3X20B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 25 min
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x20B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x20B02
2ZPIB 2PVGB 2AHJB 1UGSB 2DD4B 3VYGB 3QYHB 3A8MB 1UGRB 3X25B 1V29B 2ZPFB 3WVDB 2DD5A 2ZCFB 3A8LB 4ZGJB 3X26B 3QZ5B 2ZZDB 4ZGEB 3A8OB 4ZGDB 4OB2B 2WSCE 4XK8E 4RKUE 2CZ1B 1IREB 2ZPHB 1UGQB 2WSFE 2PUKB 4FM4B 1DJ7B 3X24B 2PVDB 2ZPBB 3X28B 4Y28E 2ZPGB 2DPPB 2QDYB 2PUOB 1UGPB 1QP3A 1AHJB 2DXBA 2O01E 2PVOB 2CZ6B 5L8RE 1QP2A 2DXCA 3HHTB 1JB0E 4KT0E 2CZ0B 2CYZB 4OB3B 2ZPEB 2D0QB 3WVEB 3A8HB 3LW5E 2DD5B 2DD4A 3VYGA 1GXIE 3QXEB 2WSEE 4OB0B 2PU9B 4L6V5 1PSEA 2DXBB 1PSFA 4OB1B 3QZ9B 2ZZDA 3X20B 2CZ7B 3A8GB 2DXCB 3VYHB 3QYGB
chains in the Genus database with same CATH superfamily
2ED1A 2R5MA 2DD4B 1YHQA 1BCMA 5KYUB 2UZEB 1M4ZA 5BNJB 3WVDB 1RAEB 2EAYA 2PNIA 4L59A 1Q81C 4PLLA 5I2MA 2C0IA 3BY7A 2DJZA 3NTIA 5DM7R 2DZ9A 2RD1A 1EZZB 2DE0X 5FW9A 2OJ2A 3MO8A 4M6VA 1Q7YR 1BBZA 2MI6A 4RKUE 4KULA 2CZ1B 4PJOD 2DYIA 1HSQA 3FJPA 1MUZA 2RQWA 4FYXB 2PUKB 4BB7A 5J3BA 1H28B 4DBHA 3MEVA 5IHKA 2QDYB 4BCQD 2DEQA 5LJ3j 4JS4A 1YCYA 1OZ3A 2CS7A 2XDBA 1GRIA 3VRZA 1X2QA 1IO6A 1UEBA 4PK4A 2HEQA 2OTLT 3BLHB 2QDLA 4KGZB 3VJPA 3CCUT 3OMCA 2P0QA 4CFMB 5CKEA 2XK0A 4BDZA 5FRNA 4PFZA 1KC8U 1H1QB 3QUIA 2V26A 4M7AA 2VYTA 2RHIA 4JRPA 3OYGA 2C5VB 5CVIA 1OI1A 1BIAA 4XTUA 4EC8B 3MI9B 2QA4Q 2W9FA 4EOKB 3M4YA 4C8QE 2E65A 1X6GA 1WJQA 4YTLA 1ACMB 1NLPC 4Z02A 3VKHA 2PZ1A 4JJDA 4PNOA 1VQKT 1KG1A 4BY1X 4C0FA 1TWBA 2F69A 1M8MA 3MIAB 1EX4A 1F5QB 1JSTB 1ZUKA 4F14A 4AFZC 1OI9B 1K9AA 1JU5C 2Z0WA 2CZ7B 4BACA 1QVFA 4IURA 4OVAA 1X01A 4HCZA 2YUQA 3THKA 1TH7A 2QQ9A 3J7AF 3JCMd 1K76A 2AHJB 1PCXA 3QHSA 1I1JA 2Y90A 1Z9QA 3CC4T 3VRYA 3CCMT 1ABOA 2DIQA 1UGRB 4F04B 