4KRCB

Crystal structure of pho85-pcl10-atp-gamma-s complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
188
structure length
180
Chain Sequence
ENPLLHGIPVDVPHISVDEALANFKETIELLLKLSGNNTRVEKKEYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSNRKLAASKLLLNELRSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/signaling protein
molecule keywords Cyclin-dependent protein kinase PHO85
publication title New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 180
sequence length 188
ec nomenclature
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08613 Cyclin Cyclin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4krcB00
2I53A 2WXVB 3BHUB 2C5OB 5HBEB 4F70B 1O9KA 2IW8B 4CFUD 2C5VB 1BU2A 4UN0A 2WFYB 3DDQB 4II5B 2I40B 4F6WB 2PHGA 4CFXB 4EC9B 3RGFB 2IVXA 1ZP2A 4BCND 4EOMB 5HVYB 2C5NB 4YOOA 3TNWB 4NSTB 4CFMB 4F7LB 1H25B 2UZBB 1JSTB 2PMIB 2R7GA 2WPAB 4IMYB 4BCPB 3H4CA 1AISB 3F5XB 4YOSA 4CFUB 1OL1B 2G9XB 4Y72B 1GUXB 4EC8B 2UZDB 4CFWB 4CRLB 3K7AM 2W9ZA 5HBJB 2PK9B 2V22B 1H1QB 1C9BA 4EOLB 1FINB 4EOKB 5HQ0B 1UNGD 2WHBB 4EOQB 1H4LD 3EOCB 4ELJA 2W2HA 5HBHB 1H27B 2BPMB 4EOIB 4F6SB 4F6UB 4BCMB 3EJ1B 5HNBB 1H1SB 1URCB 1H1PB 2CCIB 2C5XB 3QHRB 1N4MA 1PKDB 3O0GD 4BCMD 1D3UB 3DOGB 4RODA 4EORB 2CCHB 4I3ZB 1H24B 1UNLD 1VOLA 4BCHB 1OL2B 2WIPB 2B9RA 2C4GB 1OKWB 3TNHB 4EONB 3MY1B 4ROEA 2W9FA 5IDPB 5IF1B 1VYWB 4EOOB 3MIAB 5CYIB 4BCJB 2BKZB 3BLQB 4CXAB 3DDPB 5FGKB 3MY5B 5EFQB 2JGZB 5CEIB 2C6TB 5I5ZB 2WEVB 1UNHD 3BLRB 1AD6A 4OR5B 4TTHA 1H28B 5LMKB 1OIUB 2EUFA 4BCFB 1O9KB 1VINA 3LQ5B 3TNIB 3POMA 1P5EB 4F7NB 2UZLB 1G3NC 1H26B 1FVVB 2W99A 2UZEB 1OI9B 4BCGB 4EOJB 1OIYB 5ACBA 4OGRB 1TFBA 3QHWB 1GUXA 4CFNB 4EOSB 2CJMB 1JKWA 5IDNB 5L2WB 3BLHB 1JSUB 1H1RB 4BCQB 3TN8B 1W98B 4BCIB 1KXUA 4ROCA 3BHTB 4F7SB 1F5QB 3G33B 2PK2A 4BCNB 5BNJB 1XO2A 4BCQD 4BCOB 3EIDB 2X1NB 2WMBB 4G6LB 1QMZB 4F7JB 2UUEB 1OKVB 2QDJA 5LQFB 4EOPB 1GH6B 2F2CA 2WMAB 2IW6B 4ELLA 4KRDB 2W96A 4YOZA 1OGUB 3MI9B 2WIHB 4FX3B 1GY3B 4BCKB 3BHVB 4CFVB 1E9HB 2IW9B 1JOWA 3M03A 4KRCB 5ICPB 4YC3B
chains in the Genus database with same CATH superfamily
