4NC6A

Tbc domain of human rab gtpase-activating protein 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
ETWGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tbc domain of human rab gtpase-activating protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords Rab GTPase-activating protein 1
total genus 113
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4nc6A02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 4nc6A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4nc6A03
4P17A 4HL4A 2G77A 2QFZA 3HZJA 3QWLA 4HLQA 3QYBA 5EJCA 2QQ8A 4Z6YA 1FKMA 3QYEA 4NC6A
chains in the Genus database with same CATH superfamily
3SASA 4CCLA 2VUMJ 2LNHC 3WU2C 3BZKA 1JKWA 4RMNA 2L2DA 5F0HA 4YG2F 2YX7A 2K6BA 2JY8A 4UNOA 4CA0A 2LSOA 1U5TA 2DW4A 3DLAA 1HT1E 2BY2A 4BCQD 3QOPA 4FE7A 2LRDA 1J0RA 1DGHA 1V5GA 2XGNA 1XGOA 4CHUA 3CC7I 1KA8A 1MJBA 4L0YB 2I10A 1FBQA 2Y0TA 3BLYA 4LLLA 1WVRA 1MMAA 4ZYDA 1LFUP 2P0WA 5FTKA 4YOZA 2YNMD 3NEUA 3WTVC 2LKSA 5A2QS 5E79C 4XL9A 2QKMB 3OYGA 2KR6A 2XB0X 1N32M 3WE2A 2HR3A 1PKDB 4ROCA 3A42A 1W5SA 2GXGA 4ANJA 5C44J 3HPGA 3HRMA 2MJ5B 4S0HB 2DD5B 2FX0A 4MGKE 4LF5M 2QDYB 2H6BA 2L4EA 2G77A 4FT8A 1OFHA 1BM9A 5H2FC 4A0ZA 4CGYB 3I59A 4MO7A 1ZR4A 1J5EM 2ZSHB 3HX3A 4NBQA 1GKIA 3RKYA 3MZHA 2VJ4A 2FFJA 3A45A 1X2MA 1ZHFA 3FIWA 4ZGEB 1QUSA 5E8GA 1F1ZA 3QPLA 1H6UA 2KNZA 4LRTA 1TF0B 3K4MA 4OU0A 3UR3C 5JVTA 3BTCA 4EC9B 2Y48A 4AIKA 4IHXA 4ESFA 1ETKA 4LZZA 3FKIJ 2W9FA 4ITQA 1IN6A 5C18A 1GY3B 1REPC 3KP3A 3V4GA 4A3MJ 1IFYA 4RODA 4NUBA 3CTWB 1ZLKA 2RKOA 3C2HA 2VQCA 3O6BB 3JRFA 2E5NA 4BHCA 5DD8A 4EONB 2Q2EA 4JK1X 1SVMA 3JAMZ 2DYRH 3JCUC 1FJLA 2DPDA 4BY7X 2DI3A 5JI6A 5TGTA 2M1BA 3I4PA 5FO5A 2G9WA 4BU2A 2BHZA 4BUPA 3GLGA 3LCUA 3CJQB 1VQMI 1H24B 3BLRB 3S3NA 1T2KA 4A3KJ 1CF7A 2OOBA 1HNWM 2HZDA 4OB0B 2C99A 4PJMA 2EWNA 2I40B 2JNHA 4PZJA 1N77A 4KODA 2V7FA 4F3QA 3AFHA 1VQKI 1XC5A 3GTMS 3HBLA 1MBEA 1U6GA 1KGSA 2QQ9A 3I0TA 1TWFJ 2KZSA 1VQ9I 2AHQA 5J8FA 2JRMA 1UAAA 4LK1F 4GDFA 5BNJB 2R65A 2DOEA 2UZBB 4X66M 2B7EA 3ZQ7A 3KYLA 1R58A 3DL1A 3FISA 1C7YA 5BS6A 3VK7A 1KYZA 3F0CA 1E9SA 1OR7A 4LF6M 1TQIA 4EOIB 1GVJA 1HT2E 4DR1M 2HZTA 2IP2A 5DCFA 3LSMA 1D1BA 4UB8C 2CZ0B 3JTHA 1TNTA 4I98B 3J7BA 3KFWX 1I1SA 4ZDOA 3AL0B 4YIIA 2QLZA 4RAGA 4DV3M 2HVQA 1F5QB 3TEDA 2MROB 4BY1J 5GPAA 3TOAA 1FIAA 1D8JA 4M6VA 5KAFC 2ZMEB 3WTXC 2WIPB 2R5ZA 3S17J 2BBYA 4A3LJ 4BY7J 2PI0A 2ZAOA 3D5LA 4UUSB 5IY5H 2GXBA 2ZBKA 3IH2A 2XC7A 3ZQLA 4TTHA 1OCRH 2DWLA 3GTJJ 4B08A 4XRSA 3TQSA 3OIOA 3HZJA 2AXLA 4II7A 1SANA 1C0WA 2IGKA 1UFMA 1IRXA 3NAUA 5LLQA 4XK8F 3C7JA 2JK3A 3OIQA 2ESHA 4A5MA 1SAXA 2IA0A 4F6SB 3N4MA 4JYAM 3KP5A 2W00A 2LH0A 2P5VA 3BQYA 2ZANA 3D5RC 2JA2A 4CFWB 5E8IA 4F7SB 1XXHB 2W48A 3C3EA 1MBKA 1R1UA 2XVCA 2VKHA 2DOAA 1FPQA 3HEFA 1RETA 3HRUA 1AIPC 1H1SB 1XX5A 2XAJA 1AOYA 2KKOA 1FMVA 2IAIA 1R5LA 3GTQJ 1GJSA 3QYEA 2LKPA 4HEOA 4F52A 3DDQB 4E7JA 1AISB 1ZAOA 2M4KA 3FE3A 4ZTFA 3UJNA 3EETA 3CCJI 4E6KG 3TWLA 3IRRA 1TWAJ 4BACA 2E2JJ 5HQ0B 3R6SA 4EGZA 1V34A 4LGMA 4JX4A 1JR3D 2CMPA 1DPRA 3HKZA 2KMGA 4KIFA 3C3DA 1SMTA 3FDYA 4JI0M 2ZB9A 3OYFA 5DNYA 2F5FA 1IC8A 2KRCA 5LHGA 1ZN2A 1Z91A 1IQPA 1R4MB 4P1WA 4AIJA 4D7NA 3QPSA 3MVPA 1BI3A 4E7KA 2QBYB 2R7ZJ 4DQ2A 4IOCF 3CO7C 4W5WA 3RJPA 1YG2A 3TGNA 1ZQ3P 2UUAM 3BR5A 4KITB 1JKQC 5M3FJ 1ULYA 1LE8A 1UHSA 3GLLA 4BCGB 3S1QJ 3K2ZA 5L2WB 5CVIA 1OCZH 1N34M 2STWA 4P5OA 5IWAM 3OSGA 2R92J 1YE9A 1PJSA 3DEUA 3H5RA 1O7FA 4B43A 2K9NA 3IL2A 1N75A 2O6GE 2QGSA 4KUMA 1STZA 2FE3A 2Z3XA 5AIPA 2UZKA 5IT9Z 3VDUA 3DEWA 4HSRA 5JI2E 4NRWA 3G1LA 3CTAA 4OU7A 1FY7A 1YS6A 4UVBA 4LJAA 3W6KB 4DGWB 2IEKA 2VONA 4EM0B 2MSYA 1ZG5A 4DR6M 2HGCA 3JTGA 4B3RM 3CF2A 4KA4A 3U6MA 4CFXB 1PJRA 3DTKA 4I0BA 2V26A 4KNYA 3GLFE 2NVUB 2EPFA 4DR4M 2OO9A 3G71I 2N8GA 2L7HA 3C2BA 3SHFA 2MGWA 3BG9A 3ROUA 2VDBB 3M1EA 3HJ8A 2R7UA 3WG9A 2L5QA 2BNKA 3VYSB 3ILKA 3GO5A 2RQPA 4AC0A 1R4GA 2KNAA 1FWZA 5ITQA 3GPXA 1BBYA 1KYWA 1XB4A 2CQ7A 2EA2A 1JR3E 2EIKH 4AQYM 2WADA 3E6DA 4LF9M 1QDRA 2VPLA 3TL4X 1SMYF 4BXXX 2ECBA 1UHWA 4ROEA 2CQNA 3IKTA 4D0PA 1YITI 1DDNA 3FYCA 4DZJA 3B89A 2PK2A 4JI1M 1FOWA 2BXYA 3CP8A 3OL4A 3CD6I 4BLCA 2KZGA 5DQWA 2MH9A 4L78A 2JSCA 4XSXF 3I71A 2GBYA 4C3IJ 3AOEA 2DFHA 4D5CA 2D5VA 2HWJA 4N9IA 2HXOA 1X3ZB 1LTMA 3H4MA 4GMQA 2RDPA 1BR1A 1RR7A 1PP8F 1E17A 2KNVA 2DK5A 5B5EC 4CZCA 4CJ6A 4E7SA 2DXCB 2R18A 2XUBA 2UXXA 1ETYA 4GYIA 1ZTRA 2FNAA 5EP2A 2KZVA 1HW1A 3P5JA 4LRSA 4OR5B 4RM3A 2NXNB 1FBSA 2I5UA 3R60A 4JQFA 2C6TB 3IAM2 5ITXA 3CESA 3E21A 4EJWA 1IN5A 3W68A 5GKNA 5ITRA 3A4CA 2V1CA 2LP0A 3KLNA 4XORA 1WH7A 2X1CA 2E19A 3HSRA 3HJSA 1ZG3A 3BR1A 3CUQC 3EUKL 3GX4X 4PJLA 4CGZA 4ZZDA 5DYIA 2BS3A 4B47A 3TQNA 1I3AA 1OKRA 5ICEA 3SYLA 3LFKA 1X37A 3LL7A 4NQWA 4QPQA 2DD4B 1R1TA 4HA8A 3EYIA 1MU5A 3QWLA 2DMPA 1JR3A 4KN7X 4EVIA 3WTSC 2OC6A 1BW6A 3SFZA 1DO0A 3K9PA 3LSIA 2L6OA 1U0JA 3BROA 4IVNA 2IPQX 1T98A 1XGNA 2L7KA 3DFGA 4UB6C 3A01A 2JA5J 3PO2J 2G3QA 2F5DA 3CZ6A 3T1HM 3FXRA 2V79A 3HUGA 4CDGA 3M4OJ 4NSTB 2Z2SB 1TNSA 1IW7F 4KDPA 4AI6A 1A5TA 4BGDA 2H8WA 4ZDLA 4BJ6C 5KPZA 1X1DA 3ZMSA 2ADUA 2BY1A 3BHVB 1ENHA 5EXTA 2V9KA 2VKEA 1YRNA 4OINF 4B7HA 3ZCOA 4UUVA 3I3LA 5A2QZ 2QNJA 3FUTA 1LVAA 4Y4RA 2WTEA 4L8RC 2HOSA 1TW3A 2K7LA 4FE4A 5K5RA 2E2HJ 8CATA 3BJOA 3DXJF 1QBJA 2M8GX 2V1UA 5EXPA 2FD5A 3H3ZA 4ESJA 3U5ZA 4LF8M 3S2DJ 2XH9A 2ZM6M 1S7EA 4M9ZA 1LNWA 2ETHA 2JTVA 2OA4A 3B02A 3OYBA 4CYCB 3S2WA 1R23A 3IAS2 4XOPA 3A2KA 2OU2A 2DT6A 3FX3A 3RKXA 2STTA 4BH9A 1Y1VJ 2NRAC 4ZH4F 2E1NA 4HSTA 2WAQA 2WXVB 1HOMA 2W82A 1PJQA 4OVZB 4WXHA 2I8DA 5KAIC 1MSEC 1YIOA 1P4AA 3UGJA 3HYIA 2EKFA 2EFWA 1XD7A 1IY0A 1YJWI 1VEKA 1IREB 1YOVB 5HVYB 2CCIB 4PD2A 2EA0A 3ABMH 3MHVC 2BOLA 4DZPA 3FUVA 1QHHD 2MBFA 3KX2A 2QKLB 3RQIA 1RC9A 2R0QC 1XNRM 2FE8A 1WI3A 3KSJA 1D3YA 1JGSA 2E60A 1HA8A 3BWGA 1VOLA 2CHQA 2WAEA 5DUKA 2EK5A 3TOBA 1SFKA 2DK8A 2O03A 4G94A 3K70C 4IHYA 2NOGA 1SD5A 2ZSIB 4BJTA 1ZR2A 4M71A 4X64M 2E34A 5LEKA 4QOZC 1TWGJ 2WJ9A 4F55A 4OIPF 1RESA 4GGGA 3J7AY 1T8IA 3J27B 2BJWA 2CHVA 2XAGA 2ME0A 5KQDA 1G3TA 1Z7UA 4AU7A 3J81Z 2ERCA 1IY1A 4EC8B 2HDCA 4BL0B 4F6UB 4IPAA 3GWZA 1JOWA 4RF0A 3SEZA 5KQ8A 4DV2M 1EH8A 3GLXA 4YC3B 5FTMA 1J2XA 4LB6B 5FGKB 3GPPA 3CCLI 1Z21A 1H1QB 1F4KA 4IHTA 1B9NA 4AYBN 4PDGA 5FD6A 2HHHM 3SQNA 1TFBA 5L3EA 3PVSA 2XPWA 5IT9S 3IRQA 2OAZA 1V5EA 2LG4A 4BCOB 2A6TA 1TDHA 3BZCA 3DU6A 4QWQA 1ZV1A 4HLQA 4HNVA 2VLAA 2ZJQF 4X6AJ 4WURA 2KHHA 3TO6A 1WJEA 3R8FA 4KMFA 2VC0A 1G41A 2UUEB 4BE1A 5ITXE 4JV5M 5F0CA 2XF7A 4DBRA 1J75A 1H89C 2EUCA 1FTTA 1FYKA 4JI6M 3BT9A 2Y69H 2FMLA 3GZNB 5LGUA 4V19K 4JYKA 5CVVA 1Z0XA 1JXSA 2A69F 4KT6A 2DA2A 3EUAA 2XROA 4R7GA 4EM2A 5JLXA 1VFCA 2UWMA 1G3NC 2NVTJ 2KHMA 3E5UA 2WBMA 1GUXA 4W97A 3BR3A 4E7IA 4JI3M 5M5XJ 2ZJ2A 4FWDA 3T5XA 4YY3M 2A68F 4FM4B 1IXZA 1J59A 2UXCM 3QYFA 1OI9B 4PFPA 2D7EA 2AHJB 2IW6B 2DWMA 1UG2A 1HCRA 2F5NA 4LLGF 3MY1B 3GQ4A 5EEAA 3WHKA 4XN0A 2WWYA 4AUXA 1VTNC 2Y31A 4AVZA 4HX4A 2H1LA 2FOWA 3LSHA 3FRHA 2JY7A 1P92A 2H5XA 2K0BX 5KNLA 2VF8A 3UZUA 2M9HA 2MG4A 3GTKJ 4EOKB 5ICPB 1I4WA 1VINA 1HDPA 3HGIA 1D1CA 2OD5A 2RGHA 1JE8A 5HVQC 4KFCA 1HDDC 2JZ1A 1G8XA 2KDZA 5GADJ 3KPHA 2Y0SA 1K4TA 4DV4M 5HLTA 3DEEA 1IZ1A 3GUDA 5AIQA 3RZDJ 1OIUB 1I1GA 1ORYB 4F92B 5LD2C 2XSZA 3BHTB 1BJZA 2N35A 1R7RA 4HDVA 2L9VA 4G4RA 2WHBB 1D3UB 3FYDA 3B6CA 2O9LA 4IQ4A 4RKUF 1D8KA 1U78A 4A3JJ 3MAJA 5LGNA 1NG6A 3H3VK 3E46A 2DAMA 1GL6A 3S32A 4BBAA 3VEPA 2Z33A 2KRHA 1I94M 2JSPA 1R2YA 2YX4A 3I01M 4MGIE 3ZH9B 4ASNA 1AUAA 1TD6A 3D8BA 4QPOA 4ENKA 1XN7A 4RNAA 3BG5A 1K78A 1Y56A 3FTFA 3ZPLA 1N36M 4JI8M 3KOXE 3ISPA 3JSOA 3KIOA 2PHGA 5LRRA 4NRVA 4FISA 2H94A 4FVMA 1O9KA 1OKWB 5J6XA 1L8QA 2L54A 2VJJA 1IJWC 4UXNA 1Y1WJ 1Z05A 4CFUB 3GLHE 2E35A 2GOXB 2JJ7A 2LXEA 4XQFA 2L9RA 4JI2M 2RVCA 4WWCA 2J5YA 4BYYA 2XSDC 3W0LB 2HCBA 4XGIA 2XZFA 4DYQA 4NC8A 2M5ZA 3OOUA 2Y9YA 3I04M 1IBLM 3POMA 1BR4A 3K8ZA 2DQRA 1Z67A 2IA1A 2VL8A 5E18F 1O4XA 3A98B 4BNCA 5F27A 2E1OA 2FS1A 3WGGA 4BCFB 1MGTA 2XASA 2L09A 1WJ7A 1VDDA 2L9NA 2CH0A 2CWEA 4O3MA 2GQQA 2PMIB 2FBIA 2XLJA 1G3WA 1VQ1A 1KQ0A 5J40A 3V8JA 1LFPA 3GF2A 1QAOA 4BHPA 3KFUG 3DPLC 2PMZN 3BR0A 1LEBA 1S3SA 1RZ4A 1BVSA 4RLFA 1K78B 4B7FA 3U61A 4HBLA 2CP8A 1OFCX 3FXLA 2VIIA 5L3DA 4W1UA 5K1YA 4I01A 3JRBA 2H6CA 3SZPA 2X6XA 4AG6A 4XLCA 3ZMVA 4L9JA 3ECHA 3HUGB 1TWCJ 2Z1DA 2CV0A 3VYTB 4ENJA 1RUNA 3S2HJ 2COMA 2XF3A 4O5VA 4G4NA 4HF0A 1Z6RA 3R61A 2KRKA 4CHTB 2EV5A 3HJEA 4A3IJ 2NS8A 3J81K 1VI0A 1I6HJ 3THGA 2K9DA 2EO2A 3IG5A 2QVOA 1U5TC 1FVVB 5ITUA 5ILSA 2D1HA 3OS2A 1AD6A 1ETQA 1USSA 3WGIA 5ITYA 4CFNB 3MKWB 3HIFA 4XLNF 2HFHA 4PCZA 4CH7A 2X1NB 1WXQA 1KZHA 2IW8B 3A03A 2VE9A 2ZNYA 1F9NA 2DAEA 1DQUA 2QYOA 3RKWA 1J9IA 2DA1A 2Z9OA 2DKLA 4LJ7A 3PJRA 1SXJA 2OZUA 1IN7A 4IF4A 4YRVA 4CYDA 3WG7H 2F2EA 1R22A 4BJ5C 3TKYA 3MCZA 2DFIA 1SAUA 3A8LB 2LD5A 1G3YA 1ZARA 1ZK8A 1HKTA 4XKVA 2FBKA 