1URCB

Cyclin a binding groove inhibitor ace-arg-lys-leu-phe-gly
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Design, synthesis, biological activity and structural analysis of cyclic peptide inhibitors targeting the substrate recruitment site of cyclin-dependent kinase complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1urcB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1urcB02
5BNJB 1H26B 4EOKB 4EOMB 4OR5B 5HVYB 4F7NB 1OKWB 1H28B 4EONB 3EJ1B 4OGRB 4BCFB 1D3UB 4YC3B 3F5XB 2IVXA 2I53A 5HBEB 4IMYB 2EUFA 4CFWB 5HQ0B 4BCNB 1PKDB 5EFQB 2IW6B 2PK9B 3BHTB 2PMIB 3M03A 3BLHB 1VINA 3TN8B 1UNHD 4BCND 4CFNB 1G3NC 1H1QB 3DDQB 4BCPB 2WPAB 1QMZB 1JSTB 4F7SB 1H1PB 4BCQD 2QDJA 1GH6B 1OIUB 2WEVB 5FGKB 2UZDB 1TFBA 1GUXA 1URCB 4BCOB 4CRLB 2F2CA 5LQFB 2V22B 2W99A 4ROEA 4EOQB 2JGZB 3MY5B 3DOGB 4BCMD 1JKWA 4EOJB 4TTHA 5IF1B 4RODA 4BCGB 2C5XB 2C6TB 5ACBA 3O0GD 2C5OB 5IDNB 3EIDB 4ELLA 3TNWB 5HBHB 4BCHB 4F7JB 1OIYB 4F6WB 2G9XB 3BHVB 3H4CA 4CXAB 3DDPB 4BCQB 4F70B 1O9KB 4EOIB 3TNIB 2W2HA 1E9HB 1N4MA 2PHGA 3MIAB 2W9ZA 2UUEB 2CCHB 2WIPB 2BPMB 2WMBB 1O9KA 2C5NB 3POMA 4EOSB 4Y72B 1VYWB 1OL1B 4I3ZB 5HNBB 2X1NB 4KRDB 1KXUA 2WIHB 1XO2A 3BLQB 1AISB 1H1SB 4BCMB 4UN0A 4EORB 1UNGD 4EOLB 4EC8B 4NSTB 1P5EB 4YOZA 2IW8B 4F6UB 2PK2A 1OKVB 3BLRB 3G33B 5IDPB 2R7GA 4CFVB 1GY3B 5CYIB 5ICPB 3EOCB 3BHUB 4CFUD 1H25B 4ELJA 4II5B 3K7AM 4EC9B 2UZBB 2W9FA 2WHBB 4F7LB 2I40B 4CFXB 1JOWA 1UNLD 4BCKB 5L2WB 2UZLB 1JSUB 2B9RA 4YOSA 1FINB 3LQ5B 1VOLA 2CJMB 3QHRB 5CEIB 1BU2A 2C4GB 1W98B 2W96A 2WMAB 5HBJB 1OL2B 3RGFB 3TNHB 2IW9B 1OI9B 2CCIB 4BCIB 4F6SB 2UZEB 1H27B 4BCJB 4CFMB 4CFUB 4EOPB 1H4LD 1C9BA 3QHWB 1FVVB 2WXVB 1AD6A 1H24B 4YOOA 2BKZB 3MY1B 4EOOB 4KRCB 1ZP2A 1GUXB 4ROCA 1H1RB 2WFYB 3MI9B 4FX3B 1OGUB 2C5VB 5LMKB 5I5ZB 4G6LB 1F5QB
chains in the Genus database with same CATH superfamily
