4KRCB

Crystal structure of pho85-pcl10-atp-gamma-s complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
180
Chain Sequence
b'ENPLLHGIPVDVPHISVDEALANFKETIELLLKLSGNNTRVEKKEYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKLAASKLLLNELRSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclin-dependent protein kinase PHO85
publication title New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/signaling protein
total genus 56
structure length 180
sequence length 188
ec nomenclature
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08613 Cyclin Cyclin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4krcB00
2C6TB 4OR5B 2C5XB 2W9FA 1OL1B 1H1QB 4BCNB 3DDPB 2CCIB 2UZLB 1C9BA 1GY3B 1JSUB 5IDNB 4CRLB 3BLRB 1OIUB 5CYIB 2WPAB 3O0GD 5HVYB 5IDPB 5LMKB 4CFMB 1N4MA 4EOSB 5HNBB 4EOLB 4BCKB 1H28B 2CCHB 4BCFB 4EC8B 2PMIB 2WMAB 1H27B 3RGFB 4BCHB 5BNJB 1ZP2A 2QDJA 2W96A 3MIAB 4EOQB 1GH6B 4F6WB 3BHTB 2JGZB 2IW8B 4ROCA 1AD6A 2WXVB 4EOOB 2R7GA 1OI9B 2W9ZA 4CFUB 1AISB 2I40B 4Y72B 2IW6B 5LQFB 3G33B 1H1RB 4ELJA 5CEIB 2F2CA 4F70B 1OIYB 3BHUB 3TNHB 3TNWB 2C5NB 2IVXA 1H4LD 1G3NC 4YOOA 1PKDB 4EONB 2WIPB 1E9HB 4EOPB 4CFVB 1OKWB 2IW9B 3F5XB 1KXUA 2UZEB 4UN0A 5HBHB 5ICPB 4BCND 1W98B 5FGKB 4ELLA 2G9XB 2BKZB 4CXAB 1VYWB 1OKVB 3BLHB 2V22B 1F5QB 4BCJB 4EOIB 2C5OB 1H26B 1BU2A 3POMA 4F7NB 2I53A 1GUXA 2B9RA 2UZBB 4BCQB 3M03A 1URCB 4ROEA 1O9KA 3QHRB 1VINA 1OGUB 2CJMB 3EIDB 2C5VB 3EJ1B 1JOWA 2WIHB 4EC9B 2PK2A 4BCPB 4KRDB 1UNGD 4FX3B 2PHGA 3MY1B 5ACBA 1D3UB 4CFUD 3DDQB 1H1SB 4BCQD 1VOLA 3K7AM 1H1PB 2WEVB 2WMBB 1GUXB 1QMZB 4KRCB 3DOGB 4II5B 2W99A 3EOCB 4YOSA 5IF1B 2W2HA 4OGRB 2BPMB 4F7JB 4CFXB 1P5EB 4CFWB 4BCMB 4F7LB 1UNHD 4F7SB 4G6LB 2EUFA 4RODA 5EFQB 2UUEB 2PK9B 5HBJB 4YC3B 3LQ5B 4BCGB 3QHWB 4NSTB 4TTHA 1TFBA 4CFNB 4EOMB 4IMYB 3BHVB 4YOZA 4EOKB 4BCMD 4EORB 4EOJB 3BLQB 1JSTB 1H24B 1H25B 3TNIB 5HQ0B 2UZDB 3MI9B 2WFYB 4I3ZB 1XO2A 2X1NB 4BCIB 1FINB 2WHBB 1O9KB 1UNLD 5L2WB 3H4CA 1FVVB 4BCOB 1JKWA 3MY5B 1OL2B 4F6SB 5I5ZB 5HBEB 2C4GB 4F6UB 3TN8B
chains in the Genus database with same CATH superfamily