1UGQB 2VKDA 1XGSA 1XGMA 2GZWA 1CGPA 4HEA2 3RFWA 1N25A 3GFMA 4OAYA 2FQ4A 3CMAI 1TT0A 4HQEA 2F6CA 4HLYA 4BCKB 1UB9A 1OFIA 4L15A 2GA2A 1ZRFA 2M87A 2AO9A 1CQTA 1PJIA 1IBMM 5C1BA 1GUXB 4V2FA 4XKBA 2XRNA 3E3VA 4PJ0C 3MIAB 2BW3B 2OJED 3CCUI 3OYJA 2K40A 4M3BA 1O3TA 3I4NJ 1B4AA 3U6LA 3FTCA 3NWTA 1E7PA 5EEHA 3M0EA 4HV5A 4AIDA 4EQQA 4RAYA 3K9TA 2IT0A 2DA6A 3DKYA 2D0QB 3FTEA 3GP1A 1SFOJ 3O2PE 3R0JA 1PDNC 2ZNZA 3K1MA 4RM2A 2VKVA 2OCEA 2UV1A 3F72A 4LB5A 1ZGAA 1DP3A 3L9FA 5JFRA 3B7NA 4L5JA 2IGOA 3Q9SA 2X6OA 1LKXA 4CISA 3A8OB 2M5WA 3S16J 4KT5C 3DU5A 2CGPA 4XKWA 4DJAA 1PVEA 3RPQA 1LJ9A 1GV2A 2VJIA 1G59A 3M8JA 4NDLA 3KP6A 1PRBA 1VG5A 2Z4RA 3HOZJ 2R45A 1SG9A 2Z7JA 3IECA 1XCVA 1T33A 3I56I 5EG0B 1NK3P 1UGRB 5IDPB 3ZMTA 4XKCA 3FMSA 5L3FA 1K6OA 1S5LC 2R7GA 1VQOI 2ZC2A 5LEJA 1WI9A 1HLVA 3SAVA 1XO2A 2ZXHA 4BS9A 5J3LA 2XV4S 4AKHA 2X85A 2KLOA 2QQBA 1OR7C 4BEHA 1I27A 1ZLJA 2VT2A 4BXUA 1H26B 3JR4A 3OYAA 1OL1B 1Q1VA 3ULQB 3VB2A 2WSCF 3NWLA 3QYBA 2G9XB 3TPZA 4HZFA 2G7HA 2HNHA 3CO6C 1H1RB 3L26A 2MH8A 3OS1A 5E17F 3DKWA 1SXJC 4A69C 2M7BA 4EOQB 2EB7A 3ZQHA 4KRCB 1IO2A 2QSGX 3BBZA 2MFZA 1HSJA 5EDNA 3J80K 4L0ZB 4IBCA 2F4VM 1TDZA 2CQXA 2XRLA 3V8LA 5IOYA 1KXUA 1Z5CA 1VF9A 3CCYA 3E5XA 5FROA 1Y39A 2GIVA 3W67A 2PMZA 2F2CA 5FB2A 1L2DA 2KJBA 3MMYB 2ZPHB 1GO5A 3AG2H 4BBRM 4RAFA 4WP2A 2VE8A 1VEJA 4Y7NJ 3MKZA 4IMYB 2MA3A 2J7OA 1L1ZA 2X0LA 3OWTA 1PUEE 3SDBA 3DA1A 1HR0M 3T6PA 2EZIA 4EOOB 4LJ6A 3M9AA 2JWSA 1K3XA 3D0SA 4GFBA 1X3UA 3VSKA 3LSGA 4MTEA 3CUOA 4BQOA 3N97A 1I5ZA 4OMZA 1W98B 2HOAA 2LMDA 4FCWA 1R7JA 1K82A 4CCMA 4RB1A 2CU7A 3LNQA 4K2EA 1XMKA 2EINH 2JZYA 3K4CA 2DVWB 4M3EA 2I53A 1ZMUA 1YX5A 1QU3A 4A3EJ 4AM3A 1BU2A 2XGDA 5JLWA 4M6XA 3I4VA 4LJ5A 1PM5A 5GAEJ 4UUSA 4NHJA 4IBBA 1XSXA 2R5ZB 2IVXA 2E5ZA 1TGUA 3ERED 4EJTA 5EFQB 2M34A 2APLA 5LQFB 1J7KA 1T08B 3IHPA 1QAMA 4B48A 2XF5A 4EOSB 3KVWA 2DAIA 1GL7A 2XB5A 1P4WA 2EILH 3SZGA 5IPAA 4E7LA 4EJOA 5K7FA 2KMUA 3TWKA 2A5WA 3VYGB 2P7VB 3O3KA 4JOMA 3DKXA 1IUYA 3A01B 1TC3C 1WH5A 3MFKA 1VQ8I 2CV2A 2PEXA 4A0XA 4CSWA 4BY1X 3HHZA 4CIZA 2CV1A 3CUQB 3KP4A 3HOXJ 4IQJA 3W2AA 1K79A 1WJDA 2F4IA 3HG9A 4V2GA 3CCRI 2L3DA 2CYYA 5HBEB 2HWVA 1FOKA 2G8LA 2HPIA 3BG7A 3GLFB 4BCJB 2H8RA 1R5HA 2AS5F 1QZZA 3QQAA 4BB9A 3HSFA 4WK8F 1QRYA 2P6SA 1DP7P 1IXCA 3EDPA 1K6YA 1XDSA 2BY0A 3RGPA 2HQRA 3J81S 3OOPA 1D0YA 3H9QA 1DU6A 3L2QA 1FSHA 2XFSA 3OTOM 2DO7A 4I99C 4XRSG 4I4LA 5JVGF 2HOEA 3V7SA 6PAXA 1RPWA 2L0KA 2FOKA 5GPCA 2UUZA 1MJ9A 3U6DA 1T0FA 1B6AA 4X1EA 1FT9A 5GTHC 2XAHA 2FMYA 1OIZA 1BI2A 1JHHA 4U87A 1RR8C 3TDZC 1T95A 4CUGA 1APLC 2F5SA 2CRGA 5E3OA 4BXXJ 3HOTA 4PDIA 2EJRA 3F9KA 2Y0QA 5E26A 1X1PA 2B63J 4C2TA 4LZJA 4IZZA 3ZQCA 1FJGM 3JSPA 3RQ4A 3M03A 1R6RA 3SYKA 5ICGA 3KDSE 4Z6YA 3GTMJ 3I4MJ 2QWWA 1FOXA 1U8RA 3HPHA 2IJLA 3K6GA 3D5SC 2LVQD 3C2GA 4FX3B 3SJMA 2BS2A 5C4JJ 2XFTA 1XC8A 4HW0A 5FKKA 1PJJA 1KU9A 4ZJZA 1GHCA 5D8LB 3GLIE 1FIPA 4ITVA 3LSPA 1W5TA 1FYLA 5DYGA 4HNUA 3K4JA 3AG4H 3DCFA 1R36A 3FXQA 2X6WA 1R9TJ 3OSFA 3KS8A 2JY5A 3K1JA 3JR5A 4IRGA 1AKHB 5HBJB 2LF7A 3V42A 1IG7A 3H92A 2R93J 3DP7A 3HKZN 1U8BA 3A46A 1JTXA 1EF4A 3I53A 1AU7A 1F43A 1ACIA 1ZAEA 2E7WA 4DOZA 3LAPA 4ZC3A 2LVOC 3CJRB 1XMOM 4KLNA 1GABA 3J80Z 3G73A 1H88C 3VDPA 4K0KM 3T1BA 5FD5A 1TW2A 4A3BJ 2F48A 1E9RA 3ML6A 2X1EA 2CEAA 2DAKA 4WCGA 4A12A 4RB2C 3S3MA 3K9OA 4E7ZA 4HX7A 2QGUA 4NOOB 2VQGA 4Y13A 3CCEI 1U3EM 3CLOA 3MWMA 1U5TB 4BXFA 2WFYB 4U7DA 2X4AA 1NV9A 1AWCA 2JT1A 1A6QA 1Y0NA 4Q7JA 4LGYA 1IRFA 2KPMA 2NNNA 2VBZA 2ZXWH 5DEQA 3OYIA 3QRFF 3GTLJ 1PUFA 1NG7A 4XOTA 1KYIA 1WGNA 4FX0A 4DIQA 1SC7A 2DLLA 2IW5A 2XGEA 4XK4A 5H20A 2IGMA 3CJTB 3EQLF 1T39A 3KOZE 1ITYA 4FCTA 3ZQJA 5D5WB 2JA8J 4LK0F 4XONA 3OYDA 4LJ9A 2LNBA 1IDZA 1QMZB 3ZQFA 3K7AM 1BR2A 2FXAA 1FMWA 2JY6B 1NHAA 4MB7A 4S04A 4NC6A 5CVUA 4U0YA 1YW9A 1QO0D 5KVRA 3QAUA 2ZXJA 3U6EA 5C3EJ 4OIQF 5DV5A 2E2IJ 5E3NA 4DR5M 4ZGDB 5I5ZB 1WRJA 3FXJA 5ACBA 4ZGJB 4G7HF 2GWRA 1SXJD 3F22A 4LFBM 4TUWA 1QHGA 2M8EA 4CCOA 4EJUA 4JI5M 5TISC 3B73A 1OYIA 2YFQA 1H27B 3WTZA 4JX6A 5IP6A 3DLLF 3JW4A 1B72B 1BA5A 3W3CA 3OYMA 4WX9A 2BEOA 5KO3A 1M1EB 2EUFA 2ZPBB 2BV6A 4A6DA 1F5TA 1XG1A 4ZYAA 3HRTA 3X26B 2DOFA 3J2PB 3U9GA 2TCTA 4OGRB 2YQZA 2DA7A 4PGGA 2DBBA 4OB2B 1FYMA 2QDJA 4QHTA 1WJAA 4MNUA 3F23A 2NAZA 2H1RA 4GC9A 1NNUC 2RNJA 2CUZA 5HLGA 4HRIA 5IDNB 3TW6A 4E7HA 3Q9VA 2BKZB 2V1DA 2VIXA 1FLIA 1G3IA 2DDAA 1WHUA 4CZZA 2JUCA 1B72A 1P6RA 1MBJA 4UVCA 4DBQA 1VQLI 2VN2A 3CCSI 3DDPB 4LMYA 3J7AO 2K3FA 4L6V6 1JTYA 2HL7A 1ZH5A 2DAOA 2O5RA 2L9SA 1VQ5I 1UNHD 2LWXA 1NO1A 3OYKA 1UGPB 1S8NA 3KZIC 2EFPA 4P9FA 3TDUC 2HVRA 3T15A 1HW5A 3F6OA 2K86A 5CVJA 5DYMA 3K92A 2K9LA 2Y0MA 5KCMA 1U9NA 2JP7A 3C3WA 1H1PB 2R44A 5F64A 3RPUD 3H9GA 5F6FA 2DWZB 3H0DA 1HW2A 3VWBA 4IHSA 3L2AA 3W6VA 2BWBA 3BOQA 1FEXA 3DOGB 2R4JA 1E3HA 1WGXA 1XCBA 2WV0A 1YJNI 5FKLA 3OY9A 1I39A 1W7PB 2Z4SA 2J7NA 2ISZA 4BQAA 3P9CA 3LA2A 3A02A 2PBIA 2P6TA 3TMOA 4HQMA 3PXGA 4HLXA 2F4MB 1XXHE 4QHSA 1P4XA 1Z3XA 2L7FP 1AHDP 1LDDA 4LFUA 2ZTDA 2NYXA 2OF7A 2Q2EB 4XNFA 1EE8A 1FP2A 3K2LA 4I7HA 3ZN1A 1YYVA 1EA3A 2PN6A 3OV8A 1NHWC 1W5CC 4B09A 4KRDB 5AONA 5EG0A 2D1VA 2DZOB 4WW0A 4OAZA 2JUJA 5BPVA 4FX4A 2JQ7A 3RGSA 2QENA 5BR8M 2HYFA 2Q1ZB 1SEUA 4I81A 1RNLA 1S72I 4BBSJ 1JSTB 2W96A 5ILVA 3PIOF 3WHCA 5L3CA 3SAUA 3ZQIA 5A2QK 2EZKA 2RAEA 1IF1A 1SD7A 2DODA 4KMUX 5GTIC 2B9SA 2BPMB 1AKHA 3HU3A 3EJ1B 4HF1A 3X25B 1PP7U 1P9QC 2L2OA 4HV6A 4LJZF 2R7XA 4IJEA 3FHNA 2R7FA 4B4CA 4WF2A 1ZRCA 2XSJC 3A8HB 3BG6A 3C58A 5CLSA 2KIQA 4G4QA 2ZPIB 1NNJA 3W6JB 5BPIA 3IH4A 4ANRA 1A36A 1RKTA 2HYJA 3EUHC 4RA2A 3WGHA 2IW9B 3VLFB 2W85A 3PIPF 1P7JA 5C4XJ 2ZKZA 2EFNA 5IF1B 4G7ZF 2WEVB 4M0DA 3KSXA 1W36C 1JJ6C 2QSFX 1UM8A 2CRUA 2ESNA 5IT3A 2HKXA 2KISA 2PJRA 3S14J 1G4AE 1JUMA 2BW3A 2PMUA 1DGHB 3FD9A 4X0GA 1R49A 3EPZA 3GLIA 3SFIA 3VPRA 1A35A 1QQIA 1RUOA 4AD9A 3GEZA 1FSEA 3A0BC 4OIRF 4O6JA 5E6JA 3QODA 3CCQI 1D0XA 1YI2I 4DBGB 2V22B 3BJ6A 3K10A 4C3HJ 1K4SA 1RIOH 2FOIC 7CATA 3TNIB 2BVMA 1XTAA 2FU4A 2Q0OA 2KL4A 4GYGA 2CFOA 3PFYA 1X19A 2K85A 3V76A 3CDHA 3BCAA 3BZ6A 5GAHJ 1EH6A 1V54H 3V8KA 1BOAA 3NDQA 2ECCA 3LSTA 1XDUA 4DYCA 2CS3A 3K2AA 1YS7A 2HDWA 4YELA 1T43A 1C1KA 4IO9F 4IRIA 3E0JB 2LOOA 1Y0UA 1E32A 3GLFA 3L25A 1R4NB 2WSFF 3HHTB 1R71A 3MKYB 4BQNA 2V6CA 5CEIB 4M9SA 3M6AA 3HC7A 1YTYA 3OMYA 4MFDA 3S1MJ 2VJ5A 4F7JB 1R1VA 3GLGE 1KQ8A 9ANTA 1Y8GA 1WZ2A 5FKMA 3CUQA 4P16A 2EA4A 4ELLA 3CF6E 2OTJI 1BIBA 1JB0F 3AJIB 2VBWA 4MFEA 5FFZA 1QUTA 3FTDA 2KDOA 2MD5A 3A0HC 1WJCA 2J5PA 2FBHA 3ABLH 2DFFA 2JVGA 4QIWN 2P8TA 4B3MM 3H35A 4IBKA 2UZEB 5H6QA 1BC7C 1OAOC 1USTA 3MN2A 4AWXB 4OB3B 1WGLA 1S7OA 2KRFA 3HTUA 2DAGA 3FXOA 2I7PA 1O57A 2O3FA 3G1MA 2WV1A 4UV9A 5HDNA 1E94E 2EIMH 3DOAA 3ONQA 2BYVE 1GUUA 5BPDA 3U6SA 3Q8GA 3RGFB 4FCVA 3F6VA 2CW0F 2O25A 4Y33A 1HBXG 3VYHB 2DMQA 1H9GA 2D45A 1X58A 2OUMA 1KONA 3BOSA 2DA5A 1UJ8A 2AQFA 3FWEA 3AKZA 4ZYEA 5LHHA 3JREA 3O8GA 3L28A 4M3GA 2EZLA 4R71A 3F8MA 4MTDA 1N4MA 3B7QA 3BCBA 4BCHB 2QF7A 3C1DA 1JSUB 4B8XA 4I5SA 1MBGA 3HOYJ 5FSWA 1C9BA 3CJNA 5F08A 1QQWA 2A05A 3WE3A 4CICA 3H36A 4N4NB 3TP0A 3L27A 3K70D 3E6CC 4PCQA 1Q39A 4JX5A 1D0MA 4YIFA 4IOAF 1GXQA 4D9JA 4L5EA 3FXUA 2HYGD 4II2A 4D1QA 3SEQA 4LIUA 1WPKA 4UY8I 1WFXA 4NXNM 3F3XA 4MLOA 4LFCM 2OCCH 2LY1A 3DV8A 1ZG1A 2ZPGB 4E70A 1OCCH 2YU9J 4MM3B 1ZKGA 4BHBA 3BR6A 1QPMA 1OYYA 3MZYA 3PO3S 3M7GA 3VFZA 2WPAB 1MSFC 2C9CA 2LHGA 3DPUA 3PUFA 3SC3A 4IHWA 3LQQA 1WIVA 4X62M 2CFXA 3W2VA 1BL0A 2YU3A 3NRVA 3BLQB 3BP8A 3WVEB 4I8OA 4EV0A 2EZHA 3CMEI 1TLHB 2DXBB 1XNQM 1GVDA 4LJ4A 3HWSA 3LSKA 5E1ZB 4EMSA 1SD6A 4BEHB 4IRHA 1VQ6I 5D5XB 4IBDA 2NVQJ 2KA6B 1MDMB 2IS2A 2WIHB 1KU3A 4IBGA 1IXSA 4AW4A 1P7IA 4QNRA 4RGRA 5D6FA 2DENA 2A6EF 2K4BA 2M0MA 5EYRA 5JR3A 3U1DA 2HPMA 4BDZA 1N78A 3IWFA 4XSZF 4QNMA 5DD4A 2DTRA 5E1XA 3JRDA 3CDLA 2V6ZM 4RLQA 1YQAA 5J47A 2ISYA 2DXIA 1W36D 3J7AS 1ETXA 2HKJA 1Y8QB 2NS7A 3G3ZA 2I7NA 3GLHB 3LWFA 3KZYA 3M07A 3ZMUA 1G6NA 1SD4A 4AVPA 4HDUA 2O7OA 1I50J 3I55I 4C30A 1NK2P 1MMGA 4BBRJ 2B9RA 2QEXI 1W4MA 2NVXJ 1MZBA 2VXZA 2R5YB 1FKMA 3LAJA 4M0WA 1OGUB 4NSOB 5IYDJ 2IA2A 1Q02A 4A3GJ 3MD2A 4D5FA 1XHBA 4MGHA 3AV0A 4KHPM 2PG4A 2F5PA 3FUUA 3I9V2 4F93B 3OYNA 3SZTA 1J5YA 5F04A 5DCMA 4CFMB 3E7LA 1NY5A 1YJ9I 2KXEA 2LVSA 1YSYA 2ZCFB 2ZTCA 4TV7A 3E6BA 4MH0E 3OS0A 2KRUA 2XKOA 5CKTA 4ZYGA 2Y75A 4F2LA 5K5QA 3DTIA 4RGSA 3TNWB 3JR9A 1Y8RB 1XSDA 3X24B 4ZDPA 1SFUA 3S93A 4M74A 1ZMVA 4AKGA 4BE0A 2GNOA 3J80S 1TR8A 1IV8A 1YLFA 4LG2A 3ASOH 4NC7A 3JRHA 3GYHX 4RF1A 1WWXA 2CSOA 5HNBB 1YLAA 2X49A 1Z77A 1UNGD 3IWZA 3J7ZI 2ZPFB 4DUYM 2PFBA 3GTOJ 2OQGA 3GTPJ 1D0KA 1RU3A 1OMIA 3H5AA 4U88A 1ETWA 1OIYB 2XGXA 1HQYE 5F3WA 2E7XA 5L3BA 4LOCA 1O3QA 3QXEB 2C5VB 1Y6IA 1SXJB 3IHUA 4GHAA 4IXAA 3RZOJ 4AG5A 2JGZB 3L1PA 2WAQN 2CQKA 5J1UA 4G8XA 3VYUB 3COAC 2WB1N 1QZMA 1J09A 2QHOB 2L7MP 5DDGA 4G7OF 2BHYA 3U21A 1YIJI 2DMUA 4Y28F 