4NC6A

Tbc domain of human rab gtpase-activating protein 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
ETWGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab GTPase-activating protein 1
publication title Tbc domain of human rab gtpase-activating protein 1
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 113
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4nc6A02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 4nc6A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4nc6A03
4NC6A 2G77A 4Z6YA 3QWLA 3QYEA 1FKMA 4HLQA 5EJCA 3QYBA 4P17A 3HZJA 2QQ8A 2QFZA 4HL4A
chains in the Genus database with same CATH superfamily
4BQOA 2CO5A 1ETVA 5IP6A 5ICCA 3CD6I 2R7ZJ 5L3GA 1D8JA 5HLTA 1H1PB 1NY5A 1IDYA 3KFUG 1RETA 1TQPA 2EV0A 3G2BA 3HHTB 3SC3A 2EZHA 4EEFG 1LFUP 2JXNA 2A68F 1XC8A 1IBKM 3GLLA 4NB5A 4M3DA 4CGYB 5JI2E 1BM9A 3ELKA 4ZZLA 3FKIJ 5F04A 3TE6A 3I59A 2R93J 4BCOB 2AHMA 3OYAA 3JRIA 2BS3A 1XB2B 3CMYA 2VC1A 2VQFM 1ZN2A 4W1UA 1BVSA 3SZTA 3K2AA 1WJ7A 5EG0A 4F91B 1VFCA 2JQ7A 5FFXA 6PAXA 2XGCA 1J9IA 4R71A 1QHHD 1XB4A 3TQSA 2E71A 3DPUA 4DBQA 4ZYEA 1USSA 1U8BA 1ZGAA 4M74A 5BNGA 2C9OA 1K78A 2K86A 3VOEA 2CZ1B 3SDGA 3VYHB 1MX0A 4FHTA 2UWMA 2JP7A 1R58A 1X4PA 2O5RA 4RF0A 2XAJA 3BZCA 3RKYA 5B5EC 2FFJA 3SAWA 3HSEA 4I09A 2EK5A 5E3LA 3W0LB 5JHFA 3TWLA 4LFCM 3T38A 4JI1M 2DA5A 3BWGA 4CYCB 4BQQA 4LF6M 2EKFA 3Q5FA 2ISYA 5E3NA 3CF5F 2DFEA 4IOCF 3R0JA 1GVJA 3U6CA 2PMZA 1O3RA 1Q3CA 4QOZC 4BCIB 2W2HA 1JR3A 4A0XA 2K3FA 4B44A 2P81A 1YE9A 2EBIA 1XTAA 3K9OA 2Y0SA 4ENJA 5HNHA 3HB9A 3DTOA 3GX4X 2Z99A 4BY7J 2DMEA 3GLGE 3K4LA 4NNJA 5E8GA 3BG5A 1OL1B 3POMA 4YC3B 2HVSA 3S32A 1OYWA 3R60A 2C6TB 3F72A 3VK8A 1TT5B 2GQQA 4HNUA 3VYRB 2R0QC 2YU9J 4MEXF 2MFZA 2N35A 2K40A 1UG0A 4IJEA 3DQVC 3KZZA 4EJTA 1TWCJ 3OYIA 1NVMA 4NL4H 4L4UA 4DBRA 2CFXA 1HCRA 4ZGEB 3IH2A 2M1BA 3AFHA 2UU9M 2IJLA 2PFBA 3GLIB 1U3EM 3A8LB 2DO7A 2VN2A 1AKHB 2KNZA 2DW4A 2VQLA 3FMSA 4XKCA 2CMPA 4F6SB 5H6QA 4CCMA 1JSUB 1X19A 3LOCA 4ESFA 4LB5A 2PJQA 3VPRA 2AHQA 1ZV1A 3A03A 5D6FA 4CCLA 2IW9B 3PXGA 2M87A 3SFIA 2QNJA 3TP0A 5BQTA 1QA6A 4Z2YA 2STTA 1OI9B 1R1VA 3HJQA 2Y2ZA 3IP4B 4PJNA 4RAGA 1XDUA 2UZKA 2CYYA 3CESA 3E9SA 2L02A 2JUCA 3VDUA 3WTTC 1IN7A 3BG9A 2W9FA 4XRFA 3DL1A 3O0GD 1HNWM 1T43A 5J8CA 4B7HA 4EOKB 1MBFA 4X65M 1MD0A 3CF6E 3H4JA 3AV0A 3VK7A 4OU7A 2L7ZA 2XHKA 4CFNB 2EILH 2J7OA 1YJWI 1DGBA 2GNOA 2VBXA 1IG7A 2WMBB 2QKMB 4G4NA 2M2EA 4QPOA 1HNZM 3KCCA 4E70A 3DEUA 3C2BA 2ZJPF 1IXSB 1T33A 4O6JA 4BCQB 1W5TA 3TL4X 1B72A 4KO8A 3O6BB 2KL4A 1BR1A 3REOA 5EJCA 4LRSA 5C1BA 5JI3E 1U0JA 2V9PA 2HHHM 1XSVA 3GXOA 1ETKA 2ZMEB 4ANJA 5DM6F 1BI3A 2Y69H 3HUGB 3DOGB 2FD5A 2XKPA 4PCZA 2D7EA 2VKEA 1YHQI 1H8AC 2BJWA 2AQEA 2YX4A 1FLIA 2XZUA 2LY9A 4YELA 2DMNA 5L3FA 3F22A 3KFWX 1OQYA 2QA4I 4I6ZA 2HGCA 3K2ZA 1W0TA 3RSNA 5D4RA 2RRUA 1PRBA 4Z8XA 1T6SA 3KYDB 1R2ZA 3AG2H 3ULQB 2ZJ2A 5K1YA 3TNWB 3TMOA 2NVTJ 2K85A 3OYLA 2HAKA 4IHSA 1ZLJA 1DUXC 1ETXA 4DV4M 2HTJA 3G73A 2OPTA 2JA6J 2EZLA 2LRDA 4DV6M 2FEZA 4JI7M 1J5YA 1D0KA 2HXOA 2L4MA 4XLNF 5LEJA 3MFKA 4HG2A 3H36A 1TLHB 3K4JA 5LLQA 3S2DJ 1OCTC 2XAQA 2VPRA 3E1SA 5EYRA 1EE8A 1OISA 2MD5A 1G4DA 3LNQA 2V4JC 1SXJD 1HSJA 2K9SA 4RS8A 1R5GA 4NSTB 3U21A 4F3QA 2LY2A 2KRHA 2K27A 3FXOA 2QDJA 1OAOC 1G6NA 1F4IA 2ICWG 2WWYA 1NK3P 2JA2A 2ACJA 2QLZA 3BR6A 4BCHB 3FTFA 5DV5A 3GLHE 1WR1B 5HLIA 2I7NA 2F5PA 5GKNA 1F1ZA 1N4MA 3OS0A 1UCRA 1RESA 3CTAA 3K10A 3GCMA 4JI4M 1IFYA 3OYCA 4PK4A 2ZMEC 3HRMA 5EXTA 1E9SA 5IT3A 3TOAA 4I3ZB 4DV2M 3BR5A 4AVPA 5JVTA 1ZHFA 3HC7A 1X1CA 1XXHE 1GDTA 4DUZM 3G1MA 3RPUD 2KISA 1HQCA 4OVZA 1K83J 2V9VA 2QQ8A 2UUEB 5LGTA 2KR6A 2R7GA 3FD9A 1QZZA 2JSPA 2QCUA 2BY0A 5JVGF 4D80A 3OWTA 2XSZA 1ON1A 2WFYB 4HF1A 5GAEJ 5TGTA 1V29B 3HEFA 5D4SA 5CYIB 1XNQM 2ZB9A 3ZXSA 3SFZA 2DXIA 4ENMA 2DYRH 1IBLM 2YSRA 1VQKI 2E5NA 1ETWA 3ML6A 3VSLA 2JA7J 1UHMA 2DOFA 2R3SA 2O61A 2PMIB 2WHBB 4CH7A 1TC3C 2JY7A 2MR9A 4S04A 2DVWB 2YUSA 5LFAA 5C44J 1LEBA 2VOOA 2ZPHB 1MMDA 1GLNA 2KPMA 3OYGA 2ID6A 1WH7A 3CMMA 1J59A 3BG3A 3S15J 3WVEB 2UXXA 1F43A 3HOUJ 1TD6A 2M8EA 2P6TA 2J7NA 1DV0A 4BBRM 3HGYA 2IS2A 4WW0A 2CSOA 1FNNA 2YS9A 2VQCA 4ROCA 2M8GX 3E3VA 2FH0A 3UZUA 2DJNA 3ONQA 2X1NB 4G6ZA 2R65A 4YY3M 3LSRA 2GWRA 2HPMA 4EGZA 3F6VA 1ZG5A 2Y48A 4DJAA 4XN0A 2KRKA 3B9PA 3GRYA 3WGHA 2KLOA 2R5YB 1ZRFA 2IN3A 1VQ7I 5KCMA 1Z7UA 1ZTRA 3MAJA 3CGWA 3HGIA 1POGA 1PYVA 1H9TA 3ECOA 1A5JA 1X1BA 2VODA 1W98B 4DV5M 4FWGA 4UHTA 1JTXA 2VBZA 4NUBA 1BI1A 3WGIA 3WTWC 1IN4A 3R4KA 2ZXJA 3L2RA 4MGZE 3FXRA 1TTEA 4XBOA 4PT5A 2MH9A 3LFKA 4S05A 2STWA 2ZNZA 3LSPA 4YG2F 3H1CA 5HLHA 2DPUA 2Z1DA 3FUVA 4OW0A 2PG4A 3EIDB 1QDTA 2Z4RA 3GF2A 1K3XA 2KNVA 4HF2A 3SYLA 4E7IA 3DLLF 5ICGA 3ABTA 1X3UA 1B1BA 3I71A 3FIWA 2RGHA 1JR3D 3I01M 2E60A 3DWLE 4FETA 3BLQB 1YX3A 2VQHA 3SYTA 4REZA 3P9KA 2CHQA 4MB7A 4BXXX 4IHTA 1WI9A 4AKGA 4IJAA 1KYWA 3KDSE 1XMOM 4LMYA 5L3DA 3DXJF 3QAHA 5DQWA 5IYBJ 2XGNA 1LDKB 2IA1A 3V7CA 3JRDA 2JK3A 1Z77A 3CCYA 3X2QH 1MN3A 1XGMA 1XNRM 4TV7A 5FKNA 1YRNA 2CGPA 3K7AM 1MBHA 4Q48A 2VBWA 1RKTA 3S1QJ 2HXIA 3BG7A 2VOPA 2LTPA 1PGYA 4ZGDB 4NQWA 1V92A 3LVWA 3DTIA 1D0LA 3GRVA 1Q39A 2XH9A 4IRIA 2BVLA 1X58A 3C3DA 5F0CA 1FBSA 3J81S 1IRZA 3BHUB 2MLKA 2PJPA 1Q02A 3OIPA 5LMUM 1ORKA 1VNDA 3BR0A 3DKYA 3V8JA 3GTQJ 4KN4X 1KYIA 1I4WA 3K1MA 2HCBA 3FMRA 5DCMA 2V7FA 1IJWC 2KW0A 1EF4A 1RZ4A 1DGHB 1JHHA 4HOBA 3MKWB 3V8LA 2VUMJ 2F5FA 2L9NA 3FM3A 4HA8A 1U9OA 2OOAA 2XSJC 3VSKA 4GMQA 2WAQA 1QZYA 1FSHA 3OS2A 4YFKF 3JR9A 3A8GB 2EPFA 5EF6A 3HG9A 1PJTA 2CCHB 1T2KA 4XGIA 1A6IA 2HDCA 2Y9ZA 1FMWA 4WXCA 2E34A 2WJ9A 2L2OA 3ZMSA 3IC7A 4MQ9F 3ABMH 1Z7LA 1NHGC 2VLAA 4EGYA 1FJLA 4G6QA 1NH3A 2L2DA 2CQ7A 1T95A 2L4EA 1Z67A 3FF5A 4NRWA 4JX4A 4FCWA 1SC7A 1TR8A 5DTDA 1VEGA 2LW4A 5ITQA 4F6WB 3CDHA 4UUSA 3EDPA 5CKTA 3HHZA 3K92A 4CZCA 1H9GA 4LJ5A 1DQUA 3A8MB 5L8RF 1Y8GA 4WX9A 3UR3C 2LG4A 1KONA 4I0AA 3T1YM 3OIOA 3SJMA 1LQ1A 2K6BA 3P5JA 1CF7A 2LR8A 2KKOA 3TO9A 4C2MJ 2ZKZA 4DQ2A 2XLJA 3BQYA 3T8TA 1XC5A 2DD4B 8CATA 2VASA 3J81Z 1Z5AA 3S3MA 3J80K 3HTSB 2R5ZA 4XLHA 5F08A 2G0EA 2Q0OA 2IS1A 2R7UA 4JOMA 1VDDA 1IN5A 1YW8A 2FMYA 3CDIA 3FDYA 4M72A 5K7HA 4IKFA 2X6YA 3LA3A 1R36A 4FX4A 4XLFA 3TO7A 2CW7A 4IMYB 3F5XB 3A8OB 2ZSHB 4CFXB 4IBCA 1R6BX 3FYCA 5F0FA 2XF5A 4Y7NJ 1ZARA 5DCFA 3SXYA 4F52A 4RB3C 3KPHA 2FJ1A 4LCBA 2ZANA 3MZYA 1PP7U 3F8CA 2EIKH 3FUXA 3V76A 2VB6A 4RGRA 3QZ9B 3ZQCA 2FNAA 1YW7A 2RV8A 4IQ4A 4OIOF 5JI6A 2L4FA 5FKKA 1ZMVA 4I4LA 4BCJB 4RAZA 5LRSA 4G4QA 1D1CA 4MLOA 2R18A 2JA8J 2E36A 1H89C 3M3YJ 5LGUA 4A2UA 1H6UA 1WJ5A 2OF7A 4MIMA 1QMZB 5EZHA 1IY1A 2AHJB 1DO2A 3FKEA 5FGKB 4BBAA 3K4KA 4E4HA 1SFOJ 1A36A 4KYWA 3WTSC 4L9TA 3QPTA 4IPAA 5KQDA 4V19K 3MJ5A 3H3VK 3T0YA 3U9GA 2KRFA 4MH0E 5ITXA 3RTRA 5BPDA 4LFUA 3QYGB 5ICPB 4IHVA 5FTJA 1Z5BA 2F5NA 2XSZD 2KMUA 3DDPB 2UXNA 3QPSA 2JVGA 5M3MJ 2D0QB 4XLEA 2JZ0A 2ESHA 1BBYA 4OWRB 3FX3A 3IRQA 2DCEA 1Z0XA 1WSUA 2K0BX 1N34M 3KEYA 4L0YB 3A4CA 3BZKA 1XCBA 4M0DA 1UM8A 2JPBA 4WF2A 5HBJB 2XPVA 3BCBA 2CWEA 4ABZA 3LL7A 2JWTA 4QHTA 4O5VA 2XAHA 5ILUA 1ETOA 2XASA 1C0WA 2V1XA 3B57A 2M0MA 3HPGA 3BTIA 3DKXA 2MA3A 1O7LA 1TP4A 4IBBA 3U6QA 2E35A 1MSEC 5FRNA 4KMUX 2FRHA 3S17J 2IPQX 1YITI 4FVMA 4UVCA 1P7JA 4OINF 1O3QA 2QKLB 3UK6A 1Y8QB 2EZKA 1J5EM 4S12A 5KK1A 3L28A 2KIQA 2G9WA 5D5VB 2CZ0B 2UUZA 4BCQD 1S29A 2JY8A 5FGMA 2B0LA 5DD4A 4II7A 2XAFA 1PJIA 4RGXA 4CXAB 2DA3A 2CW8A 2QVOA 2ZPBB 1O3SA 4U87A 3GPUA 4CCNA 1M1EB 4AKIA 4FISA 2LFBA 3ABUA 4A6EA 2QPAA 2JT1A 2ZXIA 1E2XA 4XBFA 4BEHA 2NVQJ 4H4KC 5HDKA 1ZELA 3MMYB 5D8LB 4BAYA 3GYHX 1BL0A 1WH5A 3S2WA 5E1ZB 3CCVI 1CUKA 3W2WA 4LLLA 1Z1DA 1V33A 4ZC3A 3TW6A 2G77A 1W7PA 5D5WB 5TRDA 1NJGA 1U9NA 4JK1X 2Q8KA 1LE8B 5FB2A 1Y1VJ 2WC2A 2VKDA 5D6EA 4LF8M 5J4YA 4Y72B 3HTUA 3WTVC 2HOEA 4LG0A 4M6XA 3HHWA 4HZFA 4BJ5C 2R44A 3CCEI 1VQ6I 2DK5A 1W1WE 2BZTA 2FU4A 5E1XA 2M4GA 2IA2A 4AG5A 2ZTCA 1EH7A 4WXHA 4YFXF 1FZPB 3GLFE 1OKRA 1QPIA 3PSFA 3AOEC 3T1HM 1S7AA 2LYCA 3TOBA 3WHCA 1VQPI 3LVVA 2HL7A 2V79A 2EUCA 3BHTB 3BDDA 1T3TA 1QANA 4NSRA 3PQJA 2HYJA 1OFHA 4L5IA 4PD2A 3ERED 2UZEB 2XEPA 2XVCA 4NSOB 3W2VA 1RR8C 2ZPIB 1SXJE 1KQ0A 2C4GB 1MW7A 2ELKA 2K02A 2ZCWA 2H27A 3OV8A 5FROA 5IYCJ 5M5WJ 2VL8A 1IN6A 1T6OA 3HZJA 5FTNA 1MMNA 2L9SA 3PQKA 4A6DA 3PFIA 1QLBA 2F5CA 2QFZA 3GZNB 2CUFA 1UFMA 1HQYE 2L0KA 3PJRA 1D5YA 5M5XJ 3QODA 4I81A 1HKSA 2YNMD 2R7FA 4MFEA 4OU0A 1WFXA 5J1YA 4YOOA 4JI3M 1FJGM 3Q3SA 3W67A 1GUXB 1HNXM 1TWGJ 2FQ4A 4XNFA 1QQWA 4ZDOA 2KP6A 2Y0TA 2YR2A 5E3MA 3WU0A 3U1KA 1XN7A 1VQ1A 2CUZA 2GXGA 5HNFA 3RGFB 2CE7A 3HU1A 2R92J 3I4NJ 4DR7M 3KETA 3KOZE 3ZQLA 1UNLD 3X25B 3U5ZB 1SANA 2DQRA 2ESNA 3HKZN 4U0YA 4IIWA 3KP6A 3CTWB 1WJAA 1KU9A 1I39A 3CF0A 1KU3A 2QGSA 2I40B 1R00A 3L7WA 4IO9F 1KQ8A 4CGZA 4BB9A 2Q2EA 3F3XA 1K78B 2FSWA 5CVUA 1K4SA 1VG5A 4RODA 4HRIA 2RGVA 2DQLA 4ESBA 3WG9A 3J2PB 4LJZF 5EXSA 4EORB 1EKEA 3K70D 