4NC6A

Tbc domain of human rab gtpase-activating protein 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
b'ETWGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab GTPase-activating protein 1
publication title Tbc domain of human rab gtpase-activating protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 113
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4nc6A02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 4nc6A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4nc6A03
4HL4A 2G77A 3HZJA 5EJCA 4Z6YA 3QYEA 2QFZA 1FKMA 4HLQA 2QQ8A 4P17A 4NC6A 3QYBA 3QWLA
chains in the Genus database with same CATH superfamily
2FBIA 4MGYE 4G7OF 3J7AO 2I8DA 2DK8A 1K78B 3CC7I 4BHBA 3QWLA 2K9LA 3L26A 3DV8A 2R7QA 1U8RA 1NTCA 3BLQB 3S2DJ 3W68A 2C99A 1FBSA 2VC1A 1RR7A 2G9WA 2ZNYA 4P17A 1R5ID 5FO5A 4B7GA 3WU0A 1YJ9I 2DZOB 3VDUA 2YNMD 4DR1M 2BOLA 4OVZB 2L01A 4G6DA 4ZYGA 2STTA 3HOZJ 2HS5A 2F4OB 2XPVA 1IM2A 4HBLA 2LNHC 5HLIA 2KDOA 4CA0A 4EM1A 3HOUJ 3E46A 2VQLA 2C98A 1ZQ3P 2MA3A 2JA2A 2CU7A 2P4WA 4F3QA 2EK5A 5E20A 5ITXE 2Y0TA 3K7AJ 4BXFA 1R1UA 2CSOA 2VQGA 4IQ4A 4RAYA 3GBGA 5EG0B 2M9HA 2GA1A 2IXSA 3FDYA 1ZLJA 1PM5A 4EORB 1JJ6C 2Y0SN 1SXJE 5IYBJ 1T98A 2VJ5A 2W24A 1MBFA 3OYBA 5I5ZB 2X1EA 1IW7F 2KL4A 4E4HA 3PIOF 1J59A 1TQPA 2PMIB 4LMYA 3R0AA 5GPAA 3WHBA 1JKRC 4OW0A 4QLCU 3I59A 1PUFA 3ZRGA 4CFUB 2F4IA 3W3CA 2IAIA 4G12A 4N4OB 2V9PA 4M71A 3DPLC 3FUWA 4QOZC 1RUOA 2PBIA 5EXPA 1YE9A 2QEXI 3PO3J 4BXXX 2DD4B 2PEXA 3HU2A 1QUTA 3T1HM 1L1ZA 3MKLA 1TL8A 1QLBA 3UMMA 4B3MM 3HIFA 5E3NA 3TQSA 1W5CC 2EFNA 5HLTA 1JGSA 3WTWC 2QZ4A 3Q0VA 1VQKI 5LRRA 1D5VA 3K9TA 1S3JA 3LFUA 2UU9M 4BAYA 2CJJA 3PFYA 2HOEA 1S7OA 2EV5A 3BZKA 2DWNA 1OCOH 2R7SA 2FE8A 1H24B 3UKGA 3GLHB 1QDRA 2CUFA 2YQZA 4JI7M 3HHHA 4DUZM 1R00A 1O7LA 4RA2A 5HS7A 4GDFA 2HTJA 1ZRFA 4BBRM 2CFOA 5LGUA 4FCTA 3KSXA 2V22B 2KMGA 3L09A 3M8JA 2R4JA 3E21A 2F5VA 3CMMA 4KT5C 2M60A 2NS7A 1HKQA 2K5CA 2VQEM 2BY2A 4OB3B 1VEJA 2XRNA 2W7NA 4KMFA 4IEJA 1V34A 2M7BA 5C4JJ 1U2WA 2BVMA 2NXNB 3VFZA 4FTHA 1UZCA 2LVSA 2KRUA 2CH0A 4IJAA 5DTDA 3BDDA 2KRKA 1WCMJ 2GA2A 3OL4A 4DQ2A 3SFZA 3DOAA 1MJ9A 3RKQA 4LLNA 4LLLA 4BL0B 1BA5A 1I39A 3FUUA 4DV1M 4M9SA 2HDCA 4LFUA 2PMUA 2BHZA 4A5MA 3OYIA 4B7FA 3CCYA 5EFQB 1VQ7I 5IOZA 2KRHA 1GO5A 2NVXJ 3OYKA 2G3QA 4BE2A 4I76A 3SAUA 4GXOA 4P55A 1KQ8A 3VYGB 1TWAJ 2WXVB 2Y0SA 1SEUA 3CCEI 2DPDA 2PFBA 1NHGC 3W67A 1HJPA 2QQ8A 2O0YA 3DKYA 1RKWA 4CXFA 2EV0A 2DWMA 4X0GA 2A61A 4XLPF 2AQEA 4AC0A 1BIAA 2FXAA 2ZTDA 4A3MJ 4M6XA 1QA6A 5LHIA 1DGBA 1BBYA 5JFRA 2FE3A 2EBIA 3CMYA 5GPCA 5IHYA 2W99A 4JP0A 5K5QA 3JRAA 1KYWA 2WADA 3O3KA 1FOXA 4BGDA 1ZRCA 1N34M 1MIJA 1S9HA 1STZA 2K27A 1G59A 2HKOA 4XL9A 1MN3A 4AD9A 2HU9A 4ZJZA 1E94E 1POGA 2KDLA 2TRTA 3DU6A 4OX9M 4BQAA 4G4QA 2FOKA 1JT0A 1Q39A 3I3LA 3U6PA 4W1UA 4LF5M 4RM2A 3E5UA 1AKHB 2K9SA 3FUTA 2F2EA 3HL2A 1X2MA 1D3YA 4RMNA 3CZ6A 4BCPB 4L5IA 1RPWA 1MJBA 4XICA 3CC2I 4XR6A 2XB0X 4NSOB 3GZNB 5F1RA 2RQQA 4FETA 4NUBA 4Y33A 3FKEA 1OIYB 2M34A 3EOCB 2LRDA 2NS8A 1JJ8C 1BC8C 2C6YA 4D7NA 1YTYA 3T6PA 1FWZA 1BI3A 1MH3A 1R6RA 4KLNA 3MN2A 2CHQA 5FSWA 4G6TB 4B47A 2W9ZA 1KU9A 3GQ3A 3DFGA 2VOPA 1Z1DA 2PK2A 1Z91A 1K3XA 2IBDA 4FE4A 4A3FJ 1YRNA 2KR6A 2D1VA 2BPMB 1QQIA 5EF6A 4HDUA 1FMWA 2MC3A 3Q0WA 5F3WA 1D0LA 3EUAA 2CZ6B 4BCJB 3DKXA 3KP4A 2M2EA 3FRIA 4RGUA 1GV5A 1OMIA 4DZJA 2WSFF 1GXQA 1TTYA 3G33B 2COMA 1I94M 2XSZA 4NXMM 3ZMDA 4HRIA 2A5YB 3LCUA 3BY6A 4RLFA 1Z5BA 2ELHA 1F36A 1C0WA 3GLIE 1WKMA 4LIUA 1SD4A 3DBRB 2PJQA 2Y48A 1FX7A 2G7UA 1NHWC 2KHHA 1RZ4A 3K1PA 4I98B 3WTSC 1XD7A 2QDYB 2RREA 5AONA 2VKVA 2M45A 3HHZA 2DQLA 3CCJI 1MNEA 2QBYA 1VQNI 3JRHA 3CCRI 5HBHB 2LH9A 4BCHB 2RAEA 1TWFJ 2QGUA 1J5EM 3OYAA 3ZCBB 3QPTA 3L2WA 1DP7P 3GTJJ 5FTNA 3OOUA 1K3WA 4EVIA 1ZGAA 3VB2A 3U21A 5C4XJ 1OL2B 1IY1A 1XPXA 2DOFA 3ZXSA 4CH7A 3OSFA 3FXRA 3L00A 4OAYA 4PJNA 3BP8A 2JQ7A 3F92A 1I3AA 1Y0UA 1E7PA 2C4GB 1T8IA 3DJBA 4HX8A 1D0ZA 3KOYE 1L2BA 3ERED 3BCAA 3IKVA 2YR0A 4AIHA 1H1QB 2QM3A 3K4KA 4AKGA 3K4LA 5DDGA 2HOSA 3SHGB 2COBA 4L16A 2I7PA 1XSXA 5LD2C 1E17A 4OIOF 3HHYA 2MLGA 1UCRA 3MI9B 4UUTA 4HLQA 2VDBB 1PRBA 3U60A 2ZNZA 1OPCA 1G8PA 1Y1VJ 3GTOJ 2V9KA 1ZLKA 3FZVA 2QGSA 1TQIA 4R1HA 1N33M 5ICCA 4JI8M 5C44J 3QP6A 3B7ZA 3QOPA 1OCZH 1SMTA 5F0FA 2H6BA 3A8MB 3B7NA 3OOPA 5B1AH 3OYDA 2B63J 2OCEA 3GLGE 2MBFA 4ZDLA 1OQYA 1UELB 3CMAI 4LG0B 1UFZA 2KIMA 3VPRA 5E17F 3QHWB 3TNHB 1IN6A 1T3TA 4LFBM 1OKRA 1QBJA 1IUYA 2LDUA 4DR6M 1BW5A 4J01A 2Y30A 5FROA 3HY5A 1OR7C 3KPHA 1ON2A 2DA3A 5D5UB 2ZO4A 3J7AY 2ZC2A 1GL6A 1WHCA 2CW7A 3CDLA 3JW4A 4M0WA 2Z4SA 3CJTB 2JZ0A 4ZYAA 3KP1E 4GC9A 2C5OB 4BQNA 5J6XA 4PGHA 4XORA 2ID3A 4AQYM 4L0ZB 4YEJA 4IHSA 3KXEC 1IBMM 3HOWJ 2R4EA 3KP2A 2KZVA 2UXCM 4OAZA 1APLC 3MJ5A 3HBLA 3HJQA 2O3FA 2ZCWA 4BS9A 2O8XA 2AQFA 5EEHA 2R7DA 4M74A 1O3QA 1ZP2A 1ONVA 2BE5F 1XSDA 5DS9A 3LOCA 4IQJA 2QKLB 4QHSA 2UZDB 1EKEA 3RI4A 1W4MA 4HEA2 4G7ZF 2DI3A 5F1JA 2ECCA 3IHPA 2XLJA 2LKPA 5CKTA 2FRHA 4DIQA 2AHMA 5LHHA 4FHTA 2XZFA 1X37A 2HDWA 3G3ZA 5HS8A 5EXTA 5J8CA 4CFWB 4CYDA 4S05A 2A3SA 2NRAC 2HYGD 1P92A 2MYSA 3V76A 2VASA 4LJ6A 2R4GA 3D5LA 2IW6B 2ZJRF 2ZJ2A 3WTUC 2EUCA 3DBLB 5FGKB 3KFWX 2NOJB 1R9TJ 2KRFA 2N8GA 4G4NA 1FNNA 2L2OA 1V5FA 1JUMA 2PMHA 3K9OA 5F64A 4J00A 3GQ5A 2VBWA 2PN6A 3FXUA 1FP1D 1RR8C 1Y8RB 1OIZA 1JTXA 4IBGA 4JI4M 2D5VA 2KHMA 3NEUA 1MMDA 4HLYA 1LFPA 4PFPA 2K85A 1V4RA 5CQGA 1B9NA 2XGNA 3FTCA 2BWEA 1NV8A 1X4OA 2JVGA 2Q8KA 4ESJA 2KNZA 2X1DA 1WJFA 3A8HB 1IZ1A 2X6WA 2BY1A 3IHUA 1MMNA 4LZJA 2KP6A 3GPPA 2IGMA 4RBOA 5IDNB 2APLA 2WFYB 2OZUA 3U61B 1TH4A 2XROA 1FYKA 1GH6B 5CJ9A 2GXBA 1K7AA 4OU7A 5K1YA 3M0EA 3L25A 3BR6A 4IBEA 4EV0A 5EGOA 1D1CA 3PSIA 3KZIC 4OR5B 2DU9A 2LHCA 1AIPC 2DZNB 4E7LA 1HCRA 3A1YA 4CCMA 5C3EJ 2L6OA 4DV6M 1QUSA 5D4SA 1QU3A 2KQRA 4Y13A 4DR2M 2ZB9A 2F2CA 3E1SA 4YOOA 4UVAA 2ZCFB 2LTPA 2FQ4A 2M8EA 2XAFA 1XXHB 1E3OC 4GITA 3Q9VA 4U0YA 1HNWM 1D8JA 2LC2A 5ITRA 3OSGA 2R0QC 4IBIA 4B8XA 3HX3A 4G6QA 2LVNC 4MTEA 3TP0A 5BS6A 4FX4A 5DNYA 3BTIA 3HYIA 3R9XB 2VI6A 4N0BA 4EOJB 3HJ8A 2IS2A 2Z2SB 3FXQA 3B02A 3WG7H 3S3OA 2RDPA 2EUFA 1D1AA 3FXOA 2CWEA 2KZUA 3E6DA 3GW2A 2R5YB 3BHVB 1R22A 1WHUA 2L9RA 1ZG1A 2FBHA 3QAUA 3OYLA 3CUQA 3F9KA 3HSRA 2CV2A 1JSTB 1BW6A 2ISZA 2LF7A 3GWZA 2FOIC 4U87A 3TO9A 4AKHA 5D8KB 3VK8A 1IDYA 4UB6C 5HBEB 3RCOA 3DLAA 4BXUA 2ZANA 4L4UA 1MSEC 4BHCA 5DCMA 1X1CA 5M3MJ 3WTTC 2HZDA 4I02A 4AUXA 1KGSA 2VKHA 1HDPA 1ZH5A 2EH3A 4UVCA 2NS0A 3BBZA 2CG4A 3U6OA 2F5OA 1B1BA 1Z0XA 1MBKA 2QPAA 3HC7A 2VPRA 4MGKE 1Z59A 2K3FA 4PFOA 4BQOA 3GYHX 2XGEA 3LQRA 3GLLA 4RAZA 2HXIA 1FMVA 1BL0A 2PG4A 3S2WA 5IT9K 2OU2A 1KQ9A 3L2UA 3X28B 1SVLA 3MMYB 3SASA 1TDHA 4F7ZA 6PAXA 5ITYA 3W2WA 2M3AA 3F8FA 2WB1N 4EATA 4D5CA 1U78A 3U6CA 4UUSA 2K40A 3AJIB 2B0LA 2ELJA 1JKOC 2KIUA 2CEAA 1WJAA 2WY8Q 3D0SA 1B72B 2OPTA 4IBBA 3ZQ7A 3LA7A 5EYRA 1X1BA 4IHXA 3AFHA 4ZC3A 5JHFA 4DV3M 1QVUA 1OTRA 4U88A 3ZMZA 1E32A 2CW8A 2DFFA 4P9UA 1ZREA 4ROCA 2ZM6M 2F5SA 1R4NB 3HRSA 1HSTA 1D3UB 3A46A 1Q1HA 4HPQA 3WVEB 2MD0A 2KZGA 1XC5A 4UB8C 4XONA 2IS1A 2MSYA 2BS2A 4L8RC 3BHTB 3RFWA 2P6SA 4HSRA 1GLNA 2JPBA 4WCGA 1IXSB 1G41A 3MMPA 2BV6A 2O01F 4II2A 3MZYA 2ZXHA 3DOGB 2L9NA 1PJQA 1T0FC 2H8WA 1DO0A 1W36C 2E2IJ 4LF7M 3J81S 4LLGF 1WFXA 3IG8A 3LAPA 4V19K 1N77A 3H5NA 4B3TM 5E8GA 3MY5B 2YR2A 2LY2A 4R79A 2CWBA 4LFCM 5B5EC 4MQVA 4FCYA 2GM4A 1WZ2A 5FKKA 3JRIA 1ZARA 1CUKA 5AIPA 3FYCA 4GFBA 1P4AA 3MIAB 3QPLA 3JR5A 4LD5A 2P7VB 3TWKA 4RF1A 5F04A 1YRNB 2E5ZA 1RI7A 2NVYJ 3MZ8A 4MHGA 4NRVA 1ZK8A 2CCHB 3H0DA 4WW0A 3MVPA 5CVJA 3KS8A 3PQJA 2R7GA 1LVKA 2V1XA 5DEQA 5KQDA 1H8AC 4CYCB 3SC3A 2H5XA 4IPAA 3X24B 1G3SA 4NBQA 2JA5J 2LG4A 2F6CA 1VZ0A 4BXXJ 4UN2B 4P96A 3J80Z 4CCLA 2KRCA 4Q4ZF 2OJED 4EGYA 1TD6A 5F0CA 2AXTC 3V8KA 2WB1A 2DENA 3HXLA 1L2CA 4XKCA 3J7AS 2L09A 1I1GA 1MBJA 2HEOA 4F6WB 2OC6A 5CYIB 2Z9OA 1RKTA 3IKTA 1H9TA 2FH0A 4JI0M 3FIWA 3ECOA 4I8OA 4N4NB 4OB0B 2DJNA 1TDZA 5EJCA 2IJLA 2QA4I 1MBGA 1OCRH 4ZTJA 4WXHA 3R6SA 3VEPA 3QYHB 1MX0A 4OGRB 5LMUM 3QRFF 1V55H 5GAHJ 3RJPA 4Y15A 2LFBA 1IRZA 1E9HB 1XGSA 1FJLA 3SEQA 2WEVB 1D0MA 5E26A 4A3GJ 1MJAA 3LL7A 3S32A 3U9GA 1YFHA 3FD9A 2HR3A 4PJ0C 3L2QA 4II5B 1U5TC 2DA4A 4L78A 4Y3OA 2IEKA 3BG3A 3F5XB 2IT0A 5D8LB 3GTLJ 4A69C 1IDZA 4CO8A 3A8OB 1X58A 2X4HA 3VODA 2OQGA 3GP1A 3B6CA 5E1XA 2UZKA 1H1PB 1V29B 3FBNB 1T6OA 3WGIA 4JI5M 3F3XA 2VKDA 3NQOA 4PT5A 4JOMA 3GO8A 1GY3B 1P9QC 5ITXA 1NSFA 1NV9A 5TJJA 3OS0A 1XGOA 4P5OA 3TOBA 3HOYJ 3J80K 1DGHA 2ZFWA 5LEKA 2HPMA 4E7JA 3L2VA 3A98B 4QOSA 3DKWA 1FIPA 4E70A 3VOEA 3K70D 3LA2A 4CGZA 2XRLA 3FM5A 3KE2A 2XAQA 4PK4A 4I0AA 2L02A 4BKXA 4HF1A 2RRUA 2MGWA 3RIRA 3KETA 1X2NA 3CDIA 2XSJC 2LH0A 2IGNA 1TF0B 1I27A 5EP1A 1IQPA 2R3SA 3E6BA 3JTGA 5E3OA 1XS9A 2X0LA 4HL4A 1LV7A 1XB4A 3RKWA 3GO5A 3H92A 1WPKA 5IREB 4IRGA 3X2QH 4MIMA 4ZZLA 2RGHA 1HA8A 5L3BA 3S2HJ 4BJTA 3ASNH 2AXLA 5EQTA 