1OX8A 4RTXA 3CCST 3WXMB 2EGAA 1UHFA 4HCBA 3VS1A 1VQ8T 3FEOA 1VQ4A 1QKXA 2L3QA 4XU1A 1RI0A 3HB9A 4M7DB 2OTJA 2D9TA 4X9CA 4OB2B 5GANj 5EC7A 2K57A 3Q1JA 2PK9B 3JCMQ 5IHIA 1D3BB 2DYBA 2ZPHB 2L2PA 3MCAB 1WHJA 3SEMA 2BZ8A 1DJ7B 4X34A 3OSSC 1H3HA 4GBQA 2CCIB 3VKGA 4PFPA 3JCMc 3E9FA 2LQKA 3V7CA 3CMAA 2K4YA 2B9RA 2LC4A 3RNJA 1O75A 3M0PA 1VQNT 1SSHA 1VQ5T 3FB9A 5CR2A 4A4EA 1KQSP 2HL5C 3EJ1B 5LJ5f 2W0ZA 3MEAA 2V1RA 3CC7Q 2DXCA 1LVKA 4HVVA 4M7DA 2QQ8A 1I5LA 4PJJA 4JJBA 5FU6B 1SG5A 1OIYB 4F6SB 3EG0A 2FRWA 4EOMB 1TTHB 5LL6S 4FW1A 2EJGA 3BHTB 2DD5B 1NBEB 4E7IA 1V1CA 2YSQA 4E7JA 1WI7A 5KYXA 2MIOA 3OW2P 3BHVB 1W1FA 1KSWA 3QHRB 4OMLA 5FWCA 3CCVQ 4AFQC 2GGRA 3I9QA 4XTXA 3EGXB 3CEYA 1M1FA 4EIKA 3QDFA 2V8KA 2KMTA 3O8VA 3JB9F 4AG2C 3A1PA 1VQOT 1ABQA 3TNHB 2BS3A 1MV3A 3CBMA 1K8AC 1H25B 1WHHA 1XNIA 1H3ZA 2FVUA 2QFZA 5GAMd 3CC2Q 4PLIA 3EG3A 3AT1B 4BCMD 2RB6A 4KH0B 3V7RA 4J83A 3A8MB 2KY9A 4RG8A 4M78C 2K9GA 2WPAB 2JGZB 2HQEA 2DD5A 1MNDA 1WA7A 3TW7A 1Y71A 3OS0A 2KQWA 1PRLC 3HRUA 1MNEA 4CC7A 4AT1B 2WSCE 3EFSA 3DTOA 1K0SA 4EMKC 5L2WB 1IREB 4Y91A 1YWOA 1OIUB 1VQ7A 4LNPA 3MHXA 1MHNA 2JN0A 1VQLT 1N27A 4EOQB 1M90U 2RQUA 1X6BA 3HP9A 2RI2A 2HZYA 2K6DA 2DTOA 2LDMA 2PUOB 1X27A 1YFNA 3G6EA 3LLRA 2JTMA 1ZSZB 2H8HA 2O01E 5HCKA 1M1GA 1JOWA 4IUPA 1IHWA 4NC6A 3VV0A 1QP2A 2LTOA 2WXVB 5IF1B 5GANe 4MZMA 4J9IA 1S72T 3CMEA 1OU9A 4M75A 1M90C 1YWPA 3L2QA 4OB3B 1GUXB 1I5OB 1OQKA 2FPFA 4CFNB 2L3RA 4M78G 3A8HB 3M57A 4CFWB 2J06A 3VYGA 4AMCA 1VQ6T 4PJNA 3SFMA 1QCOA 3CCJT 1YJWT 2X4WA 2R5AA 5LJ3h 4R0KA 4C5IA 1Q86U 2F5KA 4WCIA 4OB1B 1B7TA 2XDDA 3JB9J 1FYNA 2JXBA 2C4GB 1U06A 3LQ5B 2KRSA 2YRDA 3C95A 2FZKB 3GBQA 4HVWA 1TD6A 2P0KA 1ZSZA 1YJNT 3EG2A 2C6TB 4JJCA 2RQVA 2J7IA 1KK7A 2XKOC 3EHQA 3CCRA 3KHIA 3MPUB 1D1AA 5IDNB 2QTXA 1WXTA 