4NC6A

Tbc domain of human rab gtpase-activating protein 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
ETWGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase activator
molecule keywords Rab GTPase-activating protein 1
publication title Tbc domain of human rab gtpase-activating protein 1
rcsb
source organism Homo sapiens
total genus 113
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4nc6A02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 4nc6A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4nc6A03
3QWLA 3QYEA 2G77A 3QYBA 2QFZA 2QQ8A 1FKMA 3HZJA 4HLQA 4P17A 4NC6A 4Z6YA 5EJCA 4HL4A
chains in the Genus database with same CATH superfamily
1LVAA 1V29B 1JR3A 2AHMA 3F3XA 3WHKA 2OUMA 4RGXA 1VG5A 5K5OA 5GKNA 4NDLA 1OKVB 4OWRB 1XGNA 2LVQD 4EC8B 3WG7H 3P9IA 2UUZA 4F92B 1S7AA 1WGNA 2KKOA 2LBCA 1F4IA 3A02A 2MH8A 4YY3M 3S1RJ 2W9ZA 4QNMA 1JGSA 1KU9A 1TP4A 2UXNA 4CHUA 3K1JA 4GH9A 1G3SA 3V4GA 4XICA 3NEUA 1C9BA 1G6NA 4FT8A 4PCQA 3HOXJ 2W00A 1X1PA 2UZLB 4YOSA 1V55H 1IJWC 3S1MJ 1OI9B 2LVOC 5CVVA 1Z7UA 3OWTA 4CZCA 1LV7A 1X1BA 1TWHJ 3CDLA 1OCZH 1PYVA 3GW2A 4S0HB 3LQRA 4BLCA 1D0KA 3BCAA 3RTRA 3EIHA 1OFCX 4BQNA 2DZLA 3ECOA 1XXHA 3L2VA 2X48A 2K0BX 4CZZA 4JI4M 2Q2EA 1H4LD 3VLFB 1O57A 1TWFJ 5DYMA 1MIJA 2A61A 2VC1A 5M5WJ 1NVMA 5ED4A 3E1SA 4KDPA 2Z4SA 2CU7A 3JTHA 4DV5M 2VQGA 5IY5H 1O9KA 4WW0A 4BY1J 4ZZDA 2STWA 4ELJA 1CF7A 2IEKA 4PJLA 2UUBM 2ADUA 1AA7A 2LVNC 4DR7M 5L3CA 1J9IA 4G6ZA 3U6PA 4AKGA 1WH5A 2E7XA 2DQLA 2KRHA 4U0VA 5DCMB 4YIRX 2A6HF 1H1PB 3LNQA 2MLKA 1QBJA 2XDVA 3GLIB 4BGDA 3RZDJ 1KQ8A 1SXJA 5DNYA 2DQRA 2P6TA 4Y7NJ 2BNKA 4X1EA 1LB2A 6PAXA 3GFIA 4MB7A 3I01M 2MR9A 4I09A 3QYBA 3DDQB 2O9LA 1D0MA 1Y8QB 4M73A 2X49A 3OSGA 3PO2J 2HZTA 1H24B 3F8CA 2L2OA 3QYEA 5BOXA 1FP2A 2V26A 5CJ9A 4LF5M 3GO8A 3H4JA 2F2CA 2HYFA 1PP7U 1AKHB 2ZPIB 3I4MJ 1DPUA 2WY7Q 4FX4A 1V33A 1SMYF 4KICA 1F5QB 3F8NA 3M4OJ 2FMYA 4CRLB 4ZTJA 1E2XA 1HW2A 2F5NA 1GKIA 1DGWY 5BS6A 1OTRA 1TQIA 3RQIA 5FD5A 2BZTA 1R9TJ 4AG5A 3ABTA 4N9IA 4EM2A 4K2EA 1WH7A 5TISC 1IG7A 1QHGA 2W7NA 1VYWB 4FX3B 4NOOB 4CJ6A 2HQAA 3GFLA 3U9GA 2M5ZA 1URCB 1VQ8I 2D1HA 4LB5A 4IO9F 4IOCF 2A68F 2PK9B 4A3GJ 2P6SA 4MGYE 4BHCA 3ASOH 2JA7J 2STTA 4L8RC 2G8LA 3CTAA 4KMUX 5LMKB 2MROB 1X19A 2ZPBB 1B8IB 5CYVA 4BCQD 4LF9M 5A2QK 5L3FA 4M9SA 4I4LA 2XAGA 4KISA 4TUWA 1J75A 5LGTA 3PO3J 2CHVA 5EDNA 1MNMC 4E4HA 5FLXK 3G33B 2HAKA 2QCUA 1Z6RA 4NQWA 3SAVA 3TO6A 1BW6A 3WGGA 4B3XA 5DUIA 1Z67A 4F91B 4WX9A 1KQ0A 4G4NA 2CQQA 1ZR2A 1DGRM 1Y1VJ 2OV7A 3WTUC 3FRHA 4Z8XA 1S6LA 2FX0A 1T6OA 4LIVA 1KU3A 2A05A 3B57A 5HOOA 4IBIA 3ZQJA 2DI3A 2G7UA 4CFMB 1K61A 5IF1B 1SXJE 4L15A 4LJ9A 2PMZN 2ZBKA 3DKXA 4IPAA 4MFDA 5FB2A 3BBZA 2IA0A 3GTJJ 3N97A 2XPWA 1ITYA 2GA1A 4EONB 1HSJA 3JRAA 3ABMH 3CP2A 3ABKH 5FKNA 4IF4A 2ID3A 3FMQA 1EE8A 2EUCA 2VQFM 2P7CB 1BBYA 3UJNA 2ZFUA 2CSOA 2DA7A 4QLCU 4NHJA 1SAUA 2XPVA 4XGIA 1IY1A 1TDZA 4XONA 1LJ9A 3TMOA 1RIOH 3GZ5A 2HQNA 3K1PA 1V54H 4Y17A 3QU6A 1P9QC 4JI5M 2R5YA 4IRGA 3C1DA 2R3SA 3EYYA 3PL8A 1U9NA 3H3UA 2BS4A 3DBHB 3U6LA 2DVWB 4UXNA 3BR3A 3DBRB 2JUJA 4DV4M 1OIPA 2VXDA 2PHGA 2DXCB 1VQMI 2XROA 2OO9A 3NARA 4F3QA 4NSOB 2DKLA 2AXLA 1XMKA 5E3NA 1DGBA 5EGOA 3G4SI 2CZ1B 3I4NJ 5L3EA 3HBLA 2BXZA 4F7LB 3HXLA 5F27A 4BDYA 2GQQA 4M0WA 2FXAA 2DN0A 1ETKA 1OYIA 1MW7A 2IA2A 1XHBA 1O7FA 2HOEA 2XAHA 1GJTA 2AS5F 4XRSA 2VKVA 5ILUA 3HGIA 1JUPA 4GEWA 4ITVA 4M3BA 1BM9A 1X1AA 2EFPA 4Q4ZF 4IHSA 4MLOA 5LHIA 3I5UA 3BROA 4QHTA 1UHMA 1U6GA 3QAHA 4HA8A 4MQVA 4MM3B 3J81K 3HHZA 3MKWB 3A8OB 3X25B 4LLLA 4CHTB 3VB2A 1E9SA 2ZKZA 3L27A 3ZC7B 4LZJA 2XH9A 1LE8B 3QAUA 3JRHA 4P9FA 3OOUA 4WP2A 2M87A 2XVCA 3EUHC 3K4LA 3KP5A 4M6YA 1YRNB 5EFQB 2EZIA 5DCFA 1IUFA 1OISA 1TWCJ 3CLOA 3WTZA 5HNFA 1HSTA 3HHGA 1N36M 3O8HA 3I0TA 1A35A 1QMZB 2Z5UA 1HBXG 2FF4A 4L78A 3S16J 2XSZA 3ZGKA 2MJ5B 1I94M 2LFBA 5ERIA 2DHYA 2OOBA 2F5PA 4HRIA 2LVAA 4LGWA 2CS3A 2R4GA 3J7AY 4EJVA 2OU2A 4XKVA 7CATA 5FJ8J 1GUXB 3OSFA 1WHUA 4IIWA 4NBQA 1H26B 2D7HA 1UNGD 4BEHB 3DL1A 2C99A 5GAHJ 2QPAA 1RESA 2KW0A 2PBIA 1GV2A 1A6QA 3L26A 1NJGA 3HU1A 2DYSH 2ZFWA 4A5MA 4G3OA 2HPIA 3HGGA 1MDMA 3VK7A 3VSLA 5LRSA 3NRVA 4BL0B 5D4RA 1W98B 3PFIA 1IY0A 3BC8A 3U6OA 4CFUB 4CIZA 4LK0F 3SFZA 1A36A 3MK6A 3M07A 2DMNA 1MX0A 1JOWA 1BA5A 3ILKA 3IECA 4AKIA 3H35A 2ZJRF 2H1KA 2VB6A 1DQUA 4UN0A 4LF8M 2QGUA 2H6BA 2JP7A 1UZCA 3CCSI 3EETA 1JSUB 2BJWA 1PJRA 4JQFA 4EOKB 3SC3A 2XSDC 4XORA 4YC3B 2CW0F 4N4OB 1R2ZA 2LVSA 2RDPA 3HHXA 3T38A 3R6SA 4RDUA 2IP2A 4LJ6A 3LSGA 3OYGA 4HF0A 4GRIA 3H36A 4XMYA 3OYHA 1QGPA 3RE8A 1N78A 1SC7A 3WTVC 5IYDJ 3KS4A 5CVRA 3EJ1B 2R65A 3RKXA 1VQ6I 3GBGA 1ON1A 1VQ9I 4OB3B 2MD5A 3S17J 4CO8A 1XD7A 3W68A 2Z3XA 2BBYA 1YE9A 3QPLA 4CXAB 2ZANA 3U6QA 1R6RA 4HW0A 1VDDA 3L28A 3Q3SA 5L3DA 2WSFF 2V9VA 3H9QA 2KISA 4HSTA 3JSOA 3HWSA 2OQGA 1XXHB 4XKBA 4D9JA 3JRCA 3OL3A 4UVBA 4MGRA 1R2YA 3FDYA 3CCMI 3ZPLA 4CGZA 4MEYF 3B74A 5CVUA 4AZFA 1GUXA 2LKSA 5HDGA 2RRUA 3J80S 3A4CA 1YX3A 1K3WA 2CE7A 2ZSIB 4XRSG 1M1EB 2NVYJ 4MHGA 3L2UA 2PLYA 1O9KB 4BBRM 3JAMS 4A6EA 1CF7B 2Y0TA 3BY6A 3WE3A 3ZCOA 1EIJA 4ESFA 2DA2A 5FO5A 4DOZA 3BOSA 2CV1A 1GVJA 2DFEA 2M3AA 2Q0OA 2VJ4A 1T38A 2D5VA 3PNYA 3FUUA 4I02A 3O6BB 4A3JJ 1IRFA 4AC0A 2DPDA 1SXJB 3EIEA 1BI2A 4WURA 4J00A 1ERDA 3A98B 3L09A 4QPQA 4WF2A 2R7VA 3BLHB 1OQYA 4JI0M 4KODA 2BKZB 5ITTA 4A3LJ 3TQSA 4DR3M 2MYSA 4IBBA 3F0CA 4DR2M 2QQBA 3IH2A 1MMSA 4C2UA 4MFEA 2WIPB 3BR1A 3K8ZA 3DWLE 1UAAA 1IW7F 3W2AA 3U2RA 3LWFA 5EG0A 2L7ZA 5JI3E 1HNXM 5BNJB 2JY8A 2XLJA 1FBUA 2FQ3A 2O61A 3G3ZA 1P5EB 2HWJA 1Y0NA 5ITXA 1JB0F 4G8XA 2R7RA 1D1BA 2GBYA 1GABA 3GTOJ 4EEFG 4D1QA 1TT5B 2H94A 3GTMS 4OB0B 3B89A 4REZA 1WR1B 4KJZA 2D7GA 3BXWA 1L3LA 2DAEA 1L2CA 2X51A 3WU0A 2HL7A 3OIPA 4B7GA 2DAKA 2A5WA 4ZDOA 2RNJA 2YX4A 4DUZM 2L7FP 4BHPA 3E5UA 4O6JA 4AIKA 4NRWA 4S05A 1WVRA 1G3YA 1KA8A 3H92A 1AU7A 2VBZA 5L8RF 3ZMVA 3T1YM 3E4RA 1Q1VA 1YJNI 3GQ3A 2DDAA 1H1SB 1D8JA 1BL0A 4EOSB 4G7ZF 1OAIA 1ETVA 4BB9A 1XB2B 4A0ZA 2AO9A 3DKYA 3I59A 2A3SA 3BTLA 3HHTB 4LK1F 5K1YA 3HOZJ 3L2QA 1GL7A 4V2FA 4R71A 3MZHA 1TZLA 5C1BA 5DEQA 2K4BA 1FJGM 4LFBM 1BI1A 4NQWB 4KITB 5IREB 2VT2A 5K7HA 3HOVJ 3QOEA 2JRMA 2KEBA 1P4AA 1JKPC 2LK2A 3QWLA 2KL4A 3KP2A 4KA4A 1C0WA 4ELLA 1Q39A 5GPCA 5ACBA 3KHIA 3Q0WA 2CMPA 1A6IA 2I8DA 2PMHA 2ZBKB 2ICWG 2DNAA 1RZ4A 2XUBA 4ENMA 1N25A 1UHWA 4C3IJ 1YW7A 2JY5A 5DYGA 3B9PA 4ANJA 3CCVI 1Y39A 2DTZA 3RYPA 1MMAA 4KLNA 3A46A 2C5OB 1DGFA 4PJ0C 3DLLF 3GFMA 3HL2A 4UNOA 2X1NB 1ORYB 1UNLD 1I3QJ 5A2QZ 4U88A 3ZQ7A 4QNRA 2EWNA 1GL6A 2LY9A 4Y13A 2R5YB 4F6UB 2P5TA 3GMEA 4JX4A 4G4QA 2ZB9A 3TL4X 2WWYA 1LVKA 2NXNB 5FLXZ 1F9NA 3ZN1A 2V1NA 3E21A 2Z16A 1XDSA 2CRUA 1QPMA 2XSJC 2CUZA 1LKXA 1QPIA 3AL0C 5EGOB 1WGLA 5IDPB 4NUBA 4HBLA 4C3HJ 2DJNA 1H6UA 4G4OA 2YSRA 4IOAF 4G4RA 2L4FA 2K3FA 1K4TA 1K6OA 1NJFA 5KCMA 3TDZC 3RFWA 4XK4A 2IT0A 2GXGA 3S2DJ 2R4JA 2KR6A 4GCVA 5FFZA 4XN3A 1KSFX 4HQMA 1SFUA 2QSGX 4D7NA 4ANRA 3K2AA 4L9JA 4AIJA 2YNMD 1VQ1A 1I1GA 2MG4A 3GYHX 1HDDC 1JSTB 2JY6B 3DPTA 3VEPA 4HX8A 1YHQI 3UKGA 4I8OA 3IG5A 2EBIA 2PMZA 2H09A 3BZKA 3FXUA 3HSRA 3PJRA 2Q1ZB 1PJQA 2RNGA 3J27B 2X4AA 4XLPF 2QP9X 2XHKA 1PUEE 3CUQC 3DZDA 2ZJ2A 3I53A 2OTJI 1PUFA 3QPSA 2K40A 3RCOA 2LKXA 1R00A 1IRZA 4G94A 4GKJM 4DQ2A 3HPHA 4CCKA 1FIPA 2OD5A 2K4JA 4G9YA 1HXDA 3JR5A 2BEOA 4DYQA 4EORB 4GIPA 1ZP2A 4X62M 1STZA 2BY2A 5IHYA 1JTYA 2CUFA 4F7ZA 4JI2M 2MH9A 3DKWA 3HJEA 1BC8C 1YFHA 2LH0A 1IF1A 2E1MB 1WHCA 1DV0A 2ZXWH 2CRGA 3HGYA 2DPPB 2H1LA 2E19A 4FCVA 4JI1M 2GNOA 3M3YJ 1WJCA 1OIUB 4Y3OA 3K4KA 4II2A 4XKWA 4DJAA 5D4SA 4LIUA 5EEAA 2EIMH 4AU7A 3L2CA 5DTDA 3J81Z 1TD6A 4NSTB 1RKWA 2NAZA 1MDMB 2OPFA 2OCCH 1VF9A 4J19A 2VI6A 3DLAA 1T39A 1G8XA 3VYSB 2BS2A 5FKLA 2YFQA 1U5TA 3HSEA 2JQ7A 4BCQB 3DU6A 4BCHB 5EEGA 1IM2A 4OMYA 2LY1A 2IA1A 2X1DA 3GLXA 3PNVA 2R18A 2DENA 3HKZN 4UUVA 1T08B 1HKQA 3KFWX 5J3LA 3QZ9B 3W6KB 1G59A 4FWHA 1GXQA 1U9OA 1BIBA 1JJ6C 1MJBA 3O0GD 3QHWB 3POMA 3SAWA 4XL9A 5FTLA 3FXKA 5BNGA 1QUSA 1NV9A 2LTUA 4A3VB 5AONA 4X64M 4GO1A 3EOCB 1VQ5I 1GJSA 3IL2A 3SDBA 2F4VM 2XFSA 1V5FA 3CP8A 3S3MA 2VQEM 3NQOA 2ME0A 2C6TB 2VPLA 3CO6C 1LEAA 1QU3A 2JTVA 2V79A 2CZ6B 4ZGDB 3KXEC 2W9FA 4HLYA 3FBIB 4XQFA 1FIAA 1C7YA 2EFQA 3HU2A 1D8KA 5J8FA 1TWGJ 3AJIB 5EP3A 1E3PA 3GLLA 1VQLI 3H9GA 4AYBN 2Y48A 2HPMA 3DTOA 3W0LB 3BG9A 3ELKA 4QIWN 2UXXA 4OOIA 5BQTA 3OS1A 4A3IJ 3TO9A 1I39A 3B02A 1QYRA 2UU9M 3HEFA 2GA2A 3K6GA 3R8FA 3I58A 2VKEA 4BCMB 3ZRGA 2X6WA 3FMRA 4F6WB 1I5ZA 2K85A 1WZ2A 4Y33A 2KIUA 4HZFA 3UK6A 2CW7A 3K0LA 1IBKM 4PUSA 1OKRA 4EM1A 1VEJA 1PJTA 3KEYA 3KIOA 3QQAA 5F08A 4AIHA 3AAFA 4PT5A 2JUCA 3HIFA 4I0BA 3GLHA 5LLQA 2EFOA 2FD5A 3BR2A 1VQ4I 2VONA 3WTTC 4MTDA 5J47A 3LA7A 2I5UA 3CDHA 2BXYA 4D82A 5M5YJ 3L9FA 4L0YB 5EF6A 2UZEB 3ABUA 3MMYB 1O3RA 2M8GX 1Z1DA 1YOVB 1SD4A 2DFFA 2DODA 5B66C 2DLLA 2DAMA 2DMQA 3K4BA 4LF7M 1VQNI 4N0BA 2FH0A 3A03A 