3HBLA 2ZPIB 4EONB 4OGRB 4BCFB 4YC3B 3F5XB 2IVXA 2I53A 4IMYB 2EUFA 4CFWB 3TN8B 3BLHB 1UNHD 2D0QB 2PJQA 3DDQB 3QXEB 2CZ0B 1GH6B 4AKGA 5FGKB 4CRLB 2F2CA 3MY5B 3DOGB 4BCGB 2C6TB 5ACBA 3O0GD 5IDNB 2KMGA 1IREB 4JX6A 4CXAB 4F70B 3TNIB 3TW7A 1N4MA 4OB1B 1UGPB 2WMBB 2C5NB 4EOSB 1VYWB 1KXUA 1H1SB 4BCMB 4EOLB 1AHJB 4NSTB 4YOZA 1OKVB 3BLRB 1GY3B 3X20B 2KR6A 4II5B 2W9FA 2WHBB 1JOWA 1UNLD 1UGRB 3VKGA 2ZZDB 1VOLA 1W98B 2WMAB 5HBJB 4NC6A 1H24B 4YOOA 2QDYB 4ROCA 1OGUB 2WJ9A 2CZ6B 3PO3S 4MFDA 5BNJB 4EOMB 5HVYB 1H28B 1D3UB 4JX5A 4BCNB 5EFQB 4ZGJB 2PK9B 4CFNB 1H1QB 4BCPB 1QMZB 4F7SB 1H1PB 4BY1X 2DXCB 2QDJA 3X24B 1E7PA 1TFBA 3BG9A 4BCOB 2V22B 2W99A 4EOQB 4BCMD 4TTHA 2BS3A 3EIDB 4BCHB 4HNTA 3WVDB 3BHVB 1UGSB 4BXXX 1O9KB 1E9HB 4JX4A 3B57A 4FM4B 2WIPB 2BPMB 3POMA 4Y72B 1OL1B 2X1NB 1XO2A 3DJBA 1AISB 5IHYA 2CYZB 1UNGD 5EJCA 4EC8B 4OB0B 2IW8B 2PK2A 3G33B 2DMEA 4ZGEB 2QFZA 2DD4B 3NDQA 5ICPB 4ELJA 4MFEA 2I40B 5L2WB 3A8MB 4AKHA 2CJMB 5DQWA 2G77A 3TNHB 2IW9B 1OI9B 3VKHA 1H27B 4BCJB 4CFMB 1QLBA 1C9BA 4M6VA 1FVVB 2WXVB 4LOCA 1UGQB 2BKZB 1ZP2A 4BBSM 3X26B 4FX3B 2IN3A 2WFYB 1F5QB 2ZPHB 4F7NB 1OKWB 3QWLA 1TD6A 5HBEB 2LW4A 3M03A 4Z6YA 1VINA 2ZPFB 3HO8A 2WPAB 1JSTB 1OIUB 2WEVB 3A8LB 1URCB 3VYGB 1JKWA 3X25B 5IF1B 4HLQA 3A8HB 4RODA 3TNWB 4F7JB 3BG5A 4F6WB 2DD5B 2G9XB 4BCQB 4EOIB 4BY7X 3KHIA 2PHGA 2BS2A 2CCHB 4KRDB 3BLQB 4UN0A 4QSHA 1P5EB 4OB2B 2R7GA 4CFVB 3EOCB 3BHUB 1ENWA 4ZGDB 4AKIA 4F7LB 1JSUB 4YOSA 3QHRB 5CEIB 2C4GB 2W96A 2ZPBB 2ZPEB 2CCIB 4F6SB 2UZEB 3X28B 4CFUB 1H4LD 1AD6A 3QZ9B 3MY1B 1H1RB 3BG3A 3MI9B 3QZ5B 3HHTB 2C5VB 2DPPB 4HNUA 3A8OB 5I5ZB 2QQ8A 4G6LB 1H26B 4EOKB 4OR5B 2QGSA 3EJ1B 3DL1A 2DXBB 3HB9A 5HQ0B 3A8GB 1PKDB 2AHJB 2IW6B 3BHTB 2PMIB 4BCND 1G3NC 4BCQD 3QYEA 4OB3B 2ZPGB 2UZDB 4AI6A 1GUXA 3QYGB 5LQFB 4ROEA 2JGZB 4MIMA 4EOJB 2C5XB 2C5OB 4ELLA 5HBHB 1OIYB 3H4CA 3DDPB 2CZ7B 2W2HA 2ZCFB 3QYBA 3MIAB 2W9ZA 2UUEB 3TW6A 1V29B 1O9KA 4I3ZB 5HNBB 3HZJA 2WIHB 4HL4A 3WVEB 4EORB 3VYHB 4F6UB 5IDPB 3QYHB 5CYIB 4CFUD 1H25B 3K7AM 4EC9B 2UZBB 4CFXB 3GTMS 4BBRM 4BCKB 2UZLB 2B9RA 1FINB 3LQ5B 3DTOA 1BU2A 2BS4A 2CZ1B 4HNVA 1OL2B 3RGFB 4BCIB 4EOPB 3QHWB 5DQVA 4EOOB 4KRCB 1GUXB 1FKMA 2QF7A 5LMKB
chains in the Genus database with same CATH topology