3NWSA 2M60A 3SYTA 1NVMA 4BDYA 4F1IA 3AG3H 2CZ1B 1Z1DA 5M5YJ 2W25A 2DJNA 3IG8A 3ABTA 3HJQA 1PGYA 2XPVA 2YR2A 3L00A 4GKJM 3ZMDA 3HL2A 4IX7A 1LQ1A 2L4FA 4A93J 4FWHA 3RPUA 5HNFA 2MABA 4GHLA 1TTYA 3ZRGA 2RKHA 5KHDA 4I76A 3TNHB 4LCBA 3IV5A 3FHZA 2V9VA 4ELJA 2HTJA 3H3UA 2H09A 5B1BH 4YHHM 3U61B 2XKPA 4DV1M 3HOVJ 2VOPA 1EH7A 2ELKA 5D4SA 2BJVA 2VF7A 4I0AA 1MH3A 3CGWA 2PJPA 3QU3A 2CZ6B 4EOJB 2F5EA 1WQ2A 4M3FA 1IRGA 2OTLI 1D0ZA 4J00A 4A3DJ 1R5GA 1K83J 2ELJA 4YFXF 1A31A 1LUJB 2DCEA 3KHIA 1XMAA 3BY6A 1B9MA 3DTOA 5EZGA 3EYYA 3GQ3A 2B0LA 4OVZA 1MBHA 2Y20A 4RAZA 1LPQA 1MNEA 2KW0A 2JWTA 1EIJA 2RV8A 3KP1E 4Y52J 4OB1B 1ERDA 3OR2C 1HC8A 3B6AA 2W4SA 4RS8A 5BOXA 5EP3A 3I4YA 2ID3A 1BJAA 3KEYA 5LMNM 2VPRA 4CYCA 1ETOA 1GT0C 2ZPEB 3B9PA 1K3WA 3K69A 4KJZA 1KU7A 5FRMA 1MX0A 3X28B 2NOJB 1FZPB 1W7PD 2JN6A 5BNGA 1BC8C 3MQ0A 2JXNA 3HO8A 2CJJA 2R46A 4CXFA 2VASA 3S15J 3W2WA 4A0YA 1WJBA 3DZDA 4J01A 1QVUA 1KQ9A 2V1XA 2L7IA 4Y15A 1O9KB 2BXZA 2R7WA 2DMNA 4XR6A 3DFZA 3VOEA 4JBAA 2HDDA 2LREA 1YHQI 3QPHA 1U9OA 3FRIA 4QOSA 2NS0A 2W24A 2RGVA 5E1WA 1N33M 1YRNB 3TN8B 4C9YA 1QVRA 5HS9A 4BE2A 2IXSA 1TH4A 5KK1A 3UKGA 5DFLA 3HHXA 1QLBA 5GP9A 3QYGB 4XLPF 4A6EA 1U2WA 1POGA 4C2UA 2QUFA 3RI4A 1RRJA 2CUEA 3E97A 2K02A 4KIGA 1G4DA 4DV0M 1OKVB 3QZ9B 1MNDA 1MJGM 2GAUA 5ED4A 3PFIA 4IBIA 4XLAA 4U0VA 2Z99A 2M2EA 4NQWB 2MD0A 2OQRA 2LBCA 1L0OC 2BWEA 2EJSA 3ZXSA 2FJ1A 2HU9A 3L2UA 3K1PA 4LITA 4R3DA 2V1NA 3HGYA 5F0FA 5ICFA 5FTLA 3FUXA 3CMMA 5IYCJ 3G6EI 3HY5A 3KETA 1V29B 4XIDA 3IH3A 3CF0A 4MGRA 1X2NA 3TBIA 3BPXA 4L9NA 3DBLB 1GJTA 4P55A 2C9OA 2KJCA 4PUSA 1FC3A 1E2XA 2P5LC 3I58A 2E1MC 3IP4B 2WZJA 2VQLA 3H1CA 2Q8KA 3D1NI 1JHFA 3W0FA 3FM5A 2ZZDB 2L01A 1FOYA 3TWMA 1Z5AA 2TDXA 3B7ZA 1LFBA 2M4GA 4MHGA 5DUIA 4G6LB 1UELB 2JRTA 2G5GX 3MMPA 3E1SA 4KIBA 4DNCA 1GDTA 4BCMD 4FWGA 1P2FA 3P9KA 1QA6A 1VQNI 5GAGJ 3EOCB 3CCMI 5TRDA 1JKPC 3M8FA 1R2ZA 2EKKA 1IY2A 1MMNA 2XAUA 3KEOA 1LB2A 4II5B 2A61A 3RE8A 4P9UA 2IS1A 2NNYA 1DO2A 1IV6A 2WB1A 3KEQA 4ZTJA 2C5XB 4RB0A 2DQLA 2AXTC 1MN3A 2DYSH 3X2QH 5K7HA 5HDGA 2DU9A 4GO1A 2BVLA 2V9PA 4LG3A 4OOIA 2A5YB 3ABKH 3CC2I 2ZCWA 3DPTA 2FSWA 2R7SA 4G9YA 1SXJE 3EUHA 1JGGA 3K4KA 2C4GB 4F7NB 2QP9X 1KFVA 1MJAA 1L2CA 3GZ5A 4KN4X 1DU0A 3M3YJ 2ZMEC 1BW5A 2Z5UA 2K5CA 4CRLB 3VK8A 3LVWA 4IBFA 2V6EA 3HGGA 2OV7A 3LSJA 5IHYA 4B7GA 4GEWA 4ON0A 3QU6A 3RDIA 4R1HA 1F36A 2F5CA 1ZELA 3WU0A 3QHRB 4PJNA 1E9HB 1SVLA 3GW2A 2O8KA 1D2NA 2JA7J 3A8GB 3PSFA 1ON2A 2ZFWA 3FK6A 4YIRX 3IC7A 3H0GJ 3ZQQA 4OWRB 1WR1B 2CW7A 1IM2A 1VDLA 4PSWA 2ZJPF 2Y9ZA 2QSHX 5FGMA 4CXAB 3OYLA 2QBYA 2W7NA 3JRIA 1HQCA 3ELKA 3FXKA 1Z7LA 4GXOA 3GPUA 2LTPA 4S05A 5EJCA 1DV0A 3MKLA 1LV7A 4KICA 3LQ5B 1OTRA 2DZLA 3GRVA 2R6FA 3HU2A 1LDJA 3JRGA 2LKXA 2NQ8C 2IS4A 3GVAA 2X51A 2MLGA 3KLOA 2HS5A 3L09A 1DUXC 2UZDB 5DQVA 2QPAA 5BMZA 1NJFA 3CCVI 1T3TA 4L9VA 3KS4A 1HNXM 2ACJA 4F70B 2FQ3A 1OCTC 2ELHA 1Z5BA 4FHTA 5CJ9A 2A3SA 1T56A 2VBYA 2O61A 1ZGJA 4YOOA 1E0EA 1UGSB 5EXXA 2YUSA 2OQ4A 1X4OA 4DR2M 1V5FA 2EV6A 4IJFA 2W9ZA 3OL3A 3BC8A 3HHGA 1JT0A 2CZ7B 3R4KA 2KIMA 3EIHA 4U7BA 1I3QJ 1VQ4I 3LFUA 4ZYHA 1ZMWA 4JI7M 3GO8A 5FKNA 4KISA 3LQRA 4NL4H 4E4HA 5CQEA 3F8NA 2EQRA 4NB5A 3SAWA 4DR3M 3KCCA 5CYIB 2DHYA 4D82A 2VQEM 1UG0A 2YSRA 3MJ5A 1KSFX 1ON1A 3UNGC 4FTHA 3OR1C 2XAQA 3U5ZB 4LF4M 1ONVA 3K4LA 3J7YJ 2PQ8A 2UZLB 2QCUA 2BE5F 3DBHB 3DTEA 2CW8A 4XLHA 2K3PA 2DZNB 2E36A 2Z3YA 3K1NA 3GRUA 4XLFA 4CCJA 2PLYA 1GVNA 4AYBA 1WSUA 2QFZA 2P5KA 1OKSA 2J5OA 3T8RA 3L2VA 1QZEA 2MYSA 2K4JA 2VXDA 2ZFUA 3CMYA 5FLVA 3BLHB 3BDDA 3WHBA 4XRMA 5EXSA 3KP7A 3OIPA 1BI1A 2P4WA 3HM5A 1FBUA 2WSEF 1G3SA 1X1CA 1X1BA 1HXDA 5D4RA 2GA1A 1V33A 1NJGA 1AHJB 2LVPC 3GBGA 4I02A 2LW4A 3QOEA 1ZGWA 3OYHA 3NQOA 1EFUB 5HS7A 4G3OA 5HBHB 2KIFA 2GOMA 2CO5A 2DA3A 3SDGA 4M9XA 1OPCA 2COBA 4R79A 5HNHA 2FRHA 1WJ5A 3LSRA 4UN2B 2KT0A 1AA7A 2OPFA 2LR8A 5LBQA 2RNGA 3GCMA 4F6WB 1HKSA 5D8KB 4LJ8A 5E3LA 1OYWA 4MGYE 2LH9A 3VDXA 1W0UA 3SMPA 3SMSA 3I64A 4II3A 3V7CA 3VODA 1JI8A 1VQPI 3LW5F 4FCYA 1JKRC 4BCNB 2CUFA 2LK2A 1CF7B 1MNMC 1XMQM 2O8XA 1TL8A 3GLGB 4GCVA 4BCPB 4XMYA 3K7AJ 3PL8A 2L4AA 3UK6A 2WAFA 3HXLA 3HB9A 5J1RA 2K9QA 1JUSA 3N05A 5EEGA 3BR2A 2WMAB 5LFAA 2VI6A 4H0EA 3KOYE 1ENWA 4N4OB 3GFLA 2KDLA 2LY9A 4A3VB 1KU2A 3QP6A 3WTYC 2R4GA 2DPPB 3DBRB 1JQJC 3H9JA 1EJ9A 3LOCA 1OCPA 3PSIA 5FJ8J 3I5UA 4C3JJ 3D8LA 3SATA 1TQPA 3TO9A 1UMQA 3DQVC 5HOOA 1A5JA 1YO5C 1DGBA 3S1RJ 3HKPA 5D6EA 2WMBB 3MZ8A 1GV5A 5K5OA 4GC5A 2DT5A 1PJTA 4DV5M 3FF5A 2UUBM 3ZQGA 2R7QA 4EM1A 4LLNA 1E3PA 1YUBA 1LVKA 2EH3A 2HQAA 1XS9A 4L9TA 2PMHA 3I59B 4EOPB 1H8AC 4YEJA 2HQNA 2F5OA 2KQRA 3BTJA 2A07F 1ZP2A 2NVYJ 3VSLA 4UHTA 4M72A 5F1RA 5F1JA 3RKQA 3M8EA 3ZC7B 1G8PA 2RGOA 4Q47A 2DMEA 3LMMA 3FM3A 1QZYA 2CYZB 4FW9A 3AOGA 3LA3A 5FKOA 3H5NA 4M73A 2VC1A 2PJQA 5FTJA 1ZYRF 4R8HA 3MEXA 4MEXF 1K7AA 2KZUA 2DWNA 1S29A 4MQVA 4A3FJ 2MR9A 2MC4A 2MGQA 3TW7A 5K7ZA 2XDVA 2F5QA 1FTZA 3RYRA 2XPUA 2CE7A 2LVAA 4DW6A 4CCKA 4LFAM 2YR0A 4WXDA 3T1YM 3C18A 5IT9K 2YPRA 2QA4I 4ZZLA 1GH6B 5CYVA 1LE8B 2OZ6A 5CPRB 1H9TA 2DNAA 3TE6A 4FETA 1RKWA 4IEJA 4FD2A 4L4UA 3GFJA 5HODA 1X4PA 3M1CA 3HSEA 2K47A 3WTWC 1QNTA 3CDIA 4QSHA 2UXBM 3GQ5A 2X8AA 3S8PA 5B3SH 4BCIB 4LG0B 4F7LB 3CLQA 5IOZA 4XICA 2XHKA 3NBIA 3DWLE 3O0GD 1F4IA 4EOMB 4ABZA 1DGRM 5IP7J 3E9SA 4HYEA 5HLHA 5FLXZ 1O7LA 3HU1A 2ICWG 2KFDA 3KW6A 2VT3A 5IYBJ 3L2RA 1TP4A 4XN3A 1Z6TA 4Z2YA 4QTRA 1W0TA 1MW7A 5M3MJ 4AIHA 4RB3C 4HF2A 4IKFA 2VOOA 2DN0A 3H4CA 1QYRA 2Z8YM 3ABUA 4J19A 3ZP5A 3K4NA 1IAWA 1XWIA 3VYRB 4DR7M 2R3SA 2EV0A 2BGCA 2LDUA 2M0CA 5DCMB 3GPYA 1MBFA 3JRCA 3QPTA 2H1KA 3WVDB 4BBSM 2X6YA 4BCQB 1WKMA 1CUKA 2FH0A 1XXHA 1Z3YA 5HLIA 1P5EB 5JHFA 3PNVA 3HHYA 3B74A 3RTRA 1Z9CA 4CFVB 4N9HA 1MMDA 5HS8A 4LGWA 1EV7A 1URCB 3BHUB 3KXEC 3HHWA 2FF4A 3EIDB 1JJ8C 4B3SM 2XEPA 3KYDB 4A2UA 3ECOA 1FX7A 3FMQA 1DGWY 4HOBA 1H0MA 1QPIA 2M30A 4DYRA 5BQTA 3I51A 2Z16A 4RDUA 2C6YA 4H4KC 4MQ9F 4I3ZB 2ZBKB 4GRIA 1DGFA 3NARA 4Y3OA 2HOTA 2FEZA 3A8MB 4PJJA 2ZAMA 1QANA 1EKEA 2ZMEA 2ZO4A 3G2BA 1YFHA 1S6LA 3E4RA 3HRSA 5CVRA 4XBFA 4YFNF 4IBJA 2BY3A 1IXRC 1IXSB 2FA5A 3T0YA 2E1CA 2Y21A 2CCHB 2Y30A 5D5VB 1MDMA 4HX8A 4UN0A 3FZVA 1ORKA 3KOWE 2O0YA 2QZ8A 2HVSA 1PYVA 3T8TA 4JI4M 1MKMA 2ZXIA 3L2CA 2EFQA 4BQQA 3WHLA 4U0WA 2D7HA 5LMUM 2WC2A 4XM3A 5CQGA 3MY5B 1QDTA 1JT6A 3B57A 2EIJH 1BIAA 4NNJA 2LC2A 4PT5A 1BOBA 1R00A 4P17A 2GQFA 2KEBA 1XSVA 3VFDA 1Q3CA 1D1AA 3F8CA 5H37D 3P9IA 3BTLA 4F7ZA 1HF0A 2MC3A 3GRYA 5IREB 1H28B 2DDBA 5B66C 1BN5A 2MLKA 1L3LA 4L5IA 3AL0C 3F92A 2G0EA 3U2RA 3QYHB 3ZMZA 2VB6A 1TQMA 4BCMB 1T0FC 5EF6A 3FKEA 3ZCBB 1HKQA 4UVAA 2HAKA 1V55H 5ITTA 2E5LM 5LRSA 2IN3A 4KO8A 3BTIA 1VQ7I 3GXOA 5TJJA 3Q8XA 4HNTA 5J1YA 1XPXA 2UXDM 5B1AH 2O01F 1H4LD 3BG3A 1QAQA 2KIUA 4G12A 5E20A 4EEFG 4IBEA 3U6CA 1Q1HA 3ESWB 4M6YA 4PGHA 2VQHA 1HNZM 1IDYA 1IGNA 4I09A 2H27A 3CF5F 2F4OB 2JPCA 2DPUA 3LA7A 5EZHA 3KP0E 3PNYA 1VYWB 1VNDA 1YW8A 3FBNB 2MH2A 4M3DA 1UFZA 3K4BA 2ID6A 3G4SI 1IN4A 1B8IA 2CG4A 3DJBA 2WY8Q 2AHMA 4Z8XA 2CHGA 2HQ5A 4PSXA 3TP3A 1V92A 1OCOH 3QHWB 3Q0VA 2CUJA 3QAHA 3K0LA 4D7MA 1B1BA 2R7VA 4Y72B 1YX3A 5KPRA 4OMYA 3KE2A 1G71A 4C2MJ 1OISA 2E1MB 5ERIA 3JAMK 3WU1B 4EIWA 5J4YA 1A6IA 3ZOBA 2K27A 4RGXA 3RSNA 2XF6A 3F5XB 4LD5A 1UZCA 3ZGKA 4UUTA 2KP6A 4AKIA 5DTDA 2DTZA 3OYEA 4EGYA 1Z59A 2XZUA 3UMMA 4Q48A 2HEOA 2PK9B 4B3AA 5H6RA 2JZ0A 3E6MA 4BAYA 2L4MA 2CWBA 2C96A 3AG1H 1B59A 4G6TB 4F91B 1A04A 2HTSA 3JRAA 2LVNC 4RBOA 1T6SA 3BJAA 3PQKA 3U60A 1SFXA 5E3MA 3MK6A 3KZZA 4LY6A 2RN7A 2GXAA 3RYPA 1FINB 2RREA 2EBIA 3GZ6A 1ZREA 4EORB 2QQ8A 2EFOA 2UUCM 4XBOA 2DJIA 3ZN0A 5EP1A 5EP4A 3S1NJ 1IN8A 1IRZA 1TH3A 4HL4A 3HDDA 1K61A 5IZ7D 3PNTA 2R7TA 4GH9A 3KP2A 2GIZA 5LGTA 4A3CJ 2M3AA 2D2WA 2DMTA 2OBPA 2VBXA 5J4VA 1NH3A 2OOAA 2QCOA 2VODA 2QZ4A 3IUOA 3T38A 1TTEA 1Q3BA 5EQTA 3BXWA 1TWHJ 4ETSA 1E3OC 4YFKF 1XMXA 2M7AA 2QM3A 2W84A 2WY7Q 3PQJA 1VEGA 3HOWJ 2M45A 4OW0A 5JHUA 1TZLA 4B44A 3ERMA 3O8HA 4IHVA 2C5OB 1T38A 1NY6A 5L3GA 4EOLB 1HSTA 4WXCA 3GLIB 1OAIA 2X9DA 3WTUC 1G2HA 1XB2B 2GLOA 3LVVA 1R5ID 1WCMJ 1TT5B 5KPTA 3U60B 3BPVA 2LBFA 3L2WA 3U6OA 3U6QA 2X48A 2PJRB 1VZ0A 4EJVA 4B3XA 2RQQA 2R7RA 1S9HA 4DV7M 1S3JA 2ZJRF 1D5VA 3DF8A 5FLXK 3I54A 2P7CB 2R7DA 1GXPA 2P5TA 3FXMA 4D80A 2IRFG 1IUFA 2WA0A 1L1TA 2UU9M 2LFBA 2P81A 3OYCA 4ENNA 5FFXA 2HXIA 2W2HA 2OPTA 4L16A 1HJPA 5JI3E 4B3TM 1NV8A 2L7ZA 3TO7A 2R5YA 4LF7M 2XAFA 4A5NA 4CFUD 4G6ZA 4OX9M 2QQAA 1D0LA 3AOEC 4YOSA 3X20B 3H4JA 2PX9A 2YS9A 1UHMA 5LMKB 3VKGA 3F21A 3G33B 1ZRDA 1FNNA 3GLHA 2HI3A 1PUFB 4IIWA 2FUG2 1ETVA 2DT7B 4PFOA 2LHCA 1D5YA 4OIOF 2AQEA 4REZA 5IP9J 2Y0SN 4CO8A 1O3RA 1B8IB 1WHCA 4I6ZA 3FBIB 2W57A 1OL2B 1SVOA 3HTSB 4NXMM 2XGCA 3IKVA 3JAMS 5EGOA 5FTNA 4DUZM 3R9XB 3A1YA 2FNPA 5LHIA 3R0AA 2W1OA 5DM7F 4BCND 3CP2A 2JMWA 2VQFM 2C5RA 2LF8A 1YW7A 1JKOC 4S12A 4HAMA 2DA4A 4HPQA 4RGUA 4MGZE 1IBKM 1W7PA 2X4HA 2JA6J 2DFEA 2JUGA 1O3SA 3SBJA 3Q0UA 5FLMJ 3GTGJ 2G7UA 4N0BA 1LEAA 3C9PA 4ENMA 2HKOA 2XSZD 2RRUA 1WJFA 2CJMB 3ZR8X 2C98A 4PK4A 1NTCA 1ODDA 2LLKA 3ASNH 3HOUJ 2IBDA 2JVHA 4G6QA 4LIVA 2R62A 3GFIA 1UCRA 1TBXA 1NHGC 3FMRA 3HOSA 1V3FA 3AAFA 3P7NA 2ME6A 4KT0F 1ZQ9A 1NSFA 1R6BX 4GIPA 5FLXS 3QP5A 3WTTC 2R0IA 2TRTA 4JP0A 5FRNA 1MIJA 2K9MA 2MW8A 4BKXA 3SHGB 1T6OA 3CQZJ 1SFEA 5J8CA 3S3OA 2LY2A 1OQYA 4Y17A 1P3QQ 3PUBA 4QLCU 4JXJA 3F8BA 3RCOA 3KYCB 5EGOB 1I6XA 1H25B 4ZPXA 2C5NB 3FUWA 4B1RA 3G1OA 1RI7A 3NBXX 4D81A 1UNLD 4IJAA 3REOA 4JN6A 3QZ5B 1L2BA 3SARA 4DV6M 3F8FA 1DGGA 1X3WB 2IGNA 3HHHA 4EATA 4PDKA 2E71A 4L18B 4Q5SF 3GMEA 1MH4A 3BQZA 2XIGA 4IL6C 4HG2A 5HDKA 4I2OA 3VKHA 5L8RF 3EIEA 4X65M 3CC4I 1BI0A 2L02A 3PM1A 4FQGA 3V7RA 5D5UB 2X1DA 2Y2ZA 2F5VA 4Q4ZF 1FP1D 3L7WA 4FASD 2LTUA 1V4RA 2BS4A 3LCVB 4GKKM 3Q3SA 1MMSA 1OJLA 4UV8A 4GITA 2D7GA 1X1AA 5DM6F 2UXNA 2DI0A 4G4OA 1MD0A 5ILUA 1GLNA 1DPUA 5M5WJ 4XLEA 2DHRA 2JPBA 1OLTA 2RC4A 4AZFA 3E5QA 2R7OA 3FKJA 2LBFB 2K9SA 3RIRA 3SXYA 4MIMA 3U6PA 2LYCA 2A6HF 3U1KA 3GRRA 3L29A 3FK7A 3WODF 4CCNA 4G6DA 1JUPA 3Q0WA 5ICCA 3PO3J 1OIPA 1W1WE 3Q5FA 1S7AA 4MEYF 2V4JC 2IVMA 4KYWA 2B3TA 4ESBA 1LDKB 2BZTA 4P96A 2IS6A 4XRFA 4NSRA 1QVTA 1QGPA 2W99A 2CQQA 4LG0A 2GM4A 2R4EA 1TH2A 3MI9B 5DS9A