4OIRF 1B9NA 4IQJA 4E7LA 1T6SA 2HKJA 3ECHA 5FTNA 5EG0B 2QFZA 4Q5SF 4IX7A 3OOPA 5KQDA 3HKPA 5EJCA 1TTYA 4LJ8A 3X26B 1WJBA 2QUFA 3G73A 4UB8C 2K3PA 3FWEA 3I71A 4I99C 4DR4M 1ETWA 1D2NA 1SXJD 1SVMA 4II5B 5HBEB 3PM1A 1QHHD 2DA1A 4A0XA 1T0FC 4AUXA 4EGYA 2TRTA 3C18A 3DPLC 5JR3A 1RPWA 1NNJA 1FYKA 1HC8A 4MQ9F 1DP3A 4H0EA 4L9TA 1PRBA 1FVVB 2FE8A 1IN7A 1B1BA 2R7UA 1SEUA 4IQ4A 4PJMA 3MCZA 3IRQA 2QQAA 2I7PA 2HR3A 4CFXB 5KK1A 3I04M 3HJSA 4YEJA 3QHRB 2DT7B 5F0HA 2JGZB 1XDUA 1ORKA 1VNDA 1HQYE 1E32A 4LG2A 2OZUA 2XGEA 3DTKA 3DQVC 3ERED 4AM3A 2FNAA 4CFVB 3I59B 3F5XB 3AOEC 3IAM2 2PJPA 2HVRA 1WCMJ 4IJEA 3TWLA 3H9JA 3GRVA 3U6SA 3E3VA 3SFIA 5BPDA 3PUFA 1BJZA 3B6AA 4RB3C 5FTJA 2F5DA 3PIPF 2XC7A 1Z6TA 5FKMA 2L7HA 4IZZA 2LF8A 5CKTA 1WJEA 3DPUA 3QU3A 2I53A 3KP1E 3CCJI 2ELKA 4Q48A 2R45A 1V5GA 2N8GA 5D6FA 4QPOA 1TF0B 2M30A 3K9OA 4EIWA 2F48A 4JYKA 4UUTA 3DXJF 3CCQI 1IUYA 4LG0A 1EH8A 1L8QA 3I3LA 2DFIA 2HVSA 2W1OA 3RQ4A 1ZYRF 1X4OA 4KRDB 4ON0A 2LTPA 3NWTA 4BCFB 1LDJA 3V7CA 4BU2A 4DV2M 2VPRA 5JHUA 1XGOA 2X1EA 1Z0XA 3ZQQA 4XOTA 5HODA 2WBMA 3H0DA 5DD8A 2FBHA 2YPRA 4EGZA 1CUKA 2K9MA 5B1BH 2FOWA 1JHHA 2M1BA 5IZ7D 2WHBB 3CMEI 3TWMA 3MN2A 1OCTC 1IGNA 3DFGA 2HOAA 1NHGC 1ZG5A 1T3TA 1ZARA 2WADA 3VDXA 2YU3A 4HG2A 3B73A 1R4GA 4FWDA 3T5XA 5LHHA 3TNWB 3IC7A 4DV0M 1OYWA 2CJMB 5L2WB 4M0DA 1OFHA 5DM6F 2D2WA 2R0IA 1JT6A 3LQQA 2LBFA 4BYYA 2UWMA 5LGUA 3D5RC 4Y52J 1E7PA 2PJQA 5JI2E 1H1RB 3CMYA 2EA2A 2O25A 3BLQB 4RAFA 4PFOA 3C58A 3TW6A 1E3HA 1KYWA 3WGIA 4L16A 2DPUA 3A8GB 4BCJB 1Z91A 3ULQB 3LA3A 3AFHA 2EB7A 2W2HA 3F9KA 4RAZA 3DP7A 1XTAA 5H20A 3SZGA 4DUYM 2O5RA 1MMNA 4M3GA 2WSEF 2DMUA 3KZZA 3T6PA 1Q02A 4PZJA 3VODA 5D5UB 2UZKA 1PUFB 1EA3A 3J7ZI 1IQPA 2AHJB 1R4NB 5F64A 1IN5A 4IMYB 2O0YA 3SHFA 3PQKA 3TDUC 5F3WA 5LEJA 1TBXA 4IJFA 3HJ8A 1DO0A 3BJOA 3HRMA 1TL8A 3CC7I 4KT0F 4KNYA 2XGCA 4NC8A 4ENKA 1QZMA 3I4YA 1E9RA 4OU7A 3LSRA 2MFZA 2F5QA 1FYLA 2VQHA 1R23A 2NNYA 2X85A 4XM3A 2CQKA 3QPTA 4RMNA 3FTEA 2NOGA 4RGUA 3E46A 4CXFA 1H27B 5D8KB 4BCGB 3U1DA 3ZMDA 4L18B 1XNRM 3H5NA 1HW5A 1UCRA 3ZMTA 1IV8A 3SMSA 4R79A 4JBAA 4KN7X 1O3QA 1LTMA 3KOXE 4ZPXA 2JMWA 1POGA 4CCMA 2J7NA 5J6XA 3VK8A 1U5TB 1LFPA 3RYRA 1ZAEA 2XSZD 3P9CA 1NNUC 5ICEA 5IP9J 1XMQM 5IT9K 3CF6E 2ZMEA 2DA5A 2AQFA 4L9NA 1P7IA 3P5JA 5C44J 4LFAM 2GOXB 3QYGB 3BR6A 4C2MJ 4A3BJ 1V92A 4DV3M 5LEKA 5JFRA 4W97A 1TH4A 1BVSA 4XLAA 3H3VK 4FASD 1DU6A 2YU9J 2EKFA 4P17A 4FM4B 3SHGB 2ZXIA 5F6FA 4DYRA 3K7AJ 4NXNM 3OYBA 1I4WA 1U8RA 4MNUA 2PI0A 4QTRA 1FOXA 2UUAM 2BV6A 4LOCA 2DOEA 3VPRA 1T8IA 4ZZLA 3FXMA 3S3OA 4FHTA 1USSA 1LFUP 1OR7A 2MA3A 2ME6A 4RODA 1FY7A 3KYDB 5E3LA 4K0KM 4A5NA 2WEVB 5FTKA 2QYOA 3S15J 2NQ8C 4BXXX 1ETOA 1RKTA 5E6JA 3BG3A 3H4MA 1L1ZA 2LC2A 4G6QA 1TWAJ 1DUXC 1CQTA 4S12A 1J7KA 1NG7A 2Z99A 3Q9SA 2UXCM 5K7FA 1D0ZA 4L9VA 1XSDA 1K7AA 4XRFA 3BP8A 1FLIA 2KZUA 3ZQCA 2KPMA 4BACA 3GLGE 4JN6A 1P2FA 4GC9A 1QVRA 2FNPA 1FPQA 2F5FA 2VT3A 5H6QA 3X24B 3JREA 4BE2A 3BHTB 2L0KA 2ECCA 2RV8A 5EEHA 4P55A 2GQFA 2CFXA 5D6EA 1JJ8C 4EC9B 3E7LA 4OU0A 3DA1A 3VYUB 3HKZA 1WKMA 3PNTA 4RKUF 3OTOM 2IBDA 3E5XA 2WB1A 1AHJB 4DZPA 5ILVA 1R5LA 3FRIA 3T15A 4DR5M 3GLHB 1WQ2A 2DT5A 2VJIA 2VF7A 4FQGA 3RKQA 2ELHA 5LD2C 2ZO4A 1SFEA 1QA6A 3EPZA 3LCVB 3P7NA 1QAQA 3NBXX 1R22A 1ZLKA 1CGPA 4B3AA 1AOYA 2HCBA 1LE8A 3F8FA 3V76A 3IHUA 2LHGA 5FKOA 3RKWA 1P3QQ 4MH0E 1DP7P 3T8RA 2QF7A 4O3MA 1SFXA 1FBQA 1SXJC 5J40A 3MI9B 3X28B 4BCMD 1HR0M 1Y8RB 2K9SA 3AG1H 3BTIA 4V19K 3X2QH 3D8BA 5B5EC 4CGYB 2LSOA 1WI9A 2R7DA 2XIGA 3KP0E 3E9SA 1MBKA 1X3WB 2VQLA 3W6VA 5FRNA 2W99A 4KMFA 2BHYA 2VN2A 2DK5A 3PO3S 3I9V2 1R5GA 2CYZB 4EOJB 4C30A 1X2MA 4XKCA 2LREA 4BCPB 5FFXA 1BC7C 4DV7M 3M6AA 2GIZA 3MQ0A 3LOCA 1T2KA 1A31A 2J5YA 2EQRA 1G4AE 2ZAMA 2MW8A 4OAYA 2IS6A 4DBGB 3HO8A 2K5CA 2HS5A 3OIQA 4NL4H 2HFHA 3PXGA 1B6AA 3GXOA 2Y9YA 4RB0A 3TKYA 1W0UA 4ROEA 2JA6J 3FTFA 3CUOA 2EIJH 2KJCA 4UVCA 4ZDLA 3ABLH 5K5QA 3WE2A 1VTNC 1OGUB 2EV0A 4LCBA 2G9WA 4LFCM 2MH2A 3C3DA 1JI8A 1YX5A 2M7AA 4KIBA 5DYIA 3JR9A 2DTRA 3CO7C 4ITQA 4IJAA 2PMIB 4OB2B 4TTHA 2Q8KA 5GAGJ 1ZV1A 5IPAA 2ZXHA 3KCCA 1XN7A 1XCVA 2E5ZA 4IRHA 5J8CA 4F7JB 4JXJA 4II7A 5KPZA 2RQQA 3FM3A 5J1RA 4P16A 3LAJA 2Y0SA 2C5VB 1B72A 2K9NA 3RGFB 2LOOA 2WJ9A 3M8FA 2B63J 2WAQA 4RF0A 4EJTA 2RC4A 3JRBA 1TR8A 2FSWA 4I76A 2LD5A 2E2JJ 1S9HA 1A04A 2ZJQF 1SVOA 1ZHFA 1ZREA 3CTWB 1FEXA 3FD9A 4X65M 2EK5A 3W6JB 2KIMA 4ZTFA 2OQ4A 1Z3XA 4U0YA 4I2OA 5CEIB 1V3FA 4M3EA 1P4WA 4LG0B 1DPRA 1UG0A 4B3MM 3SATA 3GZ6A 1UFZA 2DWLA 3PFYA 1IXRC 4HYEA 2TDXA 3DTIA 4HV5A 5EP4A 3SYLA 2M4KA 2XGXA 4AW4A 1ZN2A 3SEQA 2ERCA 4BY7X 2NVUB 2VLAA 4CCJA 4FETA 2XV4S 3S14J 3H0GJ 2OOAA 3R0JA 3LW5F 2GAUA 2XGDA 2R7WA 2W25A 4Q47A 5HLIA 1MSFC 5KQ8A 1VOLA 3A0BC 2C5RA 2CUEA 3OYDA 4BDZA 2JA5J 5KO3A 3ZMSA 2K9QA 2M9HA 2FOKA 4DR1M 4A3DJ 1IO2A 3ML6A 1OCOH 2DWZB 2N35A 1S5LC 5D5VB 4GITA 2R5ZA 2IN3A 3TNHB 1MH3A 1YJ9I 2EFWA 1HCRA 1W1WE 4HLQA 3DEWA 4BXFA 1W4MA 3SXYA 3SYKA 4Z6YA 4M72A 3BZ6A 4XR6A 2XASA 2E71A 3QP6A 3OV8A 4UUSA 5E1ZB 1NHAA 4ZDPA 4A69C 2KHMA 2L01A 5FRMA 1OCCH 1OLTA 4CISA 5E3MA 5FGMA 3H3ZA 1R1UA 2LBFB 2QNJA 2WMAB 4O5VA 1NK2P 2Q2EB 3REOA 5AIPA 3EDPA 5LQFB 2KT0A 4RM3A 1SD5A 5KAIC 1FSEA 5LFAA 1G3WA 3LFUA 2KNVA 2MC4A 4PFPA 4ZH4F 1TGUA 1VQKI 1D0LA 3GPYA 1PP8F 2E34A 1D0XA 1XB4A 1A5JA 4B3SM 2DCEA 3KOYE 1H0MA 2KQRA 2JPBA 1FOKA 2A69F 2PEXA 3CJTB 3DV8A 3MY5B 1OL2B 1SFKA 4XLFA 3TOAA 2VODA 4I3ZB 3TWKA 1G41A 1IY2A 1GLNA 1X1DA 2X6OA 3G1MA 4QOZC 2KDZA 1U8BA 2GLOA 2IGKA 2JK3A 2KXEA 1IXZA 4LY6A 3A42A 3K1NA 5GADJ 1MMDA 3HUGA 1TH2A 2V4JC 4AD9A 1Z9CA 3Q0VA 3L25A 3GZNB 3WG9A 3WTWC 1ZMWA 1MBEA 1IXSA 2ID6A 4EM0B 3S1NJ 3G1LA 1W36D 2E36A 1H88C 1D3UB 4HDUA 4LJ7A 3E5QA 5DDGA 2E1MC 5HBHB 2WAFA 2QKLB 2GXAA 2LHCA 3JRGA 4M9ZA 4GHLA 2JN6A 3WVDB 1W5SA 3WVEB 1TQPA 1MZBA 1BOAA 1HNZM 4AWXB 3K4NA 2P5LC 1U3EM 2ISZA 1MJAA 3GO5A 1YUBA 3HG9A 3FKEA 1Z5AA 2ZMEB 4CH7A 2EFNA 3FHNA 1TNTA 1UHSA 4B1RA 5C18A 2FA5A 2A6TA 1IN4A 1JUMA 3LL7A 1K82A 1UJ8A 4IKFA 2M34A 3HSFA 4P1WA 2C96A 4XSZF 2M60A 3QPHA 1ODDA 2B3TA 2RKHA 1IC8A 2QGSA 4B08A 2ISYA 4D0PA 1DDNA 1FZPB 2LLKA 1XX5A 4Q7JA 3FXJA 2VBXA 2DK8A 3SZTA 1FP1D 2QVOA 3OR2C 4W1UA 3FUXA 4LGMA 3GLFE 1OCRH 2L5QA 1E0EA 2V1XA 3BR0A 5EP1A 4XLHA 2ESHA 3OYLA 3WHBA 2O01F 1R49A 3LSMA 2JWTA 3G71I 1S29A 2EZHA 1B59A 5E26A 3BZCA 4LD5A 2DBBA 4E70A 1QUTA 2B7EA 2ZXJA 3U5ZA 2KP6A 4HL4A 3KP3A 3ZMUA 5KHDA 2XEPA 3K92A 3KYLA 5IT9Z 4OR5B 3THGA 1SANA 1X3ZB 3TPZA 4NSRA 4I7HA 4Z2YA 3VYTB 1TNSA 3E6DA 5JVGF 5E79C 3KP4A 4RLQA 3EQLF 2R7GA 2Y9ZA 3HOTA 4XRMA 1MNDA 3M0EA 2Y0QA 3ZQIA 5DQWA 1RUNA 3GRRA 1AIPC 1RNLA 3D0SA 4RGSA 2HKXA 2L7KA 1FBSA 2HOSA 1WI3A 2LP0A 2J5OA 3RSNA 1SD7A 5K7ZA 1HQCA 1UMQA 3OYAA 4DIQA 2KIFA 2KRKA 4OX9M 3FX3A 2FE3A 3I54A 4U7BA 3C3WA 5GPAA 2UXDM 2CV2A 4ZYDA 4XBOA 2W48A 2UUEB 4CFNB 2ZAOA 4R7GA 2IW6B 3GPXA 2PK2A 3CMMA 4IBFA 2NYXA 1O3SA 4HNTA 1USTA 3K4MA 2XFTA 4ZGJB 4ESJA 1C1KA 5ICGA 3OYNA 1RUOA 5DD4A 2MLGA 5F1RA 1V5EA 2LXEA 1G4DA 2CYYA 2LF7A 4YFKF 1BIAA 1N34M 3KS8A 2J5PA 1ZELA 3D5SC 2CEAA 4RA2A 3B7QA 2DAGA 1KYZA 4DGWB 2YS9A 1VQ7I 2DXBB 3FUTA 2HDCA 3ZH9B 4CYDA 3BJ6A 2MABA 3GTGJ 5EQTA 3MZ8A 4IXAA 1K6YA 2BS3A 5FD6A 3CCUI 4BAYA 1LEBA 1MD0A 3HRUA 2DFHA 1JGGA 2C4GB 1EH6A 4YOOA 4B4CA 2M45A 4WXHA 4CICA 1YI2I 4M6XA 2ZPEB 1NH3A 5EXXA 2FBIA 2JZ1A 4XLCA 5ICFA 4C3JJ 5J1YA 2QEXI 1REPC 3I4PA 4IHYA 1J5YA 3G2BA 1HKTA 1ZG1A 1KYIA 3TP0A 5M5XJ 3LVVA 2H8RA 1MNEA 1YW8A 2Z7JA 3BT9A 3FYCA 4L5JA 2GZWA 2P81A 4AQYM 4C2TA 2DOFA 2DT6A 4LJ4A 5H37D 2CG4A 2AHQA 1Q3CA 4DR6M 3PQJA 3VOEA 4HQEA 2IS2A 4X6AJ 3Q9VA 1BR4A 4OVZA 1Q3BA 4UN2B 4OMZA 4RF1A 3IH3A 4FISA 2IW9B 2MGQA 2LR8A 2Y75A 2L4AA 1BU2A 2O8KA 3LAPA 2IW8B 3FBNB 1FSHA 2WTEA 1B72B 3WHCA 1ZTRA 5GTIC 2X6XA 1O7LA 1FX7A 3K4CA 4AIDA 4ZJZA 5EYRA 4LG3A 4AI6A 4LB6B 1K83J 3GRYA 2EIKH 1BR2A 3J80K 2BYVE 2CUJA 2KRFA 2XZUA 1YIJI 4B7HA 1WJ5A 3EUKL 2E1CA 3JAMK 4YELA 3L00A 2VIXA 1MMGA 3IG8A 1IREB 3C3EA 1GO5A 2EZLA 1HJPA 4ZGEB 9ANTA 5J1UA 4UVAA 4II3A 1R6BX 4IBEA 4IHXA 2HKOA 3FXRA 2GOMA 1FT9A 4X0GA 3LSJA 4N4NB 4RBOA 3X20B 2CW8A 2QZ4A 1GVDA 3COAC 4E7KA 3SMPA 3FYDA 1U0JA 1E17A 2VDBB 1TT0A 3W67A 1IN8A 2BWBA 1ZRCA 1SFOJ 5ITYA 4F7SB 4IBCA 3KPHA 2V9PA 1XMAA 3O8GA 2R6FA 3U6EA 2JPCA 2DI0A 3HB9A 3OYKA 2ZCWA 2K9LA 2E35A 2W82A 5DS9A 3GEZA 3FKIJ 2R5ZB 3HRTA 2ZTDA 3WODF 2XAUA 1B9MA 5JHFA 2FMLA 4B3RM 4L5EA 2QM3A 3LQ5B 2EV6A 4IHTA 2F4IA 1IBLM 5J4VA 3RJPA 5HLGA 2JVGA 4UUSB 2O6GE 4HX4A 3KZYA 4A12A 2P5VA 1ZK8A 3K1MA 4PJJA 4QSHA 3S8PA 1JKWA 4YFXF 4RAGA 4QOSA 2HHHM 2BPMB 4CDGA 4L5IA 1YLAA 5E18F 3ZQGA 2VJJA 5HS9A 2WPAB 1DGHA 5DV5A 2X9DA 2OJED 1PGYA 3AOGA 3SASA 1IV6A 2DZOB 2M2EA 1QDTA 2Y30A 4JP0A 4JX5A 2ZC2A 3IRRA 5KVRA 5F04A 1W0TA 2XGNA 1OKWB 1QAMA 1OJLA 2K86A 3PVSA 2C9CA 4JOMA 4OINF 1FTZA 3VYHB 2IGMA 4BE1A 2H5XA 1VEGA 3GRUA 5LMUM 1PM5A 4KIFA 4ABZA 4EQQA 1I1SA 1WFXA 4R3DA 3C2BA 5ITUA 4WXDA 3NBIA 5D5XB 