3RKYA 2MJ5B 4U0WA 3S17J 2ZPIB 1SAXA 5HLGA 1KONA 4EC9B 3RYPA 3JAMZ 3BZCA 1GVJA 2DN0A 1IUFA 2JP7A 1FC3A 3CP2A 3TN8B 3GLXA 2QUFA 3GFJA 2BGCA 1FSEA 2OQ4A 1WJDA 4D80A 3H9JA 2ZTCA 1TQMA 4DR5M 4DBGB 3SDGA 2QP9X 4FW9A 4A6DA 3ZMUA 1UMQA 4RLQA 4CCKA 1IRGA 2C9OA 4G6LB 1IBKM 3REOA 1L0OC 2EJRA 3VSLA 1MDMA 1V33A 1QGPA 1S7EA 1SMYF 2O8KA 5JR3A 2Y0MA 2ZPHB 1HW1A 3GXOA 1GVNA 4BCND 1L3LA 5M5XJ 2Z99A 3DXJF 4NB5A 7CATA 4KIFA 1FOWA 1YYVA 1GJTA 2ZSHB 3H36A 1ETVA 2NVUB 2D7HA 2AHQA 5IYCJ 1WI3A 1EJ9A 4RAGA 3F8CA 2L3DA 3AV0A 1VTNC 4IOCF 3NRVA 3G4SI 4UXNA 2RGOA 4CSWA 3VKGA 2FX0A 3TO6A 1QRYA 4BJ6C 4IJEA 3L2RA 3H1CA 1UM8A 2LLKA 1OKWB 2R46A 4YIRX 3L2AA 2HKXA 1SXJC 5CLSA 2F5NA 2HWVA 2H1KA 1NJFA 2UV1A 3O6BB 1H9GA 2VJJA 3H35A 5CVVA 4OWRB 3LAJA 5F27A 5JI6A 1H6UA 3DPUA 4DBRA 1JKPC 5HDKA 3GLFB 3JRBA 3ZP5A 5H20A 1FTZA 2J7NA 5FTJA 1VG5A 4MFEA 2P5TA 1JB0F 2OPFA 5DUIA 2RVCA 3KP0E 3BPXA 3PUBA 5FRNA 3HGIA 3HRMA 2R7TA 3E0JB 1TLHB 4A0ZA 3JAMK 1JXSA 4LJ4A 4UNOA 1ETKA 2VBZA 3DEUA 4CFMB 1ORYB 3PNTA 3G73A 4CHUA 3A4CA 4C30A 1J09A 1G3WA 4FWDA 2R6FA 4H4KC 3CTWB 5L3EA 2BZTA 2DZLA 4B08A 2W00A 4BHPA 3H9QA 4QTRA 3JRCA 1W1WE 2L54A 4IBKA 5EGOB 4WK8F 1A31A 2V79A 1IG7A 3R4KA 4IOAF 2YU3A 1Z77A 5TISC 4AKIA 2OA4A 2GIZA 5K7ZA 3PVSA 1VI0A 4C2MJ 3WTXC 4BYYA 2KEBA 3SAWA 4L15A 1P7IA 1K4TA 2XEPA 2MLKA 1WRJA 2K47A 2K4BA 3BJ6A 4BCNB 1T2KA 4F7SB 4AIJA 2ZMEA 4XLNF 2I5UA 2W48A 1S29A 4IBCA 3BC8A 4YFKF 2L7FP 4RNAA 2DODA 1DU0A 2TCTA 2QSGX 1LJ9A 1MGTA 5E79C 4PDIA 2MABA 3QOEA 1XNRM 4MEYF 1MMSA 4J19A 3DTKA 1G3TA 4BBRJ 2UUBM 2Z33A 2L2DA 4DYCA 2VKEA 3A45A 3IV5A 3DP7A 3H0GJ 2AHJB 4ELLA 4MO7A 3T5XA 4LJ8A 3CUQB 2MROB 1IV8A 3T8TA 4G4RA 1NK3P 1TWHJ 2OOAA 4XRFA 1T08B 1HXDA 3BR2A 3UR3C 3GLIA 2DHYA 1Y56A 3IRQA 3ZQCA 2MW8A 2VN2A 3M9AA 3QZ5B 2M4KA 1Q1VA 3Q0UA 5DCMB 4KJZA 3BR3A 2M5WA 1LE8B 5ITQA 4LJ9A 3EUHC 3U5ZA 1HQYE 3V4GA 3JSPA 4YOZA 5FLXK 5IY5H 1ODDA 1SFEA 3E6CC 1OJLA 4MH0E 3H3ZA 2ID6A 4JK1X 1OL1B 5DYGA 1A6QA 1GL7A 1GKIA 3B6AA 2WAQA 2L9SA 1WGNA 5KK1A 2CGPA 2BJVA 2DQRA 2VB6A 4YIFA 2YU9J 1FOYA 3GMEA 1IRFA 1LTMA 4JBAA 2ZJQF 1H0MA 2L7HA 5JHUA 3RPUD 1YW9A 8CATA 1D5YA 4YFNF 2L7IA 3B89A 3GRYA 1FY7A 3KZYA 1YQAA 5IYDJ 1G3IA 1TH3A 4RDUA 1J75A 1QHHD 1AA7A 1GUUA 4A3CJ 3HGYA 4REZA 1WJCA 2L7KA 2KFDA 4BDYA 4HV6A 4PDKA 3P5JA 2R7FA 5CVUA 4A0YA 3VFDA 1UGPB 2EO2A 4AW4A 4FVMA 3WE3A 3BCBA 3Q3SA 5GTHC 2DO7A 3OIOA 4HX4A 3SEZA 5EP3A 2PQ8A 2R5ZA 3HOTA 2ZXJA 4HV5A 4I09A 3M1EA 1VQ4I 2GQFA 2HKJA 3A2KA 2XFSA 1F4IA 2JA7J 4DV4M 3GLGA 3M1CA 4B3SM 4XKWA 3M6AA 3R0JA 2L4MA 3J7ZI 3CCQI 1GDTA 2HQAA 1CGPA 4LJAA 4KICA 5GKNA 2WIPB 1U5TB 2HNHA 4EOOB 4FCWA 3KX2A 2GOMA 4OOIA 2G77A 2R65A 3FUXA 1H89C 3POMA 5K7FA 1HDDC 3AOGA 2GAUA 1XWIA 1KYZA 2FOWA 3MKYB 1ZHFA 2EFQA 1JHFA 4M3DA 2VONA 3I4PA 3MWMA 3ZQQA 4Y28F 5LHGA 4LF4M 4BBSM 1XC8A 1R5LA 1VINA 2KW0A 1KYIA 1P2FA 2YX7A 4U7DA 4F93B 1OCPA 1T95A 1N25A 2DOEA 3PL8A 1JR3D 2Z3XA 3Q8GA 3BG5A 3D5SC 3KEQA 3OR2C 1XGNA 2DWLA 1UG0A 5FFXA 5FJ8J 2VJIA 2UZLB 2DTZA 4B48A 3T1YM 3G2BA 5HODA 3F8NA 1BI2A 4YG2F 3K4CA 1P6RA 3NDQA 2XUBA 1SXJD 1DU6A 2PX9A 4HG2A 4IHVA 4NSRA 2BY3A 4PCQA 2R7XA 3CCVI 4QSHA 3C3WA 1IN5A 3BR5A 1HOMA 1RRJA 5BPVA 3VYHB 3FWEA 1QNTA 1IO2A 4IRHA 4CCJA 3PQKA 3FTEA 4QHTA 3ZN1A 1N32M 1GV2A 4A3IJ 2ACJA 2ISYA 1G8XA 1ZAEA 2HGCA 2IA2A 3GPUA 4Y52J 3C2HA 2OV7A 1HBXG 1G3YA 4OIRF 2O61A 2KNVA 3LSPA 1GXPA 4RB0A 3PXGA 4YRVA 2WWYA 4LB5A 4DYQA 2X49A 1Z6TA 3FK7A 4BCKB 4IXAA 1A6IA 2JUCA 4YELA 2N35A 4QIWN 1QZZA 4LCBA 1R71A 3EQLF 2C9CA 1BR2A 3MAJA 1SD5A 5LEJA 1Y0NA 3BOQA 1FYLA 3GEZA 4PD2A 3R8FA 2R18A 3L28A 2LVQD 1B8IB 3RTRA 4BY1X 3E4RA 1ZMUA 1OKVB 5BPIA 2FQ3A 1UGSB 3U6LA 3NAUA 5ICFA 2JJ7A 2V6EA 2X1CA 4M3GA 2OOBA 4FT8A 1M1EB 1TR8A 3SHFA 3GTMJ 2OTJI 2JUGA 4D5FA 1Z7LA 1K6OA 2EILH 1UNGD 2XHKA 2DYRH 1OR7A 2VUMJ 1SFOJ 2LOOA 2LBFA 1QYRA 4R71A 4Q7JA 4FD2A 2GBYA 2YUSA 2A07F 4ITQA 3KEYA 4LB6B 3T1BA 3N97A 3E7LA 2E36A 4EM0B 4JI1M 3K1JA 2XKOA 2EIMH 4LG3A 4I6ZA 1XNQM 2ETHA 1O9KA 2DXBB 3L2CA 1SXJB 4FISA 2K86A 3G1OA 4XKVA 4GMQA 2CZ1B 4DYRA 2V6CA 3I9V2 2LR8A 2JK3A 2XGCA 4O3MA 3HKPA 4R3DA 1UB9A 3EYYA 3QP5A 3IL2A 2C6TB 1JTYA 3K1MA 2HTSA 1P3QQ 4X62M 4RAFA 1J7KA 4BU2A 1XX5A 3S93A 3BHUB 4M3EA 3RDIA 3HZJA 3LW5F 4K0KM 1MKMA 1QHGA 3IH3A 4BEHA 4G7HF 4EOKB 2Q2EB 2F5FA 2V7FA 2XAGA 5J4YA 1FIAA 2DTRA 1ZKGA 1R2YA 2VE9A 4HZFA 4ON0A 3JSOA 2P7CB 4EMSA 1JOWA 1QAQA 2RNGA 3T38A 4XRSA 2LF8A 3OMYA 1Z9CA 2FA5A 2I10A 2R7RA 1YS7A 2MFZA 2VQHA 1UJ8A 4M6YA 4HSTA 1R4GA 3UGJA 4XRSG 1S7AA 2DHRA 2VOOA 5IZ7D 4EJVA 3V7CA 4RB1A 1UHWA 5E1WA 5KQ8A 5FKMA 3V8JA 4L0YB 2MD5A 4GO1A 1JKQC 1LVAA 1WJ7A 4BBAA 4F55A 2WJ9A 5FLVA 1VQPI 1BM9A 3I71A 3J2PB 3ML6A 2FBKA 2VL8A 3NARA 2E1MB 4NC7A 4MGHA 2H8RA 4L5JA 4Y17A 2GIVA 1ETYA 2FD5A 2QQAA 3SFIA 2UXNA 4ZTFA 2VXDA 3UJNA 2WPAB 2BW3B 2CE7A 4WF2A 1WXQA 4F7NB 2JY5A 3DF8A 5J1YA 1W5SA 2FNAA 3KCCA 5M5WJ 2CO5A 4U0VA 5CYVA 2OO9A 4IIWA 1LDDA 3A0BC 1KZHA 4DNCA 2UXDM 2GQQA 4XK4A 2CV0A 2KPMA 1XMKA 4Y72B 1PJIA 3ELKA 1T33A 3NWSA 4YY3M 4I3ZB 1JT6A 3C9PA 2KLOA 2QWWA 3AL0B 2LVOC 1RC9A 4XM3A 2LKSA 3MD2A 3ZH9B 3B9PA 2FUG2 1G4AE 1BJZA 3K4BA 4ZDPA 2QZ8A 3OYFA 2ME6A 1V54H 4AVZA 1I5ZA 3FX3A 1SD6A 1EF4A 1AWCA 3BLRB 3HHTB 2X8AA 3S1RJ 4CIZA 4GC5A 1QZYA 2L5QA 5DQVA 1IF1A 1EH8A 1WVRA 3SBJA 4B09A 1FVVB 4LGMA 3AOEC 5CVRA 3ZCOA 5ICPB 1XN7A 4B3AA 4A3BJ 4LITA 1W98B 4M0DA 3SQNA 4O5VA 4ANRA 1MNMC 4DV5M 2ZBKA 5ITTA 1PDNC 2X6XA 3E5QA 3CGWA 1WJEA 5DM7F 1D1BA 1TWGJ 4S12A 4JQFA 4Y7NJ 2GLOA 1N75A 4A93J 2BS3A 3SYKA 1HT1E 2JSPA 4LRSA 4ENKA 3ZQLA 2Y0QA 2A6TA 4X64M 1XCBA 3TWLA 1D8KA 1VF9A 2E7XA 5FGMA 3D1NI 2R93J 3DDPB 4ELJA 2ZMEB 1PKDB 2FEZA 2EA4A 5EXSA 2K9QA 2DAEA 3K2AA 4DUYM 1QPIA 4KMUX 1F43A 1R58A 3HM5A 1MMAA 1IAWA 5J1UA 3EIDB 1AU7A 5IT9Z 3PNVA 4S0HB 1T56A 4D9JA 3OIPA 3P7NA 1XGMA 4HDVA 4LRTA 2EKKA 2VC0A 1B4AA 2ESHA 1OFIA 3MCZA 1UHSA 2RNJA 5CPRB 5KVRA 4FX3B 1G3NC 3V7RA 3DA1A 3ILKA 2QVOA 3ABLH 1QAOA 4QPQA 3NBIA 5HLHA 2LXEA 3I0TA 4IO9F 2CMPA 1SVOA 1ZYRF 5LMNM 3I59B 4E7IA 1PUFB 3ZQHA 1XB2B 3GPYA 2HQ5A 3KP5A 3J80S 3GLIB 2V1NA 3BTJA 2P5KA 5J47A 4JX5A 5K7HA 1J0RA 2WAEA 5KPTA 4JYKA 1R4MB 4OVZA 4PZJA 1MU5A 3S3NA 2HVSA 1H4LD 4LJ5A 2R45A 4GIPA 3HRUA 2ADUA 2LSOA 4HNTA 1IN8A 3JRDA 1VQOI 4JN6A 2YPRA 5FB2A 3VWBA 3RGFB 2XF7A 3K70C 5B66C 3VK7A 3CCSI 2R7VA 5BMZA 1FEXA 1IXCA 3I4VA 2DA7A 1O57A 3S1MJ 1W5TA 3PJRA 1R7JA 2B9RA 1HQCA 2LHGA 4WURA 2LYCA 5EG0A 1KA8A 1VQ1A 4PDGA 2KZSA 4M3FA 3TBIA 4B43A 4BLCA 1HT2E 3KHIA 1HF0A 2JY8A 2RC4A 1TH2A 4GHAA 3AG2H 3PIPF 5D6FA 2CV1A 1VDDA 1DPUA 2ZPBB 4XLEA 3A8GB 4XNFA 5IT3A 4E7KA 3TE6A 5GADJ 4A3EJ 1YSYA 1FT9A 3PSFA 2EINH 5BNJB 2VT2A 2Z1DA 1P5EB 1BI0A 1X3WB 4OMZA 3H3VK 2E1OA 2EIJH 2V26A 3U1DA 1OLTA 2R7OA 4MGIE 2O6GE 1W0TA 3SARA 2E34A 2K9MA 4PUSA 3ASOH 3HOSA 4XBOA 3ABMH 1E2XA 3GLGB 1GT0C 5ILUA 2RV8A 3UZUA 2XSZD 5BNGA 1P4WA 2X6OA 4GH9A 3AG1H 3GPXA 2HXOA 3GLHA 3DZDA 2E7WA 3C18A 5LBQA 2ZPGB 3ZQIA 1TW2A 2JT1A 3I64A 1YLAA 3K4MA 2R0IA 4XSZF 2XAHA 4CCOA 3WHLA 1O3TA 1LQ1A 1EV7A 2IP2A 1CQTA 1DP3A 3A42A 2BKZB 1WI9A 3SYLA 1TC3C 5HNHA 2ZPEB 1E9RA 2YFQA 3IRRA 4N9IA 2ESNA 4GGGA 4E6KG 4FM4B 4X66M 4IJFA 4UN0A 2X4AA 4F7LB 1JHHA 1D0XA 3ZMSA 2JVHA 4C3IJ 4XQFA 2P5LC 1TFBA 1MZBA 2IN3A 2I40B 3X20B 4I5SA 4XK8F 3CUQC 5L3CA 2IW5A 3LNQA 2DI0A 3W6JB 5JLWA 1Z5CA 1I4WA 1WGXA 1H27B 1TNSA 2QKMB 1ZV1A 4G94A 2XV4S 3ISPA 3JAMS 3ZQJA 4B3XA 1SAUA 5L8RF 4C3JJ 1LPQA 1B6AA 1ITYA 2Q1ZB 1NG7A 3OYHA 2K9NA 3C2GA 2H27A 3HKZN 3HOXJ 2J5YA 3I55I 3HDDA 1IFYA 1QZEA 2QSFX 2W2HA 4KNYA 3JR9A 2C96A 4DR3M 1XHBA 4GKJM 3GF2A 3L9FA 4DJAA 3TL4X 1PJJA 1LFBA 2B3TA 2ZSIB 2JY7A 1OYIA 4WP2A 1K82A 2FMYA 2O25A 5KO3A 2K3PA 3RQ4A 4GEWA 2LP0A 4GRIA 2A5WA 2HI3A 5GP9A 1VOLA 4ETSA 2PMZN 5GTIC 2DPPB 2E35A 4TUWA 4RGXA 5FFZA 3OY9A 1OCTC 1R5GA 4W5WA 2EKFA 2V4JC 4Q47A 5A2QZ 5FKLA 4KHPM 3HSFA 3RZOJ 4YOSA 1JSUB 2ZXWH 3ULQB 2Y9ZA 1AKHA 1SANA 3UNGC 1H26B 2WBMA 4ENMA 1H25B 2JY6B 4AZFA 1GVDA 5DYIA 1KXUA 4LK0F 4A3LJ 1BVSA 2QBYB 4IHWA 5L3FA 3ZMTA 1AD6A 4XKBA 4HQEA 2H1LA 1JQJC 3CLOA 5H37D 3I56I 4F6UB 2DBBA 4RS8A 1FKMA 2DKLA 3DTOA 5LFAA 2JXNA 3QPSA 5K5OA 1ETOA 4ZDOA 1ZN2A 5F0HA 4I2OA 1AUAA 1E0EA 3JCUC 1QVRA 4NSTB 3N4MA 1WIVA 2E60A 2NVTJ 4UV9A 2IA0A 2BEOA 1ERDA 2XDVA 4QWQA 2E1CA 1VQ8I 3SDBA 4I0BA 1C1KA 2V1CA 1HKSA 3LFKA 5J3LA 3WU1B 1YW8A 3F22A 1WSUA 3HOVJ 4BUPA 4XLAA 3NWLA 3MQ0A 3MK6A 2DAGA 5LGTA 4YC3B 3LSJA 2BHYA 3DWLE 5LLQA 2AO9A 4M72A 3COAC 3OYNA 3LQQA 2A05A 2M8GX 4RGSA 1S6LA 1HLVA 3U60B 3TEDA 2O9LA 1NY5A 2L4EA 3G71I 1X3UA 3HKZA 4EJUA 4ESFA 4WWCA 4Y4RA 2UXBM 2D1HA 4UHTA 3S8PA 4BEHB 3KVWA 1VNDA 2ZFUA 3QQAA 4HF2A 2A6HF 3OIQA 3A01A 2QQBA 2XH9A 3ROUA 3GTKJ 1TWCJ 3C1DA 1R5HA 3KLNA 2DA1A 5A2QK 5FRMA 5LRSA 2V6ZM 4XN3A 2GXAA 1JE8A 1R36A 4EJWA 2DNAA 3EPZA 1E3HA 2K6BA 3HPHA 1U8BA 5FTKA 5CVIA 5AIQA 1SFXA 2OCCH 2E2JJ 3JTHA 3GLHE 4EQQA 4IMYB 2ME0A 2OAZA 2PMZA 3R61A 1U9NA 2CHVA 4LGWA 2UZEB 2G5GX 