3X26B 4AI6A 4F70B 4CFUD 3A8LB 2ZPGB 2I40B 4ZGDB 4F6WB 2PHGA 4CFXB 5EJCA 2C5NB 4CFMB 5HVYB 4NSTB 3VKGA 2DXBB 2PMIB 4IMYB 4BCPB 3H4CA 3F5XB 4YOSA 1GUXB 2BS2A 4HL4A 2DD4B 3K7AM 2W9ZA 1C9BA 4EOLB 4EOQB 2WHBB 1H4LD 1UGPB 1H27B 2BPMB 4F6UB 5HNBB 2CZ1B 1URCB 2C5XB 3QHRB 4HNUA 4BCMD 3DOGB 4RODA 4EORB 2CCHB 3X28B 4BCHB 3VYGB 2B9RA 5CYIB 3B57A 4BCJB 2BKZB 5FGKB 1UGSB 5EFQB 5I5ZB 4MFDA 1UGRB 5LMKB 4OR5B 1H28B 4BCFB 1O9KB 3LQ5B 1G3NC 2UZEB 3HBLA 5ACBA 1ENWA 3QHWB 4EOSB 1JKWA 5L2WB 4NC6A 1JSUB 4QSHA 4BCIB 1KXUA 3A8OB 2DXCB 3X25B 4AKHA 4BCQD 1IREB 2X1NB 2WMBB 4OB3B 2QDJA 1GH6B 2LW4A 4BY1X 1OGUB 4BCKB 5IHYA 4KRCB 5ICPB 4OB2B 3BHUB 2KR6A 3WVDB 2C5VB 4UN0A 2WFYB 3RGFB 4BCND 4EOMB 2DMEA 1H25B 1JSTB 2R7GA 4MIMA 1AISB 3NDQA 2UZDB 4CRLB 3HHTB 2DD5B 2ZCFB 4OB0B 5HBJB 4EOKB 1UNGD 3EOCB 2W2HA 5HBHB 3EJ1B 3HB9A 1H1SB 4JX5A 4HNTA 1D3UB 2CZ6B 1UNLD 2BS4A 2WIPB 1OKWB 5IDPB 4OB1B 5IF1B 3MIAB 3BLQB 3DDPB 3QYEA 3MY5B 2ZPIB 3PO3S 3TW7A 1UNHD 4TTHA 1OIUB 4JX4A 1OI9B 4ZGEB 1TFBA 2IN3A 3HZJA 1H1RB 3TN8B 1AHJB 2PK2A 4HLQA 4BCNB 5BNJB 5LQFB 1UGQB 3DJBA 2IW6B 5DQVA 2IW9B 4CFUB 2KMGA 2I53A 2WXVB 5HBEB 2C5OB 3VYHB 1BU2A 3X20B 4II5B 2DPPB 1ZP2A 3QYBA 2WPAB 4BY7X 1V29B 2G9XB 4Y72B 4EC8B 4CFWB 1H1QB 5HQ0B 4ELJA 3QXEB 3BG3A 2CZ0B 4F6SB 4BCMB 1H1PB 2CCIB 1N4MA 1PKDB 4I3ZB 1H24B 1VOLA 3X24B 2G77A 3TNHB 2C4GB 2QGSA 4EONB 2CZ7B 3MY1B 4ROEA 1VYWB 4EOOB 4CXAB 2WEVB 1AD6A 2WJ9A 3BG5A 1VINA 2ZPEB 3DTOA 2UZLB 1H26B 1FVVB 2W99A 1GUXA 4CFNB 2CJMB 3BLHB 4AKIA 4BCQB 1W98B 2ZZDB 4F7SB 3WVEB 3QYGB 1TD6A 1F5QB 3G33B 1XO2A 4BCOB 4G6LB 1QMZB 2UUEB 1OKVB 2D0QB 4ZGJB 2WMAB 2W96A 4YOZA 3MI9B 3QWLA 3BHVB 3M03A 1O9KA 2IW8B 1FKMA 4M6VA 3DDQB 2QFZA 3DL1A 1E7PA 4EC9B 2IVXA 4BBRM 4HNVA 4YOOA 3TNWB 4F7LB 2UZBB 3BG9A 3HO8A 3A8GB 1OL1B 4BXXX 3TW6A 2BS3A 2QQ8A 4JX6A 2ZPFB 2PK9B 2V22B 1FINB 3GTMS 4EOIB 3O0GD 2PJQA 4LOCA 3VKHA 2QDYB 1OL2B 4AKGA 3QZ9B 2W9FA 5DQWA 1QLBA 2CYZB 2JGZB 2C6TB 5CEIB 3BLRB 3QZ5B 2QF7A 2EUFA 3TNIB 3POMA 1P5EB 4F7NB 4BCGB 4EOJB 1OIYB 4OGRB 3KHIA 4MFEA 5IDNB 2AHJB 4FM4B 4ROCA 3BHTB 4Z6YA 3EIDB 4F7JB 4EOPB 4BBSM 2F2CA 3A8HB 4ELLA 4KRDB 4FX3B 2WIHB 1GY3B 4CFVB 1E9HB 1JOWA 2ZPBB 2ZPHB 3QYHB 3A8MB 4YC3B
chains in the Genus database with same CATH topology