5BNJB 1H26B 4EOKB 4EOMB 4OR5B 5HVYB 4F7NB 1OKWB 1H28B 4EONB 3EJ1B 4OGRB 4BCFB 1D3UB 4YC3B 3F5XB 2IVXA 2I53A 5HBEB 4IMYB 2EUFA 4CFWB 5HQ0B 4BCNB 1PKDB 5EFQB 2IW6B 2PK9B 3BHTB 2PMIB 3M03A 3BLHB 1VINA 3TN8B 1UNHD 4BCND 4CFNB 1G3NC 1H1QB 3DDQB 4BCPB 2WPAB 1QMZB 1JSTB 4F7SB 1H1PB 4BCQD 2QDJA 1GH6B 1OIUB 2WEVB 5FGKB 2UZDB 1TFBA 1GUXA 1URCB 4BCOB 4CRLB 2F2CA 5LQFB 2V22B 2W99A 4ROEA 4EOQB 2JGZB 3MY5B 3DOGB 4BCMD 1JKWA 4EOJB 4TTHA 5IF1B 4RODA 4BCGB 2C5XB 2C6TB 5ACBA 3O0GD 2C5OB 5IDNB 3EIDB 4ELLA 3TNWB 5HBHB 4BCHB 4F7JB 1OIYB 4F6WB 2G9XB 3BHVB 3H4CA 4CXAB 3DDPB 4BCQB 4F70B 1O9KB 4EOIB 3TNIB 2W2HA 1E9HB 1N4MA 2PHGA 3MIAB 2W9ZA 2UUEB 2CCHB 2WIPB 2BPMB 2WMBB 1O9KA 2C5NB 3POMA 4EOSB 4Y72B 1VYWB 1OL1B 4I3ZB 5HNBB 2X1NB 4KRDB 1KXUA 2WIHB 1XO2A 3BLQB 1AISB 1H1SB 4BCMB 4UN0A 4EORB 1UNGD 4EOLB 4EC8B 4NSTB 1P5EB 4YOZA 2IW8B 4F6UB 2PK2A 1OKVB 3BLRB 3G33B 5IDPB 2R7GA 4CFVB 1GY3B 5CYIB 5ICPB 3EOCB 3BHUB 4CFUD 1H25B 4ELJA 4II5B 3K7AM 4EC9B 2UZBB 2W9FA 2WHBB 4F7LB 2I40B 4CFXB 1JOWA 1UNLD 4BCKB 5L2WB 2UZLB 1JSUB 2B9RA 4YOSA 1FINB 3LQ5B 1VOLA 2CJMB 3QHRB 5CEIB 1BU2A 2C4GB 1W98B 2W96A 2WMAB 5HBJB 1OL2B 3RGFB 3TNHB 2IW9B 1OI9B 2CCIB 4BCIB 4F6SB 2UZEB 1H27B 4BCJB 4CFMB 4CFUB 4EOPB 1H4LD 1C9BA 3QHWB 1FVVB 2WXVB 1AD6A 1H24B 4YOOA 2BKZB 3MY1B 4EOOB 4KRCB 1ZP2A 1GUXB 4ROCA 1H1RB 2WFYB 3MI9B 4FX3B 1OGUB 2C5VB 5LMKB 5I5ZB 4G6LB 1F5QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNJ B;  1H26 B;  4EOK B;  4EOM B;  4OR5 B;  5HVY B;  4F7N B;  1OKW B;  1H28 B;  4EON B;  3EJ1 B;  4OGR B;  4BCF B;  1D3U B;  4YC3 B;  3F5X B;  2IVX A;  2I53 A;  5HBE B;  4IMY B;  2EUF A;  4CFW B;  5HQ0 B;  4BCN B;  1PKD B;  5EFQ B;  2IW6 B;  2PK9 B;  3BHT B;  2PMI B;  3M03 A;  3BLH B;  1VIN A;  3TN8 B;  1UNH D;  4BCN D;  4CFN B;  1G3N C;  1H1Q B;  3DDQ B;  4BCP B;  2WPA B;  1QMZ B;  1JST B;  4F7S B;  1H1P B;  4BCQ D;  2QDJ A;  1GH6 B;  1OIU B;  2WEV B;  5FGK B;  2UZD B;  1TFB A;  1GUX A;  1URC B;  4BCO B;  4CRL B;  2F2C A;  5LQF B;  2V22 B;  2W99 A;  4ROE A;  4EOQ B;  2JGZ B;  3MY5 B;  3DOG B;  4BCM D;  1JKW A;  4EOJ B;  4TTH A;  5IF1 B;  4ROD A;  4BCG B;  2C5X B;  2C6T B;  5ACB A;  3O0G D;  2C5O B;  5IDN B;  3EID B;  4ELL A;  3TNW B;  5HBH B;  4BCH B;  4F7J B;  1OIY B;  4F6W B;  2G9X B;  3BHV B;  3H4C A;  4CXA B;  3DDP B;  4BCQ B;  4F70 B;  1O9K B;  4EOI B;  3TNI B;  2W2H A;  1E9H B;  1N4M A;  2PHG A;  3MIA B;  2W9Z A;  2UUE B;  2CCH B;  2WIP B;  2BPM B;  2WMB B;  