2R46A 2JTVA 2FS1A 3CMAI 5ITUA 4JI8M 2XRNA 3FXUA 4XIDA 2L6OA 2C9CA 1YS6A 3M03A 4LG2A 1QYRA 4M73A 3RCOA 2F4MB 2ECCA 3HXLA 5F27A 3RIRA 4LF5M 3R9XB 3AKZA 3OSGA 1JT0A 1BA5A 3KZIC 1AHJB 1ZQ9A 1X3ZB 2AO9A 4XK8F 4AYBA 5KPTA 4UUVA 4P16A 2JJ7A 1JTYA 1Z59A 2WB1N 2F5SA 3A0HC 3VFZA 2UV1A 2DAKA 2LC2A 3DA1A 2HOTA 5FFZA 1OIUB 3V7SA 1X4OA 4RNAA 1U6GA 2DTZA 2OCCH 2MD0A 2NS7A 3QU3A 2JSCA 4G6TB 4KJZA 3G3ZA 4L9VA 3D8LA 3OL3A 3E46A 1B59A 1LVAA 2EFOA 1GJSA 4N4OB 5GPCA 1FTTA 2EB7A 1S9HA 2MYSA 2XF7A 3E0JB 3U6LA 2K3PA 4Y4RA 4H0EA 2APLA 2B9SA 2C99A 1H1QB 4P5OA 3D0SA 3ZR8X 1JE8A 1DGGA 3DBLB 3AL0B 5FD5A 5BPIA 1J75A 4HW0A 3AOGA 1TGUA 1XS9A 3OYKA 2WV0A 1ENHA 1XHBA 1YUBA 5DUIA 4KFCA 2DKLA 3A0BC 4OAYA 4JYKA 3JR5A 3R61A 5KVRA 2FX0A 1D3YA 1UGQB 4P9UA 3FTCA 4ASNA 3MKYB 1YFHA 2OU2A 1ZR4A 3VKHA 4PJMA 1O9KB 3IG5A 2DA4A 3VEPA 1F36A 4RMNA 4Y52J 5CPRB 1XMXA 4U88A 2HYGD 3S3NA 3M4OJ 1MMSA 4OMZA 3DU5A 1GXPA 2VQEM 1D8KA 1MJBA 1Y6IA 3ZPLA 3H4MA 2P5VA 3GLGB 2LH0A 3HJSA 1Y39A 2VJJA 2DT7B 3FBIB 3HJEA 4XSXF 1ORYB 1X3WB 4XMYA 2DFFA 2E1MC 4XM3A 3QRFF 1UELB 3BR1A 3GRUA 1BJZA 1JR3E 2D45A 2NRAC 2EH3A 2ZPEB 3A01A 4YOSA 2F6CA 3HIFA 3SHFA 5CVRA 4M6YA 4IX7A 4RB2C 1PJJA 2WEVB 2HDDA 4W5WA 2HZDA 4QPQA 3NRVA 5DYGA 1WKMA 2JPCA 5KO3A 2A6TA 2K4JA 3P9IA 3QU6A 2LKXA 2QBYB 3WODF 2E5ZA 4F2LA 1U5TB 2JVHA 3Q0WA 5J40A 4RBOA 4KDPA 2CV2A 3W3CA 1JB0F 3DEWA 4G4RA 3D1NI 2VF8A 3TEDA 2HKJA 3EOCB 4DV1M 1S5LC 4YIFA 2DMTA 1AUAA 3QHRB 3FK7A 1DP3A 4OB0B 1ON2A 3AL0C 1GL7A 5H20A 1BOAA 1T98A 1V54H 4XRSG 5F0HA 4KMFA 4OIQF 2W1OA 4AQYM 2VQGA 1HKQA 3BPVA 2LKSA 4F6UB 1SD4A 4EVIA 3HM5A 3OY9A 2L7HA 2K9LA 3OOPA 4GHLA 3QZ5B 3TNIB 4ZYHA 1R4GA 5EEAA 4E7KA 1VQ8I 3SEZA 2LF8A 3F8FA 1T38A 2RQPA 4JI6M 5IT9S 4OB2B 1E7PA 2EIMH 4BJ6C 2E7WA 1NO1A 3ILKA 4AI6A 4A0ZA 1F4KA 3QHWB 1WGXA 3RI4A 1B8IA 5FKOA 5KPZA 3RGSA 2V6CA 2EA0A 5GAHJ 5GPAA 2OJED 4LF4M 2OC6A 3DV8A 2HNHA 2H5XA 2AXLA 1FEXA 1MZBA 2LVPC 2QZ8A 2EA4A 3PUBA 3FMQA 2F5DA 4Y17A 4UV9A 1OAIA 2JY6B 2HS5A 5BMZA 1JGGA 2JRTA 2LKPA 4XKVA 2H1LA 5GADJ 3PIPF 1JI8A 1DPRA 2X1CA 1ULYA 4I01A 3EUHC 2W7NA 1ETQA 4YFNF 1BW6A 1MH4A 1GL6A 1V4RA 5CQEA 5C3EJ 3WTUC 1E3OC 3A46A 2K9DA 2R4GA 3G71I 1TF0B 1U5TC 1N25A 2CH0A 1OR7C 2DT6A 3B74A 1D0YA 4A5MA 3KE2A 3HL2A 1VF9A 3WHKA 2HKOA 3JSPA 3MMPA 5EEHA 4BJTA 4LJ7A 5BOXA 1KU7A 3W2AA 4FX3B 1W7PD 3IL2A 3KW6A 4M9SA 3ZH9B 3T1BA 4CJ6A 1IXCA 3UMMA 2X9DA 2HVQA 2ZBKB 3WE2A 4GYGA 1UNGD 2HWJA 4X64M 4R1HA 4X62M 2Y30A 1IO2A 2M3AA 3DBHB 2V6EA 2X6WA 4X1EA 3UNGC 4BY1J 3OL4A 3QOEA 3SMSA 4GFBA 1TFBA 2Z7JA 2VT3A 5E6JA 3FHNA 2ZXWH 3GO5A 4P96A 2BYVE 2QZ4A 3HSFA 5GP9A 3T5XA 5IP9J 2IP2A 3U6OA 2V9KA 1VQ9I 2BS2A 2Y0QA 5KQ8A 4CFUD 2M60A 5DDGA 3VDXA 5KNLA 3LQRA 4IQJA 3C18A 4B47A 3BTJA 1ONVA 4CDGA 2E2JJ 3GLHB 1QDRA 2CYZB 4I2OA 5IT9Z 1TZLA 1X1DA 3EIHA 2ADUA 3NWLA 1Z3YA 2H6CA 4C9YA 3LQ5B 1FOYA 4MGRA 4D5FA 2Z2SB 5EP2A 3FTEA 2FBHA 3GQ5A 4HL4A 4RLFA 3CC4I 4BCGB 2Y20A 4F55A 3BBZA 5FTKA 2QCOA 2D7HA 4NC7A 4XN3A 2Z5UA 2O8KA 4KISA 2PLYA 2PJRB 3J7ZI 4JV5M 2VC0A 1XXHB 2G5GX 3DJBA 3T15A 1LV7A 1Z91A 4LJ6A 2HOAA 3DP7A 2OZ6A 4L6V6 2LH9A 3MK6A 4CFMB 2R6FA 4QOSA 2EINH 4BH9A 2KZSA 2I7PA 3C3EA 1QVTA 2WTEA 1YW9A 4II3A 4RAYA 3WG7H 2DAOA 1BU2A 5HBEB 2CV1A 3G1OA 2H6BA 2HQNA 1HF0A 4ROEA 3U6PA 5J47A 5GAGJ 2C5RA 1WJFA 2PHGA 4ZYGA 1GUUA 1OKSA 2H8WA 2PMHA 1R5LA 3DCFA 3ZQIA 2OTLI 1OKVB 2NNNA 1YJ9I 1NNJA 1IUFA 3SAVA 1BR4A 4FTHA 5DFLA 3C58A 4DOZA 3L2VA 4GKJM 1FIPA 2R7TA 4PDGA 3IG8A 4G7OF 1JKPC 1G2HA 1TWFJ 4CYCA 4OGRB 3DZDA 1G3IA 1L8QA 4MM3B 3TDUC 3MWMA 2VDBB 2ZFUA 5IF1B 2PK9B 2DLLA 3C3WA 5FLMJ 5HQ0B 1R5ID 2DWMA 2LP0A 2LVSA 4MTEA 5FD6A 1HLVA 1L1ZA 2HEOA 5EZGA 4UVAA 4FQGA 1FMVA 2O01F 1Y0UA 4JX5A 3WTXC 2XFTA 1YO5C 1XGOA 3ZRGA 1IV6A 1PJSA 2GXAA 2VJ5A 5EQTA 5KPRA 5E20A 3S3OA 1ODDA 4FM4B 4CFWB 2C96A 1ZAOA 4RF1A 1MBKA 3J27B 5IZ7D 2BXZA 2QDYB 3CLOA 3GPYA 4B3SM 2DHYA 2BPMB 1Z9CA 1I1SA 1QAQA 1RR7A 4LGMA 2QGUA 1DO0A 3UJNA 3GLIA 2QSHX 3H0GJ 4LB6B 3FXQA 1ZG1A 1AKHA 3HHGA 1QVUA 5ICFA 4XRSA 2LBFB 1WJDA 2EZIA 3W6KB 1URCB 4EOPB 1GXQA 2V1DA 4LITA 1I3AA 3I5UA 2EO2A 1Z5CA 1UJ8A 1XX5A 2GOXB 2G7UA 4KT6A 2WZJA 2L7FP 2H94A 5J3LA 3QPHA 4E7SA 4L78A 1D0MA 1J2XA 2O7OA 1BR2A 1C9BA 1E3PA 2IRFG 4JN6A 2KFDA 1JUMA 4WK8F 3PM1A 4HBLA 3FYDA 2NQ8C 1B6AA 3M8JA 1P4AA 4JI0M 4EOLB 3IHUA 1FP1D 3E5XA 3R0AA 1U78A 3K0LA 3ZQGA 3W6VA 1AOYA 3KP7A 3MY1B 2WSCF 3F8BA 4EJUA 2NVXJ 1Y8RB 4HSRA 4PDKA 2E1CA 1T0FC 4LFBM 4CCOA 4EJWA 4BCMB 2DAIA 4LG3A 3TP3A 2R4JA 3BLHB 5BNJB 1IXSA 3HO8A 1S7OA 1FP2A 2GA1A 3C7JA 3OYDA 1JKQC 1HBXG 1H0MA 3SASA 4G9YA 3O3KA 5LD2C 1W0UA 4NHJA 2MROB 3GFIA 2O3FA 2TCTA 4J01A 2WPAB 4L5EA 2ZMEA 3H5NA 4OAZA 3M8FA 1RU3A 2KIMA 3GPXA 3HUGA 4NC6A 1S7EA 3GTMS 2HVRA 2YQZA 2MH2A 2P7CB 1PKDB 3I54A 1OKWB 2L9RA 2FE8A 4RGUA 4CICA 4CCKA 2XKOA 3GVAA 1QGPA 4U7BA 2LSOA 3GP1A 2L7IA 2FXAA 3H9GA 3I9V2 3BJ6A 5DD8A 2BHZA 1W5SA 4WP2A 2QQAA 5HDGA 1D1BA 2J5YA 1NG7A 1LFBA 1KQ9A 1OCPA 1SFXA 3K9TA 3ZOBA 2DMPA 2XAUA 5HNBB 5HLGA 5FO5A 1JKOC 1QNTA 3OS1A 2P4WA 1USTA 2F4OB 3LQQA 3OYBA 3A42A 2KT0A 3MD2A 3I3LA 2L01A 1FVVB 3OYJA 3M1EA 3F0CA 3IAM2 4GYIA 3TDZC 5IPAA 1CF7B 1H1RB 1TH4A 4I02A 1OCOH 4L16A 3KP3A 1P4XA 1DDNA 2Z3XA 4MFDA 1PUEE 1XPXA 3J7AS 2RVCA 4M6VA 3H9JA 5GTIC 2KIUA 2NAZA 1H25B 1XO2A 2F48A 1ZRCA 5D8KB 4IHWA 1PJQA 4JQFA 1MJ9A 1TW2A 5A2QS 2IVMA 1CQTA 3CO6C 3W68A 1X2NA 4EJOA 1GV2A 1C7YA 1SVMA 4GH9A 2UXBM 1A6QA 2W4SA 1IZ1A 1MH3A 2OCEA 2LVOC 2LLKA 3LSGA 1MJAA 2M9HA 2I53A 1D0ZA 1L1TA 4X0GA 3WGGA 4IBJA 4HQMA 2OQGA 2DOAA 2O03A 5JHUA 1OL2B 1K7AA 3CJQB 2ZTDA 2COBA 1H28B 3GZ6A 3SMPA 2X1EA 5LBQA 1R71A 1OPCA 2NOJB 2ELJA 3BLRB 3GFMA 1N36M 2YU3A 5EXXA 2FMLA 2IW6B 1MSFC 2GOMA 3ZP5A 3DU6A 3ZQJA 4ESJA 3B7QA 4AM3A 5DEQA 4E7JA 2GQFA 2DA7A 4IBEA 2D1VA 3CUQB 4U0WA 5ERIA 5JR3A 1HOMA 4DV3M 3OR1C 4LZJA 5LHIA 1EA3A 3QAUA 1H27B 2VJIA 1ZKGA 3ZMZA 2VIXA 4P17A 4DGWB 5ICEA 4OX9M 1BW5A 5DYIA 2QWWA 1FSEA 1G59A 1L3LA 2BV6A 4RM3A 3V4GA 4DYCA 4G6DA 2EUFA 1YX5A 2CG4A 2K9QA 5FSWA 2FOIC 3OR2C 2C5VB 2UUBM 1WHUA 3UGJA 1IGNA 4DZJA 3RYPA 2OO9A 4A3MJ 2QQBA 2GM4A 1S3SA 1PVEA 5A2QZ 1NY6A 1ZMUA 3A45A 3EJ1B 2MLGA 4QSHA 1FOKA 3RYRA 4F7JB 2DD5B 5LQFB 4JBAA 3MQ0A 4M9XA 3VYUB 3SAUA 1HDDC 1ZR2A 2CEAA 2ERCA 2Z4SA 1D0XA 2IEKA 3L1PA 4GRIA 4F7ZA 1O57A 3SZGA 4BY7X 4G7HF 3SQNA 4LOCA 1B9MA 1FOWA 1W4MA 3VYSB 1O7FA 4GCVA 4AIHA 4DW6A 2FOKA 2R5YA 4XLPF 2W48A 4HX4A 3BOQA 3ZN1A 2R7DA 1YG2A 4BHPA 2UZLB 2XPWA 3G33B 2ISZA 3AAFA 4HLYA 4WURA 4CRLB 3LSMA 5E8IA 3SEQA 2XIGA 5JFRA 3GTGJ 3BJAA 4JI2M 1BC8C 3R8FA 2W82A 2UXDM 3CUQC 3JAMK 1FBQA 3WHBA 2J5OA 5ITXE 5CVJA 1Q1VA 1PUFB 3GPPA 1QUSA 3I53A 5HS9A 3I4YA 1V3FA 1OGUB 1ZLKA 3H92A 1RI7A 2A69F 1RUNA 5ILVA 5KAIC 5DQVA 5M3FJ 4BQAA 2CWBA 4IZZA 2M34A 3NDQA 2Y9YA 1JSTB 2RKHA 4PFPA 2JY5A 4D5CA 5C4JJ 2BW3B 1UGRB 2C98A 4DBGB 5ED4A 4C30A 1MDMB 2W25A 2LOOA 5E1WA 1GVDA 4A3IJ 5BS6A 2XGEA 2VE9A 4YIRX 2HQ5A 4GC9A 4XLAA 4M9ZA 1TDZA 3AG1H 3KYCB 3L25A 2IW8B 1TH2A 3PIOF 4BYYA 3JRGA 2M5WA 1R1TA 3CO7C 1G4AE 2R0IA 2AS5F 1MBGA 2A61A 1HC8A 5J6XA 4N4NB 3HWSA 4OB3B 1R4NB 3CCMI 1Y0NA 1SD5A 2BS4A 2LVQD 3DFZA 2BE5F 3OYEA 3GEZA 2CJJA 1O3TA 4CIZA 1FT9A 3BXWA 1XGSA 2KHMA 1VQ5I 2LVAA 2M30A 1KSFX 4PSXA 5B66C 3OYNA 1WPKA 4PGHA 3J7AY 3NQOA 5FLXS 4NXMM 2CQKA 1GT0C 4KODA 1G3SA 2K5CA 3JTGA 2DDBA 3RQIA 3CMEI 1TW3A 4AUXA 1DGHA 3GLFB 5HOOA 4B4CA 3D5LA 3H5AA 1WXQA 3PNYA 4J19A 4L0ZB 3H5RA 2E19A 3K69A 4RLQA 4QLCU 1N78A 5CQGA 1HJPA 1TDHA 4KN7X 2BY3A 1SXJB 1L2DA 4M71A 1KZHA 3HHXA 3KIOA 1UHSA 1A04A 3HJ8A 1IW7F 2JN6A 3U61B 3I0TA 1NNUC 4KIGA 2EV5A 2K9MA 4OOIA 4LGYA 3GRRA 2XFSA 2MG4A 2HQRA 4HF0A 2CHVA 4RGSA 3SZPA 2C5OB 2DTRA 1HSTA 4GO1A 4FW9A 3S1NJ 2G9XB 3EYIA 3B02A 4A3DJ 2O0YA 3FXMA 4A93J 1GO5A 2DU9A 1NHAA 2IW5A 2L5QA 4EC8B 4ANRA 2KQRA 2DWZB 1DU6A 3ERMA 3SARA 2P7VB 1B4AA 5EGOB 4Y15A 1R7RA 3BJOA 1VQOI 3MN2A 2B7EA 4B43A 4DR3M 1X1AA 3LSIA 2NS8A 3QPLA 5E17F 4EONB 1MNEA 1QVRA 5IY5H 4DR5M 4KIFA 1HT1E 2L9VA 2DI3A 3ROUA 2KIFA 3X26B 5B1BH 3FXLA 5HS7A 5K5RA 3EUAA 3UKGA 1NK2P 4X66M 4LZZA 4CA0A 5HODA 3JR4A 2LNHC 1AIPC 1WI3A 3IKVA 3OYHA 2ZJQF 2CS3A 2XGXA 5FLXZ 1A35A 2LNBA 4R8HA 2X0LA 1QHGA 4PJJA 3TO6A 1FY7A 5C18A 3E6MA 3T8RA 3OMYA 2UZBB 3LCVB 4RDUA 3NWTA 3AG4H 3DOAA 1YTYA 1LDDA 4BDZA 4R7GA 1V5FA 1SXJC 1G3WA 2QYOA 1E94E 2XGDA 3LFUA 4BHBA 1VDLA 1ZG3A 3GW2A 2JUJA 1TQMA 5IOZA 1AD6A 3VODA 3GTMJ 2NYXA 4LFAM 4A3FJ 4B3XA 3KSJA 1VOLA 1I27A 4L5JA 3KS4A 2WY8Q 3RPQA 1R7JA 1MJGM 4P1WA 1EFUB 2EA2A 4B8XA 3BLYA 5M5YJ 3CCSI 2DPPB 2D5VA 1VI0A 4XSZF 3ZQ7A 3WTYC 1T8IA 1H88C 1WZ2A 4BXFA 3KOWE 4HNTA 3HBLA 1TTYA 2PEXA 3IUOA 4JXJA 3I59B 1VQNI 2RN7A 5EG0B 3CUOA 4AD9A 2NVUB 1QPMA 1Z3XA 5E79C 2CUEA 3ESWB 4NXNM 4E7HA 2L09A 3HHHA 3ZQQA 1WJEA 3V7RA 4G12A 1BC7C 5IDPB 2F2CA 1PP8F 1K6OA 3DDQB 3QYEA 3CC2I 4EIWA 3IHPA 2V1UA 1O4XA 4DR4M 4PDIA 2IAIA 4ZJZA 1G3YA 3BTLA 3E5QA 3CCQI 3K6GA 4KITB 3AOEA 3C9PA 2UUAM 1SVLA 5FTLA 3WHLA 