2I53A 2WXVB 3BHUB 2C5OB 5HBEB 4F70B 1O9KA 2IW8B 4CFUD 2C5VB 1BU2A 4UN0A 2WFYB 3DDQB 4II5B 2I40B 4F6WB 2PHGA 4CFXB 4EC9B 3RGFB 2IVXA 1ZP2A 4BCND 4EOMB 5HVYB 2C5NB 4YOOA 3TNWB 4NSTB 4CFMB 4F7LB 1H25B 2UZBB 1JSTB 2PMIB 2R7GA 2WPAB 4IMYB 4BCPB 3H4CA 1AISB 3F5XB 4YOSA 4CFUB 1OL1B 2G9XB 4Y72B 1GUXB 4EC8B 2UZDB 4CFWB 4CRLB 3K7AM 2W9ZA 5HBJB 2PK9B 2V22B 1H1QB 1C9BA 4EOLB 1FINB 4EOKB 5HQ0B 1UNGD 2WHBB 4EOQB 1H4LD 3EOCB 4ELJA 2W2HA 5HBHB 1H27B 2BPMB 4EOIB 4F6SB 4F6UB 4BCMB 3EJ1B 5HNBB 1H1SB 1URCB 1H1PB 2CCIB 2C5XB 3QHRB 1N4MA 1PKDB 3O0GD 4BCMD 1D3UB 3DOGB 4RODA 4EORB 2CCHB 4I3ZB 1H24B 1UNLD 1VOLA 4BCHB 1OL2B 2WIPB 2B9RA 2C4GB 1OKWB 3TNHB 4EONB 3MY1B 4ROEA 2W9FA 5IDPB 5IF1B 1VYWB 4EOOB 3MIAB 5CYIB 4BCJB 2BKZB 3BLQB 4CXAB 3DDPB 5FGKB 3MY5B 5EFQB 2JGZB 5CEIB 2C6TB 5I5ZB 2WEVB 1UNHD 3BLRB 1AD6A 4OR5B 4TTHA 1H28B 5LMKB 1OIUB 2EUFA 4BCFB 1O9KB 1VINA 3LQ5B 3TNIB 3POMA 1P5EB 4F7NB 2UZLB 1G3NC 1H26B 1FVVB 2W99A 2UZEB 1OI9B 4BCGB 4EOJB 1OIYB 5ACBA 4OGRB 1TFBA 3QHWB 1GUXA 4CFNB 4EOSB 2CJMB 1JKWA 5IDNB 5L2WB 3BLHB 1JSUB 1H1RB 4BCQB 3TN8B 1W98B 4BCIB 1KXUA 4ROCA 3BHTB 4F7SB 1F5QB 3G33B 2PK2A 4BCNB 5BNJB 1XO2A 4BCQD 4BCOB 3EIDB 2X1NB 2WMBB 4G6LB 1QMZB 4F7JB 2UUEB 1OKVB 2QDJA 5LQFB 4EOPB 1GH6B 2F2CA 2WMAB 2IW6B 4ELLA 4KRDB 2W96A 4YOZA 1OGUB 3MI9B 2WIHB 4FX3B 1GY3B 4BCKB 3BHVB 4CFVB 1E9HB 2IW9B 1JOWA 3M03A 4KRCB 5ICPB 4YC3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I53 A;  2WXV B;  3BHU B;  2C5O B;  5HBE B;  4F70 B;  1O9K A;  2IW8 B;  4CFU D;  2C5V B;  1BU2 A;  4UN0 A;  2WFY B;  3DDQ B;  4II5 B;  2I40 B;  4F6W B;  2PHG A;  4CFX B;  4EC9 B;  3RGF B;  2IVX A;  1ZP2 A;  4BCN D;  4EOM B;  5HVY B;  2C5N B;  4YOO A;  3TNW B;  4NST B;  4CFM B;  4F7L B;  1H25 B;  2UZB B;  1JST B;  2PMI B;  2R7G A;  2WPA B;  4IMY B;  4BCP B;  3H4C A;  1AIS B;  3F5X B;  4YOS A;  4CFU B;  1OL1 B;  2G9X B;  4Y72 B;  1GUX B;  4EC8 B;  2UZD B;  4CFW B;  4CRL B;  3K7A M;  2W9Z A;  5HBJ B;  2PK9 B;  2V22 B;  1H1Q B;  1C9B A;  4EOL B;  1FIN B;  4EOK B;  5HQ0 B;  1UNG D;  2WHB B;  4EOQ B;  1H4L D;  3EOC B;  4ELJ A;  2W2H A;  5HBH B;  1H27 B;  2BPM B;  4EOI B;  4F6S B;  4F6U B;  4BCM B;  3EJ1 B;  5HNB B;  1H1S B;  1URC B;  1H1P B;  2CCI B;  2C5X B;  3QHR B;  1N4M A;  1PKD B;  3O0G D;  4BCM D;  1D3U B;  3DOG B;  4ROD A;  4EOR B;  2CCH B;  4I3Z