4C2TA 3I5UA 1H1RB 3LWFA 5EEGA 4KIGA 2E2HJ 2DFHA 3WTZA 4LOCA 3BG7A 3ZC7B 2IW8B 2LVAA 4LK1F 1SC7A 5HBJB 2QENA 3F6OA 4C2UA 2ELKA 1C7YA 2A68F 1I1SA 1OIPA 2XB5A 4M6VA 3BXWA 3CMEI 2G8LA 2R44A 1YW7A 3L7WA 4BJ5C 1ACIA 2ZZDB 4MGRA 1IY2A 3FMSA 3K10A 4KISA 4L18B 5L2WB 3LSIA 4I99C 4WXDA 2L7ZA 2OUMA 2JWTA 3CJQB 4XOPA 3CCMI 2H94A 2FJ1A 3VDXA 1F4KA 3SZTA 4DR7M 2BWBA 2K7LA 2CQQA 2TDXA 2H1RA 3S15J 2A69F 4LG0A 1FJGM 2XFTA 2DXCB 1DGGA 3HHXA 2VQCA 4D1QA 3HJSA 2G7HA 2KA6B 4NDLA 1MMGA 3GZ5A 5HNFA 1P4XA 1K61A 1SFUA 4PJMA 4KFCA 2JRTA 2JA8J 5IP9J 1IBLM 5KPZA 5H2FC 2CQNA 4I01A 5F08A 3ZQGA 2IW9B 4CFVB 3HU3A 5E6JA 2CJMB 4BCGB 3CESA 2GWRA 3G1LA 2VODA 4Q5SF 3TKYA 2VIXA 4PCZA 2LTUA 2VXZA 4KRCB 1R6BX 4BY1J 3KOZE 1V5EA 4ANJA 2HOTA 4AG5A 3I51A 3I58A 3DL1A 1RNLA 1UGQB 3DQVC 3UK6A 2PI0A 2K4JA 1V3FA 2HL7A 5J40A 5DD4A 5H6QA 4A3VB 1FBUA 1EFUB 4NHJA 3H5AA 3E5XA 2W82A 1X1DA 3M8FA 2ZBKB 4JX6A 3M4OJ 3TO7A 1VEKA 3CJRB 1N36M 1BR4A 3WVDB 1G6NA 1DV0A 2P6TA 3F8MA 3FMQA 3AAFA 1MSFC 5FLXZ 1JUSA 2CW0F 3FF5A 1ZMVA 2W25A 4H0EA 4S04A 1Q02A 3DPTA 2NOGA 4IZZA 1ZGJA 1V92A 3RZDJ 1K4SA 2STWA 3FTDA 2Y9YA 2M1BA 4II7A 4QNMA 4JV5M 4EONB 3EUHA 4KODA 2DMQA 2DDAA 2XKPA 1VQ9I 3CD6I 3FE3A 2HZTA 2Z3YA 2HYFA 3J81K 1NG6A 1VFCA 5M5YJ 4KIBA 4LG2A 3Q8XA 4CISA 2JA6J 4ZYHA 2E1MC 1LEAA 2BXYA 2WIHB 1R49A 4ZZDA 9ANTA 5C1BA 5HQ0B 3DLLF 2C5RA 1OAOC 4II3A 1BU2A 1ZG3A 2Z5UA 2CCIB 4IKFA 3HEFA 2DA6A 3GRUA 4OIPF 3SMPA 4GKKM 3OR1C 2M0MA 3K92A 1LKXA 3I4YA 4CXAB 3BTCA 2Y2ZA 2F4MB 3BJOA 5M3FJ 1NK2P 4HQMA 1UAAA 1IN7A 1BIBA 3FRHA 1YOVB 3BPVA 3CTAA 3U61A 1JR3E 3Q9SA 5J4VA 2DPUA 3HO8A 2G0EA 1K79A 3IP4B 2M7AA 2V9VA 3KP7A 1YHQI 3KW6A 1CF7A 4FWGA 2O7OA 4M9XA 3FXJA 2M87A 1LEBA 3EYIA 2R7UA 3IECA 4JYAM 4KA4A 2PLYA 2P8TA 2DA2A 3L1PA 2EWNA 1WR1B 5FKOA 4ZYDA 3KYCB 1TT5B 2LBCA 2WY7Q 3AL0C 4V2GA 3B57A 5CEIB 5ACBA 4G8XA 2LNBA 3IUOA 5F6FA 3OYEA 4C3HJ 1XXHA 1UHMA 4WX9A 1U3EM 2DAIA 4UV8A 3EIEA 3EUKL 4IBDA 1ON1A 1D2NA 4CJ6A 1T6SA 3QODA 1U0JA 2WA0A 4MLOA 2RQPA 4L9JA 4EOPB 3DTEA 3U2RA 2EA2A 5HVYB 4ENJA 3LSTA 3ZR8X 4OIQF 2CYZB 1XDSA 4BBSJ 3ZOBA 4UUSB 2R5YA 1O4XA 2DWZB 2EB7A 4B44A 2WSCF 3L29A 3HG9A 1IV6A 4BB9A 4OINF 2PHGA 5HNBB 2DMPA 5B3SH 2R7ZJ 3M7GA 3C7JA 2HYJA 2OTLI 5L3DA 3U6SA 3K7AM 4LF6M 3K2ZA 2MGQA 2LY1A 2ZMEC 2M0CA 1FZPB 3M03A 3S14J 4L9TA 3CO7C 1ZTRA 3TDZC 2KXEA 1FINB 1OFHA 4BE1A 2CRUA 3V42A 2MC4A 1BOAA 4ESBA 3RPQA 1I6XA 4XN0A 3J27B 4B4CA 5E3MA 1WH5A 1IY0A 2AS5F 4RM3A 2FNPA 2LY9A 1GJSA 1WH7A 2OBPA 3IC7A 4X1EA 2XVCA 1U9OA 1HR0M 3MKWB 1K83J 2C5NB 1IREB 1PJRA 3BOSA 1F5TA 2OQRA 3H5RA 4HF0A 2L7MP 4PSWA 3DEWA 4HX7A 3M07A 2EJSA 1QVTA 5KNLA 5EEAA 3RE8A 1BI1A 2CZ0B 5E8IA 5ICGA 1XTAA 1YJNI 3HU1A 4BY7J 4ZYEA 5EP2A 5E18F 4LF9M 2JPCA 4KYWA 2JZ1A 2YSRA 2G9XB 1B72A 3BJAA 3E97A 3JRFA 2QF7A 1LFUP 1WJ5A 3F72A 3DU5A 3ONQA 4DGWB 2LK2A 1TZLA 4NOOB 5BQTA 4E7HA 1ZQ9A 3J7YJ 2L4FA 2IPQX 4A2UA 3FBIB 1XMAA 2DMTA 1QANA 1YS6A 1ENWA 3X26B 1OYYA 3K69A 4AM3A 4CRLB 4ITVA 4F7JB 4IF4A 3ZGKA 4IHYA 5IP7J 3H4CA 1Z6RA 3MY1B 2MH8A 3SATA 1REPC 1V5GA 4IBFA 3WHCA 2K0BX 1OCCH 2W84A 1I3QJ 1IXSA 1Z67A 2MH2A 1NO1A 4FASD 1RESA 4MQ9F 4CHTB 2LW4A 2CQKA 4I4LA 2LMDA 4IX7A 4IBJA 2W57A 1N4MA 3A0HC 2NQ8C 2YX4A 3FISA 3LSGA 5ED4A 4BDZA 2VE8A 3FHNA 1B9MA 2BXZA 2EZKA 1T43A 4HNUA 3EDPA 3BWGA 3I4NJ 5IP6A 3HTUA 1UGRB 3VLFB 3JREA 5ITUA 1ZAOA 2HAKA 1T38A 3CQZJ 1BOBA 2D45A 1YO5C 1GUXA 5KHDA 3CF0A 4RKUF 1Q3BA 1HNZM 1QMZB 4G4OA 4BH9A 5IPAA 1Z05A 2KJCA 3EETA 2XGXA 4NC8A 2GXGA 1TTEA 3KFUG 1R1VA 1YX3A 3DEEA 3U1KA 3CO6C 3M3YJ 1PVEA 4NC6A 4EEFG 2IGOA 5DQWA 4CYCA 4WXCA 3MKZA 2JSCA 3IWFA 4BE0A 1Z7UA 2Q0OA 4F70B 3B73A 1WWXA 1XXHE 4OB2B 4CGYB 2FS1A 1R2ZA 4XSXF 1NY6A 1PJSA 5DFLA 4DV0M 3TOAA 2B7EA 3KP6A 2BBYA 1R23A 4Z8XA 2M30A 2UWMA 3VSKA 5HDGA 3X25B 2CZ7B 1DPRA 3WE2A 3ABTA 4CZZA 4EJOA 4ZGDB 3NWTA 3LVWA 3GCMA 2X1NB 1XMQM 5TRDA 1DGHB 2KKOA 3HWSA 2QCOA 3P9IA 2Y21A 4XGIA 3A01B 4OU0A 4A3KJ 2X85A 2EFOA 4A0XA 4A6EA 4EJTA 3H4MA 3BQYA 1UG2A 4LJZF 4PJJA 4EIWA 3HRTA 4BCMD 1O3SA 1PJTA 1WQ2A 1ETXA 5IT9S 3GFMA 4HOBA 4ZH4F 5D4RA 1YI2I 3TNIB 1TW3A 2KIQA 3GQ4A 4RB2C 4F52A 3ESWB 3LCVB 1R7RA 3IAS2 4U7BA 1W7PA 4FE7A 1KU2A 2RKOA 2WAFA 1FYMA 3RSNA 4G9YA 1Z3YA 2J7OA 2LKXA 1DGFA 2ERCA 1RETA 3LQ5B 4B7HA 4Z6YA 3CCUI 1NH3A 2ZKZA 4KN4X 3QYGB 3ZPLA 5DUKA 1SG9A 1VEGA 4BCIB 3I53A 3HTSB 2CQXA 3U6EA 1AHDP 2QFZA 3QYFA 1O7FA 4ROEA 3BR0A 4F2LA 2KMUA 2OZ6A 1MH4A 3KIOA 5LGNA 3BG6A 1IRXA 1AHJB 1LB2A 1BR1A 1IJWC 4AVPA 3V7SA 3A03A 3RYRA 3U6QA 1JGGA 2X48A 3JR4A 1KU3A 3SAVA 3OYMA 3WODF 3H4JA 3ERMA 4NQWA 1DGRM 1OYWA 2VBXA 3FM3A 4A5NA 4F91B 2RN7A 5JVTA 1MDMB 2FU4A 3K6GA 2DYSH 3SYTA 3PO3S 1EH7A 2JZYA 3HGGA 2JGZB 3I04M 1ZELA 5EDNA 2VLAA 4M9ZA 3AOEA 3E9SA 4A12A 3MFKA 1KU7A 3QXEB 1OIUB 1PGYA 1NHAA 4EOLB 4BCOB 3AKZA 1A5TA 4D82A 1F9NA 3KOWE 2IGKA 1LNWA 3LSKA 1OAIA 3FKJA 2DFEA 1ENHA 4HEOA 3RKXA 2WC2A 4M73A 3I01M 1A5JA 2DOAA 4LJ7A 4BCMB 3PO2J 3CF2A 4IRIA 3P9KA 4CICA 2KJBA 3GFLA 4PSXA 5DV5A 5GAEJ 4LZZA 3F23A 1DO2A 5DD8A 5EZHA 3FKIJ 4X6AJ 5IDPB 3C2BA 4PJLA 2EFPA 3MEXA 3GTQJ 1MJGM 4XLFA 4DBQA 3W2AA 2LREA 4MTDA 2WMAB 4CFNB 1A36A 2WV0A 3TDUC 1TNTA 1YLFA 1OFCX 3ABUA 3CJNA 4KN7X 3S16J 1XMOM 1YUBA 3OS2A 1USSA 3BT9A 5K5RA 1A35A 2IVMA 4AYBN 1TP4A 3T8RA 3QYEA 2EZHA 4OB1B 2L0KA 3FXKA 5D6EA 3I4MJ 1AOYA 3FK6A 2MH9A 2IVXA 1A04A 2WSEF 3JRGA 5IWAM 3CP8A 4FQGA 1HNXM 2IS6A 1TT0A 3HUGA 3F6VA 5H6RA 1UNLD 2HHHM 4B3RM 1X3ZB 3DDQB 1ETQA 2H6CA 4RF0A 2WZJA 2ZAOA 1TBXA 4C9YA 3J7BA 4BY7X 4EOMB 4JXJA 1X1PA 1PP7U 3GLFA 3U6MA 2PJRA 4LIVA 2O03A 3C3EA 2X51A 4CUGA 3WTVC 4PGGA 4AI6A 4X65M 1G2HA 3WG9A 3N05A 5LQFB 5DCFA 1GABA 3IWZA 2DDBA 4HAMA 2CUJA 3SXYA 1L2DA 2DT6A 1K78A 3AG4H 4YFXF 3FTFA 3D5RC 3KP3A 4IL6C 3ZQFA 4AU7A 2HDDA 1SVMA 2I7NA 5J8FA 1ORKA 1CF7B 2W9FA 3NBXX 3VKHA 1RIOH 4NXNM 1C9BA 3IH2A 3TQNA 2KNAA 3HHWA 5A2QS 3KDSE 3BQZA 4Q48A 3U5ZB 2Y20A 1XSVA 2VT3A 1DGWY 3MZHA 3K9PA 3S1NJ 1Y8GA 4AG6A 2F4VM 3HJEA 1QQWA 3TWMA 1Z5AA 1J2XA 4P16A 1W0UA 2RGVA 4XLHA 4AIKA 5FLMJ 1EA3A 5ILVA 2DA5A 3WGGA 1IN4A 1URCB 1ZRDA 2JN6A 2BNKA 2W1OA 4CFXB 2D7GA 3DFZA 2M5ZA 3OYGA 4IHTA 2JWSA 3H3UA 1FPQA 2BYVE 2O5RA 3FXLA 4F1IA 5ILSA 5E3LA 2QHOB 1ZG5A 1HKTA 2DT5A 4F6SB 2P0WA 3TMOA 5FTLA 2ZAMA 4YHHM 2NNNA 3WTYC 1Y39A 2R92J 1FSHA 5HS9A 4AYBA 2Z8YM 2F5QA 1NNUC 4MB7A 1MW7A 1ULYA 4EOIB 3GX4X 1T0FA 4XRMA 2UXXA 1S8NA 2EFWA 2PK9B 4K2EA 1JUPA 2VJ4A 2Y69H 1IXRC 2IRFG 2F5PA 3P9CA 4L5EA 1MBEA 3LVVA 1LUJB 3W6KB 2E5NA 2IA1A 4E7SA 1KSFX 4NRWA 2ZJPF 4HYEA 1D0KA 4MGZE 3VDPA 1XO2A 4W97A 2E5LM 4P1WA 1S72I 1H1SB 3GTMS 2Z4RA 4NL4H 2CS3A 2DJIA 4XMYA 1LE8A 2W96A 4EC8B 3FXMA 2DLLA 2V1UA 1EIJA 2R5ZB 1OGUB 1BN5A 4EM2A 4MEXF 2V1DA 2CUEA 2CUZA 2JUJA 1SD7A 2DW4A 3DTIA 3BLYA 3OWTA 4DV7M 2QLZA 1H88C 3KYLA 3PFIA 4KO8A 2CYYA 2DCEA 5LMKB 5JVGF 1H28B 2Z16A 1HW2A 2EPFA 4R7GA 2X9DA 3AG3H 2P5VA 4JI2M 3BROA 3QU3A 1HSJA 1VQMI 4KT6A 5C18A 1BC7C 3TPZA 2Y75A 4EOSB 2EZLA 3S3MA 1XCVA 3HPGA 3QAHA 2DVWB 2J5OA 5GAGJ 3D8BA 4RGRA 3CLQA 1I50J 4MM3B 1Y8QB 3RGSA 1QPMA 4A3DJ 4IVNA 4XIDA 3L27A 4EGZA 1QDTA 5D5XB 3S1QJ 4BCFB 2EV6A 4GYIA 4DZPA 1YIOA 2IS4A 2QCUA 3K8ZA 4ASNA 4KITB 2HWJA 2LD5A 2M4GA 5JI2E 2E71A 4AIDA 2UUCM 2F5EA 3K4JA 1PUEE 1IC8A 2DAOA 4V2FA 2RKHA 1VDLA 5D5VB 2H09A 4L6V6 2DFIA 3WGHA 3CCLI 3ABKH 1WJBA 4TTHA 5EP4A 1HW5A 3K1NA 1NJGA 3LMMA 3TW7A 1YJWI 4KDPA 1DQUA 3QZ9B 1EE8A 1LDJA 4XOTA 1YITI 2KT0A 5JLXA 4DW6A 3FUVA 3E6MA 3KSJA 1XG1A 4JX4A 4L9NA 2WHBB 4KRDB 1AISB 2NAZA 1U5TA 2CFXA 1N78A 3FHZA 5KCMA 4RODA 1X19A 3KEOA 3GLFE 3OYCA 3B74A 1W7PD 4HLXA 2HCBA 2K9DA 4EOQB 1UFMA 3VYTB 2QQ9A 3CUOA 4O6JA 3KYDB 2B9SA 3EIHA 2EZIA 3K0LA 3A8LB 3DBHB 2JRMA 2JMWA 3HSEA 2BJWA 3BZ6A 4HNVA 2DMEA 3W0FA 4RB3C 4GHLA 4HA8A 1E3PA 2FMLA 2J5PA 3WU2C 4LGYA 5B1BH 2ZXIA 3SZPA 2GOXB 2CP8A 1GUXB 3W6VA 4DR4M 1RUNA 5E1ZB 4BNCA 3OV8A 4I7HA 4LFAM 1IXZA 2VF8A 4D81A 2HPIA 2W85A 2Y31A 3TGNA 5J1RA 2WMBB 4JI3M 2XIGA 2QSHX 4G6ZA 3LSMA 2MG4A 4UUVA 5KAIC 3RPUA 1ZMWA 2D7EA 2GZWA 2HVQA 2XPUA 2ZPFB 4HW0A 4GYGA 1QO0D 1DUXC 5ICEA 3TP3A 1O3RA 3WHKA 2MR9A 2L9VA 4QNRA 3IG5A 2UUAM 4MNUA 4LF8M 2A6EF 3BG9A 4KUMA 2DK5A 2R62A 2LBFB 3IAM2 1EH6A 1FBQA 3A02A 3W2VA 5HOOA 4ZPXA 3THGA 5JI3E 1S3SA 2VQFM 1LDKB 2DMNA 4E7ZA 5FLXS 4ABZA 4XBFA 1JKWA 4FCVA 2BS4A 1L8QA 3U6DA 3OL3A 3LA3A 1O9KB 1XDUA 4M3BA 2KDZA 2EIKH 2NNYA 2E19A 4GCVA 1B59A 2C5VB 4B1RA 3GZ6A 1VQ5I 3GFIA 2OD5A 2XASA 3OS1A 1QZMA 5HVQC 3C3DA 2XZUA 2GNOA 3M8EA 3RGPA 1NVMA 2QDJA 4P9FA 5FTMA 3LSHA 2HQNA 3KS4A 1PP8F 5KPRA 1W7PB 5HDNA 5ERIA 3VYUB 5DYMA 1G4DA 2XC7A 1K6YA 2LVPC 4TV7A 3GUDA 4MFDA 1B8IA 3QHRB 1FP2A 2XF5A 3F21A 4DOZA 4CCNA 3W0LB 3KLOA 4F92B 1YG2A 3ZMVA 3BTLA 2XSDC 2VIIA 1TGUA 3O8HA 3T0YA 3F8BA 1JR3A 3GRVA 1U6GA 3SMSA 1P7JA 2F48A 4AWXB 1L1TA 2XGDA 2UUZA 1USTA 3PM1A 3D8LA 1YIJI 2WTEA 2DT7B 2K02A 4N9HA 4UVBA 4LY6A 3I54A 4QPOA 4Z2YA 1SXJA 1SFKA 4NQWB 3IH4A 2DAMA 3BR1A 3VYSB 3KOXE 3K4NA 1S5LC 5FD6A 3PNYA 5IOYA 5DM6F 1X4PA 2LWXA 1MBHA 2QYOA 1OKSA 5FKNA 2C5XB 2UUEB 2Z7JA 2L4AA 3KZZA 2VF7A 2F5DA 1BJAA 2F5CA 3H9GA 1F5QB 4CZCA 1UNHD 2FFJA 5EXXA 1ETWA 2ECBA 2FSWA 5D5WB 1I6HJ 1Y6IA 3CF6E 3HHGA 1KFVA 3MHVC 3O2PE 2XAUA 2OF7A 3F0CA 4UY8I 2Q2EA 2R7WA 2JNHA 4BCQD 3G1MA 3QYBA 3T15A 1YX5A 1Z3XA 5BOXA 1ZGWA 1HC8A 1FLIA 2VPLA 2KISA 3J81Z 4YIIA 3OYJA 3QPHA 4A3JJ 4L9VA 1JI8A 3K2LA 1PYVA 1T39A 1Y1WJ 3CDHA 3RQIA 4I81A 3Q5FA 2DD5B 4ZGEB 1QAMA 2DMUA 2P81A 1GHCA 5FD5A 3PUFA 3R60A 1E9SA 4DV2M 2DXIA 2HFHA 2QNJA 2WV1A 3OTOM 2CQ7A 2KIFA 2NVQJ 1NNJA 2XPWA 3EJ1B 2X6YA 2XF6A 5TGTA 5IF1B 1J9IA 4BQQA 1F1ZA 4FWHA 2NYXA 3GTGJ 2FF4A 2YS9A 2E1NA 1OISA 3E3VA 5BPDA 3C58A 3GTPJ 3V8LA 2D0QB 1Q3CA 1X1AA 4ENNA 1MNDA 3CF5F 2I53A 1VYWB 3SZGA 3ECHA 4KT0F 2BW3A 2VBYA 5KAFC 1ZR4A 1ZR2A 3TNWB 1D0YA 4D7MA 1G71A 1OI9B 4FX0A 1DDNA 3FMRA 4JI6M 4BACA 3GVAA 1WGLA 2EQRA 3DCFA 2ICWG 1FOKA 2HVRA 3O0GD 3LSRA 2D2WA 1KQ0A 4NNJA 5EZGA 1FTTA 3HUGB 4G3OA 3VYRB 2XF3A 4D0PA 2PJPA 1RU3A 3FYDA 2XAJA 1J5YA 3B7QA 2HOAA 4OMYA 4ZGJB 1W36D 4CFUD 3O8GA 2BVLA 3ZN0A 1Z21A 1IGNA 1VQ6I 3G6EI 3HB9A 2CRGA 4XLCA 5CQEA 3BLHB 1MD0A 2UZBB 3SJMA 5L3GA 2CHGA 3CC4I 3GRRA 2PJRB 2BY0A 3TW6A 2DAKA 3QU6A 1VQLI 2W4SA 4BCQB 4R8HA 2HQRA 2WAQN 1R1TA 4CDGA 5BR8M 2JTVA 2EA0A 1XMXA
