4NC6A

Tbc domain of human rab gtpase-activating protein 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
ETWGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tbc domain of human rab gtpase-activating protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords Rab GTPase-activating protein 1
total genus 113
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4nc6A02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 4nc6A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4nc6A03
3QYBA 3QYEA 4Z6YA 4HLQA 5EJCA 2QFZA 2G77A 4NC6A 3QWLA 4HL4A 4P17A 1FKMA 2QQ8A 3HZJA
chains in the Genus database with same CATH superfamily
1W36C 1LB2A 2DZNB 5E3NA 4YOOA 1AUAA 1JTXA 1YW8A 5EG0B 4BCJB 1W98B 5JI3E 3S17J 2WADA 3TGNA 4RAGA 3WHKA 3FHNA 4RM3A 4LZZA 3SAVA 5AIPA 2VF8A 4NRVA 5D5XB 1GVDA 3MY5B 1S3JA 4EONB 1YUBA 4GC5A 1PUEE 3HHHA 2VLAA 1UMQA 2D2WA 1ZGWA 1YIJI 3S1MJ 2HL7A 4Q5SF 5DD4A 3EUHC 3QWLA 1FIAA 2DA2A 2XGXA 2WAQN 4XSZF 2E35A 2MD5A 1ZR4A 3CO6C 2C5XB 5HLGA 3P7NA 3M8JA 5CQEA 3GLGE 1FBUA 3DU5A 5FO5A 2CV0A 2RVCA 3RTRA 2STTA 4NSRA 4G6QA 1ZRDA 2EV0A 1Z67A 4AW4A 1MZBA 4HNTA 2HTJA 2BJWA 2KW0A 1MBKA 1E9SA 1O9KA 4XKBA 5FD5A 2K9NA 3D5LA 1O57A 5FRNA 4PCZA 4RGXA 4MNUA 2QM3A 4MEYF 3LVWA 4IBFA 4IMYB 2YPRA 3W67A 4B43A 3A0BC 2XF7A 5LGUA 1H1SB 1D5VA 2OTLI 3GLIA 2OZUA 1UJ8A 4M71A 4C2MJ 2KZUA 4P9UA 3BLQB 5EEGA 1K83J 3E3VA 3GRYA 2IW5A 3I58A 2L9RA 2ME0A 4CFWB 2CO5A 3SZPA 4XSXF 3C2GA 1ZARA 4BCKB 4XIDA 2KA6B 1JGSA 2HXIA 3SJMA 4BY1J 5E20A 4CIZA 4M3BA 3N97A 3GLHA 3GP1A 1TWCJ 4RAZA 4B7HA 1FVVB 1R4NB 1EF4A 3CC7I 2LKPA 2KIMA 3DP7A 3BTJA 3OYNA 5DQWA 1U9NA 2VIXA 1BIBA 1LEAA 3WU2C 3CGWA 4AU7A 2BPMB 2EJRA 1S7AA 1ON2A 2ETHA 1XMAA 2FMLA 3S3OA 1HR0M 5EF6A 2KNVA 2HYFA 1Q39A 3Q9VA 1OCOH 3OYBA 4S05A 3GLGA 1F1ZA 2DZLA 5KCMA 5HS8A 1RUNA 1NNJA 1J59A 1L1ZA 2C96A 4Y52J 1QRYA 3TL4X 1XTAA 3LAPA 4C2UA 1A35A 4N9IA 4AI6A 1HJPA 1UNGD 3BROA 2I7NA 5EP3A 1RUOA 2W48A 3A98B 3OMYA 3KYCB 3AL0C 2CMPA 2UZKA 4H0EA 2JA7J 3S15J 3UK6A 2DN0A 2Z7JA 1XNRM 4IBDA 5DYMA 5F08A 4S0HB 4BEHA 1ZMVA 4ANRA 1ZKGA 3PNVA 2EFNA 3UR3C 3E6CC 3T1BA 3IV5A 4MB7A 4UHTA 1PP7U 2O3FA 3AV0A 2MLGA 2DXIA 1WJFA 4OX9M 1LFBA 1NVMA 2JSCA 5H6QA 2GQFA 2A5WA 4B3AA 4C3HJ 4OR5B 4QHTA 2V1CA 3QYEA 5C3EJ 3H4JA 1JI8A 1LVKA 3HB9A 1UELB 2CRUA 4L16A 2QKLB 1H1RB 4A3EJ 3F3XA 4ETSA 1I1SA 3BR3A 1DGHA 1Z59A 3FUXA 1OYIA 1KYIA 2ZFWA 3PSIA 4HF2A 2UXBM 1KU7A 4IZZA 3A8LB 2K40A 4IOAF 1LNWA 3T15A 4Y17A 4NOOB 3ZCBB 1Y0UA 2QBYB 3ZGKA 4DZPA 3EIEA 2L3DA 5DD8A 5AIQA 1BA5A 2PHGA 4IKFA 2KRCA 4N9HA 1P5EB 3Q0VA 3M3YJ 3ERMA 4KLNA 3GLIB 3PNYA 2H1KA 2BW3A 2K4JA 3N05A 3LSRA 4HV5A 3H36A 2OV7A 3VDPA 5E8GA 3L28A 4HL4A 5C4XJ 1AD6A 3FD9A 1BI2A 2LWXA 1X1PA 2E2IJ 3BT9A 1TGUA 3DFGA 2QQ9A 2CUZA 2RGVA 3HSFA 3I71A 3V8JA 5LLQA 1IC8A 4XBOA 4BQAA 3QP6A 1PJRA 3MMPA 4RB0A 1R1TA 1W36D 4IOCF 3BDDA 4PGHA 4XMYA 2P5TA 1FJLA 2GZWA 5F04A 3FUTA 5BPVA 1PUFA 4UV8A 4XKWA 3ECOA 3GF2A 4GDFA 3SHFA 4A3DJ 5C1BA 2Y21A 2IRFG 1VDDA 4CJ6A 5LGNA 1REPC 3ISPA 3B02A 3GCMA 3BQZA 2PMIB 4YELA 3LMMA 4CRLB 4HOBA 1ZG1A 3C18A 2FH0A 1GLNA 3G73A 2RC4A 3M4OJ 2ZMEA 5ITTA 3GO5A 3H0DA 1ENWA 1WI9A 3RE8A 3BHUB 4EOKB 2FBIA 4KNYA 3WHCA 5HBJB 4GH9A 2R4EA 5EZGA 5FROA 5J4YA 1LJ9A 3K4CA 4FM4B 1CF7B 1Z6TA 4KT6A 2F5PA 5FTKA 1QYRA 2KP6A 2F5VA 3MD2A 2QSGX 5GTHC 1L2CA 4CXFA 3U60B 4QNRA 4EORB 3RKWA 3S93A 1T95A 4IX7A 2JNHA 1UHMA 1ZG3A 2OD5A 2VE9A 3GFLA 5ILVA 2ZZDB 4NB5A 4L5JA 3OL3A 3RYRA 2LNHC 1Q3BA 2I40B 2HS5A 1U9OA 2ZPIB 3RGSA 1XGNA 3C7JA 4NNJA 2DLLA 3JRAA 4G4RA 4IJFA 1V29B 4LZJA 1IRZA 5IPAA 4KYWA 1XXHB 2V9PA 1MJAA 4L9JA 3CCYA 4LJZF 4CFVB 4NQWA 1K4SA 3S2WA 5JI6A 3HRMA 1E3OC 4AKIA 2RNGA 2L7ZA 2R93J 2P6SA 2CWBA 3KZYA 4RDUA 4A3FJ 2DAEA 2E2JJ 3E21A 3KPHA 3WTZA 3LSJA 4M0WA 3TW7A 3ZQ7A 1OQYA 1QAOA 2V6ZM 1HKQA 1HNZM 1ZTRA 2GQQA 5DCMB 3T8TA 1ODDA 3QAUA 1B59A 2OJED 3CF0A 2O7OA 5GKNA 4B7FA 2VXZA 1IN8A 5J40A 4ZYGA 1QBJA 4BCOB 1IAWA 1W1WE 3KP1E 2X1DA 1GABA 1VZ0A 3DFZA 1RKTA 3OIQA 3OSFA 2EH3A 1FYKA 3WVEB 3ASOH 4E4HA 1N78A 2QGSA 4XR6A 1KA8A 2BEOA 2RNJA 1XMQM 1LUJB 4JP0A 1OFIA 1J5EM 3JR9A 3TNWB 3L29A 3W2WA 1KFVA 2DVWB 3KOWE 5KQ8A 3L9FA 1ACIA 1KGSA 4HF0A 4ZTFA 1FOYA 2Y75A 3AJIB 2G3QA 2GM4A 4M9SA 2ELKA 3VFDA 2FX0A 2DFEA 1YS7A 1T39A 2OQRA 2QCOA 1TFBA 1GJTA 4HV6A 3QRFF 4XORA 1DGBA 2XEPA 4U0YA 2XVCA 3CUQB 4M3DA 3TMOA 4FHTA 3WTYC 2WXVB 2BZTA 2W2HA 1TDHA 3GX4X 3MZHA 2J5PA 4BH9A 3X24B 3V42A 4EM2A 1ZREA 1H4LD 3FXLA 2WB1N 1DGWY 4I8OA 1TWGJ 2XF3A 2LLKA 2R44A 2RV8A 1Z21A 4RBOA 2PK9B 2LNBA 3V4GA 4BXFA 4FWDA 1WJCA 2DENA 4EC8B 5K7FA 1JHFA 2VQHA 2CCHB 1D3YA 4MM3B 4A0YA 3IL2A 1WFXA 2EKKA 4EVIA 5IF1B 5BQTA 2DBBA 2W4SA 3V7SA 1WHCA 4X65M 4L6V6 2V6CA 3FXKA 3S3NA 3LVVA 3QOEA 2X4AA 4EOMB 4EATA 2IGMA 5K5QA 2NS0A 3VLFB 2TRTA 1IUYA 2E71A 5LHIA 2B63J 1R2YA 2K27A 3RGPA 2M3AA 2DPPB 3F72A 4BAYA 4Y13A 2G0EA 2ZTCA 2OTJI 1ETKA 2DYRH 5IYDJ 3MKZA 3KW6A 3F21A 2WMAB 3VSKA 5B1BH 4OVZB 4B48A 1XS9A 1R6RA 3ABLH 3GPXA 3Q9SA 9ANTA 5J1YA 3A46A 4LJ7A 2UU9M 2M7AA 4A69C 5E8IA 1RNLA 2ISZA 4JI6M 2H5XA 2IT0A 2EJSA 4YIRX 2VC1A 4OGRB 4GFBA 1ZMUA 3FK7A 1X19A 3CC2I 1GKIA 3T1HM 1AKHB 3HDDA 3KCCA 2A3SA 3A8MB 1TF0B 3C3EA 4X0GA 4Y72B 2VJIA 3WGHA 5HVQC 3A01B 2H09A 3PSFA 1QVTA 2EZIA 1B6AA 1TZLA 1U8BA 3D5RC 3HKZA 1DV0A 3TP0A 1XDSA 3RYPA 4L5EA 3BR0A 5C44J 3BR6A 2YS9A 1XCBA 5HQ0B 3I04M 3KS4A 4KJZA 1H88C 4BCFB 2K9LA 2IS4A 4F70B 3C9PA 4P9FA 5D6EA 4LFAM 2BY0A 4KMUX 1R5GA 4M3GA 1HDPA 3RJPA 1H26B 2WV0A 8CATA 2Z4SA 5BPDA 3S1NJ 1O9KB 3QXEB 2DWNA 3HJEA 3OYGA 4BB9A 1QGPA 2C9CA 1R22A 3DV8A 5KHDA 3W0FA 3HOVJ 4F92B 1IF1A 4ANJA 1DPRA 2LK2A 2GLOA 4DV4M 1P92A 5K7HA 4BJ6C 3WHLA 2KHHA 2FQ4A 2H6BA 3E0JB 4L9NA 2Z9OA 1SFXA 3R0JA 4M73A 4CFXB 3IC7A 2CS3A 4GRIA 4G4OA 3ESWB 3TP3A 4XRSG 4LLNA 1G8PA 1QZEA 2FE8A 2L2DA 3FKEA 5D8LB 3EIHA 3CCLI 3QHRB 3ZPLA 4UNOA 2ZXHA 2M60A 4OVZA 2M5WA 3SFIA 4F3QA 2E36A 2O61A 3QYGB 4R79A 2LBFB 1FZPB 4X62M 2BJVA 3GQ5A 2JK3A 4OOIA 5LBQA 4LJ9A 2P5KA 2ZBKA 1GHCA 1T38A 2CHVA 3HRTA 3DXJF 2P5LC 2QQ8A 1IBKM 4XN0A 2FMYA 4YEJA 4GCVA 2IGNA 3EUKL 3VYGB 1YW7A 4XRMA 3WTSC 2YNMD 4I09A 2IA2A 2NOJB 3PUFA 2RGOA 4X1EA 1NH3A 5ICEA 2R7DA 5IOZA 2XZUA 5E17F 5LMKB 4M3FA 2XLJA 1F4IA 1BJZA 2IS1A 1IBMM 2Q8KA 1HA8A 1IM2A 3R4KA 2CQXA 2X49A 2HZDA 4BCMD 2WAEA 4F7JB 4XLPF 5L3DA 1FP1D 2J7NA 5IT9K 3A4CA 3SZGA 3KETA 3MFKA 4F52A 2OOBA 1SVMA 3CTWB 2XASA 1IUFA 1SAXA 1EV7A 4WF2A 5KAIC 1W0UA 1TTYA 1KZHA 1K82A 1BI3A 1RETA 3BLRB 4LG3A 4LF8M 3K10A 2R0QC 4BL0B 3CF2A 3I4VA 3M07A 3PO2J 2J5YA 2R65A 1OCRH 2WAFA 4BUPA 3HL2A 1Q1VA 2LSOA 4IRGA 3T8RA 3VYTB 3CCQI 3FZVA 4II7A 1SVOA 3NWLA 1TH2A 2UXCM 3KS8A 1YJNI 3QU6A 4CUGA 1EE8A 1N75A 1VQ8I 1RC9A 2LKSA 4PK4A 3Q0WA 3ZXSA 3LAJA 2DXBB 3GO8A 2QF7A 1Y56A 3PFYA 3JRBA 4RLQA 5JLXA 4FX4A 3F9KA 1WR1B 2UZDB 3J80S 4BY7J 2VPLA 1R4GA 4ZYAA 3RDIA 4QLCU 3I56I 3G33B 4D0PA 1STZA 4XGIA 4IBIA 1ZYRF 5EP4A 3M1EA 3TWKA 3DJBA 5DTDA 3ZMDA 2COBA 2AHQA 4X66M 3VFZA 3W2AA 3HHXA 3G4SI 2EZLA 2WB1A 4EOJB 4YG2F 1H9GA 1BJAA 4QWQA 1DP7P 2FSWA 2LHCA 4EEFG 2HDDA 1KSFX 1TQIA 4B3XA 3DPTA 4F55A 4KICA 5LEJA 1IY0A 3CJTB 2ZTDA 4M0DA 4MO7A 5BPIA 4LD5A 3REOA 3J7AO 5J1RA 1VQ6I 1GUXA 1JQJC 2GWRA 3BLYA 1Z6RA 5F1RA 1KU2A 2L01A 1FOWA 5IOYA 2DODA 2F6CA 4EJOA 1HBXG 1MKMA 4Y3OA 3RZDJ 4P17A 5LEKA 3CLOA 2TCTA 4XLEA 3W6JB 5I5ZB 3HBLA 1VEKA 3B7QA 3L09A 2BGCA 1A04A 2K7LA 3B9PA 2CW0F 1SXJA 1S6LA 3FIWA 2DMEA 1D8KA 4Y28F 4LFBM 2V79A 1ZAOA 5EJCA 2CGPA 2DTRA 2NS7A 3EYIA 1TTEA 4IIWA 1IGNA 4BHBA 1KONA 2O8XA 4HDUA 2QHOB 1S7OA 1RRJA 3U6QA 3SXYA 1X2NA 4MTDA 4YFKF 1VQKI 2CHQA 3WVDB 3AOGA 4E7JA 2DD4B 2PJQA 2QYOA 2LXEA 1MBJA 1QHHD 1MU5A 2DWLA 2EA4A 2GIZA 4JQFA 1QQWA 5ITRA 3ERED 3CCSI 1E7PA 3EIDB 4LGYA 4BQNA 3ZRGA 3BTIA 1MBGA 5LD2C 5E1XA 3VK8A 1X37A 2WZJA 4REZA 2IN3A 1TQMA 4RMNA 1KYWA 4HAMA 1W0TA 1TWHJ 5KPTA 1X2MA 1MJGM 4QSHA 2NVQJ 2XDVA 3J7BA 5HNBB 1IXRC 3ZQLA 3L25A 1LKXA 1EFUB 1M1EB 1V55H 3SYLA 3CQZJ 3FDYA 3LSIA 4HBLA 5HDGA 3EYYA 3SYKA 3H1CA 1K78B 4I2OA 2G7UA 4CXAB 4F1IA 1YHQI 3MKLA 2JGZB 4HZFA 3RI4A 2EFQA 1H28B 1PJIA 3JAMS 1KQ9A 4R1HA 4UB8C 3LA7A 2OUMA 4AVZA 3S16J 1JKRC 4WK8F 3CUOA 2VT2A 4P16A 2P81A 1FP2A 4BE1A 3D0SA 5L3EA 4MTEA 4IEJA 3GUDA 3K4MA 3PIPF 4E7IA 2N8GA 3E5XA 3FWEA 4H4KC 2OQ4A 1A5TA 2KHMA 2V4JC 2HVRA 3Q8XA 4AZFA 2IXSA 2MABA 2DA6A 4ZYEA 2EWNA 4ZC3A 3OYMA 5FTJA 3WE3A 2LH0A 1TW3A 2KRFA 4TTHA 3J27B 3LFUA 2XKPA 3HXLA 1IY1A 4F93B 4FWGA 2DA7A 4CFMB 3GRUA 4OB0B 2JY5A 3MVPA 2E34A 3U21A 4FVMA 1BL0A 3K9PA 4I3ZB 2JPCA 3VYSB 1L2BA 3I54A 4O6JA 1DDNA 3HHWA 2V26A 2DA4A 1SVLA 3BJAA 3BOQA 4XONA 2RRUA 5H20A 2JZ0A 2HXOA 2LF8A 4YRVA 5FJ8J 5HVYB 3CTAA 3B89A 3K4KA 3H92A 4AD9A 1PKDB 3A8GB 1WJ5A 2KJCA 1IV6A 1T6OA 3JRFA 1P4WA 2XAFA 1TT0A 4KO8A 2WTEA 1XMKA 3E5QA 2W7NA 3WGIA 3UKGA 3QPTA 3Q5FA 1OKSA 1JJ8C 1J9IA 2QDYB 2DPDA 1VQOI 3IKTA 2HEOA 1HDDC 3LL7A 3FYDA 3K7AJ 4BYYA 2VQFM 2WBMA 4R7GA 1R1UA 1GXQA 