B;  1H24 B;  1UNL D;  1VOL A;  4BCH B;  1OL2 B;  2WIP B;  2B9R A;  2C4G B;  1OKW B;  3TNH B;  4EON B;  3MY1 B;  4ROE A;  2W9F A;  5IDP B;  5IF1 B;  1VYW B;  4EOO B;  3MIA B;  5CYI B;  4BCJ B;  2BKZ B;  3BLQ B;  4CXA B;  3DDP B;  5FGK B;  3MY5 B;  5EFQ B;  2JGZ B;  5CEI B;  2C6T B;  5I5Z B;  2WEV B;  1UNH D;  3BLR B;  1AD6 A;  4OR5 B;  4TTH A;  1H28 B;  5LMK B;  1OIU B;  2EUF A;  4BCF B;  1O9K B;  1VIN A;  3LQ5 B;  3TNI B;  3POM A;  1P5E B;  4F7N B;  2UZL B;  1G3N C;  1H26 B;  1FVV B;  2W99 A;  2UZE B;  1OI9 B;  4BCG B;  4EOJ B;  1OIY B;  5ACB A;  4OGR B;  1TFB A;  3QHW B;  1GUX A;  4CFN B;  4EOS B;  2CJM B;  1JKW A;  5IDN B;  5L2W B;  3BLH B;  1JSU B;  1H1R B;  4BCQ B;  3TN8 B;  1W98 B;  4BCI B;  1KXU A;  4ROC A;  3BHT B;  4F7S B;  1F5Q B;  3G33 B;  2PK2 A;  4BCN B;  5BNJ B;  1XO2 A;  4BCQ D;  4BCO B;  3EID B;  2X1N B;  2WMB B;  4G6L B;  1QMZ B;  4F7J B;  2UUE B;  1OKV B;  2QDJ A;  5LQF B;  4EOP B;  1GH6 B;  2F2C A;  2WMA B;  2IW6 B;  4ELL A;  4KRD B;  2W96 A;  4YOZ A;  1OGU B;  3MI9 B;  2WIH B;  4FX3 B;  1GY3 B;  4BCK B;  3BHV B;  4CFV B;  1E9H B;  2IW9 B;  1JOW A;  3M03 A;  4KRC B;  5ICP B;  4YC3 B; 
#chains in the Genus database with same CATH topology
 3X26 B;  4AI6 A;  4F70 B;  4CFU D;  3A8L B;  2ZPG B;  2I40 B;  4ZGD B;  4F6W B;  2PHG A;  4CFX B;  5EJC A;  2C5N B;  4CFM B;  5HVY B;  4NST B;  3VKG A;  2DXB B;  2PMI B;  4IMY B;  4BCP B;  3H4C A;  3F5X B;  4YOS A;  1GUX B;  2BS2 A;  4HL4 A;  2DD4 B;  3K7A M;  2W9Z A;  1C9B A;  4EOL B;  4EOQ B;  2WHB B;  1H4L D;  1UGP B;  1H27 B;  2BPM B;  4F6U B;  5HNB B;  2CZ1 B;  1URC B;  2C5X B;  3QHR B;  4HNU A;  4BCM D;  3DOG B;  4ROD A;  4EOR B;  2CCH B;  3X28 B;  4BCH B;  3VYG B;  2B9R A;  5CYI B;  3B57 A;  4BCJ B;  2BKZ B;  5FGK B;  1UGS B;  5EFQ B;  5I5Z B;  4MFD A;  1UGR B;  5LMK B;  4OR5 B;  1H28 B;  4BCF B;  1O9K B;  3LQ5 B;  1G3N C;  2UZE B;  3HBL A;  5ACB A;  1ENW A;  3QHW B;  4EOS B;  1JKW A;  5L2W B;  4NC6 A;  1JSU B;  4QSH A;  4BCI B;  1KXU A;  3A8O B;  2DXC B;  3X25 B;  4AKH A;  4BCQ D;  1IRE B;  2X1N B;  2WMB B;  4OB3 B;  2QDJ A;  1GH6 B;  2LW4 A;  4BY1 X;  1OGU B;  4BCK B;  5IHY A;  4KRC B;  5ICP B;  4OB2 B;  3BHU B;  2KR6 A;  3WVD B;  