chains in the Genus database with same CATH topology
4ELJA 4M6VA 4MFDA 3VKGA 3QWLA 2DXBB 2ZZDB 1UGPB 2CZ1B 4P17A 4NC6A 4OB0B 5EJCA 4AKHA 3QYHB 4OB2B 3HZJA 4OB1B 2DXCB 3QYEA 4MFEA 3HBLA 2CYZB 3X25B 2G77A 2CZ7B 4ZGDB 4JX5A 2DPPB 3BG3A 3A8OB 2KR6A 3TW7A 4BBSM 3QZ9B 4HNTA 3X28B 1V29B 2CZ6B 4JX4A 3BG5A 3DL1A 4AKIA 1UGQB 3QYBA 2WJ9A 4AI6A 1FKMA 2DD4B 1QLBA 1IREB 4JX6A 3A8LB 4Z6YA 3KHIA 3WVDB 4HNVA 4ZGEB 2DD5B 3VKHA 3QYGB 4QSHA 2QDYB 2CZ0B 2ZPBB 3WVEB 2QFZA 3A8GB 3VYHB 1AHJB 2BS2A 4HL4A 2AHJB 2QF7A 4BBRM 3A8HB 4MIMA 2KMGA 2ZPFB 2D0QB 2ZCFB 3QZ5B 2ZPIB 4OB3B 1E7PA 3BG9A 3X26B 3QXEB 2ZPGB 3H4CA 4AKGA 2BS4A 3HHTB 4ZGJB 4HLQA 2ZPEB 1UGSB 2ZPHB 3HB9A 4FM4B 3VYGB 3TW6A 3HO8A 3X24B 3X20B 3A8MB 4HNUA 4LOCA 2QQ8A 2QDJA 2BS3A 1UGRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HL4 A;  2G77 A;  3HZJ A;  5EJC A;  4Z6Y A;  3QYE A;  2QFZ A;  1FKM A;  4HLQ A;  2QQ8 A;  4P17 A;  4NC6 A;  3QYB A;  3QWL A; 
#chains in the Genus database with same CATH topology
 2FBI A;  4MGY E;  4G7O F;  3J7A O;  2I8D A;  2DK8 A;  1K78 B;  3CC7 I;  4BHB A;  3QWL A;  2K9L A;  3L26 A;  3DV8 A;  2R7Q A;  1U8R A;  1NTC A;  3BLQ B;  3S2D J;  3W68 A;  2C99 A;  1FBS A;  2VC1 A;  1RR7 A;  2G9W A;  2ZNY A;  4P17 A;  1R5I D;  5FO5 A;  4B7G A;  3WU0 A;  1YJ9 I;  2DZO B;  3VDU A;  2YNM D;  4DR1 M;  2BOL A;  4OVZ B;  2L01 A;  4G6D A;  4ZYG A;  2STT A;  3HOZ J;  2HS5 A;  2F4O B;  2XPV A;  1IM2 A;  4HBL A;  2LNH C;  5HLI A;  2KDO A;  4CA0 A;  4EM1 A;  3HOU J;  3E46 A;  2VQL A;  2C98 A;  1ZQ3 P;  2MA3 A;  2JA2 A;  2CU7 A;  2P4W A;  4F3Q A;  2EK5 A;  5E20 A;  5ITX E;  2Y0T A;  3K7A J;  4BXF A;  1R1U A;  2CSO A;  2VQG A;  4IQ4 A;  4RAY A;  3GBG A;  5EG0 B;  2M9H A;  2GA1 A;  2IXS A;  3FDY A;  1ZLJ A;  1PM5 A;  4EOR B;  1JJ6 C;  2Y0S N;  1SXJ E;  5IYB J;  1T98 A;  2VJ5 A;  2W24 A;  1MBF A;  3OYB A;  5I5Z B;  2X1E A;  1IW7 F;  2KL4 A;  4E4H A;  3PIO F;  1J59 A;  1TQP A;  2PMI B;  4LMY A;  3R0A A;  5GPA A;  3WHB A;  1JKR C;  4OW0 A;  4QLC U;  3I59 A;  1PUF A;  3ZRG A;  4CFU B;  2F4I A;  3W3C A;  2IAI A;  4G12 A;  4N4O B;  2V9P A;  4M71 A;  3DPL C;  3FUW A;  4QOZ C;  1RUO A;  2PBI A;  5EXP A;  1YE9 A;  2QEX I;  3PO3 J;  4BXX X;  2DD4 B;  2PEX A;  3HU2 A;  1QUT A;  3T1H M;  1L1Z A;  3MKL A;  1TL8 A;  1QLB A;  3UMM A;  4B3M M;  3HIF A;  5E3N A;  3TQS A;  1W5C C;  2EFN A;  5HLT A;  1JGS A;  3WTW C;  2QZ4 A;  3Q0V A;  1VQK I;  5LRR A;  1D5V A;  3K9T A;  1S3J A;  3LFU A;  2UU9 M;  4BAY A;  2CJJ A;  3PFY A;  2HOE A;  1S7O A;  2EV5 A;  3BZK A;  2DWN A;  1OCO H;  2R7S A;  2FE8 A;  1H24 B;  3UKG A;  3GLH B;  1QDR A;  2CUF A;  2YQZ A;  4JI7 M;  3HHH A;  4DUZ M;  1R00 A;  1O7L A;  4RA2 A;  5HS7 A;  4GDF A;  2HTJ A;  1ZRF A;  4BBR M;  2CFO A;  5LGU A;  4FCT A;  3KSX A;  2V22 B;  2KMG A;  3L09 A;  3M8J A;  2R4J A;  3E21 A;  2F5V A;  3CMM A;  4KT5 C;  2M60 A;  2NS7 A;  1HKQ A;  2K5C A;  2VQE M;  2BY2 A;  4OB3 B;  1VEJ A;  2XRN A;  2W7N A;  4KMF A;  4IEJ A;  1V34 A;  2M7B A;  5C4J J;  1U2W A;  2BVM A;  2NXN B;  3VFZ A;  4FTH A;  1UZC A;  2LVS A;  2KRU A;  2CH0 A;  4IJA A;  5DTD A;  3BDD A;  2KRK A;  1WCM J;  2GA2 A;  3OL4 A;  4DQ2 A;  3SFZ A;  3DOA A;  1MJ9 A;  3RKQ A;  4LLN A;  4LLL A;  4BL0 B;  1BA5 A;  1I39 A;  3FUU A;  4DV1 M;  4M9S A;  2HDC A;  4LFU A;  2PMU A;  2BHZ A;  4A5M A;  3OYI A;  4B7F A;  3CCY A;  5EFQ B;  1VQ7 I;  5IOZ A;  2KRH A;  1GO5 A;  2NVX J;  3OYK A;  2G3Q A;  4BE2 A;  4I76 A;  3SAU A;  4GXO A;  4P55 A;  1KQ8 A;  3VYG B;  1TWA J;  2WXV B;  2Y0S A;  1SEU A;  3CCE I;  2DPD A;  2PFB A;  1NHG C;  3W67 A;  1HJP A;  2QQ8 A;  2O0Y A;  3DKY A;  1RKW A;  4CXF A;  2EV0 A;  2DWM A;  4X0G A;  2A61 A;  4XLP F;  2AQE A;  4AC0 A;  1BIA A;  2FXA A;  2ZTD A;  4A3M J;  4M6X A;  1QA6 A;  5LHI A;  1DGB A;  1BBY A;  5JFR A;  2FE3 A;  2EBI A;  3CMY A;  5GPC A;  5IHY A;  2W99 A;  4JP0 A;  5K5Q A;  3JRA A;  1KYW A;  2WAD A;  3O3K A;  1FOX A;  4BGD A;  1ZRC A;  1N34 M;  1MIJ A;  1S9H A;  1STZ A;  2K27 A;  1G59 A;  2HKO A;  4XL9 A;  1MN3 A;  4AD9 A;  2HU9 A;  4ZJZ A;  1E94 E;  1POG A;  2KDL A;  2TRT A;  3DU6 A;  4OX9 M;  4BQA A;  4G4Q A;  2FOK A;  1JT0 A;  1Q39 A;  3I3L A;  3U6P A;  4W1U A;  4LF5 M;  4RM2 A;  3E5U A;  1AKH B;  2K9S A;  3FUT A;  2F2E A;  3HL2 A;  1X2M A;  1D3Y A;  4RMN A;  3CZ6 A;  4BCP B;  4L5I A;  1RPW A;  1MJB A;  4XIC A;  3CC2 I;  4XR6 A;  2XB0 X;  4NSO B;  3GZN B;  5F1R A;  2RQQ A;  4FET A;  4NUB A;  4Y33 A;  3FKE A;  1OIY B;  2M34 A;  3EOC B;  2LRD A;  2NS8 A;  1JJ8 C;  1BC8 C;  2C6Y A;  4D7N A;  1YTY A;  3T6P A;  1FWZ A;  1BI3 A;  1MH3 A;  1R6R A;  4KLN A;  3MN2 A;  2CHQ A;  5FSW A;  4G6T B;  4B47 A;  2W9Z A;  1KU9 A;  3GQ3 A;  3DFG A;  2VOP A;  1Z1D A;  2PK2 A;  1Z91 A;  1K3X A;  2IBD A;  4FE4 A;  4A3F J;  1YRN A;  2KR6 A;  2D1V A;  2BPM B;  1QQI A;  5EF6 A;  4HDU A;  1FMW A;  2MC3 A;  3Q0W A;  5F3W A;  1D0L A;  3EUA A;  2CZ6 B;  4BCJ B;  3DKX A;  3KP4 A;  2M2E A;  3FRI A;  4RGU A;  1GV5 A;  1OMI A;  4DZJ A;  2WSF F;  1GXQ A;  1TTY A;  3G33 B;  2COM A;  1I94 M;  2XSZ A;  4NXM M;  3ZMD A;  4HRI A;  2A5Y B;  3LCU A;  3BY6 A;  4RLF A;  1Z5B A;  2ELH A;  1F36 A;  1C0W A;  3GLI E;  1WKM A;  4LIU A;  1SD4 A;  3DBR B;  2PJQ A;  2Y48 A;  1FX7 A;  2G7U A;  1NHW C;  2KHH A;  1RZ4 A;  3K1P A;  4I98 B;  3WTS C;  1XD7 A;  2QDY B;  2RRE A;  5AON A;  2VKV A;  2M45 A;  3HHZ A;  2DQL A;  3CCJ I;  1MNE A;  2QBY A;  1VQN I;  3JRH A;  3CCR I;  5HBH B;  2LH9 A;  4BCH B;  2RAE A;  1TWF J;  2QGU A;  1J5E M;  3OYA A;  3ZCB B;  3QPT A;  3L2W A;  1DP7 P;  3GTJ J;  5FTN A;  3OOU A;  1K3W A;  4EVI A;  1ZGA A;  3VB2 A;  3U21 A;  5C4X J;  1OL2 B;  1IY1 A;  1XPX A;  2DOF A;  3ZXS A;  4CH7 A;  3OSF A;  3FXR A;  3L00 A;  4OAY A;  4PJN A;  3BP8 A;  2JQ7 A;  3F92 A;  1I3A A;  1Y0U A;  1E7P A;  2C4G B;  1T8I A;  3DJB A;  4HX8 A;  1D0Z A;  3KOY E;  1L2B A;  3ERE D;  3BCA A;  3IKV A;  2YR0 A;  4AIH A;  1H1Q B;  2QM3 A;  3K4K A;  4AKG A;  3K4L A;  5DDG A;  2HOS A;  3SHG B;  2COB A;  4L16 A;  2I7P A;  1XSX A;  5LD2 C;  1E17 A;  4OIO F;  3HHY A;  2MLG A;  1UCR A;  3MI9 B;  4UUT A;  4HLQ A;  2VDB B;  1PRB A;  3U60 A;  2ZNZ A;  1OPC A;  1G8P A;  1Y1V J;  3GTO J;  2V9K A;  1ZLK A;  3FZV A;  2QGS A;  1TQI A;  4R1H A;  1N33 M;  5ICC A;  4JI8 M;  5C44 J;  3QP6 A;  3B7Z A;  3QOP A;  1OCZ H;  1SMT A;  5F0F A;  2H6B A;  3A8M B;  3B7N A;  3OOP A;  5B1A H;  3OYD A;  2B63 J;  2OCE A;  3GLG E;  2MBF A;  4ZDL A;  1OQY A;  1UEL B;  3CMA I;  4LG0 B;  1UFZ A;  2KIM A;  3VPR A;  5E17 F;  3QHW B;  3TNH B;  1IN6 A;  1T3T A;  4LFB M;  1OKR A;  1QBJ A;  1IUY A;  2LDU A;  4DR6 M;  1BW5 A;  4J01 A;  2Y30 A;  5FRO A;  3HY5 A;  1OR7 C;  3KPH A;  1ON2 A;  2DA3 A;  5D5U B;  2ZO4 A;  3J7A Y;  2ZC2 A;  1GL6 A;  1WHC A;  2CW7 A;  3CDL A;  3JW4 A;  4M0W A;  2Z4S A;  3CJT B;  2JZ0 A;  4ZYA A;  3KP1 E;  4GC9 A;  2C5O B;  4BQN A;  5J6X A;  4PGH A;  4XOR A;  2ID3 A;  4AQY M;  4L0Z B;  4YEJ A;  4IHS A;  3KXE C;  1IBM M;  3HOW J;  2R4E A;  3KP2 A;  2KZV A;  2UXC M;  4OAZ A;  1APL C;  3MJ5 A;  3HBL A;  3HJQ A;  2O3F A;  2ZCW A;  4BS9 A;  2O8X A;  2AQF A;  5EEH A;  2R7D A;  4M74 A;  1O3Q A;  1ZP2 A;  1ONV A;  2BE5 F;  1XSD A;  5DS9 A;  3LOC A;  4IQJ A;  2QKL B;  4QHS A;  2UZD B;  1EKE A;  3RI4 A;  1W4M A;  4HEA 2;  4G7Z F;  2DI3 A;  5F1J A;  2ECC A;  3IHP A;  2XLJ A;  2LKP A;  5CKT A;  2FRH A;  4DIQ A;  2AHM A;  5LHH A;  4FHT A;  2XZF A;  1X37 A;  2HDW A;  3G3Z A;  5HS8 A;  5EXT A;  