5EZHA 2UXNA 3ILKA 5BNGA 3SAUA 1XMXA 4PSWA 4DV1M 2V1NA 2AO9A 3BC8A 1POGA 4Y15A 5E79C 2L7KA 2XRLA 3T6PA 2DFIA 2RREA 3KP2A 3ABKH 3MN2A 2GOMA 1E2XA 4MEXF 1BC8C 4BNCA 3MIAB 4ZYDA 4AKGA 1A31A 4I7HA 5ITXE 1P6RA 5M3MJ 4G7HF 1Q1HA 5KPRA 2VOOA 1MMAA 2AXTC 4XLNF 4FT8A 2OA4A 5J8FA 2PG4A 4M6XA 5E3MA 1X1AA 3OYKA 2C5VB 4FCTA 2QSHX 4PJLA 1H89C 3THGA 4U0VA 1FIPA 3GQ3A 5KVRA 2EIJH 2UXXA 1T0FC 3UGJA 4FISA 3RQ4A 4XQFA 5CYIB 2HOSA 3O8HA 3M6AA 3KSJA 2FOKA 3BBZA 2L9VA 3HHGA 2GA2A 2G77A 1EH7A 2C99A 4G8XA 1R7JA 1U2WA 4HX8A 2F4IA 1W7PA 1GV2A 2XUBA 2DXCB 1OI9B 3PXGA 1FX7A 3ZCOA 4R8HA 4MGIE 1G4DA 4ELJA 1SXJD 1ZG5A 1G41A 2BY3A 3CF5F 2IGKA 2LG4A 3J7ZI 1GDTA 2C98A 5DM7F 2HQNA 3TQNA 1NV8A 3SASA 3C3DA 4P5OA 1LQ1A 3I64A 4A3BJ 4G7OF 3TDUC 1LPQA 2MROB 2MC3A 2VN2A 1ZH5A 1RIOH 1SD4A 5IYBJ 2HQ5A 3GTKJ 3V7RA 3GTOJ 2M4GA 1D8JA 1XO2A 1IDYA 2K85A 1YX3A 2EB7A 2JWTA 4HQMA 4EV0A 3OYIA 3CJRB 2B3TA 1WJEA 4IPAA 1U78A 3TO9A 4MH0E 2MGQA 2L0KA 5KAFC 4JYAM 4V2FA 2H1LA 2CZ6B 4XOPA 2Z2SB 3P5JA 2GXBA 3JRIA 1R23A 1TH4A 1ZQ3P 2X6YA 2JZ1A 5EGOB 2DNAA 2GBYA 2DHYA 1MBFA 2VBWA 4GO1A 4JI1M 3W6VA 2QZ4A 2W9FA 1HC8A 5ERIA 2DTZA 4HLYA 3S8PA 2XF5A 3HGYA 4BDYA 1OGUB 3FK6A 1AOYA 2G5GX 2FNPA 3FM3A 4DV0M 5D5VB 1MIJA 3FXJA 4KIBA 4PJJA 3FYCA 1MDMB 2VODA 4D82A 3K92A 2XSZA 1G59A 2EINH 2O0YA 3BR5A 3GRRA 1Y8GA 1XSVA 3CDLA 3CLQA 1TH3A 3VYRB 3VSLA 5B1AH 1GJSA 2BVLA 5FLXS 4ENNA 3RKQA 2XB5A 1HLVA 1W5CC 4JI3M 1VINA 3ZN1A 3NBIA 2QQAA 2JA5J 3U6SA 3ELKA 4EC9B 1F5TA 4ZGJB 2E19A 2C5NB 3WODF 1KYZA 4DBQA 1OMIA 2D5VA 3H3ZA 5GAEJ 1D5YA 4DOZA 4MLOA 5TGTA 5L3CA 4NRWA 3S2DJ 4EOSB 3Q8GA 4F7LB 4CICA 4NSTB 5EXXA 2W24A 3U6DA 3HGIA 4FCYA 1XMOM 1ETVA 1SMTA 4BY1X 3DDQB 4EJVA 3L00A 1G8XA 4KMFA 3MZ8A 4AUXA 1HOMA 2RKHA 2HOTA 3PVSA 4JN6A 2KKOA 1USSA 5M5XJ 1A6IA 3PL8A 1D0LA 1QHGA 3P9IA 4AWXB 2MH8A 1J5YA 2NQ8C 4RF1A 4IL6C 3ZQGA 4YC3B 4AKHA 2KR6A 4F7SB 2LVPC 4LG0B 2LMDA 3TQSA 3PQKA 3KEYA 1UAAA 1NJGA 1I94M 4IXAA 4F91B 3R8FA 2QLZA 1S29A 4AYBA 3K4NA 1K78A 3OWTA 5LRRA 5CVIA 5CVUA 1NHAA 1PP8F 1R5ID 1OIZA 1SD6A 3I3LA 2L9NA 2M7BA 2YUSA 3LQ5B 2I8DA 3BQYA 1OTRA 1ZK8A 1N32M 3DL1A 3C3WA 2R7OA 1F9NA 1U3EM 2Z99A 4G9YA 2M5ZA 4PJNA 3U6CA 3J2PB 1ZV1A 2R3SA 4S04A 4XLCA 1QMZB 3TPZA 3NWSA 2KMGA 4RAYA 1OPCA 4HRIA 2O5RA 4D81A 2K86A 1I39A 2PK2A 1MNEA 2R7VA 4KN7X 2DU9A 2M8GX 2M1BA 4LJ6A 1K79A 3K7AM 4FX3B 4B09A 1ULYA 5F6FA 1JSTB 3PFIA 3KZIC 1D0YA 3K2LA 5L3BA 2WHBB 4IBGA 3TWLA 2CQ7A 2NXNB 2DAKA 2TDXA 5DDGA 1QVRA 4GITA 1C0WA 3IECA 3RFWA 4OMYA 4M9ZA 4ITQA 2CZ1B 4OIPF 5IWAM 2R4JA 5DV5A 3AKZA 4AVPA 5E3OA 1TQPA 5F0CA 5K5OA 1JXSA 1D0KA 1E94E 1QDTA 2WPAB 2Y20A 4BE0A 2AHJB 3KP7A 4XBFA 4CISA 2XPUA 5DEQA 1OFHA 1JE8A 4BXUA 1FSHA 3CP2A 3GQ4A 5HLIA 2DD5B 2F4OB 1P4XA 2J5OA 1HSJA 2CQQA 3ASNH 4A93J 4L0YB 2HVQA 2VL8A 3E5UA 2WWYA 3B57A 3QZ9B 2PX9A 2VASA 2K3PA 3E6BA 3JTHA 2ELJA 1FWZA 2FOIC 4OIRF 3PO3J 3QAHA 1N36M 1Z0XA 3BG7A 1G3TA 2Y69H 1H1PB 2OPFA 2VBYA 1XX5A 4ABZA 1NO1A 2Z16A 1YLAA 1X1DA 2LY2A 2W85A 3HKZN 3ECHA 4QPQA 3IG8A 1SAUA 2BY2A 2XAGA 5IT3A 1YOVB 3QQAA 1B8IB 1QUTA 2L02A 3H0GJ 5CKTA 1WJAA 1KXUA 2CYYA 3CJNA 4XKVA 4P96A 2ME6A 1APLC 1BW6A 1VG5A 1GUXB 4J01A 5D8KB 1TNTA 2CQKA 1BR1A 1V5GA 4ZGEB 5F3WA 1RI7A 4CZZA 3W68A 4AG5A 3EQLF 5GP9A 3JSPA 1QNTA 2HQAA 1QAQA 2F5NA 3M7GA 2HR3A 2CYZB 1VQ5I 1VFCA 2GNOA 2GXGA 1MH3A 3QP5A 4NQWB 5HOOA 3S2HJ 1USTA 4JBAA 1EIJA 3E1SA 2XROA 3SAWA 2DJIA 4JI0M 1WHUA 3V8LA 1SFOJ 1R5HA 2XPWA 3FMQA 2DOAA 3BTCA 4IHSA 3FKIJ 2O03A 5JHUA 5ITYA 1Z3XA 5TISC 5GPCA 2HKJA 1XSXA 3IRQA 2P4WA 1E3HA 3BR1A 3ABUA 2ZPGB 2E7XA 3NAUA 4IF4A 1IXCA 1FTTA 2EIKH 3DOAA 1MW7A 3K9TA 2GAUA 1Y8QB 1ETQA 2Y0SN 4B08A 2ESHA 5E1WA 1I50J 2XSJC 4UVAA 3CESA 4ZDPA 4LJ8A 4N0BA 2RDPA 4WWCA 2AQEA 4YOZA 2M30A 1XWIA 3LSTA 4WXHA 5HNHA 2D1VA 1IDZA 3GLGB 3OIPA 1I6XA 2UUZA 2YQZA 3DF8A 1IXSA 2K0BX 2JJ7A 4I5SA 1QZYA 2XRNA 2L4FA 4OU0A 1V54H 2CCIB 3BHTB 2CV1A 1IXZA 2EFPA 2Y0SA 2E60A 2VBXA 4CCKA 2HDCA 4OW0A 3LCVB 5EXPA 1VEJA 1BM9A 1HW5A 1U8RA 2LF7A 4ZYHA 3BTLA 1JHHA 1CUKA 2ID6A 1DGFA 2KXEA 4YFXF 3HOWJ 2KDZA 4DR1M 4QNMA 5BS6A 4B44A 1BI0A 4M9XA 4DR4M 3PIOF 3RZOJ 2MSYA 1F36A 1DP3A 1YTYA 3BJ6A 1I4WA 2ZBKB 1WJDA 2QA4I 2JY7A 1I3AA 4GGGA 4OINF 1T43A 4B8XA 4DUYM 2R7WA 2CJMB 4KRDB 4KRCB 2R7TA 1GY3B 3ULQB 1TW2A 5IP6A 5J3LA 4PUSA 3X26B 3EUAA 2ID3A 2XC7A 1CQTA 5ICFA 2B9SA 4EJUA 4E7ZA 2C5RA 3HSEA 5DCMA 3HG9A 4MGRA 2LDUA 5FTNA 3DKXA 2D7HA 3FUVA 1OAOC 3L27A 1X3WB 1F5QB 2F4MB 1KQ0A 2QENA 3L2VA 2HQRA 3FTEA 2W57A 5LHHA 4RGUA 1U5TB 2JWSA 4RM2A 1YFHA 2ZFUA 1Z3YA 2CSOA 2BV6A 2WIHB 1I1GA 2XSZD 5DYGA 1E9RA 5H37D 1HSTA 2M87A 1Z5AA 2ZSIB 4NUBA 3F8BA 1NK2P 2R4GA 2OU2A 2R7ZJ 2JY8A 2F5DA 1Y39A 5IT9Z 3F5XB 4ZZDA 3DPUA 4BU2A 2Q1ZB 2LW4A 2MR9A 4YIIA 1ZQ9A 3DA1A 1HXDA 4BCQB 2RQQA 3ZMTA 2JN6A 3A8OB 2JQ7A 2JRMA 3K69A 1W7PB 2A61A 1YW9A 3SARA 2XAHA 4XK4A 2P7CB 4BGDA 4ZDOA 2IW8B 4PSXA 3POMA 4DR3M 3MEXA 3FTDA 5ILUA 4DR2M 4XICA 2A68F 2DAIA 5HBHB 1S8NA 3V7CA 1JUSA 1HW1A 4GIPA 1Z5CA 1MNMC 4CCJA 1BVSA 4ITVA 2L7IA 2KNAA 4BS9A 2LVAA 1R71A 1CF7A 3I4YA 1H24B 1ORKA 1ZP2A 2WA0A 2BYVE 1XCVA 3IG5A 1IRFA 3F8CA 2PMHA 1ZLJA 3W2VA 1S7EA 5JLWA 5DFLA 5CLSA 1CGPA 1PDNC 3QHWB 3OYAA 3F0CA 5B3SH 1IV8A 3K4LA 2JA2A 3HU3A 2BHZA 4HDVA 3OS1A 3JCUC 3N4MA 1NNUC 2F2EA 1TBXA 1FMVA 1BC7C 3DWLE 2UZLB 3FHZA 3KP3A 1Z91A 2ZPHB 1A36A 2Y0TA 5IT9S 4JI8M 2BE5F 1SXJC 3M8EA 2KJBA 3K1MA 3O3KA 1S72I 1I6HJ 4JX5A 1SEUA 1URCB 2IPQX 1SC7A 2HGCA 3K1PA 2XAJA 3ZMUA 1Z5BA 4KDPA 3P9CA 3OSGA 3OYEA 4CA0A 2ZPBB 2MFZA 3CUQC 3H3UA 5IYCJ 4N4NB 2R7RA 2O9LA 4ZH4F 1UB9A 1G4AE 3GLFB 2OOAA 2JA6J 1DPUA 2DQRA 2LBCA 4V2GA 4MGYE 2VPRA 4MGZE 2FJ1A 2CFXA 2M45A 2X1EA 1UGRB 3VEPA 1E17A 4I4LA 3KZZA 3MZYA 4L9VA 5ICCA 4BBSM 2XB0X 5IREB 4I0BA 3OYDA 3HHTB 1SFUA 3K1NA 1N34M 1OLTA 3KP6A 1W4MA 4EGZA 2VONA 3B7NA 4WXDA 2LC2A 2Z4RA 4O5VA 3H5NA 5GPAA 3TKYA 5J4VA 3DTOA 1FPQA 4BQOA 1VQNI 4BCGB 1IQPA 1NHGC 4X64M 1XB4A 5M5YJ 2M34A 5FFXA 5C4JJ 1XSDA 5HBEB 2X1NB 4JI2M 1ITYA 1V5EA 4UN0A 4PDKA 4FWHA 3IAS2 3MKYB 2LVOC 3RSNA 2D7GA 4ENKA 2W99A 3HIFA 2NRAC 5IZ7D 1GT0C 1XC8A 5M5WJ 3VDXA 4RB2C 1YLFA 2BY1A 4UY8I 3EOCB 2HOEA 3IH2A 2W96A 2ZC2A 3V8KA 5FGKB 4G4QA 4RAFA 5HDKA 3JR4A 4RNAA 1EKEA 3HJQA 1FSEA 3L7WA 4EJTA 3HOTA 2VJJA 2DA3A 4ZGDB 4HSTA 2C4GB 1ONVA 1H0MA 2E1OA 4RB1A 4C30A 5LQFB 1V3FA 2K9QA 3HPGA 2W00A 3COAC 3U5ZB 4LF4M 4B7GA 2R7UA 2PJPA 3FRHA 5EFQB 4EM1A 4CH7A 3G2BA 4BE2A 3HOUJ 2JT1A 4R71A 1LV7A 3F8FA 2EK5A 2M8EA 2G9XB 1TD6A 2F4VM 4AG6A 3D1NI 3OY9A 4MGHA 4JXJA 3KP0E 2LTUA 1AA7A 1RKWA 2FBKA 1VQMI 4C2TA 3KLOA 3E6MA 4ESBA 4ZPXA 3L2WA 2K4BA 3QU3A 1FLIA 2K6BA 1LVAA 1MMNA 4MHGA 1X58A 4BCHB 2C6TB 4U88A 5J47A 3HZJA 2JMWA 1N4MA 2W1OA 3ZOBA 1B72A 1R9TJ 1FOXA 4BBRM 3ZH9B 1WGLA 3NARA 3WU0A 1ZGJA 3U60A 1WJBA 4BBAA 2YSRA 3BG6A 4OWRB 2KIFA 4UV9A 1YQAA 1QZMA 4ZJZA 1PUFB 5FTLA 4HYEA 4MQ9F 3DBHB 2HKOA 3CCUI 1E32A 4IHWA 1RU3A 1VYWB 2L2OA 4PFPA 2NYXA 4B47A 1VQPI 2HKXA 1QU3A 1JUPA 2BNKA 2BS2A 4UXNA 3OS2A 1NTCA 2DT5A 2Z3YA 2X6WA 2VDBB 3CCMI 5FKLA 1C1KA 4JI5M 3NQOA 4Y4RA 2FNAA 1R49A 3DTIA 2H6CA 3FX3A 3MCZA 4L15A 3E4RA 2F5FA 2R5ZB 2Y0QA 2E7WA 5E3LA 2D1HA 1MJ9A 1XB2B 3I59B 1S9HA 1Y0NA 1O7FA 4LK0F 1U5TC 1K61A 2G9WA 1PGYA 5F27A 4U87A 2LKXA 3MK6A 4AQYM 2KISA 1PJJA 1T6SA 5EP2A 3J7AS 4FASD 5KNLA 2AS5F 1C9BA 3L2RA 2NVYJ 1P9QC 1OCPA 2XGNA 3BP8A 2ZJRF 1AKHA 1QA6A 2C6YA 4LG2A 2Z33A 5KQDA 2MG4A 5L3GA 3KYDB 3LSMA 3KOXE 2LOOA 1FEXA 4A3JJ 2V22B 3H4CA 3BJOA 4BQQA 4CGYB 4LOCA 3A0HC 3WG7H 5LMNM 1B1BA 1QQIA 4E7LA 2ZJPF 4FD2A 4NHJA 2HYGD 2L7MP 3BZKA 1VQ7I 4M6YA 4IJAA 1Y1VJ 3L1PA 1P7JA 1N77A 4IBJA 3RPUD 5K5RA 4BCPB 3S32A 2MH9A 3RPUA 4HNVA 3DBRB 1PRBA 4ENMA 2KQRA 2NOGA 4KN4X 2DDAA 4NC7A 2IVMA 2ECBA 5D6FA 1GUUA 3NEUA 4EGYA 4IJEA 2CH0A 2VOPA 4GMQA 2WSEF 2R5YB 6PAXA 3MI9B 3T5XA 3IAM2 5A2QS 3GYHX 3OYHA 4PJ0C 4GXOA 1JGGA 5AONA 1DU6A 1K7AA 4CCNA 4CO8A 1ON1A 1SD5A 1R36A 5L3FA 5ICPB 2CRGA 2WC2A 4JX4A 5KPZA 1E9HB 3BCAA 3A03A 2VE8A 2D7EA 3O6BB 3MWMA 3QODA 3TE6A 3E6DA 2F48A 1J09A 2AHMA 4AIDA 4A3MJ 1MMDA 1O3SA 3UNGC 1B9NA 2DHRA 2K9SA 1VQLI 4LFUA 3GLHE 2A6TA 4BJ5C 2DMPA 1N33M 2XPVA 3KP4A 2N35A 3SMSA 2PMUA 2V9VA 1LDJA 1ZLKA 2VC0A 1QZZA 3K4JA 2AQFA 2BHYA 2EV6A 4NXNM 1UGSB 4DR7M 1ERDA 2WIPB 4JV5M 2EZHA 4PCQA 4PFOA 3A1YA 3K8ZA 4KT0F 2PN6A 3J81Z 4L0ZB 2IS2A 3M0EA 3J81S 3J80K 1RZ4A 2HAKA 5DM6F 3KVWA 3VWBA 3HRUA 2L09A 2X0LA 4Y7NJ 3WTUC 3FTCA 1DGRM 2FD5A 3HU2A 5E1ZB 2VKDA 3FMRA 2NNNA 2UUBM 2LFBA 1ZN2A 2V1DA 1SFEA 4DYQA 5JVTA 2LVNC 4UN2B 1QO0D 2PFBA 1AU7A 2W25A 1XD7A 1L1TA 3JAMK 5ITXA 1X3UA 5F0FA 4IQ4A 3GLIE 3PUBA 1FOKA 4JI4M 2EA2A 3KDSE 2DK8A 2DFHA 4BLCA 2EQRA 2YU3A 3GPPA 4I81A 3AG2H 2H8RA 1FTZA 3LW5F 3TNHB 1GV5A 4F6WB 1NK3P 2LREA 1VF9A 1RR7A 4W5WA 1T8IA 4UB6C 1E0EA 3GFMA 5DUIA 1IG7A 3GTPJ 4LF9M 1JR3A 4LIVA 4LJ5A 4CYCA 1FYLA 4Z6YA 1WIVA 1XNQM 1SXJE 5EQTA 1WWXA 2HNHA 1H1QB 3SATA 4Z8XA 1NG7A 2A69F 4V19K 4ROEA 2IW9B 