3DOGB

Structure of thr 160 phosphorylated cdk2/cyclin a in complex with the inhibitor n-&-n1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, cell cycle
molecule keywords Cell division protein kinase 2
publication title N-&-N, a new class of cell death-inducing kinase inhibitors derived from the purine roscovitine.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3dogB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3dogB02
1W98B 4EOPB 4BCPB 1GUXB 3TNIB 2W96A 4YOSA 2CCIB 4EC8B 4F70B 4CFUB 5IDPB 5I5ZB 4ROEA 1H1PB 1G3NC 2UZLB 3BHVB 4II5B 4BCGB 2CJMB 1H4LD 1H27B 2W99A 3G33B 4OGRB 4CFUD 1AD6A 1E9HB 1H1RB 1JOWA 2WIHB 1GUXA 4CXAB 1JSTB 5ICPB 1UNLD 5BNJB 4NSTB 4CFWB 4CRLB 4F7SB 3MY5B 3TNWB 5LQFB 1OL1B 1GY3B 4Y72B 2WEVB 2C5XB 5HBHB 2C6TB 4F6UB 1H26B 2QDJA 2WIPB 3BHTB 2W2HA 1P5EB 1VYWB 1OGUB 2X1NB 3H4CA 5HVYB 2W9ZA 4FX3B 2WMBB 4BCNB 4EOOB 4EOIB 4KRDB 2PK9B 2WFYB 4EC9B 5CEIB 1URCB 3BHUB 3TN8B 2V22B 1TFBA 2C5OB 4BCQB 2BPMB 1JKWA 1C9BA 1OL2B 2C5NB 2UZBB 4RODA 1UNGD 2IVXA 4IMYB 4YC3B 2F2CA 1O9KB 4EOKB 4F6WB 3EOCB 4EOQB 4BCKB 1OIYB 2UZEB 3BLQB 3BLHB 4CFMB 5HBEB 4YOOA 4F7JB 3EIDB 1VOLA 4F7NB 1D3UB 4ELLA 5L2WB 1KXUA 4EOSB 2B9RA 1OIUB 3LQ5B 4EOLB 1XO2A 2CCHB 1FINB 1O9KA 1UNHD 4BCOB 4EORB 5LMKB 2IW6B 3MY1B 1OI9B 1GH6B 2WHBB 4UN0A 5HQ0B 3QHWB 2C4GB 5IF1B 4F6SB 1N4MA 2IW9B 4YOZA 2JGZB 4EOJB 4I3ZB 2BKZB 1AISB 4BCMB 4BCND 2W9FA 1VINA 4OR5B 5HNBB 2IW8B 2R7GA 1OKVB 2PHGA 4TTHA 3RGFB 4BCFB 5FGKB 2I40B 1QMZB 3DOGB 1H24B 3TNHB 3BLRB 2UZDB 4BCQD 5CYIB 3O0GD 2WMAB 2G9XB 5HBJB 4EONB 2PK2A 2WXVB 4BCIB 1FVVB 5IDNB 4ROCA 1H1SB 3DDPB 2I53A 1ZP2A 2WPAB 4KRCB 1H28B 4G6LB 4BCHB 1JSUB 1PKDB 5ACBA 2EUFA 4CFNB 1BU2A 1H1QB 4CFXB 3POMA 2UUEB 3EJ1B 4CFVB 3MI9B 2C5VB 1F5QB 4EOMB 4F7LB 3MIAB 3F5XB 1OKWB 5EFQB 4ELJA 2PMIB 3K7AM 3M03A 4BCMD 4BCJB 3DDQB 1H25B 3QHRB
chains in the Genus database with same CATH superfamily