chains in the Genus database with same CATH topology
4QSHA 2ZPIB 2CZ1B 2ZPGB 4ZGDB 3HZJA 3A8OB 4ZGJB 2DXCB 1AHJB 4ELJA 4JX6A 3WVEB 2DXBB 1UGRB 2CZ6B 3H4CA 2ZPBB 2KR6A 3X26B 4AKIA 3KHIA 2BS3A 4OB2B 4HLQA 2QDJA 4HNVA 3WVDB 3QYEA 4BBSM 2DD5B 4AKHA 4OB1B 2QDYB 2G77A 3TW6A 2DD4B 3QWLA 3QYBA 3A8GB 2ZPEB 4ZGEB 3HB9A 3X28B 4JX4A 2QQ8A 4Z6YA 2KMGA 3HO8A 4AI6A 1UGPB 4HL4A 3HHTB 4M6VA 2BS2A 1FKMA 2DPPB 4MFDA 4HNUA 2QFZA 3A8MB 5EJCA 4BBRM 2ZPHB 4FM4B 3QZ5B 2AHJB 4MFEA 1QLBA 3QYGB 2ZCFB 3VKHA 3QZ9B 4OB3B 4P17A 4OB0B 3A8LB 3X24B 1UGQB 1UGSB 4AKGA 2CYZB 2BS4A 3HBLA 2CZ7B 3VYHB 1IREB 1V29B 3QYHB 2ZPFB 3BG9A 3DL1A 4LOCA 3TW7A 3QXEB 4MIMA 4HNTA 3X20B 2QF7A 3BG3A 1E7PA 3VKGA 2CZ0B 3VYGB 2D0QB 4JX5A 2ZZDB 3X25B 3BG5A 2WJ9A 4NC6A 3A8HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P17 A;  4HL4 A;  2G77 A;  2QFZ A;  3HZJ A;  3QWL A;  4HLQ A;  3QYB A;  5EJC A;  2QQ8 A;  4Z6Y A;  1FKM A;  3QYE A;  4NC6 A; 
#chains in the Genus database with same CATH topology
 3SAS A;  4CCL A;  2VUM J;  2LNH C;  3WU2 C;  3BZK A;  1JKW A;  4RMN A;  2L2D A;  5F0H A;  4YG2 F;  2YX7 A;  2K6B A;  2JY8 A;  4UNO A;  4CA0 A;  2LSO A;  1U5T A;  2DW4 A;  3DLA A;  1HT1 E;  2BY2 A;  4BCQ D;  3QOP A;  4FE7 A;  2LRD A;  1J0R A;  1DGH A;  1V5G A;  2XGN A;  1XGO A;  4CHU A;  3CC7 I;  1KA8 A;  1MJB A;  4L0Y B;  2I10 A;  1FBQ A;  2Y0T A;  3BLY A;  4LLL A;  1WVR A;  1MMA A;  4ZYD A;  1LFU P;  2P0W A;  5FTK A;  4YOZ A;  2YNM D;  3NEU A;  3WTV C;  2LKS A;  5A2Q S;  5E79 C;  4XL9 A;  2QKM B;  3OYG A;  2KR6 A;  2XB0 X;  1N32 M;  3WE2 A;  2HR3 A;  1PKD B;  4ROC A;  3A42 A;  1W5S A;  2GXG A;  4ANJ A;  5C44 J;  3HPG A;  3HRM A;  2MJ5 B;  4S0H B;  2DD5 B;  2FX0 A;  4MGK E;  4LF5 M;  2QDY B;  2H6B A;  2L4E A;  2G77 A;  4FT8 A;  1OFH A;  1BM9 A;  5H2F C;  4A0Z A;  4CGY B;  3I59 A;  4MO7 A;  1ZR4 A;  1J5E M;  2ZSH B;  3HX3 A;  4NBQ A;  1GKI A;  3RKY A;  3MZH A;  2VJ4 A;  2FFJ A;  3A45 A;  1X2M A;  1ZHF A;  3FIW A;  4ZGE B;  1QUS A;  5E8G A;  1F1Z A;  3QPL A;  1H6U A;  2KNZ A;  4LRT A;  1TF0 B;  3K4M A;  4OU0 A;  3UR3 C;  5JVT A;  3BTC A;  4EC9 B;  2Y48 A;  4AIK A;  4IHX A;  4ESF A;  1ETK A;  4LZZ A;  3FKI J;  2W9F A;  4ITQ A;  1IN6 A;  5C18 A;  1GY3 B;  1REP C;  3KP3 A;  3V4G A;  4A3M J;  1IFY A;  4ROD A;  4NUB A;  3CTW B;  1ZLK A;  2RKO A;  3C2H A;  2VQC A;  3O6B B;  3JRF A;  2E5N A;  4BHC A;  5DD8 A;  4EON B;  2Q2E A;  4JK1 X;  1SVM A;  3JAM Z;  2DYR H;  3JCU C;  1FJL A;  2DPD A;  4BY7 X;  2DI3 A;  5JI6 A;  5TGT A;  2M1B A;  3I4P A;  5FO5 A;  2G9W A;  4BU2 A;  2BHZ A;  4BUP A;  3GLG A;  3LCU A;  3CJQ B;  1VQM I;  1H24 B;  3BLR B;  3S3N A;  1T2K A;  4A3K J;  1CF7 A;  2OOB A;  1HNW M;  2HZD A;  4OB0 B;  2C99 A;  4PJM A;  2EWN A;  2I40 B;  2JNH A;  4PZJ A;  1N77 A;  4KOD A;  2V7F A;  4F3Q A;  3AFH A;  1VQK I;  1XC5 A;  3GTM S;  3HBL A;  1MBE A;  1U6G A;  1KGS A;  2QQ9 A;  3I0T A;  1TWF J;  2KZS A;  1VQ9 I;  2AHQ A;  5J8F A;  2JRM A;  1UAA A;  4LK1 F;  4GDF A;  5BNJ B;  2R65 A;  2DOE A;  2UZB B;  4X66 M;  2B7E A;  3ZQ7 A;  3KYL A;  1R58 A;  3DL1 A;  3FIS A;  1C7Y A;  5BS6 A;  3VK7 A;  1KYZ A;  3F0C A;  1E9S A;  1OR7 A;  4LF6 M;  1TQI A;  4EOI B;  1GVJ A;  1HT2 E;  4DR1 M;  2HZT A;  2IP2 A;  5DCF A;  3LSM A;  1D1B A;  4UB8 C;  2CZ0 B;  3JTH A;  1TNT A;  4I98 B;  3J7B A;  3KFW X;  1I1S A;  4ZDO A;  3AL0 B;  4YII A;  2QLZ A;  4RAG A;  4DV3 M;  2HVQ A;  1F5Q B;  3TED A;  2MRO B;  4BY1 J;  5GPA A;  3TOA A;  1FIA A;  1D8J A;  4M6V A;  5KAF C;  2ZME B;  3WTX C;  2WIP B;  2R5Z A;  3S17 J;  2BBY A;  4A3L J;  4BY7 J;  2PI0 A;  2ZAO A;  3D5L A;  4UUS B;  5IY5 H;  2GXB A;  2ZBK A;  3IH2 A;  2XC7 A;  3ZQL A;  4TTH A;  1OCR H;  2DWL A;  3GTJ J;  4B08 A;  4XRS A;  3TQS A;  3OIO A;  3HZJ A;  2AXL A;  4II7 A;  1SAN A;  1C0W A;  2IGK A;  1UFM A;  1IRX A;  3NAU A;  5LLQ A;  4XK8 F;  3C7J A;  2JK3 A;  3OIQ A;  2ESH A;  4A5M A;  1SAX A;  2IA0 A;  4F6S B;  3N4M A;  4JYA M;  3KP5 A;  2W00 A;  2LH0 A;  2P5V A;  3BQY A;  2ZAN A;  3D5R C;  2JA2 A;  4CFW B;  5E8I A;  4F7S B;  1XXH B;  2W48 A;  3C3E A;  1MBK A;  1R1U A;  2XVC A;  2VKH A;  2DOA A;  1FPQ A;  3HEF A;  1RET A;  3HRU A;  1AIP C;  1H1S B;  1XX5 A;  2XAJ A;  1AOY A;  2KKO A;  1FMV A;  2IAI A;  1R5L A;  3GTQ J;  1GJS A;  3QYE A;  2LKP A;  4HEO A;  4F52 A;  3DDQ B;  4E7J A;  1AIS B;  1ZAO A;  2M4K A;  3FE3 A;  4ZTF A;  3UJN A;  3EET A;  3CCJ I;  4E6K G;  3TWL A;  3IRR A;  1TWA J;  4BAC A;  2E2J J;  5HQ0 B;  3R6S A;  4EGZ A;  1V34 A;  4LGM A;  4JX4 A;  1JR3 D;  2CMP A;  1DPR A;  3HKZ A;  2KMG A;  4KIF A;  3C3D A;  1SMT A;  3FDY A;  4JI0 M;  2ZB9 A;  3OYF A;  5DNY A;  2F5F A;  1IC8 A;  2KRC A;  5LHG A;  1ZN2 A;  1Z91 A;  1IQP A;  1R4M B;  4P1W A;  4AIJ A;  4D7N A;  3QPS A;  3MVP A;  1BI3 A;  4E7K A;  2QBY B;  2R7Z J;  4DQ2 A;  4IOC F;  3CO7 C;  4W5W A;  3RJP A;  1YG2 A;  3TGN A;  1ZQ3 P;  2UUA M;  3BR5 A;  4KIT B;  1JKQ C;  5M3F J;  1ULY A;  1LE8 A;  1UHS A;  3GLL A;  4BCG B;  3S1Q J;  3K2Z A;  5L2W B;  5CVI A;  1OCZ H;  1N34 M;  2STW A;  4P5O A;  5IWA M;  3OSG A;  2R92 J;  1YE9 A;  1PJS A;  3DEU A;  3H5R A;  1O7F A;  4B43 A;  2K9N A;  3IL2 A;  1N75 A;  2O6G E;  2QGS A;  4KUM A;  1STZ A;  2FE3 A;  2Z3X A;  5AIP A;  2UZK A;  5IT9 Z;  3VDU A;  3DEW A;  4HSR A;  5JI2 E;  4NRW A;  3G1L A;  3CTA A;  4OU7 A;  1FY7 A;  1YS6 A;  4UVB A;  4LJA A;  3W6K B;  4DGW B;  2IEK A;  2VON A;  4EM0 B;  2MSY A;  1ZG5 A;  4DR6 M;  2HGC A;  3JTG A;  4B3R M;  3CF2 A;  4KA4 A;  3U6M A;  4CFX B;  1PJR A;  3DTK A;  4I0B A;  2V26 A;  4KNY A;  3GLF E;  2NVU B;  2EPF A;  4DR4 M;  2OO9 A;  3G71 I;  2N8G A;  2L7H A;  3C2B A;  3SHF A;  2MGW A;  3BG9 A;  3ROU A;  2VDB B;  3M1E A;  3HJ8 A;  2R7U A;  3WG9 A;  2L5Q A;  2BNK A;  3VYS B;  3ILK A;  3GO5 A;  2RQP A;  4AC0 A;  1R4G A;  2KNA A;  1FWZ A;  5ITQ A;  3GPX A;  1BBY A;  1KYW A;  1XB4 A;  2CQ7 A;  2EA2 A;  1JR3 E;  2EIK H;  4AQY M;  2WAD A;  3E6D A;  4LF9 M;  1QDR A;  2VPL A;  3TL4 X;  1SMY F;  4BXX X;  2ECB A;  1UHW A;  4ROE A;  2CQN A;  3IKT A;  4D0P A;  1YIT I;  1DDN A;  3FYC A;  4DZJ A;  3B89 A;  2PK2 A;  4JI1 M;  1FOW A;  2BXY A;  3CP8 A;  3OL4 A;  3CD6 I;  4BLC A;  2KZG A;  5DQW A;  2MH9 A;  4L78 A;  2JSC A;  4XSX F;  3I71 A;  2GBY A;  4C3I J;  3AOE A;  2DFH A;  4D5C A;  2D5V A;  2HWJ A;  4N9I A;  2HXO A;  1X3Z B;  1LTM A;  3H4M A;  4GMQ A;  2RDP A;  1BR1 A;  1RR7 A;  1PP8 F;  1E17 A;  2KNV A;  2DK5 A;  5B5E C;  4CZC A;  4CJ6 A;  4E7S A;  2DXC B;  2R18 A;  2XUB A;  2UXX A;  1ETY A;  4GYI A;  1ZTR A;  2FNA A;  5EP2 A;  2KZV A;  1HW1 A;  3P5J A;  4LRS A;  4OR5 B;  4RM3 A;  2NXN B;  1FBS A;  2I5U A;  3R60 A;  4JQF A;  2C6T B;  3IAM 2;  5ITX A;  3CES A;  3E21 A;  4EJW A;  1IN5 A;  3W68 A;  5GKN A;  5ITR A;  3A4C A;  2V1C A;  2LP0 A;  3KLN A;  4XOR A;  1WH7 A;  2X1C A;  2E19 A;  3HSR A;  3HJS A;  1ZG3 A;  3BR1 A;  3CUQ C;  3EUK L;  3GX4 X;  4PJL A;  4CGZ A;  4ZZD A;  5DYI A;  2BS3 A;  4B47 A;  3TQN A;  1I3A A;  1OKR A;  5ICE A;  3SYL A;  3LFK A;  1X37 A;  3LL7 A;  4NQW A;  4QPQ A;  2DD4 B;  1R1T A;  4HA8 A;  3EYI A;  1MU5 A;  3QWL A;  2DMP A;  1JR3 A;  4KN7 X;  4EVI A;  3WTS C;  2OC6 A;  1BW6 A;  3SFZ A;  1DO0 A;  3K9P A;  3LSI A;  2L6O A;  1U0J A;  3BRO A;  4IVN A;  2IPQ X;  1T98 A;  1XGN A;  2L7K A;  3DFG A;  4UB6 C;  3A01 A;  2JA5 J;  3PO2 J;  2G3Q A;  2F5D A;  3CZ6 A;  3T1H M;  3FXR A;  2V79 A;  3HUG A;  4CDG A;  3M4O J;  4NST B;  2Z2S B;  1TNS A;  1IW7 F;  4KDP A;  