2DKLA 4KT5C 2CUJA 1PJSA 2QVOA 4ZZLA 1OJLA 3HTSB 1UNLD 4DIQA 3BHVB 5ACBA 3IWFA 1H9TA 2WJ9A 2X6OA 5F1JA 2WEVB 5KK1A 1OFCX 3TDZC 5J6XA 2R45A 1P4AA 4EIWA 1FBSA 4WURA 3CCVI 4G3OA 4A0ZA 4AC0A 1MMGA 1NY6A 1O4XA 4A3CJ 3PQJA 4LB6B 1QVUA 3HO8A 2MGWA 4RA2A 3HKPA 2VXDA 5JHFA 4AIJA 2F5SA 2LBFA 2QKMB 4FTHA 2C5OB 2JTVA 2KLOA 2X48A 1AWCA 1BIAA 2Q2EA 4E6KG 3FXUA 3W3CA 3GTMS 3K4BA 4HW0A 1KQ8A 5D5UB 1A6QA 1V4RA 4CHUA 1YJ9I 1MMSA 3GBGA 3H9JA 2YU9J 2VI6A 3OIOA 5FTMA 2R0IA 3L2QA 3DLAA 2VIIA 4HNUA 1LEBA 2GOXB 1QPIA 3TWMA 5E26A 4YFNF 1X1CA 2GA1A 1RR8C 2WSFF 3A45A 3U9GA 4NDLA 1D0XA 3LOCA 2PMZN 4OB3B 5LGTA 5DNYA 3HY5A 3CZ6A 1HKSA 1X3ZB 3DQVC 3O8GA 3QYFA 4B1RA 2D0QB 4LGMA 3JAMZ 3CMYA 2ZB9A 3F22A 1EA3A 4PZJA 4LIUA 3MJ5A 5A2QZ 3EETA 2VJ4A 3WTTC 2X4HA 2OBPA 2ZJQF 1K6YA 1OYWA 3R61A 2IW6B 4CZCA 5LFAA 3J7YJ 3G1LA 3SDBA 3GTGJ 2COMA 1OIUB 1KU3A 2E1MC 2IGOA 5BMZA 5HS7A 4UVBA 2PJRB 4IBCA 3ZP5A 1U0JA 2GIVA 4C3IJ 4W97A 1VEGA 1S5LC 3DU6A 4BHCA 1H8AC 1QUSA 4GKKM 1IO2A 1XDUA 3WG9A 1UFZA 1GO5A 4I02A 3T38A 4G94A 2XSDC 1PM5A 2NVUB 2V9KA 2X6XA 1I5ZA 3SZTA 4EOPB 2DMTA 3SQNA 2Y0MA 3HHZA 2EBIA 1FKMA 1QPMA 4DV7M 2HI3A 4HLQA 1R2ZA 4E7KA 2H94A 5LRSA 1QAMA 1OKRA 1IN7A 3A2KA 5M3FJ 4M72A 4IBBA 3GXOA 3CP8A 1NV9A 2R7FA 2F5QA 4OAYA 1L0OC 2CFOA 4A3VB 2UUAM 3H35A 2CW7A 5TJJA 4B3SM 2DO7A 5HODA 1T98A 1OIPA 4IVNA 4M3EA 1NY5A 5CVVA 2E5ZA 1AHDP 3B74A 4HX4A 2KFDA 3S1RJ 3DOGB 4DW6A 2O8KA 2DT6A 4DNCA 4DV2M 2BBYA 4XM3A 4JX6A 2O6GE 2CZ0B 2FA5A 2LHGA 2MBFA 3KLNA 5B66C 1A5JA 2K47A 4A6DA 3OYJA 4A0XA 4Y33A 3J80Z 4L9TA 3ZR8X 2CE7A 1FC3A 3BOSA 3FTFA 4FE4A 1OR7A 1JSUB 2NVTJ 2W84A 4GKJM 3JW4A 1Z9CA 3ZQIA 2L4EA 2O25A 2DAOA 2BS3A 1QDRA 2XGCA 2PMZA 4IHTA 3DEWA 2WY8Q 2HPMA 5CVRA 2UZBB 3OOPA 2NS8A 5JR3A 1YG2A 3L26A 1MX0A 2VKHA 1YRNB 4CHTB 2R5YA 4OMZA 4KIFA 3GLHB 4LF5M 3UMMA 5ED4A 1ZHFA 2Z3XA 4RS8A 2BXZA 2JXNA 3K1JA 4MIMA 4K2EA 1G3YA 4DZJA 4NSOB 2ZM6M 1G71A 3HEFA 3SC3A 2RAEA 3KIOA 1LTMA 3LA3A 2M2EA 2G7HA 2LD5A 2OC6A 2KRUA 5ITQA 4L18B 4F2LA 3WTWC 1BU2A 2PJRA 3HOYJ 4D1QA 2L7FP 2CJJA 1SFKA 4QOZC 1UGPB 2HCBA 3FUUA 2EZKA 3FE3A 3OL4A 4A3KJ 2DFFA 4RF0A 3EUHA 4XLHA 1JT6A 1TC3C 3UJNA 3B6AA 2HVSA 4IHXA 2B9RA 1G3SA 3SBJA 4OB2B 1Z05A 1T56A 3R60A 2LVSA 2P5VA 3MMYB 3DEUA 5FRMA 1MGTA 3F92A 2YR2A 5JFRA 4AM3A 1IN5A 3JRDA 3M1CA 4LY6A 2KZGA 5H6RA 1XXHA 2D45A 1YX5A 2A6EF 3DPLC 2ISYA 1B4AA 4LK1F 1H27B 1L8QA 3H5RA 4HA8A 2HZTA 4XN3A 4IO9F 3JRCA 2FXAA 5EYRA 4F6SB 1G3WA 3CCJI 3U6MA 3KEQA 3FF5A 1UZCA 1ETWA 5EP1A 3FKJA 1Z7UA 3QPLA 3BXWA 1ENHA 2E5NA 2DT7B 3WHBA 4BDZA 2LRDA 3GTMJ 4XOTA 3E97A 1GVJA 2DWZB 4Q47A 4NC6A 2CW8A 3GFJA 2XV4S 1MBEA 4CFUB 1EH8A 1K3WA 3VOEA 1K4TA 1YE9A 2WSCF 4LFCM 1OKVB 3HU1A 1JKPC 3EDPA 3SHGB 3ZQFA 5CVJA 1L3LA 5HLHA 4XKCA 2DAMA 5J1UA 2BKZB 1R4MB 4RKUF 1JTYA 1WQ2A 2MYSA 2PEXA 1VQ1A 3BZCA 1EJ9A 2Z1DA 1BI1A 5D4RA 4OIOF 5EXSA 4B3MM 1ZGAA 3D5SC 3U6OA 3FXOA 2XZFA 1LFPA 1ZELA 3CUQA 2UUEB 3GZ5A 4IHVA 3W0LB 3U6PA 1WGXA 3BG5A 1MJBA 4I0AA 4RB3C 3IRRA 2UZEB 4GHLA 1K3XA 4HF1A 4QTRA 3NWTA 4ELLA 1IN4A 2RQPA 2YX4A 4EMSA 3JREA 1F4KA 2GXAA 1WPKA 5GAGJ 4LMYA 5ILSA 3G71I 2ACJA 2VQLA 3FBNB 1R00A 2UWMA 4OU7A 4CCMA 3I4NJ 1DU0A 2EIMH 2FU4A 1Z1DA 1R7RA 4HG2A 1OL2B 3D8LA 1OYYA 2BWEA 4JK1X 4ON0A 4LJ4A 3F6VA 3HHYA 4MFEA 5FB2A 3GLXA 3UZUA 3CCEI 4X6AJ 2HFHA 3K9OA 3HSRA 2L54A 3GPYA 2XGEA 4DYRA 2HYJA 4QHSA 3GZNB 2G8LA 2JY6B 1UCRA 3O2PE 2F5EA 2FF4A 5FLMJ 2OF7A 3DTKA 4FCWA 2HTSA 3VYUB 5B5EC 2Z8YM 3F23A 2LVQD 4XL9A 4BCMB 1J0RA 4EOOB 2ZNZA 4OAZA 1DGGA 3ZQQA 1WXQA 2DJNA 1JKWA 3HUGB 2VKEA 1OIYB 4XNFA 2QSFX 2CU7A 2X85A 4O3MA 1D1BA 1UG2A 1BOBA 3VPRA 3L2AA 3FUWA 4K0KM 2EO2A 5EGOA 3KOYE 2Q0OA 4L8RC 3M9AA 4LITA 4D7MA 5FLXZ 2KT0A 4FX0A 2EUFA 1UNHD 4XLFA 1UFMA 3KHIA 2ZNYA 3U2RA 3MHVC 3A02A 4HEOA 2KZVA 1JUMA 1ZMWA 2HOAA 3LQQA 1K6OA 5FGMA 1PYVA 2ZSHB 1MDMA 3CMMA 1D1AA 3GLFA 3KX2A 1R6BX 4FE7A 3QPHA 5E18F 3FRIA 3BWGA 5DYIA 1OCCH 2STWA 2BS4A 3HYIA 3X28B 2R7QA 1WH5A 1SXJB 3OOUA 3CMEI 2BXYA 2FFJA 4HX7A 1H25B 2X8AA 5FFZA 4LLGF 2DMNA 1PJTA 3B6CA 1UGQB 2XGDA 1FJGM 2ZMEB 2H1RA 3BLHB 4QPOA 4LRSA 2E1MB 2WAQA 2WV1A 2XAQA 1V92A 1MNDA 1T2KA 3JSOA 3VKGA 1P2FA 3C2BA 4G4NA 3AL0B 3QOPA 1Q02A 3AOEC 2PI0A 2HHHM 3CDHA 4Z2YA 4Q7JA 1FYMA 2DDBA 3AOEA 3DCFA 1G6NA 3BR2A 2EPFA 4IRIA 4BCNB 4RODA 3R9XB 4LCBA 1R1VA 1IRXA 3HUGA 2W9ZA 4EOLB 2LH9A 1R58A 2JVHA 1T3TA 1JKQC 3I5UA 4I98B 4LRTA 1FBQA 4I99C 5GTIC 3PJRA 1DUXC 1FINB 1AISB 1H6UA 3LNQA 3FISA 4OB1B 4DV5M 3HOZJ 3HTUA 1XC5A 3GW2A 4GYIA 2H8WA 1YO5C 1IRGA 4FW9A 3TO7A 3X2QH 3EJ1B 2A6HF 2OCEA 4EOQB 2ZANA 4ROCA 2BWBA 1LDKB 2QCUA 4L78A 1B9MA 3GWZA 2DZOB 3LSPA 1ORYB 2P6TA 2M4KA 1KU9A 1VTNC 2EILH 3F8MA 3X20B 3HM5A 2KL4A 2ESNA 3SFZA 2E5LM 3P9KA 4P55A 3ABTA 2A5YB 3Q0UA 5IDNB 1LDDA 4DJAA 3QYBA 3GTLJ 5EG0A 3I51A 3R6SA 4ESFA 3OV8A 1TDZA 3LA2A 4U7BA 2P7VB 4DR5M 1WZ2A 3HJSA 1YIOA 4LF7M 5LHGA 2V6EA 2Y9ZA 3QYHB 4NC8A 3C1DA 1TNSA 5CJ9A 2H27A 4Q48A 3JRGA 3KSXA 5GAHJ 2CEAA 3FMSA 3U1DA 5ICGA 2CG4A 2JVGA 4D5CA 3NDQA 4CYDA 4KA4A 3GLFE 2KIQA 1UM8A 1N25A 3QZ5B 4QIWN 3SMPA 1UHWA 2QQBA 5F0HA 2IEKA 2EKFA 2PQ8A 2M9HA 2R7XA 4LF6M 2QWWA 2VQGA 3ZMVA 2LY1A 5CYVA 2F5OA 2VQEM 2Y2ZA 3SEQA 2QP9X 4EQQA 3HX3A 4A5MA 2EFOA 5DQVA 1C7YA 3NRVA 4B3RM 4LGWA 1AIPC 4WX9A 3C2HA 2CUEA 5TRDA 2W82A 4TUWA 2DI3A 4PJMA 4U0WA 4YIFA 2R7SA 5DUKA 1D2NA 2NAZA 1VQ9I 2Q2EB 2F5CA 4B3TM 1BOAA 3BG9A 3GEZA 1V34A 2VF7A 1GH6B 3G6EI 4CYCB 1DO0A 3G1OA 4KFCA 2JUCA 5BOXA 3I01M 3BPXA 4HPQA 1NSFA 3E46A 4JI7M 2CUFA 1P7IA 5HNFA 2K5CA 2LR8A 4W1UA 3DTEA 3CF6E 3E9SA 3CO7C 1W5TA 1IW7F 2HPIA 1EH6A 2IA1A 2OPTA 3OYLA 4B4CA 4MQVA 4Q4ZF 4L5IA 2QBYA 2DA5A 3H9QA 4EM0B 1YITI 5BNJB 4BHPA 2ZPEB 3RQIA 3PNTA 1OAIA 4A6EA 2I10A 3JRHA 1UG0A 3TO6A 1XGMA 1X1BA 3U6LA 5HLTA 3WE2A 2FS1A 1JJ6C 2ZKZA 4EOIB 4NL4H 4YY3M 2DMQA 2EUCA 1O7LA 1HCRA 2KNZA 5H2FC 1T0FA 1TWFJ 4NXMM 2E1NA 2QGUA 3WTXC 1I3QJ 1LE8A 5JVGF 5D4SA 2ECCA 3KP5A 3KE2A 3ZQJA 5BR8M 3FBIB 3IHUA 3ABMH 1GVNA 1O3RA 1GXPA 4DGWB 1XGOA 3A42A 2KPMA 2V7FA 4I01A 1TL8A 3F6OA 3KEOA 1MD0A 2DQLA 2DPUA 3U61A 3OR1C 4BY7X 2L5QA 2MC4A 3T1YM 3DDPB 3EPZA 4PDGA 2FBHA 3GZ6A 2HWVA 5C18A 5LMUM 1OL1B 4XLAA 2PLYA 2RN7A 4LLLA 4IQJA 3J7AY 1NHWC 1ETOA 1DGHB 2L4MA 4KITB 2ZPFB 2OQGA 2DOFA 4AYBN 4BXXX 3PM1A 1E3PA 4ESJA 3IH4A 3LSHA 5K1YA 3S1QJ 2DI0A 5GADJ 2BOLA 1B8IA 3I9V2 4A3LJ 1IN6A 1OKWB 5EEAA 1QANA 4BCND 1XXHE 1FNNA 1X4PA 2OCCH 3CC4I 1PJQA 3VB2A 2VQCA 4DBGB 2L9SA 4PGGA 1VOLA 3DBLB 3S3MA 4NBQA 2RKOA 2FEZA 3LSGA 2HDWA 1HNWM 3IWZA 1OCZH 1YSYA 3LFKA 1L2DA 5FKMA 2EV5A 3RIRA 3H3VK 1TWAJ 4KODA 1J2XA 3ZN0A 1Z77A 4J19A 1HT1E 3OS0A 1GL6A 4BCIB 1GL7A 3GLLA 2DOEA 4XK8F 3NBXX 2ICWG 3FXMA 3TBIA 3W6KB 4F7NB 5HDNA 1ZAEA 4PT5A 2ZAMA 5L2WB 2JPBA 2FOWA 1OISA 2ZAOA 5EXTA 1P3QQ 2ELHA 3G3ZA 4WP2A 4GC9A 3H9GA 5D5WB 2MW8A 3K70D 2NNYA 2X51A 3AAFA 2FE3A 1YJWI 4F6UB 2IP2A 3GPUA 3CCRI 2P0WA 3MQ0A 3ZQCA 2Z5UA 1WGNA 2QDJA 1IJWC 2LY9A 1V33A 5FD6A 2E2HJ 2XF6A 2MJ5B 2A07F 4GYGA 4M6VA 1F43A 3C58A 3U61B 1NG6A 3ML6A 4R3DA 2NVXJ 4CFNB 2FRHA 4LG0A 5IP9J 4G12A 1IREB 2XAUA 1RESA 2L6OA 2Y31A 3SDGA 3QPSA 3HOXJ 3KXEC 4AIHA 1JKOC 2UXDM 2CHGA 2UV1A 5CEIB 4A5NA 2E1CA 4GEWA 3VKHA 1I27A 3FM5A 3DKWA 1MH4A 4D80A 3HJ8A 5IY5H 1D1CA 1IFYA 4IBKA 1HQYE 4CCLA 3IHPA 3SEZA 4CFUD 4DV3M 4UUTA 1SD7A 2VBZA 3HC7A 1FY7A 3IH3A 2ZCWA 1T33A 4G6TB 1U5TA 4G7ZF 1VNDA 3RPQA 4BBSJ 2BVMA 3S14J 2DK5A 4LJAA 4DYCA 3Q3SA 3CMAI 4JYKA 1MSEC 1U6GA 3IP4B 4IHYA 5FLVA 1Q3CA 3SYTA 1WH7A 4C3JJ 1WCMJ 4KUMA 1WJ7A 1V5FA 3VYHB 3IUOA 3G1MA 3J81K 2HU9A 1BR2A 2M0CA 3AG4H 3GRVA 2ZMEC 4TV7A 4DUZM 4FETA 4UUSB 2B0LA 2KIUA 4BACA 1XHBA 5A2QK 2DMUA 5EEHA 2F2CA 2DA1A 3LWFA 4LB5A 3KOZE 2KRHA 2L7HA 1WSUA 3MAJA 2K9DA 3RKXA 2KDOA 2YFQA 1BBYA 1ZRCA 2KZSA 2HWJA 4BKXA 1HF0A 1BR4A 3B7ZA 1O3QA 2R92J 4KISA 3M8FA 2XIGA 3I4MJ 4PD2A 3HGGA 2OAZA 2IJLA 4DR6M 2JP7A 1W7PD 1J75A 5FKKA 4FQGA 3KFWX 2Y30A 4JOMA 1G3NC 2IBDA 2DCEA 3B73A 1JT0A 3DKYA 2ZJ2A 2XKOA 1W5SA 1VI0A 3LQRA 5CQGA 2R46A 2WFYB 3WTVC 2CQNA 3GVAA 3I0TA 4XRFA 5FKOA 2RGHA 5L8RF 1IXSB 2R62A 4BBRJ 1WI3A 2YX7A 2ZXWH 4D9JA 2A05A 1VDLA 3GTJJ 2V1XA 2ZXJA 1G2HA 4BCQD 1WRJA 2M0MA 2LP0A 4RLFA 4G6LB 1D3UB 3GTQJ 1BW5A 2CP8A 2O01F 2V1UA 1T08B 2OZ6A 3U5ZA 2C9OA 2JUJA 2Y48A 3E7LA 1JB0F 1RPWA 3FXQA 2QNJA 4OIQF 3CD6I 1OR7C 2IA0A 4CDGA 4CSWA 1HW2A 1D0ZA 2K02A 4UVCA 2MLKA 3ONQA 2QZ8A 1SG9A 3HRSA 3TEDA 3AG3H 3M03A 3L2UA 4EJWA 1ETXA 3RKYA 2Y9YA 2WY7Q 3TOAA 7CATA 2YR0A 1TLHB 3F8NA 4P1WA 5ITUA 2CWEA 5DCFA 4U7DA 1Y6IA 4WCGA 3GFIA 3K6GA 4ENJA 5K7ZA 1SANA 2APLA 3K2AA 1HKTA 1DO2A 3T0YA 2ADUA 1D0MA 2LYCA 4F7ZA 3L2CA 1IBLM 2K9MA 2IS6A 5FLXK 2I53A 3H4MA 3TW6A 2DYSH 4I76A 1JR3D 1ZRFA 3JTGA 3I4PA 2KDLA 5KO3A 3FXRA 5IDPB 1B72B 4YHHM 4A2UA 1UHSA 2KRKA 2I5UA 2KMUA 3I55I 2PBIA 3DEEA 4D7NA 3PO3S 3K0LA 1IZ1A 3JR5A 1FMWA 3BY6A 3OTOM 2JUGA 3WGGA 4G6ZA 1ETYA 1MBHA 3ZMZA 3ZC7B 4HQEA 2JSPA 3RCOA 2CV2A 4BEHB 1DQUA 2JZYA 4IBEA 2FUG2 4II2A 4KHPM 2MH2A 2VB6A 2L4AA 4BJTA 3KYLA 3HOSA 1S3SA 1AHJB 2DWMA 5FKNA 1JOWA 4QOSA 2ZO4A 4KIGA 3D8BA 1Y1WJ 5E6JA 3BPVA 1Z7LA 4M74A 4E7HA 3U1KA 5EDNA 3DLLF 3O0GD 3HPHA 3OYCA 1WVRA 1O3TA 2XFSA 1JR3E 1OCTC 1TR8A 5IP7J 4PDIA 4ASNA 1YI2I 2AXLA 4ZDLA 3MKWB 2R18A 5IHYA 4UUVA 1LE8B 3K70C 1HNXM 3R0AA 1MN3A 3U6EA 2DW4A 1G3IA 2QUFA 1FT9A 1SMYF 3AG1H 4J00A 1HT2E 2K3FA 2KEBA 3IKVA 3KFUG 4MGKE 3I53A 2QEXI 1TT5B 2XH9A 3MY1B 4HLXA 3VODA 4G6DA 2OO9A 3WU1B 1TP4A 5DS9A 1YRNA 3VDUA 4A12A 4CGZA 5J8CA 1XGSA 5JI2E 1X4OA 1YS6A 3BCBA 3OR2C 4GHAA 1LFUP 2J7OA 4BXXJ 4HEA2 4DV6M 3TNIB 2JA8J 2FQ3A 1R5LA 4FCVA 4DBRA 1QLBA 4WW0A 3DZDA 2VJ5A 3H5AA 2P8TA 3VK7A 2XHKA 3BG3A 4A3IJ 4RGSA 2B7EA 1NJFA 2R5ZA 2CZ7B 3CJQB 4CCOA 2ERCA 2BW3B 2DAGA 1XG1A 3V76A 3OYFA 2LTPA 1HQCA 1WKMA 4RGRA 2QPAA 4C9YA 4YOSA 5HS9A 3LSKA 3TN8B 4DQ2A 4XRSA 4L4UA 1XPXA 1BN5A 3A01A 2MA3A 3AFHA 2VUMJ 4E7SA 3ZQHA 2UUCM 3A8HB 4WXCA 1Y8RB 2I7PA 5CPRB 1MSFC 5FSWA 2EA0A 1PVEA 3RGFB 2MD0A 4MFDA 1IY2A 2X9DA 4N4OB 3ROUA 3K2ZA 3X25B 4IRHA 2ZCFB 3HWSA 3CDIA 2ZXIA 4E70A 4II5B 3I59A 2EFWA 1J7KA 2VKVA 2WMBB 3BZ6A 4UUSA 2QFZA 1YYVA 2JRTA 3GMEA 4HSRA 2IAIA 1VQ4I 4A3GJ 4I6ZA 4II3A 5F64A 2R7GA 2R6FA 2X1CA 4D5FA 4S12A 3TOBA 1ZR2A 1XN7A 4ZTJA 3ZMSA 4AIKA 2IVXA 3LCUA 2XFTA 2VT3A