4ROCA 4NXMM 3OY9A 3Q8GA 5EXTA 1P4XA 2CV0A 1FOWA 4EJWA 4OAZA 1RR8C 4N9HA 4LRSA 1XGSA 3F6VA 3GLIE 3JRFA 1UGSB 4YHHM 3HHHA 4M74A 4XOPA 3M8EA 5EZGA 5IWAM 2WZJA 1XC5A 3UMMA 4HLXA 4BHBA 3F92A 4H4KC 3HUGB 3BWGA 4MGIE 3WTXC 2V6EA 4OIOF 2O03A 3L2AA 1IZ1A 2C5NB 2L2DA 3HDDA 2NS8A 1IXSB 1SG9A 4IL6C 4D5CA 1F36A 3C2HA 2UXBM 1S7OA 2L02A 3KZIC 2F4OB 2DJIA 4YG2F 2LY2A 3BDDA 2C98A 5HQ0B 4PDGA 1H9GA 2J7OA 1ZR4A 2W84A 2NVTJ 1ZLJA 4PGGA 3HHYA 1Z7LA 3K7AM 4P9UA 1LUJB 2JA2A 1ENHA 1IDYA 2HXIA 1SD6A 1XSXA 2Y31A 1G2HA 1BI3A 1R1TA 4CFWB 5ICCA 2PFBA 4I0AA 2WY8Q 2IVMA 1U5TC 4OIQF 3KDSE 1UGRB 4DV6M 4UV8A 3KEOA 2LG4A 3VKHA 2V6ZM 2CGPA 1D3YA 2WXVB 1GV5A 4NC6A 4QWQA 1X2NA 2A6EF 5A2QS 3TP3A 1YG2A 2XAFA 2VASA 4CUGA 5IYCJ 4BXXJ 3L2WA 2E60A 2BVMA 3CC2I 4F6SB 2V1UA 3A45A 1HW1A 2A5YB 4LJ5A 5FLXS 2AXTC 2D7EA 1R36A 1D0YA 2OPTA 3AG4H 5HDKA 2L7MP 3A01A 3DEUA 5LMNM 4A3CJ 2FRHA 1X3UA 2KIQA 4RNAA 2QQ9A 1OFIA 4AKHA 1R1VA 2R7QA 3KP7A 3CCYA 5IOYA 3GP1A 4BCND 3RGSA 1RRJA 4C9YA 3MY1B 2V9KA 2VF8A 3TW7A 3U5ZB 2X8AA 4R1HA 4HEOA 1KU7A 1J2XA 1ETQA 1P6RA 2LMDA 3A2KA 1LDKB 1OL1B 3GFJA 3RI4A 3L7WA 1GHCA 1N75A 4IBGA 4HNUA 1XC8A 1LNWA 1D1CA 2I7NA 1QZYA 4G6DA 4HX7A 2BY1A 2H1RA 3I64A 1EKEA 3Q5FA 3HTUA 5GAEJ 4S04A 1TFBA 3CZ6A 4EOIB 4F7NB 4NC7A 2BY0A 2JUGA 1KGSA 1YIOA 2HZDA 2X6YA 4BEHA 1QRYA 2XF3A 4JYAM 3DFZA 3U6CA 1S8NA 2P4WA 2PX9A 3ZCBB 3IH4A 2EO2A 3KYCB 3B7ZA 1NSFA 5GTHC 2Z33A 2CWEA 5CQGA 2VE9A 1U78A 1TC3C 4F52A 4E7SA 1AD6A 4PD2A 5KPRA 4XN0A 3A8HB 1Y56A 3CESA 1DO2A 1I50J 2K6BA 4LFUA 2P7VB 1S7EA 3TOBA 2Z8YM 2OQRA 3FE3A 3MJ5A 1FMVA 1WJFA 2EZKA 2Z1DA 1IAWA 3BTJA 1D1AA 4A3MJ 1R7RA 5EP2A 4UY8I 3K4JA 2HWVA 3BG6A 1UNHD 3J81S 3BPVA 2R62A 1S3JA 3MZYA 3CDIA 1PDNC 2DDBA 2QDYB 2XZFA 1H1QB 2BWEA 4JV5M 4AG6A 3DTEA 1T43A 3U61A 2BVLA 4I81A 3R0AA 1ZGJA 4HF2A 2MGWA 1R71A 3VFDA 5F0CA 1NG6A 4EJUA 3ISPA 4XLNF 2QENA 2LVPC 5E8IA 3L2RA 3MMPA 2WA0A 1TLHB 5TJJA 2NRAC 3OIOA 1VI0A 3QYFA 5HVYB 3S2HJ 4JI3M 2LW4A 5LRRA 3BPXA 4YOZA 3E6MA 5L3GA 3CCLI 3HM5A 3B6CA 1HF0A 3VFZA 1J0RA 2VJ5A 1JTXA 2GWRA 4YRVA 2XB5A 3GLGA 4B3TM 2RQPA 4V2GA 1D5YA 3WGHA 1R5ID 5D8LB 4J01A 5L3BA 1G3TA 3B7NA 2DU9A 4OVZB 2HU9A 1L1TA 1H28B 1FNNA 2Y0MA 2CFOA 5BMZA 2QKMB 1LDDA 2E1NA 3PIOF 2RGVA 3GTLJ 3DCFA 4BJ6C 2IS1A 3H5AA 3ONQA 2B9SA 2DA4A 1HKSA 3C2GA 3NDQA 2ZNYA 1UFMA 2XKOA 4BY7J 1S3SA 4ASNA 3K70D 4AVZA 2Y2ZA 5H6RA 4B47A 1R5HA 2VBWA 1OIZA 3BTCA 3GUDA 1BI0A 3MD2A 2R93J 3SAUA 2RGOA 3HPGA 3CJRB 4ZYAA 2LKPA 2DWNA 4LZZA 1JR3E 1RR7A 2AQEA 3K69A 4L6V6 1JHFA 3MKLA 4U87A 4NRVA 1H8AC 1YS6A 1MGTA 2WV0A 3FUVA 2K02A 3TN8B 2O8XA 2EUFA 2JY7A 3CGWA 3KEQA 1IN6A 2VBYA 3JR4A 2HTSA 4FWGA 5CPRB 3JW4A 3UGJA 5HNHA 2VOOA 3GTPJ 2NS0A 4RS8A 4PDIA 2IVXA 1MBGA 3DEEA 4LMYA 2B9RA 1FINB 4UV9A 3QXEB 4MGKE 3MAJA 5M3MJ 3VYGB 3EUHA 3MIAB 1PVEA 2WAEA 3FXQA 1TDHA 1Y0UA 3F23A 2C5XB 3J80Z 3I56I 1FKMA 3S1QJ 3R60A 1UB9A 3W2WA 3F72A 2JVHA 2ZNZA 3JAMZ 3LSHA 2Y20A 1T56A 4B09A 4CCOA 3LA2A 4D5FA 1ZGWA 2WV1A 2Z2SB 1QQIA 3CCRI 5ITRA 3TEDA 1QAOA 2VXZA 3KSJA 3TBIA 1XXHE 2NNNA 3IKTA 2KNAA 1K4SA 1XG1A 1DGHB 2DOAA 4A6DA 2DZNB 2BE5F 1NY6A 2JXNA 1IFYA 4LF6M 1Z5CA 2RKOA 4BBSJ 4BXUA 3JRDA 4IBDA 4BCKB 3I51A 5E20A 2R46A 3RIRA 3K9PA 1RC9A 4Y28F 2Y69H 4XK8F 2NVXJ 1I27A 1OIYB 2M0CA 2OF7A 4G12A 4E7ZA 1TW2A 4A93J 2I10A 1YW9A 2CQ7A 1O3TA 1Z05A 1MKMA 2RGHA 2XRNA 5HBJB 5F1JA 4BUPA 1QZZA 2ECBA 5IDNB 2V1CA 2G0EA 3GF2A 5JVTA 3D8LA 3V8JA 2Z4RA 2EINH 2L54A 1X1CA 3H5RA 2M0MA 5HLTA 3IKVA 5EZHA 2PJRA 3DOGB 2EKKA 3OYEA 3PUBA 2CZ0B 5FLMJ 5CLSA 4FCWA 1QDRA 4BQAA 2W4SA 1R4MB 4JI7M 1R58A 2ACJA 1ACIA 3HZJA 4DZJA 3OR1C 2FOIC 5C3EJ 2UZBB 1Y1WJ 5E8GA 2XRLA 4IBKA 4D81A 1ZRFA 1MBHA 2C6YA 3L29A 2KMUA 3S3NA 2JZ0A 1G3IA 3J7AS 3SARA 4EOLB 3DU5A 4DW6A 4G6TB 2V22B 3IWZA 4AYBA 2KDLA 4F1IA 5H2FC 1XPXA 2UV1A 4A3KJ 5BR8M 4LLNA 3FF5A 2R7SA 4E7IA 4MGZE 4BJ5C 3FISA 1FOYA 2HI3A 3CQZJ 1RETA 4IBJA 2E5NA 1UELB 1FWZA 4M6VA 1SMTA 2VQCA 2XAJA 4ZYGA 1YO5C 3D5LA 1K78A 5C4XJ 1EFUB 1HOMA 1ZGAA 2X0LA 1SVLA 2EPFA 3HY5A 2YR2A 2QSFX 2ZMEC 4BKXA 2ZPHB 2ZZDB 1X37A 1ZMUA 4JI6M 2HNHA 3FKJA 4GGGA 3WTYC 2BW3A 3WU1B 2DXIA 3FMSA 2WSCF 3LCUA 4B48A 4CCNA 1XGMA 5LBQA 3A01B 3MHVC 3KLOA 4FW9A 4CYCA 3OYMA 4GC5A 3HTSB 4GDFA 4ZYEA 3ESWB 4LGYA 2QZ8A 3GTKJ 4OW0A 4PSWA 4HDVA 1ULYA 3P9KA 4CA0A 3FTCA 4BS9A 1OR7C 2G77A 4D7MA 3MKYB 2QDJA 4KHPM 1X58A 2JA8J 4R8HA 4ENJA 1MJ9A 4B43A 3N4MA 5IOZA 1W7PD 1NK3P 4XLEA 3S2WA 3G6EI 1HNWM 5DM7F 5FSWA 1ZRDA 5IT3A 2Z3YA 4L4UA 2RREA 3FZVA 3SJMA 3K2LA 2FUG2 4F93B 4BY1X 3OYCA 1P92A 4DYCA 2LDUA 1A5TA 2E7WA 2FQ4A 3ROUA 2LYCA 3OYIA 3HYIA 1QVTA 2DA6A 2GXBA 4F55A 3KX2A 1BR1A 1WGXA 4F70B 1H9TA 1BW5A 5J4YA 2H27A 3DBLB 3LSTA 4RM2A 3J7YJ 2L4MA 2L9RA 4GFBA 2LNHC 4A3EJ 3JSPA 1OKSA 4I98B 3KSXA 2VL8A 3O2PE 4FX0A 1VZ0A 2H6CA 3CLQA 3JCUC 5KNLA 2KHHA 3BLRB 3Q8XA 3ZMZA 1VFCA 1K79A 2FJ1A 2YQZA 2JSPA 5B3SH 3SBJA 3VKGA 1YYVA 3U6DA 3C7JA 3ZQHA 4MEXF 5ITQA 3CJNA 4NB5A 5DQVA 4WCGA 2FFJA 2DAIA 3MKZA 5FLVA 5HDNA 4IHWA 2ZM6M 3RZOJ 2UZDB 4OIPF 1D5VA 4FCTA 2V7FA 1Y6IA 3OL4A 2HEOA 2WC2A 2OZ6A 1Y8GA 3ASNH 3AV0A 3GLFA 1TH3A 3U61B 2DMEA 4UHTA 1MBFA 3DF8A 3G1OA 1XMOM 2EJSA 1ON2A 3GWZA 4FVMA 3LSKA 2DA3A 4W5WA 3HHWA 2TCTA 4HV6A 3HU3A 4FD2A 3E6BA 1AISB 2H8WA 1NV8A 2IPQX 3BCBA 3F8BA 3N05A 5ICPB 1L2DA 1WXQA 4HF1A 1BOBA 2B0LA 2IJLA 4AVPA 5E1XA 4G7OF 4KRCB 3V42A 3GLGB 4PJNA 3K70C 5FGKB 4E7HA 3EIDB 2XPUA 3DDPB 3K9TA 3GTMJ 1NY5A 2QQ8A 3BG5A 4PGHA 1LPQA 5FROA 1IRGA 2HQRA 4HEA2 1Z5BA 1I3AA 2QCOA 3IP4B 3M7GA 1EJ9A 3C9PA 2FU4A 2MBFA 4BJTA 3AG2H 4DBRA 2X1CA 4ZC3A 3ZQFA 5E17F 4MGHA 3I55I 5E1WA 1HT1E 2EV5A 2KRUA 4IEJA 3OS2A 3FTDA 3CMAI 4B44A 2V1DA 2F5VA 3HOSA 1FTTA 2ZPFB 3BQZA 3A1YA 1EH7A 3BG7A 3WHLA 2QHOB 2DO7A 3FHZA 4WXCA 4BCNB 2COBA 2APLA 2EILH 4EOQB 5KPTA 3LVWA 2G7HA 2KRCA 2ZJPF 1J59A 4GMQA 4HOBA 4KIGA 2NVQJ 3HOYJ 4B8XA 1WIVA 3F8MA 1ZH5A 1W7PA 2QWWA 3M1CA 2JRTA 5BPVA 3TQNA 1JXSA 2OC6A 5C4JJ 5FTMA 1PJSA 3PSFA 1ZG3A 3RGPA 3T8TA 2QBYA 1LQ1A 1L0OC 1XCBA 3IV5A 2R4EA 5BPIA 2DD4B 3ZQLA 1MN3A 2CQXA 1I6XA 3K2ZA 2KZSA 2NS7A 4M3FA 3CUQA 3TE6A 1XMXA 1P7JA 1W5CC 2CO5A 2DMPA 1G8PA 4EATA 2HGCA 2QA4I 3ZP5A 2KFDA 1WRJA 2VKHA 3H1CA 4Y72B 3R4KA 3OYJA 1JE8A 1DU0A 5CQEA 1QZEA 2D1VA 1EV7A 4CCLA 3V7SA 2D0QB 3DOAA 3F22A 3UZUA 2CQNA 2IAIA 5B1AH 4PSXA 3LSIA 3F6OA 4HNVA 1WSUA 5IP6A 5E3OA 2VIIA 2LRDA 1PKDB 2HTJA 5IP7J 2KJBA 3U60A 3FXLA 2DYRH 3LSPA 1RI7A 1B4AA 1L2BA 2HQ5A 1ENWA 2K9DA 2RAEA 5D5WB 1J09A 4GYGA 2E2HJ 2IW5A 2F6CA 1KFVA 3RPUD 1YLFA 2QLZA 2L6OA 4GYIA 2VUMJ 3VSKA 3A8MB 3SYTA 4DV1M 3A8LB 2ETHA 3D1NI 1UG2A 3EUAA 4M9XA 4I6ZA 1VDLA 4JI8M 2G3QA 1AWCA 5I5ZB 3UNGC 3TGNA 3W2VA 5TRDA 1DGGA 1XSVA 2W57A 3E6CC 3DJBA 2VOPA 1MU5A 4FE7A 1V34A 3FK6A 1XWIA 2WFYB 1IBMM 2YUSA 2PJRB 4Y15A 3QZ5B 4PCZA 1OYYA 4EV0A 1WPKA 1QNTA 2HYJA 2VKDA 5IYBJ 1EF4A 4RGRA 2OAZA 2KA6B 2OCEA 2Z9OA 2R7XA 4KO8A 3MVPA 3CCEI 4GXOA 2IRFG 3AG3H 3SQNA 3WU2C 2G5GX 2CCIB 4TV7A 3J7AO 1YTYA 4LRTA 4KN4X 2G9XB 2BY3A 3GTQJ 2W96A 5CVIA 3EYIA 2PG4A 4BBAA 1WJAA 2E5LM 3PSIA 1F1ZA 1KZHA 4A2UA 4KUMA 4KYWA 3BLYA 3K10A 2MD0A 1VINA 5FKKA 1GUUA 5TGTA 3S32A 1H89C 3SZPA 4ETSA 4XIDA 2K7LA 5ITXE 3SEZA 2HDDA 4P96A 3LMMA 4EOOB 3ZOBA 3QP5A 3IUOA 3IHPA 3W0FA 2HOTA 4XNFA 1JQJC 4EOMB 2R7TA 1G3NC 2UUCM 5GP9A 1K78B 2DAOA 1GT0C 1QLBA 2DWMA 2PMUA 4BH9A 2WIHB 1WJ7A 3QYHB 1NTCA 2L9NA 3QRFF 1BJAA 2BW3B 1APLC 3V8KA 2JT1A 1VQOI 1GXPA 1KXUA 2OBPA 2IS4A 4LJAA 1ETYA 3HX3A 2YX7A 3BQYA 3QODA 1AUAA 5ILSA 2L3DA 4RLFA 4CYCB 3KOZE 1E94E 2EJRA 3KETA 2QSHX 2F5CA 1N32M 3U6MA 5LHGA 4EOPB 3RKYA 2CHQA 2K47A 3KLNA 4YFNF 4LITA 3OYFA 2HYGD 2R7FA 2L9VA 1XNQM 1N77A 1V4RA 5HS7A 5DCMA 2P0WA 4FTHA 1HA8A 2HXOA 2DHRA 1SAXA 2DMTA 5K5RA 3GPPA 3GLIA 4U7DA 2F2EA 1O4XA 2OA4A 2FBKA 4E7JA 1JUSA 1S72I 1GDTA 3V7RA 3GCMA 2P5KA 2JNHA 2IXSA 4BBRJ 4WK8F 3I4VA 1YJWI 2M4GA 3BR5A 1N33M 4MIMA 4IRIA 4RB1A 3CF0A 1F43A 4EMSA 4RB2C 1IXCA 1NHWC 2LWXA 2LH9A 5HVQC 1IDZA 1H25B 1OAOC 2R44A 3KFUG 1U2WA 1PJJA 4E6KG 2KMGA 2BHZA 1AKHA 2JZYA 3M03A 2LNBA 1UM8A 2FS1A 2L7IA 3A0HC 5JI6A 3GQ4A 2R7ZJ 4DNCA 1IRXA 2BOLA 1T0FA 2ESNA 2M5WA 4G6LB 4WWCA 3LFKA 3T1BA 1JKOC 1YQAA 3RPUA 2DD5B 4HSRA 1T33A 3M1EA 3NWLA 1BN5A 4CSWA 2PQ8A 4LLGF 3VDPA 3S93A 3UR3C 3CC4I 2L09A 2ZTCA 2WB1N 2F4MB 4ZYHA 1ETXA 5CYIB 2HDWA 3T1HM 1MH4A 2CH0A 4HPQA 3FUWA 1MSEC 3O3KA 3HOWJ 1T95A 2RN7A 3RPQA 4I5SA 1K3XA 2F5OA 5DUKA 4DBQA 3GLFB 1GH6B 5M3FJ 3AOEA 4GHAA 2RVCA 4Y4RA 1AHDP 3CD6I 4BCOB 4A0YA 1B8IA 4CFUD 3E97A 1E3OC 3R9XB 1GY3B 4BNCA 2W24A 1E9HB 2XB0X 2ELJA 1R7JA 3KVWA 1JR3D 2C9OA 1QO0D 4KT6A 1QVUA 3CF2A 5HS8A 2M7BA 1RU3A 3GVAA 4OGRB 3KOWE 1W36C 2KZVA 2F5SA 1GVNA 2MC3A 3VYRB 2P8TA 3Q0UA 5HNBB 2PN6A 4JX6A 2OTLI 1ZAOA 3NAUA 1XS9A 3OMYA 3KE2A 2GIVA 1QANA 2MSYA 3GX4X 1FYMA 2COMA 2X4HA 3HJQA 2XF6A 2WMBB 1ZKGA 1ZQ9A 4JK1X 2L4EA 2XAQA 3HRSA 1TW3A 2CCHB 2BJVA 2ZCFB 1KQ9A 3F21A 2E2IJ 1YITI 1UGQB 1X4PA 4QHSA 2JSCA 2CZ7B 4F2LA 3V8LA 2YR0A 5IT9S 5EXSA 5KAFC 1F4KA 2R92J 1KU2A 5F0FA 2EA0A 3MEXA 3NWSA 4HAMA 5JLWA 3U21A 3IWFA 3MFKA 3W3CA 3VWBA 2I40B 2VE8A 4G7HF 3ZXSA 1FJLA 1J5EM 2O7OA 3IAS2 3AL0B 4UB6C 2R0QC 4IVNA 2Y0SN 3CJQB 3CF5F 1JKQC 1UGPB 3RDIA 1VQPI 4EVIA 4ENNA 3L1PA 4OB1B 2WAQN 1G71A 3AKZA 2L9SA 1Z3YA 2DW4A 4XSXF 5AIQA 3H4CA 1QQWA 3ZR8X 1W7PB 1JKRC 3OS0A 3HOUJ 4RAYA 3KW6A 5LGNA 2KZGA 3WTSC 2CP8A 2BGCA 2HVQA 4MTEA 1ZMVA 1OPCA 1F5TA 2QBYB 2M8EA 4KFCA 1Z59A 1HT2E 2EA4A 2EH3A 2KLOA 1LFBA 4YIIA 3GQ5A 1OCPA 2F5EA 4M71A 2IGOA 1KONA 2D45A 2KDOA 3MWMA 5HLHA 1XO2A 2IGNA 4PK4A 4FE4A 3CUQB 2O3FA 4BBSM 3FM5A 3KP6A 4U0WA 1I6HJ 3FXOA 2ZSHB 2CWBA 2Y21A 2VC0A 3R61A 2R7OA 2FEZA 2XKPA 4KT5C 4LJZF 4MO7A 4XBFA 1Z21A 1YRNA 1W5TA 4LF4M 1FMWA 8CATA 2KNZA 1ONVA 2CJJA 1TTEA 1PJIA 3ERMA 4A3FJ 3BHVB 2CHGA 1Q1HA 1JT0A 1OMIA 3GPUA 2XF7A 4I01A 3T0YA 1HDPA 4YIFA 1MBJA 3JRIA 1WWXA 2XF5A 2E1OA 3QOPA 4P5OA 4IHVA 2V6CA 4L0ZB 1FC3A 3U60B 4EJOA 1ZQ3P 4BCIB 5CVJA 3E0JB 3HC7A 2A07F 2GM4A 5JLXA 3BOQA 3BHUB 1YSYA 3J2PB 1TQMA 3J7BA 1NO1A 5DFLA 1YS7A 4GKKM 3M9AA 1VEKA 3TNIB 3M8JA 4BQQA 1N4MA 3TO7A 2ZPGB 4D80A 3FK7A 3BJAA 4BQOA 2JWSA 4FCYA 1MJGM 4B7FA 1WJDA 2K27A 4BE0A 4PDKA 4ESBA 4X66M 3JTGA 3GLHE 2JJ7A 1Z77A 3VDUA 2NOJB 2W85A 3SDGA 1HLVA 3ZN0A 1T98A 5EXPA 3U1KA 4NNJA 4M3DA 3FIWA