4NC6A 3QYEA 4EC8B 2CCIB 5I5ZB 1G3NC 1H27B 3G33B 4LOCA 4OB1B 1E9HB 2ZPEB 4CXAB 1JSTB 3DJBA 5BNJB 4NSTB 1V29B 4CRLB 1QLBA 4F7SB 4MIMA 2PJQA 2C5XB 2C6TB 4F6UB 2QDJA 1VYWB 2X1NB 3HZJA 3H4CA 3X25B 3QYBA 4EOIB 4KRDB 3BHUB 3TN8B 1TFBA 1JKWA 3A8LB 1C9BA 2C5NB 2UZBB 2IVXA 4F6WB 4EOQB 4HL4A 1IREB 2CYZB 4F7JB 1D3UB 4ELLA 1O9KA 5EJCA 5LMKB 1FKMA 1OI9B 3MY1B 2BKZB 1UGRB 2R7GA 4TTHA 4ZGDB 3DOGB 1H24B 4BCQD 3VYGB 2G9XB 5HBJB 2WXVB 4BXXX 4BY7X 4Z6YA 1H1SB 2WPAB 1H28B 1JSUB 1PKDB 3BG9A 5ACBA 2ZPHB 3POMA 3QXEB 2UUEB 4HNVA 3K7AM 3X28B 3QHRB 4EOPB 3TNIB 4YOSA 4ROEA 2UZLB 4II5B 3HHTB 4HNTA 2W99A 4CFUD 1AD6A 1GUXA 4OB0B 3QWLA 5HBHB 2AHJB 3BHTB 3A8HB 2CZ6B 4FX3B 3X20B 2WMBB 4EOOB 3BG5A 1URCB 2ZPBB 2KR6A 4BCQB 4ZGEB 3X26B 4RODA 1UNGD 3QYGB 1O9KB 4AI6A 2UZEB 3BLQB 3BLHB 1VOLA 1KXUA 4EOSB 2B9RA 1OIUB 4OB2B 4BCOB 3QZ9B 3WVEB 5HQ0B 3QHWB 2C4GB 4F6SB 3TW6A 4BCND 1OKVB 2I40B 3TNHB 3VKGA 2D0QB 3O0GD 4BCIB 1FVVB 4KRCB 3DDPB 4G6LB 2ZCFB 4CFXB 4MFDA 2G77A 3EJ1B 4CFVB 2C5VB 4F7LB 3MIAB 1OKWB 5EFQB 3PO3S 2ZPFB 1GUXB 2W96A 4F70B 5IDPB 3GTMS 1H1PB 3BHVB 2CJMB 3A8OB 4OGRB 4AKIA 1H1RB 1JOWA 2WIHB 5ICPB 3X24B 5LQFB 4Y72B 3QZ5B 2WIPB 3BG3A 2DMEA 2W2HA 1P5EB 1OGUB 4JX4A 5HVYB 2W9ZA 4HLQA 1AHJB 2ZPGB 4BCNB 2PK9B 1TD6A 4EC9B 1UGQB 4ZGJB 2BPMB 4JX5A 2BS2A 5DQVA 4BY1X 4EOKB 3EOCB 4BCKB 2BS3A 3VYHB 4YOOA 3EIDB 2DXCB 4EOLB 2QF7A 1XO2A 4QSHA 4YOZA 2JGZB 4EOJB 1AISB 2W9FA 1VINA 4OR5B 4JX6A 3B57A 5HNBB 2WJ9A 2IW8B 2QDYB 3BLRB 5CYIB 2WMAB 3NDQA 4EONB 5IDNB 4ROCA 4BCHB 2ZPIB 4HNUA 1BU2A 1H1QB 2QFZA 2CZ7B 4EOMB 4ELJA 2PMIB 3M03A 4BCMD 4BCJB 3DDQB 1H25B 3QYHB 3KHIA 1W98B 4BCPB 4BBRM 3A8MB 5IHYA 4CFUB 4BCGB 1H4LD 1UGSB 3HB9A 1UNLD 4CFWB 3MY5B 2DD5B 3TNWB 1OL1B 1GY3B 2WEVB 2QQ8A 1H26B 3TW7A 3HO8A 3DTOA 2DXBB 3A8GB 2WFYB 4MFEA 4AKGA 5CEIB 2BS4A 2V22B 5DQWA 2C5OB 3WVDB 1OL2B 2CZ1B 4IMYB 2KMGA 4YC3B 2F2CA 1E7PA 4FM4B 1OIYB 2DD4B 2CZ0B 4CFMB 5HBEB 1UGPB 4F7NB 3HBLA 5L2WB 3LQ5B 2CCHB 1FINB 1UNHD 2ZZDB 4EORB 2IW6B 1GH6B 2WHBB 4UN0A 5IF1B 1N4MA 2IW9B 4I3ZB 4BCMB 2QGSA 4OB3B 4AKHA 2PHGA 4M6VA 3RGFB 4BCFB 5FGKB 1QMZB 2IN3A 2UZDB 1ENWA 2PK2A 3VKHA 3DL1A 2I53A 1ZP2A 2LW4A 2EUFA 4CFNB 4BBSM 3MI9B 1F5QB 3F5XB 2DPPB
chains in the Genus database with same CATH topology