chains in the Genus database with same CATH topology
3TW6A 3A8LB 4M6VA 4HNUA 2CZ1B 3VYGB 4ZGEB 4MIMA 1IREB 3BG9A 3X24B 3KHIA 4JX4A 3X26B 3VKHA 4OB3B 2CZ6B 2AHJB 4HL4A 4ZGDB 1UGPB 2D0QB 3QWLA 2DD5B 1AHJB 4OB2B 2ZPEB 3QZ9B 2BS4A 3X28B 1UGSB 4HNTA 4OB0B 1UGQB 2DXBB 2QF7A 2DPPB 3VYHB 3A8OB 3VKGA 3HZJA 4ZGJB 4BBRM 3A8GB 4FM4B 4NC6A 2QDYB 3A8MB 2ZPFB 2CYZB 1FKMA 4OB1B 4HLQA 2BS2A 2ZZDB 1QLBA 3BG3A 2ZPIB 2CZ7B 2ZPHB 4P17A 1V29B 4AKGA 4Z6YA 3HBLA 2ZPGB 3X20B 2KR6A 4AKHA 4JX5A 3QXEB 3BG5A 3QYBA 2ZPBB 4AKIA 5EJCA 3A8HB 4AI6A 4JX6A 2CZ0B 2WJ9A 4MFDA 2G77A 3TW7A 2ZCFB 3H4CA 3X25B 3WVDB 3DL1A 4LOCA 3QYHB 2DD4B 3HO8A 1UGRB 1E7PA 2QFZA 2KMGA 3QYGB 3WVEB 4MFEA 4BBSM 2BS3A 2DXCB 3HHTB 3QYEA 3QZ5B 4HNVA 4ELJA 3HB9A 2QDJA 4QSHA 2QQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYB A;  3QYE A;  4Z6Y A;  4HLQ A;  5EJC A;  2QFZ A;  2G77 A;  4NC6 A;  3QWL A;  4HL4 A;  4P17 A;  1FKM A;  2QQ8 A;  3HZJ A; 
#chains in the Genus database with same CATH topology
 1W36 C;  1LB2 A;  2DZN B;  5E3N A;  4YOO A;  1AUA A;  1JTX A;  1YW8 A;  5EG0 B;  4BCJ B;  1W98 B;  5JI3 E;  3S17 J;  2WAD A;  3TGN A;  4RAG A;  3WHK A;  3FHN A;  4RM3 A;  4LZZ A;  3SAV A;  5AIP A;  2VF8 A;  4NRV A;  5D5X B;  1GVD A;  3MY5 B;  1S3J A;  4EON B;  1YUB A;  4GC5 A;  1PUE E;  3HHH A;  2VLA A;  1UMQ A;  2D2W A;  1ZGW A;  1YIJ I;  3S1M J;  2HL7 A;  4Q5S F;  5DD4 A;  3EUH C;  3QWL A;  1FIA A;  2DA2 A;  2XGX A;  2WAQ N;  4XSZ F;  2E35 A;  2MD5 A;  1ZR4 A;  3CO6 C;  2C5X B;  5HLG A;  3P7N A;  3M8J A;  5CQE A;  3GLG E;  1FBU A;  3DU5 A;  5FO5 A;  2CV0 A;  2RVC A;  3RTR A;  2STT A;  4NSR A;  4G6Q A;  1ZRD A;  2EV0 A;  1Z67 A;  4AW4 A;  1MZB A;  4HNT A;  2HTJ A;  2BJW A;  2KW0 A;  1MBK A;  1E9S A;  1O9K A;  4XKB A;  5FD5 A;  2K9N A;  3D5L A;  1O57 A;  5FRN A;  4PCZ A;  4RGX A;  4MNU A;  2QM3 A;  4MEY F;  3LVW A;  4IBF A;  4IMY B;  2YPR A;  3W67 A;  4B43 A;  3A0B C;  2XF7 A;  5LGU A;  1H1S B;  1D5V A;  2OTL I;  3GLI A;  2OZU A;  1UJ8 A;  4M71 A;  4C2M J;  2KZU A;  4P9U A;  3BLQ B;  5EEG A;  1K83 J;  3E3V A;  3GRY A;  2IW5 A;  3I58 A;  2L9R A;  2ME0 A;  4CFW B;  2CO5 A;  3SZP A;  4XSX F;  3C2G A;  1ZAR A;  4BCK B;  4XID A;  2KA6 B;  1JGS A;  2HXI A;  3SJM A;  4BY1 J;  5E20 A;  4CIZ A;  4M3B A;  3N97 A;  3GLH A;  3GP1 A;  1TWC J;  4RAZ A;  4B7H A;  1FVV B;  1R4N B;  1EF4 A;  3CC7 I;  2LKP A;  2KIM A;  3DP7 A;  3BTJ A;  3OYN A;  5DQW A;  1U9N A;  2VIX A;  1BIB A;  1LEA A;  3WU2 C;  3CGW A;  4AU7 A;  2BPM B;  2EJR A;  1S7A A;  1ON2 A;  2ETH A;  1XMA A;  2FML A;  3S3O A;  1HR0 M;  5EF6 A;  2KNV A;  2HYF A;  1Q39 A;  3Q9V A;  1OCO H;  3OYB A;  4S05 A;  3GLG A;  1F1Z A;  2DZL A;  5KCM A;  5HS8 A;  1RUN A;  1NNJ A;  1J59 A;  1L1Z A;  2C96 A;  4Y52 J;  1QRY A;  3TL4 X;  1XTA A;  3LAP A;  4C2U A;  1A35 A;  4N9I A;  4AI6 A;  1HJP A;  1UNG D;  3BRO A;  2I7N A;  5EP3 A;  1RUO A;  2W48 A;  3A98 B;  3OMY A;  3KYC B;  3AL0 C;  2CMP A;  2UZK A;  4H0E A;  2JA7 J;  3S15 J;  3UK6 A;  2DN0 A;  2Z7J A;  1XNR M;  4IBD A;  5DYM A;  5F08 A;  4S0H B;  4BEH A;  1ZMV A;  4ANR A;  1ZKG A;  3PNV A;  2EFN A;  3UR3 C;  3E6C C;  3T1B A;  3IV5 A;  4MB7 A;  4UHT A;  1PP7 U;  2O3F A;  3AV0 A;  2MLG A;  2DXI A;  1WJF A;  4OX9 M;  1LFB A;  1NVM A;  2JSC A;  5H6Q A;  2GQF A;  2A5W A;  4B3A A;  4C3H J;  4OR5 B;  4QHT A;  2V1C A;  3QYE A;  5C3E J;  3H4J A;  1JI8 A;  1LVK A;  3HB9 A;  1UEL B;  2CRU A;  4L16 A;  2QKL B;  1H1R B;  4A3E J;  3F3X A;  4ETS A;  1I1S A;  3BR3 A;  1DGH A;  1Z59 A;  3FUX A;  1OYI A;  1KYI A;  2ZFW A;  3PSI A;  4HF2 A;  2UXB M;  1KU7 A;  4IZZ A;  3A8L B;  2K40 A;  4IOA F;  1LNW A;  3T15 A;  4Y17 A;  4NOO B;  3ZCB B;  1Y0U A;  2QBY B;  3ZGK A;  4DZP A;  3EIE A;  2L3D A;  5DD8 A;  5AIQ A;  1BA5 A;  2PHG A;  4IKF A;  2KRC A;  4N9H A;  1P5E B;  3Q0V A;  3M3Y J;  3ERM A;  4KLN A;  3GLI B;  3PNY A;  2H1K A;  2BW3 A;  2K4J A;  3N05 A;  3LSR A;  4HV5 A;  3H36 A;  2OV7 A;  3VDP A;  5E8G A;  3L28 A;  4HL4 A;  5C4X J;  1AD6 A;  3FD9 A;  1BI2 A;  2LWX A;  1X1P A;  2E2I J;  3BT9 A;  1TGU A;  3DFG A;  2QQ9 A;  2CUZ A;  2RGV A;  3HSF A;  3I71 A;  3V8J A;  5LLQ A;  1IC8 A;  4XBO A;  4BQA A;  3QP6 A;  1PJR A;  3MMP A;  4RB0 A;  1R1T A;  1W36 D;  4IOC F;  3BDD A;  4PGH A;  4XMY A;  2P5T A;  1FJL A;  2GZW A;  5F04 A;  3FUT A;  5BPV A;  1PUF A;  4UV8 A;  4XKW A;  3ECO A;  3GF2 A;  4GDF A;  3SHF A;  4A3D J;  5C1B A;  2Y21 A;  2IRF G;  1VDD A;  4CJ6 A;  5LGN A;  1REP C;  3ISP A;  3B02 A;  3GCM A;  3BQZ A;  2PMI B;  4YEL A;  3LMM A;  4CRL B;  4HOB A;  1ZG1 A;  3C18 A;  2FH0 A;  1GLN A;  3G73 A;  2RC4 A;  3M4O J;  2ZME A;  5ITT A;  3GO5 A;  3H0D A;  1ENW A;  1WI9 A;  3RE8 A;  3BHU B;  4EOK B;  2FBI A;  4KNY A;  3WHC A;  5HBJ B;  4GH9 A;  2R4E A;  5EZG A;  5FRO A;  5J4Y A;  1LJ9 A;  3K4C A;  4FM4 B;  1CF7 B;  1Z6T A;  4KT6 A;  2F5P A;  5FTK A;  1QYR A;  2KP6 A;  2F5V A;  3MD2 A;  2QSG X;  5GTH C;  1L2C A;  4CXF A;  3U60 B;  4QNR A;  4EOR B;  3RKW A;  3S93 A;  1T95 A;  4IX7 A;  2JNH A;  1UHM A;  1ZG3 A;  2OD5 A;  2VE9 A;  3GFL A;  5ILV A;  2ZZD B;  4NB5 A;  4L5J A;  3OL3 A;  3RYR A;  2LNH C;  1Q3B A;  2I40 B;  2HS5 A;  1U9O A;  2ZPI B;  3RGS A;  1XGN A;  3C7J A;  4NNJ A;  2DLL A;  3JRA A;  4G4R A;  4IJF A;  1V29 B;  4LZJ A;  1IRZ A;  5IPA A;  4KYW A;  1XXH B;  2V9P A;  1MJA A;  4L9J A;  3CCY A;  4LJZ F;  4CFV B;  4NQW A;  1K4S A;  3S2W A;  5JI6 A;  3HRM A;  1E3O C;  4AKI A;  2RNG A;  2L7Z A;  2R93 J;  2P6S A;  2CWB A;  3KZY A;  4RDU A;  4A3F J;  2DAE A;  2E2J J;  3E21 A;  3KPH A;  3WTZ A;  3LSJ A;  4M0W A;  3TW7 A;  3ZQ7 A;  1OQY A;  1QAO A;  2V6Z M;  1HKQ A;  1HNZ M;  1ZTR A;  2GQQ A;  5DCM B;  3T8T A;  1ODD A;  3QAU A;  1B59 A;  2OJE D;  3CF0 A;  2O7O A;  5GKN A;  4B7F A;  2VXZ A;  1IN8 A;  5J40 A;  4ZYG A;  1QBJ A;  4BCO B;  1IAW A;  1W1W E;  3KP1 E;  2X1D A;  1GAB A;  1VZ0 A;  3DFZ A;  1RKT A;  3OIQ A;  3OSF A;  2EH3 A;  1FYK A;  3WVE B;  3ASO H;  4E4H A;  1N78 A;  2QGS A;  4XR6 A;  1KA8 A;  2BEO A;  2RNJ A;  1XMQ M;  1LUJ B;  4JP0 A;  1OFI A;  1J5E M;  3JR9 A;  3TNW B;  3L29 A;  3W2W A;  1KFV A;  2DVW B;  3KOW E;  5KQ8 A;  3L9F A;  1ACI A;  1KGS A;  4HF0 A;  4ZTF A;  1FOY A;  2Y75 A;  3AJI B;  2G3Q A;  2GM4 A;  4M9S A;  2ELK A;  3VFD A;  2FX0 A;  2DFE A;  1YS7 A;  1T39 A;  2OQR A;  2QCO A;  1TFB A;  1GJT A;  4HV6 A;  3QRF F;  4XOR A;  1DGB A;  2XEP A;  4U0Y A;  2XVC A;  3CUQ B;  4M3D A;  3TMO A;  4FHT A;  3WTY C;  2WXV B;  2BZT A;  2W2H A;  1TDH A;  3GX4 X;  3MZH A;  2J5P A;  4BH9 A;  3X24 B;  3V42 A;  4EM2 A;  1ZRE A;  1H4L D;  3FXL A;  2WB1 N;  1DGW Y;  4I8O A;  1TWG J;  2XF3 A;  2LLK A;  2R44 A;  2RV8 A;  1Z21 A;  4RBO A;  2PK9 B;  2LNB A;  3V4G A;  4BXF A;  4FWD A;  1WJC A;  2DEN A;  4EC8 B;  5K7F A;  1JHF A;  2VQH A;  2CCH B;  1D3Y A;  4MM3 B;  4A0Y A;  3IL2 A;  1WFX A;  2EKK A;  4EVI A;  5IF1 B;  5BQT A;  2DBB A;  2W4S A;  3V7S A;  1WHC A;  4X65 M;  4L6V 6;  2V6C A;  3FXK A;  3S3N A;  3LVV A;  3QOE A;  2X4A A;  4EOM B;  4EAT A;  2IGM A;  5K5Q A;  2NS0 A;  3VLF B;  2TRT A;  1IUY A;  2E71 A;  5LHI A;  2B63 J;  1R2Y A;  2K27 A;  3RGP A;  2M3A A;  2DPP B;  3F72 A;  4BAY A;  4Y13 A;  2G0E A;  2ZTC A;  2OTJ I;  1ETK A;  2DYR H;  5IYD J;  3MKZ A;  3KW6 A;  3F21 A;  2WMA B;  3VSK A;  5B1B H;  4OVZ B;  4B48 A;  1XS9 A;  1R6R A;  3ABL H;  3GPX A;  3Q9S A;  9ANT A;  5J1Y A;  3A46 A;  4LJ7 A;  2UU9 M;  2M7A A;  4A69 C;  5E8I A;  1RNL A;  2ISZ A;  4JI6 M;  