chains in the Genus database with same CATH topology
1V29B 2ZPBB 2BS2A 3HZJA 3WVDB 3WVEB 4OB2B 4AKIA 3HHTB 3QZ9B 4JX6A 2QQ8A 3QYGB 3BG5A 2WJ9A 3QWLA 1UGRB 4M6VA 4MFDA 2ZCFB 3VKHA 3KHIA 4P17A 4FM4B 4NC6A 4AI6A 2ZZDB 2ZPHB 1UGQB 1QLBA 2CZ7B 4LOCA 4OB3B 3QYHB 2CZ6B 4ZGDB 2ZPFB 1IREB 3A8GB 4ZGEB 4AKHA 3BG3A 3X20B 3BG9A 2BS4A 4HL4A 1UGPB 4JX4A 3TW7A 2G77A 2DXCB 2QDJA 4OB1B 4ELJA 4BBRM 2CZ1B 3X24B 3H4CA 3HB9A 3HBLA 4AKGA 4HNUA 4HLQA 2DD4B 3QXEB 4Z6YA 3VYGB 2KR6A 1AHJB 1FKMA 4BBSM 4MIMA 1E7PA 4QSHA 3QYBA 3A8OB 3X25B 3TW6A 2D0QB 3QYEA 2KMGA 4HNTA 2QF7A 3A8HB 4JX5A 4MFEA 3X28B 4ZGJB 2ZPIB 4HNVA 2AHJB 2QFZA 3VYHB 2DD5B 5EJCA 3VKGA 3X26B 2CYZB 2DXBB 3A8MB 3A8LB 2QDYB 4OB0B 2BS3A 2ZPGB 1UGSB 3DL1A 2DPPB 3HO8A 2ZPEB 2CZ0B 3QZ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWL A;  3QYE A;  2G77 A;  3QYB A;  2QFZ A;  2QQ8 A;  1FKM A;  3HZJ A;  4HLQ A;  4P17 A;  4NC6 A;  4Z6Y A;  5EJC A;  4HL4 A; 
#chains in the Genus database with same CATH topology
 1LVA A;  1V29 B;  1JR3 A;  2AHM A;  3F3X A;  3WHK A;  2OUM A;  4RGX A;  1VG5 A;  5K5O A;  5GKN A;  4NDL A;  1OKV B;  4OWR B;  1XGN A;  2LVQ D;  4EC8 B;  3WG7 H;  3P9I A;  2UUZ A;  4F92 B;  1S7A A;  1WGN A;  2KKO A;  2LBC A;  1F4I A;  3A02 A;  2MH8 A;  4YY3 M;  3S1R J;  2W9Z A;  4QNM A;  1JGS A;  1KU9 A;  1TP4 A;  2UXN A;  4CHU A;  3K1J A;  4GH9 A;  1G3S A;  3V4G A;  4XIC A;  3NEU A;  1C9B A;  1G6N A;  4FT8 A;  4PCQ A;  3HOX J;  2W00 A;  1X1P A;  2UZL B;  4YOS A;  1V55 H;  1IJW C;  3S1M J;  1OI9 B;  2LVO C;  5CVV A;  1Z7U A;  3OWT A;  4CZC A;  1LV7 A;  1X1B A;  1TWH J;  3CDL A;  1OCZ H;  1PYV A;  3GW2 A;  4S0H B;  3LQR A;  4BLC A;  1D0K A;  3BCA A;  3RTR A;  3EIH A;  1OFC X;  4BQN A;  2DZL A;  3ECO A;  1XXH A;  3L2V A;  2X48 A;  2K0B X;  4CZZ A;  4JI4 M;  2Q2E A;  1H4L D;  3VLF B;  1O57 A;  1TWF J;  5DYM A;  1MIJ A;  2A61 A;  2VC1 A;  5M5W J;  1NVM A;  5ED4 A;  3E1S A;  4KDP A;  2Z4S A;  2CU7 A;  3JTH A;  4DV5 M;  2VQG A;  5IY5 H;  1O9K A;  4WW0 A;  4BY1 J;  4ZZD A;  2STW A;  4ELJ A;  1CF7 A;  2IEK A;  4PJL A;  2UUB M;  2ADU A;  1AA7 A;  2LVN C;  4DR7 M;  5L3C A;  1J9I A;  4G6Z A;  3U6P A;  4AKG A;  1WH5 A;  2E7X A;  2DQL A;  2KRH A;  4U0V A;  5DCM B;  4YIR X;  2A6H F;  1H1P B;  3LNQ A;  2MLK A;  1QBJ A;  2XDV A;  3GLI B;  4BGD A;  3RZD J;  1KQ8 A;  1SXJ A;  5DNY A;  2DQR A;  2P6T A;  4Y7N J;  2BNK A;  4X1E A;  1LB2 A;  6PAX A;  3GFI A;  4MB7 A;  3I01 M;  2MR9 A;  4I09 A;  3QYB A;  3DDQ B;  2O9L A;  1D0M A;  1Y8Q B;  4M73 A;  2X49 A;  3OSG A;  3PO2 J;  2HZT A;  1H24 B;  3F8C A;  2L2O A;  3QYE A;  5BOX A;  1FP2 A;  2V26 A;  5CJ9 A;  4LF5 M;  3GO8 A;  3H4J A;  2F2C A;  2HYF A;  1PP7 U;  1AKH B;  2ZPI B;  3I4M J;  1DPU A;  2WY7 Q;  4FX4 A;  1V33 A;  1SMY F;  4KIC A;  1F5Q B;  3F8N A;  3M4O J;  2FMY A;  4CRL B;  4ZTJ A;  1E2X A;  1HW2 A;  2F5N A;  1GKI A;  1DGW Y;  5BS6 A;  1OTR A;  1TQI A;  3RQI A;  5FD5 A;  2BZT A;  1R9T J;  4AG5 A;  3ABT A;  4N9I A;  4EM2 A;  4K2E A;  1WH7 A;  5TIS C;  1IG7 A;  1QHG A;  2W7N A;  1VYW B;  4FX3 B;  4NOO B;  4CJ6 A;  2HQA A;  3GFL A;  3U9G A;  2M5Z A;  1URC B;  1VQ8 I;  2D1H A;  4LB5 A;  4IO9 F;  4IOC F;  2A68 F;  2PK9 B;  4A3G J;  2P6S A;  4MGY E;  4BHC A;  3ASO H;  2JA7 J;  2STT A;  4L8R C;  2G8L A;  3CTA A;  4KMU X;  5LMK B;  2MRO B;  1X19 A;  2ZPB B;  1B8I B;  5CYV A;  4BCQ D;  4LF9 M;  5A2Q K;  5L3F A;  4M9S A;  4I4L A;  2XAG A;  4KIS A;  4TUW A;  1J75 A;  5LGT A;  3PO3 J;  2CHV A;  5EDN A;  1MNM C;  4E4H A;  5FLX K;  3G33 B;  2HAK A;  2QCU A;  1Z6R A;  4NQW A;  3SAV A;  3TO6 A;  1BW6 A;  3WGG A;  4B3X A;  5DUI A;  1Z67 A;  4F91 B;  4WX9 A;  1KQ0 A;  4G4N A;  2CQQ A;  1ZR2 A;  1DGR M;  1Y1V J;  2OV7 A;  3WTU C;  3FRH A;  4Z8X A;  1S6L A;  2FX0 A;  1T6O A;  4LIV A;  1KU3 A;  2A05 A;  3B57 A;  5HOO A;  4IBI A;  3ZQJ A;  2DI3 A;  2G7U A;  4CFM B;  1K61 A;  5IF1 B;  1SXJ E;  4L15 A;  4LJ9 A;  2PMZ N;  2ZBK A;  3DKX A;  4IPA A;  4MFD A;  5FB2 A;  3BBZ A;  2IA0 A;  3GTJ J;  3N97 A;  2XPW A;  1ITY A;  2GA1 A;  4EON B;  1HSJ A;  3JRA A;  3ABM H;  3CP2 A;  3ABK H;  5FKN A;  4IF4 A;  2ID3 A;  3FMQ A;  1EE8 A;  2EUC A;  2VQF M;  2P7C B;  1BBY A;  3UJN A;  2ZFU A;  2CSO A;  2DA7 A;  4QLC U;  4NHJ A;  1SAU A;  2XPV A;  4XGI A;  1IY1 A;  1TDZ A;  4XON A;  1LJ9 A;  3TMO A;  1RIO H;  3GZ5 A;  2HQN A;  3K1P A;  1V54 H;  4Y17 A;  3QU6 A;  1P9Q C;  4JI5 M;  2R5Y A;  4IRG A;  3C1D A;  2R3S A;  3EYY A;  3PL8 A;  1U9N A;  3H3U A;  2BS4 A;  3DBH B;  3U6L A;  2DVW B;  4UXN A;  3BR3 A;  3DBR B;  2JUJ A;  4DV4 M;  1OIP A;  2VXD A;  2PHG A;  2DXC B;  1VQM I;  2XRO A;  2OO9 A;  3NAR A;  4F3Q A;  4NSO B;  2DKL A;  2AXL A;  1XMK A;  5E3N A;  1DGB A;  5EGO A;  3G4S I;  2CZ1 B;  3I4N J;  5L3E A;  3HBL A;  2BXZ A;  4F7L B;  3HXL A;  5F27 A;  4BDY A;  2GQQ A;  4M0W A;  2FXA A;  2DN0 A;  1ETK A;  1OYI A;  1MW7 A;  2IA2 A;  1XHB A;  1O7F A;  2HOE A;  2XAH A;  1GJT A;  2AS5 F;  4XRS A;  2VKV A;  5ILU A;  3HGI A;  1JUP A;  4GEW A;  4ITV A;  4M3B A;  1BM9 A;  1X1A A;  2EFP A;  4Q4Z F;  4IHS A;  4MLO A;  5LHI A;  3I5U A;  3BRO A;  4QHT A;  1UHM A;  1U6G A;  3QAH A;  4HA8 A;  4MQV A;  4MM3 B;  3J81 K;  3HHZ A;  3MKW B;  3A8O B;  3X25 B;  4LLL A;  4CHT B;  3VB2 A;  1E9S A;  2ZKZ A;  3L27 A;  3ZC7 B;  4LZJ A;  2XH9 A;  1LE8 B;  3QAU A;  3JRH A;  4P9F A;  3OOU A;  4WP2 A;  2M87 A;  2XVC A;  3EUH C;  3K4L A;  3KP5 A;  4M6Y A;  1YRN B;  5EFQ B;  2EZI A;  5DCF A;  1IUF A;  1OIS A;  1TWC J;  3CLO A;  3WTZ A;  5HNF A;  1HST A;  3HHG A;  1N36 M;  3O8H A;  3I0T A;  1A35 A;  1QMZ B;  2Z5U A;  1HBX G;  2FF4 A;  4L78 A;  3S16 J;  2XSZ A;  3ZGK A;  2MJ5 B;  1I94 M;  2LFB A;  5ERI A;  2DHY A;  2OOB A;  2F5P A;  4HRI A;  2LVA A;  4LGW A;  2CS3 A;  2R4G A;  3J7A Y;  4EJV A;  2OU2 A;  4XKV A;  7CAT A;  5FJ8 J;  1GUX B;  3OSF A;  1WHU A;  4IIW A;  4NBQ A;  1H26 B;  2D7H A;  1UNG D;  4BEH B;  3DL1 A;  2C99 A;  5GAH J;  2QPA A;  1RES A;  2KW0 A;  2PBI A;  1GV2 A;  1A6Q A;  3L26 A;  1NJG A;  3HU1 A;  2DYS H;  2ZFW A;  4A5M A;  4G3O A;  2HPI A;  3HGG A;  1MDM A;  3VK7 A;  3VSL A;  5LRS A;  3NRV A;  4BL0 B;  5D4R A;  1W98 B;  3PFI A;  1IY0 A;  3BC8 A;  3U6O A;  4CFU B;  4CIZ A;  4LK0 F;  3SFZ A;  1A36 A;  3MK6 A;  3M07 A;  2DMN A;  1MX0 A;  1JOW A;  1BA5 A;  3ILK A;  3IEC A;  4AKI A;  3H35 A;  2ZJR F;  2H1K A;  2VB6 A;  1DQU A;  4UN0 A;  4LF8 M;  2QGU A;  2H6B A;  2JP7 A;  1UZC A;  3CCS I;  3EET A;  1JSU B;  2BJW A;  1PJR A;  4JQF A;  4EOK B;  3SC3 A;  2XSD C;  4XOR A;  4YC3 B;  2CW0 F;  4N4O B;  1R2Z A;  2LVS A;  2RDP A;  3HHX A;  3T38 A;  3R6S A;  4RDU A;  2IP2 A;  4LJ6 A;  3LSG A;  3OYG A;  4HF0 A;  4GRI A;  3H36 A;  4XMY A;  3OYH A;  1QGP A;  3RE8 A;  1N78 A;  1SC7 A;  3WTV C;  5IYD J;  3KS4 A;  5CVR A;  3EJ1 B;  2R65 A;  3RKX A;  1VQ6 I;  3GBG A;  1ON1 A;  1VQ9 I;  4OB3 B;  2MD5 A;  3S17 J;  4CO8 A;  1XD7 A;  3W68 A;  2Z3X A;  2BBY A;  1YE9 A;  3QPL A;  4CXA B;  2ZAN A;  3U6Q A;  1R6R A;  4HW0 A;  1VDD A;  3L28 A;  3Q3S A;  5L3D A;  2WSF F;  2V9V A;  3H9Q A;  2KIS A;  4HST A;  3JSO A;  3HWS A;  2OQG A;  1XXH B;  4XKB A;  4D9J A;  3JRC A;  3OL3 A;  4UVB A;  4MGR A;  1R2Y A;  3FDY A;  3CCM I;  3ZPL A;  4CGZ A;  4MEY F;  3B74 A;  5CVU A;  4AZF A;  1GUX A;  2LKS A;  5HDG A;  2RRU A;  3J80 S;  3A4C A;  1YX3 A;  1K3W A;  2CE7 A;  2ZSI B;  4XRS G;  1M1E B;  2NVY J;  4MHG A;  3L2U A;  2PLY A;  1O9K B;  4BBR M;  3JAM S;  4A6E A;  1CF7 