2RQQA 3BPXA 3K1PA 3SHGB 3KEOA 5L3EA 1XMQM 3Q9VA 4I8OA 3OIQA 3KOYE 4HV6A 4HQEA 3LSHA 2DAGA 1JGSA 4LIUA 2OQRA 4BACA 3DEEA 4CCJA 3M6AA 2E1MB 4DYRA 4Q5SF 2DXBB 3A02A 3N05A 3KYLA 3CCUI 4CFVB 5JLWA 1IY2A 3K4BA 1E17A 2A5WA 2ZAMA 1KGSA 2ZM6M 1XGNA 4BHCA 2R45A 5DM7F 1WGNA 2PMUA 1E9HB 2E1NA 3VYGB 1FYMA 2MH8A 4Q47A 4CHTB 2DFHA 2PMZN 2WY7Q 4D7NA 1REPC 2BKZB 1B8IB 2QUFA 5AIPA 3F9KA 1UNHD 1GABA 2LK2A 1UMQA 1NJFA 5LMNM 1LTMA 2Y0SN 3Q9SA 1UGPB 1AISB 2P5TA 1RNLA 2FE3A 1WQ2A 3PL8A 4K2EA 5L3CA 2RGOA 4BE1A 5JLXA 4ZGJB 4PGGA 4M0WA 2P5KA 3SATA 5FKLA 2A6EF 2HPIA 3X24B 2LD5A 1QUTA 2MBFA 1GH6B 4LRTA 4G94A 2LREA 3NARA 3GTJJ 3RQ4A 2GAUA 1AA7A 2H8RA 2LWXA 2A05A 4D9JA 1LE8A 2ZPFB 3GLXA 2R7OA 3I4VA 4WWCA 1I94M 1A5TA 2D1HA 3E6BA 1BJAA 1TH3A 4V2FA 2F4IA 3IKTA 4C3IJ 1Q3BA 5F1RA 1EH6A 4ZDPA 3JRHA 1WVRA 2CJMB 3TNHB 2CQNA 1IXRC 4LIVA 4IOAF 3JSOA 3J7YJ 3KVWA 3KP0E 4ITQA 5B3SH 4DR2M 2CFOA 4BXXJ 1QU3A 4ZTFA 2X6XA 2ZO4A 2V6ZM 2HU9A 2DK8A 1F9NA 3QYFA 3TBIA 3TWKA 2WAEA 2WIPB 2KDOA 3CLQA 1MIJA 4HX8A 3CC7I 1K82A 2Z3YA 2DOEA 3CP8A 2KHHA 2IGMA 1D2NA 2BNKA 4QHSA 3FXKA 3M07A 4CSWA 1FPQA 1B72B 2BY1A 4ETSA 5K5OA 3BC8A 2DA2A 2M4KA 4CO8A 3LA2A 3TWMA 2FF4A 4D1QA 3HDDA 1KU2A 2I8DA 3MVPA 2ELHA 3KLOA 1VQLI 2K7LA 4DIQA 2CU7A 4F7LB 3JCUC 1Z6RA 4OB1B 4BXUA 4XQFA 1PDNC 1KXUA 4M3GA 2DYSH 2IA0A 1GUXA 3U60A 3F8MA 2E2HJ 2DENA 3RKWA 1LB2A 2W85A 2XB0X 3QYHB 3AG3H 3HKZA 4HEA2 4DR6M 4YRVA 3U2RA 2P8TA 3S8PA 3MY5B 3H9QA 3VYTB 2DMQA 1ITYA 2XV4S 1WJCA 2I10A 2VONA 3U5ZA 1I5ZA 4DNCA 2OBPA 1SD7A 3DKWA 4ZDLA 2WA0A 3E7LA 1VQ4I 3GFJA 3L2WA 4TTHA 4LJAA 1YIOA 5AIQA 4FT8A 2JNHA 2VIIA 4PUSA 3E97A 3RKQA 2W00A 2W99A 4XOTA 2Z33A 3VLFB 1DGFA 3RGPA 1ZYRF 4CHUA 3GTLJ 4X6AJ 2AXTC 1YIJI 2EV6A 3ZMVA 1ZRDA 3WE3A 3BT9A 3Q8XA 1MGTA 1QZMA 1STZA 3C1DA 4XK4A 3N4MA 3KLNA 2LBCA 4MGHA 3D8BA 4NBQA 1APLC 4AIJA 3DFGA 2H1KA 2WB1A 4IJFA 3LW5F 2C5NB 4KT0F 4UNOA 3F92A 1MKMA 3FM5A 4P9FA 4B3MM 3A98B 2MJ5B 4A3JJ 1UZCA 3I51A 1ZH5A 4BCNB 1OLTA 2LDUA 3VWBA 4BBSJ 1P9QC 1OFCX 4HPQA 2CQXA 1H4LD 1S8NA 2O6GE 1QAOA 4DV0M 4ELJA 3C2HA 2X85A 4MQVA 5LRRA 5EP3A 1GV5A 1ERDA 3B7NA 2E5LM 2QF7A 3ZMDA 3KSXA 3U6SA 4EMSA 1R49A 4KRDB 1JQJC 1UHWA 2FUG2 1IUYA 1VYWB 2DI0A 2K9NA 3HGGA 1JJ6C 3TQNA 3GFLA 4Z6YA 4A5NA 3GZ5A 3ZCBB 4A12A 5IT9K 3JREA 2V26A 4QNMA 3BOSA 2KDLA 2RNJA 2PN6A 4OVZB 1ZK8A 3TKYA 1FINB 2V1CA 3DPTA 4FX0A 1BI0A 2KRCA 5FLVA 5J1UA 2XPUA 3TW7A 4OIRF 1HT2E 1FBUA 2A6HF 2L7KA 2VBYA 3EETA 3CJTB 3I4MJ 2QSFX 1CGPA 3BR2A 1FIAA 2HQAA 1IQPA 2JWSA 4BGDA 3CF2A 4UB6C 1DU0A 3E21A 1Q1HA 3I58A 1O9KA 3IECA 4F92B 1VINA 4UN0A 2R4EA 2CZ6B 2MC3A 2VJ4A 5KAFC 1RRJA 4PJ0C 1FKMA 1TNTA 4CXFA 1NV9A 3EYYA 4L8RC 1TQIA 2V22B 1Z21A 2GXBA 5DUKA 1P6RA 3GLGA 1RPWA 2ME6A 4C3JJ 3S1RJ 4F7SB 2DHRA 1IY0A 3L26A 1BOBA 4E7LA 4HV5A 1WHCA 3SYKA 5HDNA 4XKWA 5K7ZA 2HZTA 5DNYA 1OTRA 2W57A 3NEUA 4HEOA 4EQQA 1N32M 1P2FA 4LJ9A 4IEJA 5LMKB 1OIPA 4AC0A 1W36C 1Z05A 1UGSB 4IBFA 4II5B 2KZVA 3EUHA 5IP7J 2DWNA 1N33M 3I55I 3H35A 2M7BA 4BE2A 1RUOA 4BCKB 2QEXI 4A3BJ 3PUFA 1IDZA 2PI0A 5EP4A 2QBYA 2X48A 2FA5A 1U5TA 3E6CC 1U2WA 4CZZA 1OR7A 4RAFA 3KZYA 3GMEA 2HFHA 1HXDA 1FTZA 2OZUA 1Y56A 2OV7A 2LXEA 4D7MA 1KFVA 2MGQA 2HDWA 4D81A 1R9TJ 3N97A 3S93A 3QOPA 3GLIE 4R3DA 1QO0D 4WCGA 1VEJA 5E26A 1YQAA 4G7ZF 1MNMC 1S3JA 3G4SI 2I5UA 3I4PA 5AONA 1V34A 1G41A 2FBIA 3QXEB 3KHIA 1P4WA 2H1RA 1KYZA 2W24A 1UAAA 3DLAA 2ID3A 3U6DA 1EIJA 3U6EA 2CRGA 4KIBA 4FWDA 1A31A 4IBDA 2CZ7B 3QWLA 3BY6A 1IM2A 4MGKE 2A3SA 3LAPA 1TWHJ 3J7BA 3BZ6A 3CDLA 1TT0A 1XG1A 1LJ9A 1QZEA 2ZFWA 2CP8A 1OIZA 3DBRB 3OYMA 3CCRI 3U6MA 4G4OA 2XC7A 1ETYA 1ZQ3P 4GIPA 2K4BA 3RFWA 4DUYM 4RA2A 2LVNC 3HU2A 5IREB 1WCMJ 3B6CA 5CLSA 3HOZJ 1HR0M 2VPLA 3X20B 3HY5A 1YLAA 4FCTA 4XRMA 2DAMA 2R62A 2A5YB 4L15A 4KHPM 1YRNB 4IXAA 4KT5C 3WTZA 3NBXX 3P9CA 1IXZA 2JUGA 2VXZA 1E9RA 2LF7A 5CYVA 2O25A 3GQ4A 4M3BA 4NQWB 3M8EA 4UVBA 4UV8A 3FTDA 1R23A 1HW1A 2DFIA 4EOQB 2DDAA 2JZYA 4J00A 3KP4A 4LK0F 4GGGA 4Y3OA 1XCVA 3R6SA 3OTOM 2ZBKA 5FJ8J 3CJNA 4YHHM 4R79A 1JXSA 2MSYA 4PSWA 2NNYA 2R7SA 5DCMB 1MU5A 2DN0A 2G7HA 4JP0A 1WWXA 3VB2A 4QIWN 3J7AO 4ITVA 2OD5A 4KICA 3H4CA 4I99C 1R1UA 1OIYB 1RKWA 3X28B 3T6PA 2O8XA 2Z9OA 2KJCA 4BE0A 1L2CA 3HPHA 4II2A 3LCUA 1ZMWA 1YYVA 4XORA 3IRRA 5IYDJ 4IBIA 1F5QB 4LY6A 3ZQHA 3HRUA 2PX9A 3GLHA 2ETHA 3B6AA 1TL8A 3K4MA 4FD2A 3HU3A 3IV5A 1T56A 3EQLF 2DAEA 2F4VM 2QQ9A 2Y31A 5DYMA 2Y75A 2WAQN 1K6YA 4JI5M 3M9AA 1DGWY 1L2BA 4BDYA 1D5VA 2EFQA 4XR6A 3PO3S 3QP6A 1K4TA 2YR0A 2X51A 5F64A 2JA5J 4LF9M 4JX6A 2PJRA 3IH3A 4FWHA 1XXHA 2M7AA 2MGWA 1J7KA 4M3FA 4ON0A 2Y0MA 2F5OA 3ZMTA 3K8ZA 4A3GJ 5ILSA 3PNVA 4EM1A 4B48A 5FKMA 4UUSB 2BWBA 3HOSA 1P5EB 3TPZA 2RC4A 4F7NB 1VQMI 3LMMA 2B3TA 4N0BA 3RDIA 3CZ6A 4I7HA 4UY8I 1MNDA 3V8KA 2Z16A 1R22A 1NSFA 2ZJRF 1JKWA 5IOYA 5F6FA 3WU1B 2R7WA 5EEGA 4FCYA 3DF8A 3GBGA 3O8GA 2GA2A 4GHAA 4PFOA 1FYLA 4B1RA 4KLNA 5J1RA 2X4AA 3HKPA 2L7MP 2VT2A 1SFKA 5L2WB 1MMGA 4EC9B 2R5ZB 5CEIB 2R7XA 4S0HB 1IN8A 2IS6A 4MNUA 1H1SB 2BOLA 3D5SC 3M7GA 2QSGX 1T0FA 2P6SA 1YOVB 3A1YA 3FK6A 5LHGA 2JGZB 2DZOB 4JYAM 4EJVA 4LF7M 2LTUA 2KA6B 2RAEA 1ZAEA 3KP5A 3L00A 2A07F 2DT5A 3K70C 1E0EA 2IGNA 2ZZDB 2ZCFB 2XF6A 2KRUA 4RKUF 1HW5A 2HTSA 2ZC2A 4LJ8A 3ISPA 4E7ZA 3CQZJ 4ZZDA 4UB8C 4XOPA 2AQFA 2EKKA 3LSTA 2ZXHA 1DPUA 4ZTJA 1RIOH 4KA4A 1EH8A 2E7XA 4PCQA 5F1JA 3MIAB 4GXOA 2BEOA 4L9JA 2EJSA 3HOVJ 2ZPGB 1AU7A 3KOXE 1BIBA 1UG2A 1B9NA 1XSXA 4BL0B 3FHZA 4KNYA 1X2MA 2LBFA 3NWSA 1VTNC 4RB0A 2EFPA 5FTMA 2EJRA 5A2QK 1QRYA 2ECBA 4HSTA 3PFYA 1Y1WJ 3BR3A 4EV0A 2O9LA 3RZOJ 1HKTA 4I5SA 4UXNA 5J4VA 2M5ZA 4A3EJ 4MTDA 1X1PA 4IL6C 4YEJA 3SBJA 1SMYF 3JRCA 1SAXA 5L3BA 3HOXJ 2E1OA 1WRJA 1GHCA 4ENKA 4B3AA 1SMTA 1WIVA 3HX3A 2OUMA 2Q1ZB 1I3QJ 4PJLA 3IH4A 4P55A 4AW4A 2PK2A 1HDPA 1LVKA 2TDXA 2WSFF 4A0YA 1IF1A 3FRHA 1H24B 2XRLA 4EOSB 3PSIA 2GLOA 4EOIB 2OQ4A 2KZUA 3EIEA 1P92A 2BGCA 3DTKA 3TGNA 4E6KG 3J81K 2IVXA 5H37D 3S2HJ 1IRGA 3F21A 3L2QA 1G3TA 5ITRA 1FX7A 2CUJA 2LY1A 1YI2I 5EFQB 4HLQA 1OYIA 2EQRA 1PM5A 3CP2A 3LA7A 3L9FA 2EIJH 1R2YA 3J80S 2XSDC 3K2LA 2COMA 3JAMS 2RDPA 5K5QA 3WVDB 2L4AA 2XF3A 3HOWJ 3BHVB 5K7FA 2JRMA 5LGNA 2WMAB 4IHXA 2BY2A 3HYIA 4EOJB 4NC8A 1I50J 5D5XB 1ZGWA 4BEHB 5H2FC 2DZNB 3ABKH 4AIKA 4U7DA 3O8HA 3Q0VA 1XMAA 4BS9A 4ZYDA 3JW4A 4ENNA 2F5VA 3F8NA 2UZDB 1RC9A 4D0PA 4XICA 3K1NA 2GZWA 2OA4A 4MEYF 1W7PB 4GDFA 3H3ZA 4OR5B 1JUSA 3LWFA 3MZ8A 3CJRB 3L27A 2V1NA 1J09A 1IAWA 1H26B 3K4CA 1KA8A 3OYFA 4L9NA 4QNRA 4LG0B 3B7ZA 4BLCA 3KXEC 1G3NC 4A3VB 2BHYA 2GIVA 2M45A 3M0EA 3H3UA 3DTEA 3RE8A 4BUPA 2WBMA 4CFUB 2YFQA 3GTKJ 2KEBA 4BY1X 2HWVA 4MO7A 1K61A 2UUCM 1YLFA 3PO2J 3VFDA 4B3RM 2BBYA 2D2WA 4HNVA 5FRMA 1FOXA 4I0BA 4N9HA 2BXYA 2W96A 2BVMA 5J8FA 5F3WA 2ZAOA 3ZC7B 4AU7A 2BWEA 1AWCA 3TN8B 1LUJB 2X4HA 2C6YA 3ASOH 4BCND 3L2UA 2XDVA 1LEAA 2XUBA 1W36D 1PJRA 2JMWA 3IWZA 1LPQA 4IRGA 3LAJA 2P0WA 2VE8A 5BR8M 3J80Z 2JZ1A 2NOGA 2XB5A 4BBRJ 4C3HJ 1R5HA 3JAMZ 3BG6A 5CVIA 1YJNI 4LK1F 1OJLA 1OYYA 5ITYA 3JRAA 3ZCOA 1SEUA 3E4RA 2NS0A 3KP1E 3CUQA 1ZP2A 4GEWA 4XKBA 4HLXA 3S14J 4HAMA 4HDVA 2QM3A 1YS7A 5LHHA 2HI3A 3RKXA 1Z6TA 3O2PE 4BCPB 1UFZA 1YSYA 4ZYAA 1GKIA 2IS4A 4EOOB 2F5QA 3ABLH 2DWLA 2KZGA 3FXJA 1I1GA 4Y33A 5GTHC 2MABA 5HS8A 2HKXA 3QYBA 4Y28F 7CATA 2TRTA 2Q2EB 3I64A 1T08B 1WJBA 2R7QA 3FWEA 3F23A 2IGOA 1ZREA 4LLNA 2QHOB 3FBNB 5IHYA 1OCCH 1I6XA 1HA8A 4W97A 4NOOB 3D5RC 5TJJA 3JRBA 5EXPA 3DPLC 2XZFA 1P7IA 3BTCA 5HBHB 1D1AA 2Z8YM 1GY3B 1QQIA 2FBKA 4FE7A 5TISC 4OIPF 4MHGA 4A3CJ 5IDNB 4NDLA 2KXEA 3FRIA 1G8XA 5EP1A 5IWAM 2LMDA 2NVYJ 4IRHA 5FLXK 3K9PA 3I04M 4Q7JA 5E3OA 3MKLA 4PZJA 2P5LC 1U8RA 2OPFA 2DXCB 4IBKA 2VKVA 1XSDA 3JRFA 2X6OA 3HSRA 1JHFA 3E5UA 4AYBN 3L29A 9ANTA 5KHDA 3C2GA 4AVZA 4V2GA 3E6DA 1E32A 3Q8GA 2DZLA 1XMKA 3IAS2 2KDZA 3COAC 2OAZA 3CCLI 3IWFA 4IVNA 4A3KJ 3FUUA 3VKGA 1VZ0A 3LSKA 4U0VA 1S72I 1DGRM 3GUDA 4MGIE 4FCVA 2W84A 3FUWA 4QWQA 5C4XJ 1S6LA 4AZFA 2DPDA 1MBJA 1ZGJA 2LHGA 1L0OC 1JUPA 3K7AJ 3QP5A 4DZPA 2XAGA 1LKXA 4BKXA 1IV8A 2WADA 4F70B 3SDBA 1NG6A 4L18B 2DODA 3FUTA 3P7NA 1PUFA 4C2UA 3MI9B 3GQ3A 1JKRC 4BU2A 5E18F 1XWIA 2ME0A 4YIIA 4QTRA 3S16J 3L2AA 3G1LA 1P3QQ 1FWZA 2WAFA 3W6JB 3W0FA 4B7GA 3MHVC 4BBSM 1SG9A 1TBXA 1NHWC 5ITTA 2M0CA 2C5XB 1SD6A 3I56I 3PO3J 4BQNA 1N75A 4CUGA 4UN2B 4A3LJ 3B73A 2KJBA 3BROA 4EOMB 4XL9A 2OOBA 2BW3A 4D82A 3MZHA 3MEXA 4AWXB 2ZSIB 4ELLA 2H09A 1MDMA 2X1DA 1SAUA 4A69C 3U1DA 3K1JA 2D7GA 4F93B 2CCIB 4B7FA 2IGKA 1R4MB 2L3DA 2LHCA 2GBYA 3HRSA 2PBIA 1GVNA 2HYFA 3F6OA 3KX2A 4Q4ZF 3OSFA 3A01B 3PVSA 4ZH4F 3RZDJ 3HHYA 4B08A 2F5EA 3JTHA 4B09A 2VXDA 3FKJA 4FASD 2B63J 3PNTA 4HX7A 3BQZA 5H6RA 2EFWA 3OOUA 4OMYA 1OMIA 1ACIA 4GC5A 4AG6A 4HDUA 2IT0A 2RKOA 2HOSA 1C1KA 2R7RA 2CV0A 1FC3A 1IC8A 1BN5A 3Q0UA 1T39A 2QENA 3U60B 3KP2A 2NXNB 1K79A 1XD7A 3GWZA 4MGYE 4FE4A 5I5ZB 1G8PA 3GLFA 1IBMM 1LFPA 3EUKL 2DNAA 2W9ZA 4M3EA 2DA1A 2DBBA 4AIDA 1UB9A 1OCZH 1SFUA 1BIAA 4TUWA 2WSEF 4EATA 3L09A 3BCAA 1TNSA 2OTJI 1GJTA 3AJIB 1SXJA 1OFIA 1JT6A 1IRXA 1ENWA 2E2IJ 3U61A 4LGWA 3K4NA 1IREB 2BJVA 4LJ4A 1TWAJ 3HRTA 2KMGA 1OCRH 3H0DA 2DA6A 4IHYA 4BCMD 4Y13A 1QAMA 2VF7A 4RB1A 3MCZA 1I6HJ 2VKHA 2K47A 1V5EA 4WXDA 3ECHA 2WIHB 1JOWA 3ZMUA 3MKZA 3GTOJ 1X37A 3KEQA 5ACBA 2B9RA 2HR3A 2MC4A 1R6RA 4G8XA 5EDNA 3G6EI 1BI2A 4LLGF 3NAUA 4UUTA 1EJ9A 1W5CC 1SFEA 2EWNA 2X8AA 4GKKM 3FISA 4N9IA 5HVQC 1IRFA 1NV8A 2IBDA 5EGOA 1QBJA 1E3HA 4EM0B 2EFNA 4HYEA 5LEKA 1MBEA 1LDJA 1G71A 2J5PA 2VI6A 2DMUA 3V42A 3BP8A 3M1CA 3VDPA 2GIZA 4LD5A 4O3MA 4DYQA 2G3QA 4EM2A 1D3UB 3ZN0A 4KRCB 1VEKA 1MMAA 2N8GA 5B1AH 3RPUA 4YOZA 2CRUA 2F2EA 3QQAA 4G6LB 5BPVA 2CQQA 2UXCM 3NBIA 2PQ8A 5D5UB 1JJ8C 2YPRA 4CYDA 2X49A 3KS8A 1WGLA 4B3TM 2RREA 1V55H 2ZNYA 4XLCA 2DJIA 4RM2A 4DR1M 2XROA 3HOTA 1DP7P 3GTPJ 5HVYB 1HW2A 3EPZA 1N77A 1J0RA 3B89A 1XDSA 2CW0F 4I98B 4KUMA 3WU2C 4C2TA 2QP9X 4I76A 3A2KA 3GO8A 4ZPXA 3RJPA 4BCFB 3FZVA 3A8HB 1SVOA 5CVVA 2RNGA 4NRVA 4K0KM 2KNAA 2IXSA 2FNPA 3ASNH 4DV7M 1F5TA 4G3OA 2R7VA 4AKHA 3ZQFA 2YX7A 2FOWA 2MW8A 4IF4A 2G8LA 1EV7A 4F1IA 4CISA 4GITA 3FE3A 3LSJA 2FQ3A 3CCJI 1NTCA 1LNWA 1V5GA 3THGA 3HOYJ 4BNCA 2WV1A 4XONA 1FYKA 3S1MJ 2Y21A 2WXVB 5CJ9A 3ZGKA 2L54A 3L2CA 1AHDP 5DS9A 1K3WA 4IBGA 2CHGA