5J8C A;  4CFW B;  4CYD A;  4S05 A;  2A3S A;  2NRA C;  2HYG D;  1P92 A;  2MYS A;  3V76 A;  2VAS A;  4LJ6 A;  2R4G A;  3D5L A;  2IW6 B;  2ZJR F;  2ZJ2 A;  3WTU C;  2EUC A;  3DBL B;  5FGK B;  3KFW X;  2NOJ B;  1R9T J;  2KRF A;  2N8G A;  4G4N A;  1FNN A;  2L2O A;  1V5F A;  1JUM A;  2PMH A;  3K9O A;  5F64 A;  4J00 A;  3GQ5 A;  2VBW A;  2PN6 A;  3FXU A;  1FP1 D;  1RR8 C;  1Y8R B;  1OIZ A;  1JTX A;  4IBG A;  4JI4 M;  2D5V A;  2KHM A;  3NEU A;  1MMD A;  4HLY A;  1LFP A;  4PFP A;  2K85 A;  1V4R A;  5CQG A;  1B9N A;  2XGN A;  3FTC A;  2BWE A;  1NV8 A;  1X4O A;  2JVG A;  2Q8K A;  4ESJ A;  2KNZ A;  2X1D A;  1WJF A;  3A8H B;  1IZ1 A;  2X6W A;  2BY1 A;  3IHU A;  1MMN A;  4LZJ A;  2KP6 A;  3GPP A;  2IGM A;  4RBO A;  5IDN B;  2APL A;  2WFY B;  2OZU A;  3U61 B;  1TH4 A;  2XRO A;  1FYK A;  1GH6 B;  5CJ9 A;  2GXB A;  1K7A A;  4OU7 A;  5K1Y A;  3M0E A;  3L25 A;  3BR6 A;  4IBE A;  4EV0 A;  5EGO A;  1D1C A;  3PSI A;  3KZI C;  4OR5 B;  2DU9 A;  2LHC A;  1AIP C;  2DZN B;  4E7L A;  1HCR A;  3A1Y A;  4CCM A;  5C3E J;  2L6O A;  4DV6 M;  1QUS A;  5D4S A;  1QU3 A;  2KQR A;  4Y13 A;  4DR2 M;  2ZB9 A;  2F2C A;  3E1S A;  4YOO A;  4UVA A;  2ZCF B;  2LTP A;  2FQ4 A;  2M8E A;  2XAF A;  1XXH B;  1E3O C;  4GIT A;  3Q9V A;  4U0Y A;  1HNW M;  1D8J A;  2LC2 A;  5ITR A;  3OSG A;  2R0Q C;  4IBI A;  4B8X A;  3HX3 A;  4G6Q A;  2LVN C;  4MTE A;  3TP0 A;  5BS6 A;  4FX4 A;  5DNY A;  3BTI A;  3HYI A;  3R9X B;  2VI6 A;  4N0B A;  4EOJ B;  3HJ8 A;  2IS2 A;  2Z2S B;  3FXQ A;  3B02 A;  3WG7 H;  3S3O A;  2RDP A;  2EUF A;  1D1A A;  3FXO A;  2CWE A;  2KZU A;  3E6D A;  3GW2 A;  2R5Y B;  3BHV B;  1R22 A;  1WHU A;  2L9R A;  1ZG1 A;  2FBH A;  3QAU A;  3OYL A;  3CUQ A;  3F9K A;  3HSR A;  2CV2 A;  1JST B;  1BW6 A;  2ISZ A;  2LF7 A;  3GWZ A;  2FOI C;  4U87 A;  3TO9 A;  4AKH A;  5D8K B;  3VK8 A;  1IDY A;  4UB6 C;  5HBE B;  3RCO A;  3DLA A;  4BXU A;  2ZAN A;  4L4U A;  1MSE C;  4BHC A;  5DCM A;  1X1C A;  5M3M J;  3WTT C;  2HZD A;  4I02 A;  4AUX A;  1KGS A;  2VKH A;  1HDP A;  1ZH5 A;  2EH3 A;  4UVC A;  2NS0 A;  3BBZ A;  2CG4 A;  3U6O A;  2F5O A;  1B1B A;  1Z0X A;  1MBK A;  2QPA A;  3HC7 A;  2VPR A;  4MGK E;  1Z59 A;  2K3F A;  4PFO A;  4BQO A;  3GYH X;  2XGE A;  3LQR A;  3GLL A;  4RAZ A;  2HXI A;  1FMV A;  1BL0 A;  2PG4 A;  3S2W A;  5IT9 K;  2OU2 A;  1KQ9 A;  3L2U A;  3X28 B;  1SVL A;  3MMY B;  3SAS A;  1TDH A;  4F7Z A;  6PAX A;  5ITY A;  3W2W A;  2M3A A;  3F8F A;  2WB1 N;  4EAT A;  4D5C A;  1U78 A;  3U6C A;  4UUS A;  2K40 A;  3AJI B;  2B0L A;  2ELJ A;  1JKO C;  2KIU A;  2CEA A;  1WJA A;  2WY8 Q;  3D0S A;  1B72 B;  2OPT A;  4IBB A;  3ZQ7 A;  3LA7 A;  5EYR A;  1X1B A;  4IHX A;  3AFH A;  4ZC3 A;  5JHF A;  4DV3 M;  1QVU A;  1OTR A;  4U88 A;  3ZMZ A;  1E32 A;  2CW8 A;  2DFF A;  4P9U A;  1ZRE A;  4ROC A;  2ZM6 M;  2F5S A;  1R4N B;  3HRS A;  1HST A;  1D3U B;  3A46 A;  1Q1H A;  4HPQ A;  3WVE B;  2MD0 A;  2KZG A;  1XC5 A;  4UB8 C;  4XON A;  2IS1 A;  2MSY A;  2BS2 A;  4L8R C;  3BHT B;  3RFW A;  2P6S A;  4HSR A;  1GLN A;  2JPB A;  4WCG A;  1IXS B;  1G41 A;  3MMP A;  2BV6 A;  2O01 F;  4II2 A;  3MZY A;  2ZXH A;  3DOG B;  2L9N A;  1PJQ A;  1T0F C;  2H8W A;  1DO0 A;  1W36 C;  2E2I J;  4LF7 M;  3J81 S;  4LLG F;  1WFX A;  3IG8 A;  3LAP A;  4V19 K;  1N77 A;  3H5N A;  4B3T M;  5E8G A;  3MY5 B;  2YR2 A;  2LY2 A;  4R79 A;  2CWB A;  4LFC M;  5B5E C;  4MQV A;  4FCY A;  2GM4 A;  1WZ2 A;  5FKK A;  3JRI A;  1ZAR A;  1CUK A;  5AIP A;  3FYC A;  4GFB A;  1P4A A;  3MIA B;  3QPL A;  3JR5 A;  4LD5 A;  2P7V B;  3TWK A;  4RF1 A;  5F04 A;  1YRN B;  2E5Z A;  1RI7 A;  2NVY J;  3MZ8 A;  4MHG A;  4NRV A;  1ZK8 A;  2CCH B;  3H0D A;  4WW0 A;  3MVP A;  5CVJ A;  3KS8 A;  3PQJ A;  2R7G A;  1LVK A;  2V1X A;  5DEQ A;  5KQD A;  1H8A C;  4CYC B;  3SC3 A;  2H5X A;  4IPA A;  3X24 B;  1G3S A;  4NBQ A;  2JA5 J;  2LG4 A;  2F6C A;  1VZ0 A;  4BXX J;  4UN2 B;  4P96 A;  3J80 Z;  4CCL A;  2KRC A;  4Q4Z F;  2OJE D;  4EGY A;  1TD6 A;  5F0C A;  2AXT C;  3V8K A;  2WB1 A;  2DEN A;  3HXL A;  1L2C A;  4XKC A;  3J7A S;  2L09 A;  1I1G A;  1MBJ A;  2HEO A;  4F6W B;  2OC6 A;  5CYI B;  2Z9O A;  1RKT A;  3IKT A;  1H9T A;  2FH0 A;  4JI0 M;  3FIW A;  3ECO A;  4I8O A;  4N4N B;  4OB0 B;  2DJN A;  1TDZ A;  5EJC A;  2IJL A;  2QA4 I;  1MBG A;  1OCR H;  4ZTJ A;  4WXH A;  3R6S A;  3VEP A;  3QYH B;  1MX0 A;  4OGR B;  5LMU M;  3QRF F;  1V55 H;  5GAH J;  3RJP A;  4Y15 A;  2LFB A;  1IRZ A;  1E9H B;  1XGS A;  1FJL A;  3SEQ A;  2WEV B;  1D0M A;  5E26 A;  4A3G J;  1MJA A;  3LL7 A;  3S32 A;  3U9G A;  1YFH A;  3FD9 A;  2HR3 A;  4PJ0 C;  3L2Q A;  4II5 B;  1U5T C;  2DA4 A;  4L78 A;  4Y3O A;  2IEK A;  3BG3 A;  3F5X B;  2IT0 A;  5D8L B;  3GTL J;  4A69 C;  1IDZ A;  4CO8 A;  3A8O B;  1X58 A;  2X4H A;  3VOD A;  2OQG A;  3GP1 A;  3B6C A;  5E1X A;  2UZK A;  1H1P B;  1V29 B;  3FBN B;  1T6O A;  3WGI A;  4JI5 M;  3F3X A;  2VKD A;  3NQO A;  4PT5 A;  4JOM A;  3GO8 A;  1GY3 B;  1P9Q C;  5ITX A;  1NSF A;  1NV9 A;  5TJJ A;  3OS0 A;  1XGO A;  4P5O A;  3TOB A;  3HOY J;  3J80 K;  1DGH A;  2ZFW A;  5LEK A;  2HPM A;  4E7J A;  3L2V A;  3A98 B;  4QOS A;  3DKW A;  1FIP A;  4E70 A;  3VOE A;  3K70 D;  3LA2 A;  4CGZ A;  2XRL A;  3FM5 A;  3KE2 A;  2XAQ A;  4PK4 A;  4I0A A;  2L02 A;  4BKX A;  4HF1 A;  2RRU A;  2MGW A;  3RIR A;  3KET A;  1X2N A;  3CDI A;  2XSJ C;  2LH0 A;  2IGN A;  1TF0 B;  1I27 A;  5EP1 A;  1IQP A;  2R3S A;  3E6B A;  3JTG A;  5E3O A;  1XS9 A;  2X0L A;  4HL4 A;  1LV7 A;  1XB4 A;  3RKW A;  3GO5 A;  3H92 A;  1WPK A;  5IRE B;  4IRG A;  3X2Q H;  4MIM A;  4ZZL A;  2RGH A;  1HA8 A;  5L3B A;  3S2H J;  4BJT A;  3ASN H;  2AXL A;  5EQT A;  3RKY A;  2MJ5 B;  4U0W A;  3S17 J;  2ZPI B;  1SAX A;  5HLG A;  1KON A;  4EC9 B;  3RYP A;  3JAM Z;  3BZC A;  1GVJ A;  2DN0 A;  1IUF A;  2JP7 A;  1FC3 A;  3CP2 A;  3TN8 B;  3GLX A;  2QUF A;  3GFJ A;  2BGC A;  1FSE A;  2OQ4 A;  1WJD A;  4D80 A;  3H9J A;  2ZTC A;  1TQM A;  4DR5 M;  4DBG B;  3SDG A;  2QP9 X;  4FW9 A;  4A6D A;  3ZMU A;  1UMQ A;  4RLQ A;  4CCK A;  1IRG A;  2C9O A;  4G6L B;  1IBK M;  3REO A;  1L0O C;  2EJR A;  3VSL A;  1MDM A;  1V33 A;  1QGP A;  1S7E A;  1SMY F;  2O8K A;  5JR3 A;  2Y0M A;  2ZPH B;  1HW1 A;  3GXO A;  1GVN A;  4BCN D;  1L3L A;  5M5X J;  2Z99 A;  3DXJ F;  4NB5 A;  7CAT A;  4KIF A;  1FOW A;  1YYV A;  1GJT A;  2ZSH B;  3H36 A;  1ETV A;  2NVU B;  2D7H A;  2AHQ A;  5IYC J;  1WI3 A;  1EJ9 A;  4RAG A;  3F8C A;  2L3D A;  3AV0 A;  1VTN C;  4IOC F;  3NRV A;  3G4S I;  4UXN A;  2RGO A;  4CSW A;  3VKG A;  2FX0 A;  3TO6 A;  1QRY A;  4BJ6 C;  4IJE A;  3L2R A;  3H1C A;  1UM8 A;  2LLK A;  1OKW B;  2R46 A;  4YIR X;  3L2A A;  2HKX A;  1SXJ C;  5CLS A;  2F5N A;  2HWV A;  2H1K A;  1NJF A;  2UV1 A;  3O6B B;  1H9G A;  2VJJ A;  3H35 A;  5CVV A;  4OWR B;  3LAJ A;  5F27 A;  5JI6 A;  1H6U A;  3DPU A;  4DBR A;  1JKP C;  5HDK A;  3GLF B;  3JRB A;  3ZP5 A;  5H20 A;  1FTZ A;  2J7N A;  5FTJ A;  1VG5 A;  4MFE A;  2P5T A;  1JB0 F;  2OPF A;  5DUI A;  2RVC A;  3KP0 E;  3BPX A;  3PUB A;  5FRN A;  3HGI A;  3HRM A;  2R7T A;  3E0J B;  1TLH B;  4A0Z A;  3JAM K;  1JXS A;  4LJ4 A;  4UNO A;  1ETK A;  2VBZ A;  3DEU A;  4CFM B;  1ORY B;  3PNT A;  3G73 A;  4CHU A;  3A4C A;  4C30 A;  1J09 A;  1G3W A;  4FWD A;  2R6F A;  4H4K C;  3CTW B;  5L3E A;  2BZT A;  2DZL A;  4B08 A;  2W00 A;  4BHP A;  3H9Q A;  4QTR A;  3JRC A;  1W1W E;  2L54 A;  4IBK A;  5EGO B;  4WK8 F;  1A31 A;  2V79 A;  1IG7 A;  3R4K A;  4IOA F;  2YU3 A;  1Z77 A;  5TIS C;  4AKI A;  2OA4 A;  2GIZ A;  5K7Z A;  3PVS A;  1VI0 A;  4C2M J;  3WTX C;  4BYY A;  2KEB A;  3SAW A;  4L15 A;  1P7I A;  1K4T A;  2XEP A;  2MLK A;  1WRJ A;  2K47 A;  2K4B A;  3BJ6 A;  4BCN B;  1T2K A;  4F7S B;  4AIJ A;  2ZME A;  4XLN F;  2I5U A;  2W48 A;  1S29 A;  4IBC A;  3BC8 A;  4YFK F;  2L7F P;  4RNA A;  2DOD A;  1DU0 A;  2TCT A;  2QSG X;  1LJ9 A;  1MGT A;  5E79 C;  4PDI A;  2MAB A;  3QOE A;  1XNR M;  4MEY F;  1MMS A;  4J19 A;  3DTK A;  1G3T A;  4BBR J;  2UUB M;  2Z33 A;  2L2D A;  4DYC A;  2VKE A;  3A45 A;  3IV5 A;  3DP7 A;  3H0G J;  2AHJ B;  4ELL A;  4MO7 A;  3T5X A;  4LJ8 A;  3CUQ B;  2MRO B;  1IV8 A;  3T8T A;  4G4R A;  1NK3 P;  1TWH J;  2OOA A;  4XRF A;  1T08 B;  1HXD A;  3BR2 A;  3UR3 C;  3GLI A;  2DHY A;  1Y56 A;  3IRQ A;  3ZQC A;  2MW8 A;  2VN2 A;  3M9A A;  3QZ5 B;  2M4K A;  1Q1V A;  3Q0U A;  5DCM B;  4KJZ A;  3BR3 A;  2M5W A;  1LE8 B;  5ITQ A;  4LJ9 A;  3EUH C;  3U5Z A;  1HQY E;  3V4G A;  3JSP A;  4YOZ A;  5FLX K;  5IY5 H;  1ODD A;  1SFE A;  3E6C C;  1OJL A;  4MH0 E;  3H3Z A;  2ID6 A;  4JK1 X;  1OL1 B;  5DYG A;  1A6Q A;  1GL7 A;  1GKI A;  3B6A A;  2WAQ A;  2L9S A;  1WGN A;  5KK1 A;  2CGP A;  2BJV A;  2DQR A;  2VB6 A;  4YIF A;  2YU9 J;  1FOY A;  3GME A;  1IRF A;  1LTM A;  4JBA