2C5V B;  4UN0 A;  2WFY B;  3RGF B;  4BCN D;  4EOM B;  2DME A;  1H25 B;  1JST B;  2R7G A;  4MIM A;  1AIS B;  3NDQ A;  2UZD B;  4CRL B;  3HHT B;  2DD5 B;  2ZCF B;  4OB0 B;  5HBJ B;  4EOK B;  1UNG D;  3EOC B;  2W2H A;  5HBH B;  3EJ1 B;  3HB9 A;  1H1S B;  4JX5 A;  4HNT A;  1D3U B;  2CZ6 B;  1UNL D;  2BS4 A;  2WIP B;  1OKW B;  5IDP B;  4OB1 B;  5IF1 B;  3MIA B;  3BLQ B;  3DDP B;  3QYE A;  3MY5 B;  2ZPI B;  3PO3 S;  3TW7 A;  1UNH D;  4TTH A;  1OIU B;  4JX4 A;  1OI9 B;  4ZGE B;  1TFB A;  2IN3 A;  3HZJ A;  1H1R B;  3TN8 B;  1AHJ B;  2PK2 A;  4HLQ A;  4BCN B;  5BNJ B;  5LQF B;  1UGQ B;  3DJB A;  2IW6 B;  5DQV A;  2IW9 B;  4CFU B;  2KMG A;  2I53 A;  2WXV B;  5HBE B;  2C5O B;  3VYH B;  1BU2 A;  3X20 B;  4II5 B;  2DPP B;  1ZP2 A;  3QYB A;  2WPA B;  4BY7 X;  1V29 B;  2G9X B;  4Y72 B;  4EC8 B;  4CFW B;  1H1Q B;  5HQ0 B;  4ELJ A;  3QXE B;  3BG3 A;  2CZ0 B;  4F6S B;  4BCM B;  1H1P B;  2CCI B;  1N4M A;  1PKD B;  4I3Z B;  1H24 B;  1VOL A;  3X24 B;  2G77 A;  3TNH B;  2C4G B;  2QGS A;  4EON B;  2CZ7 B;  3MY1 B;  4ROE A;  1VYW B;  4EOO B;  4CXA B;  2WEV B;  1AD6 A;  2WJ9 A;  3BG5 A;  1VIN A;  2ZPE B;  3DTO A;  2UZL B;  1H26 B;  1FVV B;  2W99 A;  1GUX A;  4CFN B;  2CJM B;  3BLH B;  4AKI A;  4BCQ B;  1W98 B;  2ZZD B;  4F7S B;  3WVE B;  3QYG B;  1TD6 A;  1F5Q B;  3G33 B;  1XO2 A;  4BCO B;  4G6L B;  1QMZ B;  2UUE B;  1OKV B;  2D0Q B;  4ZGJ B;  2WMA B;  2W96 A;  4YOZ A;  3MI9 B;  3QWL A;  3BHV B;  3M03 A;  1O9K A;  2IW8 B;  1FKM A;  4M6V A;  3DDQ B;  2QFZ A;  3DL1 A;  1E7P A;  4EC9 B;  2IVX A;  4BBR M;  4HNV A;  4YOO A;  3TNW B;  4F7L B;  2UZB B;  3BG9 A;  3HO8 A;  3A8G B;  1OL1 B;  4BXX X;  3TW6 A;  2BS3 A;  2QQ8 A;  4JX6 A;  2ZPF B;  2PK9 B;  2V22 B;  1FIN B;  3GTM S;  4EOI B;  3O0G D;  2PJQ A;  4LOC A;  3VKH A;  2QDY B;  1OL2 B;  4AKG A;  3QZ9 B;  2W9F A;  5DQW A;  1QLB A;  2CYZ B;  2JGZ B;  2C6T B;  5CEI B;  3BLR B;  3QZ5 B;  2QF7 A;  2EUF A;  3TNI B;  3POM A;  1P5E B;  4F7N B;  4BCG B;  4EOJ B;  1OIY B;  4OGR B;  3KHI A;  4MFE A;  5IDN B;  2AHJ B;  4FM4 B;  4ROC A;  3BHT B;  4Z6Y A;  3EID B;  4F7J B;  4EOP B;  4BBS M;  2F2C A;  3A8H B;  4ELL A;  4KRD B;  4FX3 B;  2WIH B;  1GY3 B;  4CFV B;  1E9H B;  1JOW A;  2ZPB B;  2ZPH B;  3QYH B;  3A8M B;  4YC3 B; 