2H5X A;  2IT0 A;  2EJS A;  4YIR X;  2VC1 A;  4OGR B;  4GFB A;  1ZMU A;  3FK7 A;  1X19 A;  3CC2 I;  1GKI A;  3T1H M;  1AKH B;  3HDD A;  3KCC A;  2A3S A;  3A8M B;  1TF0 B;  3C3E A;  4X0G A;  4Y72 B;  2VJI A;  3WGH A;  5HVQ C;  3A01 B;  2H09 A;  3PSF A;  1QVT A;  2EZI A;  1B6A A;  1TZL A;  1U8B A;  3D5R C;  3HKZ A;  1DV0 A;  3TP0 A;  1XDS A;  3RYP A;  4L5E A;  3BR0 A;  5C44 J;  3BR6 A;  2YS9 A;  1XCB A;  5HQ0 B;  3I04 M;  3KS4 A;  4KJZ A;  1H88 C;  4BCF B;  2K9L A;  2IS4 A;  4F70 B;  3C9P A;  4P9F A;  5D6E A;  4LFA M;  2BY0 A;  4KMU X;  1R5G A;  4M3G A;  1HDP A;  3RJP A;  1H26 B;  2WV0 A;  8CAT A;  2Z4S A;  5BPD A;  3S1N J;  1O9K B;  3QXE B;  2DWN A;  3HJE A;  3OYG A;  4BB9 A;  1QGP A;  2C9C A;  1R22 A;  3DV8 A;  5KHD A;  3W0F A;  3HOV J;  4F92 B;  1IF1 A;  4ANJ A;  1DPR A;  2LK2 A;  2GLO A;  4DV4 M;  1P92 A;  5K7H A;  4BJ6 C;  3WHL A;  2KHH A;  2FQ4 A;  2H6B A;  3E0J B;  4L9N A;  2Z9O A;  1SFX A;  3R0J A;  4M73 A;  4CFX B;  3IC7 A;  2CS3 A;  4GRI A;  4G4O A;  3ESW B;  3TP3 A;  4XRS G;  4LLN A;  1G8P A;  1QZE A;  2FE8 A;  2L2D A;  3FKE A;  5D8L B;  3EIH A;  3CCL I;  3QHR B;  3ZPL A;  4UNO A;  2ZXH A;  2M60 A;  4OVZ A;  2M5W A;  3SFI A;  4F3Q A;  2E36 A;  2O61 A;  3QYG B;  4R79 A;  2LBF B;  1FZP B;  4X62 M;  2BJV A;  3GQ5 A;  2JK3 A;  4OOI A;  5LBQ A;  4LJ9 A;  2P5K A;  2ZBK A;  1GHC A;  1T38 A;  2CHV A;  3HRT A;  3DXJ F;  2P5L C;  2QQ8 A;  1IBK M;  4XN0 A;  2FMY A;  4YEJ A;  4GCV A;  2IGN A;  3EUK L;  3VYG B;  1YW7 A;  4XRM A;  3WTS C;  2YNM D;  4I09 A;  2IA2 A;  2NOJ B;  3PUF A;  2RGO A;  4X1E A;  1NH3 A;  5ICE A;  2R7D A;  5IOZ A;  2XZU A;  5E17 F;  5LMK B;  4M3F A;  2XLJ A;  1F4I A;  1BJZ A;  2IS1 A;  1IBM M;  2Q8K A;  1HA8 A;  1IM2 A;  3R4K A;  2CQX A;  2X49 A;  2HZD A;  4BCM D;  2WAE A;  4F7J B;  4XLP F;  5L3D A;  1FP1 D;  2J7N A;  5IT9 K;  3A4C A;  3SZG A;  3KET A;  3MFK A;  4F52 A;  2OOB A;  1SVM A;  3CTW B;  2XAS A;  1IUF A;  1SAX A;  1EV7 A;  4WF2 A;  5KAI C;  1W0U A;  1TTY A;  1KZH A;  1K82 A;  1BI3 A;  1RET A;  3BLR B;  4LG3 A;  4LF8 M;  3K10 A;  2R0Q C;  4BL0 B;  3CF2 A;  3I4V A;  3M07 A;  3PO2 J;  2J5Y A;  2R65 A;  1OCR H;  2WAF A;  4BUP A;  3HL2 A;  1Q1V A;  2LSO A;  4IRG A;  3T8R A;  3VYT B;  3CCQ I;  3FZV A;  4II7 A;  1SVO A;  3NWL A;  1TH2 A;  2UXC M;  3KS8 A;  1YJN I;  3QU6 A;  4CUG A;  1EE8 A;  1N75 A;  1VQ8 I;  1RC9 A;  2LKS A;  4PK4 A;  3Q0W A;  3ZXS A;  3LAJ A;  2DXB B;  3GO8 A;  2QF7 A;  1Y56 A;  3PFY A;  3JRB A;  4RLQ A;  5JLX A;  4FX4 A;  3F9K A;  1WR1 B;  2UZD B;  3J80 S;  4BY7 J;  2VPL A;  1R4G A;  4ZYA A;  3RDI A;  4QLC U;  3I56 I;  3G33 B;  4D0P A;  1STZ A;  4XGI A;  4IBI A;  1ZYR F;  5EP4 A;  3M1E A;  3TWK A;  3DJB A;  5DTD A;  3ZMD A;  2COB A;  2AHQ A;  4X66 M;  3VFZ A;  3W2A A;  3HHX A;  3G4S I;  2EZL A;  2WB1 A;  4EOJ B;  4YG2 F;  1H9G A;  1BJA A;  4QWQ A;  1DP7 P;  2FSW A;  2LHC A;  4EEF G;  2HDD A;  1KSF X;  1TQI A;  4B3X A;  3DPT A;  4F55 A;  4KIC A;  5LEJ A;  1IY0 A;  3CJT B;  2ZTD A;  4M0D A;  4MO7 A;  5BPI A;  4LD5 A;  3REO A;  3J7A O;  5J1R A;  1VQ6 I;  1GUX A;  1JQJ C;  2GWR A;  3BLY A;  1Z6R A;  5F1R A;  1KU2 A;  2L01 A;  1FOW A;  5IOY A;  2DOD A;  2F6C A;  4EJO A;  1HBX G;  1MKM A;  4Y3O A;  3RZD J;  4P17 A;  5LEK A;  3CLO A;  2TCT A;  4XLE A;  3W6J B;  5I5Z B;  3HBL A;  1VEK A;  3B7Q A;  3L09 A;  2BGC A;  1A04 A;  2K7L A;  3B9P A;  2CW0 F;  1SXJ A;  1S6L A;  3FIW A;  2DME A;  1D8K A;  4Y28 F;  4LFB M;  2V79 A;  1ZAO A;  5EJC A;  2CGP A;  2DTR A;  2NS7 A;  3EYI A;  1TTE A;  4IIW A;  1IGN A;  4BHB A;  1KON A;  2O8X A;  4HDU A;  2QHO B;  1S7O A;  1RRJ A;  3U6Q A;  3SXY A;  1X2N A;  4MTD A;  4YFK F;  1VQK I;  2CHQ A;  3WVD B;  3AOG A;  4E7J A;  2DD4 B;  2PJQ A;  2QYO A;  2LXE A;  1MBJ A;  1QHH D;  1MU5 A;  2DWL A;  2EA4 A;  2GIZ A;  4JQF A;  1QQW A;  5ITR A;  3ERE D;  3CCS I;  1E7P A;  3EID B;  4LGY A;  4BQN A;  3ZRG A;  3BTI A;  1MBG A;  5LD2 C;  5E1X A;  3VK8 A;  1X37 A;  2WZJ A;  4REZ A;  2IN3 A;  1TQM A;  4RMN A;  1KYW A;  4HAM A;  1W0T A;  1TWH J;  5KPT A;  1X2M A;  1MJG M;  4QSH A;  2NVQ J;  2XDV A;  3J7B A;  5HNB B;  1IXR C;  3ZQL A;  3L25 A;  1LKX A;  1EFU B;  1M1E B;  1V55 H;  3SYL A;  3CQZ J;  3FDY A;  3LSI A;  4HBL A;  5HDG A;  3EYY A;  3SYK A;  3H1C A;  1K78 B;  4I2O A;  2G7U A;  4CXA B;  4F1I A;  1YHQ I;  3MKL A;  2JGZ B;  4HZF A;  3RI4 A;  2EFQ A;  1H28 B;  1PJI A;  3JAM S;  1KQ9 A;  4R1H A;  4UB8 C;  3LA7 A;  2OUM A;  4AVZ A;  3S16 J;  1JKR C;  4WK8 F;  3CUO A;  2VT2 A;  4P16 A;  2P81 A;  1FP2 A;  4BE1 A;  3D0S A;  5L3E A;  4MTE A;  4IEJ A;  3GUD A;  3K4M A;  3PIP F;  4E7I A;  2N8G A;  3E5X A;  3FWE A;  4H4K C;  2OQ4 A;  1A5T A;  2KHM A;  2V4J C;  2HVR A;  3Q8X A;  4AZF A;  2IXS A;  2MAB A;  2DA6 A;  4ZYE A;  2EWN A;  4ZC3 A;  3OYM A;  5FTJ A;  3WE3 A;  2LH0 A;  1TW3 A;  2KRF A;  4TTH A;  3J27 B;  3LFU A;  2XKP A;  3HXL A;  1IY1 A;  4F93 B;  4FWG A;  2DA7 A;  4CFM B;  3GRU A;  4OB0 B;  2JY5 A;  3MVP A;  2E34 A;  3U21 A;  4FVM A;  1BL0 A;  3K9P A;  4I3Z B;  2JPC A;  3VYS B;  1L2B A;  3I54 A;  4O6J A;  1DDN A;  3HHW A;  2V26 A;  2DA4 A;  1SVL A;  3BJA A;  3BOQ A;  4XON A;  2RRU A;  5H20 A;  2JZ0 A;  2HXO A;  2LF8 A;  4YRV A;  5FJ8 J;  5HVY B;  3CTA A;  3B89 A;  3K4K A;  3H92 A;  4AD9 A;  1PKD B;  3A8G B;  1WJ5 A;  2KJC A;  1IV6 A;  1T6O A;  3JRF A;  1P4W A;  2XAF A;  1TT0 A;  4KO8 A;  2WTE A;  1XMK A;  3E5Q A;  2W7N A;  3WGI A;  3UKG A;  3QPT A;  3Q5F A;  1OKS A;  1JJ8 C;  1J9I A;  2QDY B;  2DPD A;  1VQO I;  3IKT A;  2HEO A;  1HDD C;  3LL7 A;  3FYD A;  3K7A J;  4BYY A;  2VQF M;  2WBM A;  4R7G A;  1R1U A;  1GXQ A;  5EZH A;  2UXN A;  3ILK A;  5BNG A;  3SAU A;  1XMX A;  4PSW A;  4DV1 M;  2V1N A;  2AO9 A;  3BC8 A;  1POG A;  4Y15 A;  5E79 C;  2L7K A;  2XRL A;  3T6P A;  2DFI A;  2RRE A;  3KP2 A;  3ABK H;  3MN2 A;  2GOM A;  1E2X A;  4MEX F;  1BC8 C;  4BNC A;  3MIA B;  4ZYD A;  4AKG A;  1A31 A;  4I7H A;  5ITX E;  1P6R A;  5M3M J;  4G7H F;  1Q1H A;  5KPR A;  2VOO A;  1MMA A;  2AXT C;  4XLN F;  4FT8 A;  2OA4 A;  5J8F A;  2PG4 A;  4M6X A;  5E3M A;  1X1A A;  3OYK A;  2C5V B;  4FCT A;  2QSH X;  4PJL A;  1H89 C;  3THG A;  4U0V A;  1FIP A;  3GQ3 A;  5KVR A;  2EIJ H;  2UXX A;  1T0F C;  3UGJ A;  4FIS A;  3RQ4 A;  4XQF A;  5CYI B;  2HOS A;  3O8H A;  3M6A A;  3KSJ A;  2FOK A;  3BBZ A;  2L9V A;  3HHG A;  2GA2 A;  2G77 A;  1EH7 A;  2C99 A;  4G8X A;  1R7J A;  1U2W A;  4HX8 A;  2F4I A;  1W7P A;  1GV2 A;  2XUB A;  2DXC B;  1OI9 B;  3PXG A;  1FX7 A;  3ZCO A;  4R8H A;  4MGI E;  1G4D A;  4ELJ A;  1SXJ D;  1ZG5 A;  1G41 A;  2BY3 A;  3CF5 F;  2IGK A;  2LG4 A;  3J7Z I;  1GDT A;  2C98 A;  5DM7 F;  2HQN A;  3TQN A;  1NV8 A;  3SAS A;  3C3D A;  4P5O A;  1LQ1 A;  3I64 A;  4A3B J;  4G7O F;  3TDU C;  1LPQ A;  2MRO B;  2MC3 A;  2VN2 A;  1ZH5 A;  1RIO H;  1SD4 A;  5IYB J;  2HQ5 A;  3GTK J;  3V7R A;  3GTO J;  2M4G A;  1D8J A;  1XO2 A;  1IDY A;  2K85 A;  1YX3 A;  2EB7 A;  2JWT A;  4HQM A;  4EV0 A;  3OYI A;  3CJR B;  2B3T A;  1WJE A;  4IPA A;  1U78 A;  3TO9 A;  4MH0 E;  2MGQ A;  2L0K A;  5KAF C;  4JYA M;  4V2F A;  2H1L A;  2CZ6 B;  4XOP A;  2Z2S B;  3P5J A;  2GXB A;  3JRI A;  1R23 A;  1TH4 A;  1ZQ3 P;  2X6Y A;  2JZ1 A;  5EGO B;  2DNA A;  2GBY A;  2DHY A;  1MBF A;  2VBW A;  4GO1 A;  4JI1 M;  3W6V A;  2QZ4 A;  2W9F A;  1HC8 A;  5ERI A;  2DTZ A;  4HLY A;  3S8P A;  2XF5 A;  3HGY A;  4BDY A;  1OGU B;  3FK6 A;  1AOY A;  2G5G X;  2FNP A;  3FM3 A;  4DV0 M;  5D5V B;  1MIJ A;  3FXJ A;  4KIB A;  4PJJ A;  3FYC A;  1MDM B;  2VOD A;  4D82 A;  3K92 A;  2XSZ A;  1G59 A;  2EIN H;  2O0Y A;  3BR5 A;  3GRR A;  1Y8G A;  1XSV A;  3CDL A;  3CLQ A;  1TH3 A;  3VYR B;  3VSL A;  5B1A H;  1GJS A;  2BVL A;  5FLX S;  4ENN A;  3RKQ A;  2XB5 A;  1HLV A;  1W5C C;  4JI3 M;  1VIN A;  3ZN1 A;  3NBI A;  2QQA A;  2JA5 J;  3U6S A;  3ELK A;  4EC9 B;  1F5T A;  4ZGJ B;  2E19 A;  2C5N B;  3WOD F;  1KYZ A;  4DBQ A;  1OMI A;  2D5V A;  3H3Z A;  5GAE J;  1D5Y A;  4DOZ A;  4MLO A;  5TGT A;  5L3C A;  4NRW A;  3S2D J;  4EOS B;  3Q8G A;  4F7L B;  4CIC A;  4NST B;  5EXX A;  2W24 A;  3U6D A;  3HGI A;  4FCY A;  1XMO M;  1ETV A;  1SMT A;  4BY1 X;  3DDQ B;  4EJV A;  3L00 A;  1G8X A;  4KMF A;  3MZ8 A;  4AUX A;  1HOM A;  2RKH A;  2HOT A;  3PVS A;  4JN6 A;  2KKO A;  1USS A;  5M5X J;  1A6I A;  3PL8 A;  1D0L A;  1QHG A;  3P9I A;  4AWX B;  2MH8 A;  1J5Y A;  2NQ8 C;  4RF1 A;  4IL6 C;  3ZQG A;  4YC3 B;  4AKH A;  2KR6 A;  4F7S B;  2LVP C;  4LG0 B;  2LMD A;  3TQS A;  3PQK A;  3KEY A;  1UAA A;  1NJG A;  1I94 M;  4IXA A;  4F91 B;  3R8F A;  2QLZ A;  1S29 A;  4AYB A;  3K4N A;  1K78 A;  3OWT A;  5LRR A;  5CVI A;  5CVU A;  1NHA A;  1PP8 F;  1R5I D;  1OIZ A;  1SD6 A;  3I3L A;  2L9N A;  2M7B A;  2YUS A;  3LQ5 