1W98B 4EOPB 4BCPB 1GUXB 3TNIB 2W96A 4YOSA 2CCIB 4EC8B 4F70B 4CFUB 5IDPB 5I5ZB 4ROEA 1H1PB 1G3NC 2UZLB 3BHVB 4II5B 4BCGB 2CJMB 1H4LD 1H27B 2W99A 3G33B 4OGRB 4CFUD 1AD6A 1E9HB 1H1RB 1JOWA 2WIHB 1GUXA 4CXAB 1JSTB 5ICPB 1UNLD 5BNJB 4NSTB 4CFWB 4CRLB 4F7SB 3MY5B 3TNWB 5LQFB 1OL1B 1GY3B 4Y72B 2WEVB 2C5XB 5HBHB 2C6TB 4F6UB 1H26B 2QDJA 2WIPB 3BHTB 2W2HA 1P5EB 1VYWB 1OGUB 2X1NB 3H4CA 5HVYB 2W9ZA 4FX3B 2WMBB 4BCNB 4EOOB 4EOIB 4KRDB 2PK9B 2WFYB 4EC9B 5CEIB 1URCB 3BHUB 3TN8B 2V22B 1TFBA 2C5OB 4BCQB 2BPMB 1JKWA 1C9BA 1OL2B 2C5NB 2UZBB 4RODA 1UNGD 2IVXA 4IMYB 4YC3B 2F2CA 1O9KB 4EOKB 4F6WB 3EOCB 4EOQB 4BCKB 1OIYB 2UZEB 3BLQB 3BLHB 4CFMB 5HBEB 4YOOA 4F7JB 3EIDB 1VOLA 4F7NB 1D3UB 4ELLA 5L2WB 1KXUA 4EOSB 2B9RA 1OIUB 3LQ5B 4EOLB 1XO2A 2CCHB 1FINB 1O9KA 1UNHD 4BCOB 4EORB 5LMKB 2IW6B 3MY1B 1OI9B 1GH6B 2WHBB 4UN0A 5HQ0B 3QHWB 2C4GB 5IF1B 4F6SB 1N4MA 2IW9B 4YOZA 2JGZB 4EOJB 4I3ZB 2BKZB 1AISB 4BCMB 4BCND 2W9FA 1VINA 4OR5B 5HNBB 2IW8B 2R7GA 1OKVB 2PHGA 4TTHA 3RGFB 4BCFB 5FGKB 2I40B 1QMZB 3DOGB 1H24B 3TNHB 3BLRB 2UZDB 4BCQD 5CYIB 3O0GD 2WMAB 2G9XB 5HBJB 4EONB 2PK2A 2WXVB 4BCIB 1FVVB 5IDNB 4ROCA 1H1SB 3DDPB 2I53A 1ZP2A 2WPAB 4KRCB 1H28B 4G6LB 4BCHB 1JSUB 1PKDB 5ACBA 2EUFA 4CFNB 1BU2A 1H1QB 4CFXB 3POMA 2UUEB 3EJ1B 4CFVB 3MI9B 2C5VB 1F5QB 4EOMB 4F7LB 3MIAB 3F5XB 1OKWB 5EFQB 4ELJA 2PMIB 3K7AM 3M03A 4BCMD 4BCJB 3DDQB 1H25B 3QHRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W98 B;  4EOP B;  4BCP B;  1GUX B;  3TNI B;  2W96 A;  4YOS A;  2CCI B;  4EC8 B;  4F70 B;  4CFU B;  5IDP B;  5I5Z B;  4ROE A;  1H1P B;  1G3N C;  2UZL B;  3BHV B;  4II5 B;  4BCG B;  2CJM B;  1H4L D;  1H27 B;  2W99 A;  3G33 B;  4OGR B;  4CFU D;  1AD6 A;  1E9H B;  1H1R B;  1JOW A;  2WIH B;  1GUX A;  4CXA B;  1JST B;  5ICP B;  1UNL D;  5BNJ B;  4NST B;  4CFW B;  4CRL B;  4F7S B;  3MY5 B;  3TNW B;  5LQF B;  1OL1 B;  1GY3 B;  4Y72 B;  2WEV B;  2C5X B;  5HBH B;  2C6T B;  4F6U B;  1H26 B;  2QDJ A;  2WIP B;  3BHT B;  2W2H A;  1P5E B;  1VYW B;  1OGU B;  2X1N B;  3H4C A;  5HVY B;  2W9Z A;  4FX3 B;  2WMB B;  4BCN B;  4EOO B;  4EOI B;  4KRD B;  2PK9 B;  2WFY B;  4EC9 B;  5CEI B;  1URC B;  3BHU B;  3TN8 B;  2V22 B;  1TFB A;  2C5O B;  4BCQ B;  2BPM B;  1JKW A;  1C9B A;  1OL2 B;  2C5N B;  2UZB B;  4ROD A;  1UNG D;  2IVX A;  4IMY B;  4YC3 B;  2F2C A;  1O9K B;  4EOK B;  4F6W B;  3EOC B;  4EOQ B;  4BCK B;  1OIY B;  2UZE B;  3BLQ B;  3BLH B;  4CFM B;  5HBE B;  4YOO