2W9FA 1OL1B 1FKMA 1H1QB 4BCNB 3PO3S 5IDNB 2WJ9A 1OIUB 2WPAB 5HVYB 5IDPB 3TW7A 3A8HB 1H28B 4BY1X 3VKGA 2PMIB 2WMAB 2DMEA 2QDYB 1ZP2A 2W96A 2DXBB 2CYZB 2WXVB 2W9ZA 1AISB 3DJBA 2ZPBB 4BY7X 3TNWB 1H4LD 1ENWA 4Z6YA 4CFVB 2QQ8A 4AKIA 4UN0A 4M6VA 3A8LB 1VYWB 1BU2A 3QZ9B 2B9RA 3HBLA 3QHRB 2QFZA 4JX5A 3B57A 2CJMB 3EJ1B 4BCPB 1H1SB 4BBRM 3K7AM 4LOCA 1QMZB 5EJCA 3EOCB 2BPMB 4AKHA 1P5EB 4F7LB 1UNHD 2IN3A 3DTOA 3VYGB 2UUEB 4BCGB 4BXXX 4HNVA 4CFNB 4EOMB 4IMYB 4BCMD 4HNTA 3HHTB 2WFYB 2ZCFB 4ZGEB 1FINB 1O9KB 4BCOB 1JKWA 3MY5B 1OL2B 2C4GB 4FM4B 4OR5B 2C5XB 3DDPB 2DD4B 2UZLB 1C9BA 1GY3B 4CRLB 4NC6A 5CYIB 5LMKB 1IREB 1UGPB 4CFMB 4EOSB 4BCKB 4EC8B 2AHJB 3MIAB 2JGZB 1AD6A 1OI9B 2IW6B 3HO8A 3G33B 4ELJA 5CEIB 3BHUB 3TNHB 2IVXA 1G3NC 1PKDB 3HB9A 2WIPB 1E9HB 4EOPB 4MFEA 4JX6A 5ICPB 4AI6A 5FGKB 2BS2A 2G9XB 4EOIB 2C5OB 4OB0B 4JX4A 1GUXA 3BG9A 4BCQB 3QYGB 1O9KA 1VINA 3EIDB 1JOWA 1UGQB 2PK2A 4EC9B 5IHYA 4CFUD 1VOLA 2LW4A 3A8MB 1H1PB 2WMBB 3WVEB 3A8OB 4CFXB 4CFWB 4G6LB 4RODA 3X26B 3LQ5B 3GTMS 3QWLA 2PJQA 4YOZA 3BLQB 3HZJA 1JSTB 1H25B 3TNIB 1XO2A 3A8GB 1UNLD 4MFDA 1FVVB 5HBEB 2ZPHB 2C6TB 1E7PA 4MIMA 4ZGJB 2CCIB 1JSUB 2ZPIB 1V29B 3X25B 5HNBB 4EOLB 2CCHB 2KMGA 3QXEB 4BCFB 4AKGA 4OB2B 2QDJA 2ZPGB 1GH6B 2IW8B 4EOOB 2I40B 4Y72B 2F2CA 4QSHA 4F70B 4YOOA 2ZPEB 1OKWB 2IW9B 3F5XB 2UZEB 4BCND 1W98B 4ELLA 2BKZB 3TW6A 4CXAB 1AHJB 1OKVB 3BLHB 1F5QB 1H26B 3POMA 2UZBB 3M03A 4ROEA 1OGUB 2C5VB 1UGRB 2WIHB 4BBSM 4KRDB 3MY1B 3DDQB 4OB3B 4BCQD 4HL4A 2WEVB 4KRCB 3X24B 1TD6A 2W99A 2W2HA 2EUFA 2ZPFB 4OB1B 3DL1A 3BG5A 4YC3B 4NSTB 2BS4A 2G77A 3BHVB 4EORB 3X20B 2DXCB 3KHIA 2BS3A 3MI9B 2CZ6B 4BCIB 2WHBB 5L2WB 3H4CA 4F6UB 3TN8B 3BG3A 3BLRB 2KR6A 3O0GD 1N4MA 3QZ5B 3QYBA 1H27B 3RGFB 4BCHB 3QYEA 5BNJB 2DD5B 4EOQB 4F6WB 3BHTB 3VKHA 4ROCA 5DQWA 3WVDB 3NDQA 2R7GA 4CFUB 5LQFB 1H1RB 4HLQA 1OIYB 2C5NB 4EONB 2CZ7B 2CZ1B 1QLBA 1KXUA 4HNUA 2CZ0B 5HBHB 2V22B 4BCJB 4F7NB 2I53A 2QGSA 2ZZDB 1URCB 1UGSB 3QYHB 1UNGD 4FX3B 2PHGA 4ZGDB 5ACBA 1D3UB 1GUXB 3DOGB 4II5B 5IF1B 4YOSA 4OGRB 4F7JB 4BCMB 4F7SB 5DQVA 5EFQB 2PK9B 5HBJB 3QHWB 2QF7A 4TTHA 3X28B 1TFBA 4EOKB 4EOJB 2D0QB 1H24B 2DPPB 5HQ0B 2UZDB 4I3ZB 2X1NB 3VYHB 4F6SB 5I5ZB
chains in the Genus database with same CATH topology