chains in the Genus database with same CATH topology
2ZPBB 2ZPIB 2CZ7B 3QWLA 4HNVA 4AKIA 4JX4A 5EJCA 2ZPFB 3HHTB 2ZZDB 2ZCFB 4P17A 2DXBB 3TW6A 3A8MB 2G77A 2BS3A 1UGQB 3VYGB 2BS2A 3VKHA 4ELJA 3X20B 2DD4B 2ZPGB 2QF7A 3HO8A 4QSHA 1UGPB 2CZ1B 2DD5B 3VYHB 2CYZB 4Z6YA 4ZGJB 4HL4A 3X24B 3A8OB 4NC6A 2ZPEB 4LOCA 2QDJA 3QYBA 1QLBA 3HZJA 2QFZA 3TW7A 3QZ9B 3X26B 1IREB 3H4CA 4AKGA 2KMGA 3X28B 3HB9A 4MFEA 2CZ6B 1FKMA 3BG5A 4MIMA 2AHJB 4OB0B 4HNUA 4HLQA 4ZGDB 3X25B 2DXCB 4ZGEB 3QYGB 4MFDA 4M6VA 3QZ5B 3A8LB 2QQ8A 4JX6A 2KR6A 3WVDB 2D0QB 1UGSB 1UGRB 3VKGA 4OB2B 1E7PA 1V29B 4AI6A 2DPPB 4JX5A 4OB1B 3A8HB 4HNTA 3HBLA 3A8GB 3BG9A 3QYHB 1AHJB 4OB3B 3DL1A 4FM4B 4AKHA 2BS4A 2QDYB 2ZPHB 4BBSM 3BG3A 3KHIA 3QXEB 3WVEB 2WJ9A 2CZ0B 3QYEA 4BBRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC6 A;  2G77 A;  4Z6Y A;  3QWL A;  3QYE A;  1FKM A;  4HLQ A;  5EJC A;  3QYB A;  4P17 A;  3HZJ A;  2QQ8 A;  2QFZ A;  4HL4 A; 
#chains in the Genus database with same CATH topology
 4BQO A;  2CO5 A;  1ETV A;  5IP6 A;  5ICC A;  3CD6 I;  2R7Z J;  5L3G A;  1D8J A;  5HLT A;  1H1P B;  1NY5 A;  1IDY A;  3KFU G;  1RET A;  1TQP A;  2EV0 A;  3G2B A;  3HHT B;  3SC3 A;  2EZH A;  4EEF G;  1LFU P;  2JXN A;  2A68 F;  1XC8 A;  1IBK M;  3GLL A;  4NB5 A;  4M3D A;  4CGY B;  5JI2 E;  1BM9 A;  3ELK A;  4ZZL A;  3FKI J;  5F04 A;  3TE6 A;  3I59 A;  2R93 J;  4BCO B;  2AHM A;  3OYA A;  3JRI A;  2BS3 A;  1XB2 B;  3CMY A;  2VC1 A;  2VQF M;  1ZN2 A;  4W1U A;  1BVS A;  3SZT A;  3K2A A;  1WJ7 A;  5EG0 A;  4F91 B;  1VFC A;  2JQ7 A;  5FFX A;  6PAX A;  2XGC A;  1J9I A;  4R71 A;  1QHH D;  1XB4 A;  3TQS A;  2E71 A;  3DPU A;  4DBQ A;  4ZYE A;  1USS A;  1U8B A;  1ZGA A;  4M74 A;  5BNG A;  2C9O A;  1K78 A;  2K86 A;  3VOE A;  2CZ1 B;  3SDG A;  3VYH B;  1MX0 A;  4FHT A;  2UWM A;  2JP7 A;  1R58 A;  1X4P A;  2O5R A;  4RF0 A;  2XAJ A;  3BZC A;  3RKY A;  5B5E C;  2FFJ A;  3SAW A;  3HSE A;  4I09 A;  2EK5 A;  5E3L A;  3W0L B;  5JHF A;  3TWL A;  4LFC M;  3T38 A;  4JI1 M;  2DA5 A;  3BWG A;  4CYC B;  4BQQ A;  4LF6 M;  2EKF A;  3Q5F A;  2ISY A;  5E3N A;  3CF5 F;  2DFE A;  4IOC F;  3R0J A;  1GVJ A;  3U6C A;  2PMZ A;  1O3R A;  1Q3C A;  4QOZ C;  4BCI B;  2W2H A;  1JR3 A;  4A0X A;  2K3F A;  4B44 A;  2P81 A;  1YE9 A;  2EBI A;  1XTA A;  3K9O A;  2Y0S A;  4ENJ A;  5HNH A;  3HB9 A;  3DTO A;  3GX4 X;  2Z99 A;  4BY7 J;  2DME A;  3GLG E;  3K4L A;  4NNJ A;  5E8G A;  3BG5 A;  1OL1 B;  3POM A;  4YC3 B;  2HVS A;  3S32 A;  1OYW A;  3R60 A;  2C6T B;  3F72 A;  3VK8 A;  1TT5 B;  2GQQ A;  4HNU A;  3VYR B;  2R0Q C;  2YU9 J;  4MEX F;  2MFZ A;  2N35 A;  2K40 A;  1UG0 A;  4IJE A;  3DQV C;  3KZZ A;  4EJT A;  1TWC J;  3OYI A;  1NVM A;  4NL4 H;  4L4U A;  4DBR A;  2CFX A;  1HCR A;  4ZGE B;  3IH2 A;  2M1B A;  3AFH A;  2UU9 M;  2IJL A;  2PFB A;  3GLI B;  1U3E M;  3A8L B;  2DO7 A;  2VN2 A;  1AKH B;  2KNZ A;  2DW4 A;  2VQL A;  3FMS A;  4XKC A;  2CMP A;  4F6S B;  5H6Q A;  4CCM A;  1JSU B;  1X19 A;  3LOC A;  4ESF A;  4LB5 A;  2PJQ A;  3VPR A;  2AHQ A;  1ZV1 A;  3A03 A;  5D6F A;  4CCL A;  2IW9 B;  3PXG A;  2M87 A;  3SFI A;  2QNJ A;  3TP0 A;  5BQT A;  1QA6 A;  4Z2Y A;  2STT A;  1OI9 B;  1R1V A;  3HJQ A;  2Y2Z A;  3IP4 B;  4PJN A;  4RAG A;  1XDU A;  2UZK A;  2CYY A;  3CES A;  3E9S A;  2L02 A;  2JUC A;  3VDU A;  3WTT C;  1IN7 A;  3BG9 A;  2W9F A;  4XRF A;  3DL1 A;  3O0G D;  1HNW M;  1T43 A;  5J8C A;  4B7H A;  4EOK B;  1MBF A;  4X65 M;  1MD0 A;  3CF6 E;  3H4J A;  3AV0 A;  3VK7 A;  4OU7 A;  2L7Z A;  2XHK A;  4CFN B;  2EIL H;  2J7O A;  1YJW I;  1DGB A;  2GNO A;  2VBX A;  1IG7 A;  2WMB B;  2QKM B;  4G4N A;  2M2E A;  4QPO A;  1HNZ M;  3KCC A;  4E70 A;  3DEU A;  3C2B A;  2ZJP F;  1IXS B;  1T33 A;  4O6J A;  4BCQ B;  1W5T A;  3TL4 X;  1B72 A;  4KO8 A;  3O6B B;  2KL4 A;  1BR1 A;  3REO A;  5EJC A;  4LRS A;  5C1B A;  5JI3 E;  1U0J A;  2V9P A;  2HHH M;  1XSV A;  3GXO A;  1ETK A;  2ZME B;  4ANJ A;  5DM6 F;  1BI3 A;  2Y69 H;  3HUG B;  3DOG B;  2FD5 A;  2XKP A;  4PCZ A;  2D7E A;  2VKE A;  1YHQ I;  1H8A C;  2BJW A;  2AQE A;  2YX4 A;  1FLI A;  2XZU A;  2LY9 A;  4YEL A;  2DMN A;  5L3F A;  3F22 A;  3KFW X;  1OQY A;  2QA4 I;  4I6Z A;  2HGC A;  3K2Z A;  1W0T A;  3RSN A;  5D4R A;  2RRU A;  1PRB A;  4Z8X A;  1T6S A;  3KYD B;  1R2Z A;  3AG2 H;  3ULQ B;  2ZJ2 A;  5K1Y A;  3TNW B;  3TMO A;  2NVT J;  2K85 A;  3OYL A;  2HAK A;  4IHS A;  1ZLJ A;  1DUX C;  1ETX A;  4DV4 M;  2HTJ A;  3G73 A;  2OPT A;  2JA6 J;  2EZL A;  2LRD A;  4DV6 M;  2FEZ A;  4JI7 M;  1J5Y A;  1D0K A;  2HXO A;  2L4M A;  4XLN F;  5LEJ A;  3MFK A;  4HG2 A;  3H36 A;  1TLH B;  3K4J A;  5LLQ A;  3S2D J;  1OCT C;  2XAQ A;  2VPR A;  3E1S A;  5EYR A;  1EE8 A;  1OIS A;  2MD5 A;  1G4D A;  3LNQ A;  2V4J C;  1SXJ D;  1HSJ A;  2K9S A;  4RS8 A;  1R5G A;  4NST B;  3U21 A;  4F3Q A;  2LY2 A;  2KRH A;  2K27 A;  3FXO A;  2QDJ A;  1OAO C;  1G6N A;  1F4I A;  2ICW G;  2WWY A;  1NK3 P;  2JA2 A;  2ACJ A;  2QLZ A;  3BR6 A;  4BCH B;  3FTF A;  5DV5 A;  3GLH E;  1WR1 B;  5HLI A;  2I7N A;  2F5P A;  5GKN A;  1F1Z A;  1N4M A;  3OS0 A;  1UCR A;  1RES A;  3CTA A;  3K10 A;  3GCM A;  4JI4 M;  1IFY A;  3OYC A;  4PK4 A;  2ZME C;  3HRM A;  5EXT A;  1E9S A;  5IT3 A;  3TOA A;  4I3Z B;  4DV2 M;  3BR5 A;  4AVP A;  5JVT A;  1ZHF A;  3HC7 A;  1X1C A;  1XXH E;  1GDT A;  4DUZ M;  3G1M A;  3RPU D;  2KIS A;  1HQC A;  4OVZ A;  1K83 J;  2V9V A;  2QQ8 A;  2UUE B;  5LGT A;  2KR6 A;  2R7G A;  3FD9 A;  1QZZ A;  2JSP A;  2QCU A;  2BY0 A;  5JVG F;  4D80 A;  3OWT A;  2XSZ A;  1ON1 A;  2WFY B;  4HF1 A;  5GAE J;  5TGT A;  1V29 B;  3HEF A;  5D4S A;  5CYI B;  1XNQ M;  2ZB9 A;  3ZXS A;  3SFZ A;  2DXI A;  4ENM A;  2DYR H;  1IBL M;  2YSR A;  1VQK I;  2E5N A;  1ETW A;  3ML6 A;  3VSL A;  2JA7 J;  1UHM A;  2DOF A;  2R3S A;  2O61 A;  2PMI B;  2WHB B;  4CH7 A;  1TC3 C;  2JY7 A;  2MR9 A;  4S04 A;  2DVW B;  2YUS A;  5LFA A;  5C44 J;  1LEB A;  2VOO A;  2ZPH B;  1MMD A;  1GLN A;  2KPM A;  3OYG A;  2ID6 A;  1WH7 A;  3CMM A;  1J59 A;  3BG3 A;  3S15 J;  3WVE B;  2UXX A;  1F43 A;  3HOU J;  1TD6 A;  2M8E A;  2P6T A;  2J7N A;  1DV0 A;  4BBR M;  3HGY A;  2IS2 A;  4WW0 A;  2CSO A;  1FNN A;  2YS9 A;  2VQC A;  4ROC A;  2M8G X;  3E3V A;  2FH0 A;  3UZU A;  2DJN A;  3ONQ A;  2X1N B;  4G6Z A;  2R65 A;  4YY3 M;  3LSR A;  2GWR A;  2HPM A;  4EGZ A;  3F6V A;  1ZG5 A;  2Y48 A;  4DJA A;  4XN0 A;  2KRK A;  3B9P A;  3GRY A;  3WGH A;  2KLO A;  2R5Y B;  1ZRF A;  2IN3 A;  1VQ7 I;  5KCM A;  1Z7U A;  1ZTR A;  3MAJ A;  3CGW A;  3HGI A;  1POG A;  1PYV A;  1H9T A;  3ECO A;  1A5J A;  1X1B A;  2VOD A;  1W98 B;  4DV5 M;  4FWG A;  4UHT A;  1JTX A;  2VBZ A;  4NUB A;  1BI1 A;  3WGI A;  3WTW C;  1IN4 A;  3R4K A;  2ZXJ A;  3L2R A;  4MGZ E;  3FXR A;  1TTE A;  4XBO A;  4PT5 A;  2MH9 A;  3LFK A;  4S05 A;  2STW A;  2ZNZ A;  3LSP A;  4YG2 F;  3H1C A;  5HLH A;  2DPU A;  2Z1D A;  3FUV A;  4OW0 A;  2PG4 A;  3EID B;  1QDT A;  2Z4R A;  3GF2 A;  1K3X A;  2KNV A;  4HF2 A;  3SYL A;  4E7I A;  3DLL F;  5ICG A;  3ABT A;  1X3U A;  1B1B A;  3I71 A;  3FIW A;  2RGH A;  1JR3 D;  3I01 M;  2E60 A;  3DWL E;  4FET A;  3BLQ B;  1YX3 A;  2VQH A;  3SYT A;  4REZ A;  3P9K A;  2CHQ A;  4MB7 A;  4BXX X;  4IHT A;  1WI9 A;  4AKG A;  4IJA A;  1KYW A;  3KDS E;  1XMO M;  4LMY A;  5L3D A;  3DXJ F;  3QAH A;  5DQW A;  5IYB J;  2XGN A;  1LDK B;  2IA1 A;  3V7C A;  3JRD A;  2JK3 A;  1Z77 A;  3CCY A;  3X2Q H;  1MN3 A;  1XGM A;  1XNR M;  4TV7 A;  5FKN A;  1YRN A;  2CGP A;  3K7A M;  1MBH