A;  4F7J B;  3EID B;  1VOL A;  4F7N B;  1D3U B;  4ELL A;  5L2W B;  1KXU A;  4EOS B;  2B9R A;  1OIU B;  3LQ5 B;  4EOL B;  1XO2 A;  2CCH B;  1FIN B;  1O9K A;  1UNH D;  4BCO B;  4EOR B;  5LMK B;  2IW6 B;  3MY1 B;  1OI9 B;  1GH6 B;  2WHB B;  4UN0 A;  5HQ0 B;  3QHW B;  2C4G B;  5IF1 B;  4F6S B;  1N4M A;  2IW9 B;  4YOZ A;  2JGZ B;  4EOJ B;  4I3Z B;  2BKZ B;  1AIS B;  4BCM B;  4BCN D;  2W9F A;  1VIN A;  4OR5 B;  5HNB B;  2IW8 B;  2R7G A;  1OKV B;  2PHG A;  4TTH A;  3RGF B;  4BCF B;  5FGK B;  2I40 B;  1QMZ B;  3DOG B;  1H24 B;  3TNH B;  3BLR B;  2UZD B;  4BCQ D;  5CYI B;  3O0G D;  2WMA B;  2G9X B;  5HBJ B;  4EON B;  2PK2 A;  2WXV B;  4BCI B;  1FVV B;  5IDN B;  4ROC A;  1H1S B;  3DDP B;  2I53 A;  1ZP2 A;  2WPA B;  4KRC B;  1H28 B;  4G6L B;  4BCH B;  1JSU B;  1PKD B;  5ACB A;  2EUF A;  4CFN B;  1BU2 A;  1H1Q B;  4CFX B;  3POM A;  2UUE B;  3EJ1 B;  4CFV B;  3MI9 B;  2C5V B;  1F5Q B;  4EOM B;  4F7L B;  3MIA B;  3F5X B;  1OKW B;  5EFQ B;  4ELJ A;  2PMI B;  3K7A M;  3M03 A;  4BCM D;  4BCJ B;  3DDQ B;  1H25 B;  3QHR B; 
#chains in the Genus database with same CATH topology
 4NC6 A;  3QYE A;  4EC8 B;  2CCI B;  5I5Z B;  1G3N C;  1H27 B;  3G33 B;  4LOC A;  4OB1 B;  1E9H B;  2ZPE B;  4CXA B;  1JST B;  3DJB A;  5BNJ B;  4NST B;  1V29 B;  4CRL B;  1QLB A;  4F7S B;  4MIM A;  2PJQ A;  2C5X B;  2C6T B;  4F6U B;  2QDJ A;  1VYW B;  2X1N B;  3HZJ A;  3H4C A;  3X25 B;  3QYB A;  4EOI B;  4KRD B;  3BHU B;  3TN8 B;  1TFB A;  1JKW A;  3A8L B;  1C9B A;  2C5N B;  2UZB B;  2IVX A;  4F6W B;  4EOQ B;  4HL4 A;  1IRE B;  2CYZ B;  4F7J B;  1D3U B;  4ELL A;  1O9K A;  5EJC A;  5LMK B;  1FKM A;  1OI9 B;  3MY1 B;  2BKZ B;  1UGR B;  2R7G A;  4TTH A;  4ZGD B;  3DOG B;  1H24 B;  4BCQ D;  3VYG B;  2G9X B;  5HBJ B;  2WXV B;  4BXX X;  4BY7 X;  4Z6Y A;  1H1S B;  2WPA B;  1H28 B;  1JSU B;  1PKD B;  3BG9 A;  5ACB A;  2ZPH B;  3POM A;  3QXE B;  2UUE B;  4HNV A;  3K7A M;  3X28 B;  3QHR B;  4EOP B;  3TNI B;  4YOS A;  4ROE A;  2UZL B;  4II5 B;  3HHT B;  4HNT A;  2W99 A;  4CFU D;  1AD6 A;  1GUX A;  4OB0 B;  3QWL A;  5HBH B;  2AHJ B;  3BHT B;  3A8H B;  2CZ6 B;  4FX3 B;  3X20 B;  2WMB B;  4EOO B;  3BG5 A;  1URC B;  2ZPB