B;  2Y0T A;  3BY6 A;  3WE3 A;  3ZCO A;  1EIJ A;  4ESF A;  2DA2 A;  5FO5 A;  4DOZ A;  3BOS A;  2CV1 A;  1GVJ A;  2DFE A;  2M3A A;  2Q0O A;  2VJ4 A;  1T38 A;  2D5V A;  3PNY A;  3FUU A;  4I02 A;  3O6B B;  4A3J J;  1IRF A;  4AC0 A;  2DPD A;  1SXJ B;  3EIE A;  1BI2 A;  4WUR A;  4J00 A;  1ERD A;  3A98 B;  3L09 A;  4QPQ A;  4WF2 A;  2R7V A;  3BLH B;  1OQY A;  4JI0 M;  4KOD A;  2BKZ B;  5ITT A;  4A3L J;  3TQS A;  4DR3 M;  2MYS A;  4IBB A;  3F0C A;  4DR2 M;  2QQB A;  3IH2 A;  1MMS A;  4C2U A;  4MFE A;  2WIP B;  3BR1 A;  3K8Z A;  3DWL E;  1UAA A;  1IW7 F;  3W2A A;  3U2R A;  3LWF A;  5EG0 A;  2L7Z A;  5JI3 E;  1HNX M;  5BNJ B;  2JY8 A;  2XLJ A;  1FBU A;  2FQ3 A;  2O61 A;  3G3Z A;  1P5E B;  2HWJ A;  1Y0N A;  5ITX A;  1JB0 F;  4G8X A;  2R7R A;  1D1B A;  2GBY A;  1GAB A;  3GTO J;  4EEF G;  4D1Q A;  1TT5 B;  2H94 A;  3GTM S;  4OB0 B;  3B89 A;  4REZ A;  1WR1 B;  4KJZ A;  2D7G A;  3BXW A;  1L3L A;  2DAE A;  1L2C A;  2X51 A;  3WU0 A;  2HL7 A;  3OIP A;  4B7G A;  2DAK A;  2A5W A;  4ZDO A;  2RNJ A;  2YX4 A;  4DUZ M;  2L7F P;  4BHP A;  3E5U A;  4O6J A;  4AIK A;  4NRW A;  4S05 A;  1WVR A;  1G3Y A;  1KA8 A;  3H92 A;  1AU7 A;  2VBZ A;  5L8R F;  3ZMV A;  3T1Y M;  3E4R A;  1Q1V A;  1YJN I;  3GQ3 A;  2DDA A;  1H1S B;  1D8J A;  1BL0 A;  4EOS B;  4G7Z F;  1OAI A;  1ETV A;  4BB9 A;  1XB2 B;  4A0Z A;  2AO9 A;  3DKY A;  3I59 A;  2A3S A;  3BTL A;  3HHT B;  4LK1 F;  5K1Y A;  3HOZ J;  3L2Q A;  1GL7 A;  4V2F A;  4R71 A;  3MZH A;  1TZL A;  5C1B A;  5DEQ A;  2K4B A;  1FJG M;  4LFB M;  1BI1 A;  4NQW B;  4KIT B;  5IRE B;  2VT2 A;  5K7H A;  3HOV J;  3QOE A;  2JRM A;  2KEB A;  1P4A A;  1JKP C;  2LK2 A;  3QWL A;  2KL4 A;  3KP2 A;  4KA4 A;  1C0W A;  4ELL A;  1Q39 A;  5GPC A;  5ACB A;  3KHI A;  3Q0W A;  2CMP A;  1A6I A;  2I8D A;  2PMH A;  2ZBK B;  2ICW G;  2DNA A;  1RZ4 A;  2XUB A;  4ENM A;  1N25 A;  1UHW A;  4C3I J;  1YW7 A;  2JY5 A;  5DYG A;  3B9P A;  4ANJ A;  3CCV I;  1Y39 A;  2DTZ A;  3RYP A;  1MMA A;  4KLN A;  3A46 A;  2C5O B;  1DGF A;  4PJ0 C;  3DLL F;  3GFM A;  3HL2 A;  4UNO A;  2X1N B;  1ORY B;  1UNL D;  1I3Q J;  5A2Q Z;  4U88 A;  3ZQ7 A;  4QNR A;  2EWN A;  1GL6 A;  2LY9 A;  4Y13 A;  2R5Y B;  4F6U B;  2P5T A;  3GME A;  4JX4 A;  4G4Q A;  2ZB9 A;  3TL4 X;  2WWY A;  1LVK A;  2NXN B;  5FLX Z;  1F9N A;  3ZN1 A;  2V1N A;  3E21 A;  2Z16 A;  1XDS A;  2CRU A;  1QPM A;  2XSJ C;  2CUZ A;  1LKX A;  1QPI A;  3AL0 C;  5EGO B;  1WGL A;  5IDP B;  4NUB A;  4HBL A;  4C3H J;  2DJN A;  1H6U A;  4G4O A;  2YSR A;  4IOA F;  4G4R A;  2L4F A;  2K3F A;  1K4T A;  1K6O A;  1NJF A;  5KCM A;  3TDZ C;  3RFW A;  4XK4 A;  2IT0 A;  2GXG A;  3S2D J;  2R4J A;  2KR6 A;  4GCV A;  5FFZ A;  4XN3 A;  1KSF X;  4HQM A;  1SFU A;  2QSG X;  4D7N A;  4ANR A;  3K2A A;  4L9J A;  4AIJ A;  2YNM D;  1VQ1 A;  1I1G A;  2MG4 A;  3GYH X;  1HDD C;  1JST B;  2JY6 B;  3DPT A;  3VEP A;  4HX8 A;  1YHQ I;  3UKG A;  4I8O A;  3IG5 A;  2EBI A;  2PMZ A;  2H09 A;  3BZK A;  3FXU A;  3HSR A;  3PJR A;  2Q1Z B;  1PJQ A;  2RNG A;  3J27 B;  2X4A A;  4XLP F;  2QP9 X;  2XHK A;  1PUE E;  3CUQ C;  3DZD A;  2ZJ2 A;  3I53 A;  2OTJ I;  1PUF A;  3QPS A;  2K40 A;  3RCO A;  2LKX A;  1R00 A;  1IRZ A;  4G94 A;  4GKJ M;  4DQ2 A;  3HPH A;  4CCK A;  1FIP A;  2OD5 A;  2K4J A;  4G9Y A;  1HXD A;  3JR5 A;  2BEO A;  4DYQ A;  4EOR B;  4GIP A;  1ZP2 A;  4X62 M;  1STZ A;  2BY2 A;  5IHY A;  1JTY A;  2CUF A;  4F7Z A;  4JI2 M;  2MH9 A;  3DKW A;  3HJE A;  1BC8 C;  1YFH A;  2LH0 A;  1IF1 A;  2E1M B;  1WHC A;  1DV0 A;  2ZXW H;  2CRG A;  3HGY A;  2DPP B;  2H1L A;  2E19 A;  4FCV A;  4JI1 M;  2GNO A;  3M3Y J;  1WJC A;  1OIU B;  4Y3O A;  3K4K A;  4II2 A;  4XKW A;  4DJA A;  5D4S A;  4LIU A;  5EEA A;  2EIM H;  4AU7 A;  3L2C A;  5DTD A;  3J81 Z;  1TD6 A;  4NST B;  1RKW A;  2NAZ A;  1MDM B;  2OPF A;  2OCC H;  1VF9 A;  4J19 A;  2VI6 A;  3DLA A;  1T39 A;  1G8X A;  3VYS B;  2BS2 A;  5FKL A;  2YFQ A;  1U5T A;  3HSE A;  2JQ7 A;  4BCQ B;  3DU6 A;  4BCH B;  5EEG A;  1IM2 A;  4OMY A;  2LY1 A;  2IA1 A;  2X1D A;  3GLX A;  3PNV A;  2R18 A;  2DEN A;  3HKZ N;  4UUV A;  1T08 B;  1HKQ A;  3KFW X;  5J3L A;  3QZ9 B;  3W6K B;  1G59 A;  4FWH A;  1GXQ A;  1U9O A;  1BIB A;  1JJ6 C;  1MJB A;  3O0G D;  3QHW B;  3POM A;  3SAW A;  4XL9 A;  5FTL A;  3FXK A;  5BNG A;  1QUS A;  1NV9 A;  2LTU A;  4A3V B;  5AON A;  4X64 M;  4GO1 A;  3EOC B;  1VQ5 I;  1GJS A;  3IL2 A;  3SDB A;  2F4V M;  2XFS A;  1V5F A;  3CP8 A;  3S3M A;  2VQE M;  3NQO A;  2ME0 A;  2C6T B;  2VPL A;  3CO6 C;  1LEA A;  1QU3 A;  2JTV A;  2V79 A;  2CZ6 B;  4ZGD B;  3KXE C;  2W9F A;  4HLY A;  3FBI B;  4XQF A;  1FIA A;  1C7Y A;  2EFQ A;  3HU2 A;  1D8K A;  5J8F A;  1TWG J;  3AJI B;  5EP3 A;  1E3P A;  3GLL A;  1VQL I;  3H9G A;  4AYB N;  2Y48 A;  2HPM A;  3DTO A;  3W0L B;  3BG9 A;  3ELK A;  4QIW N;  2UXX A;  4OOI A;  5BQT A;  3OS1 A;  4A3I J;  3TO9 A;  1I39 A;  3B02 A;  1QYR A;  2UU9 M;  3HEF A;  2GA2 A;  3K6G A;  3R8F A;  3I58 A;  2VKE A;  4BCM B;  3ZRG A;  2X6W A;  3FMR A;  4F6W B;  1I5Z A;  2K85 A;  1WZ2 A;  4Y33 A;  2KIU A;  4HZF A;  3UK6 A;  2CW7 A;  3K0L A;  1IBK M;  4PUS A;  1OKR A;  4EM1 A;  1VEJ A;  1PJT A;  3KEY A;  3KIO A;  3QQA A;  5F08 A;  4AIH A;  3AAF A;  4PT5 A;  2JUC A;  3HIF A;  4I0B A;  3GLH A;  5LLQ A;  2EFO A;  2FD5 A;  3BR2 A;  1VQ4 I;  2VON A;  3WTT C;  4MTD A;  5J47 A;  3LA7 A;  2I5U A;  3CDH A;  2BXY A;  4D82 A;  5M5Y J;  3L9F A;  4L0Y B;  5EF6 A;  2UZE B;  3ABU A;  3MMY B;  1O3R A;  2M8G X;  1Z1D A;  1YOV B;  1SD4 A;  2DFF A;  2DOD A;  5B66 C;  2DLL A;  2DAM A;  2DMQ A;  3K4B A;  4LF7 M;  1VQN I;  4N0B A;  2FH0 A;  3A03 A;  4OIR F;  1B9N A;  4IQJ A;  4E7L A;  1T6S A;  2HKJ A;  3ECH A;  5FTN A;  5EG0 B;  2QFZ A;  4Q5S F;  4IX7 A;  3OOP A;  5KQD A;  3HKP A;  5EJC A;  1TTY A;  4LJ8 A;  3X26 B;  1WJB A;  2QUF A;  3G73 A;  4UB8 C;  2K3P A;  3FWE A;  3I71 A;  4I99 C;  4DR4 M;  1ETW A;  1D2N A;  1SXJ D;  1SVM A;  4II5 B;  5HBE B;  3PM1 A;  1QHH D;  2DA1 A;  4A0X A;  1T0F C;  4AUX A;  4EGY A;  2TRT A;  3C18 A;  3DPL C;  5JR3 A;  1RPW A;  1NNJ A;  1FYK A;  1HC8 A;  4MQ9 F;  1DP3 A;  4H0E A;  4L9T A;  1PRB A;  1FVV B;  2FE8 A;  1IN7 A;  1B1B A;  2R7U A;  1SEU A;  4IQ4 A;  4PJM A;  3MCZ A;  3IRQ A;  2QQA A;  2I7P A;  2HR3 A;  4CFX B;  5KK1 A;  3I04 M;  3HJS A;  4YEJ A;  3QHR B;  2DT7 B;  5F0H A;  2JGZ B;  1XDU A;  1ORK A;  1VND A;  1HQY E;  1E32 A;  4LG2 A;  2OZU A;  2XGE A;  3DTK A;  3DQV C;  3ERE D;  4AM3 A;  2FNA A;  4CFV B;  3I59 B;  3F5X B;  3AOE C;  3IAM 2;  2PJP A;  2HVR A;  1WCM J;  4IJE A;  3TWL A;  3H9J A;  3GRV A;  3U6S A;  3E3V A;  3SFI A;  5BPD A;  3PUF A;  1BJZ A;  3B6A A;  4RB3 C;  5FTJ A;  2F5D A;  3PIP F;  2XC7 A;  1Z6T A;  5FKM A;  2L7H A;  4IZZ A;  2LF8 A;  5CKT A;  1WJE A;  3DPU A;  3QU3 A;  2I53 A;  3KP1 E;  3CCJ I;  2ELK A;  4Q48 A;  2R45 A;  1V5G A;  2N8G A;  5D6F A;  4QPO A;  1TF0 B;  2M30 A;  3K9O A;  4EIW A;  2F48 A;  4JYK A;  4UUT A;  3DXJ F;  3CCQ I;  1IUY A;  4LG0 A;  1EH8 A;  1L8Q A;  3I3L A;  2DFI A;  2HVS A;  2W1O A;  3RQ4 A;  1ZYR F;  1X4O A;  4KRD B;  4ON0 A;  2LTP A;  3NWT A;  4BCF B;  1LDJ A;  3V7C A;  4BU2 A;  4DV2 M;  2VPR A;  5JHU A;  1XGO A;  2X1E A;  1Z0X A;  3ZQQ A;  4XOT A;  5HOD A;  2WBM A;  3H0D A;  5DD8 A;  2FBH A;  2YPR A;  4EGZ A;  1CUK A;  2K9M A;  5B1B H;  2FOW A;  1JHH A;  2M1B A;  5IZ7 D;  2WHB B;  3CME I;  3TWM A;  3MN2 A;  1OCT C;  1IGN A;  3DFG A;  2HOA A;  1NHG C;  1ZG5 A;  1T3T A;  1ZAR A;  2WAD A;  3VDX A;  2YU3 A;  4HG2 A;  3B73 A;  1R4G A;  4FWD A;  3T5X A;  5LHH A;  3TNW B;  3IC7 A;  4DV0 M;  1OYW A;  2CJM B;  5L2W B;  4M0D A;  1OFH A;  5DM6 F;  2D2W A;  2R0I A;  1JT6 A;  3LQQ A;  2LBF A;  4BYY A;  2UWM A;  5LGU A;  3D5R C;  4Y52 J;  1E7P A;  2PJQ A;  5JI2 E;  1H1R B;  3CMY A;  2EA2 A;  2O25 A;  3BLQ B;  4RAF A;  4PFO A;  3C58 A;  3TW6 A;  1E3H A;  1KYW A;  3WGI A;  4L16 A;  2DPU A;  3A8G B;  4BCJ B;  1Z91 A;  3ULQ B;  3LA3 A;  3AFH A;  2EB7 A;  2W2H A;  3F9K A;  4RAZ A;  3DP7 A;  1XTA A;  5H20 A;  3SZG A;  4DUY M;  2O5R A;  1MMN A;  4M3G A;  2WSE F;  2DMU A;  3KZZ A;  3T6P A;  1Q02 A;  4PZJ A;  3VOD A;  5D5U B;  2UZK A;  1PUF B;  1EA3 A;  3J7Z I;  1IQP A;  2AHJ B;  1R4N B;  5F64 A;  1IN5 A;  4IMY B;  2O0Y A;  3SHF A;  3PQK A;  3TDU C;  5F3W A;  5LEJ A;  1TBX A;  4IJF A;  3HJ8 A;  1DO0 A;  3BJO A;  3HRM A;  1TL8 A;  3CC7 I;  4KT0 F;  4KNY A;  2XGC A;  4NC8 A;  4ENK A;  1QZM A;  3I4Y A;  1E9R A;  4OU7 A;  3LSR A;  2MFZ A;  2F5Q A;  1FYL A;  2VQH A;  1R23 A;  2NNY A;  2X85 A;  4XM3 A;  2CQK A;  3QPT A;  4RMN A;  3FTE A;  2NOG A;  4RGU A;  3E46 A;  4CXF A;  1H27 B;  5D8K B;  4BCG B;  3U1D A;  3ZMD A;  4L18 B;  1XNR M;  3H5N A;  1HW5 A;  1UCR A;  3ZMT A;  1IV8 A;  3SMS A;  4R79 A;  4JBA A;  