4AI6 A;  1A5T A;  4BGD A;  2H8W A;  4ZDL A;  4BJ6 C;  5KPZ A;  1X1D A;  3ZMS A;  2ADU A;  2BY1 A;  3BHV B;  1ENH A;  5EXT A;  2V9K A;  2VKE A;  1YRN A;  4OIN F;  4B7H A;  3ZCO A;  4UUV A;  3I3L A;  5A2Q Z;  2QNJ A;  3FUT A;  1LVA A;  4Y4R A;  2WTE A;  4L8R C;  2HOS A;  1TW3 A;  2K7L A;  4FE4 A;  5K5R A;  2E2H J;  8CAT A;  3BJO A;  3DXJ F;  1QBJ A;  2M8G X;  2V1U A;  5EXP A;  2FD5 A;  3H3Z A;  4ESJ A;  3U5Z A;  4LF8 M;  3S2D J;  2XH9 A;  2ZM6 M;  1S7E A;  4M9Z A;  1LNW A;  2ETH A;  2JTV A;  2OA4 A;  3B02 A;  3OYB A;  4CYC B;  3S2W A;  1R23 A;  3IAS 2;  4XOP A;  3A2K A;  2OU2 A;  2DT6 A;  3FX3 A;  3RKX A;  2STT A;  4BH9 A;  1Y1V J;  2NRA C;  4ZH4 F;  2E1N A;  4HST A;  2WAQ A;  2WXV B;  1HOM A;  2W82 A;  1PJQ A;  4OVZ B;  4WXH A;  2I8D A;  5KAI C;  1MSE C;  1YIO A;  1P4A A;  3UGJ A;  3HYI A;  2EKF A;  2EFW A;  1XD7 A;  1IY0 A;  1YJW I;  1VEK A;  1IRE B;  1YOV B;  5HVY B;  2CCI B;  4PD2 A;  2EA0 A;  3ABM H;  3MHV C;  2BOL A;  4DZP A;  3FUV A;  1QHH D;  2MBF A;  3KX2 A;  2QKL B;  3RQI A;  1RC9 A;  2R0Q C;  1XNR M;  2FE8 A;  1WI3 A;  3KSJ A;  1D3Y A;  1JGS A;  2E60 A;  1HA8 A;  3BWG A;  1VOL A;  2CHQ A;  2WAE A;  5DUK A;  2EK5 A;  3TOB A;  1SFK A;  2DK8 A;  2O03 A;  4G94 A;  3K70 C;  4IHY A;  2NOG A;  1SD5 A;  2ZSI B;  4BJT A;  1ZR2 A;  4M71 A;  4X64 M;  2E34 A;  5LEK A;  4QOZ C;  1TWG J;  2WJ9 A;  4F55 A;  4OIP F;  1RES A;  4GGG A;  3J7A Y;  1T8I A;  3J27 B;  2BJW A;  2CHV A;  2XAG A;  2ME0 A;  5KQD A;  1G3T A;  1Z7U A;  4AU7 A;  3J81 Z;  2ERC A;  1IY1 A;  4EC8 B;  2HDC A;  4BL0 B;  4F6U B;  4IPA A;  3GWZ A;  1JOW A;  4RF0 A;  3SEZ A;  5KQ8 A;  4DV2 M;  1EH8 A;  3GLX A;  4YC3 B;  5FTM A;  1J2X A;  4LB6 B;  5FGK B;  3GPP A;  3CCL I;  1Z21 A;  1H1Q B;  1F4K A;  4IHT A;  1B9N A;  4AYB N;  4PDG A;  5FD6 A;  2HHH M;  3SQN A;  1TFB A;  5L3E A;  3PVS A;  2XPW A;  5IT9 S;  3IRQ A;  2OAZ A;  1V5E A;  2LG4 A;  4BCO B;  2A6T A;  1TDH A;  3BZC A;  3DU6 A;  4QWQ A;  1ZV1 A;  4HLQ A;  4HNV A;  2VLA A;  2ZJQ F;  4X6A J;  4WUR A;  2KHH A;  3TO6 A;  1WJE A;  3R8F A;  4KMF A;  2VC0 A;  1G41 A;  2UUE B;  4BE1 A;  5ITX E;  4JV5 M;  5F0C A;  2XF7 A;  4DBR A;  1J75 A;  1H89 C;  2EUC A;  1FTT A;  1FYK A;  4JI6 M;  3BT9 A;  2Y69 H;  2FML A;  3GZN B;  5LGU A;  4V19 K;  4JYK A;  5CVV A;  1Z0X A;  1JXS A;  2A69 F;  4KT6 A;  2DA2 A;  3EUA A;  2XRO A;  4R7G A;  4EM2 A;  5JLX A;  1VFC A;  2UWM A;  1G3N C;  2NVT J;  2KHM A;  3E5U A;  2WBM A;  1GUX A;  4W97 A;  3BR3 A;  4E7I A;  4JI3 M;  5M5X J;  2ZJ2 A;  4FWD A;  3T5X A;  4YY3 M;  2A68 F;  4FM4 B;  1IXZ A;  1J59 A;  2UXC M;  3QYF A;  1OI9 B;  4PFP A;  2D7E A;  2AHJ B;  2IW6 B;  2DWM A;  1UG2 A;  1HCR A;  2F5N A;  4LLG F;  3MY1 B;  3GQ4 A;  5EEA A;  3WHK A;  4XN0 A;  2WWY A;  4AUX A;  1VTN C;  2Y31 A;  4AVZ A;  4HX4 A;  2H1L A;  2FOW A;  3LSH A;  3FRH A;  2JY7 A;  1P92 A;  2H5X A;  2K0B X;  5KNL A;  2VF8 A;  3UZU A;  2M9H A;  2MG4 A;  3GTK J;  4EOK B;  5ICP B;  1I4W A;  1VIN A;  1HDP A;  3HGI A;  1D1C A;  2OD5 A;  2RGH A;  1JE8 A;  5HVQ C;  4KFC A;  1HDD C;  2JZ1 A;  1G8X A;  2KDZ A;  5GAD J;  3KPH A;  2Y0S A;  1K4T A;  4DV4 M;  5HLT A;  3DEE A;  1IZ1 A;  3GUD A;  5AIQ A;  3RZD J;  1OIU B;  1I1G A;  1ORY B;  4F92 B;  5LD2 C;  2XSZ A;  3BHT B;  1BJZ A;  2N35 A;  1R7R A;  4HDV A;  2L9V A;  4G4R A;  2WHB B;  1D3U B;  3FYD A;  3B6C A;  2O9L A;  4IQ4 A;  4RKU F;  1D8K A;  1U78 A;  4A3J J;  3MAJ A;  5LGN A;  1NG6 A;  3H3V K;  3E46 A;  2DAM A;  1GL6 A;  3S32 A;  4BBA A;  3VEP A;  2Z33 A;  2KRH A;  1I94 M;  2JSP A;  1R2Y A;  2YX4 A;  3I01 M;  4MGI E;  3ZH9 B;  4ASN A;  1AUA A;  1TD6 A;  3D8B A;  4QPO A;  4ENK A;  1XN7 A;  4RNA A;  3BG5 A;  1K78 A;  1Y56 A;  3FTF A;  3ZPL A;  1N36 M;  4JI8 M;  3KOX E;  3ISP A;  3JSO A;  3KIO A;  2PHG A;  5LRR A;  4NRV A;  4FIS A;  2H94 A;  4FVM A;  1O9K A;  1OKW B;  5J6X A;  1L8Q A;  2L54 A;  2VJJ A;  1IJW C;  4UXN A;  1Y1W J;  1Z05 A;  4CFU B;  3GLH E;  2E35 A;  2GOX B;  2JJ7 A;  2LXE A;  4XQF A;  2L9R A;  4JI2 M;  2RVC A;  4WWC A;  2J5Y A;  4BYY A;  2XSD C;  3W0L B;  2HCB A;  4XGI A;  2XZF A;  4DYQ A;  4NC8 A;  2M5Z A;  3OOU A;  2Y9Y A;  3I04 M;  1IBL M;  3POM A;  1BR4 A;  3K8Z A;  2DQR A;  1Z67 A;  2IA1 A;  2VL8 A;  5E18 F;  1O4X A;  3A98 B;  4BNC A;  5F27 A;  2E1O A;  2FS1 A;  3WGG A;  4BCF B;  1MGT A;  2XAS A;  2L09 A;  1WJ7 A;  1VDD A;  2L9N A;  2CH0 A;  2CWE A;  4O3M A;  2GQQ A;  2PMI B;  2FBI A;  2XLJ A;  1G3W A;  1VQ1 A;  1KQ0 A;  5J40 A;  3V8J A;  1LFP A;  3GF2 A;  1QAO A;  4BHP A;  3KFU G;  3DPL C;  2PMZ N;  3BR0 A;  1LEB A;  1S3S A;  1RZ4 A;  1BVS A;  4RLF A;  1K78 B;  4B7F A;  3U61 A;  4HBL A;  2CP8 A;  1OFC X;  3FXL A;  2VII A;  5L3D A;  4W1U A;  5K1Y A;  4I01 A;  3JRB A;  2H6C A;  3SZP A;  2X6X A;  4AG6 A;  4XLC A;  3ZMV A;  4L9J A;  3ECH A;  3HUG B;  1TWC J;  2Z1D A;  2CV0 A;  3VYT B;  4ENJ A;  1RUN A;  3S2H J;  2COM A;  2XF3 A;  4O5V A;  4G4N A;  4HF0 A;  1Z6R A;  3R61 A;  2KRK A;  4CHT B;  2EV5 A;  3HJE A;  4A3I J;  2NS8 A;  3J81 K;  1VI0 A;  1I6H J;  3THG A;  2K9D A;  2EO2 A;  3IG5 A;  2QVO A;  1U5T C;  1FVV B;  5ITU A;  5ILS A;  2D1H A;  3OS2 A;  1AD6 A;  1ETQ A;  1USS A;  3WGI A;  5ITY A;  4CFN B;  3MKW B;  3HIF A;  4XLN F;  2HFH A;  4PCZ A;  4CH7 A;  2X1N B;  1WXQ A;  1KZH A;  2IW8 B;  3A03 A;  2VE9 A;  2ZNY A;  1F9N A;  2DAE A;  1DQU A;  2QYO A;  3RKW A;  1J9I A;  2DA1 A;  2Z9O A;  2DKL A;  4LJ7 A;  3PJR A;  1SXJ A;  2OZU A;  1IN7 A;  4IF4 A;  4YRV A;  4CYD A;  3WG7 H;  2F2E A;  1R22 A;  4BJ5 C;  3TKY A;  3MCZ A;  2DFI A;  1SAU A;  3A8L B;  2LD5 A;  1G3Y A;  1ZAR A;  1ZK8 A;  1HKT A;  4XKV A;  2FBK A;  1UGQ B;  2VKD A;  1XGS A;  1XGM A;  2GZW A;  1CGP A;  4HEA 2;  3RFW A;  1N25 A;  3GFM A;  4OAY A;  2FQ4 A;  3CMA I;  1TT0 A;  4HQE A;  2F6C A;  4HLY A;  4BCK B;  1UB9 A;  1OFI A;  4L15 A;  2GA2 A;  1ZRF A;  2M87 A;  2AO9 A;  1CQT A;  1PJI A;  1IBM M;  5C1B A;  1GUX B;  4V2F A;  4XKB A;  2XRN A;  3E3V A;  4PJ0 C;  3MIA B;  2BW3 B;  2OJE D;  3CCU I;  3OYJ A;  2K40 A;  4M3B A;  1O3T A;  3I4N J;  1B4A A;  3U6L A;  3FTC A;  3NWT A;  1E7P A;  5EEH A;  3M0E A;  4HV5 A;  4AID A;  4EQQ A;  4RAY A;  3K9T A;  2IT0 A;  2DA6 A;  3DKY A;  2D0Q B;  3FTE A;  3GP1 A;  1SFO J;  3O2P E;  3R0J A;  1PDN C;  2ZNZ A;  3K1M A;  4RM2 A;  2VKV A;  2OCE A;  2UV1 A;  3F72 A;  4LB5 A;  1ZGA A;  1DP3 A;  3L9F A;  5JFR A;  3B7N A;  4L5J A;  2IGO A;  3Q9S A;  2X6O A;  1LKX A;  4CIS A;  3A8O B;  2M5W A;  3S16 J;  4KT5 C;  3DU5 A;  2CGP A;  4XKW A;  4DJA A;  1PVE A;  3RPQ A;  1LJ9 A;  1GV2 A;  2VJI A;  1G59 A;  3M8J A;  4NDL A;  3KP6 A;  1PRB A;  1VG5 A;  2Z4R A;  3HOZ J;  2R45 A;  1SG9 A;  2Z7J A;  3IEC A;  1XCV A;  1T33 A;  3I56 I;  5EG0 B;  1NK3 P;  1UGR B;  5IDP B;  3ZMT A;  4XKC A;  3FMS A;  5L3F A;  1K6O A;  1S5L C;  2R7G A;  1VQO I;  2ZC2 A;  5LEJ A;  1WI9 A;  1HLV A;  3SAV A;  1XO2 A;  2ZXH A;  4BS9 A;  5J3L A;  2XV4 S;  4AKH A;  2X85 A;  2KLO A;  2QQB A;  1OR7 C;  4BEH A;  1I27 A;  1ZLJ A;  2VT2 A;  4BXU A;  1H26 B;  3JR4 A;  3OYA A;  1OL1 B;  1Q1V A;  3ULQ B;  3VB2 A;  2WSC F;  3NWL A;  3QYB A;  2G9X B;  3TPZ A;  4HZF A;  2G7H A;  2HNH A;  3CO6 C;  1H1R B;  3L26 A;  2MH8 A;  3OS1 A;  5E17 F;  3DKW A;  1SXJ C;  4A69 C;  2M7B A;  4EOQ B;  2EB7 A;  3ZQH A;  4KRC B;  1IO2 A;  2QSG X;  3BBZ A;  2MFZ A;  1HSJ A;  5EDN A;  3J80 K;  4L0Z B;  4IBC A;  2F4V M;  1TDZ A;  2CQX A;  2XRL A;  3V8L A;  5IOY A;  1KXU A;  1Z5C A;  1VF9 A;  3CCY A;  3E5X A;  5FRO A;  1Y39 A;  2GIV A;  3W67 A;  2PMZ A;  2F2C A;  5FB2 A;  1L2D A;  2KJB A;  3MMY B;  2ZPH B;  1GO5 A;  3AG2 H;  4BBR M;  4RAF A;  4WP2 A;  2VE8 A;  1VEJ A;  4Y7N J;  3MKZ A;  4IMY B;  2MA3 A;  2J7O A;  1L1Z A;  2X0L A;  3OWT A;  1PUE E;  3SDB A;  3DA1 A;  1HR0 M;  3T6P A;  2EZI A;  4EOO B;  4LJ6 A;  3M9A A;  2JWS A;  1K3X A;  3D0S A;  4GFB A;  1X3U A;  3VSK A;  3LSG A;  4MTE A;  3CUO A;  4BQO A;  3N97 A;  1I5Z A;  4OMZ A;  1W98 B;  2HOA A;  2LMD A;  4FCW A;  1R7J A;  1K82 A;  4CCM A;  4RB1 A;  2CU7 A;  3LNQ A;  4K2E A;  1XMK A;  2EIN H;  2JZY A;  3K4C A;  2DVW B;  4M3E A;  2I53 A;  1ZMU A;  1YX5 A;  1QU3 A;  4A3E J;  4AM3 A;  1BU2 A;  2XGD A;  5JLW A;  4M6X A;  3I4V A;  4LJ5 A;  1PM5 A;  5GAE J;  4UUS A;  4NHJ A;  4IBB A;  1XSX A;  2R5Z B;  2IVX A;  2E5Z A;  1TGU A;  3ERE D;  4EJT A;  5EFQ B;  2M34 A;  2APL A;  5LQF B;  1J7K A;  1T08 B;  3IHP A;  1QAM A;  4B48 A;  2XF5 A;  4EOS B;  3KVW A;  2DAI A;  1GL7 A;  2XB5 A;  1P4W A;  2EIL H;  3SZG A;  5IPA A;  4E7L A;  4EJO A;  5K7F A;  2KMU A;  3TWK A;  2A5W A;  3VYG B;  2P7V B;  3O3K A;  4JOM A;  3DKX A;  1IUY A;  3A01 B;  1TC3 C;  1WH5 A;  3MFK A;  1VQ8 I;  2CV2 A;  2PEX A;  4A0X A;  4CSW A;  4BY1 X;  3HHZ A;  4CIZ A;  2CV1 A;  3CUQ B;  3KP4 A;  3HOX J;  4IQJ A;  3W2A A;  1K79 A;  1WJD A;  2F4I A;  3HG9 A;  4V2G A;  3CCR I;  2L3D A;  2CYY A;  5HBE B;  2HWV A;  1FOK A;  2G8L A;  2HPI A;  3BG7 A;  3GLF B;  4BCJ B;  2H8R A;  1R5H A;  2AS5 F;  1QZZ A;  3QQA A;  4BB9 A;  3HSF A;  4WK8 F;  1QRY A;  2P6S A;  1DP7 P;  1IXC A;  3EDP A;  1K6Y A;  1XDS A;  2BY0 A;  3RGP A;  2HQR A;  3J81 S;  3OOP A;  1D0Y A;  3H9Q A;  1DU6 A;  3L2Q A;  1FSH A;  2XFS A;  3OTO M;  2DO7 A;  4I99 C;  4XRS G;  4I4L A;  5JVG F;  2HOE A;  3V7S A;  6PAX A;  1RPW A;  2L0K A;  2FOK A;  5GPC A;  2UUZ A;  1MJ9 A;  3U6D A;  1T0F A;  1B6A A;  4X1E A;  1FT9 A;  5GTH C;  2XAH A;  2FMY A;  1OIZ A;  1BI2 A;  1JHH A;  4U87 A;  1RR8 C;  3TDZ C;  1T95 A;  4CUG A;  1APL C;  2F5S A;  2CRG A;  5E3O A;  4BXX J;  3HOT A;  4PDI A;  2EJR A;  3F9K A;  2Y0Q A;  5E26 A;  1X1P A;  2B63 J;  4C2T A;  4LZJ A;  4IZZ A;  3ZQC A;  1FJG M;  3JSP A;  3RQ4 A;  3M03 A;  1R6R A;  3SYK A;  5ICG A;  3KDS E;  4Z6Y A;  3GTM J;  3I4M J;  2QWW A;  1FOX A;  1U8R A;  3HPH A;  2IJL A;  3K6G A;  3D5S C;  2LVQ D;  3C2G A;  4FX3 B;  3SJM A;  2BS2 A;  5C4J J;  2XFT A;  1XC8 A;  4HW0 A;  5FKK A;  1PJJ A;  1KU9 A;  4ZJZ A;  1GHC A;  5D8L B;  3GLI E;  1FIP A;  4ITV A;  3LSP A;  1W5T A;  1FYL A;  5DYG A;  4HNU A;  3K4J A;  3AG4 H;  3DCF A;  1R36 A;  3FXQ A;  2X6W A;  1R9T J;  3OSF A;  3KS8 A;  2JY5 A;  3K1J A;  3JR5 A;  4IRG A;  1AKH B;  5HBJ B;  2LF7 A;  3V42 A;  1IG7 A;  3H92 A;  2R93 J;  3DP7 A;  3HKZ N;  1U8B A;  3A46 A;  1JTX A;  1EF4 A;  3I53 A;  1AU7 A;  1F43 A;  1ACI A;  1ZAE A;  2E7W A;  4DOZ A;  3LAP A;  4ZC3 A;  2LVO C;  3CJR B;  1XMO M;  4KLN A;  1GAB A;  3J80 Z;  3G73 A;  1H88 C;  3VDP A;  4K0K M;  3T1B A;  5FD5 A;  1TW2 A;  4A3B J;  2F48 A;  1E9R A;  3ML6 A;  2X1E A;  2CEA A;  2DAK A;  4WCG A;  4A12 A;  4RB2 C;  3S3M A;  3K9O A;  4E7Z A;  4HX7 A;  2QGU A;  4NOO B;  2VQG A;  4Y13 A;  3CCE I;  1U3E M;  3CLO A;  3MWM A;  1U5T B;  4BXF A;  2WFY B;  4U7D A;  2X4A A;  1NV9 A;  1AWC A;  2JT1 A;  1A6Q A;  1Y0N A;  4Q7J A;  4LGY A;  1IRF A;  2KPM A;  2NNN A;  2VBZ A;  2ZXW H;  5DEQ A;  3OYI A;  3QRF F;  3GTL J;  1PUF A;  1NG7 A;  4XOT A;  1KYI A;  1WGN A;  4FX0 A;  4DIQ A;  1SC7 A;  2DLL A;  2IW5 A;  2XGE A;  4XK4 A;  5H20 A;  2IGM A;  3CJT B;  3EQL F;  1T39 A;  3KOZ E;  1ITY A;  4FCT A;  3ZQJ A;  5D5W B;  2JA8 J;  4LK0 F;  4XON A;  3OYD A;  4LJ9 A;  2LNB A;  1IDZ A;  1QMZ B;  3ZQF A;  3K7A M;  1BR2 A;  2FXA A;  1FMW A;  2JY6 B;  1NHA A;  4MB7 A;  4S04 A;  4NC6 A;  5CVU A;  4U0Y A;  1YW9 A;  1QO0 D;  5KVR A;  3QAU A;  2ZXJ A;  3U6E A;  5C3E J;  4OIQ F;  5DV5 A;  2E2I J;  5E3N A;  4DR5 M;  4ZGD B;  5I5Z B;  1WRJ A;  3FXJ A;  5ACB A;  4ZGJ B;  4G7H F;  2GWR A;  1SXJ D;  3F22 A;  4LFB M;  4TUW A;  1QHG A;  2M8E A;  4CCO A;  4EJU A;  4JI5 M;  5TIS C;  3B73 A;  1OYI A;  2YFQ A;  1H27 B;  3WTZ A;  4JX6 A;  5IP6 A;  3DLL F;  3JW4 A;  1B72 B;  1BA5 A;  3W3C A;  3OYM A;  4WX9 A;  2BEO A;  5KO3 A;  1M1E B;  2EUF A;  2ZPB B;  2BV6 A;  4A6D A;  1F5T A;  1XG1 A;  4ZYA A;  3HRT A;  3X26 B;  2DOF A;  3J2P B;  3U9G A;  2TCT A;  4OGR B;  2YQZ A;  2DA7 A;  4PGG A;  2DBB A;  4OB2 B;  1FYM A;  2QDJ A;  4QHT A;  1WJA A;  4MNU A;  3F23 A;  2NAZ A;  2H1R A;  4GC9 A;  1NNU C;  2RNJ A;  2CUZ A;  5HLG A;  4HRI A;  5IDN B;  3TW6 A;  4E7H A;  3Q9V A;  2BKZ B;  2V1D A;  2VIX A;  1FLI A;  1G3I A;  2DDA A;  1WHU A;  4CZZ A;  2JUC A;  1B72 A;  1P6R A;  1MBJ A;  4UVC A;  4DBQ A;  1VQL I;  2VN2 A;  3CCS I;  3DDP B;  4LMY A;  3J7A O;  2K3F A;  4L6V 6;  1JTY A;  2HL7 A;  1ZH5 A;  2DAO A;  2O5R A;  2L9S A;  1VQ5 I;  1UNH D;  2LWX A;  1NO1 A;  3OYK A;  1UGP B;  1S8N A;  3KZI C;  2EFP A;  4P9F A;  3TDU C;  2HVR A;  3T15 A;  1HW5 A;  3F6O A;  2K86 A;  5CVJ A;  5DYM A;  3K92 A;  2K9L A;  2Y0M A;  5KCM A;  1U9N A;  2JP7 A;  3C3W A;  1H1P B;  2R44 A;  5F64 A;  3RPU D;  3H9G A;  5F6F A;  2DWZ B;  3H0D A;  1HW2 A;  3VWB A;  4IHS A;  3L2A A;  3W6V A;  2BWB A;  3BOQ A;  1FEX A;  3DOG B;  2R4J A;  1E3H A;  1WGX A;  1XCB A;  2WV0 A;  1YJN I;  5FKL A;  3OY9 A;  1I39 A;  1W7P B;  2Z4S A;  2J7N A;  2ISZ A;  4BQA A;  3P9C A;  3LA2 A;  3A02 A;  2PBI A;  2P6T A;  3TMO A;  4HQM A;  3PXG A;  4HLX A;  2F4M B;  1XXH E;  4QHS A;  1P4X A;  1Z3X A;  2L7F P;  1AHD P;  1LDD A;  4LFU A;  2ZTD A;  2NYX A;  2OF7 A;  2Q2E B;  4XNF A;  1EE8 A;  1FP2 A;  3K2L A;  4I7H A;  3ZN1 A;  1YYV A;  1EA3 A;  2PN6 A;  3OV8 A;  1NHW C;  1W5C C;  4B09 A;  4KRD B;  5AON A;  5EG0 A;  2D1V A;  2DZO B;  4WW0 A;  4OAZ A;  2JUJ A;  5BPV A;  4FX4 A;  2JQ7 A;  3RGS A;  2QEN A;  5BR8 M;  2HYF A;  2Q1Z B;  1SEU A;  4I81 A;  1RNL A;  1S72 I;  4BBS J;  1JST B;  2W96 A;  5ILV A;  3PIO F;  3WHC A;  5L3C A;  3SAU A;  3ZQI A;  5A2Q K;  2EZK A;  2RAE A;  1IF1 A;  1SD7 A;  2DOD A;  4KMU X;  5GTI C;  2B9S A;  2BPM B;  1AKH A;  3HU3 A;  3EJ1 B;  4HF1 A;  3X25 B;  1PP7 U;  1P9Q C;  2L2O A;  4HV6 A;  4LJZ F;  2R7X A;  4IJE A;  3FHN A;  2R7F A;  4B4C A;  4WF2 A;  1ZRC A;  2XSJ C;  3A8H B;  3BG6 A;  3C58 A;  5CLS A;  2KIQ A;  4G4Q A;  2ZPI B;  1NNJ A;  3W6J B;  5BPI A;  3IH4 A;  4ANR A;  1A36 A;  1RKT A;  2HYJ A;  3EUH C;  4RA2 A;  3WGH A;  2IW9 B;  3VLF B;  2W85 A;  3PIP F;  1P7J A;  5C4X J;  2ZKZ A;  2EFN A;  5IF1 B;  4G7Z F;  2WEV B;  4M0D A;  3KSX A;  1W36 C;  1JJ6 C;  2QSF X;  1UM8 A;  2CRU A;  2ESN A;  5IT3 A;  2HKX A;  2KIS A;  2PJR A;  3S14 J;  1G4A E;  1JUM A;  2BW3 A;  2PMU A;  1DGH B;  3FD9 A;  4X0G A;  1R49 A;  3EPZ A;  3GLI A;  3SFI A;  3VPR A;  1A35 A;  1QQI A;  1RUO A;  4AD9 A;  3GEZ A;  1FSE A;  3A0B C;  4OIR F;  4O6J A;  5E6J A;  3QOD A;  3CCQ I;  1D0X A;  1YI2 I;  4DBG B;  2V22 B;  3BJ6 A;  3K10 A;  4C3H J;  1K4S A;  1RIO H;  2FOI C;  7CAT A;  3TNI B;  2BVM A;  1XTA A;  2FU4 A;  2Q0O A;  2KL4 A;  4GYG A;  2CFO A;  3PFY A;  1X19 A;  2K85 A;  3V76 A;  3CDH A;  3BCA A;  3BZ6 A;  5GAH J;  1EH6 A;  1V54 H;  3V8K A;  1BOA A;  3NDQ A;  2ECC A;  3LST A;  1XDU A;  4DYC A;  2CS3 A;  3K2A A;  1YS7 A;  2HDW A;  4YEL A;  1T43 A;  1C1K A;  4IO9 F;  4IRI A;  3E0J B;  2LOO A;  1Y0U A;  1E32 A;  3GLF A;  3L25 A;  1R4N B;  2WSF F;  3HHT B;  1R71 A;  3MKY B;  4BQN A;  2V6C A;  5CEI B;  4M9S A;  3M6A A;  3HC7 A;  1YTY A;  3OMY A;  4MFD A;  3S1M J;  2VJ5 A;  4F7J B;  1R1V A;  3GLG E;  1KQ8 A;  9ANT A;  1Y8G A;  1WZ2 A;  5FKM A;  3CUQ A;  4P16 A;  2EA4 A;  4ELL A;  3CF6 E;  2OTJ I;  1BIB A;  1JB0 F;  3AJI B;  2VBW A;  4MFE A;  5FFZ A;  1QUT A;  3FTD A;  2KDO A;  2MD5 A;  3A0H C;  1WJC A;  2J5P A;  2FBH A;  3ABL H;  2DFF A;  2JVG A;  4QIW N;  2P8T A;  4B3M M;  3H35 A;  4IBK A;  2UZE B;  5H6Q A;  1BC7 C;  1OAO C;  1UST A;  3MN2 A;  4AWX B;  4OB3 B;  1WGL A;  1S7O A;  2KRF A;  3HTU A;  2DAG A;  3FXO A;  2I7P A;  1O57 A;  2O3F A;  3G1M A;  2WV1 A;  4UV9 A;  5HDN A;  1E94 E;  2EIM H;  3DOA A;  3ONQ A;  2BYV E;  1GUU A;  5BPD A;  3U6S A;  3Q8G A;  3RGF B;  4FCV A;  3F6V A;  2CW0 F;  2O25 A;  4Y33 A;  1HBX G;  3VYH B;  2DMQ A;  1H9G A;  2D45 A;  1X58 A;  2OUM A;  1KON A;  3BOS A;  2DA5 A;  1UJ8 A;  2AQF A;  3FWE A;  3AKZ A;  4ZYE A;  5LHH A;  3JRE A;  3O8G A;  3L28 A;  4M3G A;  2EZL A;  4R71 A;  3F8M A;  4MTD A;  1N4M A;  3B7Q A;  3BCB A;  4BCH B;  2QF7 A;  3C1D A;  1JSU B;  4B8X A;  4I5S A;  1MBG A;  3HOY J;  5FSW A;  1C9B A;  3CJN A;  5F08 A;  1QQW A;  2A05 A;  3WE3 A;  4CIC A;  3H36 A;  4N4N B;  3TP0 A;  3L27 A;  3K70 D;  3E6C C;  4PCQ A;  1Q39 A;  4JX5 A;  1D0M A;  4YIF A;  4IOA F;  1GXQ A;  4D9J A;  4L5E A;  3FXU A;  2HYG D;  4II2 A;  4D1Q A;  3SEQ A;  4LIU A;  1WPK A;  4UY8 I;  1WFX A;  4NXN M;  3F3X A;  4MLO A;  4LFC M;  2OCC H;  2LY1 A;  3DV8 A;  1ZG1 A;  2ZPG B;  4E70 A;  1OCC H;  2YU9 J;  4MM3 B;  1ZKG A;  4BHB A;  3BR6 A;  1QPM A;  1OYY A;  3MZY A;  3PO3 S;  3M7G A;  3VFZ A;  2WPA B;  1MSF C;  2C9C A;  2LHG A;  3DPU A;  3PUF A;  3SC3 A;  4IHW A;  3LQQ A;  1WIV A;  4X62 M;  2CFX A;  3W2V A;  1BL0 A;  2YU3 A;  3NRV A;  3BLQ B;  3BP8 A;  3WVE B;  4I8O A;  4EV0 A;  2EZH A;  3CME I;  1TLH B;  2DXB B;  1XNQ M;  1GVD A;  4LJ4 A;  3HWS A;  3LSK A;  5E1Z B;  4EMS A;  1SD6 A;  4BEH B;  4IRH A;  1VQ6 I;  5D5X B;  4IBD A;  2NVQ J;  2KA6 B;  1MDM B;  2IS2 A;  2WIH B;  1KU3 A;  4IBG A;  1IXS A;  4AW4 A;  1P7I A;  4QNR A;  4RGR A;  5D6F A;  2DEN A;  2A6E F;  2K4B A;  2M0M A;  5EYR A;  5JR3 A;  3U1D A;  2HPM A;  4BDZ A;  1N78 A;  3IWF A;  4XSZ F;  4QNM A;  5DD4 A;  2DTR A;  5E1X A;  3JRD A;  3CDL A;  2V6Z M;  4RLQ A;  1YQA A;  5J47 A;  2ISY A;  2DXI A;  1W36 D;  3J7A S;  1ETX A;  2HKJ A;  1Y8Q B;  2NS7 A;  3G3Z A;  2I7N A;  3GLH B;  3LWF A;  3KZY A;  3M07 A;  3ZMU A;  1G6N A;  1SD4 A;  4AVP A;  4HDU A;  2O7O A;  1I50 J;  3I55 I;  4C30 A;  1NK2 P;  1MMG A;  4BBR J;  