1FVVB 1YIJA 2E4HA 1E9HB 4RCCA 3G71A 4C5HA 1A0NB 4M77C 2RJFA 3DDPB 4BUGA 1X2KA 3RIRA 4KRCB 3P8DA 3X26B 2KYMA 2YUNA 5C0MA 2F2WA 1RLQC 5CAIA 5D6YA 1OZ2A 4A54A 3CCLA 1RADB 1BKBA 1E7PA 2AK5A 1Q82C 1N8RC 3G4SQ 2DXUA 4A4GA 3R6OA 4PL6A 5GAN6 2EGCA 4M4ZA 3TSZA 3PVQA 3SHWA 3PT9A 4RODA 2QF7A 4F7LB 2BTTA 5GJVB 4CFUD 1VQPA 1VQMA 2COWA 3C0CA 1NE8A 2HBPA 3VUBA 4KRTA 1WDXA 3CCQT 1VUBA 4XTZA 4ELLA 4C5GA 4PJOC 2G9XB 1JKWA 3CCEA 5GAOl 3N5BB 4OMOA 4C92C 1ZLMA 3T9NA 1YITT 2EFIA 2DL5A 1GCPA 2WJ9A 2CZ6B 5GANh 1RAGB 3S6WA 3DJBA 5GAN7 5IXBA 1QVGP 3I55A 3L1AA 4J9CA 3HHTB 5I21A 3LX7A 1VQ9T 2A08A 2O88A 2CZ0B 1SSFA 2CYZB 2HKQB 3RMQA 2EYXA 2NLUA 5IHYA 3EH1A 5GMKm 2WIPB 2G3RA 2A7YA 2CSQA 3RKYA 3OBYA 1G3TA 1XJWB 4GY5A 2NUTB 5AYFA 1QMZB 4M77G 2OI3A 3FLGA 1QVPA 4OB0B 1RUWA 2KE9A 2J6FA 4F7UG 3BFMA 5I2SA 1NYGA 1M9SA 2F2XA 3JCMP 2LCLA 2RMOA 5I22A 5HVYB 2L89A 1D3UB 5LJ3d 1Y96A 2DZCA 3FC3A 3META 4BCOB 1AWWA 3OYCA 1KQSS 1M2VB 4FT4A 2MYSA 3NDQA 1AWJA 3L2RA 5FRMA 3PVLA 4TTHA 3QDRB 1IXDA 2DETA 1TXQA 1QLBA 4EONB 5A2QE 1KIKA 1G8XA 1UFFA 2VB6A 3QHWB 2QQRA 2XMFA 4PFOA 4PJOG 2OTLA 4M7AD 4JUVA 1WHLA 2FYKA 3CCUA 4X9DA 4C92G 4EDUA 1E6HA 4BCFB 2KT1A 3BHUB 2LX7A 1GFDA 1GH6B 1VOMA 2KVQG 3OW2S 2LJ3A 3JCMe 3OYFA 4M78F 3SWNC 4ZGEB 4N0AC 2PMIB 4L5GA 4XTVA 4HKEA 1BI2A 4C0DC 1MGQA 3MY5B 2DBKA 2HQXA 2ROLA 4N4GA 4BCJB 4C0ZA 5IN1A 1C9BA 5GAOn 2O4XB 1Y57A 4EMGA 4FM4B 4BCNB 2CP7A 2AZSA 3GLXA 1AZGB 1VQKA 1M3CA 2LNVA 1B34B 3M55A 4CC2A 1ZBXA 4UN0A 4MMLA 5LJ5j 1OL2B 3QKJA 1AHJB 4ANJA 3QG1A 1WLPB 5EJCA 3BG3A 2HD0A 1JQQA 2YDLA 4C8QC 2QTVA 1SHFA 4M77E 5CO7A 5HY6A 3CC4A 4FU6A 3CCMA 2K2MA 3EGDB 4F7UE 4JLGA 1Y0MA 3VS7A 4F16A 5KCOA 4HT9A 2LT4A 3CCSA 2H3JA 2D0QB 3L2UA 9ATCB 2WIHB 1VQ8A 5ACBA 2F2VA 3S3OA 1MV0B 4J6XA 5C6SA 2QAZA 3F70A 2DXBB 