#chains in the Genus database with same CATH homology
 2I53 A;  2WXV B;  3BHU B;  2C5O B;  5HBE B;  4F70 B;  1O9K A;  2IW8 B;  4CFU D;  2C5V B;  1BU2 A;  4UN0 A;  2WFY B;  3DDQ B;  4II5 B;  2I40 B;  4F6W B;  2PHG A;  4CFX B;  4EC9 B;  3RGF B;  2IVX A;  1ZP2 A;  4BCN D;  4EOM B;  5HVY B;  2C5N B;  4YOO A;  3TNW B;  4NST B;  4CFM B;  4F7L B;  1H25 B;  2UZB B;  1JST B;  2PMI B;  2R7G A;  2WPA B;  4IMY B;  4BCP B;  3H4C A;  1AIS B;  3F5X B;  4YOS A;  4CFU B;  1OL1 B;  2G9X B;  4Y72 B;  1GUX B;  4EC8 B;  2UZD B;  4CFW B;  4CRL B;  3K7A M;  2W9Z A;  5HBJ B;  2PK9 B;  2V22 B;  1H1Q B;  1C9B A;  4EOL B;  1FIN B;  4EOK B;  5HQ0 B;  1UNG D;  2WHB B;  4EOQ B;  1H4L D;  3EOC B;  4ELJ A;  2W2H A;  5HBH B;  1H27 B;  2BPM B;  4EOI B;  4F6S B;  4F6U B;  4BCM B;  3EJ1 B;  5HNB B;  1H1S B;  1URC B;  1H1P B;  2CCI B;  2C5X B;  3QHR B;  1N4M A;  1PKD B;  3O0G D;  4BCM D;  1D3U B;  3DOG B;  4ROD A;  4EOR B;  2CCH B;  4I3Z B;  1H24 B;  1UNL D;  1VOL A;  4BCH B;  1OL2 B;  2WIP B;  2B9R A;  2C4G B;  1OKW B;  3TNH B;  4EON B;  3MY1 B;  4ROE A;  2W9F A;  5IDP B;  5IF1 B;  1VYW B;  4EOO B;  3MIA B;  5CYI B;  4BCJ B;  2BKZ B;  3BLQ B;  4CXA B;  3DDP B;  5FGK B;  3MY5 B;  5EFQ B;  2JGZ B;  5CEI B;  2C6T B;  5I5Z B;  2WEV B;  1UNH D;  3BLR B;  1AD6 A;  4OR5 B;  4TTH A;  1H28 B;  5LMK B;  1OIU B;  2EUF A;  4BCF B;  1O9K B;  1VIN A;  3LQ5 B;  3TNI B;  3POM A;  1P5E B;  4F7N B;  2UZL B;  1G3N C;  1H26 B;  1FVV B;  2W99 A;  2UZE B;  1OI9 B;  4BCG B;  4EOJ B;  1OIY B;  5ACB A;  4OGR B;  1TFB A;  3QHW B;  1GUX A;  4CFN B;  4EOS B;  2CJM B;  1JKW A;  5IDN B;  5L2W B;  3BLH B;  1JSU B;  1H1R B;  4BCQ B;  3TN8 B;  1W98 B;  4BCI B;  1KXU A;  4ROC A;  3BHT B;  4F7S B;  1F5Q B;  3G33 B;  2PK2 A;  4BCN B;  5BNJ B;  1XO2 A;  4BCQ D;  4BCO B;  3EID B;  2X1N B;  2WMB B;  4G6L B;  1QMZ B;  4F7J B;  2UUE B;  1OKV B;  2QDJ A;  5LQF B;  4EOP B;  1GH6 B;  2F2C A;  2WMA B;  2IW6 B;  4ELL A;  4KRD B;  2W96 A;  4YOZ A;  1OGU B;  3MI9 B;  2WIH B;  4FX3 B;  1GY3 B;  4BCK B;  3BHV B;  4CFV B;  1E9H B;  2IW9 B;  1JOW A;  3M03 A;  4KRC B;  5ICP B;  4YC3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...