2B9R A;  2QEX I;  1W4M A;  2NVX J;  1MZB A;  2VXZ A;  2R5Y B;  1FKM A;  3LAJ A;  4M0W A;  1OGU B;  4NSO B;  5IYD J;  2IA2 A;  1Q02 A;  4A3G J;  3MD2 A;  4D5F A;  1XHB A;  4MGH A;  3AV0 A;  4KHP M;  2PG4 A;  2F5P A;  3FUU A;  3I9V 2;  4F93 B;  3OYN A;  3SZT A;  1J5Y A;  5F04 A;  5DCM A;  4CFM B;  3E7L A;  1NY5 A;  1YJ9 I;  2KXE A;  2LVS A;  1YSY A;  2ZCF B;  2ZTC A;  4TV7 A;  3E6B A;  4MH0 E;  3OS0 A;  2KRU A;  2XKO A;  5CKT A;  4ZYG A;  2Y75 A;  4F2L A;  5K5Q A;  3DTI A;  4RGS A;  3TNW B;  3JR9 A;  1Y8R B;  1XSD A;  3X24 B;  4ZDP A;  1SFU A;  3S93 A;  4M74 A;  1ZMV A;  4AKG A;  4BE0 A;  2GNO A;  3J80 S;  1TR8 A;  1IV8 A;  1YLF A;  4LG2 A;  3ASO H;  4NC7 A;  3JRH A;  3GYH X;  4RF1 A;  1WWX A;  2CSO A;  5HNB B;  1YLA A;  2X49 A;  1Z77 A;  1UNG D;  3IWZ A;  3J7Z I;  2ZPF B;  4DUY M;  2PFB A;  3GTO J;  2OQG A;  3GTP J;  1D0K A;  1RU3 A;  1OMI A;  3H5A A;  4U88 A;  1ETW A;  1OIY B;  2XGX A;  1HQY E;  5F3W A;  2E7X A;  5L3B A;  4LOC A;  1O3Q A;  3QXE B;  2C5V B;  1Y6I A;  1SXJ B;  3IHU A;  4GHA A;  4IXA A;  3RZO J;  4AG5 A;  2JGZ B;  3L1P A;  2WAQ N;  2CQK A;  5J1U A;  4G8X A;  3VYU B;  3COA C;  2WB1 N;  1QZM A;  1J09 A;  2QHO B;  2L7M P;  5DDG A;  4G7O F;  2BHY A;  3U21 A;  1YIJ I;  2DMU A;  4Y28 F;  3NWS A;  2M60 A;  3SYT A;  1NVM A;  4BDY A;  4F1I A;  3AG3 H;  2CZ1 B;  1Z1D A;  5M5Y J;  2W25 A;  2DJN A;  3IG8 A;  3ABT A;  3HJQ A;  1PGY A;  2XPV A;  2YR2 A;  3L00 A;  4GKJ M;  3ZMD A;  3HL2 A;  4IX7 A;  1LQ1 A;  2L4F A;  4A93 J;  4FWH A;  3RPU A;  5HNF A;  2MAB A;  4GHL A;  1TTY A;  3ZRG A;  2RKH A;  5KHD A;  4I76 A;  3TNH B;  4LCB A;  3IV5 A;  3FHZ A;  2V9V A;  4ELJ A;  2HTJ A;  3H3U A;  2H09 A;  5B1B H;  4YHH M;  3U61 B;  2XKP A;  4DV1 M;  3HOV J;  2VOP A;  1EH7 A;  2ELK A;  5D4S A;  2BJV A;  2VF7 A;  4I0A A;  1MH3 A;  3CGW A;  2PJP A;  3QU3 A;  2CZ6 B;  4EOJ B;  2F5E A;  1WQ2 A;  4M3F A;  1IRG A;  2OTL I;  1D0Z A;  4J00 A;  4A3D J;  1R5G A;  1K83 J;  2ELJ A;  4YFX F;  1A31 A;  1LUJ B;  2DCE A;  3KHI A;  1XMA A;  3BY6 A;  1B9M A;  3DTO A;  5EZG A;  3EYY A;  3GQ3 A;  2B0L A;  4OVZ A;  1MBH A;  2Y20 A;  4RAZ A;  1LPQ A;  1MNE A;  2KW0 A;  2JWT A;  1EIJ A;  2RV8 A;  3KP1 E;  4Y52 J;  4OB1 B;  1ERD A;  3OR2 C;  1HC8 A;  3B6A A;  2W4S A;  4RS8 A;  5BOX A;  5EP3 A;  3I4Y A;  2ID3 A;  1BJA A;  3KEY A;  5LMN M;  2VPR A;  4CYC A;  1ETO A;  1GT0 C;  2ZPE B;  3B9P A;  1K3W A;  3K69 A;  4KJZ A;  1KU7 A;  5FRM A;  1MX0 A;  3X28 B;  2NOJ B;  1FZP B;  1W7P D;  2JN6 A;  5BNG A;  1BC8 C;  3MQ0 A;  2JXN A;  3HO8 A;  2CJJ A;  2R46 A;  4CXF A;  2VAS A;  3S15 J;  3W2W A;  4A0Y A;  1WJB A;  3DZD A;  4J01 A;  1QVU A;  1KQ9 A;  2V1X A;  2L7I A;  4Y15 A;  1O9K B;  2BXZ A;  2R7W A;  2DMN A;  4XR6 A;  3DFZ A;  3VOE A;  4JBA A;  2HDD A;  2LRE A;  1YHQ I;  3QPH A;  1U9O A;  3FRI A;  4QOS A;  2NS0 A;  2W24 A;  2RGV A;  5E1W A;  1N33 M;  1YRN B;  3TN8 B;  4C9Y A;  1QVR A;  5HS9 A;  4BE2 A;  2IXS A;  1TH4 A;  5KK1 A;  3UKG A;  5DFL A;  3HHX A;  1QLB A;  5GP9 A;  3QYG B;  4XLP F;  4A6E A;  1U2W A;  1POG A;  4C2U A;  2QUF A;  3RI4 A;  1RRJ A;  2CUE A;  3E97 A;  2K02 A;  4KIG A;  1G4D A;  4DV0 M;  1OKV B;  3QZ9 B;  1MND A;  1MJG M;  2GAU A;  5ED4 A;  3PFI A;  4IBI A;  4XLA A;  4U0V A;  2Z99 A;  2M2E A;  4NQW B;  2MD0 A;  2OQR A;  2LBC A;  1L0O C;  2BWE A;  2EJS A;  3ZXS A;  2FJ1 A;  2HU9 A;  3L2U A;  3K1P A;  4LIT A;  4R3D A;  2V1N A;  3HGY A;  5F0F A;  5ICF A;  5FTL A;  3FUX A;  3CMM A;  5IYC J;  3G6E I;  3HY5 A;  3KET A;  1V29 B;  4XID A;  3IH3 A;  3CF0 A;  4MGR A;  1X2N A;  3TBI A;  3BPX A;  4L9N A;  3DBL B;  1GJT A;  4P55 A;  2C9O A;  2KJC A;  4PUS A;  1FC3 A;  1E2X A;  2P5L C;  3I58 A;  2E1M C;  3IP4 B;  2WZJ A;  2VQL A;  3H1C A;  2Q8K A;  3D1N I;  1JHF A;  3W0F A;  3FM5 A;  2ZZD B;  2L01 A;  1FOY A;  3TWM A;  1Z5A A;  2TDX A;  3B7Z A;  1LFB A;  2M4G A;  4MHG A;  5DUI A;  4G6L B;  1UEL B;  2JRT A;  2G5G X;  3MMP A;  3E1S A;  4KIB A;  4DNC A;  1GDT A;  4BCM D;  4FWG A;  1P2F A;  3P9K A;  1QA6 A;  1VQN I;  5GAG J;  3EOC B;  3CCM I;  5TRD A;  1JKP C;  3M8F A;  1R2Z A;  2EKK A;  1IY2 A;  1MMN A;  2XAU A;  3KEO A;  1LB2 A;  4II5 B;  2A61 A;  3RE8 A;  4P9U A;  2IS1 A;  2NNY A;  1DO2 A;  1IV6 A;  2WB1 A;  3KEQ A;  4ZTJ A;  2C5X B;  4RB0 A;  2DQL A;  2AXT C;  1MN3 A;  2DYS H;  3X2Q H;  5K7H A;  5HDG A;  2DU9 A;  4GO1 A;  2BVL A;  2V9P A;  4LG3 A;  4OOI A;  2A5Y B;  3ABK H;  3CC2 I;  2ZCW A;  3DPT A;  2FSW A;  2R7S A;  4G9Y A;  1SXJ E;  3EUH A;  1JGG A;  3K4K A;  2C4G B;  4F7N B;  2QP9 X;  1KFV A;  1MJA A;  1L2C A;  3GZ5 A;  4KN4 X;  1DU0 A;  3M3Y J;  2ZME C;  1BW5 A;  2Z5U A;  2K5C A;  4CRL B;  3VK8 A;  3LVW A;  4IBF A;  2V6E A;  3HGG A;  2OV7 A;  3LSJ A;  5IHY A;  4B7G A;  4GEW A;  4ON0 A;  3QU6 A;  3RDI A;  4R1H A;  1F36 A;  2F5C A;  1ZEL A;  3WU0 A;  3QHR B;  4PJN A;  1E9H B;  1SVL A;  3GW2 A;  2O8K A;  1D2N A;  2JA7 J;  3A8G B;  3PSF A;  1ON2 A;  2ZFW A;  3FK6 A;  4YIR X;  3IC7 A;  3H0G J;  3ZQQ A;  4OWR B;  1WR1 B;  2CW7 A;  1IM2 A;  1VDL A;  4PSW A;  2ZJP F;  2Y9Z A;  2QSH X;  5FGM A;  4CXA B;  3OYL A;  2QBY A;  2W7N A;  3JRI A;  1HQC A;  3ELK A;  3FXK A;  1Z7L A;  4GXO A;  3GPU A;  2LTP A;  4S05 A;  5EJC A;  1DV0 A;  3MKL A;  1LV7 A;  4KIC A;  3LQ5 B;  1OTR A;  2DZL A;  3GRV A;  2R6F A;  3HU2 A;  1LDJ A;  3JRG A;  2LKX A;  2NQ8 C;  2IS4 A;  3GVA A;  2X51 A;  2MLG A;  3KLO A;  2HS5 A;  3L09 A;  1DUX C;  2UZD B;  5DQV A;  2QPA A;  5BMZ A;  1NJF A;  3CCV I;  1T3T A;  4L9V A;  3KS4 A;  1HNX M;  2ACJ A;  4F70 B;  2FQ3 A;  1OCT C;  2ELH A;  1Z5B A;  4FHT A;  5CJ9 A;  2A3S A;  1T56 A;  2VBY A;  2O61 A;  1ZGJ A;  4YOO A;  1E0E A;  1UGS B;  5EXX A;  2YUS A;  2OQ4 A;  1X4O A;  4DR2 M;  1V5F A;  2EV6 A;  4IJF A;  2W9Z A;  3OL3 A;  3BC8 A;  3HHG A;  1JT0 A;  2CZ7 B;  3R4K A;  2KIM A;  3EIH A;  4U7B A;  1I3Q J;  1VQ4 I;  3LFU A;  4ZYH A;  1ZMW A;  4JI7 M;  3GO8 A;  5FKN A;  4KIS A;  3LQR A;  4NL4 H;  4E4H A;  5CQE A;  3F8N A;  2EQR A;  4NB5 A;  3SAW A;  4DR3 M;  3KCC A;  5CYI B;  2DHY A;  4D82 A;  2VQE M;  1UG0 A;  2YSR A;  3MJ5 A;  1KSF X;  1ON1 A;  3UNG C;  4FTH A;  3OR1 C;  2XAQ A;  3U5Z B;  4LF4 M;  1ONV A;  3K4L A;  3J7Y J;  2PQ8 A;  2UZL B;  2QCU A;  2BE5 F;  3DBH B;  3DTE A;  2CW8 A;  4XLH A;  2K3P A;  2DZN B;  2E36 A;  2Z3Y A;  3K1N A;  3GRU A;  4XLF A;  4CCJ A;  2PLY A;  1GVN A;  4AYB A;  1WSU A;  2QFZ A;  2P5K A;  1OKS A;  2J5O A;  3T8R A;  3L2V A;  1QZE A;  2MYS A;  2K4J A;  2VXD A;  2ZFU A;  3CMY A;  5FLV A;  3BLH B;  3BDD A;  3WHB A;  4XRM A;  5EXS A;  3KP7 A;  3OIP A;  1BI1 A;  2P4W A;  3HM5 A;  1FBU A;  2WSE F;  1G3S A;  1X1C A;  1X1B A;  1HXD A;  5D4R A;  2GA1 A;  1V33 A;  1NJG A;  1AHJ B;  2LVP C;  3GBG A;  4I02 A;  2LW4 A;  3QOE A;  1ZGW A;  3OYH A;  3NQO A;  1EFU B;  5HS7 A;  4G3O A;  5HBH B;  2KIF A;  2GOM A;  2CO5 A;  2DA3 A;  3SDG A;  4M9X A;  1OPC A;  2COB A;  4R79 A;  5HNH A;  2FRH A;  1WJ5 A;  3LSR A;  4UN2 B;  2KT0 A;  1AA7 A;  2OPF A;  2LR8 A;  5LBQ A;  2RNG A;  3GCM A;  4F6W B;  1HKS A;  5D8K B;  4LJ8 A;  5E3L A;  1OYW A;  4MGY E;  2LH9 A;  3VDX A;  1W0U A;  3SMP A;  3SMS A;  3I64 A;  4II3 A;  3V7C A;  3VOD A;  1JI8 A;  1VQP I;  3LW5 F;  4FCY A;  1JKR C;  4BCN B;  2CUF A;  2LK2 A;  1CF7 B;  1MNM C;  1XMQ M;  2O8X A;  1TL8 A;  3GLG B;  4GCV A;  4BCP B;  4XMY A;  3K7A J;  3PL8 A;  2L4A A;  3UK6 A;  2WAF A;  3HXL A;  3HB9 A;  5J1R A;  2K9Q A;  1JUS A;  3N05 A;  5EEG A;  3BR2 A;  2WMA B;  5LFA A;  2VI6 A;  4H0E A;  3KOY E;  1ENW A;  4N4O B;  3GFL A;  2KDL A;  2LY9 A;  4A3V B;  1KU2 A;  3QP6 A;  3WTY C;  2R4G A;  2DPP B;  3DBR B;  1JQJ C;  3H9J A;  1EJ9 A;  3LOC A;  1OCP A;  3PSI A;  5FJ8 J;  3I5U A;  4C3J J;  3D8L A;  3SAT A;  1TQP A;  3TO9 A;  1UMQ A;  3DQV C;  5HOO A;  1A5J A;  1YO5 C;  1DGB A;  3S1R J;  3HKP A;  5D6E A;  2WMB B;  3MZ8 A;  1GV5 A;  5K5O A;  4GC5 A;  2DT5 A;  1PJT A;  4DV5 M;  3FF5 A;  2UUB M;  3ZQG A;  2R7Q A;  4EM1 A;  4LLN A;  1E3P A;  1YUB A;  1LVK A;  2EH3 A;  2HQA A;  1XS9 A;  4L9T A;  2PMH A;  3I59 B;  4EOP B;  1H8A C;  4YEJ A;  2HQN A;  2F5O A;  2KQR A;  3BTJ A;  2A07 F;  1ZP2 A;  2NVY J;  3VSL A;  4UHT A;  4M72 A;  5F1R A;  5F1J A;  3RKQ A;  3M8E A;  3ZC7 B;  1G8P A;  2RGO A;  4Q47 A;  2DME A;  3LMM A;  3FM3 A;  1QZY A;  2CYZ B;  4FW9 A;  3AOG A;  3LA3 A;  5FKO A;  3H5N A;  4M73 A;  2VC1 A;  2PJQ A;  5FTJ A;  1ZYR F;  4R8H A;  3MEX A;  4MEX F;  1K7A A;  2KZU A;  2DWN A;  1S29 A;  4MQV A;  4A3F J;  2MR9 A;  2MC4 A;  2MGQ A;  3TW7 A;  5K7Z A;  2XDV A;  2F5Q A;  1FTZ A;  3RYR A;  2XPU A;  2CE7 A;  2LVA A;  4DW6 A;  4CCK A;  4LFA M;  2YR0 A;  4WXD A;  3T1Y M;  3C18 A;  5IT9 K;  2YPR A;  2QA4 I;  4ZZL A;  1GH6 B;  5CYV A;  1LE8 B;  2OZ6 A;  5CPR