4KN7 X;  1O3Q A;  1LTM A;  3KOX E;  4ZPX A;  2JMW A;  1POG A;  4CCM A;  2J7N A;  5J6X A;  3VK8 A;  1U5T B;  1LFP A;  3RYR A;  1ZAE A;  2XSZ D;  3P9C A;  1NNU C;  5ICE A;  5IP9 J;  1XMQ M;  5IT9 K;  3CF6 E;  2ZME A;  2DA5 A;  2AQF A;  4L9N A;  1P7I A;  3P5J A;  5C44 J;  4LFA M;  2GOX B;  3QYG B;  3BR6 A;  4C2M J;  4A3B J;  1V92 A;  4DV3 M;  5LEK A;  5JFR A;  4W97 A;  1TH4 A;  1BVS A;  4XLA A;  3H3V K;  4FAS D;  1DU6 A;  2YU9 J;  2EKF A;  4P17 A;  4FM4 B;  3SHG B;  2ZXI A;  5F6F A;  4DYR A;  3K7A J;  4NXN M;  3OYB A;  1I4W A;  1U8R A;  4MNU A;  2PI0 A;  4QTR A;  1FOX A;  2UUA M;  2BV6 A;  4LOC A;  2DOE A;  3VPR A;  1T8I A;  4ZZL A;  3FXM A;  3S3O A;  4FHT A;  1USS A;  1LFU P;  1OR7 A;  2MA3 A;  2ME6 A;  4ROD A;  1FY7 A;  3KYD B;  5E3L A;  4K0K M;  4A5N A;  2WEV B;  5FTK A;  2QYO A;  3S15 J;  2NQ8 C;  4BXX X;  1ETO A;  1RKT A;  5E6J A;  3BG3 A;  3H4M A;  1L1Z A;  2LC2 A;  4G6Q A;  1TWA J;  1DUX C;  1CQT A;  4S12 A;  1J7K A;  1NG7 A;  2Z99 A;  3Q9S A;  2UXC M;  5K7F A;  1D0Z A;  4L9V A;  1XSD A;  1K7A A;  4XRF A;  3BP8 A;  1FLI A;  2KZU A;  3ZQC A;  2KPM A;  4BAC A;  3GLG E;  4JN6 A;  1P2F A;  4GC9 A;  1QVR A;  2FNP A;  1FPQ A;  2F5F A;  2VT3 A;  5H6Q A;  3X24 B;  3JRE A;  4BE2 A;  3BHT B;  2L0K A;  2ECC A;  2RV8 A;  5EEH A;  4P55 A;  2GQF A;  2CFX A;  5D6E A;  1JJ8 C;  4EC9 B;  3E7L A;  4OU0 A;  3DA1 A;  3VYU B;  3HKZ A;  1WKM A;  3PNT A;  4RKU F;  3OTO M;  2IBD A;  3E5X A;  2WB1 A;  1AHJ B;  4DZP A;  5ILV A;  1R5L A;  3FRI A;  3T15 A;  4DR5 M;  3GLH B;  1WQ2 A;  2DT5 A;  2VJI A;  2VF7 A;  4FQG A;  3RKQ A;  2ELH A;  5LD2 C;  2ZO4 A;  1SFE A;  1QA6 A;  3EPZ A;  3LCV B;  3P7N A;  1QAQ A;  3NBX X;  1R22 A;  1ZLK A;  1CGP A;  4B3A A;  1AOY A;  2HCB A;  1LE8 A;  3F8F A;  3V76 A;  3IHU A;  2LHG A;  5FKO A;  3RKW A;  1P3Q Q;  4MH0 E;  1DP7 P;  3T8R A;  2QF7 A;  4O3M A;  1SFX A;  1FBQ A;  1SXJ C;  5J40 A;  3MI9 B;  3X28 B;  4BCM D;  1HR0 M;  1Y8R B;  2K9S A;  3AG1 H;  3BTI A;  4V19 K;  3X2Q H;  3D8B A;  5B5E C;  4CGY B;  2LSO A;  1WI9 A;  2R7D A;  2XIG A;  3KP0 E;  3E9S A;  1MBK A;  1X3W B;  2VQL A;  3W6V A;  5FRN A;  2W99 A;  4KMF A;  2BHY A;  2VN2 A;  2DK5 A;  3PO3 S;  3I9V 2;  1R5G A;  2CYZ B;  4EOJ B;  4C30 A;  1X2M A;  4XKC A;  2LRE A;  4BCP B;  5FFX A;  1BC7 C;  4DV7 M;  3M6A A;  2GIZ A;  3MQ0 A;  3LOC A;  1T2K A;  1A31 A;  2J5Y A;  2EQR A;  1G4A E;  2ZAM A;  2MW8 A;  4OAY A;  2IS6 A;  4DBG B;  3HO8 A;  2K5C A;  2HS5 A;  3OIQ A;  4NL4 H;  2HFH A;  3PXG A;  1B6A A;  3GXO A;  2Y9Y A;  4RB0 A;  3TKY A;  1W0U A;  4ROE A;  2JA6 J;  3FTF A;  3CUO A;  2EIJ H;  2KJC A;  4UVC A;  4ZDL A;  3ABL H;  5K5Q A;  3WE2 A;  1VTN C;  1OGU B;  2EV0 A;  4LCB A;  2G9W A;  4LFC M;  2MH2 A;  3C3D A;  1JI8 A;  1YX5 A;  2M7A A;  4KIB A;  5DYI A;  3JR9 A;  2DTR A;  3CO7 C;  4ITQ A;  4IJA A;  2PMI B;  4OB2 B;  4TTH A;  2Q8K A;  5GAG J;  1ZV1 A;  5IPA A;  2ZXH A;  3KCC A;  1XN7 A;  1XCV A;  2E5Z A;  4IRH A;  5J8C A;  4F7J B;  4JXJ A;  4II7 A;  5KPZ A;  2RQQ A;  3FM3 A;  5J1R A;  4P16 A;  3LAJ A;  2Y0S A;  2C5V B;  1B72 A;  2K9N A;  3RGF B;  2LOO A;  2WJ9 A;  3M8F A;  2B63 J;  2WAQ A;  4RF0 A;  4EJT A;  2RC4 A;  3JRB A;  1TR8 A;  2FSW A;  4I76 A;  2LD5 A;  2E2J J;  1S9H A;  1A04 A;  2ZJQ F;  1SVO A;  1ZHF A;  1ZRE A;  3CTW B;  1FEX A;  3FD9 A;  4X65 M;  2EK5 A;  3W6J B;  2KIM A;  4ZTF A;  2OQ4 A;  1Z3X A;  4U0Y A;  4I2O A;  5CEI B;  1V3F A;  4M3E A;  1P4W A;  4LG0 B;  1DPR A;  1UG0 A;  4B3M M;  3SAT A;  3GZ6 A;  1UFZ A;  2DWL A;  3PFY A;  1IXR C;  4HYE A;  2TDX A;  3DTI A;  4HV5 A;  5EP4 A;  3SYL A;  2M4K A;  2XGX A;  4AW4 A;  1ZN2 A;  3SEQ A;  2ERC A;  4BY7 X;  2NVU B;  2VLA A;  4CCJ A;  4FET A;  2XV4 S;  3S14 J;  3H0G J;  2OOA A;  3R0J A;  3LW5 F;  2GAU A;  2XGD A;  2R7W A;  2W25 A;  4Q47 A;  5HLI A;  1MSF C;  5KQ8 A;  1VOL A;  3A0B C;  2C5R A;  2CUE A;  3OYD A;  4BDZ A;  2JA5 J;  5KO3 A;  3ZMS A;  2K9Q A;  2M9H A;  2FOK A;  4DR1 M;  4A3D J;  1IO2 A;  3ML6 A;  1OCO H;  2DWZ B;  2N35 A;  1S5L C;  5D5V B;  4GIT A;  2R5Z A;  2IN3 A;  3TNH B;  1MH3 A;  1YJ9 I;  2EFW A;  1HCR A;  1W1W E;  4HLQ A;  3DEW A;  4BXF A;  1W4M A;  3SXY A;  3SYK A;  4Z6Y A;  4M72 A;  3BZ6 A;  4XR6 A;  2XAS A;  2E71 A;  3QP6 A;  3OV8 A;  4UUS A;  5E1Z B;  1NHA A;  4ZDP A;  4A69 C;  2KHM A;  2L01 A;  5FRM A;  1OCC H;  1OLT A;  4CIS A;  5E3M A;  5FGM A;  3H3Z A;  1R1U A;  2LBF B;  2QNJ A;  2WMA B;  4O5V A;  1NK2 P;  2Q2E B;  3REO A;  5AIP A;  3EDP A;  5LQF B;  2KT0 A;  4RM3 A;  1SD5 A;  5KAI C;  1FSE A;  5LFA A;  1G3W A;  3LFU A;  2KNV A;  2MC4 A;  4PFP A;  4ZH4 F;  1TGU A;  1VQK I;  1D0L A;  3GPY A;  1PP8 F;  2E34 A;  1D0X A;  1XB4 A;  1A5J A;  4B3S M;  2DCE A;  3KOY E;  1H0M A;  2KQR A;  2JPB A;  1FOK A;  2A69 F;  2PEX A;  3CJT B;  3DV8 A;  3MY5 B;  1OL2 B;  1SFK A;  4XLF A;  3TOA A;  2VOD A;  4I3Z B;  3TWK A;  1G41 A;  1IY2 A;  1GLN A;  1X1D A;  2X6O A;  3G1M A;  4QOZ C;  2KDZ A;  1U8B A;  2GLO A;  2IGK A;  2JK3 A;  2KXE A;  1IXZ A;  4LY6 A;  3A42 A;  3K1N A;  5GAD J;  1MMD A;  3HUG A;  1TH2 A;  2V4J C;  4AD9 A;  1Z9C A;  3Q0V A;  3L25 A;  3GZN B;  3WG9 A;  3WTW C;  1ZMW A;  1MBE A;  1IXS A;  2ID6 A;  4EM0 B;  3S1N J;  3G1L A;  1W36 D;  2E36 A;  1H88 C;  1D3U B;  4HDU A;  4LJ7 A;  3E5Q A;  5DDG A;  2E1M C;  5HBH B;  2WAF A;  2QKL B;  2GXA A;  2LHC A;  3JRG A;  4M9Z A;  4GHL A;  2JN6 A;  3WVD B;  1W5S A;  3WVE B;  1TQP A;  1MZB A;  1BOA A;  1HNZ M;  4AWX B;  3K4N A;  2P5L C;  1U3E M;  2ISZ A;  1MJA A;  3GO5 A;  1YUB A;  3HG9 A;  3FKE A;  1Z5A A;  2ZME B;  4CH7 A;  2EFN A;  3FHN A;  1TNT A;  1UHS A;  4B1R A;  5C18 A;  2FA5 A;  2A6T A;  1IN4 A;  1JUM A;  3LL7 A;  1K82 A;  1UJ8 A;  4IKF A;  2M34 A;  3HSF A;  4P1W A;  2C96 A;  4XSZ F;  2M60 A;  3QPH A;  1ODD A;  2B3T A;  2RKH A;  1IC8 A;  2QGS A;  4B08 A;  2ISY A;  4D0P A;  1DDN A;  1FZP B;  2LLK A;  1XX5 A;  4Q7J A;  3FXJ A;  2VBX A;  2DK8 A;  3SZT A;  1FP1 D;  2QVO A;  3OR2 C;  4W1U A;  3FUX A;  4LGM A;  3GLF E;  1OCR H;  2L5Q A;  1E0E A;  2V1X A;  3BR0 A;  5EP1 A;  4XLH A;  2ESH A;  3OYL A;  3WHB A;  2O01 F;  1R49 A;  3LSM A;  2JWT A;  3G71 I;  1S29 A;  2EZH A;  1B59 A;  5E26 A;  3BZC A;  4LD5 A;  2DBB A;  4E70 A;  1QUT A;  2B7E A;  2ZXJ A;  3U5Z A;  2KP6 A;  4HL4 A;  3KP3 A;  3ZMU A;  5KHD A;  2XEP A;  3K92 A;  3KYL A;  5IT9 Z;  4OR5 B;  3THG A;  1SAN A;  1X3Z B;  3TPZ A;  4NSR A;  4I7H A;  4Z2Y A;  3VYT B;  1TNS A;  3E6D A;  5JVG F;  5E79 C;  3KP4 A;  4RLQ A;  3EQL F;  2R7G A;  2Y9Z A;  3HOT A;  4XRM A;  1MND A;  3M0E A;  2Y0Q A;  3ZQI A;  5DQW A;  1RUN A;  3GRR A;  1AIP C;  1RNL A;  3D0S A;  4RGS A;  2HKX A;  2L7K A;  1FBS A;  2HOS A;  1WI3 A;  2LP0 A;  2J5O A;  3RSN A;  1SD7 A;  5K7Z A;  1HQC A;  1UMQ A;  3OYA A;  4DIQ A;  2KIF A;  2KRK A;  4OX9 M;  3FX3 A;  2FE3 A;  3I54 A;  4U7B A;  3C3W A;  5GPA A;  2UXD M;  2CV2 A;  4ZYD A;  4XBO A;  2W48 A;  2UUE B;  4CFN B;  2ZAO A;  4R7G A;  2IW6 B;  3GPX A;  2PK2 A;  3CMM A;  4IBF A;  2NYX A;  1O3S A;  4HNT A;  1UST A;  3K4M A;  2XFT A;  4ZGJ B;  4ESJ A;  1C1K A;  5ICG A;  3OYN A;  1RUO A;  5DD4 A;  2MLG A;  5F1R A;  1V5E A;  2LXE A;  1G4D A;  2CYY A;  2LF7 A;  4YFK F;  1BIA A;  1N34 M;  3KS8 A;  2J5P A;  1ZEL A;  3D5S C;  2CEA A;  4RA2 A;  3B7Q A;  2DAG A;  1KYZ A;  4DGW B;  2YS9 A;  1VQ7 I;  2DXB B;  3FUT A;  2HDC A;  3ZH9 B;  4CYD A;  3BJ6 A;  2MAB A;  3GTG J;  5EQT A;  3MZ8 A;  4IXA A;  1K6Y A;  2BS3 A;  5FD6 A;  3CCU I;  4BAY A;  1LEB A;  1MD0 A;  3HRU A;  2DFH A;  1JGG A;  2C4G B;  1EH6 A;  4YOO A;  4B4C A;  2M45 A;  4WXH A;  4CIC A;  1YI2 I;  4M6X A;  2ZPE B;  1NH3 A;  5EXX A;  2FBI A;  2JZ1 A;  4XLC A;  5ICF A;  4C3J J;  5J1Y A;  2QEX I;  1REP C;  3I4P A;  4IHY A;  1J5Y A;  3G2B A;  1HKT A;  1ZG1 A;  1KYI A;  3TP0 A;  5M5X J;  3LVV A;  2H8R A;  1MNE A;  1YW8 A;  2Z7J A;  3BT9 A;  3FYC A;  4L5J A;  2GZW A;  2P81 A;  4AQY M;  4C2T A;  2DOF A;  2DT6 A;  4LJ4 A;  5H37 D;  2CG4 A;  2AHQ A;  1Q3C A;  4DR6 M;  3PQJ A;  3VOE A;  4HQE A;  2IS2 A;  4X6A J;  3Q9V A;  1BR4 A;  4OVZ A;  1Q3B A;  4UN2 B;  4OMZ A;  4RF1 A;  3IH3 A;  4FIS A;  2IW9 B;  2MGQ A;  2LR8 A;  2Y75 A;  2L4A A;  1BU2 A;  2O8K A;  3LAP A;  2IW8 B;  3FBN B;  1FSH A;  2WTE A;  1B72 B;  3WHC A;  1ZTR A;  5GTI C;  2X6X A;  1O7L A;  1FX7 A;  3K4C A;  4AID A;  4ZJZ A;  5EYR A;  4LG3 A;  4AI6 A;  4LB6 B;  1K83 J;  3GRY A;  2EIK H;  1BR2 A;  3J80 K;  2BYV E;  2CUJ A;  2KRF A;  2XZU A;  1YIJ I;  4B7H A;  1WJ5 A;  3EUK L;  2E1C A;  3JAM K;  4YEL A;  3L00 A;  2VIX A;  1MMG A;  3IG8 A;  1IRE B;  3C3E A;  1GO5 A;  2EZL A;  1HJP A;  4ZGE B;  9ANT A;  5J1U A;  4UVA A;  4II3 A;  1R6B X;  4IBE A;  4IHX A;  2HKO A;  3FXR A;  2GOM A;  1FT9 A;  4X0G A;  3LSJ A;  4N4N B;  