4F7JB 3G71T 4Q5WA 3M59A 3KFVA 1GCQA 5GAN2 1OOTA 2BIVA 3A98A 2GTJA 1QW1A 4RTZA 3RMSA 4PJOE 2KRNA 3EG9B 4UC4A 2M0YA 3VYHB 1PHTA 3HO8A 2HNIA 1M1KU 4ELJA 3QWLA 4J9HA 4QT7A 4EORB 2CP6A 3NGPA 1VQNA 2V8JA 2M16A 3DLMA 2QQAA 3O5ZA 2DNUA 4M7DD 1Q81U 2VC8A 3VKIA 1W98B 1M5Q1 3JCMh 4C8QG 1YJ9Q 4ZGJB 2JMCA 5GAMe 3CCET 2EUFA 1RAHB 1AZEA 3OYIA 2E6ZA 1NJIC 2L5QA 3CXCS 5J39A 4M77F 3TQ7P 2KSSA 3I55T 4BI8B 4BBSM 4DOWA 4F7UF 2P84A 5CIUA 1QWEA 2A28A 2WSFE 2DERA 4RTWA 1NM7A 4EOSB 3E1SA 1MMNA 2CDTA 2ZPBB 4ZN3A 1K1ZA 1W2BA 4LUDA 4EOPB 2HSPA 2C0TA 2M02A 1RAFB 2QEXQ 2DPPB 1VQOA 5HBEB 2DM1A 3GOXA 3ME9A 4BCPB 5KYYA 2WEVB 4JX6A 3HRSA 4ATOA 3I35A 1BU1A 1YHQQ 2IG0A 1LJOA 4BDYA 3JCMJ 1D09B 1R8OB 2DRMA 1M1KR 2D0NA 4PJOF 2DXTA 2RN8A 3JB9G 3OYEA 3ASKA 4J7FA 2UZDB 4C92F 4RMOA 2KYBA 3C94A 2DMOA 2GBQA 4MMKA 1Q81R 4M78B 2DD4A 2GTOA 5KYUA 1UNLD 2IW8B 1HD3A 3JAME 3MEWA 1M30A 1VYVA 2VGMA 5IXFA 1UHCA 1YN8A 2FL7A 5HK3A 1BI3A 2DK3A 2PHGA 2A3LA 5HBJB 3A8GB 5I11A 3VS0A 1H1SB 4EMKB 1VQLA 3JCMX 2EYZA 2P4TA 3NFCA 1UE9A 4LD6A 1QVGS 5CCAA 2DL7A 1OU8A 4FSSA 5A0DA 1G3WA 1V29B 3H0HA 3V8JA 4ME7A 4CFXB 3CPWP 1ZA2B 1J3TA 3QBYA 3GPLA 1JJ2S 4M75D 5GAMh 3UA6A 2DIGA 2IW9B 1S72A 1CSKA 3RR6A 3TU4K 4LOCA 2DA9A 3LGLA 4KUDK 4LN2A 1VQ6A 1PD0A 3FJ5A 3RKXA 3CCJA 4B9XA 5LJ3g 1YJWA 1HYOA 4RUGA 3CQTA 1ZP2A 2PVDB 1EFNA 2XDPA 1B3QA 4DEYA 1KXUA 1JJ2A 1B07A 3HTRA 3EGUA 2JM9A 4XU2A 1AVZC 1KC8R 3ZEHA 2DFUA 2W99A 4ORZA 1YJNA 2KRMA 1QCFA 2C06A 2K3BA 1TG0A 2CGHA 2X4XA 1H8KA 2KXDA 3I56T 1NYFA 1Y7XA 2MWOA 5GAOp 1VQ4Q 2QDJA 5J26A 5FWBA 1YI2T 1NLOC 5KCHA 4C8QF 2OTJQ 3GTMS 3EFRA 3CD6T 3D7SB 2JOYA 4CRIA 5D7UA 1QMCA 2XIDA 3UPUA 2KT8A 1G2BA 1IHVA 4M77B 5LJ5h 4JX4A 2G6FX 3DDQB 4F7UB 1RACB 2EPDA 4EOIB 1C1AA 1NEGA 1KQ2A 2HMAA 5CKFA 3JB9I 1CKBA 2J6KA 3CMAQ 4KUIA 