1O9K A;  2C5N B;  3POM A;  4EOS B;  4Y72 B;  1VYW B;  1OL1 B;  4I3Z B;  5HNB B;  2X1N B;  4KRD B;  1KXU A;  2WIH B;  1XO2 A;  3BLQ B;  1AIS B;  1H1S B;  4BCM B;  4UN0 A;  4EOR B;  1UNG D;  4EOL B;  4EC8 B;  4NST B;  1P5E B;  4YOZ A;  2IW8 B;  4F6U B;  2PK2 A;  1OKV B;  3BLR B;  3G33 B;  5IDP B;  2R7G A;  4CFV B;  1GY3 B;  5CYI B;  5ICP B;  3EOC B;  3BHU B;  4CFU D;  1H25 B;  4ELJ A;  4II5 B;  3K7A M;  4EC9 B;  2UZB B;  2W9F A;  2WHB B;  4F7L B;  2I40 B;  4CFX B;  1JOW A;  1UNL D;  4BCK B;  5L2W B;  2UZL B;  1JSU B;  2B9R A;  4YOS A;  1FIN B;  3LQ5 B;  1VOL A;  2CJM B;  3QHR B;  5CEI B;  1BU2 A;  2C4G B;  1W98 B;  2W96 A;  2WMA B;  5HBJ B;  1OL2 B;  3RGF B;  3TNH B;  2IW9 B;  1OI9 B;  2CCI B;  4BCI B;  4F6S B;  2UZE B;  1H27 B;  4BCJ B;  4CFM B;  4CFU B;  4EOP B;  1H4L D;  1C9B A;  3QHW B;  1FVV B;  2WXV B;  1AD6 A;  1H24 B;  4YOO A;  2BKZ B;  3MY1 B;  4EOO B;  4KRC B;  1ZP2 A;  1GUX B;  4ROC A;  1H1R B;  2WFY B;  3MI9 B;  4FX3 B;  1OGU B;  2C5V B;  5LMK B;  5I5Z B;  4G6L B;  1F5Q B; 
#chains in the Genus database with same CATH topology
 3HBL A;  2ZPI B;  4EON B;  4OGR B;  4BCF B;  4YC3 B;  3F5X B;  2IVX A;  2I53 A;  4IMY B;  2EUF A;  4CFW B;  3TN8 B;  3BLH B;  1UNH D;  2D0Q B;  2PJQ A;  3DDQ B;  3QXE B;  2CZ0 B;  1GH6 B;  4AKG A;  5FGK B;  4CRL B;  2F2C A;  3MY5 B;  3DOG B;  4BCG B;  2C6T B;  5ACB A;  3O0G D;  5IDN B;  2KMG A;  1IRE B;  4JX6 A;  4CXA B;  4F70 B;  3TNI B;  3TW7 A;  1N4M A;  4OB1 B;  1UGP B;  2WMB B;  2C5N B;  4EOS B;  1VYW B;  1KXU A;  1H1S B;  4BCM B;  4EOL B;  1AHJ B;  4NST B;  4YOZ A;  1OKV B;  3BLR B;  1GY3 B;  3X20 B;  2KR6 A;  4II5 B;  2W9F A;  2WHB B;  1JOW A;  1UNL D;  1UGR B;  3VKG A;  2ZZD B;  1VOL A;  1W98 B;  2WMA B;  5HBJ B;  4NC6 A;  1H24 B;  4YOO A;  2QDY B;  4ROC A;  1OGU B;  2WJ9 A;  2CZ6 B;  3PO3 S;  4MFD A;  5BNJ B;  4EOM B;  5HVY B;  1H28 B;  1D3U B;  4JX5 A;  4BCN B;  5EFQ B;  4ZGJ B;  2PK9 B;  4CFN B;  1H1Q B;  4BCP B;  1QMZ B;  4F7S B;  1H1P B;  4BY1 X;  2DXC B;  2QDJ A;  3X24 B;  1E7P A;  1TFB A;  3BG9 A;  4BCO B;  2V22 B;  2W99 A;  4EOQ B;  4BCM D;  4TTH A;  2BS3 A;  3EID B;  4BCH B;  4HNT A;  3WVD B;  3BHV