B;  1H9T A;  2DNA A;  3TE6 A;  4FET A;  1RKW A;  4IEJ A;  4FD2 A;  4L4U A;  3GFJ A;  5HOD A;  1X4P A;  3M1C A;  3HSE A;  2K47 A;  3WTW C;  1QNT A;  3CDI A;  4QSH A;  2UXB M;  3GQ5 A;  2X8A A;  3S8P A;  5B3S H;  4BCI B;  4LG0 B;  4F7L B;  3CLQ A;  5IOZ A;  4XIC A;  2XHK A;  3NBI A;  3DWL E;  3O0G D;  1F4I A;  4EOM B;  4ABZ A;  1DGR M;  5IP7 J;  3E9S A;  4HYE A;  5HLH A;  5FLX Z;  1O7L A;  3HU1 A;  2ICW G;  2KFD A;  3KW6 A;  2VT3 A;  5IYB J;  3L2R A;  1TP4 A;  4XN3 A;  1Z6T A;  4Z2Y A;  4QTR A;  1W0T A;  1MW7 A;  5M3M J;  4AIH A;  4RB3 C;  4HF2 A;  4IKF A;  2VOO A;  2DN0 A;  3H4C A;  1QYR A;  2Z8Y M;  3ABU A;  4J19 A;  3ZP5 A;  3K4N A;  1IAW A;  1XWI A;  3VYR B;  4DR7 M;  2R3S A;  2EV0 A;  2BGC A;  2LDU A;  2M0C A;  5DCM B;  3GPY A;  1MBF A;  3JRC A;  3QPT A;  2H1K A;  3WVD B;  4BBS M;  2X6Y A;  4BCQ B;  1WKM A;  1CUK A;  2FH0 A;  1XXH A;  1Z3Y A;  5HLI A;  1P5E B;  5JHF A;  3PNV A;  3HHY A;  3B74 A;  3RTR A;  1Z9C A;  4CFV B;  4N9H A;  1MMD A;  5HS8 A;  4LGW A;  1EV7 A;  1URC B;  3BHU B;  3KXE C;  3HHW A;  2FF4 A;  3EID B;  1JJ8 C;  4B3S M;  2XEP A;  3KYD B;  4A2U A;  3ECO A;  1FX7 A;  3FMQ A;  1DGW Y;  4HOB A;  1H0M A;  1QPI A;  2M30 A;  4DYR A;  5BQT A;  3I51 A;  2Z16 A;  4RDU A;  2C6Y A;  4H4K C;  4MQ9 F;  4I3Z B;  2ZBK B;  4GRI A;  1DGF A;  3NAR A;  4Y3O A;  2HOT A;  2FEZ A;  3A8M B;  4PJJ A;  2ZAM A;  1QAN A;  1EKE A;  2ZME A;  2ZO4 A;  3G2B A;  1YFH A;  1S6L A;  3E4R A;  3HRS A;  5CVR A;  4XBF A;  4YFN F;  4IBJ A;  2BY3 A;  1IXR C;  1IXS B;  2FA5 A;  3T0Y A;  2E1C A;  2Y21 A;  2CCH B;  2Y30 A;  5D5V B;  1MDM A;  4HX8 A;  4UN0 A;  3FZV A;  1ORK A;  3KOW E;  2O0Y A;  2QZ8 A;  2HVS A;  1PYV A;  3T8T A;  4JI4 M;  1MKM A;  2ZXI A;  3L2C A;  2EFQ A;  4BQQ A;  3WHL A;  4U0W A;  2D7H A;  5LMU M;  2WC2 A;  4XM3 A;  5CQG A;  3MY5 B;  1QDT A;  1JT6 A;  3B57 A;  2EIJ H;  1BIA A;  4NNJ A;  2LC2 A;  4PT5 A;  1BOB A;  1R00 A;  4P17 A;  2GQF A;  2KEB A;  1XSV A;  3VFD A;  1Q3C A;  1D1A A;  3F8C A;  5H37 D;  3P9I A;  3BTL A;  4F7Z A;  1HF0 A;  2MC3 A;  3GRY A;  5IRE B;  1H28 B;  2DDB A;  5B66 C;  1BN5 A;  2MLK A;  1L3L A;  4L5I A;  3AL0 C;  3F92 A;  2G0E A;  3U2R A;  3QYH B;  3ZMZ A;  2VB6 A;  1TQM A;  4BCM B;  1T0F C;  5EF6 A;  3FKE A;  3ZCB B;  1HKQ A;  4UVA A;  2HAK A;  1V55 H;  5ITT A;  2E5L M;  5LRS A;  2IN3 A;  4KO8 A;  3BTI A;  1VQ7 I;  3GXO A;  5TJJ A;  3Q8X A;  4HNT A;  5J1Y A;  1XPX A;  2UXD M;  5B1A H;  2O01 F;  1H4L D;  3BG3 A;  1QAQ A;  2KIU A;  4G12 A;  5E20 A;  4EEF G;  4IBE A;  3U6C A;  1Q1H A;  3ESW B;  4M6Y A;  4PGH A;  2VQH A;  1HNZ M;  1IDY A;  1IGN A;  4I09 A;  2H27 A;  3CF5 F;  2F4O B;  2JPC A;  2DPU A;  3LA7 A;  5EZH A;  3KP0 E;  3PNY A;  1VYW B;  1VND A;  1YW8 A;  3FBN B;  2MH2 A;  4M3D A;  1UFZ A;  3K4B A;  2ID6 A;  3G4S I;  1IN4 A;  1B8I A;  2CG4 A;  3DJB A;  2WY8 Q;  2AHM A;  4Z8X A;  2CHG A;  2HQ5 A;  4PSX A;  3TP3 A;  1V92 A;  1OCO H;  3QHW B;  3Q0V A;  2CUJ A;  3QAH A;  3K0L A;  4D7M A;  1B1B A;  2R7V A;  4Y72 B;  1YX3 A;  5KPR A;  4OMY A;  3KE2 A;  1G71 A;  4C2M J;  1OIS A;  2E1M B;  5ERI A;  3JAM K;  3WU1 B;  4EIW A;  5J4Y A;  1A6I A;  3ZOB A;  2K27 A;  4RGX A;  3RSN A;  2XF6 A;  3F5X B;  4LD5 A;  1UZC A;  3ZGK A;  4UUT A;  2KP6 A;  4AKI A;  5DTD A;  2DTZ A;  3OYE A;  4EGY A;  1Z59 A;  2XZU A;  3UMM A;  4Q48 A;  2HEO A;  2PK9 B;  4B3A A;  5H6R A;  2JZ0 A;  3E6M A;  4BAY A;  2L4M A;  2CWB A;  2C96 A;  3AG1 H;  1B59 A;  4G6T B;  4F91 B;  1A04 A;  2HTS A;  3JRA A;  2LVN C;  4RBO A;  1T6S A;  3BJA A;  3PQK A;  3U60 A;  1SFX A;  5E3M A;  3MK6 A;  3KZZ A;  4LY6 A;  2RN7 A;  2GXA A;  3RYP A;  1FIN B;  2RRE A;  2EBI A;  3GZ6 A;  1ZRE A;  4EOR B;  2QQ8 A;  2EFO A;  2UUC M;  4XBO A;  2DJI A;  3ZN0 A;  5EP1 A;  5EP4 A;  3S1N J;  1IN8 A;  1IRZ A;  1TH3 A;  4HL4 A;  3HDD A;  1K61 A;  5IZ7 D;  3PNT A;  2R7T A;  4GH9 A;  3KP2 A;  2GIZ A;  5LGT A;  4A3C J;  2M3A A;  2D2W A;  2DMT A;  2OBP A;  2VBX A;  5J4V A;  1NH3 A;  2OOA A;  2QCO A;  2VOD A;  2QZ4 A;  3IUO A;  3T38 A;  1TTE A;  1Q3B A;  5EQT A;  3BXW A;  1TWH J;  4ETS A;  1E3O C;  4YFK F;  1XMX A;  2M7A A;  2QM3 A;  2W84 A;  2WY7 Q;  3PQJ A;  1VEG A;  3HOW J;  2M45 A;  4OW0 A;  5JHU A;  1TZL A;  4B44 A;  3ERM A;  3O8H A;  4IHV A;  2C5O B;  1T38 A;  1NY6 A;  5L3G A;  4EOL B;  1HST A;  4WXC A;  3GLI B;  1OAI A;  2X9D A;  3WTU C;  1G2H A;  1XB2 B;  2GLO A;  3LVV A;  1R5I D;  1WCM J;  1TT5 B;  5KPT A;  3U60 B;  3BPV A;  2LBF A;  3L2W A;  3U6O A;  3U6Q A;  2X48 A;  2PJR B;  1VZ0 A;  4EJV A;  4B3X A;  2RQQ A;  2R7R A;  1S9H A;  4DV7 M;  1S3J A;  2ZJR F;  1D5V A;  3DF8 A;  5FLX K;  3I54 A;  2P7C B;  2R7D A;  1GXP A;  2P5T A;  3FXM A;  4D80 A;  2IRF G;  1IUF A;  2WA0 A;  1L1T A;  2UU9 M;  2LFB A;  2P81 A;  3OYC A;  4ENN A;  5FFX A;  2HXI A;  2W2H A;  2OPT A;  4L16 A;  1HJP A;  5JI3 E;  4B3T M;  1NV8 A;  2L7Z A;  3TO7 A;  2R5Y A;  4LF7 M;  2XAF A;  4A5N A;  4CFU D;  4G6Z A;  4OX9 M;  2QQA A;  1D0L A;  3AOE C;  4YOS A;  3X20 B;  3H4J A;  2PX9 A;  2YS9 A;  1UHM A;  5LMK B;  3VKG A;  3F21 A;  3G33 B;  1ZRD A;  1FNN A;  3GLH A;  2HI3 A;  1PUF B;  4IIW A;  2FUG 2;  1ETV A;  2DT7 B;  4PFO A;  2LHC A;  1D5Y A;  4OIO F;  2AQE A;  4REZ A;  5IP9 J;  2Y0S N;  4CO8 A;  1O3R A;  1B8I B;  1WHC A;  4I6Z A;  3FBI B;  2W57 A;  1OL2 B;  1SVO A;  3HTS B;  4NXM M;  2XGC A;  3IKV A;  3JAM S;  5EGO A;  5FTN A;  4DUZ M;  3R9X B;  3A1Y A;  2FNP A;  5LHI A;  3R0A A;  2W1O A;  5DM7 F;  4BCN D;  3CP2 A;  2JMW A;  2VQF M;  2C5R A;  2LF8 A;  1YW7 A;  1JKO C;  4S12 A;  4HAM A;  2DA4 A;  4HPQ A;  4RGU A;  4MGZ E;  1IBK M;  1W7P A;  2X4H A;  2JA6 J;  2DFE A;  2JUG A;  1O3S A;  3SBJ A;  3Q0U A;  5FLM J;  3GTG J;  2G7U A;  4N0B A;  1LEA A;  3C9P A;  4ENM A;  2HKO A;  2XSZ D;  2RRU A;  1WJF A;  2CJM B;  3ZR8 X;  2C98 A;  4PK4 A;  1NTC A;  1ODD A;  2LLK A;  3ASN H;  3HOU J;  2IBD A;  2JVH A;  4G6Q A;  4LIV A;  2R62 A;  3GFI A;  1UCR A;  1TBX A;  1NHG C;  3FMR A;  3HOS A;  1V3F A;  3AAF A;  3P7N A;  2ME6 A;  4KT0 F;  1ZQ9 A;  1NSF A;  1R6B X;  4GIP A;  5FLX S;  3QP5 A;  3WTT C;  2R0I A;  2TRT A;  4JP0 A;  5FRN A;  1MIJ A;  2K9M A;  2MW8 A;  4BKX A;  3SHG B;  1T6O A;  3CQZ J;  1SFE A;  5J8C A;  3S3O A;  2LY2 A;  1OQY A;  4Y17 A;  1P3Q Q;  3PUB A;  4QLC U;  4JXJ A;  3F8B A;  3RCO A;  3KYC B;  5EGO B;  1I6X A;  1H25 B;  4ZPX A;  2C5N B;  3FUW A;  4B1R A;  3G1O A;  1RI7 A;  3NBX X;  4D81 A;  1UNL D;  4IJA A;  3REO A;  4JN6 A;  3QZ5 B;  1L2B A;  3SAR A;  4DV6 M;  3F8F A;  1DGG A;  1X3W B;  2IGN A;  3HHH A;  4EAT A;  4PDK A;  2E71 A;  4L18 B;  4Q5S F;  3GME A;  1MH4 A;  3BQZ A;  2XIG A;  4IL6 C;  4HG2 A;  5HDK A;  4I2O A;  3VKH A;  5L8R F;  3EIE A;  4X65 M;  3CC4 I;  1BI0 A;  2L02 A;  3PM1 A;  4FQG A;  3V7R A;  5D5U B;  2X1D A;  2Y2Z A;  2F5V A;  4Q4Z F;  1FP1 D;  3L7W A;  4FAS D;  2LTU A;  1V4R A;  2BS4 A;  3LCV B;  4GKK M;  3Q3S A;  1MMS A;  1OJL A;  4UV8 A;  4GIT A;  2D7G A;  1X1A A;  5DM6 F;  2UXN A;  2DI0 A;  4G4O A;  1MD0 A;  5ILU A;  1GLN A;  1DPU A;  5M5W J;  4XLE A;  2DHR A;  2JPB A;  1OLT A;  2RC4 A;  4AZF A;  3E5Q A;  2R7O A;  3FKJ A;  2LBF B;  2K9S A;  3RIR A;  3SXY A;  4MIM A;  3U6P A;  2LYC A;  2A6H F;  3U1K A;  3GRR A;  3L29 A;  3FK7 A;  3WOD F;  4CCN A;  4G6D A;  1JUP A;  3Q0W A;  5ICC A;  3PO3 J;  1OIP A;  1W1W E;  3Q5F A;  1S7A A;  4MEY F;  2V4J C;  2IVM A;  4KYW A;  2B3T A;  4ESB A;  1LDK B;  2BZT A;  4P96 A;  2IS6 A;  4XRF A;  4NSR A;  1QVT A;  1QGP A;  2W99 A;  2CQQ A;  4LG0 A;  2GM4 A;  2R4E A;  1TH2 A;  3MI9 B;  5DS9 A; 
#chains in the Genus database with same CATH homology
 4QSH A;  2ZPI B;  2CZ1 B;  2ZPG B;  4ZGD B;  3HZJ A;  3A8O B;  4ZGJ B;  2DXC B;  1AHJ B;  4ELJ A;  4JX6 A;  3WVE B;  2DXB B;  1UGR B;  2CZ6 B;  3H4C A;  2ZPB B;  2KR6 A;  3X26 B;  4AKI A;  3KHI A;  2BS3 A;  4OB2 B;  4HLQ A;  2QDJ A;  4HNV A;  3WVD B;  3QYE A;  4BBS M;  2DD5 B;  4AKH A;  4OB1 B;  2QDY B;  2G77 A;  3TW6 A;  2DD4 B;  3QWL A;  3QYB A;  3A8G B;  2ZPE B;  4ZGE B;  3HB9 A;  3X28 B;  4JX4 A;  2QQ8 A;  4Z6Y A;  2KMG A;  3HO8 A;  4AI6 A;  1UGP B;  4HL4 A;  3HHT B;  4M6V A;  2BS2 A;  1FKM A;  2DPP B;  4MFD A;  4HNU A;  2QFZ A;  3A8M B;  5EJC A;  4BBR M;  2ZPH B;  4FM4 B;  3QZ5 B;  2AHJ B;  4MFE A;  1QLB A;  3QYG B;  2ZCF B;  3VKH A;  3QZ9 B;  4OB3 B;  4P17 A;  4OB0 B;  3A8L B;  3X24 B;  1UGQ B;  1UGS B;  4AKG A;  2CYZ B;  2BS4 A;  3HBL A;  2CZ7 B;  3VYH B;  1IRE B;  1V29 B;  3QYH B;  2ZPF B;  3BG9 A;  3DL1 A;  4LOC A;  3TW7 A;  3QXE B;  4MIM A;  4HNT A;  3X20 B;  2QF7 A;  3BG3 A;  1E7P A;  3VKG A;  2CZ0 B;  3VYG B;  2D0Q B;  4JX5 A;  2ZZD B;  3X25 B;  3BG5 A;  2WJ9 A;  4NC6 A;  3A8H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...