2C6TB 4OR5B 2C5XB 2W9FA 1OL1B 1H1QB 4BCNB 3DDPB 2CCIB 2UZLB 1C9BA 1GY3B 1JSUB 5IDNB 4CRLB 3BLRB 1OIUB 5CYIB 2WPAB 3O0GD 5HVYB 5IDPB 5LMKB 4CFMB 1N4MA 4EOSB 5HNBB 4EOLB 4BCKB 1H28B 2CCHB 4BCFB 4EC8B 2PMIB 2WMAB 1H27B 3RGFB 4BCHB 5BNJB 1ZP2A 2QDJA 2W96A 3MIAB 4EOQB 1GH6B 4F6WB 3BHTB 2JGZB 2IW8B 4ROCA 1AD6A 2WXVB 4EOOB 2R7GA 1OI9B 2W9ZA 4CFUB 1AISB 2I40B 4Y72B 2IW6B 5LQFB 3G33B 1H1RB 4ELJA 5CEIB 2F2CA 4F70B 1OIYB 3BHUB 3TNHB 3TNWB 2C5NB 2IVXA 1H4LD 1G3NC 4YOOA 1PKDB 4EONB 2WIPB 1E9HB 4EOPB 4CFVB 1OKWB 2IW9B 3F5XB 1KXUA 2UZEB 4UN0A 5HBHB 5ICPB 4BCND 1W98B 5FGKB 4ELLA 2G9XB 2BKZB 4CXAB 1VYWB 1OKVB 3BLHB 2V22B 1F5QB 4BCJB 4EOIB 2C5OB 1H26B 1BU2A 3POMA 4F7NB 2I53A 1GUXA 2B9RA 2UZBB 4BCQB 3M03A 1URCB 4ROEA 1O9KA 3QHRB 1VINA 1OGUB 2CJMB 3EIDB 2C5VB 3EJ1B 1JOWA 2WIHB 4EC9B 2PK2A 4BCPB 4KRDB 1UNGD 4FX3B 2PHGA 3MY1B 5ACBA 1D3UB 4CFUD 3DDQB 1H1SB 4BCQD 1VOLA 3K7AM 1H1PB 2WEVB 2WMBB 1GUXB 1QMZB 4KRCB 3DOGB 4II5B 2W99A 3EOCB 4YOSA 5IF1B 2W2HA 4OGRB 2BPMB 4F7JB 4CFXB 1P5EB 4CFWB 4BCMB 4F7LB 1UNHD 4F7SB 4G6LB 2EUFA 4RODA 5EFQB 2UUEB 2PK9B 5HBJB 4YC3B 3LQ5B 4BCGB 3QHWB 4NSTB 4TTHA 1TFBA 4CFNB 4EOMB 4IMYB 3BHVB 4YOZA 4EOKB 4BCMD 4EORB 4EOJB 3BLQB 1JSTB 1H24B 1H25B 3TNIB 5HQ0B 2UZDB 3MI9B 2WFYB 4I3ZB 1XO2A 2X1NB 4BCIB 1FINB 2WHBB 1O9KB 1UNLD 5L2WB 3H4CA 1FVVB 4BCOB 1JKWA 3MY5B 1OL2B 4F6SB 5I5ZB 5HBEB 2C4GB 4F6UB 3TN8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6T B;  4OR5 B;  2C5X B;  2W9F A;  1OL1 B;  1H1Q B;  4BCN B;  3DDP B;  2CCI B;  2UZL B;  1C9B A;  1GY3 B;  1JSU B;  5IDN B;  4CRL B;  3BLR B;  1OIU B;  5CYI B;  2WPA B;  3O0G D;  5HVY B;  5IDP B;  5LMK B;  4CFM B;  1N4M A;  4EOS B;  5HNB B;  4EOL B;  4BCK B;  1H28 B;  2CCH B;  4BCF B;  4EC8 B;  2PMI B;  2WMA B;  1H27 B;  3RGF B;  4BCH B;  5BNJ B;  1ZP2 A;  2QDJ A;  2W96 A;  3MIA B;  4EOQ B;  1GH6 B;  4F6W B;  3BHT B;  2JGZ B;  2IW8 B;  4ROC A;  1AD6 A;  2WXV B;  4EOO B;  2R7G A;  1OI9 B;  2W9Z A;  4CFU B;  1AIS B;  2I40 B;  4Y72 B;  2IW6 B;  5LQF B;  3G33 B;  1H1R B;  4ELJ A;  5CEI B;  2F2C A;  4F70 B;  1OIY B;  3BHU B;  3TNH B;  3TNW B;  2C5N B;  2IVX A;  1H4L D;  1G3N C;  4YOO A;  1PKD B;  4EON B;  2WIP B;  1E9H B;  4EOP B;  4CFV B;  1OKW B;  2IW9 B;  3F5X B;  1KXU A;  2UZE B;  4UN0 A;  5HBH B;  5ICP B;  4BCN D;  1W98 B;  5FGK B;  4ELL A;  2G9X B;  