A;  2ZJQ F;  1H0M A;  2L7H A;  5JHU A;  3RPU D;  1YW9 A;  8CAT A;  1D5Y A;  4YFN F;  2L7I A;  3B89 A;  3GRY A;  1FY7 A;  3KZY A;  1YQA A;  5IYD J;  1G3I A;  1TH3 A;  4RDU A;  1J75 A;  1QHH D;  1AA7 A;  1GUU A;  4A3C J;  3HGY A;  4REZ A;  1WJC A;  2L7K A;  2KFD A;  4BDY A;  4HV6 A;  4PDK A;  3P5J A;  2R7F A;  5CVU A;  4A0Y A;  3VFD A;  1UGP B;  2EO2 A;  4AW4 A;  4FVM A;  3WE3 A;  3BCB A;  3Q3S A;  5GTH C;  2DO7 A;  3OIO A;  4HX4 A;  3SEZ A;  5EP3 A;  2PQ8 A;  2R5Z A;  3HOT A;  2ZXJ A;  4HV5 A;  4I09 A;  3M1E A;  1VQ4 I;  2GQF A;  2HKJ A;  3A2K A;  2XFS A;  1F4I A;  2JA7 J;  4DV4 M;  3GLG A;  3M1C A;  4B3S M;  4XKW A;  3M6A A;  3R0J A;  2L4M A;  3J7Z I;  3CCQ I;  1GDT A;  2HQA A;  1CGP A;  4LJA A;  4KIC A;  5GKN A;  2WIP B;  1U5T B;  2HNH A;  4EOO B;  4FCW A;  3KX2 A;  2GOM A;  4OOI A;  2G77 A;  2R65 A;  3FUX A;  1H89 C;  3POM A;  5K7F A;  1HDD C;  3AOG A;  2GAU A;  1XWI A;  1KYZ A;  2FOW A;  3MKY B;  1ZHF A;  2EFQ A;  1JHF A;  4M3D A;  2VON A;  3I4P A;  3MWM A;  3ZQQ A;  4Y28 F;  5LHG A;  4LF4 M;  4BBS M;  1XC8 A;  1R5L A;  1VIN A;  2KW0 A;  1KYI A;  1P2F A;  2YX7 A;  4U7D A;  4F93 B;  1OCP A;  1T95 A;  1N25 A;  2DOE A;  3PL8 A;  1JR3 D;  2Z3X A;  3Q8G A;  3BG5 A;  3D5S C;  3KEQ A;  3OR2 C;  1XGN A;  2DWL A;  1UG0 A;  5FFX A;  5FJ8 J;  2VJI A;  2UZL B;  2DTZ A;  4B48 A;  3T1Y M;  3G2B A;  5HOD A;  3F8N A;  1BI2 A;  4YG2 F;  3K4C A;  1P6R A;  3NDQ A;  2XUB A;  1SXJ D;  1DU6 A;  2PX9 A;  4HG2 A;  4IHV A;  4NSR A;  2BY3 A;  4PCQ A;  2R7X A;  3CCV I;  4QSH A;  3C3W A;  1IN5 A;  3BR5 A;  1HOM A;  1RRJ A;  5BPV A;  3VYH B;  3FWE A;  1QNT A;  1IO2 A;  4IRH A;  4CCJ A;  3PQK A;  3FTE A;  4QHT A;  3ZN1 A;  1N32 M;  1GV2 A;  4A3I J;  2ACJ A;  2ISY A;  1G8X A;  1ZAE A;  2HGC A;  2IA2 A;  3GPU A;  4Y52 J;  3C2H A;  2OV7 A;  1HBX G;  1G3Y A;  4OIR F;  2O61 A;  2KNV A;  3LSP A;  1GXP A;  4RB0 A;  3PXG A;  4YRV A;  2WWY A;  4LB5 A;  4DYQ A;  2X49 A;  1Z6T A;  3FK7 A;  4BCK B;  4IXA A;  1A6I A;  2JUC A;  4YEL A;  2N35 A;  4QIW N;  1QZZ A;  4LCB A;  1R71 A;  3EQL F;  2C9C A;  1BR2 A;  3MAJ A;  1SD5 A;  5LEJ A;  1Y0N A;  3BOQ A;  1FYL A;  3GEZ A;  4PD2 A;  3R8F A;  2R18 A;  3L28 A;  2LVQ D;  1B8I B;  3RTR A;  4BY1 X;  3E4R A;  1ZMU A;  1OKV B;  5BPI A;  2FQ3 A;  1UGS B;  3U6L A;  3NAU A;  5ICF A;  2JJ7 A;  2V6E A;  2X1C A;  4M3G A;  2OOB A;  4FT8 A;  1M1E B;  1TR8 A;  3SHF A;  3GTM J;  2OTJ I;  2JUG A;  4D5F A;  1Z7L A;  1K6O A;  2EIL H;  1UNG D;  2XHK A;  2DYR H;  1OR7 A;  2VUM J;  1SFO J;  2LOO A;  2LBF A;  1QYR A;  4R71 A;  4Q7J A;  4FD2 A;  2GBY A;  2YUS A;  2A07 F;  4ITQ A;  3KEY A;  4LB6 B;  3T1B A;  3N97 A;  3E7L A;  2E36 A;  4EM0 B;  4JI1 M;  3K1J A;  2XKO A;  2EIM H;  4LG3 A;  4I6Z A;  1XNQ M;  2ETH A;  1O9K A;  2DXB B;  3L2C A;  1SXJ B;  4FIS A;  2K86 A;  3G1O A;  4XKV A;  4GMQ A;  2CZ1 B;  4DYR A;  2V6C A;  3I9V 2;  2LR8 A;  2JK3 A;  2XGC A;  4O3M A;  3HKP A;  4R3D A;  1UB9 A;  3EYY A;  3QP5 A;  3IL2 A;  2C6T B;  1JTY A;  3K1M A;  2HTS A;  1P3Q Q;  4X62 M;  4RAF A;  1J7K A;  4BU2 A;  1XX5 A;  3S93 A;  3BHU B;  4M3E A;  3RDI A;  3HZJ A;  3LW5 F;  4K0K M;  1MKM A;  1QHG A;  3IH3 A;  4BEH A;  4G7H F;  4EOK B;  2Q2E B;  2F5F A;  2V7F A;  2XAG A;  5J4Y A;  1FIA A;  2DTR A;  1ZKG A;  1R2Y A;  2VE9 A;  4HZF A;  4ON0 A;  3JSO A;  2P7C B;  4EMS A;  1JOW A;  1QAQ A;  2RNG A;  3T38 A;  4XRS A;  2LF8 A;  3OMY A;  1Z9C A;  2FA5 A;  2I10 A;  2R7R A;  1YS7 A;  2MFZ A;  2VQH A;  1UJ8 A;  4M6Y A;  4HST A;  1R4G A;  3UGJ A;  4XRS G;  1S7A A;  2DHR A;  2VOO A;  5IZ7 D;  4EJV A;  3V7C A;  4RB1 A;  1UHW A;  5E1W A;  5KQ8 A;  5FKM A;  3V8J A;  4L0Y B;  2MD5 A;  4GO1 A;  1JKQ C;  1LVA A;  1WJ7 A;  4BBA A;  4F55 A;  2WJ9 A;  5FLV A;  1VQP I;  1BM9 A;  3I71 A;  3J2P B;  3ML6 A;  2FBK A;  2VL8 A;  3NAR A;  2E1M B;  4NC7 A;  4MGH A;  2H8R A;  4L5J A;  4Y17 A;  2GIV A;  1ETY A;  2FD5 A;  2QQA A;  3SFI A;  2UXN A;  4ZTF A;  2VXD A;  3UJN A;  2WPA B;  2BW3 B;  2CE7 A;  4WF2 A;  1WXQ A;  4F7N B;  2JY5 A;  3DF8 A;  5J1Y A;  1W5S A;  2FNA A;  3KCC A;  5M5W J;  2CO5 A;  4U0V A;  5CYV A;  2OO9 A;  4IIW A;  1LDD A;  3A0B C;  1KZH A;  4DNC A;  2UXD M;  2GQQ A;  4XK4 A;  2CV0 A;  2KPM A;  1XMK A;  4Y72 B;  1PJI A;  3ELK A;  1T33 A;  3NWS A;  4YY3 M;  4I3Z B;  1JT6 A;  3C9P A;  2KLO A;  2QWW A;  3AL0 B;  2LVO C;  1RC9 A;  4XM3 A;  2LKS A;  3MD2 A;  3ZH9 B;  3B9P A;  2FUG 2;  1G4A E;  1BJZ A;  3K4B A;  4ZDP A;  2QZ8 A;  3OYF A;  2ME6 A;  1V54 H;  4AVZ A;  1I5Z A;  3FX3 A;  1SD6 A;  1EF4 A;  1AWC A;  3BLR B;  3HHT B;  2X8A A;  3S1R J;  4CIZ A;  4GC5 A;  1QZY A;  2L5Q A;  5DQV A;  1IF1 A;  1EH8 A;  1WVR A;  3SBJ A;  4B09 A;  1FVV B;  4LGM A;  3AOE C;  5CVR A;  3ZCO A;  5ICP B;  1XN7 A;  4B3A A;  4A3B J;  4LIT A;  1W98 B;  4M0D A;  3SQN A;  4O5V A;  4ANR A;  1MNM C;  4DV5 M;  2ZBK A;  5ITT A;  1PDN C;  2X6X A;  3E5Q A;  3CGW A;  1WJE A;  5DM7 F;  1D1B A;  1TWG J;  4S12 A;  4JQF A;  4Y7N J;  2GLO A;  1N75 A;  4A93 J;  2BS3 A;  3SYK A;  1HT1 E;  2JSP A;  4LRS A;  4ENK A;  3ZQL A;  2Y0Q A;  2A6T A;  4X64 M;  1XCB A;  3TWL A;  1D8K A;  1VF9 A;  2E7X A;  5FGM A;  3D1N I;  2R93 J;  3DDP B;  4ELJ A;  2ZME B;  1PKD B;  2FEZ A;  2EA4 A;  5EXS A;  2K9Q A;  2DAE A;  3K2A A;  4DUY M;  1QPI A;  4KMU X;  1F43 A;  1R58 A;  3HM5 A;  1MMA A;  1IAW A;  5J1U A;  3EID B;  1AU7 A;  5IT9 Z;  3PNV A;  4S0H B;  1T56 A;  4D9J A;  3OIP A;  3P7N A;  1XGM A;  4HDV A;  4LRT A;  2EKK A;  2VC0 A;  1B4A A;  2ESH A;  1OFI A;  3MCZ A;  1UHS A;  2RNJ A;  5CPR B;  5KVR A;  4FX3 B;  1G3N C;  3V7R A;  3DA1 A;  3ILK A;  2QVO A;  3ABL H;  1QAO A;  4QPQ A;  3NBI A;  5HLH A;  2LXE A;  3I0T A;  4IO9 F;  2CMP A;  1SVO A;  1ZYR F;  5LMN M;  3I59 B;  4E7I A;  1PUF B;  3ZQH A;  1XB2 B;  3GPY A;  2HQ5 A;  3KP5 A;  3J80 S;  3GLI B;  2V1N A;  3BTJ A;  2P5K A;  5J47 A;  4JX5 A;  5K7H A;  1J0R A;  2WAE A;  5KPT A;  4JYK A;  1R4M B;  4OVZ A;  4PZJ A;  1MU5 A;  3S3N A;  2HVS A;  1H4L D;  4LJ5 A;  2R45 A;  4GIP A;  3HRU A;  2ADU A;  2LSO A;  4HNT A;  1IN8 A;  3JRD A;  1VQO I;  4JN6 A;  2YPR A;  5FB2 A;  3VWB A;  3RGF B;  2XF7 A;  3K70 C;  5B66 C;  3VK7 A;  3CCS I;  2R7V A;  5BMZ A;  1FEX A;  1IXC A;  3I4V A;  2DA7 A;  1O57 A;  3S1M J;  1W5T A;  3PJR A;  1R7J A;  2B9R A;  1HQC A;  2LHG A;  4WUR A;  2LYC A;  5EG0 A;  1KA8 A;  1VQ1 A;  4PDG A;  2KZS A;  4M3F A;  3TBI A;  4B43 A;  4BLC A;  1HT2 E;  3KHI A;  1HF0 A;  2JY8 A;  2RC4 A;  1TH2 A;  4GHA A;  3AG2 H;  3PIP F;  5D6F A;  2CV1 A;  1VDD A;  1DPU A;  2ZPB B;  4XLE A;  3A8G B;  4XNF A;  5IT3 A;  4E7K A;  3TE6 A;  5GAD J;  4A3E J;  1YSY A;  1FT9 A;  3PSF A;  2EIN H;  5BNJ B;  2VT2 A;  2Z1D A;  1P5E B;  1BI0 A;  1X3W B;  4OMZ A;  3H3V K;  2E1O A;  2EIJ H;  2V26 A;  3U1D A;  1OLT A;  2R7O A;  4MGI E;  2O6G E;  1W0T A;  3SAR A;  2E34 A;  2K9M A;  4PUS A;  3ASO H;  3HOS A;  4XBO A;  3ABM H;  1E2X A;  3GLG B;  1GT0 C;  5ILU A;  2RV8 A;  3UZU A;  2XSZ D;  5BNG A;  1P4W A;  2X6O A;  4GH9 A;  3AG1 H;  3GPX A;  2HXO A;  3GLH A;  3DZD A;  2E7W A;  3C18 A;  5LBQ A;  2ZPG B;  3ZQI A;  1TW2 A;  2JT1 A;  3I64 A;  1YLA A;  3K4M A;  2R0I A;  4XSZ F;  2XAH A;  4CCO A;  3WHL A;  1O3T A;  1LQ1 A;  1EV7 A;  2IP2 A;  1CQT A;  1DP3 A;  3A42 A;  2BKZ B;  1WI9 A;  3SYL A;  1TC3 C;  5HNH A;  2ZPE B;  1E9R A;  2YFQ A;  3IRR A;  4N9I A;  2ESN A;  4GGG A;  4E6K G;  4FM4 B;  4X66 M;  4IJF A;  4UN0 A;  2X4A A;  4F7L B;  1JHH A;  1D0X A;  3ZMS A;  2JVH A;  4C3I J;  4XQF A;  2P5L C;  1TFB A;  1MZB A;  2IN3 A;  2I40 B;  3X20 B;  4I5S A;  4XK8 F;  3CUQ C;  5L3C A;  2IW5 A;  3LNQ A;  2DI0 A;  3W6J B;  5JLW A;  1Z5C A;  1I4W A;  1WGX A;  1H27 B;  1TNS A;  2QKM B;  1ZV1 A;  4G94 A;  2XV4 S;  3ISP A;  3JAM S;  3ZQJ A;  4B3X A;  1SAU A;  5L8R F;  4C3J J;  1LPQ A;  1B6A A;  1ITY A;  2Q1Z B;  1NG7 A;  3OYH A;  2K9N A;  3C2G A;  2H27 A;  3HKZ N;  3HOX J;  2J5Y A;  3I55 I;  3HDD A;  1IFY A;  1QZE A;  2QSF X;  2W2H A;  4KNY A;  3JR9 A;  2C96 A;  4DR3 M;  1XHB A;  4GKJ M;  3GF2 A;  3L9F A;  4DJA A;  3TL4 X;  1PJJ A;  1LFB A;  2B3T A;  2ZSI B;  2JY7 A;  1OYI A;  4WP2 A;  1K82 A;  2FMY A;  2O25 A;  5KO3 A;  2K3P A;  3RQ4 A;  4GEW A;  2LP0 A;  4GRI A;  2A5W A;  2HI3 A;  5GP9 A;  1VOL A;  4ETS A;  2PMZ N;  5GTI C;  2DPP B;  2E35 A;  4TUW A;  4RGX A;  5FFZ A;  3OY9 A;  1OCT C;  1R5G A;  4W5W A;  2EKF A;  2V4J C;  4Q47 A;  5A2Q Z;  5FKL A;  4KHP M;  3HSF A;  3RZO J;  4YOS A;  1JSU B;  2ZXW H;  3ULQ B;  2Y9Z A;  1AKH A;  1SAN A;  3UNG C;  1H26 B;  2WBM A;  4ENM A;  1H25 B;  2JY6 B;  4AZF A;  1GVD A;  5DYI A;  1KXU A;  4LK0 F;  4A3L J;  1BVS A;  2QBY B;  4IHW A;  5L3F A;  3ZMT A;  1AD6 A;  4XKB A;  4HQE A;  2H1L A;  1JQJ C;  3CLO A;  5H37 D;  3I56 I;  