B;  2I8D A;  3BQY A;  1OTR A;  1ZK8 A;  1N32 M;  3DL1 A;  3C3W A;  2R7O A;  1F9N A;  1U3E M;  2Z99 A;  4G9Y A;  2M5Z A;  4PJN A;  3U6C A;  3J2P B;  1ZV1 A;  2R3S A;  4S04 A;  4XLC A;  1QMZ B;  3TPZ A;  3NWS A;  2KMG A;  4RAY A;  1OPC A;  4HRI A;  2O5R A;  4D81 A;  2K86 A;  1I39 A;  2PK2 A;  1MNE A;  2R7V A;  4KN7 X;  2DU9 A;  2M8G X;  2M1B A;  4LJ6 A;  1K79 A;  3K7A M;  4FX3 B;  4B09 A;  1ULY A;  5F6F A;  1JST B;  3PFI A;  3KZI C;  1D0Y A;  3K2L A;  5L3B A;  2WHB B;  4IBG A;  3TWL A;  2CQ7 A;  2NXN B;  2DAK A;  2TDX A;  5DDG A;  1QVR A;  4GIT A;  1C0W A;  3IEC A;  3RFW A;  4OMY A;  4M9Z A;  4ITQ A;  2CZ1 B;  4OIP F;  5IWA M;  2R4J A;  5DV5 A;  3AKZ A;  4AVP A;  5E3O A;  1TQP A;  5F0C A;  5K5O A;  1JXS A;  1D0K A;  1E94 E;  1QDT A;  2WPA B;  2Y20 A;  4BE0 A;  2AHJ B;  3KP7 A;  4XBF A;  4CIS A;  2XPU A;  5DEQ A;  1OFH A;  1JE8 A;  4BXU A;  1FSH A;  3CP2 A;  3GQ4 A;  5HLI A;  2DD5 B;  2F4O B;  1P4X A;  2J5O A;  1HSJ A;  2CQQ A;  3ASN H;  4A93 J;  4L0Y B;  2HVQ A;  2VL8 A;  3E5U A;  2WWY A;  3B57 A;  3QZ9 B;  2PX9 A;  2VAS A;  2K3P A;  3E6B A;  3JTH A;  2ELJ A;  1FWZ A;  2FOI C;  4OIR F;  3PO3 J;  3QAH A;  1N36 M;  1Z0X A;  3BG7 A;  1G3T A;  2Y69 H;  1H1P B;  2OPF A;  2VBY A;  1XX5 A;  4ABZ A;  1NO1 A;  2Z16 A;  1YLA A;  1X1D A;  2LY2 A;  2W85 A;  3HKZ N;  3ECH A;  4QPQ A;  3IG8 A;  1SAU A;  2BY2 A;  2XAG A;  5IT3 A;  1YOV B;  3QQA A;  1B8I B;  1QUT A;  2L02 A;  3H0G J;  5CKT A;  1WJA A;  1KXU A;  2CYY A;  3CJN A;  4XKV A;  4P96 A;  2ME6 A;  1APL C;  1BW6 A;  1VG5 A;  1GUX B;  4J01 A;  5D8K B;  1TNT A;  2CQK A;  1BR1 A;  1V5G A;  4ZGE B;  5F3W A;  1RI7 A;  4CZZ A;  3W68 A;  4AG5 A;  3EQL F;  5GP9 A;  3JSP A;  1QNT A;  2HQA A;  1QAQ A;  2F5N A;  3M7G A;  2HR3 A;  2CYZ B;  1VQ5 I;  1VFC A;  2GNO A;  2GXG A;  1MH3 A;  3QP5 A;  4NQW B;  5HOO A;  3S2H J;  1UST A;  4JBA A;  1EIJ A;  3E1S A;  2XRO A;  3SAW A;  2DJI A;  4JI0 M;  1WHU A;  3V8L A;  1SFO J;  1R5H A;  2XPW A;  3FMQ A;  2DOA A;  3BTC A;  4IHS A;  3FKI J;  2O03 A;  5JHU A;  5ITY A;  1Z3X A;  5TIS C;  5GPC A;  2HKJ A;  1XSX A;  3IRQ A;  2P4W A;  1E3H A;  3BR1 A;  3ABU A;  2ZPG B;  2E7X A;  3NAU A;  4IF4 A;  1IXC A;  1FTT A;  2EIK H;  3DOA A;  1MW7 A;  3K9T A;  2GAU A;  1Y8Q B;  1ETQ A;  2Y0S N;  4B08 A;  2ESH A;  5E1W A;  1I50 J;  2XSJ C;  4UVA A;  3CES A;  4ZDP A;  4LJ8 A;  4N0B A;  2RDP A;  4WWC A;  2AQE A;  4YOZ A;  2M30 A;  1XWI A;  3LST A;  4WXH A;  5HNH A;  2D1V A;  1IDZ A;  3GLG B;  3OIP A;  1I6X A;  2UUZ A;  2YQZ A;  3DF8 A;  1IXS A;  2K0B X;  2JJ7 A;  4I5S A;  1QZY A;  2XRN A;  2L4F A;  4OU0 A;  1V54 H;  2CCI B;  3BHT B;  2CV1 A;  1IXZ A;  2EFP A;  2Y0S A;  2E60 A;  2VBX A;  4CCK A;  2HDC A;  4OW0 A;  3LCV B;  5EXP A;  1VEJ A;  1BM9 A;  1HW5 A;  1U8R A;  2LF7 A;  4ZYH A;  3BTL A;  1JHH A;  1CUK A;  2ID6 A;  1DGF A;  2KXE A;  4YFX F;  3HOW J;  2KDZ A;  4DR1 M;  4QNM A;  5BS6 A;  4B44 A;  1BI0 A;  4M9X A;  4DR4 M;  3PIO F;  3RZO J;  2MSY A;  1F36 A;  1DP3 A;  1YTY A;  3BJ6 A;  1I4W A;  2ZBK B;  1WJD A;  2QA4 I;  2JY7 A;  1I3A A;  4GGG A;  4OIN F;  1T43 A;  4B8X A;  4DUY M;  2R7W A;  2CJM B;  4KRD B;  4KRC B;  2R7T A;  1GY3 B;  3ULQ B;  1TW2 A;  5IP6 A;  5J3L A;  4PUS A;  3X26 B;  3EUA A;  2ID3 A;  2XC7 A;  1CQT A;  5ICF A;  2B9S A;  4EJU A;  4E7Z A;  2C5R A;  3HSE A;  5DCM A;  3HG9 A;  4MGR A;  2LDU A;  5FTN A;  3DKX A;  2D7H A;  3FUV A;  1OAO C;  3L27 A;  1X3W B;  1F5Q B;  2F4M B;  1KQ0 A;  2QEN A;  3L2V A;  2HQR A;  3FTE A;  2W57 A;  5LHH A;  4RGU A;  1U5T B;  2JWS A;  4RM2 A;  1YFH A;  2ZFU A;  1Z3Y A;  2CSO A;  2BV6 A;  2WIH B;  1I1G A;  2XSZ D;  5DYG A;  1E9R A;  5H37 D;  1HST A;  2M87 A;  1Z5A A;  2ZSI B;  4NUB A;  3F8B A;  1NK2 P;  2R4G A;  2OU2 A;  2R7Z J;  2JY8 A;  2F5D A;  1Y39 A;  5IT9 Z;  3F5X B;  4ZZD A;  3DPU A;  4BU2 A;  2Q1Z B;  2LW4 A;  2MR9 A;  4YII A;  1ZQ9 A;  3DA1 A;  1HXD A;  4BCQ B;  2RQQ A;  3ZMT A;  2JN6 A;  3A8O B;  2JQ7 A;  2JRM A;  3K69 A;  1W7P B;  2A61 A;  1YW9 A;  3SAR A;  2XAH A;  4XK4 A;  2P7C B;  4BGD A;  4ZDO A;  2IW8 B;  4PSX A;  3POM A;  4DR3 M;  3MEX A;  3FTD A;  5ILU A;  4DR2 M;  4XIC A;  2A68 F;  2DAI A;  5HBH B;  1S8N A;  3V7C A;  1JUS A;  1HW1 A;  4GIP A;  1Z5C A;  1MNM C;  4CCJ A;  1BVS A;  4ITV A;  2L7I A;  2KNA A;  4BS9 A;  2LVA A;  1R71 A;  1CF7 A;  3I4Y A;  1H24 B;  1ORK A;  1ZP2 A;  2WA0 A;  2BYV E;  1XCV A;  3IG5 A;  1IRF A;  3F8C A;  2PMH A;  1ZLJ A;  3W2V A;  1S7E A;  5JLW A;  5DFL A;  5CLS A;  1CGP A;  1PDN C;  3QHW B;  3OYA A;  3F0C A;  5B3S H;  1IV8 A;  3K4L A;  2JA2 A;  3HU3 A;  2BHZ A;  4HDV A;  3OS1 A;  3JCU C;  3N4M A;  1NNU C;  2F2E A;  1TBX A;  1FMV A;  1BC7 C;  3DWL E;  2UZL B;  3FHZ A;  3KP3 A;  1Z91 A;  2ZPH B;  1A36 A;  2Y0T A;  5IT9 S;  4JI8 M;  2BE5 F;  1SXJ C;  3M8E A;  2KJB A;  3K1M A;  3O3K A;  1S72 I;  1I6H J;  4JX5 A;  1SEU A;  1URC B;  2IPQ X;  1SC7 A;  2HGC A;  3K1P A;  2XAJ A;  3ZMU A;  1Z5B A;  4KDP A;  3P9C A;  3OSG A;  3OYE A;  4CA0 A;  2ZPB B;  2MFZ A;  3CUQ C;  3H3U A;  5IYC J;  4N4N B;  2R7R A;  2O9L A;  4ZH4 F;  1UB9 A;  1G4A E;  3GLF B;  2OOA A;  2JA6 J;  1DPU A;  2DQR A;  2LBC A;  4V2G A;  4MGY E;  2VPR A;  4MGZ E;  2FJ1 A;  2CFX A;  2M45 A;  2X1E A;  1UGR B;  3VEP A;  1E17 A;  4I4L A;  3KZZ A;  3MZY A;  4L9V A;  5ICC A;  4BBS M;  2XB0 X;  5IRE B;  4I0B A;  3OYD A;  3HHT B;  1SFU A;  3K1N A;  1N34 M;  1OLT A;  3KP6 A;  1W4M A;  4EGZ A;  2VON A;  3B7N A;  4WXD A;  2LC2 A;  2Z4R A;  4O5V A;  3H5N A;  5GPA A;  3TKY A;  5J4V A;  3DTO A;  1FPQ A;  4BQO A;  1VQN I;  4BCG B;  1IQP A;  1NHG C;  4X64 M;  1XB4 A;  5M5Y J;  2M34 A;  5FFX A;  5C4J J;  1XSD A;  5HBE B;  2X1N B;  4JI2 M;  1ITY A;  1V5E A;  4UN0 A;  4PDK A;  4FWH A;  3IAS 2;  3MKY B;  2LVO C;  3RSN A;  2D7G A;  4ENK A;  2W99 A;  3HIF A;  2NRA C;  5IZ7 D;  1GT0 C;  1XC8 A;  5M5W J;  3VDX A;  4RB2 C;  1YLF A;  2BY1 A;  4UY8 I;  3EOC B;  2HOE A;  3IH2 A;  2W96 A;  2ZC2 A;  3V8K A;  5FGK B;  4G4Q A;  4RAF A;  5HDK A;  3JR4 A;  4RNA A;  1EKE A;  3HJQ A;  1FSE A;  3L7W A;  4EJT A;  3HOT A;  2VJJ A;  2DA3 A;  4ZGD B;  4HST A;  2C4G B;  1ONV A;  1H0M A;  2E1O A;  4RB1 A;  4C30 A;  5LQF B;  1V3F A;  2K9Q A;  3HPG A;  2W00 A;  3COA C;  3U5Z B;  4LF4 M;  4B7G A;  2R7U A;  2PJP A;  3FRH A;  5EFQ B;  4EM1 A;  4CH7 A;  3G2B A;  4BE2 A;  3HOU J;  2JT1 A;  4R71 A;  1LV7 A;  3F8F A;  2EK5 A;  2M8E A;  2G9X B;  1TD6 A;  2F4V M;  4AG6 A;  3D1N I;  3OY9 A;  4MGH A;  4JXJ A;  3KP0 E;  2LTU A;  1AA7 A;  1RKW A;  2FBK A;  1VQM I;  4C2T A;  3KLO A;  3E6M A;  4ESB A;  4ZPX A;  3L2W A;  2K4B A;  3QU3 A;  1FLI A;  2K6B A;  1LVA A;  1MMN A;  4MHG A;  1X58 A;  4BCH B;  2C6T B;  4U88 A;  5J47 A;  3HZJ A;  2JMW A;  1N4M A;  2W1O A;  3ZOB A;  1B72 A;  1R9T J;  1FOX A;  4BBR M;  3ZH9 B;  1WGL A;  3NAR A;  3WU0 A;  1ZGJ A;  3U60 A;  1WJB A;  4BBA A;  2YSR A;  3BG6 A;  4OWR B;  2KIF A;  4UV9 A;  1YQA A;  1QZM A;  4ZJZ A;  1PUF B;  5FTL A;  4HYE A;  4MQ9 F;  3DBH B;  2HKO A;  3CCU I;  1E32 A;  4IHW A;  1RU3 A;  1VYW B;  2L2O A;  4PFP A;  2NYX A;  4B47 A;  1VQP I;  2HKX A;  1QU3 A;  1JUP A;  2BNK A;  2BS2 A;  4UXN A;  3OS2 A;  1NTC A;  2DT5 A;  2Z3Y A;  2X6W A;  2VDB B;  3CCM I;  5FKL A;  1C1K A;  4JI5 M;  3NQO A;  4Y4R A;  2FNA A;  1R49 A;  3DTI A;  2H6C A;  3FX3 A;  3MCZ A;  4L15 A;  3E4R A;  2F5F A;  2R5Z B;  2Y0Q A;  2E7W A;  5E3L A;  2D1H A;  1MJ9 A;  1XB2 B;  3I59 B;  1S9H A;  1Y0N A;  1O7F A;  4LK0 F;  1U5T C;  1K61 A;  2G9W A;  1PGY A;  5F27 A;  4U87 A;  2LKX A;  3MK6 A;  4AQY M;  2KIS A;  1PJJ A;  1T6S A;  5EP2 A;  3J7A S;  4FAS D;  5KNL A;  2AS5 F;  1C9B A;  3L2R A;  2NVY J;  1P9Q C;  1OCP A;  2XGN A;  3BP8 A;  2ZJR F;  1AKH A;  1QA6 A;  2C6Y A;  4LG2 A;  2Z33 A;  5KQD A;  2MG4 A;  5L3G A;  3KYD B;  3LSM A;  3KOX E;  2LOO A;  1FEX A;  4A3J J;  2V22 B;  3H4C A;  3BJO A;  4BQQ A;  4CGY B;  4LOC A;  3A0H C;  3WG7 H;  5LMN M;  1B1B A;  1QQI A;  4E7L A;  2ZJP F;  4FD2 A;  4NHJ A;  2HYG D;  2L7M P;  3BZK A;  1VQ7 I;  4M6Y A;  4IJA A;  1Y1V J;  3L1P A;  1P7J A;  1N77 A;  4IBJ A;  3RPU D;  5K5R A;  4BCP B;  3S32 A;  2MH9 A;  3RPU A;  4HNV A;  3DBR B;  1PRB A;  4ENM A;  2KQR A;  2NOG A;  4KN4 X;  2DDA A;  4NC7 A;  2IVM A;  2ECB A;  5D6F A;  1GUU A;  3NEU A;  4EGY A;  4IJE A;  2CH0 A;  2VOP A;  4GMQ A;  2WSE F;  2R5Y B;  6PAX A;  3MI9 B;  3T5X A;  3IAM 2;  5A2Q S;  3GYH X;  3OYH A;  4PJ0 C;  4GXO A;  1JGG A;  5AON A;  1DU6 A;  1K7A A;  4CCN A;  4CO8 A;  1ON1 A;  1SD5 A;  1R36 A;  5L3F A;  5ICP B;  2CRG A;  2WC2 A;  4JX4 A;  5KPZ A;  1E9H B;  3BCA A;  3A03 A;  2VE8 A;  2D7E A;  3O6B B;  3MWM A;  3QOD A;  3TE6 A;  3E6D A;  2F48 A;  1J09 A;  2AHM A;  4AID A;  4A3M J;  1MMD A;  1O3S A;  3UNG C;  