2BKZ B;  4CXA B;  1VYW B;  1OKV B;  3BLH B;  2V22 B;  1F5Q B;  4BCJ B;  4EOI B;  2C5O B;  1H26 B;  1BU2 A;  3POM A;  4F7N B;  2I53 A;  1GUX A;  2B9R A;  2UZB B;  4BCQ B;  3M03 A;  1URC B;  4ROE A;  1O9K A;  3QHR B;  1VIN A;  1OGU B;  2CJM B;  3EID B;  2C5V B;  3EJ1 B;  1JOW A;  2WIH B;  4EC9 B;  2PK2 A;  4BCP B;  4KRD B;  1UNG D;  4FX3 B;  2PHG A;  3MY1 B;  5ACB A;  1D3U B;  4CFU D;  3DDQ B;  1H1S B;  4BCQ D;  1VOL A;  3K7A M;  1H1P B;  2WEV B;  2WMB B;  1GUX B;  1QMZ B;  4KRC B;  3DOG B;  4II5 B;  2W99 A;  3EOC B;  4YOS A;  5IF1 B;  2W2H A;  4OGR B;  2BPM B;  4F7J B;  4CFX B;  1P5E B;  4CFW B;  4BCM B;  4F7L B;  1UNH D;  4F7S B;  4G6L B;  2EUF A;  4ROD A;  5EFQ B;  2UUE B;  2PK9 B;  5HBJ B;  4YC3 B;  3LQ5 B;  4BCG B;  3QHW B;  4NST B;  4TTH A;  1TFB A;  4CFN B;  4EOM B;  4IMY B;  3BHV B;  4YOZ A;  4EOK B;  4BCM D;  4EOR B;  4EOJ B;  3BLQ B;  1JST B;  1H24 B;  1H25 B;  3TNI B;  5HQ0 B;  2UZD B;  3MI9 B;  2WFY B;  4I3Z B;  1XO2 A;  2X1N B;  4BCI B;  1FIN B;  2WHB B;  1O9K B;  1UNL D;  5L2W B;  3H4C A;  1FVV B;  4BCO B;  1JKW A;  3MY5 B;  1OL2 B;  4F6S B;  5I5Z B;  5HBE B;  2C4G B;  4F6U B;  3TN8 B; 
#chains in the Genus database with same CATH topology
 2W9F A;  1OL1 B;  1FKM A;  1H1Q B;  4BCN B;  3PO3 S;  5IDN B;  2WJ9 A;  1OIU B;  2WPA B;  5HVY B;  5IDP B;  3TW7 A;  3A8H B;  1H28 B;  4BY1 X;  3VKG A;  2PMI B;  2WMA B;  2DME A;  2QDY B;  1ZP2 A;  2W96 A;  2DXB B;  2CYZ B;  2WXV B;  2W9Z A;  1AIS B;  3DJB A;  2ZPB B;  4BY7 X;  3TNW B;  1H4L D;  1ENW A;  4Z6Y A;  4CFV B;  2QQ8 A;  4AKI A;  4UN0 A;  4M6V A;  3A8L B;  1VYW B;  1BU2 A;  3QZ9 B;  2B9R A;  3HBL A;  3QHR B;  2QFZ A;  4JX5 A;  3B57 A;  2CJM B;  3EJ1 B;  4BCP B;  1H1S B;  4BBR M;  3K7A M;  4LOC A;  1QMZ B;  5EJC A;  3EOC B;  2BPM B;  4AKH A;  1P5E B;  4F7L B;  1UNH D;  2IN3 A;  3DTO A;  3VYG B;  2UUE B;  4BCG B;  4BXX X;  4HNV A;  4CFN B;  4EOM B;  4IMY B;  4BCM D;  4HNT A;  3HHT B;  2WFY B;  2ZCF B;  4ZGE B;  1FIN B;  1O9K B;  4BCO B;  1JKW A;  3MY5 B;  1OL2 B;  2C4G B;  4FM4 B;  4OR5 B;  2C5X B;  3DDP B;  2DD4 B;  2UZL B;  1C9B A;  1GY3 B;  4CRL B;  4NC6 A;  5CYI B;  5LMK B;  1IRE B;  1UGP B;  4CFM B;  4EOS B;  4BCK B;  4EC8 B;  2AHJ B;  3MIA B;  2JGZ B;  1AD6 A;  1OI9 B;  2IW6 B;  3HO8 A;  3G33 B;  4ELJ A;  5CEI B;  3BHU B;  3TNH B;  2IVX A;  1G3N C;  1PKD B;  3HB9 A;  2WIP B;  1E9H B;  4EOP B;  4MFE A;  4JX6 A;  5ICP B;  4AI6 A;  5FGK B;  2BS2 A;  2G9X B;  4EOI B;  2C5O B;  4OB0 B;  4JX4 A;  1GUX A;  3BG9 A;  4BCQ B;  3QYG B;  1O9K A;  1VIN A;  3EID B;  1JOW A;  1UGQ B;  2PK2 A;  4EC9 B;  5IHY A;  4CFU D;  1VOL A;  2LW4 A;  3A8M B;  1H1P B;  2WMB B;  3WVE B;  3A8O B;  4CFX B;  4CFW B;  4G6L B;  4ROD A;  3X26 B;  3LQ5 B;  3GTM S;  3QWL A;  2PJQ A;  4YOZ A;  3BLQ B;  3HZJ A;  1JST B;  1H25 B;  3TNI B;  1XO2 A;  3A8G B;  1UNL D;  4MFD A;  1FVV B;  5HBE B;  2ZPH B;  2C6T B;  1E7P A;  4MIM A;  4ZGJ B;  2CCI B;  1JSU B;  2ZPI B;  1V29 B;  3X25 B;  5HNB B;  4EOL B;  2CCH B;  2KMG A;  3QXE B;  4BCF B;  4AKG A;  4OB2 B;  2QDJ A;  2ZPG B;  1GH6 B;  2IW8 B;  4EOO B;  2I40 B;  4Y72 B;  2F2C A;  4QSH A;  4F70 B;  4YOO A;  2ZPE B;  1OKW B;  2IW9 B;  3F5X B;  2UZE B;  4BCN D;  1W98 B;  4ELL A;  2BKZ B;  3TW6 A;  4CXA B;  1AHJ B;  1OKV B;  3BLH B;  1F5Q B;  1H26 B;  3POM A;  2UZB B;  3M03 A;  4ROE A;  1OGU B;  2C5V B;  1UGR B;  2WIH B;  4BBS M;  4KRD B;  3MY1 B;  3DDQ B;  4OB3 B;  4BCQ D;  4HL4 A;  2WEV B;  4KRC B;  3X24 B;  1TD6 A;  2W99 A;  2W2H A;  2EUF A;  2ZPF B;  4OB1 B;  3DL1 A;  3BG5 A;  4YC3 B;  4NST B;  2BS4 A;  2G77 A;  3BHV B;  4EOR B;  3X20 B;  2DXC B;  3KHI A;  2BS3 A;  3MI9 B;  2CZ6 B;  4BCI B;  2WHB B;  5L2W B;  3H4C A;  4F6U B;  3TN8 B;  3BG3 A;  3BLR B;  2KR6 A;  3O0G D;  1N4M A;  3QZ5 B;  3QYB A;  1H27 B;  3RGF B;  4BCH B;  3QYE A;  5BNJ B;  2DD5 B;  4EOQ B;  4F6W B;  3BHT B;  3VKH A;  4ROC A;  5DQW A;  3WVD B;  3NDQ A;  2R7G A;  4CFU B;  5LQF B;  1H1R B;  4HLQ A;  1OIY B;  2C5N B;  4EON B;  2CZ7 B;  2CZ1 B;  1QLB A;  1KXU A;  4HNU A;  2CZ0 B;  5HBH B;  2V22 B;  4BCJ B;  4F7N B;  2I53 A;  2QGS A;  2ZZD B;  1URC B;  1UGS B;  3QYH B;  1UNG D;  4FX3 B;  2PHG A;  4ZGD B;  5ACB A;  1D3U B;  1GUX B;  3DOG B;  4II5 B;  5IF1 B;  4YOS A;  4OGR B;  4F7J B;  4BCM B;  4F7S B;  5DQV A;  5EFQ B;  2PK9 B;  5HBJ B;  3QHW B;  2QF7 A;  4TTH A;  3X28 B;  1TFB A;  4EOK B;  4EOJ B;  2D0Q B;  1H24 B;  2DPP B;  5HQ0 B;  2UZD B;  4I3Z B;  2X1N B;  3VYH B;  4F6S B;  5I5Z B; 