4RBO A;  3X20 B;  2CW8 A;  2QZ4 A;  1GVD A;  3COA C;  4E7K A;  3SMP A;  3FYD A;  1U0J A;  1E17 A;  2VDB B;  1TT0 A;  3W67 A;  1IN8 A;  2BWB A;  1ZRC A;  1SFO J;  5ITY A;  4F7S B;  4IBC A;  3KPH A;  2V9P A;  1XMA A;  3O8G A;  2R6F A;  3U6E A;  2JPC A;  2DI0 A;  3HB9 A;  3OYK A;  2ZCW A;  2K9L A;  2E35 A;  2W82 A;  5DS9 A;  3GEZ A;  3FKI J;  2R5Z B;  3HRT A;  2ZTD A;  3WOD F;  2XAU A;  1B9M A;  5JHF A;  2FML A;  4B3R M;  4L5E A;  2QM3 A;  3LQ5 B;  2EV6 A;  4IHT A;  2F4I A;  1IBL M;  5J4V A;  3RJP A;  5HLG A;  2JVG A;  4UUS B;  2O6G E;  4HX4 A;  3KZY A;  4A12 A;  2P5V A;  1ZK8 A;  3K1M A;  4PJJ A;  4QSH A;  3S8P A;  1JKW A;  4YFX F;  4RAG A;  4QOS A;  2HHH M;  2BPM B;  4CDG A;  4L5I A;  1YLA A;  5E18 F;  3ZQG A;  2VJJ A;  5HS9 A;  2WPA B;  1DGH A;  5DV5 A;  2X9D A;  2OJE D;  1PGY A;  3AOG A;  3SAS A;  1IV6 A;  2DZO B;  2M2E A;  1QDT A;  2Y30 A;  4JP0 A;  4JX5 A;  2ZC2 A;  3IRR A;  5KVR A;  5F04 A;  1W0T A;  2XGN A;  1OKW B;  1QAM A;  1OJL A;  2K86 A;  3PVS A;  2C9C A;  4JOM A;  4OIN F;  1FTZ A;  3VYH B;  2IGM A;  4BE1 A;  2H5X A;  1VEG A;  3GRU A;  5LMU M;  1PM5 A;  4KIF A;  4ABZ A;  4EQQ A;  1I1S A;  1WFX A;  4R3D A;  3C2B A;  5ITU A;  4WXD A;  3NBI A;  5D5X B;  4ROC A;  4NXM M;  3OY9 A;  3Q8G A;  5EXT A;  1P4X A;  2CV0 A;  1FOW A;  4EJW A;  4OAZ A;  1RR8 C;  4N9H A;  4LRS A;  1XGS A;  3F6V A;  3GLI E;  3JRF A;  1UGS B;  4YHH M;  3HHH A;  4M74 A;  4XOP A;  3M8E A;  5EZG A;  5IWA M;  2WZJ A;  1XC5 A;  3UMM A;  4HLX A;  4BHB A;  3F92 A;  4H4K C;  3HUG B;  3BWG A;  4MGI E;  3WTX C;  2V6E A;  4OIO F;  2O03 A;  3L2A A;  1IZ1 A;  2C5N B;  2L2D A;  3HDD A;  2NS8 A;  1IXS B;  1SG9 A;  4IL6 C;  4D5C A;  1F36 A;  3C2H A;  2UXB M;  1S7O A;  2L02 A;  3KZI C;  2F4O B;  2DJI A;  4YG2 F;  2LY2 A;  3BDD A;  2C98 A;  5HQ0 B;  4PDG A;  1H9G A;  2J7O A;  1ZR4 A;  2W84 A;  2NVT J;  1ZLJ A;  4PGG A;  3HHY A;  1Z7L A;  3K7A M;  4P9U A;  1LUJ B;  2JA2 A;  1ENH A;  1IDY A;  2HXI A;  1SD6 A;  1XSX A;  2Y31 A;  1G2H A;  1BI3 A;  1R1T A;  4CFW B;  5ICC A;  2PFB A;  4I0A A;  2WY8 Q;  2IVM A;  1U5T C;  4OIQ F;  3KDS E;  1UGR B;  4DV6 M;  4UV8 A;  3KEO A;  2LG4 A;  3VKH A;  2V6Z M;  2CGP A;  1D3Y A;  2WXV B;  1GV5 A;  4NC6 A;  4QWQ A;  1X2N A;  2A6E F;  5A2Q S;  3TP3 A;  1YG2 A;  2XAF A;  2VAS A;  4CUG A;  5IYC J;  4BXX J;  3L2W A;  2E60 A;  2BVM A;  3CC2 I;  4F6S B;  2V1U A;  3A45 A;  1HW1 A;  2A5Y B;  4LJ5 A;  5FLX S;  2AXT C;  2D7E A;  1R36 A;  1D0Y A;  2OPT A;  3AG4 H;  5HDK A;  2L7M P;  3A01 A;  3DEU A;  5LMN M;  4A3C J;  2FRH A;  1X3U A;  2KIQ A;  4RNA A;  2QQ9 A;  1OFI A;  4AKH A;  1R1V A;  2R7Q A;  3KP7 A;  3CCY A;  5IOY A;  3GP1 A;  4BCN D;  3RGS A;  1RRJ A;  4C9Y A;  3MY1 B;  2V9K A;  2VF8 A;  3TW7 A;  3U5Z B;  2X8A A;  4R1H A;  4HEO A;  1KU7 A;  1J2X A;  1ETQ A;  1P6R A;  2LMD A;  3A2K A;  1LDK B;  1OL1 B;  3GFJ A;  3RI4 A;  3L7W A;  1GHC A;  1N75 A;  4IBG A;  4HNU A;  1XC8 A;  1LNW A;  1D1C A;  2I7N A;  1QZY A;  4G6D A;  4HX7 A;  2BY1 A;  2H1R A;  3I64 A;  1EKE A;  3Q5F A;  3HTU A;  5GAE J;  4S04 A;  1TFB A;  3CZ6 A;  4EOI B;  4F7N B;  4NC7 A;  2BY0 A;  2JUG A;  1KGS A;  1YIO A;  2HZD A;  2X6Y A;  4BEH A;  1QRY A;  2XF3 A;  4JYA M;  3DFZ A;  3U6C A;  1S8N A;  2P4W A;  2PX9 A;  3ZCB B;  3IH4 A;  2EO2 A;  3KYC B;  3B7Z A;  1NSF A;  5GTH C;  2Z33 A;  2CWE A;  5CQG A;  2VE9 A;  1U78 A;  1TC3 C;  4F52 A;  4E7S A;  1AD6 A;  4PD2 A;  5KPR A;  4XN0 A;  3A8H B;  1Y56 A;  3CES A;  1DO2 A;  1I50 J;  2K6B A;  4LFU A;  2P7V B;  1S7E A;  3TOB A;  2Z8Y M;  2OQR A;  3FE3 A;  3MJ5 A;  1FMV A;  1WJF A;  2EZK A;  2Z1D A;  1IAW A;  3BTJ A;  1D1A A;  4A3M J;  1R7R A;  5EP2 A;  4UY8 I;  3K4J A;  2HWV A;  3BG6 A;  1UNH D;  3J81 S;  3BPV A;  2R62 A;  1S3J A;  3MZY A;  3CDI A;  1PDN C;  2DDB A;  2QDY B;  2XZF A;  1H1Q B;  2BWE A;  4JV5 M;  4AG6 A;  3DTE A;  1T43 A;  3U61 A;  2BVL A;  4I81 A;  3R0A A;  1ZGJ A;  4HF2 A;  2MGW A;  1R71 A;  3VFD A;  5F0C A;  1NG6 A;  4EJU A;  3ISP A;  4XLN F;  2QEN A;  2LVP C;  5E8I A;  3L2R A;  3MMP A;  2WA0 A;  1TLH B;  5TJJ A;  2NRA C;  3OIO A;  1VI0 A;  3QYF A;  5HVY B;  3S2H J;  4JI3 M;  2LW4 A;  5LRR A;  3BPX A;  4YOZ A;  3E6M A;  5L3G A;  3CCL I;  3HM5 A;  3B6C A;  1HF0 A;  3VFZ A;  1J0R A;  2VJ5 A;  1JTX A;  2GWR A;  4YRV A;  2XB5 A;  3GLG A;  4B3T M;  2RQP A;  4V2G A;  1D5Y A;  3WGH A;  1R5I D;  5D8L B;  4J01 A;  5L3B A;  1G3T A;  3B7N A;  2DU9 A;  4OVZ B;  2HU9 A;  1L1T A;  1H28 B;  1FNN A;  2Y0M A;  2CFO A;  5BMZ A;  2QKM B;  1LDD A;  2E1N A;  3PIO F;  2RGV A;  3GTL J;  3DCF A;  4BJ6 C;  2IS1 A;  3H5A A;  3ONQ A;  2B9S A;  2DA4 A;  1HKS A;  3C2G A;  3NDQ A;  2ZNY A;  1UFM A;  2XKO A;  4BY7 J;  1S3S A;  4ASN A;  3K70 D;  4AVZ A;  2Y2Z A;  5H6R A;  4B47 A;  1R5H A;  2VBW A;  1OIZ A;  3BTC A;  3GUD A;  1BI0 A;  3MD2 A;  2R93 J;  3SAU A;  2RGO A;  3HPG A;  3CJR B;  4ZYA A;  2LKP A;  2DWN A;  4LZZ A;  1JR3 E;  1RR7 A;  2AQE A;  3K69 A;  4L6V 6;  1JHF A;  3MKL A;  4U87 A;  4NRV A;  1H8A C;  1YS6 A;  1MGT A;  2WV0 A;  3FUV A;  2K02 A;  3TN8 B;  2O8X A;  2EUF A;  2JY7 A;  3CGW A;  3KEQ A;  1IN6 A;  2VBY A;  3JR4 A;  2HTS A;  4FWG A;  5CPR B;  3JW4 A;  3UGJ A;  5HNH A;  2VOO A;  3GTP J;  2NS0 A;  4RS8 A;  4PDI A;  2IVX A;  1MBG A;  3DEE A;  4LMY A;  2B9R A;  1FIN B;  4UV9 A;  3QXE B;  4MGK E;  3MAJ A;  5M3M J;  3VYG B;  3EUH A;  3MIA B;  1PVE A;  2WAE A;  3FXQ A;  1TDH A;  1Y0U A;  3F23 A;  2C5X B;  3J80 Z;  3I56 I;  1FKM A;  3S1Q J;  3R60 A;  1UB9 A;  3W2W A;  3F72 A;  2JVH A;  2ZNZ A;  3JAM Z;  3LSH A;  2Y20 A;  1T56 A;  4B09 A;  4CCO A;  3LA2 A;  4D5F A;  1ZGW A;  2WV1 A;  2Z2S B;  1QQI A;  3CCR I;  5ITR A;  3TED A;  1QAO A;  2VXZ A;  3KSJ A;  3TBI A;  1XXH E;  2NNN A;  3IKT A;  2KNA A;  1K4S A;  1XG1 A;  1DGH B;  2DOA A;  4A6D A;  2DZN B;  2BE5 F;  1NY6 A;  2JXN A;  1IFY A;  4LF6 M;  1Z5C A;  2RKO A;  4BBS J;  4BXU A;  3JRD A;  4IBD A;  4BCK B;  3I51 A;  5E20 A;  2R46 A;  3RIR A;  3K9P A;  1RC9 A;  4Y28 F;  2Y69 H;  4XK8 F;  2NVX J;  1I27 A;  1OIY B;  2M0C A;  2OF7 A;  4G12 A;  4E7Z A;  1TW2 A;  4A93 J;  2I10 A;  1YW9 A;  2CQ7 A;  1O3T A;  1Z05 A;  1MKM A;  2RGH A;  2XRN A;  5HBJ B;  5F1J A;  4BUP A;  1QZZ A;  2ECB A;  5IDN B;  2V1C A;  2G0E A;  3GF2 A;  5JVT A;  3D8L A;  3V8J A;  2Z4R A;  2EIN H;  2L54 A;  1X1C A;  3H5R A;  2M0M A;  5HLT A;  3IKV A;  5EZH A;  2PJR A;  3DOG B;  2EKK A;  3OYE A;  3PUB A;  2CZ0 B;  5FLM J;  5CLS A;  4FCW A;  1QDR A;  4BQA A;  2W4S A;  1R4M B;  4JI7 M;  1R58 A;  2ACJ A;  1ACI A;  3HZJ A;  4DZJ A;  3OR1 C;  2FOI C;  5C3E J;  2UZB B;  1Y1W J;  5E8G A;  2XRL A;  4IBK A;  4D81 A;  1ZRF A;  1MBH A;  2C6Y A;  3L29 A;  2KMU A;  3S3N A;  2JZ0 A;  1G3I A;  3J7A S;  3SAR A;  4EOL B;  3DU5 A;  4DW6 A;  4G6T B;  2V22 B;  3IWZ A;  4AYB A;  2KDL A;  4F1I A;  5H2F C;  1XPX A;  2UV1 A;  4A3K J;  5BR8 M;  4LLN A;  3FF5 A;  2R7S A;  4E7I A;  4MGZ E;  4BJ5 C;  3FIS A;  1FOY A;  2HI3 A;  3CQZ J;  1RET A;  4IBJ A;  2E5N A;  1UEL B;  1FWZ A;  4M6V A;  1SMT A;  2VQC A;  2XAJ A;  4ZYG A;  1YO5 C;  3D5L A;  1K78 A;  5C4X J;  1EFU B;  1HOM A;  1ZGA A;  2X0L A;  1SVL A;  2EPF A;  3HY5 A;  2YR2 A;  2QSF X;  2ZME C;  4BKX A;  2ZPH B;  2ZZD B;  1X37 A;  1ZMU A;  4JI6 M;  2HNH A;  3FKJ A;  4GGG A;  3WTY C;  2BW3 A;  3WU1 B;  2DXI A;  3FMS A;  2WSC F;  3LCU A;  4B48 A;  4CCN A;  1XGM A;  5LBQ A;  3A01 B;  3MHV C;  3KLO A;  4FW9 A;  4CYC A;  3OYM A;  4GC5 A;  3HTS B;  4GDF A;  4ZYE A;  3ESW B;  4LGY A;  2QZ8 A;  3GTK J;  4OW0 A;  4PSW A;  4HDV A;  1ULY A;  3P9K A;  4CA0 A;  3FTC A;  4BS9 A;  1OR7 C;  2G77 A;  4D7M A;  3MKY B;  2QDJ A;  4KHP M;  1X58 A;  2JA8 J;  4R8H A;  4ENJ A;  1MJ9 A;  4B43 A;  3N4M A;  5IOZ A;  1W7P D;  1NK3 P;  4XLE A;  3S2W A;  3G6E I;  1HNW M;  5DM7 F;  5FSW A;  1ZRD A;  5IT3 A;  2Z3Y A;  4L4U A;  2RRE A;  3FZV A;  3SJM A;  3K2L A;  2FUG 2;  4F93 B;  4BY1 X;  3OYC A;  1P92 A;  4DYC A;  2LDU A;  1A5T A;  2E7W A;  2FQ4 A;  3ROU A;  2LYC A;  3OYI A;  3HYI A;  1QVT A;  2DA6 A;  2GXB A;  4F55 A;  3KX2 A;  1BR1 A;  1WGX A;  4F70 B;  1H9T A;  1BW5 A;  5J4Y A;  2H27 A;  3DBL B;  3LST A;  4RM2 A;  3J7Y J;  2L4M A;  2L9R A;  4GFB A;  2LNH C;  4A3E J;  3JSP A;  1OKS A;  4I98 B;  3KSX A;  2VL8 A;  3O2P E;  4FX0 A;  1VZ0 A;  2H6C A;  3CLQ A;  3JCU C;  5KNL A;  2KHH A;  3BLR B;  3Q8X A;  3ZMZ A;  1VFC A;  1K79 A;  2FJ1 A;  2YQZ A;  2JSP A;  5B3S H;  3SBJ A;  3VKG A;  1YYV A;  3U6D A;  3C7J A;  3ZQH A;  4MEX F;  5ITQ A;  3CJN A;  4NB5 A;  5DQV A;  4WCG A;  2FFJ A;  2DAI A;  3MKZ A;  5FLV A;  5HDN A;  4IHW A;  2ZM6 M;  3RZO J;  2UZD B;  4OIP F;  1D5V A;  4FCT A;  2V7F A;  1Y6I A;  3OL4 A;  2HEO A;  2WC2 A;  2OZ6 A;  1Y8G A;  3ASN H;  3AV0 A;  3GLF A;  