A;  4Q48 A;  2VBW A;  1RKT A;  3S1Q J;  2HXI A;  3BG7 A;  2VOP A;  2LTP A;  1PGY A;  4ZGD B;  4NQW A;  1V92 A;  3LVW A;  3DTI A;  1D0L A;  3GRV A;  1Q39 A;  2XH9 A;  4IRI A;  2BVL A;  1X58 A;  3C3D A;  5F0C A;  1FBS A;  3J81 S;  1IRZ A;  3BHU B;  2MLK A;  2PJP A;  1Q02 A;  3OIP A;  5LMU M;  1ORK A;  1VND A;  3BR0 A;  3DKY A;  3V8J A;  3GTQ J;  4KN4 X;  1KYI A;  1I4W A;  3K1M A;  2HCB A;  3FMR A;  5DCM A;  2V7F A;  1IJW C;  2KW0 A;  1EF4 A;  1RZ4 A;  1DGH B;  1JHH A;  4HOB A;  3MKW B;  3V8L A;  2VUM J;  2F5F A;  2L9N A;  3FM3 A;  4HA8 A;  1U9O A;  2OOA A;  2XSJ C;  3VSK A;  4GMQ A;  2WAQ A;  1QZY A;  1FSH A;  3OS2 A;  4YFK F;  3JR9 A;  3A8G B;  2EPF A;  5EF6 A;  3HG9 A;  1PJT A;  2CCH B;  1T2K A;  4XGI A;  1A6I A;  2HDC A;  2Y9Z A;  1FMW A;  4WXC A;  2E34 A;  2WJ9 A;  2L2O A;  3ZMS A;  3IC7 A;  4MQ9 F;  3ABM H;  1Z7L A;  1NHG C;  2VLA A;  4EGY A;  1FJL A;  4G6Q A;  1NH3 A;  2L2D A;  2CQ7 A;  1T95 A;  2L4E A;  1Z67 A;  3FF5 A;  4NRW A;  4JX4 A;  4FCW A;  1SC7 A;  1TR8 A;  5DTD A;  1VEG A;  2LW4 A;  5ITQ A;  4F6W B;  3CDH A;  4UUS A;  3EDP A;  5CKT A;  3HHZ A;  3K92 A;  4CZC A;  1H9G A;  4LJ5 A;  1DQU A;  3A8M B;  5L8R F;  1Y8G A;  4WX9 A;  3UR3 C;  2LG4 A;  1KON A;  4I0A A;  3T1Y M;  3OIO A;  3SJM A;  1LQ1 A;  2K6B A;  3P5J A;  1CF7 A;  2LR8 A;  2KKO A;  3TO9 A;  4C2M J;  2ZKZ A;  4DQ2 A;  2XLJ A;  3BQY A;  3T8T A;  1XC5 A;  2DD4 B;  8CAT A;  2VAS A;  3J81 Z;  1Z5A A;  3S3M A;  3J80 K;  3HTS B;  2R5Z A;  4XLH A;  5F08 A;  2G0E A;  2Q0O A;  2IS1 A;  2R7U A;  4JOM A;  1VDD A;  1IN5 A;  1YW8 A;  2FMY A;  3CDI A;  3FDY A;  4M72 A;  5K7H A;  4IKF A;  2X6Y A;  3LA3 A;  1R36 A;  4FX4 A;  4XLF A;  3TO7 A;  2CW7 A;  4IMY B;  3F5X B;  3A8O B;  2ZSH B;  4CFX B;  4IBC A;  1R6B X;  3FYC A;  5F0F A;  2XF5 A;  4Y7N J;  1ZAR A;  5DCF A;  3SXY A;  4F52 A;  4RB3 C;  3KPH A;  2FJ1 A;  4LCB A;  2ZAN A;  3MZY A;  1PP7 U;  3F8C A;  2EIK H;  3FUX A;  3V76 A;  2VB6 A;  4RGR A;  3QZ9 B;  3ZQC A;  2FNA A;  1YW7 A;  2RV8 A;  4IQ4 A;  4OIO F;  5JI6 A;  2L4F A;  5FKK A;  1ZMV A;  4I4L A;  4BCJ B;  4RAZ A;  5LRS A;  4G4Q A;  1D1C A;  4MLO A;  2R18 A;  2JA8 J;  2E36 A;  1H89 C;  3M3Y J;  5LGU A;  4A2U A;  1H6U A;  1WJ5 A;  2OF7 A;  4MIM A;  1QMZ B;  5EZH A;  1IY1 A;  2AHJ B;  1DO2 A;  3FKE A;  5FGK B;  4BBA A;  3K4K A;  4E4H A;  1SFO J;  1A36 A;  4KYW A;  3WTS C;  4L9T A;  3QPT A;  4IPA A;  5KQD A;  4V19 K;  3MJ5 A;  3H3V K;  3T0Y A;  3U9G A;  2KRF A;  4MH0 E;  5ITX A;  3RTR A;  5BPD A;  4LFU A;  3QYG B;  5ICP B;  4IHV A;  5FTJ A;  1Z5B A;  2F5N A;  2XSZ D;  2KMU A;  3DDP B;  2UXN A;  3QPS A;  2JVG A;  5M3M J;  2D0Q B;  4XLE A;  2JZ0 A;  2ESH A;  1BBY A;  4OWR B;  3FX3 A;  3IRQ A;  2DCE A;  1Z0X A;  1WSU A;  2K0B X;  1N34 M;  3KEY A;  4L0Y B;  3A4C A;  3BZK A;  1XCB A;  4M0D A;  1UM8 A;  2JPB A;  4WF2 A;  5HBJ B;  2XPV A;  3BCB A;  2CWE A;  4ABZ A;  3LL7 A;  2JWT A;  4QHT A;  4O5V A;  2XAH A;  5ILU A;  1ETO A;  2XAS A;  1C0W A;  2V1X A;  3B57 A;  2M0M A;  3HPG A;  3BTI A;  3DKX A;  2MA3 A;  1O7L A;  1TP4 A;  4IBB A;  3U6Q A;  2E35 A;  1MSE C;  5FRN A;  4KMU X;  2FRH A;  3S17 J;  2IPQ X;  1YIT I;  4FVM A;  4UVC A;  1P7J A;  4OIN F;  1O3Q A;  2QKL B;  3UK6 A;  1Y8Q B;  2EZK A;  1J5E M;  4S12 A;  5KK1 A;  3L28 A;  2KIQ A;  2G9W A;  5D5V B;  2CZ0 B;  2UUZ A;  4BCQ D;  1S29 A;  2JY8 A;  5FGM A;  2B0L A;  5DD4 A;  4II7 A;  2XAF A;  1PJI A;  4RGX A;  4CXA B;  2DA3 A;  2CW8 A;  2QVO A;  2ZPB B;  1O3S A;  4U87 A;  3GPU A;  4CCN A;  1M1E B;  4AKI A;  4FIS A;  2LFB A;  3ABU A;  4A6E A;  2QPA A;  2JT1 A;  2ZXI A;  1E2X A;  4XBF A;  4BEH A;  2NVQ J;  4H4K C;  5HDK A;  1ZEL A;  3MMY B;  5D8L B;  4BAY A;  3GYH X;  1BL0 A;  1WH5 A;  3S2W A;  5E1Z B;  3CCV I;  1CUK A;  3W2W A;  4LLL A;  1Z1D A;  1V33 A;  4ZC3 A;  3TW6 A;  2G77 A;  1W7P A;  5D5W B;  5TRD A;  1NJG A;  1U9N A;  4JK1 X;  2Q8K A;  1LE8 B;  5FB2 A;  1Y1V J;  2WC2 A;  2VKD A;  5D6E A;  4LF8 M;  5J4Y A;  4Y72 B;  3HTU A;  3WTV C;  2HOE A;  4LG0 A;  4M6X A;  3HHW A;  4HZF A;  4BJ5 C;  2R44 A;  3CCE I;  1VQ6 I;  2DK5 A;  1W1W E;  2BZT A;  2FU4 A;  5E1X A;  2M4G A;  2IA2 A;  4AG5 A;  2ZTC A;  1EH7 A;  4WXH A;  4YFX F;  1FZP B;  3GLF E;  1OKR A;  1QPI A;  3PSF A;  3AOE C;  3T1H M;  1S7A A;  2LYC A;  3TOB A;  3WHC A;  1VQP I;  3LVV A;  2HL7 A;  2V79 A;  2EUC A;  3BHT B;  3BDD A;  1T3T A;  1QAN A;  4NSR A;  3PQJ A;  2HYJ A;  1OFH A;  4L5I A;  4PD2 A;  3ERE D;  2UZE B;  2XEP A;  2XVC A;  4NSO B;  3W2V A;  1RR8 C;  2ZPI B;  1SXJ E;  1KQ0 A;  2C4G B;  1MW7 A;  2ELK A;  2K02 A;  2ZCW A;  2H27 A;  3OV8 A;  5FRO A;  5IYC J;  5M5W J;  2VL8 A;  1IN6 A;  1T6O A;  3HZJ A;  5FTN A;  1MMN A;  2L9S A;  3PQK A;  4A6D A;  3PFI A;  1QLB A;  2F5C A;  2QFZ A;  3GZN B;  2CUF A;  1UFM A;  1HQY E;  2L0K A;  3PJR A;  1D5Y A;  5M5X J;  3QOD A;  4I81 A;  1HKS A;  2YNM D;  2R7F A;  4MFE A;  4OU0 A;  1WFX A;  5J1Y A;  4YOO A;  4JI3 M;  1FJG M;  3Q3S A;  3W67 A;  1GUX B;  1HNX M;  1TWG J;  2FQ4 A;  4XNF A;  1QQW A;  4ZDO A;  2KP6 A;  2Y0T A;  2YR2 A;  5E3M A;  3WU0 A;  3U1K A;  1XN7 A;  1VQ1 A;  2CUZ A;  2GXG A;  5HNF A;  3RGF B;  2CE7 A;  3HU1 A;  2R92 J;  3I4N J;  4DR7 M;  3KET A;  3KOZ E;  3ZQL A;  1UNL D;  3X25 B;  3U5Z B;  1SAN A;  2DQR A;  2ESN A;  3HKZ N;  4U0Y A;  4IIW A;  3KP6 A;  3CTW B;  1WJA A;  1KU9 A;  1I39 A;  3CF0 A;  1KU3 A;  2QGS A;  2I40 B;  1R00 A;  3L7W A;  4IO9 F;  1KQ8 A;  4CGZ A;  4BB9 A;  2Q2E A;  3F3X A;  1K78 B;  2FSW A;  5CVU A;  1K4S A;  1VG5 A;  4ROD A;  4HRI A;  2RGV A;  2DQL A;  4ESB A;  3WG9 A;  3J2P B;  4LJZ F;  5EXS A;  4EOR B;  1EKE A;  3K70 D;  2R46 A;  2JTV A;  2FS1 A;  3CMA I;  5ITU A;  4JI8 M;  2XRN A;  3FXU A;  4XID A;  2L6O A;  2C9C A;  1YS6 A;  3M03 A;  4LG2 A;  1QYR A;  4M73 A;  3RCO A;  2F4M B;  2ECC A;  3HXL A;  5F27 A;  3RIR A;  4LF5 M;  3R9X B;  3AKZ A;  3OSG A;  1JT0 A;  1BA5 A;  3KZI C;  1AHJ B;  1ZQ9 A;  1X3Z B;  2AO9 A;  4XK8 F;  4AYB A;  5KPT A;  4UUV A;  4P16 A;  2JJ7 A;  1JTY A;  1Z59 A;  2WB1 N;  2F5S A;  3A0H C;  3VFZ A;  2UV1 A;  2DAK A;  2LC2 A;  3DA1 A;  2HOT A;  5FFZ A;  1OIU B;  3V7S A;  1X4O A;  4RNA A;  1U6G A;  2DTZ A;  2OCC H;  2MD0 A;  2NS7 A;  3QU3 A;  2JSC A;  4G6T B;  4KJZ A;  3G3Z A;  4L9V A;  3D8L A;  3OL3 A;  3E46 A;  1B59 A;  1LVA A;  2EFO A;  1GJS A;  4N4O B;  5GPC A;  1FTT A;  2EB7 A;  1S9H A;  2MYS A;  2XF7 A;  3E0J B;  3U6L A;  2K3P A;  4Y4R A;  4H0E A;  2APL A;  2B9S A;  2C99 A;  1H1Q B;  4P5O A;  3D0S A;  3ZR8 X;  1JE8 A;  1DGG A;  3DBL B;  3AL0 B;  5FD5 A;  5BPI A;  1J75 A;  4HW0 A;  3AOG A;  1TGU A;  1XS9 A;  3OYK A;  2WV0 A;  1ENH A;  1XHB A;  1YUB A;  5DUI A;  4KFC A;  2DKL A;  3A0B C;  4OAY A;  4JYK A;  3JR5 A;  3R61 A;  5KVR A;  2FX0 A;  1D3Y A;  1UGQ B;  4P9U A;  3FTC A;  4ASN A;  3MKY B;  1YFH A;  2OU2 A;  1ZR4 A;  3VKH A;  4PJM A;  1O9K B;  3IG5 A;  2DA4 A;  3VEP A;  1F36 A;  4RMN A;  4Y52 J;  5CPR B;  1XMX A;  4U88 A;  2HYG D;  3S3N A;  3M4O J;  1MMS A;  4OMZ A;  3DU5 A;  1GXP A;  2VQE M;  1D8K A;  1MJB A;  1Y6I A;  3ZPL A;  3H4M A;  2P5V A;  3GLG B;  2LH0 A;  3HJS A;  1Y39 A;  2VJJ A;  2DT7 B;  3FBI B;  3HJE A;  4XSX F;  1ORY B;  1X3W B;  4XMY A;  2DFF A;  2E1M C;  4XM3 A;  3QRF F;  1UEL B;  3BR1 A;  3GRU A;  1BJZ A;  1JR3 E;  2D45 A;  2NRA C;  2EH3 A;  2ZPE B;  3A01 A;  4YOS A;  2F6C A;  3HIF A;  3SHF A;  5CVR A;  4M6Y A;  4IX7 A;  4RB2 C;  1PJJ A;  2WEV B;  2HDD A;  4W5W A;  2HZD A;  4QPQ A;  3NRV A;  5DYG A;  1WKM A;  2JPC A;  5KO3 A;  2A6T A;  2K4J A;  3P9I A;  3QU6 A;  2LKX A;  2QBY B;  3WOD F;  2E5Z A;  4F2L A;  1U5T B;  2JVH A;  3Q0W A;  5J40 A;  4RBO A;  4KDP A;  2CV2 A;  3W3C A;  1JB0 F;  3DEW A;  4G4R A;  3D1N I;  2VF8 A;  3TED A;  2HKJ A;  3EOC B;  4DV1 M;  1S5L C;  4YIF A;  2DMT A;  1AUA A;  3QHR B;  3FK7 A;  1DP3 A;  4OB0 B;  1ON2 A;  3AL0 C;  1GL7 A;  5H20 A;  1BOA A;  1T98 A;  1V54 H;  4XRS G;  5F0H A;  4KMF A;  4OIQ F;  2W1O A;  4AQY M;  2VQG A;  1HKQ A;  3BPV A;  2LKS A;  4F6U B;  1SD4 A;  4EVI A;  3HM5 A;  3OY9 A;  2L7H A;  2K9L A;  3OOP A;  4GHL A;  3QZ5 B;  3TNI B;  4ZYH A;  1R4G A;  5EEA A;  4E7K A;  1VQ8 I;  3SEZ A;  2LF8 A;  3F8F A;  1T38 A;  2RQP A;  4JI6 M;  5IT9 S;  4OB2 B;  1E7P A;  2EIM H;  4BJ6 C;  2E7W A;  1NO1 A;  3ILK A;  4AI6 A;  4A0Z A;  1F4K A;  3QHW B;  1WGX A;  3RI4 A;  1B8I A;  5FKO A;  5KPZ A;  3RGS A;  2V6C A;  2EA0 A;  5GAH J;  5GPA A;  2OJE D;  4LF4 M;  2OC6 A;  3DV8 A;  2HNH A;  2H5X A;  2AXL A;  1FEX A;  1MZB A;  2LVP C;  2QZ8 A;  2EA4 A;  3PUB A;  3FMQ A;  2F5D A;  4Y17 A;  4UV9 A;  1OAI A;  2JY6 B;  2HS5 A;  5BMZ A;  1JGG A;  2JRT A;  2LKP A;  4XKV A;  2H1L A;  5GAD J;  3PIP F;  1JI8 A;  1DPR A;  2X1C A;  1ULY A;  4I01 A;  3EUH C;  