#chains in the Genus database with same CATH homology
 2C6T B;  4OR5 B;  2C5X B;  2W9F A;  1OL1 B;  1H1Q B;  4BCN B;  3DDP B;  2CCI B;  2UZL B;  1C9B A;  1GY3 B;  1JSU B;  5IDN B;  4CRL B;  3BLR B;  1OIU B;  5CYI B;  2WPA B;  3O0G D;  5HVY B;  5IDP B;  5LMK B;  4CFM B;  1N4M A;  4EOS B;  5HNB B;  4EOL B;  4BCK B;  1H28 B;  2CCH B;  4BCF B;  4EC8 B;  2PMI B;  2WMA B;  1H27 B;  3RGF B;  4BCH B;  5BNJ B;  1ZP2 A;  2QDJ A;  2W96 A;  3MIA B;  4EOQ B;  1GH6 B;  4F6W B;  3BHT B;  2JGZ B;  2IW8 B;  4ROC A;  1AD6 A;  2WXV B;  4EOO B;  2R7G A;  1OI9 B;  2W9Z A;  4CFU B;  1AIS B;  2I40 B;  4Y72 B;  2IW6 B;  5LQF B;  3G33 B;  1H1R B;  4ELJ A;  5CEI B;  2F2C A;  4F70 B;  1OIY B;  3BHU B;  3TNH B;  3TNW B;  2C5N B;  2IVX A;  1H4L D;  1G3N C;  4YOO A;  1PKD B;  4EON B;  2WIP B;  1E9H B;  4EOP B;  4CFV B;  1OKW B;  2IW9 B;  3F5X B;  1KXU A;  2UZE B;  4UN0 A;  5HBH B;  5ICP B;  4BCN D;  1W98 B;  5FGK B;  4ELL A;  2G9X B;  2BKZ B;  4CXA B;  1VYW B;  1OKV B;  3BLH B;  2V22 B;  1F5Q B;  4BCJ B;  4EOI B;  2C5O B;  1H26 B;  1BU2 A;  3POM A;  4F7N B;  2I53 A;  1GUX A;  2B9R A;  2UZB B;  4BCQ B;  3M03 A;  1URC B;  4ROE A;  1O9K A;  3QHR B;  1VIN A;  1OGU B;  2CJM B;  3EID B;  2C5V B;  3EJ1 B;  1JOW A;  2WIH B;  4EC9 B;  2PK2 A;  4BCP B;  4KRD B;  1UNG D;  4FX3 B;  2PHG A;  3MY1 B;  5ACB A;  1D3U B;  4CFU D;  3DDQ B;  1H1S B;  4BCQ D;  1VOL A;  3K7A M;  1H1P B;  2WEV B;  2WMB B;  1GUX B;  1QMZ B;  4KRC B;  3DOG B;  4II5 B;  2W99 A;  3EOC B;  4YOS A;  5IF1 B;  2W2H A;  4OGR B;  2BPM B;  4F7J B;  4CFX B;  1P5E B;  4CFW B;  4BCM B;  4F7L B;  1UNH D;  4F7S B;  4G6L B;  2EUF A;  4ROD A;  5EFQ B;  2UUE B;  2PK9 B;  5HBJ B;  4YC3 B;  3LQ5 B;  4BCG B;  3QHW B;  4NST B;  4TTH A;  1TFB A;  4CFN B;  4EOM B;  4IMY B;  3BHV B;  4YOZ A;  4EOK B;  4BCM D;  4EOR B;  4EOJ B;  3BLQ B;  1JST B;  1H24 B;  1H25 B;  3TNI B;  5HQ0 B;  2UZD B;  3MI9 B;  2WFY B;  4I3Z B;  1XO2 A;  2X1N B;  4BCI B;  1FIN B;  2WHB B;  1O9K B;  1UNL D;  5L2W B;  3H4C A;  1FVV B;  4BCO B;  1JKW A;  3MY5 B;  1OL2 B;  4F6S B;  5I5Z B;  5HBE B;  2C4G B;  4F6U B;  3TN8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...