B;  1UGS B;  4BXX X;  1O9K B;  1E9H B;  4JX4 A;  3B57 A;  4FM4 B;  2WIP B;  2BPM B;  3POM A;  4Y72 B;  1OL1 B;  2X1N B;  1XO2 A;  3DJB A;  1AIS B;  5IHY A;  2CYZ B;  1UNG D;  5EJC A;  4EC8 B;  4OB0 B;  2IW8 B;  2PK2 A;  3G33 B;  2DME A;  4ZGE B;  2QFZ A;  2DD4 B;  3NDQ A;  5ICP B;  4ELJ A;  4MFE A;  2I40 B;  5L2W B;  3A8M B;  4AKH A;  2CJM B;  5DQW A;  2G77 A;  3TNH B;  2IW9 B;  1OI9 B;  3VKH A;  1H27 B;  4BCJ B;  4CFM B;  1QLB A;  1C9B A;  4M6V A;  1FVV B;  2WXV B;  4LOC A;  1UGQ B;  2BKZ B;  1ZP2 A;  4BBS M;  3X26 B;  4FX3 B;  2IN3 A;  2WFY B;  1F5Q B;  2ZPH B;  4F7N B;  1OKW B;  3QWL A;  1TD6 A;  5HBE B;  2LW4 A;  3M03 A;  4Z6Y A;  1VIN A;  2ZPF B;  3HO8 A;  2WPA B;  1JST B;  1OIU B;  2WEV B;  3A8L B;  1URC B;  3VYG B;  1JKW A;  3X25 B;  5IF1 B;  4HLQ A;  3A8H B;  4ROD A;  3TNW B;  4F7J B;  3BG5 A;  4F6W B;  2DD5 B;  2G9X B;  4BCQ B;  4EOI B;  4BY7 X;  3KHI A;  2PHG A;  2BS2 A;  2CCH B;  4KRD B;  3BLQ B;  4UN0 A;  4QSH A;  1P5E B;  4OB2 B;  2R7G A;  4CFV B;  3EOC B;  3BHU B;  1ENW A;  4ZGD B;  4AKI A;  4F7L B;  1JSU B;  4YOS A;  3QHR B;  5CEI B;  2C4G B;  2W96 A;  2ZPB B;  2ZPE B;  2CCI B;  4F6S B;  2UZE B;  3X28 B;  4CFU B;  1H4L D;  1AD6 A;  3QZ9 B;  3MY1 B;  1H1R B;  3BG3 A;  3MI9 B;  3QZ5 B;  3HHT B;  2C5V B;  2DPP B;  4HNU A;  3A8O B;  5I5Z B;  2QQ8 A;  4G6L B;  1H26 B;  4EOK B;  4OR5 B;  2QGS A;  3EJ1 B;  3DL1 A;  2DXB B;  3HB9 A;  5HQ0 B;  3A8G B;  1PKD B;  2AHJ B;  2IW6 B;  3BHT B;  2PMI B;  4BCN D;  1G3N C;  4BCQ D;  3QYE A;  4OB3 B;  2ZPG B;  2UZD B;  4AI6 A;  1GUX A;  3QYG B;  5LQF B;  4ROE A;  2JGZ B;  4MIM A;  4EOJ B;  2C5X B;  2C5O B;  4ELL A;  5HBH B;  1OIY B;  3H4C A;  3DDP B;  2CZ7 B;  2W2H A;  2ZCF B;  3QYB A;  3MIA B;  2W9Z A;  2UUE B;  3TW6 A;  1V29 B;  1O9K A;  4I3Z B;  5HNB B;  3HZJ A;  2WIH B;  4HL4 A;  3WVE B;  4EOR B;  3VYH B;  4F6U B;  5IDP B;  3QYH B;  5CYI B;  4CFU D;  1H25 B;  3K7A M;  4EC9 B;  2UZB B;  4CFX B;  3GTM S;  4BBR M;  4BCK B;  2UZL B;  2B9R A;  1FIN B;  3LQ5 B;  3DTO A;  1BU2 A;  2BS4 A;  2CZ1 B;  4HNV A;  1OL2 B;  3RGF B;  4BCI B;  4EOP B;  3QHW B;  5DQV A;  4EOO B;  4KRC B;  1GUX B;  1FKM A;  2QF7 A;  5LMK B; 