B;  2KR6 A;  4BCQ B;  4ZGE B;  3X26 B;  4ROD A;  1UNG D;  3QYG B;  1O9K B;  4AI6 A;  2UZE B;  3BLQ B;  3BLH B;  1VOL A;  1KXU A;  4EOS B;  2B9R A;  1OIU B;  4OB2 B;  4BCO B;  3QZ9 B;  3WVE B;  5HQ0 B;  3QHW B;  2C4G B;  4F6S B;  3TW6 A;  4BCN D;  1OKV B;  2I40 B;  3TNH B;  3VKG A;  2D0Q B;  3O0G D;  4BCI B;  1FVV B;  4KRC B;  3DDP B;  4G6L B;  2ZCF B;  4CFX B;  4MFD A;  2G77 A;  3EJ1 B;  4CFV B;  2C5V B;  4F7L B;  3MIA B;  1OKW B;  5EFQ B;  3PO3 S;  2ZPF B;  1GUX B;  2W96 A;  4F70 B;  5IDP B;  3GTM S;  1H1P B;  3BHV B;  2CJM B;  3A8O B;  4OGR B;  4AKI A;  1H1R B;  1JOW A;  2WIH B;  5ICP B;  3X24 B;  5LQF B;  4Y72 B;  3QZ5 B;  2WIP B;  3BG3 A;  2DME A;  2W2H A;  1P5E B;  1OGU B;  4JX4 A;  5HVY B;  2W9Z A;  4HLQ A;  1AHJ B;  2ZPG B;  4BCN B;  2PK9 B;  1TD6 A;  4EC9 B;  1UGQ B;  4ZGJ B;  2BPM B;  4JX5 A;  2BS2 A;  5DQV A;  4BY1 X;  4EOK B;  3EOC B;  4BCK B;  2BS3 A;  3VYH B;  4YOO A;  3EID B;  2DXC B;  4EOL B;  2QF7 A;  1XO2 A;  4QSH A;  4YOZ A;  2JGZ B;  4EOJ B;  1AIS B;  2W9F A;  1VIN A;  4OR5 B;  4JX6 A;  3B57 A;  5HNB B;  2WJ9 A;  2IW8 B;  2QDY B;  3BLR B;  5CYI B;  2WMA B;  3NDQ A;  4EON B;  5IDN B;  4ROC A;  4BCH B;  2ZPI B;  4HNU A;  1BU2 A;  1H1Q B;  2QFZ A;  2CZ7 B;  4EOM B;  4ELJ A;  2PMI B;  3M03 A;  4BCM D;  4BCJ B;  3DDQ B;  1H25 B;  3QYH B;  3KHI A;  1W98 B;  4BCP B;  4BBR M;  3A8M B;  5IHY A;  4CFU B;  4BCG B;  1H4L D;  1UGS B;  3HB9 A;  1UNL D;  4CFW B;  3MY5 B;  2DD5 B;  3TNW B;  1OL1 B;  1GY3 B;  2WEV B;  2QQ8 A;  1H26 B;  3TW7 A;  3HO8 A;  3DTO A;  2DXB B;  3A8G B;  2WFY B;  4MFE A;  4AKG A;  5CEI B;  2BS4 A;  2V22 B;  5DQW A;  2C5O B;  3WVD B;  1OL2 B;  2CZ1 B;  4IMY B;  2KMG A;  4YC3 B;  2F2C A;  1E7P A;  4FM4 B;  1OIY B;  2DD4 B;  2CZ0 B;  4CFM B;  5HBE B;  1UGP B;  4F7N B;  3HBL A;  5L2W B;  3LQ5 B;  2CCH B;  1FIN B;  1UNH D;  2ZZD B;  4EOR B;  2IW6 B;  1GH6 B;  2WHB B;  4UN0 A;  5IF1 B;  1N4M A;  2IW9 B;  4I3Z B;  4BCM B;  2QGS A;  4OB3 B;  4AKH A;  2PHG A;  4M6V A;  3RGF B;  4BCF B;  5FGK B;  1QMZ B;  2IN3 A;  2UZD B;  1ENW A;  2PK2 A;  3VKH A;  3DL1 A;  2I53 A;  1ZP2 A;  2LW4 A;  2EUF A;  4CFN B;  4BBS M;  3MI9 B;  1F5Q B;  3F5X B;  2DPP B; 