1TH3 A;  3U61 B;  2DME A;  4UHT A;  1MBF A;  3DF8 A;  3G1O A;  1XMO M;  2EJS A;  1ON2 A;  3GWZ A;  4FVM A;  3LSK A;  2DA3 A;  4W5W A;  3HHW A;  2TCT A;  4HV6 A;  3HU3 A;  4FD2 A;  3E6B A;  1AIS B;  2H8W A;  1NV8 A;  2IPQ X;  3BCB A;  3F8B A;  3N05 A;  5ICP B;  1L2D A;  1WXQ A;  4HF1 A;  1BOB A;  2B0L A;  2IJL A;  4AVP A;  5E1X A;  4G7O F;  4KRC B;  3V42 A;  3GLG B;  4PJN A;  3K70 C;  5FGK B;  4E7H A;  3EID B;  2XPU A;  3DDP B;  3K9T A;  3GTM J;  1NY5 A;  2QQ8 A;  3BG5 A;  4PGH A;  1LPQ A;  5FRO A;  1IRG A;  2HQR A;  4HEA 2;  1Z5B A;  1I3A A;  2QCO A;  3IP4 B;  3M7G A;  1EJ9 A;  3C9P A;  2FU4 A;  2MBF A;  4BJT A;  3AG2 H;  4DBR A;  2X1C A;  4ZC3 A;  3ZQF A;  5E17 F;  4MGH A;  3I55 I;  5E1W A;  1HT1 E;  2EV5 A;  2KRU A;  4IEJ A;  3OS2 A;  3FTD A;  3CMA I;  4B44 A;  2V1D A;  2F5V A;  3HOS A;  1FTT A;  2ZPF B;  3BQZ A;  3A1Y A;  1EH7 A;  3BG7 A;  3WHL A;  2QHO B;  2DO7 A;  3FHZ A;  4WXC A;  4BCN B;  2COB A;  2APL A;  2EIL H;  4EOQ B;  5KPT A;  3LVW A;  2G7H A;  2KRC A;  2ZJP F;  1J59 A;  4GMQ A;  4HOB A;  4KIG A;  2NVQ J;  3HOY J;  4B8X A;  1WIV A;  3F8M A;  1ZH5 A;  1W7P A;  2QWW A;  3M1C A;  2JRT A;  5BPV A;  3TQN A;  1JXS A;  2OC6 A;  5C4J J;  5FTM A;  1PJS A;  3PSF A;  1ZG3 A;  3RGP A;  3T8T A;  2QBY A;  1LQ1 A;  1L0O C;  1XCB A;  3IV5 A;  2R4E A;  5BPI A;  2DD4 B;  3ZQL A;  1MN3 A;  2CQX A;  1I6X A;  3K2Z A;  2KZS A;  2NS7 A;  4M3F A;  3CUQ A;  3TE6 A;  1XMX A;  1P7J A;  1W5C C;  2CO5 A;  2DMP A;  1G8P A;  4EAT A;  2HGC A;  2QA4 I;  3ZP5 A;  2KFD A;  1WRJ A;  2VKH A;  3H1C A;  4Y72 B;  3R4K A;  3OYJ A;  1JE8 A;  1DU0 A;  5CQE A;  1QZE A;  2D1V A;  1EV7 A;  4CCL A;  3V7S A;  2D0Q B;  3DOA A;  3F22 A;  3UZU A;  2CQN A;  2IAI A;  5B1A H;  4PSX A;  3LSI A;  3F6O A;  4HNV A;  1WSU A;  5IP6 A;  5E3O A;  2VII A;  2LRD A;  1PKD B;  2HTJ A;  5IP7 J;  2KJB A;  3U60 A;  3FXL A;  2DYR H;  3LSP A;  1RI7 A;  1B4A A;  1L2B A;  2HQ5 A;  1ENW A;  2K9D A;  2RAE A;  5D5W B;  1J09 A;  4GYG A;  2E2H J;  2IW5 A;  2F6C A;  1KFV A;  3RPU D;  1YLF A;  2QLZ A;  2L6O A;  4GYI A;  2VUM J;  3VSK A;  3A8M B;  3SYT A;  4DV1 M;  3A8L B;  2ETH A;  3D1N I;  1UG2 A;  3EUA A;  4M9X A;  4I6Z A;  1VDL A;  4JI8 M;  2G3Q A;  1AWC A;  5I5Z B;  3UNG C;  3TGN A;  3W2V A;  5TRD A;  1DGG A;  1XSV A;  2W57 A;  3E6C C;  3DJB A;  2VOP A;  1MU5 A;  4FE7 A;  1V34 A;  3FK6 A;  1XWI A;  2WFY B;  1IBM M;  2YUS A;  2PJR B;  4Y15 A;  3QZ5 B;  4PCZ A;  1OYY A;  4EV0 A;  1WPK A;  1QNT A;  2HYJ A;  2VKD A;  5IYB J;  1EF4 A;  4RGR A;  2OAZ A;  2KA6 B;  2OCE A;  2Z9O A;  2R7X A;  4KO8 A;  3MVP A;  3CCE I;  4GXO A;  2IRF G;  3AG3 H;  3SQN A;  3WU2 C;  2G5G X;  2CCI B;  4TV7 A;  3J7A O;  1YTY A;  4LRT A;  4KN4 X;  2G9X B;  2BY3 A;  3GTQ J;  2W96 A;  5CVI A;  3EYI A;  2PG4 A;  4BBA A;  1WJA A;  2E5L M;  3PSI A;  1F1Z A;  1KZH A;  4A2U A;  4KUM A;  4KYW A;  3BLY A;  3K10 A;  2MD0 A;  1VIN A;  5FKK A;  1GUU A;  5TGT A;  3S32 A;  1H89 C;  3SZP A;  4ETS A;  4XID A;  2K7L A;  5ITX E;  3SEZ A;  2HDD A;  4P96 A;  3LMM A;  4EOO B;  3ZOB A;  3QP5 A;  3IUO A;  3IHP A;  3W0F A;  2HOT A;  4XNF A;  1JQJ C;  4EOM B;  2R7T A;  1G3N C;  2UUC M;  5GP9 A;  1K78 B;  2DAO A;  1GT0 C;  1QLB A;  2DWM A;  2PMU A;  4BH9 A;  2WIH B;  1WJ7 A;  3QYH B;  1NTC A;  2L9N A;  3QRF F;  1BJA A;  2BW3 B;  1APL C;  3V8K A;  2JT1 A;  1VQO I;  1GXP A;  1KXU A;  2OBP A;  2IS4 A;  4LJA A;  1ETY A;  3HX3 A;  2YX7 A;  3BQY A;  3QOD A;  1AUA A;  5ILS A;  2L3D A;  4RLF A;  4CYC B;  3KOZ E;  1E94 E;  2EJR A;  3KET A;  2QSH X;  2F5C A;  1N32 M;  3U6M A;  5LHG A;  4EOP B;  3RKY A;  2CHQ A;  2K47 A;  3KLN A;  4YFN F;  4LIT A;  3OYF A;  2HYG D;  2R7F A;  2L9V A;  1XNQ M;  1N77 A;  1V4R A;  5HS7 A;  5DCM A;  2P0W A;  4FTH A;  1HA8 A;  2HXO A;  2DHR A;  1SAX A;  2DMT A;  5K5R A;  3GPP A;  3GLI A;  4U7D A;  2F2E A;  1O4X A;  2OA4 A;  2FBK A;  4E7J A;  1JUS A;  1S72 I;  1GDT A;  3V7R A;  3GCM A;  2P5K A;  2JNH A;  2IXS A;  4BBR J;  4WK8 F;  3I4V A;  1YJW I;  2M4G A;  3BR5 A;  1N33 M;  4MIM A;  4IRI A;  4RB1 A;  3CF0 A;  1F43 A;  4EMS A;  4RB2 C;  1IXC A;  1NHW C;  2LWX A;  2LH9 A;  5HVQ C;  1IDZ A;  1H25 B;  1OAO C;  2R44 A;  3KFU G;  1U2W A;  1PJJ A;  4E6K G;  2KMG A;  2BHZ A;  1AKH A;  2JZY A;  3M03 A;  2LNB A;  1UM8 A;  2FS1 A;  2L7I A;  3A0H C;  5JI6 A;  3GQ4 A;  2R7Z J;  4DNC A;  1IRX A;  2BOL A;  1T0F A;  2ESN A;  2M5W A;  4G6L B;  4WWC A;  3LFK A;  3T1B A;  1JKO C;  1YQA A;  3RPU A;  2DD5 B;  4HSR A;  1T33 A;  3M1E A;  3NWL A;  1BN5 A;  4CSW A;  2PQ8 A;  4LLG F;  3VDP A;  3S93 A;  3UR3 C;  3CC4 I;  2L09 A;  2ZTC A;  2WB1 N;  2F4M B;  4ZYH A;  1ETX A;  5CYI B;  2HDW A;  3T1H M;  1MH4 A;  2CH0 A;  4HPQ A;  3FUW A;  1MSE C;  3O3K A;  3HOW J;  1T95 A;  2RN7 A;  3RPQ A;  4I5S A;  1K3X A;  2F5O A;  5DUK A;  4DBQ A;  3GLF B;  1GH6 B;  5M3F J;  3AOE A;  4GHA A;  2RVC A;  4Y4R A;  1AHD P;  3CD6 I;  4BCO B;  4A0Y A;  1B8I A;  4CFU D;  3E97 A;  1E3O C;  3R9X B;  1GY3 B;  4BNC A;  2W24 A;  1E9H B;  2XB0 X;  2ELJ A;  1R7J A;  3KVW A;  1JR3 D;  2C9O A;  1QO0 D;  4KT6 A;  1QVU A;  3CF2 A;  5HS8 A;  2M7B A;  1RU3 A;  3GVA A;  4OGR B;  3KOW E;  1W36 C;  2KZV A;  2F5S A;  1GVN A;  2MC3 A;  3VYR B;  2P8T A;  3Q0U A;  5HNB B;  2PN6 A;  4JX6 A;  2OTL I;  1ZAO A;  3NAU A;  1XS9 A;  3OMY A;  3KE2 A;  2GIV A;  1QAN A;  2MSY A;  3GX4 X;  1FYM A;  2COM A;  2X4H A;  3HJQ A;  2XF6 A;  2WMB B;  1ZKG A;  1ZQ9 A;  4JK1 X;  2L4E A;  2XAQ A;  3HRS A;  1TW3 A;  2CCH B;  2BJV A;  2ZCF B;  1KQ9 A;  3F21 A;  2E2I J;  1YIT I;  1UGQ B;  1X4P A;  4QHS A;  2JSC A;  2CZ7 B;  4F2L A;  3V8L A;  2YR0 A;  5IT9 S;  5EXS A;  5KAF C;  1F4K A;  2R92 J;  1KU2 A;  5F0F A;  2EA0 A;  3MEX A;  3NWS A;  4HAM A;  5JLW A;  3U21 A;  3IWF A;  3MFK A;  3W3C A;  3VWB A;  2I40 B;  2VE8 A;  4G7H F;  3ZXS A;  1FJL A;  1J5E M;  2O7O A;  3IAS 2;  3AL0 B;  4UB6 C;  2R0Q C;  4IVN A;  2Y0S N;  3CJQ B;  3CF5 F;  1JKQ C;  1UGP B;  3RDI A;  1VQP I;  4EVI A;  4ENN A;  3L1P A;  4OB1 B;  2WAQ N;  1G71 A;  3AKZ A;  2L9S A;  1Z3Y A;  2DW4 A;  4XSX F;  5AIQ A;  3H4C A;  1QQW A;  3ZR8 X;  1W7P B;  1JKR C;  3OS0 A;  3HOU J;  4RAY A;  3KW6 A;  5LGN A;  2KZG A;  3WTS C;  2CP8 A;  2BGC A;  2HVQ A;  4MTE A;  1ZMV A;  1OPC A;  1F5T A;  2QBY B;  2M8E A;  4KFC A;  1Z59 A;  1HT2 E;  2EA4 A;  2EH3 A;  2KLO A;  1LFB A;  4YII A;  3GQ5 A;  1OCP A;  2F5E A;  4M71 A;  2IGO A;  1KON A;  2D45 A;  2KDO A;  3MWM A;  5HLH A;  1XO2 A;  2IGN A;  4PK4 A;  4FE4 A;  3CUQ B;  2O3F A;  4BBS M;  3FM5 A;  3KP6 A;  4U0W A;  1I6H J;  3FXO A;  2ZSH B;  2CWB A;  2Y21 A;  2VC0 A;  3R61 A;  2R7O A;  2FEZ A;  2XKP A;  4KT5 C;  4LJZ F;  4MO7 A;  4XBF A;  1Z21 A;  1YRN A;  1W5T A;  4LF4 M;  1FMW A;  8CAT A;  2KNZ A;  1ONV A;  2CJJ A;  1TTE A;  1PJI A;  3ERM A;  4A3F J;  3BHV B;  2CHG A;  1Q1H A;  1JT0 A;  1OMI A;  3GPU A;  2XF7 A;  4I01 A;  3T0Y A;  1HDP A;  4YIF A;  1MBJ A;  3JRI A;  1WWX A;  2XF5 A;  2E1O A;  3QOP A;  4P5O A;  4IHV A;  2V6C A;  4L0Z B;  1FC3 A;  3U60 B;  4EJO A;  1ZQ3 P;  4BCI B;  5CVJ A;  3E0J B;  3HC7 A;  2A07 F;  2GM4 A;  5JLX A;  3BOQ A;  3BHU B;  1YSY A;  3J2P B;  1TQM A;  3J7B A;  1NO1 A;  5DFL A;  1YS7 A;  4GKK M;  3M9A A;  1VEK A;  3TNI B;  3M8J A;  4BQQ A;  1N4M A;  3TO7 A;  2ZPG B;  4D80 A;  3FK7 A;  3BJA A;  4BQO A;  2JWS A;  4FCY A;  1MJG M;  4B7F A;  1WJD A;  2K27 A;  4BE0 A;  4PDK A;  4ESB A;  4X66 M;  3JTG A;  3GLH E;  2JJ7 A;  1Z77 A;  3VDU A;  2NOJ B;  2W85 A;  3SDG A;  1HLV A;  3ZN0 A;  1T98 A;  5EXP A;  3U1K A;  4NNJ A;  4M3D A;  3FIW A; 
#chains in the Genus database with same CATH homology
 1V29 B;  2ZPB B;  2BS2 A;  3HZJ A;  3WVD B;  3WVE B;  4OB2 B;  4AKI A;  3HHT B;  3QZ9 B;  4JX6 A;  2QQ8 A;  3QYG B;  3BG5 A;  2WJ9 A;  3QWL A;  1UGR B;  4M6V A;  4MFD A;  2ZCF B;  3VKH A;  3KHI A;  4P17 A;  4FM4 B;  4NC6 A;  4AI6 A;  2ZZD B;  2ZPH B;  1UGQ B;  1QLB A;  2CZ7 B;  4LOC A;  4OB3 B;  3QYH B;  2CZ6 B;  4ZGD B;  2ZPF B;  1IRE B;  3A8G B;  4ZGE B;  4AKH A;  3BG3 A;  3X20 B;  3BG9 A;  2BS4 A;  4HL4 A;  1UGP B;  4JX4 A;  3TW7 A;  2G77 A;  2DXC B;  2QDJ A;  4OB1 B;  4ELJ A;  4BBR M;  2CZ1 B;  3X24 B;  3H4C A;  3HB9 A;  3HBL A;  4AKG A;  4HNU A;  4HLQ A;  2DD4 B;  3QXE B;  4Z6Y A;  3VYG B;  2KR6 A;  1AHJ B;  1FKM A;  4BBS M;  4MIM A;  1E7P A;  4QSH A;  3QYB A;  3A8O B;  3X25 B;  3TW6 A;  2D0Q B;  3QYE A;  2KMG A;  4HNT A;  2QF7 A;  3A8H B;  4JX5 A;  4MFE A;  3X28 B;  4ZGJ B;  2ZPI B;  4HNV A;  2AHJ B;  2QFZ A;  3VYH B;  2DD5 B;  5EJC A;  3VKG A;  3X26 B;  2CYZ B;  2DXB B;  3A8M B;  3A8L B;  2QDY B;  4OB0 B;  2BS3 A;  2ZPG B;  1UGS B;  3DL1 A;  2DPP B;  3HO8 A;  2ZPE B;  2CZ0 B;  3QZ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...