2W7N A;  1ETQ A;  4YFN F;  1BW6 A;  1MH4 A;  1GL6 A;  1V4R A;  5CQE A;  5C3E J;  3WTU C;  1E3O C;  3A46 A;  2K9D A;  2R4G A;  3G71 I;  1TF0 B;  1U5T C;  1N25 A;  2CH0 A;  1OR7 C;  2DT6 A;  3B74 A;  1D0Y A;  4A5M A;  3KE2 A;  3HL2 A;  1VF9 A;  3WHK A;  2HKO A;  3JSP A;  3MMP A;  5EEH A;  4BJT A;  4LJ7 A;  5BOX A;  1KU7 A;  3W2A A;  4FX3 B;  1W7P D;  3IL2 A;  3KW6 A;  4M9S A;  3ZH9 B;  3T1B A;  4CJ6 A;  1IXC A;  3UMM A;  2X9D A;  2HVQ A;  2ZBK B;  3WE2 A;  4GYG A;  1UNG D;  2HWJ A;  4X64 M;  4R1H A;  4X62 M;  2Y30 A;  1IO2 A;  2M3A A;  3DBH B;  2V6E A;  2X6W A;  4X1E A;  3UNG C;  4BY1 J;  3OL4 A;  3QOE A;  3SMS A;  4GFB A;  1TFB A;  2Z7J A;  2VT3 A;  5E6J A;  3FHN A;  2ZXW H;  3GO5 A;  4P96 A;  2BYV E;  2QZ4 A;  3HSF A;  5GP9 A;  3T5X A;  5IP9 J;  2IP2 A;  3U6O A;  2V9K A;  1VQ9 I;  2BS2 A;  2Y0Q A;  5KQ8 A;  4CFU D;  2M60 A;  5DDG A;  3VDX A;  5KNL A;  3LQR A;  4IQJ A;  3C18 A;  4B47 A;  3BTJ A;  1ONV A;  4CDG A;  2E2J J;  3GLH B;  1QDR A;  2CYZ B;  4I2O A;  5IT9 Z;  1TZL A;  1X1D A;  3EIH A;  2ADU A;  3NWL A;  1Z3Y A;  2H6C A;  4C9Y A;  3LQ5 B;  1FOY A;  4MGR A;  4D5F A;  2Z2S B;  5EP2 A;  3FTE A;  2FBH A;  3GQ5 A;  4HL4 A;  4RLF A;  3CC4 I;  4BCG B;  2Y20 A;  4F55 A;  3BBZ A;  5FTK A;  2QCO A;  2D7H A;  4NC7 A;  4XN3 A;  2Z5U A;  2O8K A;  4KIS A;  2PLY A;  2PJR B;  3J7Z I;  4JV5 M;  2VC0 A;  1XXH B;  2G5G X;  3DJB A;  3T15 A;  1LV7 A;  1Z91 A;  4LJ6 A;  2HOA A;  3DP7 A;  2OZ6 A;  4L6V 6;  2LH9 A;  3MK6 A;  4CFM B;  2R6F A;  4QOS A;  2EIN H;  4BH9 A;  2KZS A;  2I7P A;  3C3E A;  1QVT A;  2WTE A;  1YW9 A;  4II3 A;  4RAY A;  3WG7 H;  2DAO A;  1BU2 A;  5HBE B;  2CV1 A;  3G1O A;  2H6B A;  2HQN A;  1HF0 A;  4ROE A;  3U6P A;  5J47 A;  5GAG J;  2C5R A;  1WJF A;  2PHG A;  4ZYG A;  1GUU A;  1OKS A;  2H8W A;  2PMH A;  1R5L A;  3DCF A;  3ZQI A;  2OTL I;  1OKV B;  2NNN A;  1YJ9 I;  1NNJ A;  1IUF A;  3SAV A;  1BR4 A;  4FTH A;  5DFL A;  3C58 A;  4DOZ A;  3L2V A;  4GKJ M;  1FIP A;  2R7T A;  4PDG A;  3IG8 A;  4G7O F;  1JKP C;  1G2H A;  1TWF J;  4CYC A;  4OGR B;  3DZD A;  1G3I A;  1L8Q A;  4MM3 B;  3TDU C;  3MWM A;  2VDB B;  2ZFU A;  5IF1 B;  2PK9 B;  2DLL A;  3C3W A;  5FLM J;  5HQ0 B;  1R5I D;  2DWM A;  2LP0 A;  2LVS A;  4MTE A;  5FD6 A;  1HLV A;  1L1Z A;  2HEO A;  5EZG A;  4UVA A;  4FQG A;  1FMV A;  2O01 F;  1Y0U A;  4JX5 A;  3WTX C;  2XFT A;  1YO5 C;  1XGO A;  3ZRG A;  1IV6 A;  1PJS A;  2GXA A;  2VJ5 A;  5EQT A;  5KPR A;  5E20 A;  3S3O A;  1ODD A;  4FM4 B;  4CFW B;  2C96 A;  1ZAO A;  4RF1 A;  1MBK A;  3J27 B;  5IZ7 D;  2BXZ A;  2QDY B;  3CLO A;  3GPY A;  4B3S M;  2DHY A;  2BPM B;  1Z9C A;  1I1S A;  1QAQ A;  1RR7 A;  4LGM A;  2QGU A;  1DO0 A;  3UJN A;  3GLI A;  2QSH X;  3H0G J;  4LB6 B;  3FXQ A;  1ZG1 A;  1AKH A;  3HHG A;  1QVU A;  5ICF A;  4XRS A;  2LBF B;  1WJD A;  2EZI A;  3W6K B;  1URC B;  4EOP B;  1GXQ A;  2V1D A;  4LIT A;  1I3A A;  3I5U A;  2EO2 A;  1Z5C A;  1UJ8 A;  1XX5 A;  2GOX B;  2G7U A;  4KT6 A;  2WZJ A;  2L7F P;  2H94 A;  5J3L A;  3QPH A;  4E7S A;  4L78 A;  1D0M A;  1J2X A;  2O7O A;  1BR2 A;  1C9B A;  1E3P A;  2IRF G;  4JN6 A;  2KFD A;  1JUM A;  4WK8 F;  3PM1 A;  4HBL A;  3FYD A;  2NQ8 C;  1B6A A;  3M8J A;  1P4A A;  4JI0 M;  4EOL B;  3IHU A;  1FP1 D;  3E5X A;  3R0A A;  1U78 A;  3K0L A;  3ZQG A;  3W6V A;  1AOY A;  3KP7 A;  3MY1 B;  2WSC F;  3F8B A;  4EJU A;  2NVX J;  1Y8R B;  4HSR A;  4PDK A;  2E1C A;  1T0F C;  4LFB M;  4CCO A;  4EJW A;  4BCM B;  2DAI A;  4LG3 A;  3TP3 A;  2R4J A;  3BLH B;  5BNJ B;  1IXS A;  3HO8 A;  1S7O A;  1FP2 A;  2GA1 A;  3C7J A;  3OYD A;  1JKQ C;  1HBX G;  1H0M A;  3SAS A;  4G9Y A;  3O3K A;  5LD2 C;  1W0U A;  4NHJ A;  2MRO B;  3GFI A;  2O3F A;  2TCT A;  4J01 A;  2WPA B;  4L5E A;  2ZME A;  3H5N A;  4OAZ A;  3M8F A;  1RU3 A;  2KIM A;  3GPX A;  3HUG A;  4NC6 A;  1S7E A;  3GTM S;  2HVR A;  2YQZ A;  2MH2 A;  2P7C B;  1PKD B;  3I54 A;  1OKW B;  2L9R A;  2FE8 A;  4RGU A;  4CIC A;  4CCK A;  2XKO A;  3GVA A;  1QGP A;  4U7B A;  2LSO A;  3GP1 A;  2L7I A;  2FXA A;  3H9G A;  3I9V 2;  3BJ6 A;  5DD8 A;  2BHZ A;  1W5S A;  4WP2 A;  2QQA A;  5HDG A;  1D1B A;  2J5Y A;  1NG7 A;  1LFB A;  1KQ9 A;  1OCP A;  1SFX A;  3K9T A;  3ZOB A;  2DMP A;  2XAU A;  5HNB B;  5HLG A;  5FO5 A;  1JKO C;  1QNT A;  3OS1 A;  2P4W A;  1UST A;  2F4O B;  3LQQ A;  3OYB A;  3A42 A;  2KT0 A;  3MD2 A;  3I3L A;  2L01 A;  1FVV B;  3OYJ A;  3M1E A;  3F0C A;  3IAM 2;  4GYI A;  3TDZ C;  5IPA A;  1CF7 B;  1H1R B;  1TH4 A;  4I02 A;  1OCO H;  4L16 A;  3KP3 A;  1P4X A;  1DDN A;  2Z3X A;  4MFD A;  1PUE E;  1XPX A;  3J7A S;  2RVC A;  4M6V A;  3H9J A;  5GTI C;  2KIU A;  2NAZ A;  1H25 B;  1XO2 A;  2F48 A;  1ZRC A;  5D8K B;  4IHW A;  1PJQ A;  4JQF A;  1MJ9 A;  1TW2 A;  5A2Q S;  2IVM A;  1CQT A;  3CO6 C;  3W68 A;  1X2N A;  4EJO A;  1GV2 A;  1C7Y A;  1SVM A;  4GH9 A;  2UXB M;  1A6Q A;  2W4S A;  1IZ1 A;  1MH3 A;  2OCE A;  2LVO C;  2LLK A;  3LSG A;  1MJA A;  2M9H A;  2I53 A;  1D0Z A;  1L1T A;  4X0G A;  3WGG A;  4IBJ A;  4HQM A;  2OQG A;  2DOA A;  2O03 A;  5JHU A;  1OL2 B;  1K7A A;  3CJQ B;  2ZTD A;  2COB A;  1H28 B;  3GZ6 A;  3SMP A;  2X1E A;  5LBQ A;  1R71 A;  1OPC A;  2NOJ B;  2ELJ A;  3BLR B;  3GFM A;  1N36 M;  2YU3 A;  5EXX A;  2FML A;  2IW6 B;  1MSF C;  2GOM A;  3ZP5 A;  3DU6 A;  3ZQJ A;  4ESJ A;  3B7Q A;  4AM3 A;  5DEQ A;  4E7J A;  2GQF A;  2DA7 A;  4IBE A;  2D1V A;  3CUQ B;  4U0W A;  5ERI A;  5JR3 A;  1HOM A;  4DV3 M;  3OR1 C;  4LZJ A;  5LHI A;  1EA3 A;  3QAU A;  1H27 B;  2VJI A;  1ZKG A;  3ZMZ A;  2VIX A;  4P17 A;  4DGW B;  5ICE A;  4OX9 M;  1BW5 A;  5DYI A;  2QWW A;  1FSE A;  1G59 A;  1L3L A;  2BV6 A;  4RM3 A;  3V4G A;  4DYC A;  4G6D A;  2EUF A;  1YX5 A;  2CG4 A;  2K9Q A;  5FSW A;  2FOI C;  3OR2 C;  2C5V B;  2UUB M;  1WHU A;  3UGJ A;  1IGN A;  4DZJ A;  3RYP A;  2OO9 A;  4A3M J;  2QQB A;  2GM4 A;  1S3S A;  1PVE A;  5A2Q Z;  1NY6 A;  1ZMU A;  3A45 A;  3EJ1 B;  2MLG A;  4QSH A;  1FOK A;  3RYR A;  4F7J B;  2DD5 B;  5LQF B;  4JBA A;  3MQ0 A;  4M9X A;  3VYU B;  3SAU A;  1HDD C;  1ZR2 A;  2CEA A;  2ERC A;  2Z4S A;  1D0X A;  2IEK A;  3L1P A;  4GRI A;  4F7Z A;  1O57 A;  3SZG A;  4BY7 X;  4G7H F;  3SQN A;  4LOC A;  1B9M A;  1FOW A;  1W4M A;  3VYS B;  1O7F A;  4GCV A;  4AIH A;  4DW6 A;  2FOK A;  2R5Y A;  4XLP F;  2W48 A;  4HX4 A;  3BOQ A;  3ZN1 A;  2R7D A;  1YG2 A;  4BHP A;  2UZL B;  2XPW A;  3G33 B;  2ISZ A;  3AAF A;  4HLY A;  4WUR A;  4CRL B;  3LSM A;  5E8I A;  3SEQ A;  2XIG A;  5JFR A;  3GTG J;  3BJA A;  4JI2 M;  1BC8 C;  3R8F A;  2W82 A;  2UXD M;  3CUQ C;  3JAM K;  1FBQ A;  3WHB A;  2J5O A;  5ITX E;  5CVJ A;  1Q1V A;  1PUF B;  3GPP A;  1QUS A;  3I53 A;  5HS9 A;  3I4Y A;  1V3F A;  1OGU B;  1ZLK A;  3H92 A;  1RI7 A;  2A69 F;  1RUN A;  5ILV A;  5KAI C;  5DQV A;  5M3F J;  4BQA A;  2CWB A;  4IZZ A;  2M34 A;  3NDQ A;  2Y9Y A;  1JST B;  2RKH A;  4PFP A;  2JY5 A;  4D5C A;  5C4J J;  2BW3 B;  1UGR B;  2C98 A;  4DBG B;  5ED4 A;  4C30 A;  1MDM B;  2W25 A;  2LOO A;  5E1W A;  1GVD A;  4A3I J;  5BS6 A;  2XGE A;  2VE9 A;  4YIR X;  2HQ5 A;  4GC9 A;  4XLA A;  4M9Z A;  1TDZ A;  3AG1 H;  3KYC B;  3L25 A;  2IW8 B;  1TH2 A;  3PIO F;  4BYY A;  3JRG A;  2M5W A;  1R1T A;  3CO7 C;  1G4A E;  2R0I A;  2AS5 F;  1MBG A;  2A61 A;  1HC8 A;  5J6X A;  4N4N B;  3HWS A;  4OB3 B;  1R4N B;  3CCM I;  1Y0N A;  1SD5 A;  2BS4 A;  2LVQ D;  3DFZ A;  2BE5 F;  3OYE A;  3GEZ A;  2CJJ A;  1O3T A;  4CIZ A;  1FT9 A;  3BXW A;  1XGS A;  2KHM A;  1VQ5 I;  2LVA A;  2M30 A;  1KSF X;  4PSX A;  5B66 C;  3OYN A;  1WPK A;  4PGH A;  3J7A Y;  3NQO A;  5FLX S;  4NXM M;  2CQK A;  1GT0 C;  4KOD A;  1G3S A;  2K5C A;  3JTG A;  2DDB A;  3RQI A;  3CME I;  1TW3 A;  4AUX A;  1DGH A;  3GLF B;  5HOO A;  4B4C A;  3D5L A;  3H5A A;  1WXQ A;  3PNY A;  4J19 A;  4L0Z B;  3H5R A;  2E19 A;  3K69 A;  4RLQ A;  4QLC U;  1N78 A;  5CQG A;  1HJP A;  1TDH A;  4KN7 X;  2BY3 A;  1SXJ B;  1L2D A;  4M71 A;  1KZH A;  3HHX A;  3KIO A;  1UHS A;  1A04 A;  3HJ8 A;  1IW7 F;  2JN6 A;  3U61 B;  3I0T A;  1NNU C;  4KIG A;  2EV5 A;  2K9M A;  4OOI A;  4LGY A;  3GRR A;  2XFS A;  2MG4 A;  2HQR A;  4HF0 A;  2CHV A;  4RGS A;  3SZP A;  2C5O B;  2DTR A;  1HST A;  4GO1 A;  4FW9 A;  3S1N J;  2G9X B;  3EYI A;  3B02 A;  4A3D J;  2O0Y A;  3FXM A;  4A93 J;  1GO5 A;  2DU9 A;  1NHA A;  2IW5 A;  2L5Q A;  4EC8 B;  4ANR A;  2KQR A;  2DWZ B;  1DU6 A;  3ERM A;  3SAR A;  2P7V B;  1B4A A;  5EGO B;  4Y15 A;  1R7R A;  3BJO A;  1VQO I;  3MN2 A;  2B7E A;  4B43 A;  4DR3 M;  1X1A A;  3LSI A;  2NS8 A;  3QPL A;  5E17 F;  4EON B;  1MNE A;  1QVR A;  5IY5 H;  4DR5 M;  4KIF A;  1HT1 E;  2L9V A;  2DI3 A;  3ROU A;  2KIF A;  3X26 B;  5B1B H;  3FXL A;  5HS7 A;  5K5R A;  3EUA A;  3UKG A;  1NK2 P;  4X66 M;  4LZZ A;  4CA0 A;  5HOD