#chains in the Genus database with same CATH homology
 5BNJ B;  1H26 B;  4EOK B;  4EOM B;  4OR5 B;  5HVY B;  4F7N B;  1OKW B;  1H28 B;  4EON B;  3EJ1 B;  4OGR B;  4BCF B;  1D3U B;  4YC3 B;  3F5X B;  2IVX A;  2I53 A;  5HBE B;  4IMY B;  2EUF A;  4CFW B;  5HQ0 B;  4BCN B;  1PKD B;  5EFQ B;  2IW6 B;  2PK9 B;  3BHT B;  2PMI B;  3M03 A;  3BLH B;  1VIN A;  3TN8 B;  1UNH D;  4BCN D;  4CFN B;  1G3N C;  1H1Q B;  3DDQ B;  4BCP B;  2WPA B;  1QMZ B;  1JST B;  4F7S B;  1H1P B;  4BCQ D;  2QDJ A;  1GH6 B;  1OIU B;  2WEV B;  5FGK B;  2UZD B;  1TFB A;  1GUX A;  1URC B;  4BCO B;  4CRL B;  2F2C A;  5LQF B;  2V22 B;  2W99 A;  4ROE A;  4EOQ B;  2JGZ B;  3MY5 B;  3DOG B;  4BCM D;  1JKW A;  4EOJ B;  4TTH A;  5IF1 B;  4ROD A;  4BCG B;  2C5X B;  2C6T B;  5ACB A;  3O0G D;  2C5O B;  5IDN B;  3EID B;  4ELL A;  3TNW B;  5HBH B;  4BCH B;  4F7J B;  1OIY B;  4F6W B;  2G9X B;  3BHV B;  3H4C A;  4CXA B;  3DDP B;  4BCQ B;  4F70 B;  1O9K B;  4EOI B;  3TNI B;  2W2H A;  1E9H B;  1N4M A;  2PHG A;  3MIA B;  2W9Z A;  2UUE B;  2CCH B;  2WIP B;  2BPM B;  2WMB B;  1O9K A;  2C5N B;  3POM A;  4EOS B;  4Y72 B;  1VYW B;  1OL1 B;  4I3Z B;  5HNB B;  2X1N B;  4KRD B;  1KXU A;  2WIH B;  1XO2 A;  3BLQ B;  1AIS B;  1H1S B;  4BCM B;  4UN0 A;  4EOR B;  1UNG D;  4EOL B;  4EC8 B;  4NST B;  1P5E B;  4YOZ A;  2IW8 B;  4F6U B;  2PK2 A;  1OKV B;  3BLR B;  3G33 B;  5IDP B;  2R7G A;  4CFV B;  1GY3 B;  5CYI B;  5ICP B;  3EOC B;  3BHU B;  4CFU D;  1H25 B;  4ELJ A;  4II5 B;  3K7A M;  4EC9 B;  2UZB B;  2W9F A;  2WHB B;  4F7L B;  2I40 B;  4CFX B;  1JOW A;  1UNL D;  4BCK B;  5L2W B;  2UZL B;  1JSU B;  2B9R A;  4YOS A;  1FIN B;  3LQ5 B;  1VOL A;  2CJM B;  3QHR B;  5CEI B;  1BU2 A;  2C4G B;  1W98 B;  2W96 A;  2WMA B;  5HBJ B;  1OL2 B;  3RGF B;  3TNH B;  2IW9 B;  1OI9 B;  2CCI B;  4BCI B;  4F6S B;  2UZE B;  1H27 B;  4BCJ B;  4CFM B;  4CFU B;  4EOP B;  1H4L D;  1C9B A;  3QHW B;  1FVV B;  2WXV B;  1AD6 A;  1H24 B;  4YOO A;  2BKZ B;  3MY1 B;  4EOO B;  4KRC B;  1ZP2 A;  1GUX B;  4ROC A;  1H1R B;  2WFY B;  3MI9 B;  4FX3 B;  1OGU B;  2C5V B;  5LMK B;  5I5Z B;  4G6L B;  1F5Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...