1B9N A;  2DHR A;  2K9S A;  1VQL I;  4LFU A;  3GLH E;  2A6T A;  4BJ5 C;  2DMP A;  1N33 M;  2XPV A;  3KP4 A;  2N35 A;  3SMS A;  2PMU A;  2V9V A;  1LDJ A;  1ZLK A;  2VC0 A;  1QZZ A;  3K4J A;  2AQF A;  2BHY A;  2EV6 A;  4NXN M;  1UGS B;  4DR7 M;  1ERD A;  2WIP B;  4JV5 M;  2EZH A;  4PCQ A;  4PFO A;  3A1Y A;  3K8Z A;  4KT0 F;  2PN6 A;  3J81 Z;  4L0Z B;  2IS2 A;  3M0E A;  3J81 S;  3J80 K;  1RZ4 A;  2HAK A;  5DM6 F;  3KVW A;  3VWB A;  3HRU A;  2L09 A;  2X0L A;  4Y7N J;  3WTU C;  3FTC A;  1DGR M;  2FD5 A;  3HU2 A;  5E1Z B;  2VKD A;  3FMR A;  2NNN A;  2UUB M;  2LFB A;  1ZN2 A;  2V1D A;  1SFE A;  4DYQ A;  5JVT A;  2LVN C;  4UN2 B;  1QO0 D;  2PFB A;  1AU7 A;  2W25 A;  1XD7 A;  1L1T A;  3JAM K;  5ITX A;  1X3U A;  5F0F A;  4IQ4 A;  3GLI E;  3PUB A;  1FOK A;  4JI4 M;  2EA2 A;  3KDS E;  2DK8 A;  2DFH A;  4BLC A;  2EQR A;  2YU3 A;  3GPP A;  4I81 A;  3AG2 H;  2H8R A;  1FTZ A;  3LW5 F;  3TNH B;  1GV5 A;  4F6W B;  1NK3 P;  2LRE A;  1VF9 A;  1RR7 A;  4W5W A;  1T8I A;  4UB6 C;  1E0E A;  3GFM A;  5DUI A;  1IG7 A;  3GTP J;  4LF9 M;  1JR3 A;  4LIV A;  4LJ5 A;  4CYC A;  1FYL A;  4Z6Y A;  1WIV A;  1XNQ M;  1SXJ E;  5EQT A;  1WWX A;  2HNH A;  1H1Q B;  3SAT A;  4Z8X A;  1NG7 A;  2A69 F;  4V19 K;  4ROE A;  2IW9 B;  2DKL A;  4KT5 C;  2CUJ A;  1PJS A;  2QVO A;  4ZZL A;  1OJL A;  3HTS B;  1UNL D;  4DIQ A;  3BHV B;  5ACB A;  3IWF A;  1H9T A;  2WJ9 A;  2X6O A;  5F1J A;  2WEV B;  5KK1 A;  1OFC X;  3TDZ C;  5J6X A;  2R45 A;  1P4A A;  4EIW A;  1FBS A;  4WUR A;  3CCV I;  4G3O A;  4A0Z A;  4AC0 A;  1MMG A;  1NY6 A;  1O4X A;  4A3C J;  3PQJ A;  4LB6 B;  1QVU A;  3HO8 A;  2MGW A;  4RA2 A;  3HKP A;  2VXD A;  5JHF A;  4AIJ A;  2F5S A;  2LBF A;  2QKM B;  4FTH A;  2C5O B;  2JTV A;  2KLO A;  2X48 A;  1AWC A;  1BIA A;  2Q2E A;  4E6K G;  3FXU A;  3W3C A;  3GTM S;  3K4B A;  4HW0 A;  1KQ8 A;  5D5U B;  1A6Q A;  1V4R A;  4CHU A;  1YJ9 I;  1MMS A;  3GBG A;  3H9J A;  2YU9 J;  2VI6 A;  3OIO A;  5FTM A;  2R0I A;  3L2Q A;  3DLA A;  2VII A;  4HNU A;  1LEB A;  2GOX B;  1QPI A;  3TWM A;  5E26 A;  4YFN F;  1X1C A;  2GA1 A;  1RR8 C;  2WSF F;  3A45 A;  3U9G A;  4NDL A;  1D0X A;  3LOC A;  2PMZ N;  4OB3 B;  5LGT A;  5DNY A;  3HY5 A;  3CZ6 A;  1HKS A;  1X3Z B;  3DQV C;  3O8G A;  3QYF A;  4B1R A;  2D0Q B;  4LGM A;  3JAM Z;  3CMY A;  2ZB9 A;  3F22 A;  1EA3 A;  4PZJ A;  4LIU A;  3MJ5 A;  5A2Q Z;  3EET A;  2VJ4 A;  3WTT C;  2X4H A;  2OBP A;  2ZJQ F;  1K6Y A;  1OYW A;  3R61 A;  2IW6 B;  4CZC A;  5LFA A;  3J7Y J;  3G1L A;  3SDB A;  3GTG J;  2COM A;  1OIU B;  1KU3 A;  2E1M C;  2IGO A;  5BMZ A;  5HS7 A;  4UVB A;  2PJR B;  4IBC A;  3ZP5 A;  1U0J A;  2GIV A;  4C3I J;  4W97 A;  1VEG A;  1S5L C;  3DU6 A;  4BHC A;  1H8A C;  1QUS A;  4GKK M;  1IO2 A;  1XDU A;  3WG9 A;  1UFZ A;  1GO5 A;  4I02 A;  3T38 A;  4G94 A;  2XSD C;  1PM5 A;  2NVU B;  2V9K A;  2X6X A;  1I5Z A;  3SZT A;  4EOP B;  2DMT A;  3SQN A;  2Y0M A;  3HHZ A;  2EBI A;  1FKM A;  1QPM A;  4DV7 M;  2HI3 A;  4HLQ A;  1R2Z A;  4E7K A;  2H94 A;  5LRS A;  1QAM A;  1OKR A;  1IN7 A;  3A2K A;  5M3F J;  4M72 A;  4IBB A;  3GXO A;  3CP8 A;  1NV9 A;  2R7F A;  2F5Q A;  4OAY A;  1L0O C;  2CFO A;  4A3V B;  2UUA M;  3H35 A;  2CW7 A;  5TJJ A;  4B3S M;  2DO7 A;  5HOD A;  1T98 A;  1OIP A;  4IVN A;  4M3E A;  1NY5 A;  5CVV A;  2E5Z A;  1AHD P;  3B74 A;  4HX4 A;  2KFD A;  3S1R J;  3DOG B;  4DW6 A;  2O8K A;  2DT6 A;  4DNC A;  4DV2 M;  2BBY A;  4XM3 A;  4JX6 A;  2O6G E;  2CZ0 B;  2FA5 A;  2LHG A;  2MBF A;  3KLN A;  5B66 C;  1A5J A;  2K47 A;  4A6D A;  3OYJ A;  4A0X A;  4Y33 A;  3J80 Z;  4L9T A;  3ZR8 X;  2CE7 A;  1FC3 A;  3BOS A;  3FTF A;  4FE4 A;  1OR7 A;  1JSU B;  2NVT J;  2W84 A;  4GKJ M;  3JW4 A;  1Z9C A;  3ZQI A;  2L4E A;  2O25 A;  2DAO A;  2BS3 A;  1QDR A;  2XGC A;  2PMZ A;  4IHT A;  3DEW A;  2WY8 Q;  2HPM A;  5CVR A;  2UZB B;  3OOP A;  2NS8 A;  5JR3 A;  1YG2 A;  3L26 A;  1MX0 A;  2VKH A;  1YRN B;  4CHT B;  2R5Y A;  4OMZ A;  4KIF A;  3GLH B;  4LF5 M;  3UMM A;  5ED4 A;  1ZHF A;  2Z3X A;  4RS8 A;  2BXZ A;  2JXN A;  3K1J A;  4MIM A;  4K2E A;  1G3Y A;  4DZJ A;  4NSO B;  2ZM6 M;  1G71 A;  3HEF A;  3SC3 A;  2RAE A;  3KIO A;  1LTM A;  3LA3 A;  2M2E A;  2G7H A;  2LD5 A;  2OC6 A;  2KRU A;  5ITQ A;  4L18 B;  4F2L A;  3WTW C;  1BU2 A;  2PJR A;  3HOY J;  4D1Q A;  2L7F P;  2CJJ A;  1SFK A;  4QOZ C;  1UGP B;  2HCB A;  3FUU A;  2EZK A;  3FE3 A;  3OL4 A;  4A3K J;  2DFF A;  4RF0 A;  3EUH A;  4XLH A;  1JT6 A;  1TC3 C;  3UJN A;  3B6A A;  2HVS A;  4IHX A;  2B9R A;  1G3S A;  3SBJ A;  4OB2 B;  1Z05 A;  1T56 A;  3R60 A;  2LVS A;  2P5V A;  3MMY B;  3DEU A;  5FRM A;  1MGT A;  3F92 A;  2YR2 A;  5JFR A;  4AM3 A;  1IN5 A;  3JRD A;  3M1C A;  4LY6 A;  2KZG A;  5H6R A;  1XXH A;  2D45 A;  1YX5 A;  2A6E F;  3DPL C;  2ISY A;  1B4A A;  4LK1 F;  1H27 B;  1L8Q A;  3H5R A;  4HA8 A;  2HZT A;  4XN3 A;  4IO9 F;  3JRC A;  2FXA A;  5EYR A;  4F6S B;  1G3W A;  3CCJ I;  3U6M A;  3KEQ A;  3FF5 A;  1UZC A;  1ETW A;  5EP1 A;  3FKJ A;  1Z7U A;  3QPL A;  3BXW A;  1ENH A;  2E5N A;  2DT7 B;  3WHB A;  4BDZ A;  2LRD A;  3GTM J;  4XOT A;  3E97 A;  1GVJ A;  2DWZ B;  4Q47 A;  4NC6 A;  2CW8 A;  3GFJ A;  2XV4 S;  1MBE A;  4CFU B;  1EH8 A;  1K3W A;  3VOE A;  1K4T A;  1YE9 A;  2WSC F;  4LFC M;  1OKV B;  3HU1 A;  1JKP C;  3EDP A;  3SHG B;  3ZQF A;  5CVJ A;  1L3L A;  5HLH A;  4XKC A;  2DAM A;  5J1U A;  2BKZ B;  1R4M B;  4RKU F;  1JTY A;  1WQ2 A;  2MYS A;  2PEX A;  1VQ1 A;  3BZC A;  1EJ9 A;  2Z1D A;  1BI1 A;  5D4R A;  4OIO F;  5EXS A;  4B3M M;  1ZGA A;  3D5S C;  3U6O A;  3FXO A;  2XZF A;  1LFP A;  1ZEL A;  3CUQ A;  2UUE B;  3GZ5 A;  4IHV A;  3W0L B;  3U6P A;  1WGX A;  3BG5 A;  1MJB A;  4I0A A;  4RB3 C;  3IRR A;  2UZE B;  4GHL A;  1K3X A;  4HF1 A;  4QTR A;  3NWT A;  4ELL A;  1IN4 A;  2RQP A;  2YX4 A;  4EMS A;  3JRE A;  1F4K A;  2GXA A;  1WPK A;  5GAG J;  4LMY A;  5ILS A;  3G71 I;  2ACJ A;  2VQL A;  3FBN B;  1R00 A;  2UWM A;  4OU7 A;  4CCM A;  3I4N J;  1DU0 A;  2EIM H;  2FU4 A;  1Z1D A;  1R7R A;  4HG2 A;  1OL2 B;  3D8L A;  1OYY A;  2BWE A;  4JK1 X;  4ON0 A;  4LJ4 A;  3F6V A;  3HHY A;  4MFE A;  5FB2 A;  3GLX A;  3UZU A;  3CCE I;  4X6A J;  2HFH A;  3K9O A;  3HSR A;  2L54 A;  3GPY A;  2XGE A;  4DYR A;  2HYJ A;  4QHS A;  3GZN B;  2G8L A;  2JY6 B;  1UCR A;  3O2P E;  2F5E A;  2FF4 A;  5FLM J;  2OF7 A;  3DTK A;  4FCW A;  2HTS A;  3VYU B;  5B5E C;  2Z8Y M;  3F23 A;  2LVQ D;  4XL9 A;  4BCM B;  1J0R A;  4EOO B;  2ZNZ A;  4OAZ A;  1DGG A;  3ZQQ A;  1WXQ A;  2DJN A;  1JKW A;  3HUG B;  2VKE A;  1OIY B;  4XNF A;  2QSF X;  2CU7 A;  2X85 A;  4O3M A;  1D1B A;  1UG2 A;  1BOB A;  3VPR A;  3L2A A;  3FUW A;  4K0K M;  2EO2 A;  5EGO A;  3KOY E;  2Q0O A;  4L8R C;  3M9A A;  4LIT A;  4D7M A;  5FLX Z;  2KT0 A;  4FX0 A;  2EUF A;  1UNH D;  4XLF A;  1UFM A;  3KHI A;  2ZNY A;  3U2R A;  3MHV C;  3A02 A;  4HEO A;  2KZV A;  1JUM A;  1ZMW A;  2HOA A;  3LQQ A;  1K6O A;  5FGM A;  1PYV A;  2ZSH B;  1MDM A;  3CMM A;  1D1A A;  3GLF A;  3KX2 A;  1R6B X;  4FE7 A;  3QPH A;  5E18 F;  3FRI A;  3BWG A;  5DYI A;  1OCC H;  2STW A;  2BS4 A;  3HYI A;  3X28 B;  2R7Q A;  1WH5 A;  1SXJ B;  3OOU A;  3CME I;  2BXY A;  2FFJ A;  4HX7 A;  1H25 B;  2X8A A;  5FFZ A;  4LLG F;  2DMN A;  1PJT A;  3B6C A;  1UGQ B;  2XGD A;  1FJG M;  2ZME B;  2H1R A;  3BLH B;  4QPO A;  4LRS A;  2E1M B;  2WAQ A;  2WV1 A;  2XAQ A;  1V92 A;  1MND A;  1T2K A;  3JSO A;  3VKG A;  1P2F A;  3C2B A;  4G4N A;  3AL0 B;  3QOP A;  1Q02 A;  3AOE C;  2PI0 A;  2HHH M;  3CDH A;  4Z2Y A;  4Q7J A;  1FYM A;  2DDB A;  3AOE A;  3DCF A;  1G6N A;  3BR2 A;  2EPF A;  4IRI A;  4BCN B;  4ROD A;  3R9X B;  4LCB A;  1R1V A;  1IRX A;  3HUG A;  2W9Z A;  4EOL B;  2LH9 A;  1R58 A;  2JVH A;  1T3T A;  1JKQ C;  3I5U A;  4I98 B;  4LRT A;  1FBQ A;  4I99 C;  5GTI C;  3PJR A;  1DUX C;  1FIN B;  1AIS B;  1H6U A;  3LNQ A;  3FIS A;  4OB1 B;  4DV5 M;  3HOZ J;  3HTU A;  1XC5 A;  3GW2 A;  4GYI A;  2H8W A;  1YO5 C;  1IRG A;  4FW9 A;  3TO7 A;  3X2Q H;  3EJ1 B;  2A6H F;  2OCE A;  4EOQ B;  2ZAN A;  4ROC A;  2BWB A;  1LDK B;  2QCU A;  4L78 A;  1B9M A;  3GWZ A;  2DZO B;  3LSP A;  1ORY B;  2P6T A;  2M4K A;  1KU9 A;  1VTN C;  2EIL H;  3F8M A;  3X20 B;  3HM5 A;  2KL4 A;  2ESN A;  3SFZ A;  2E5L M;  3P9K A;  4P55 A;  3ABT A;  2A5Y B;  3Q0U A;  5IDN B;  1LDD A;  4DJA A;  3QYB A;  3GTL J;  5EG0 A;  3I51 A;  3R6S A;  4ESF A;  3OV8 A;  1TDZ A;  3LA2 A;  4U7B A;  2P7V B;  4DR5 M;  1WZ2 A;  3HJS A;  1YIO A;  4LF7 M;  5LHG A;  2V6E A;  2Y9Z A;  3QYH B;  4NC8 A;  3C1D A;  1TNS A;  5CJ9 A;  2H27 A;  4Q48 A;  3JRG A;  3KSX A;  5GAH J;  2CEA A;  3FMS A;  3U1D A;  5ICG A;  2CG4 A;  2JVG A;  4D5C A;  3NDQ A;  4CYD A;  4KA4 A;  3GLF E;  2KIQ A;  1UM8 A;  1N25 A;  3QZ5 B;  4QIW N;  3SMP A;  1UHW A;  