4F6U B;  2DBB A;  4RS8 A;  1FKM A;  2DKL A;  3DTO A;  5LFA A;  2JXN A;  3QPS A;  5K5O A;  1ETO A;  4ZDO A;  1ZN2 A;  5F0H A;  4I2O A;  1AUA A;  1E0E A;  3JCU C;  1QVR A;  4NST B;  3N4M A;  1WIV A;  2E60 A;  2NVT J;  4UV9 A;  2IA0 A;  2BEO A;  1ERD A;  2XDV A;  4QWQ A;  2E1C A;  1VQ8 I;  3SDB A;  4I0B A;  1C1K A;  2V1C A;  1HKS A;  3LFK A;  5J3L A;  3WU1 B;  1YW8 A;  3F22 A;  1WSU A;  3HOV J;  4BUP A;  4XLA A;  3NWL A;  3MQ0 A;  3MK6 A;  2DAG A;  5LGT A;  4YC3 B;  3LSJ A;  2BHY A;  3DWL E;  5LLQ A;  2AO9 A;  4M72 A;  3COA C;  3OYN A;  3LQQ A;  2A05 A;  2M8G X;  4RGS A;  1S6L A;  1HLV A;  3U60 B;  3TED A;  2O9L A;  1NY5 A;  2L4E A;  3G71 I;  1X3U A;  3HKZ A;  4EJU A;  4ESF A;  4WWC A;  4Y4R A;  2UXB M;  2D1H A;  4UHT A;  3S8P A;  4BEH B;  3KVW A;  1VND A;  2ZFU A;  3QQA A;  4HF2 A;  2A6H F;  3OIQ A;  3A01 A;  2QQB A;  2XH9 A;  3ROU A;  3GTK J;  1TWC J;  3C1D A;  1R5H A;  3KLN A;  2DA1 A;  5A2Q K;  5FRM A;  5LRS A;  2V6Z M;  4XN3 A;  2GXA A;  1JE8 A;  1R36 A;  4EJW A;  2DNA A;  3EPZ A;  1E3H A;  2K6B A;  3HPH A;  1U8B A;  5FTK A;  5CVI A;  5AIQ A;  1SFX A;  2OCC H;  2E2J J;  3JTH A;  3GLH E;  4EQQ A;  4IMY B;  2ME0 A;  2OAZ A;  2PMZ A;  3R61 A;  1U9N A;  2CHV A;  4LGW A;  2UZE B;  2G5G X;  4C2T A;  3I5U A;  1H1R B;  3LWF A;  5EEG A;  4KIG A;  2E2H J;  2DFH A;  3WTZ A;  4LOC A;  3BG7 A;  3ZC7 B;  2IW8 B;  2LVA A;  4LK1 F;  1SC7 A;  5HBJ B;  2QEN A;  3F6O A;  4C2U A;  2ELK A;  1C7Y A;  2A68 F;  1I1S A;  1OIP A;  2XB5 A;  4M6V A;  3BXW A;  3CME I;  2G8L A;  2R44 A;  1YW7 A;  3L7W A;  4BJ5 C;  1ACI A;  2ZZD B;  4MGR A;  1IY2 A;  3FMS A;  3K10 A;  4KIS A;  4L18 B;  5L2W B;  3LSI A;  4I99 C;  4WXD A;  2L7Z A;  2OUM A;  2JWT A;  3CJQ B;  4XOP A;  3CCM I;  2H94 A;  2FJ1 A;  3VDX A;  1F4K A;  3SZT A;  4DR7 M;  2BWB A;  2K7L A;  2CQQ A;  2TDX A;  2H1R A;  3S15 J;  2A69 F;  4LG0 A;  1FJG M;  2XFT A;  2DXC B;  1DGG A;  3HHX A;  2VQC A;  4D1Q A;  3HJS A;  2G7H A;  2KA6 B;  4NDL A;  1MMG A;  3GZ5 A;  5HNF A;  1P4X A;  1K61 A;  1SFU A;  4PJM A;  4KFC A;  2JRT A;  2JA8 J;  5IP9 J;  1IBL M;  5KPZ A;  5H2F C;  2CQN A;  4I01 A;  5F08 A;  3ZQG A;  2IW9 B;  4CFV B;  3HU3 A;  5E6J A;  2CJM B;  4BCG B;  3CES A;  2GWR A;  3G1L A;  2VOD A;  4Q5S F;  3TKY A;  2VIX A;  4PCZ A;  2LTU A;  2VXZ A;  4KRC B;  1R6B X;  4BY1 J;  3KOZ E;  1V5E A;  4ANJ A;  2HOT A;  4AG5 A;  3I51 A;  3I58 A;  3DL1 A;  1RNL A;  1UGQ B;  3DQV C;  3UK6 A;  2PI0 A;  2K4J A;  1V3F A;  2HL7 A;  5J40 A;  5DD4 A;  5H6Q A;  4A3V B;  1FBU A;  1EFU B;  4NHJ A;  3H5A A;  3E5X A;  2W82 A;  1X1D A;  3M8F A;  2ZBK B;  4JX6 A;  3M4O J;  3TO7 A;  1VEK A;  3CJR B;  1N36 M;  1BR4 A;  3WVD B;  1G6N A;  1DV0 A;  2P6T A;  3F8M A;  3FMQ A;  3AAF A;  1MSF C;  5FLX Z;  1JUS A;  2CW0 F;  3FF5 A;  1ZMV A;  2W25 A;  4H0E A;  4S04 A;  1Q02 A;  3DPT A;  2NOG A;  4IZZ A;  1ZGJ A;  1V92 A;  3RZD J;  1K4S A;  2STW A;  3FTD A;  2Y9Y A;  2M1B A;  4II7 A;  4QNM A;  4JV5 M;  4EON B;  3EUH A;  4KOD A;  2DMQ A;  2DDA A;  2XKP A;  1VQ9 I;  3CD6 I;  3FE3 A;  2HZT A;  2Z3Y A;  2HYF A;  3J81 K;  1NG6 A;  1VFC A;  5M5Y J;  4KIB A;  4LG2 A;  3Q8X A;  4CIS A;  2JA6 J;  4ZYH A;  2E1M C;  1LEA A;  2BXY A;  2WIH B;  1R49 A;  4ZZD A;  9ANT A;  5C1B A;  5HQ0 B;  3DLL F;  2C5R A;  1OAO C;  4II3 A;  1BU2 A;  1ZG3 A;  2Z5U A;  2CCI B;  4IKF A;  3HEF A;  2DA6 A;  3GRU A;  4OIP F;  3SMP A;  4GKK M;  3OR1 C;  2M0M A;  3K92 A;  1LKX A;  3I4Y A;  4CXA B;  3BTC A;  2Y2Z A;  2F4M B;  3BJO A;  5M3F J;  1NK2 P;  4HQM A;  1UAA A;  1IN7 A;  1BIB A;  3FRH A;  1YOV B;  3BPV A;  3CTA A;  3U61 A;  1JR3 E;  3Q9S A;  5J4V A;  2DPU A;  3HO8 A;  2G0E A;  1K79 A;  3IP4 B;  2M7A A;  2V9V A;  3KP7 A;  1YHQ I;  3KW6 A;  1CF7 A;  4FWG A;  2O7O A;  4M9X A;  3FXJ A;  2M87 A;  1LEB A;  3EYI A;  2R7U A;  3IEC A;  4JYA M;  4KA4 A;  2PLY A;  2P8T A;  2DA2 A;  3L1P A;  2EWN A;  1WR1 B;  5FKO A;  4ZYD A;  3KYC B;  1TT5 B;  2LBC A;  2WY7 Q;  3AL0 C;  4V2G A;  3B57 A;  5CEI B;  5ACB A;  4G8X A;  2LNB A;  3IUO A;  5F6F A;  3OYE A;  4C3H J;  1XXH A;  1UHM A;  4WX9 A;  1U3E M;  2DAI A;  4UV8 A;  3EIE A;  3EUK L;  4IBD A;  1ON1 A;  1D2N A;  4CJ6 A;  1T6S A;  3QOD A;  1U0J A;  2WA0 A;  4MLO A;  2RQP A;  4L9J A;  4EOP B;  3DTE A;  3U2R A;  2EA2 A;  5HVY B;  4ENJ A;  3LST A;  3ZR8 X;  4OIQ F;  2CYZ B;  1XDS A;  4BBS J;  3ZOB A;  4UUS B;  2R5Y A;  1O4X A;  2DWZ B;  2EB7 A;  4B44 A;  2WSC F;  3L29 A;  3HG9 A;  1IV6 A;  4BB9 A;  4OIN F;  2PHG A;  5HNB B;  2DMP A;  5B3S H;  2R7Z J;  3M7G A;  3C7J A;  2HYJ A;  2OTL I;  5L3D A;  3U6S A;  3K7A M;  4LF6 M;  3K2Z A;  2MGQ A;  2LY1 A;  2ZME C;  2M0C A;  1FZP B;  3M03 A;  3S14 J;  4L9T A;  3CO7 C;  1ZTR A;  3TDZ C;  2KXE A;  1FIN B;  1OFH A;  4BE1 A;  2CRU A;  3V42 A;  2MC4 A;  1BOA A;  4ESB A;  3RPQ A;  1I6X A;  4XN0 A;  3J27 B;  4B4C A;  5E3M A;  1WH5 A;  1IY0 A;  2AS5 F;  4RM3 A;  2FNP A;  2LY9 A;  1GJS A;  1WH7 A;  2OBP A;  3IC7 A;  4X1E A;  2XVC A;  1U9O A;  1HR0 M;  3MKW B;  1K83 J;  2C5N B;  1IRE B;  1PJR A;  3BOS A;  1F5T A;  2OQR A;  3H5R A;  4HF0 A;  2L7M P;  4PSW A;  3DEW A;  4HX7 A;  3M07 A;  2EJS A;  1QVT A;  5KNL A;  5EEA A;  3RE8 A;  1BI1 A;  2CZ0 B;  5E8I A;  5ICG A;  1XTA A;  1YJN I;  3HU1 A;  4BY7 J;  4ZYE A;  5EP2 A;  5E18 F;  4LF9 M;  2JPC A;  4KYW A;  2JZ1 A;  2YSR A;  2G9X B;  1B72 A;  3BJA A;  3E97 A;  3JRF A;  2QF7 A;  1LFU P;  1WJ5 A;  3F72 A;  3DU5 A;  3ONQ A;  4DGW B;  2LK2 A;  1TZL A;  4NOO B;  5BQT A;  4E7H A;  1ZQ9 A;  3J7Y J;  2L4F A;  2IPQ X;  4A2U A;  3FBI B;  1XMA A;  2DMT A;  1QAN A;  1YS6 A;  1ENW A;  3X26 B;  1OYY A;  3K69 A;  4AM3 A;  4CRL B;  4ITV A;  4F7J B;  4IF4 A;  3ZGK A;  4IHY A;  5IP7 J;  3H4C A;  1Z6R A;  3MY1 B;  2MH8 A;  3SAT A;  1REP C;  1V5G A;  4IBF A;  3WHC A;  2K0B X;  1OCC H;  2W84 A;  1I3Q J;  1IXS A;  1Z67 A;  2MH2 A;  1NO1 A;  4FAS D;  1RES A;  4MQ9 F;  4CHT B;  2LW4 A;  2CQK A;  4I4L A;  2LMD A;  4IX7 A;  4IBJ A;  2W57 A;  1N4M A;  3A0H C;  2NQ8 C;  2YX4 A;  3FIS A;  3LSG A;  5ED4 A;  4BDZ A;  2VE8 A;  3FHN A;  1B9M A;  2BXZ A;  2EZK A;  1T43 A;  4HNU A;  3EDP A;  3BWG A;  3I4N J;  5IP6 A;  3HTU A;  1UGR B;  3VLF B;  3JRE A;  5ITU A;  1ZAO A;  2HAK A;  1T38 A;  3CQZ J;  1BOB A;  2D45 A;  1YO5 C;  1GUX A;  5KHD A;  3CF0 A;  4RKU F;  1Q3B A;  1HNZ M;  1QMZ B;  4G4O A;  4BH9 A;  5IPA A;  1Z05 A;  2KJC A;  3EET A;  2XGX A;  4NC8 A;  2GXG A;  1TTE A;  3KFU G;  1R1V A;  1YX3 A;  3DEE A;  3U1K A;  3CO6 C;  3M3Y J;  1PVE A;  4NC6 A;  4EEF G;  2IGO A;  5DQW A;  4CYC A;  4WXC A;  3MKZ A;  2JSC A;  3IWF A;  4BE0 A;  1Z7U A;  2Q0O A;  4F70 B;  3B73 A;  1WWX A;  1XXH E;  4OB2 B;  4CGY B;  2FS1 A;  1R2Z A;  4XSX F;  1NY6 A;  1PJS A;  5DFL A;  4DV0 M;  3TOA A;  2B7E A;  3KP6 A;  2BBY A;  1R23 A;  4Z8X A;  2M30 A;  2UWM A;  3VSK A;  5HDG A;  3X25 B;  2CZ7 B;  1DPR A;  3WE2 A;  3ABT A;  4CZZ A;  4EJO A;  4ZGD B;  3NWT A;  3LVW A;  3GCM A;  2X1N B;  1XMQ M;  5TRD A;  1DGH B;  2KKO A;  3HWS A;  2QCO A;  3P9I A;  2Y21 A;  4XGI A;  3A01 B;  4OU0 A;  4A3K J;  2X85 A;  2EFO A;  4A0X A;  4A6E A;  4EJT A;  3H4M A;  3BQY A;  1UG2 A;  4LJZ F;  4PJJ A;  4EIW A;  3HRT A;  4BCM D;  1O3S A;  1PJT A;  1WQ2 A;  1ETX A;  5IT9 S;  3GFM A;  4HOB A;  4ZH4 F;  5D4R A;  1YI2 I;  3TNI B;  1TW3 A;  2KIQ A;  3GQ4 A;  4RB2 C;  4F52 A;  3ESW B;  3LCV B;  1R7R A;  3IAS 2;  4U7B A;  1W7P A;  4FE7 A;  1KU2 A;  2RKO A;  2WAF A;  1FYM A;  3RSN A;  4G9Y A;  1Z3Y A;  2J7O A;  2LKX A;  1DGF A;  2ERC A;  1RET A;  3LQ5 B;  4B7H A;  4Z6Y A;  3CCU I;  1NH3 A;  2ZKZ A;  4KN4 X;  3QYG B;  3ZPL A;  5DUK A;  1SG9 A;  1VEG A;  4BCI B;  3I53 A;  3HTS B;  2CQX A;  3U6E A;  1AHD P;  2QFZ A;  3QYF A;  1O7F A;  4ROE A;  3BR0 A;  4F2L A;  2KMU A;  2OZ6 A;  1MH4 A;  3KIO A;  5LGN A;  3BG6 A;  1IRX A;  1AHJ B;  1LB2 A;  1BR1 A;  1IJW C;  4AVP A;  3V7S A;  3A03 A;  3RYR A;  3U6Q A;  1JGG A;  2X48 A;  3JR4 A;  1KU3 A;  3SAV A;  3OYM A;  3WOD F;  3H4J A;  3ERM A;  4NQW A;  1DGR M;  1OYW A;  2VBX A;  3FM3 A;  4A5N A;  4F91 B;  2RN7 A;  5JVT A;  1MDM B;  2FU4 A;  3K6G A;  2DYS H;  3SYT A;  3PO3 S;  1EH7 A;  2JZY A;  3HGG A;  2JGZ B;  3I04 M;  1ZEL A;  5EDN A;  2VLA A;  4M9Z A;  3AOE A;  3E9S A;  4A12 A;  3MFK A;  1KU7 A;  3QXE B;  1OIU B;  1PGY A;  1NHA A;  4EOL B;  4BCO B;  3AKZ A;  1A5T A;  4D82 A;  1F9N A;  3KOW E;  2IGK A;  1LNW A;  3LSK A;  1OAI A;  3FKJ A;  2DFE A;  1ENH A;  4HEO A;  3RKX A;  2WC2 A;  4M73 A;  3I01 M;  1A5J A;  2DOA A;  4LJ7 A;  4BCM B;  3PO2 J;  3CF2 A;  4IRI A;  3P9K A;  4CIC A;  2KJB A;  3GFL A;  4PSX A;  5DV5 A;  5GAE J;  4LZZ A;  3F23 A;  1DO2 A;  5DD8 A;  5EZH A;  3FKI J;  4X6A J;  5IDP B;  3C2B A;  4PJL A;  2EFP A;  3MEX A;  3GTQ J;  1MJG