3QZ5 B;  2BS3 A;  3H4C A;  2QQ8 A;  3A8M B;  2ZPB B;  3A8L B;  3TW6 A;  2CZ0 B;  4ZGE B;  3BG9 A;  2CYZ B;  4MIM A;  3X25 B;  4ELJ A;  4M6V A;  3X28 B;  3X24 B;  2CZ6 B;  4AKH A;  2ZPH B;  2CZ1 B;  4OB2 B;  3VYH B;  4AKI A;  2QDJ A;  3QZ9 B;  2KR6 A;  4HNV A;  2BS4 A;  3HZJ A;  1IRE B;  1FKM A;  4NC6 A;  3QYG B;  3BG5 A;  1E7P A;  2ZPF B;  4ZGJ B;  3VYG B;  2ZPE B;  2QDY B;  4JX4 A;  4Z6Y A;  2DD4 B;  3KHI A;  4OB3 B;  2G77 A;  2DXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...