2QQB A;  5F0H A;  2IEK A;  2EKF A;  2PQ8 A;  2M9H A;  2R7X A;  4LF6 M;  2QWW A;  2VQG A;  3ZMV A;  2LY1 A;  5CYV A;  2F5O A;  2VQE M;  2Y2Z A;  3SEQ A;  2QP9 X;  4EQQ A;  3HX3 A;  4A5M A;  2EFO A;  5DQV A;  1C7Y A;  3NRV A;  4B3R M;  4LGW A;  1AIP C;  4WX9 A;  3C2H A;  2CUE A;  5TRD A;  2W82 A;  4TUW A;  2DI3 A;  4PJM A;  4U0W A;  4YIF A;  2R7S A;  5DUK A;  1D2N A;  2NAZ A;  1VQ9 I;  2Q2E B;  2F5C A;  4B3T M;  1BOA A;  3BG9 A;  3GEZ A;  1V34 A;  2VF7 A;  1GH6 B;  3G6E I;  4CYC B;  1DO0 A;  3G1O A;  4KFC A;  2JUC A;  5BOX A;  3I01 M;  3BPX A;  4HPQ A;  1NSF A;  3E46 A;  4JI7 M;  2CUF A;  1P7I A;  5HNF A;  2K5C A;  2LR8 A;  4W1U A;  3DTE A;  3CF6 E;  3E9S A;  3CO7 C;  1W5T A;  1IW7 F;  2HPI A;  1EH6 A;  2IA1 A;  2OPT A;  3OYL A;  4B4C A;  4MQV A;  4Q4Z F;  4L5I A;  2QBY A;  2DA5 A;  3H9Q A;  4EM0 B;  1YIT I;  5BNJ B;  4BHP A;  2ZPE B;  3RQI A;  3PNT A;  1OAI A;  4A6E A;  2I10 A;  3JRH A;  1UG0 A;  3TO6 A;  1XGM A;  1X1B A;  3U6L A;  5HLT A;  3WE2 A;  2FS1 A;  1JJ6 C;  2ZKZ A;  4EOI B;  4NL4 H;  4YY3 M;  2DMQ A;  2EUC A;  1O7L A;  1HCR A;  2KNZ A;  5H2F C;  1T0F A;  1TWF J;  4NXM M;  2E1N A;  2QGU A;  3WTX C;  1I3Q J;  1LE8 A;  5JVG F;  5D4S A;  2ECC A;  3KP5 A;  3KE2 A;  3ZQJ A;  5BR8 M;  3FBI B;  3IHU A;  3ABM H;  1GVN A;  1O3R A;  1GXP A;  4DGW B;  1XGO A;  3A42 A;  2KPM A;  2V7F A;  4I01 A;  1TL8 A;  3F6O A;  3KEO A;  1MD0 A;  2DQL A;  2DPU A;  3U61 A;  3OR1 C;  4BY7 X;  2L5Q A;  2MC4 A;  3T1Y M;  3DDP B;  3EPZ A;  4PDG A;  2FBH A;  3GZ6 A;  2HWV A;  5C18 A;  5LMU M;  1OL1 B;  4XLA A;  2PLY A;  2RN7 A;  4LLL A;  4IQJ A;  3J7A Y;  1NHW C;  1ETO A;  1DGH B;  2L4M A;  4KIT B;  2ZPF B;  2OQG A;  2DOF A;  4AYB N;  4BXX X;  3PM1 A;  1E3P A;  4ESJ A;  3IH4 A;  3LSH A;  5K1Y A;  3S1Q J;  2DI0 A;  5GAD J;  2BOL A;  1B8I A;  3I9V 2;  4A3L J;  1IN6 A;  1OKW B;  5EEA A;  1QAN A;  4BCN D;  1XXH E;  1FNN A;  1X4P A;  2OCC H;  3CC4 I;  1PJQ A;  3VB2 A;  2VQC A;  4DBG B;  2L9S A;  4PGG A;  1VOL A;  3DBL B;  3S3M A;  4NBQ A;  2RKO A;  2FEZ A;  3LSG A;  2HDW A;  1HNW M;  3IWZ A;  1OCZ H;  1YSY A;  3LFK A;  1L2D A;  5FKM A;  2EV5 A;  3RIR A;  3H3V K;  1TWA J;  4KOD A;  1J2X A;  3ZN0 A;  1Z77 A;  4J19 A;  1HT1 E;  3OS0 A;  1GL6 A;  4BCI B;  1GL7 A;  3GLL A;  2DOE A;  4XK8 F;  3NBX X;  2ICW G;  3FXM A;  3TBI A;  3W6K B;  4F7N B;  5HDN A;  1ZAE A;  4PT5 A;  2ZAM A;  5L2W B;  2JPB A;  2FOW A;  1OIS A;  2ZAO A;  5EXT A;  1P3Q Q;  2ELH A;  3G3Z A;  4WP2 A;  4GC9 A;  3H9G A;  5D5W B;  2MW8 A;  3K70 D;  2NNY A;  2X51 A;  3AAF A;  2FE3 A;  1YJW I;  4F6U B;  2IP2 A;  3GPU A;  3CCR I;  2P0W A;  3MQ0 A;  3ZQC A;  2Z5U A;  1WGN A;  2QDJ A;  1IJW C;  2LY9 A;  1V33 A;  5FD6 A;  2E2H J;  2XF6 A;  2MJ5 B;  2A07 F;  4GYG A;  4M6V A;  1F43 A;  3C58 A;  3U61 B;  1NG6 A;  3ML6 A;  4R3D A;  2NVX J;  4CFN B;  2FRH A;  4LG0 A;  5IP9 J;  4G12 A;  1IRE B;  2XAU A;  1RES A;  2L6O A;  2Y31 A;  3SDG A;  3QPS A;  3HOX J;  3KXE C;  4AIH A;  1JKO C;  2UXD M;  2CHG A;  2UV1 A;  5CEI B;  4A5N A;  2E1C A;  4GEW A;  3VKH A;  1I27 A;  3FM5 A;  3DKW A;  1MH4 A;  4D80 A;  3HJ8 A;  5IY5 H;  1D1C A;  1IFY A;  4IBK A;  1HQY E;  4CCL A;  3IHP A;  3SEZ A;  4CFU D;  4DV3 M;  4UUT A;  1SD7 A;  2VBZ A;  3HC7 A;  1FY7 A;  3IH3 A;  2ZCW A;  1T33 A;  4G6T B;  1U5T A;  4G7Z F;  1VND A;  3RPQ A;  4BBS J;  2BVM A;  3S14 J;  2DK5 A;  4LJA A;  4DYC A;  3Q3S A;  3CMA I;  4JYK A;  1MSE C;  1U6G A;  3IP4 B;  4IHY A;  5FLV A;  1Q3C A;  3SYT A;  1WH7 A;  4C3J J;  1WCM J;  4KUM A;  1WJ7 A;  1V5F A;  3VYH B;  3IUO A;  3G1M A;  3J81 K;  2HU9 A;  1BR2 A;  2M0C A;  3AG4 H;  3GRV A;  2ZME C;  4TV7 A;  4DUZ M;  4FET A;  4UUS B;  2B0L A;  2KIU A;  4BAC A;  1XHB A;  5A2Q K;  2DMU A;  5EEH A;  2F2C A;  2DA1 A;  3LWF A;  4LB5 A;  3KOZ E;  2KRH A;  2L7H A;  1WSU A;  3MAJ A;  2K9D A;  3RKX A;  2KDO A;  2YFQ A;  1BBY A;  1ZRC A;  2KZS A;  2HWJ A;  4BKX A;  1HF0 A;  1BR4 A;  3B7Z A;  1O3Q A;  2R92 J;  4KIS A;  3M8F A;  2XIG A;  3I4M J;  4PD2 A;  3HGG A;  2OAZ A;  2IJL A;  4DR6 M;  2JP7 A;  1W7P D;  1J75 A;  5FKK A;  4FQG A;  3KFW X;  2Y30 A;  4JOM A;  1G3N C;  2IBD A;  2DCE A;  3B73 A;  1JT0 A;  3DKY A;  2ZJ2 A;  2XKO A;  1W5S A;  1VI0 A;  3LQR A;  5CQG A;  2R46 A;  2WFY B;  3WTV C;  2CQN A;  3GVA A;  3I0T A;  4XRF A;  5FKO A;  2RGH A;  5L8R F;  1IXS B;  2R62 A;  4BBR J;  1WI3 A;  2YX7 A;  2ZXW H;  4D9J A;  2A05 A;  1VDL A;  3GTJ J;  2V1X A;  2ZXJ A;  1G2H A;  4BCQ D;  1WRJ A;  2M0M A;  2LP0 A;  4RLF A;  4G6L B;  1D3U B;  3GTQ J;  1BW5 A;  2CP8 A;  2O01 F;  2V1U A;  1T08 B;  2OZ6 A;  3U5Z A;  2C9O A;  2JUJ A;  2Y48 A;  3E7L A;  1JB0 F;  1RPW A;  3FXQ A;  2QNJ A;  4OIQ F;  3CD6 I;  1OR7 C;  2IA0 A;  4CDG A;  4CSW A;  1HW2 A;  1D0Z A;  2K02 A;  4UVC A;  2MLK A;  3ONQ A;  2QZ8 A;  1SG9 A;  3HRS A;  3TED A;  3AG3 H;  3M03 A;  3L2U A;  4EJW A;  1ETX A;  3RKY A;  2Y9Y A;  2WY7 Q;  3TOA A;  7CAT A;  2YR0 A;  1TLH B;  3F8N A;  4P1W A;  5ITU A;  2CWE A;  5DCF A;  4U7D A;  1Y6I A;  4WCG A;  3GFI A;  3K6G A;  4ENJ A;  5K7Z A;  1SAN A;  2APL A;  3K2A A;  1HKT A;  1DO2 A;  3T0Y A;  2ADU A;  1D0M A;  2LYC A;  4F7Z A;  3L2C A;  1IBL M;  2K9M A;  2IS6 A;  5FLX K;  2I53 A;  3H4M A;  3TW6 A;  2DYS H;  4I76 A;  1JR3 D;  1ZRF A;  3JTG A;  3I4P A;  2KDL A;  5KO3 A;  3FXR A;  5IDP B;  1B72 B;  4YHH M;  4A2U A;  1UHS A;  2KRK A;  2I5U A;  2KMU A;  3I55 I;  2PBI A;  3DEE A;  4D7N A;  3PO3 S;  3K0L A;  1IZ1 A;  3JR5 A;  1FMW A;  3BY6 A;  3OTO M;  2JUG A;  3WGG A;  4G6Z A;  1ETY A;  1MBH A;  3ZMZ A;  3ZC7 B;  4HQE A;  2JSP A;  3RCO A;  2CV2 A;  4BEH B;  1DQU A;  2JZY A;  4IBE A;  2FUG 2;  4II2 A;  4KHP M;  2MH2 A;  2VB6 A;  2L4A A;  4BJT A;  3KYL A;  3HOS A;  1S3S A;  1AHJ B;  2DWM A;  5FKN A;  1JOW A;  4QOS A;  2ZO4 A;  4KIG A;  3D8B A;  1Y1W J;  5E6J A;  3BPV A;  1Z7L A;  4M74 A;  4E7H A;  3U1K A;  5EDN A;  3DLL F;  3O0G D;  3HPH A;  3OYC A;  1WVR A;  1O3T A;  2XFS A;  1JR3 E;  1OCT C;  1TR8 A;  5IP7 J;  4PDI A;  4ASN A;  1YI2 I;  2AXL A;  4ZDL A;  3MKW B;  2R18 A;  5IHY A;  4UUV A;  1LE8 B;  3K70 C;  1HNX M;  3R0A A;  1MN3 A;  3U6E A;  2DW4 A;  1G3I A;  2QUF A;  1FT9 A;  1SMY F;  3AG1 H;  4J00 A;  1HT2 E;  2K3F A;  2KEB A;  3IKV A;  3KFU G;  4MGK E;  3I53 A;  2QEX I;  1TT5 B;  2XH9 A;  3MY1 B;  4HLX A;  3VOD A;  4G6D A;  2OO9 A;  3WU1 B;  1TP4 A;  5DS9 A;  1YRN A;  3VDU A;  4A12 A;  4CGZ A;  5J8C A;  1XGS A;  5JI2 E;  1X4O A;  1YS6 A;  3BCB A;  3OR2 C;  4GHA A;  1LFU P;  2J7O A;  4BXX J;  4HEA 2;  4DV6 M;  3TNI B;  2JA8 J;  2FQ3 A;  1R5L A;  4FCV A;  4DBR A;  1QLB A;  4WW0 A;  3DZD A;  2VJ5 A;  3H5A A;  2P8T A;  3VK7 A;  2XHK A;  3BG3 A;  4A3I J;  4RGS A;  2B7E A;  1NJF A;  2R5Z A;  2CZ7 B;  3CJQ B;  4CCO A;  2ERC A;  2BW3 B;  2DAG A;  1XG1 A;  3V76 A;  3OYF A;  2LTP A;  1HQC A;  1WKM A;  4RGR A;  2QPA A;  4C9Y A;  4YOS A;  5HS9 A;  3LSK A;  3TN8 B;  4DQ2 A;  4XRS A;  4L4U A;  1XPX A;  1BN5 A;  3A01 A;  2MA3 A;  3AFH A;  2VUM J;  4E7S A;  3ZQH A;  2UUC M;  3A8H B;  4WXC A;  1Y8R B;  2I7P A;  5CPR B;  1MSF C;  5FSW A;  2EA0 A;  1PVE A;  3RGF B;  2MD0 A;  4MFD A;  1IY2 A;  2X9D A;  4N4O B;  3ROU A;  3K2Z A;  3X25 B;  4IRH A;  2ZCF B;  3HWS A;  3CDI A;  2ZXI A;  4E70 A;  4II5 B;  3I59 A;  2EFW A;  1J7K A;  2VKV A;  2WMB B;  3BZ6 A;  4UUS A;  2QFZ A;  1YYV A;  2JRT A;  3GME A;  4HSR A;  2IAI A;  1VQ4 I;  4A3G J;  4I6Z A;  4II3 A;  5F64 A;  2R7G A;  2R6F A;  2X1C A;  4D5F A;  4S12 A;  3TOB A;  1ZR2 A;  1XN7 A;  4ZTJ A;  3ZMS A;  4AIK A;  2IVX A;  3LCU A;  2XFT A;  2VT3 A; 
#chains in the Genus database with same CATH homology
 3TW6 A;  3A8L B;  4M6V A;  4HNU A;  2CZ1 B;  3VYG B;  4ZGE B;  4MIM A;  1IRE B;  3BG9 A;  3X24 B;  3KHI A;  4JX4 A;  3X26 B;  3VKH A;  4OB3 B;  2CZ6 B;  2AHJ B;  4HL4 A;  4ZGD B;  1UGP B;  2D0Q B;  3QWL A;  2DD5 B;  1AHJ B;  4OB2 B;  2ZPE B;  3QZ9 B;  2BS4 A;  3X28 B;  1UGS B;  4HNT A;  4OB0 B;  1UGQ B;  2DXB B;  2QF7 A;  2DPP B;  3VYH B;  3A8O B;  3VKG A;  3HZJ A;  4ZGJ B;  4BBR M;  3A8G B;  4FM4 B;  4NC6 A;  2QDY B;  3A8M B;  2ZPF B;  2CYZ B;  1FKM A;  4OB1 B;  4HLQ A;  2BS2 A;  2ZZD B;  1QLB A;  3BG3 A;  2ZPI B;  2CZ7 B;  2ZPH B;  4P17 A;  1V29 B;  4AKG A;  4Z6Y A;  3HBL A;  2ZPG B;  3X20 B;  2KR6 A;  4AKH A;  4JX5 A;  3QXE B;  3BG5 A;  3QYB A;  2ZPB B;  4AKI A;  5EJC A;  3A8H B;  4AI6 A;  4JX6 A;  2CZ0 B;  2WJ9 A;  4MFD A;  2G77 A;  3TW7 A;  2ZCF B;  3H4C A;  3X25 B;  3WVD B;  3DL1 A;  4LOC A;  3QYH B;  2DD4 B;  3HO8 A;  1UGR B;  1E7P A;  2QFZ A;  2KMG A;  3QYG B;  3WVE B;  4MFE A;  4BBS M;  2BS3 A;  2DXC B;  3HHT B;  3QYE A;  3QZ5 B;  4HNV A;  4ELJ A;  3HB9 A;  2QDJ A;  4QSH A;  2QQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...