M;  4XLF A;  4DBQ A;  3W2A A;  2LRE A;  4MTD A;  2WMA B;  4CFN B;  1A36 A;  2WV0 A;  3TDU C;  1TNT A;  1YLF A;  1OFC X;  3ABU A;  3CJN A;  4KN7 X;  3S16 J;  1XMO M;  1YUB A;  3OS2 A;  1USS A;  3BT9 A;  5K5R A;  1A35 A;  2IVM A;  4AYB N;  1TP4 A;  3T8R A;  3QYE A;  2EZH A;  4OB1 B;  2L0K A;  3FXK A;  5D6E A;  3I4M J;  1AOY A;  3FK6 A;  2MH9 A;  2IVX A;  1A04 A;  2WSE F;  3JRG A;  5IWA M;  3CP8 A;  4FQG A;  1HNX M;  2IS6 A;  1TT0 A;  3HUG A;  3F6V A;  5H6R A;  1UNL D;  2HHH M;  4B3R M;  1X3Z B;  3DDQ B;  1ETQ A;  2H6C A;  4RF0 A;  2WZJ A;  2ZAO A;  1TBX A;  4C9Y A;  3J7B A;  4BY7 X;  4EOM B;  4JXJ A;  1X1P A;  1PP7 U;  3GLF A;  3U6M A;  2PJR A;  4LIV A;  2O03 A;  3C3E A;  2X51 A;  4CUG A;  3WTV C;  4PGG A;  4AI6 A;  4X65 M;  1G2H A;  3WG9 A;  3N05 A;  5LQF B;  5DCF A;  1GAB A;  3IWZ A;  2DDB A;  4HAM A;  2CUJ A;  3SXY A;  1L2D A;  2DT6 A;  1K78 A;  3AG4 H;  4YFX F;  3FTF A;  3D5R C;  3KP3 A;  4IL6 C;  3ZQF A;  4AU7 A;  2HDD A;  1SVM A;  2I7N A;  5J8F A;  1ORK A;  1CF7 B;  2W9F A;  3NBX X;  3VKH A;  1RIO H;  4NXN M;  1C9B A;  3IH2 A;  3TQN A;  2KNA A;  3HHW A;  5A2Q S;  3KDS E;  3BQZ A;  4Q48 A;  3U5Z B;  2Y20 A;  1XSV A;  2VT3 A;  1DGW Y;  3MZH A;  3K9P A;  3S1N J;  1Y8G A;  4AG6 A;  2F4V M;  3HJE A;  1QQW A;  3TWM A;  1Z5A A;  1J2X A;  4P16 A;  1W0U A;  2RGV A;  4XLH A;  4AIK A;  5FLM J;  1EA3 A;  5ILV A;  2DA5 A;  3WGG A;  1IN4 A;  1URC B;  1ZRD A;  2JN6 A;  2BNK A;  2W1O A;  4CFX B;  2D7G A;  3DFZ A;  2M5Z A;  3OYG A;  4IHT A;  2JWS A;  3H3U A;  1FPQ A;  2BYV E;  2O5R A;  3FXL A;  4F1I A;  5ILS A;  5E3L A;  2QHO B;  1ZG5 A;  1HKT A;  2DT5 A;  4F6S B;  2P0W A;  3TMO A;  5FTL A;  2ZAM A;  4YHH M;  2NNN A;  3WTY C;  1Y39 A;  2R92 J;  1FSH A;  5HS9 A;  4AYB A;  2Z8Y M;  2F5Q A;  1NNU C;  4MB7 A;  1MW7 A;  1ULY A;  4EOI B;  3GX4 X;  1T0F A;  4XRM A;  2UXX A;  1S8N A;  2EFW A;  2PK9 B;  4K2E A;  1JUP A;  2VJ4 A;  2Y69 H;  1IXR C;  2IRF G;  2F5P A;  3P9C A;  4L5E A;  1MBE A;  3LVV A;  1LUJ B;  3W6K B;  2E5N A;  2IA1 A;  4E7S A;  1KSF X;  4NRW A;  2ZJP F;  4HYE A;  1D0K A;  4MGZ E;  3VDP A;  1XO2 A;  4W97 A;  2E5L M;  4P1W A;  1S72 I;  1H1S B;  3GTM S;  2Z4R A;  4NL4 H;  2CS3 A;  2DJI A;  4XMY A;  1LE8 A;  2W96 A;  4EC8 B;  3FXM A;  2DLL A;  2V1U A;  1EIJ A;  2R5Z B;  1OGU B;  1BN5 A;  4EM2 A;  4MEX F;  2V1D A;  2CUE A;  2CUZ A;  2JUJ A;  1SD7 A;  2DW4 A;  3DTI A;  3BLY A;  3OWT A;  4DV7 M;  2QLZ A;  1H88 C;  3KYL A;  3PFI A;  4KO8 A;  2CYY A;  2DCE A;  5LMK B;  5JVG F;  1H28 B;  2Z16 A;  1HW2 A;  2EPF A;  4R7G A;  2X9D A;  3AG3 H;  2P5V A;  4JI2 M;  3BRO A;  3QU3 A;  1HSJ A;  1VQM I;  4KT6 A;  5C18 A;  1BC7 C;  3TPZ A;  2Y75 A;  4EOS B;  2EZL A;  3S3M A;  1XCV A;  3HPG A;  3QAH A;  2DVW B;  2J5O A;  5GAG J;  3D8B A;  4RGR A;  3CLQ A;  1I50 J;  4MM3 B;  1Y8Q B;  3RGS A;  1QPM A;  4A3D J;  4IVN A;  4XID A;  3L27 A;  4EGZ A;  1QDT A;  5D5X B;  3S1Q J;  4BCF B;  2EV6 A;  4GYI A;  4DZP A;  1YIO A;  2IS4 A;  2QCU A;  3K8Z A;  4ASN A;  4KIT B;  2HWJ A;  2LD5 A;  2M4G A;  5JI2 E;  2E71 A;  4AID A;  2UUC M;  2F5E A;  3K4J A;  1PUE E;  1IC8 A;  2DAO A;  4V2F A;  2RKH A;  1VDL A;  5D5V B;  2H09 A;  4L6V 6;  2DFI A;  3WGH A;  3CCL I;  3ABK H;  1WJB A;  4TTH A;  5EP4 A;  1HW5 A;  3K1N A;  1NJG A;  3LMM A;  3TW7 A;  1YJW I;  4KDP A;  1DQU A;  3QZ9 B;  1EE8 A;  1LDJ A;  4XOT A;  1YIT I;  2KT0 A;  5JLX A;  4DW6 A;  3FUV A;  3E6M A;  3KSJ A;  1XG1 A;  4JX4 A;  4L9N A;  2WHB B;  4KRD B;  1AIS B;  2NAZ A;  1U5T A;  2CFX A;  1N78 A;  3FHZ A;  5KCM A;  4ROD A;  1X19 A;  3KEO A;  3GLF E;  3OYC A;  3B74 A;  1W7P D;  4HLX A;  2HCB A;  2K9D A;  4EOQ B;  1UFM A;  3VYT B;  2QQ9 A;  3CUO A;  4O6J A;  3KYD B;  2B9S A;  3EIH A;  2EZI A;  3K0L A;  3A8L B;  3DBH B;  2JRM A;  2JMW A;  3HSE A;  2BJW A;  3BZ6 A;  4HNV A;  2DME A;  3W0F A;  4RB3 C;  4GHL A;  4HA8 A;  1E3P A;  2FML A;  2J5P A;  3WU2 C;  4LGY A;  5B1B H;  2ZXI A;  3SZP A;  2GOX B;  2CP8 A;  1GUX B;  3W6V A;  4DR4 M;  1RUN A;  5E1Z B;  4BNC A;  3OV8 A;  4I7H A;  4LFA M;  1IXZ A;  2VF8 A;  4D81 A;  2HPI A;  2W85 A;  2Y31 A;  3TGN A;  5J1R A;  2WMB B;  4JI3 M;  2XIG A;  2QSH X;  4G6Z A;  3LSM A;  2MG4 A;  4UUV A;  5KAI C;  3RPU A;  1ZMW A;  2D7E A;  2GZW A;  2HVQ A;  2XPU A;  2ZPF B;  4HW0 A;  4GYG A;  1QO0 D;  1DUX C;  5ICE A;  3TP3 A;  1O3R A;  3WHK A;  2MR9 A;  2L9V A;  4QNR A;  3IG5 A;  2UUA M;  4MNU A;  4LF8 M;  2A6E F;  3BG9 A;  4KUM A;  2DK5 A;  2R62 A;  2LBF B;  3IAM 2;  1EH6 A;  1FBQ A;  3A02 A;  3W2V A;  5HOO A;  4ZPX A;  3THG A;  5JI3 E;  1S3S A;  2VQF M;  1LDK B;  2DMN A;  4E7Z A;  5FLX S;  4ABZ A;  4XBF A;  1JKW A;  4FCV A;  2BS4 A;  1L8Q A;  3U6D A;  3OL3 A;  3LA3 A;  1O9K B;  1XDU A;  4M3B A;  2KDZ A;  2EIK H;  2NNY A;  2E19 A;  4GCV A;  1B59 A;  2C5V B;  4B1R A;  3GZ6 A;  1VQ5 I;  3GFI A;  2OD5 A;  2XAS A;  3OS1 A;  1QZM A;  5HVQ C;  3C3D A;  2XZU A;  2GNO A;  3M8E A;  3RGP A;  1NVM A;  2QDJ A;  4P9F A;  5FTM A;  3LSH A;  2HQN A;  3KS4 A;  1PP8 F;  5KPR A;  1W7P B;  5HDN A;  5ERI A;  3VYU B;  5DYM A;  1G4D A;  2XC7 A;  1K6Y A;  2LVP C;  4TV7 A;  3GUD A;  4MFD A;  1B8I A;  3QHR B;  1FP2 A;  2XF5 A;  3F21 A;  4DOZ A;  4CCN A;  3W0L B;  3KLO A;  4F92 B;  1YG2 A;  3ZMV A;  3BTL A;  2XSD C;  2VII A;  1TGU A;  3O8H A;  3T0Y A;  3F8B A;  1JR3 A;  3GRV A;  1U6G A;  3SMS A;  1P7J A;  2F48 A;  4AWX B;  1L1T A;  2XGD A;  2UUZ A;  1UST A;  3PM1 A;  3D8L A;  1YIJ I;  2WTE A;  2DT7 B;  2K02 A;  4N9H A;  4UVB A;  4LY6 A;  3I54 A;  4QPO A;  4Z2Y A;  1SXJ A;  1SFK A;  4NQW B;  3IH4 A;  2DAM A;  3BR1 A;  3VYS B;  3KOX E;  3K4N A;  1S5L C;  5FD6 A;  3PNY A;  5IOY A;  5DM6 F;  1X4P A;  2LWX A;  1MBH A;  2QYO A;  1OKS A;  5FKN A;  2C5X B;  2UUE B;  2Z7J A;  2L4A A;  3KZZ A;  2VF7 A;  2F5D A;  1BJA A;  2F5C A;  3H9G A;  1F5Q B;  4CZC A;  1UNH D;  2FFJ A;  5EXX A;  1ETW A;  2ECB A;  2FSW A;  5D5W B;  1I6H J;  1Y6I A;  3CF6 E;  3HHG A;  1KFV A;  3MHV C;  3O2P E;  2XAU A;  2OF7 A;  3F0C A;  4UY8 I;  2Q2E A;  2R7W A;  2JNH A;  4BCQ D;  3G1M A;  3QYB A;  3T15 A;  1YX5 A;  1Z3X A;  5BOX A;  1ZGW A;  1HC8 A;  1FLI A;  2VPL A;  2KIS A;  3J81 Z;  4YII A;  3OYJ A;  3QPH A;  4A3J J;  4L9V A;  1JI8 A;  3K2L A;  1PYV A;  1T39 A;  1Y1W J;  3CDH A;  3RQI A;  4I81 A;  3Q5F A;  2DD5 B;  4ZGE B;  1QAM A;  2DMU A;  2P81 A;  1GHC A;  5FD5 A;  3PUF A;  3R60 A;  1E9S A;  4DV2 M;  2DXI A;  2HFH A;  2QNJ A;  2WV1 A;  3OTO M;  2CQ7 A;  2KIF A;  2NVQ J;  1NNJ A;  2XPW A;  3EJ1 B;  2X6Y A;  2XF6 A;  5TGT A;  5IF1 B;  1J9I A;  4BQQ A;  1F1Z A;  4FWH A;  2NYX A;  3GTG J;  2FF4 A;  2YS9 A;  2E1N A;  1OIS A;  3E3V A;  5BPD A;  3C58 A;  3GTP J;  3V8L A;  2D0Q B;  1Q3C A;  1X1A A;  4ENN A;  1MND A;  3CF5 F;  2I53 A;  1VYW B;  3SZG A;  3ECH A;  4KT0 F;  2BW3 A;  2VBY A;  5KAF C;  1ZR4 A;  1ZR2 A;  3TNW B;  1D0Y A;  4D7M A;  1G71 A;  1OI9 B;  4FX0 A;  1DDN A;  3FMR A;  4JI6 M;  4BAC A;  3GVA A;  1WGL A;  2EQR A;  3DCF A;  2ICW G;  1FOK A;  2HVR A;  3O0G D;  3LSR A;  2D2W A;  1KQ0 A;  4NNJ A;  5EZG A;  1FTT A;  3HUG B;  4G3O A;  3VYR B;  2XF3 A;  4D0P A;  2PJP A;  1RU3 A;  3FYD A;  2XAJ A;  1J5Y A;  3B7Q A;  2HOA A;  4OMY A;  4ZGJ B;  1W36 D;  4CFU D;  3O8G A;  2BVL A;  3ZN0 A;  1Z21 A;  1IGN A;  1VQ6 I;  3G6E I;  3HB9 A;  2CRG A;  4XLC A;  5CQE A;  3BLH B;  1MD0 A;  2UZB B;  3SJM A;  5L3G A;  2CHG A;  3CC4 I;  3GRR A;  2PJR B;  2BY0 A;  3TW6 A;  2DAK A;  3QU6 A;  1VQL I;  2W4S A;  4BCQ B;  4R8H A;  2HQR A;  2WAQ N;  1R1T A;  4CDG A;  5BR8 M;  2JTV A;  2EA0 A;  1XMX A; 
#chains in the Genus database with same CATH homology
 4ELJ A;  4M6V A;  4MFD A;  3VKG A;  3QWL A;  2DXB B;  2ZZD B;  1UGP B;  2CZ1 B;  4P17 A;  4NC6 A;  4OB0 B;  5EJC A;  4AKH A;  3QYH B;  4OB2 B;  3HZJ A;  4OB1 B;  2DXC B;  3QYE A;  4MFE A;  3HBL A;  2CYZ B;  3X25 B;  2G77 A;  2CZ7 B;  4ZGD B;  4JX5 A;  2DPP B;  3BG3 A;  3A8O B;  2KR6 A;  3TW7 A;  4BBS M;  3QZ9 B;  4HNT A;  3X28 B;  1V29 B;  2CZ6 B;  4JX4 A;  3BG5 A;  3DL1 A;  4AKI A;  1UGQ B;  3QYB A;  2WJ9 A;  4AI6 A;  1FKM A;  2DD4 B;  1QLB A;  1IRE B;  4JX6 A;  3A8L B;  4Z6Y A;  3KHI A;  3WVD B;  4HNV A;  4ZGE B;  2DD5 B;  3VKH A;  3QYG B;  4QSH A;  2QDY B;  2CZ0 B;  2ZPB B;  3WVE B;  2QFZ A;  3A8G B;  3VYH B;  1AHJ B;  2BS2 A;  4HL4 A;  2AHJ B;  2QF7 A;  4BBR M;  3A8H B;  4MIM A;  2KMG A;  2ZPF B;  2D0Q B;  2ZCF B;  3QZ5 B;  2ZPI B;  4OB3 B;  1E7P A;  3BG9 A;  3X26 B;  3QXE B;  2ZPG B;  3H4C A;  4AKG A;  2BS4 A;  3HHT B;  4ZGJ B;  4HLQ A;  2ZPE B;  1UGS B;  2ZPH B;  3HB9 A;  4FM4 B;  3VYG B;  3TW6 A;  3HO8 A;  3X24 B;  3X20 B;  3A8M B;  4HNU A;  4LOC A;  2QQ8 A;  2QDJ A;  2BS3 A;  1UGR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...