A;  3JR4 A;  2LNH C;  1AIP C;  1WI3 A;  3IKV A;  3OYH A;  2ZJQ F;  2CS3 A;  2XGX A;  5FLX Z;  1A35 A;  2LNB A;  4R8H A;  2X0L A;  1QHG A;  4PJJ A;  3TO6 A;  1FY7 A;  5C18 A;  3E6M A;  3T8R A;  3OMY A;  2UZB B;  3LCV B;  4RDU A;  3NWT A;  3AG4 H;  3DOA A;  1YTY A;  1LDD A;  4BDZ A;  4R7G A;  1V5F A;  1SXJ C;  1G3W A;  2QYO A;  1E94 E;  2XGD A;  3LFU A;  4BHB A;  1VDL A;  1ZG3 A;  3GW2 A;  2JUJ A;  1TQM A;  5IOZ A;  1AD6 A;  3VOD A;  3GTM J;  2NYX A;  4LFA M;  4A3F J;  4B3X A;  3KSJ A;  1VOL A;  1I27 A;  4L5J A;  3KS4 A;  2WY8 Q;  3RPQ A;  1R7J A;  1MJG M;  4P1W A;  1EFU B;  2EA2 A;  4B8X A;  3BLY A;  5M5Y J;  3CCS I;  2DPP B;  2D5V A;  1VI0 A;  4XSZ F;  3ZQ7 A;  3WTY C;  1T8I A;  1H88 C;  1WZ2 A;  4BXF A;  3KOW E;  4HNT A;  3HBL A;  1TTY A;  2PEX A;  3IUO A;  4JXJ A;  3I59 B;  1VQN I;  2RN7 A;  5EG0 B;  3CUO A;  4AD9 A;  2NVU B;  1QPM A;  1Z3X A;  5E79 C;  2CUE A;  3ESW B;  4NXN M;  4E7H A;  2L09 A;  3HHH A;  3ZQQ A;  1WJE A;  3V7R A;  4G12 A;  1BC7 C;  5IDP B;  2F2C A;  1PP8 F;  1K6O A;  3DDQ B;  3QYE A;  3CC2 I;  4EIW A;  3IHP A;  2V1U A;  1O4X A;  4DR4 M;  4PDI A;  2IAI A;  4ZJZ A;  1G3Y A;  3BTL A;  3E5Q A;  3CCQ I;  3K6G A;  4KIT B;  3AOE A;  3C9P A;  2UUA M;  1SVL A;  5FTL A;  3WHL A;  2RQQ A;  3BPX A;  3K1P A;  3SHG B;  3KEO A;  5L3E A;  1XMQ M;  3Q9V A;  4I8O A;  3OIQ A;  3KOY E;  4HV6 A;  4HQE A;  3LSH A;  2DAG A;  1JGS A;  4LIU A;  2OQR A;  4BAC A;  3DEE A;  4CCJ A;  3M6A A;  2E1M B;  4DYR A;  4Q5S F;  2DXB B;  3A02 A;  3N05 A;  3KYL A;  3CCU I;  4CFV B;  5JLW A;  1IY2 A;  3K4B A;  1E17 A;  2A5W A;  2ZAM A;  1KGS A;  2ZM6 M;  1XGN A;  4BHC A;  2R45 A;  5DM7 F;  1WGN A;  2PMU A;  1E9H B;  2E1N A;  3VYG B;  1FYM A;  2MH8 A;  4Q47 A;  4CHT B;  2DFH A;  2PMZ N;  2WY7 Q;  4D7N A;  1REP C;  2BKZ B;  1B8I B;  2QUF A;  5AIP A;  3F9K A;  1UNH D;  1GAB A;  2LK2 A;  1UMQ A;  1NJF A;  5LMN M;  1LTM A;  2Y0S N;  3Q9S A;  1UGP B;  1AIS B;  2P5T A;  1RNL A;  2FE3 A;  1WQ2 A;  3PL8 A;  4K2E A;  5L3C A;  2RGO A;  4BE1 A;  5JLX A;  4ZGJ B;  4PGG A;  4M0W A;  2P5K A;  3SAT A;  5FKL A;  2A6E F;  2HPI A;  3X24 B;  2LD5 A;  1QUT A;  2MBF A;  1GH6 B;  4LRT A;  4G94 A;  2LRE A;  3NAR A;  3GTJ J;  3RQ4 A;  2GAU A;  1AA7 A;  2H8R A;  2LWX A;  2A05 A;  4D9J A;  1LE8 A;  2ZPF B;  3GLX A;  2R7O A;  3I4V A;  4WWC A;  1I94 M;  1A5T A;  2D1H A;  3E6B A;  1BJA A;  1TH3 A;  4V2F A;  2F4I A;  3IKT A;  4C3I J;  1Q3B A;  5F1R A;  1EH6 A;  4ZDP A;  3JRH A;  1WVR A;  2CJM B;  3TNH B;  2CQN A;  1IXR C;  4LIV A;  4IOA F;  3JSO A;  3J7Y J;  3KVW A;  3KP0 E;  4ITQ A;  5B3S H;  4DR2 M;  2CFO A;  4BXX J;  1QU3 A;  4ZTF A;  2X6X A;  2ZO4 A;  2V6Z M;  2HU9 A;  2DK8 A;  1F9N A;  3QYF A;  3TBI A;  3TWK A;  2WAE A;  2WIP B;  2KDO A;  3CLQ A;  1MIJ A;  4HX8 A;  3CC7 I;  1K82 A;  2Z3Y A;  2DOE A;  3CP8 A;  2KHH A;  2IGM A;  1D2N A;  2BNK A;  4QHS A;  3FXK A;  3M07 A;  4CSW A;  1FPQ A;  1B72 B;  2BY1 A;  4ETS A;  5K5O A;  3BC8 A;  2DA2 A;  2M4K A;  4CO8 A;  3LA2 A;  3TWM A;  2FF4 A;  4D1Q A;  3HDD A;  1KU2 A;  2I8D A;  3MVP A;  2ELH A;  3KLO A;  1VQL I;  2K7L A;  4DIQ A;  2CU7 A;  4F7L B;  3JCU C;  1Z6R A;  4OB1 B;  4BXU A;  4XQF A;  1PDN C;  1KXU A;  4M3G A;  2DYS H;  2IA0 A;  1GUX A;  3U60 A;  3F8M A;  2E2H J;  2DEN A;  3RKW A;  1LB2 A;  2W85 A;  2XB0 X;  3QYH B;  3AG3 H;  3HKZ A;  4HEA 2;  4DR6 M;  4YRV A;  3U2R A;  2P8T A;  3S8P A;  3MY5 B;  3H9Q A;  3VYT B;  2DMQ A;  1ITY A;  2XV4 S;  1WJC A;  2I10 A;  2VON A;  3U5Z A;  1I5Z A;  4DNC A;  2OBP A;  1SD7 A;  3DKW A;  4ZDL A;  2WA0 A;  3E7L A;  1VQ4 I;  3GFJ A;  3L2W A;  4TTH A;  4LJA A;  1YIO A;  5AIQ A;  4FT8 A;  2JNH A;  2VII A;  4PUS A;  3E97 A;  3RKQ A;  2W00 A;  2W99 A;  4XOT A;  2Z33 A;  3VLF B;  1DGF A;  3RGP A;  1ZYR F;  4CHU A;  3GTL J;  4X6A J;  2AXT C;  1YIJ I;  2EV6 A;  3ZMV A;  1ZRD A;  3WE3 A;  3BT9 A;  3Q8X A;  1MGT A;  1QZM A;  1STZ A;  3C1D A;  4XK4 A;  3N4M A;  3KLN A;  2LBC A;  4MGH A;  3D8B A;  4NBQ A;  1APL C;  4AIJ A;  3DFG A;  2H1K A;  2WB1 A;  4IJF A;  3LW5 F;  2C5N B;  4KT0 F;  4UNO A;  3F92 A;  1MKM A;  3FM5 A;  4P9F A;  4B3M M;  3A98 B;  2MJ5 B;  4A3J J;  1UZC A;  3I51 A;  1ZH5 A;  4BCN B;  1OLT A;  2LDU A;  3VWB A;  4BBS J;  1P9Q C;  1OFC X;  4HPQ A;  2CQX A;  1H4L D;  1S8N A;  2O6G E;  1QAO A;  4DV0 M;  4ELJ A;  3C2H A;  2X85 A;  4MQV A;  5LRR A;  5EP3 A;  1GV5 A;  1ERD A;  3B7N A;  2E5L M;  2QF7 A;  3ZMD A;  3KSX A;  3U6S A;  4EMS A;  1R49 A;  4KRD B;  1JQJ C;  1UHW A;  2FUG 2;  1IUY A;  1VYW B;  2DI0 A;  2K9N A;  3HGG A;  1JJ6 C;  3TQN A;  3GFL A;  4Z6Y A;  4A5N A;  3GZ5 A;  3ZCB B;  4A12 A;  5IT9 K;  3JRE A;  2V26 A;  4QNM A;  3BOS A;  2KDL A;  2RNJ A;  2PN6 A;  4OVZ B;  1ZK8 A;  3TKY A;  1FIN B;  2V1C A;  3DPT A;  4FX0 A;  1BI0 A;  2KRC A;  5FLV A;  5J1U A;  2XPU A;  3TW7 A;  4OIR F;  1HT2 E;  1FBU A;  2A6H F;  2L7K A;  2VBY A;  3EET A;  3CJT B;  3I4M J;  2QSF X;  1CGP A;  3BR2 A;  1FIA A;  2HQA A;  1IQP A;  2JWS A;  4BGD A;  3CF2 A;  4UB6 C;  1DU0 A;  3E21 A;  1Q1H A;  3I58 A;  1O9K A;  3IEC A;  4F92 B;  1VIN A;  4UN0 A;  2R4E A;  2CZ6 B;  2MC3 A;  2VJ4 A;  5KAF C;  1RRJ A;  4PJ0 C;  1FKM A;  1TNT A;  4CXF A;  1NV9 A;  3EYY A;  4L8R C;  1TQI A;  2V22 B;  1Z21 A;  2GXB A;  5DUK A;  1P6R A;  3GLG A;  1RPW A;  2ME6 A;  4C3J J;  3S1R J;  4F7S B;  2DHR A;  1IY0 A;  3L26 A;  1BOB A;  4E7L A;  4HV5 A;  1WHC A;  3SYK A;  5HDN A;  4XKW A;  5K7Z A;  2HZT A;  5DNY A;  1OTR A;  2W57 A;  3NEU A;  4HEO A;  4EQQ A;  1N32 M;  1P2F A;  4LJ9 A;  4IEJ A;  5LMK B;  1OIP A;  4AC0 A;  1W36 C;  1Z05 A;  1UGS B;  4IBF A;  4II5 B;  2KZV A;  3EUH A;  5IP7 J;  2DWN A;  1N33 M;  3I55 I;  3H35 A;  2M7B A;  4BE2 A;  1RUO A;  4BCK B;  2QEX I;  4A3B J;  3PUF A;  1IDZ A;  2PI0 A;  5EP4 A;  2QBY A;  2X48 A;  2FA5 A;  1U5T A;  3E6C C;  1U2W A;  4CZZ A;  1OR7 A;  4RAF A;  3KZY A;  3GME A;  2HFH A;  1HXD A;  1FTZ A;  2OZU A;  1Y56 A;  2OV7 A;  2LXE A;  4D7M A;  1KFV A;  2MGQ A;  2HDW A;  4D81 A;  1R9T J;  3N97 A;  3S93 A;  3QOP A;  3GLI E;  4R3D A;  1QO0 D;  4WCG A;  1VEJ A;  5E26 A;  1YQA A;  4G7Z F;  1MNM C;  1S3J A;  3G4S I;  2I5U A;  3I4P A;  5AON A;  1V34 A;  1G41 A;  2FBI A;  3QXE B;  3KHI A;  1P4W A;  2H1R A;  1KYZ A;  2W24 A;  1UAA A;  3DLA A;  2ID3 A;  3U6D A;  1EIJ A;  3U6E A;  2CRG A;  4KIB A;  4FWD A;  1A31 A;  4IBD A;  2CZ7 B;  3QWL A;  3BY6 A;  1IM2 A;  4MGK E;  2A3S A;  3LAP A;  1TWH J;  3J7B A;  3BZ6 A;  3CDL A;  1TT0 A;  1XG1 A;  1LJ9 A;  1QZE A;  2ZFW A;  2CP8 A;  1OIZ A;  3DBR B;  3OYM A;  3CCR I;  3U6M A;  4G4O A;  2XC7 A;  1ETY A;  1ZQ3 P;  4GIP A;  2K4B A;  3RFW A;  4DUY M;  4RA2 A;  2LVN C;  3HU2 A;  5IRE B;  1WCM J;  3B6C A;  5CLS A;  3HOZ J;  1HR0 M;  2VPL A;  3X20 B;  3HY5 A;  1YLA A;  4FCT A;  4XRM A;  2DAM A;  2R62 A;  2A5Y B;  4L15 A;  4KHP M;  1YRN B;  4IXA A;  4KT5 C;  3WTZ A;  3NBX X;  3P9C A;  1IXZ A;  2JUG A;  2VXZ A;  1E9R A;  2LF7 A;  5CYV A;  2O25 A;  3GQ4 A;  4M3B A;  4NQW B;  3M8E A;  4UVB A;  4UV8 A;  3FTD A;  1R23 A;  1HW1 A;  2DFI A;  4EOQ B;  2DDA A;  2JZY A;  4J00 A;  3KP4 A;  4LK0 F;  4GGG A;  4Y3O A;  1XCV A;  3R6S A;  3OTO M;  2ZBK A;  5FJ8 J;  3CJN A;  4YHH M;  4R79 A;  1JXS A;  2MSY A;  4PSW A;  2NNY A;  2R7S A;  5DCM B;  1MU5 A;  2DN0 A;  2G7H A;  4JP0 A;  1WWX A;  3VB2 A;  4QIW N;  3J7A O;  4ITV A;  2OD5 A;  4KIC A;  3H4C A;  4I99 C;  1R1U A;  1OIY B;  1RKW A;  3X28 B;  3T6P A;  2O8X A;  2Z9O A;  2KJC A;  4BE0 A;  1L2C A;  3HPH A;  4II2 A;  3LCU A;  1ZMW A;  1YYV A;  4XOR A;  3IRR A;  5IYD J;  4IBI A;  1F5Q B;  4LY6 A;  3ZQH A;  3HRU A;  2PX9 A;  3GLH A;  2ETH A;  3B6A A;  1TL8 A;  3K4M A;  4FD2 A;  3HU3 A;  3IV5 A;  1T56 A;  3EQL F;  2DAE A;  2F4V M;  2QQ9 A;  2Y31 A;  5DYM A;  2Y75 A;  2WAQ N;  1K6Y A;  4JI5 M;  3M9A A;  1DGW Y;  1L2B A;  4BDY A;  1D5V A;  2EFQ A;  4XR6 A;  3PO3 S;  3QP6 A;  1K4T A;  2YR0 A;  2X51 A;  5F64 A;  2JA5 J;  4LF9 M;  4JX6 A;  2PJR A;  3IH3 A;  4FWH A;  1XXH A;  2M7A A;  2MGW A;  1J7K A;  4M3F A;  4ON0 A;  2Y0M A;  2F5O A;  3ZMT A;  3K8Z A;  4A3G J;  5ILS A;  3PNV A;  4EM1 A;  4B48 A;  5FKM A;  4UUS B;  2BWB A;  3HOS A;  1P5E B;  3TPZ A;  2RC4 A;  4F7N B;  1VQM I;  3LMM A;  2B3T A;  4N0B A;  3RDI A;  3CZ6 A;  4I7H A;  4UY8 I;  1MND A;  3V8K A;  2Z16 A;  1R22 A;  1NSF A;  2ZJR F;  1JKW A;  5IOY A;  5F6F A;  3WU1 B;  2R7W A;  5EEG A;  4FCY A;  3DF8 A;  3GBG A;  3O8G A;  2GA2 A;  4GHA A;  4PFO A;  1FYL A;  4B1R A;  4KLN A;  5J1R A;  2X4A A;  3HKP A;  2L7M P;  2VT2 A;  1SFK A;  5L2W B;  1MMG A;  4EC9 B;  2R5Z B;  5CEI B;  2R7X A;  4S0H B;  1IN8 A;  2IS6 A;  4MNU A;  1H1S B;  2BOL A;  3D5S C;  3M7G A;  2QSG X;  1T0F A;  2P6S A;  1YOV B;  3A1Y A;  3FK6 A;  5LHG A;  