#chains in the Genus database with same CATH homology
 1W98 B;  4EOP B;  4BCP B;  1GUX B;  3TNI B;  2W96 A;  4YOS A;  2CCI B;  4EC8 B;  4F70 B;  4CFU B;  5IDP B;  5I5Z B;  4ROE A;  1H1P B;  1G3N C;  2UZL B;  3BHV B;  4II5 B;  4BCG B;  2CJM B;  1H4L D;  1H27 B;  2W99 A;  3G33 B;  4OGR B;  4CFU D;  1AD6 A;  1E9H B;  1H1R B;  1JOW A;  2WIH B;  1GUX A;  4CXA B;  1JST B;  5ICP B;  1UNL D;  5BNJ B;  4NST B;  4CFW B;  4CRL B;  4F7S B;  3MY5 B;  3TNW B;  5LQF B;  1OL1 B;  1GY3 B;  4Y72 B;  2WEV B;  2C5X B;  5HBH B;  2C6T B;  4F6U B;  1H26 B;  2QDJ A;  2WIP B;  3BHT B;  2W2H A;  1P5E B;  1VYW B;  1OGU B;  2X1N B;  3H4C A;  5HVY B;  2W9Z A;  4FX3 B;  2WMB B;  4BCN B;  4EOO B;  4EOI B;  4KRD B;  2PK9 B;  2WFY B;  4EC9 B;  5CEI B;  1URC B;  3BHU B;  3TN8 B;  2V22 B;  1TFB A;  2C5O B;  4BCQ B;  2BPM B;  1JKW A;  1C9B A;  1OL2 B;  2C5N B;  2UZB B;  4ROD A;  1UNG D;  2IVX A;  4IMY B;  4YC3 B;  2F2C A;  1O9K B;  4EOK B;  4F6W B;  3EOC B;  4EOQ B;  4BCK B;  1OIY B;  2UZE B;  3BLQ B;  3BLH B;  4CFM B;  5HBE B;  4YOO A;  4F7J B;  3EID B;  1VOL A;  4F7N B;  1D3U B;  4ELL A;  5L2W B;  1KXU A;  4EOS B;  2B9R A;  1OIU B;  3LQ5 B;  4EOL B;  1XO2 A;  2CCH B;  1FIN B;  1O9K A;  1UNH D;  4BCO B;  4EOR B;  5LMK B;  2IW6 B;  3MY1 B;  1OI9 B;  1GH6 B;  2WHB B;  4UN0 A;  5HQ0 B;  3QHW B;  2C4G B;  5IF1 B;  4F6S B;  1N4M A;  2IW9 B;  4YOZ A;  2JGZ B;  4EOJ B;  4I3Z B;  2BKZ B;  1AIS B;  4BCM B;  4BCN D;  2W9F A;  1VIN A;  4OR5 B;  5HNB B;  2IW8 B;  2R7G A;  1OKV B;  2PHG A;  4TTH A;  3RGF B;  4BCF B;  5FGK B;  2I40 B;  1QMZ B;  3DOG B;  1H24 B;  3TNH B;  3BLR B;  2UZD B;  4BCQ D;  5CYI B;  3O0G D;  2WMA B;  2G9X B;  5HBJ B;  4EON B;  2PK2 A;  2WXV B;  4BCI B;  1FVV B;  5IDN B;  4ROC A;  1H1S B;  3DDP B;  2I53 A;  1ZP2 A;  2WPA B;  4KRC B;  1H28 B;  4G6L B;  4BCH B;  1JSU B;  1PKD B;  5ACB A;  2EUF A;  4CFN B;  1BU2 A;  1H1Q B;  4CFX B;  3POM A;  2UUE B;  3EJ1 B;  4CFV B;  3MI9 B;  2C5V B;  1F5Q B;  4EOM B;  4F7L B;  3MIA B;  3F5X B;  1OKW B;  5EFQ B;  4ELJ A;  2PMI B;  3K7A M;  3M03 A;  4BCM D;  4BCJ B;  3DDQ B;  1H25 B;  3QHR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...