2JGZ B;  2DZO B;  4JYA M;  4EJV A;  4LF7 M;  2LTU A;  2KA6 B;  2RAE A;  1ZAE A;  3KP5 A;  3L00 A;  2A07 F;  2DT5 A;  3K70 C;  1E0E A;  2IGN A;  2ZZD B;  2ZCF B;  2XF6 A;  2KRU A;  4RKU F;  1HW5 A;  2HTS A;  2ZC2 A;  4LJ8 A;  3ISP A;  4E7Z A;  3CQZ J;  4ZZD A;  4UB8 C;  4XOP A;  2AQF A;  2EKK A;  3LST A;  2ZXH A;  1DPU A;  4ZTJ A;  1RIO H;  4KA4 A;  1EH8 A;  2E7X A;  4PCQ A;  5F1J A;  3MIA B;  4GXO A;  2BEO A;  4L9J A;  2EJS A;  3HOV J;  2ZPG B;  1AU7 A;  3KOX E;  1BIB A;  1UG2 A;  1B9N A;  1XSX A;  4BL0 B;  3FHZ A;  4KNY A;  1X2M A;  2LBF A;  3NWS A;  1VTN C;  4RB0 A;  2EFP A;  5FTM A;  2EJR A;  5A2Q K;  1QRY A;  2ECB A;  4HST A;  3PFY A;  1Y1W J;  3BR3 A;  4EV0 A;  2O9L A;  3RZO J;  1HKT A;  4I5S A;  4UXN A;  5J4V A;  2M5Z A;  4A3E J;  4MTD A;  1X1P A;  4IL6 C;  4YEJ A;  3SBJ A;  1SMY F;  3JRC A;  1SAX A;  5L3B A;  3HOX J;  2E1O A;  1WRJ A;  1GHC A;  4ENK A;  4B3A A;  1SMT A;  1WIV A;  3HX3 A;  2OUM A;  2Q1Z B;  1I3Q J;  4PJL A;  3IH4 A;  4P55 A;  4AW4 A;  2PK2 A;  1HDP A;  1LVK A;  2TDX A;  2WSF F;  4A0Y A;  1IF1 A;  3FRH A;  1H24 B;  2XRL A;  4EOS B;  3PSI A;  2GLO A;  4EOI B;  2OQ4 A;  2KZU A;  3EIE A;  1P92 A;  2BGC A;  3DTK A;  3TGN A;  4E6K G;  3J81 K;  2IVX A;  5H37 D;  3S2H J;  1IRG A;  3F21 A;  3L2Q A;  1G3T A;  5ITR A;  1FX7 A;  2CUJ A;  2LY1 A;  1YI2 I;  5EFQ B;  4HLQ A;  1OYI A;  2EQR A;  1PM5 A;  3CP2 A;  3LA7 A;  3L9F A;  2EIJ H;  1R2Y A;  3J80 S;  2XSD C;  3K2L A;  2COM A;  3JAM S;  2RDP A;  5K5Q A;  3WVD B;  2L4A A;  2XF3 A;  3HOW J;  3BHV B;  5K7F A;  2JRM A;  5LGN A;  2WMA B;  4IHX A;  2BY2 A;  3HYI A;  4EOJ B;  4NC8 A;  1I50 J;  5D5X B;  1ZGW A;  4BEH B;  5H2F C;  2DZN B;  3ABK H;  4AIK A;  4U7D A;  3O8H A;  3Q0V A;  1XMA A;  4BS9 A;  4ZYD A;  3JW4 A;  4ENN A;  2F5V A;  3F8N A;  2UZD B;  1RC9 A;  4D0P A;  4XIC A;  3K1N A;  2GZW A;  2OA4 A;  4MEY F;  1W7P B;  4GDF A;  3H3Z A;  4OR5 B;  1JUS A;  3LWF A;  3MZ8 A;  3CJR B;  3L27 A;  2V1N A;  1J09 A;  1IAW A;  1H26 B;  3K4C A;  1KA8 A;  3OYF A;  4L9N A;  4QNR A;  4LG0 B;  3B7Z A;  4BLC A;  3KXE C;  1G3N C;  4A3V B;  2BHY A;  2GIV A;  2M45 A;  3M0E A;  3H3U A;  3DTE A;  3RE8 A;  4BUP A;  2WBM A;  4CFU B;  2YFQ A;  3GTK J;  2KEB A;  4BY1 X;  2HWV A;  4MO7 A;  1K61 A;  2UUC M;  1YLF A;  3PO2 J;  3VFD A;  4B3R M;  2BBY A;  2D2W A;  4HNV A;  5FRM A;  1FOX A;  4I0B A;  4N9H A;  2BXY A;  2W96 A;  2BVM A;  5J8F A;  5F3W A;  2ZAO A;  3ZC7 B;  4AU7 A;  2BWE A;  1AWC A;  3TN8 B;  1LUJ B;  2X4H A;  2C6Y A;  3ASO H;  4BCN D;  3L2U A;  2XDV A;  1LEA A;  2XUB A;  1W36 D;  1PJR A;  2JMW A;  3IWZ A;  1LPQ A;  4IRG A;  3LAJ A;  2P0W A;  2VE8 A;  5BR8 M;  3J80 Z;  2JZ1 A;  2NOG A;  2XB5 A;  4BBR J;  4C3H J;  1R5H A;  3JAM Z;  3BG6 A;  5CVI A;  1YJN I;  4LK1 F;  1OJL A;  1OYY A;  5ITY A;  3JRA A;  3ZCO A;  1SEU A;  3E4R A;  2NS0 A;  3KP1 E;  3CUQ A;  1ZP2 A;  4GEW A;  4XKB A;  4HLX A;  3S14 J;  4HAM A;  4HDV A;  2QM3 A;  1YS7 A;  5LHH A;  2HI3 A;  3RKX A;  1Z6T A;  3O2P E;  4BCP B;  1UFZ A;  1YSY A;  4ZYA A;  1GKI A;  2IS4 A;  4EOO B;  2F5Q A;  3ABL H;  2DWL A;  2KZG A;  3FXJ A;  1I1G A;  4Y33 A;  5GTH C;  2MAB A;  5HS8 A;  2HKX A;  3QYB A;  4Y28 F;  7CAT A;  2TRT A;  2Q2E B;  3I64 A;  1T08 B;  1WJB A;  2R7Q A;  3FWE A;  3F23 A;  2IGO A;  1ZRE A;  4LLN A;  2QHO B;  3FBN B;  5IHY A;  1OCC H;  1I6X A;  1HA8 A;  4W97 A;  4NOO B;  3D5R C;  5TJJ A;  3JRB A;  5EXP A;  3DPL C;  2XZF A;  1P7I A;  3BTC A;  5HBH B;  1D1A A;  2Z8Y M;  1GY3 B;  1QQI A;  2FBK A;  4FE7 A;  5TIS C;  4OIP F;  4MHG A;  4A3C J;  5IDN B;  4NDL A;  2KXE A;  3FRI A;  1G8X A;  5EP1 A;  5IWA M;  2LMD A;  2NVY J;  4IRH A;  5FLX K;  3K9P A;  3I04 M;  4Q7J A;  5E3O A;  3MKL A;  4PZJ A;  2P5L C;  1U8R A;  2OPF A;  2DXC B;  4IBK A;  2VKV A;  1XSD A;  3JRF A;  2X6O A;  3HSR A;  1JHF A;  3E5U A;  4AYB N;  3L29 A;  9ANT A;  5KHD A;  3C2G A;  4AVZ A;  4V2G A;  3E6D A;  1E32 A;  3Q8G A;  2DZL A;  1XMK A;  3IAS 2;  2KDZ A;  3COA C;  2OAZ A;  3CCL I;  3IWF A;  4IVN A;  4A3K J;  3FUU A;  3VKG A;  1VZ0 A;  3LSK A;  4U0V A;  1S72 I;  1DGR M;  3GUD A;  4MGI E;  4FCV A;  2W84 A;  3FUW A;  4QWQ A;  5C4X J;  1S6L A;  4AZF A;  2DPD A;  1MBJ A;  1ZGJ A;  2LHG A;  1L0O C;  1JUP A;  3K7A J;  3QP5 A;  4DZP A;  2XAG A;  1LKX A;  4BKX A;  1IV8 A;  2WAD A;  4F70 B;  3SDB A;  1NG6 A;  4L18 B;  2DOD A;  3FUT A;  3P7N A;  1PUF A;  4C2U A;  3MI9 B;  3GQ3 A;  1JKR C;  4BU2 A;  5E18 F;  1XWI A;  2ME0 A;  4YII A;  4QTR A;  3S16 J;  3L2A A;  3G1L A;  1P3Q Q;  1FWZ A;  2WAF A;  3W6J B;  3W0F A;  4B7G A;  3MHV C;  4BBS M;  1SG9 A;  1TBX A;  1NHW C;  5ITT A;  2M0C A;  2C5X B;  1SD6 A;  3I56 I;  3PO3 J;  4BQN A;  1N75 A;  4CUG A;  4UN2 B;  4A3L J;  3B73 A;  2KJB A;  3BRO A;  4EOM B;  4XL9 A;  2OOB A;  2BW3 A;  4D82 A;  3MZH A;  3MEX A;  4AWX B;  2ZSI B;  4ELL A;  2H09 A;  1MDM A;  2X1D A;  1SAU A;  4A69 C;  3U1D A;  3K1J A;  2D7G A;  4F93 B;  2CCI B;  4B7F A;  2IGK A;  1R4M B;  2L3D A;  2LHC A;  2GBY A;  3HRS A;  2PBI A;  1GVN A;  2HYF A;  3F6O A;  3KX2 A;  4Q4Z F;  3OSF A;  3A01 B;  3PVS A;  4ZH4 F;  3RZD J;  3HHY A;  4B08 A;  2F5E A;  3JTH A;  4B09 A;  2VXD A;  3FKJ A;  4FAS D;  2B63 J;  3PNT A;  4HX7 A;  3BQZ A;  5H6R A;  2EFW A;  3OOU A;  4OMY A;  1OMI A;  1ACI A;  4GC5 A;  4AG6 A;  4HDU A;  2IT0 A;  2RKO A;  2HOS A;  1C1K A;  2R7R A;  2CV0 A;  1FC3 A;  1IC8 A;  1BN5 A;  3Q0U A;  1T39 A;  2QEN A;  3U60 B;  3KP2 A;  2NXN B;  1K79 A;  1XD7 A;  3GWZ A;  4MGY E;  4FE4 A;  5I5Z B;  1G8P A;  3GLF A;  1IBM M;  1LFP A;  3EUK L;  2DNA A;  2W9Z A;  4M3E A;  2DA1 A;  2DBB A;  4AID A;  1UB9 A;  1OCZ H;  1SFU A;  1BIA A;  4TUW A;  2WSE F;  4EAT A;  3L09 A;  3BCA A;  1TNS A;  2OTJ I;  1GJT A;  3AJI B;  1SXJ A;  1OFI A;  1JT6 A;  1IRX A;  1ENW A;  2E2I J;  3U61 A;  4LGW A;  3K4N A;  1IRE B;  2BJV A;  4LJ4 A;  1TWA J;  3HRT A;  2KMG A;  1OCR H;  3H0D A;  2DA6 A;  4IHY A;  4BCM D;  4Y13 A;  1QAM A;  2VF7 A;  4RB1 A;  3MCZ A;  1I6H J;  2VKH A;  2K47 A;  1V5E A;  4WXD A;  3ECH A;  2WIH B;  1JOW A;  3ZMU A;  3MKZ A;  3GTO J;  1X37 A;  3KEQ A;  5ACB A;  2B9R A;  2HR3 A;  2MC4 A;  1R6R A;  4G8X A;  5EDN A;  3G6E I;  1BI2 A;  4LLG F;  3NAU A;  4UUT A;  1EJ9 A;  1W5C C;  1SFE A;  2EWN A;  2X8A A;  4GKK M;  3FIS A;  4N9I A;  5HVQ C;  1IRF A;  1NV8 A;  2IBD A;  5EGO A;  1QBJ A;  1E3H A;  4EM0 B;  2EFN A;  4HYE A;  5LEK A;  1MBE A;  1LDJ A;  1G71 A;  2J5P A;  2VI6 A;  2DMU A;  3V42 A;  3BP8 A;  3M1C A;  3VDP A;  2GIZ A;  4LD5 A;  4O3M A;  4DYQ A;  2G3Q A;  4EM2 A;  1D3U B;  3ZN0 A;  4KRC B;  1VEK A;  1MMA A;  2N8G A;  5B1A H;  3RPU A;  4YOZ A;  2CRU A;  2F2E A;  3QQA A;  4G6L B;  5BPV A;  2CQQ A;  2UXC M;  3NBI A;  2PQ8 A;  5D5U B;  1JJ8 C;  2YPR A;  4CYD A;  2X49 A;  3KS8 A;  1WGL A;  4B3T M;  2RRE A;  1V55 H;  2ZNY A;  4XLC A;  2DJI A;  4RM2 A;  4DR1 M;  2XRO A;  3HOT A;  1DP7 P;  3GTP J;  5HVY B;  1HW2 A;  3EPZ A;  1N77 A;  1J0R A;  3B89 A;  1XDS A;  2CW0 F;  4I98 B;  4KUM A;  3WU2 C;  4C2T A;  2QP9 X;  4I76 A;  3A2K A;  3GO8 A;  4ZPX A;  3RJP A;  4BCF B;  3FZV A;  3A8H B;  1SVO A;  5CVV A;  2RNG A;  4NRV A;  4K0K M;  2KNA A;  2IXS A;  2FNP A;  3ASN H;  4DV7 M;  1F5T A;  4G3O A;  2R7V A;  4AKH A;  3ZQF A;  2YX7 A;  2FOW A;  2MW8 A;  4IF4 A;  2G8L A;  1EV7 A;  4F1I A;  4CIS A;  4GIT A;  3FE3 A;  3LSJ A;  2FQ3 A;  3CCJ I;  1NTC A;  1LNW A;  1V5G A;  3THG A;  3HOY J;  4BNC A;  2WV1 A;  4XON A;  1FYK A;  3S1M J;  2Y21 A;  2WXV B;  5CJ9 A;  3ZGK A;  2L54 A;  3L2C A;  1AHD P;  5DS9 A;  1K3W A;  4IBG A;  2CHG A; 
#chains in the Genus database with same CATH homology
 2ZPB B;  2ZPI B;  2CZ7 B;  3QWL A;  4HNV A;  4AKI A;  4JX4 A;  5EJC A;  2ZPF B;  3HHT B;  2ZZD B;  2ZCF B;  4P17 A;  2DXB B;  3TW6 A;  3A8M B;  2G77 A;  2BS3 A;  1UGQ B;  3VYG B;  2BS2 A;  3VKH A;  4ELJ A;  3X20 B;  2DD4 B;  2ZPG B;  2QF7 A;  3HO8 A;  4QSH A;  1UGP B;  2CZ1 B;  2DD5 B;  3VYH B;  2CYZ B;  4Z6Y A;  4ZGJ B;  4HL4 A;  3X24 B;  3A8O B;  4NC6 A;  2ZPE B;  4LOC A;  2QDJ A;  3QYB A;  1QLB A;  3HZJ A;  2QFZ A;  3TW7 A;  3QZ9 B;  3X26 B;  1IRE B;  3H4C A;  4AKG A;  2KMG A;  3X28 B;  3HB9 A;  4MFE A;  2CZ6 B;  1FKM A;  3BG5 A;  4MIM A;  2AHJ B;  4OB0 B;  4HNU A;  4HLQ A;  4ZGD B;  3X25 B;  2DXC B;  4ZGE B;  3QYG B;  4MFD A;  4M6V A;  3QZ5 B;  3A8L B;  2QQ8 A;  4JX6 A;  2KR6 A;  3WVD B;  2D0Q B;  1UGS B;  1UGR B;  3VKG A;  4OB2 B;  1E7P A;  1V29 B;  4AI6 A;  2DPP B;  4JX5 A;  4OB1 B;  3A8H B;  4HNT A;  3HBL A;  3A8G B;  3BG9 A;  3QYH B;  1AHJ B;  4OB3 B;  3DL1 A;  4FM4 B;  4AKH A;  2BS4 A;  2QDY B;  2ZPH B;  4BBS M;  3BG3 A;  3KHI A;  3QXE B;  3WVE B;  2WJ9 A;  2CZ0 B;  3QYE A;  4BBR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...