1WNLA 3H4CA 2XI9A 3OS1A 1QLYA 1K8AU 4A4HA 1GBQA 2OAWA 2LQNA 1D3BA 1HK9A 1C0MA 1K73C 2R58A 1M3AA 3TNIB 3CCQA 2OAUA 1WX6A 5DY9A 2GFUA 3TNWB 3L2VA 3EOCB 5IHNA 3X25B 2VXFA 5LJ3e 1YITA 5GANg 4PJOB 4D6WA 2RM4A 1V76A 4C92B 2HQHA 2ZZDB 3O0GD 1QKWA 1VQ9A 2RHZA 3BE3A 4RTTA 2RF0A 1GFCA 1PKTA 4CXAB 4OMNA 2A37A 8ATCB 1WQ7A 4M7AC 2VASA 5IAYA 5M9OA 2CKKA 2KR3A 2DILA 1H4LD 1NPRA 4JRKA 2RA2A 5CQYA 5CKDA 3GNFB 4LE9A 4AKGA 2MWPA 3TN8B 3UWNA 3OYBA 1UNGD 2RJDA 1F1BB 2GFAA 1K9MC 1C6VX 3EGXA 2HSEB 1WYXA 4LDWA 1K8AR 3DKMA 4ELYC 4KRDB 4FSXA 3OQ5A 1MMAA 3LH0A 1WHMA 2QA4T 3JCMb 4E6RA 4AKHA 4ZN1A 2P0PA 3OYMA 1KJWA 1M8VA 2RI3A 5KYWB 1BK2A 4C0GA 1PKDB 1FMKA 2DL4A 4DA4A 4XU0A 3VS2A 4HNUA 1PWTA 1T3SA 2RQTA 2FHDA 1FXXA 2C5NB 1VQ7Q 4BCGB 3H0FA 4Y92A 1SEMA 3SWNB 2RK2A 2MPXC 5LJ5d 4M7AG 1VINA 5GAN5 3POMA 1FMWA 2AIRB 3GF5A 4C0DB 2JTFA 4CC3A 3FRNA 1KD1C 2MF2A 2M0OA 3G6EQ 3VU3C 2B86A 3QSUA 1PD1A 1UECA 2EYWA 4A53A 4HVUA 4RTVA 1AWXA 2PQWA 4BY6B 1D0YA 2P4RA 2PTKA 3PGGA 3R6NA 4XU3A 3NTHA 1BIBA 4LD9K 1U8RA 2CSIA 3CMEQ 5LQFB 3LH5A 3M58A 4YOZA 4N4IA 1JSUB 4Z89A 2VVKA 3M53A 4IUQA 3KXTA 1GL5A 1XTDA 5FROA 4C8QB 2RHUA 1D1CA 4F7SB 3E19A 1P5EB 4BCND 1M90R 4NL2A 3QYEA 2ABLA 2AKKA 2DVEA 4J6WA 1N6AA 1VA7A 2DLPA 3H41A 1KHIA 4BXXX 3UATA 4B9WA 1Q82U 4M7DC 1N8RU 1UGQB 2K5FA 2X9HA 3P8BB 1X43A 1GUXA 4JX5A 3EAEA 3NMZC 1GY3B 5GMKj 3SD4A 4WF2A 1UGPB 4I3ZB 3RDVA 3CCRQ 1AWOA 3CC7T 3QWYA 5HKCA 1YIJQ 4MFDA 1TUCA 2X35A 4RCBA 4LDVA 4V2SA 3EFOB 1E6GA 2NYSA 2KDSA 2H3EB 3TCJA 4CI0C 2IPOB 2QYZA 1Q86R 3JCMg 4B6MA 3CCLQ 2RH2A 3BLRB 2EBPA 2B8AA 5FGKB 4M7AE 3CCVT 3L42A 2YRVA 3V8KA 1ZX6A 2DRKA 4FX3B 2NUZA 4QKUA 3REAB 4HCKA 4D8KA 2V1QA 4AKIA 4X1VA 1VQPQ 1VQMQ 1OEBA 2IVWA 4JRQA 1RLPC 4NS5A 1N8RR 2NUPB 2XD0A 3FDRA 4MDXA 3UA7A 3BG5A 5CQXA 3CC2T 1QVFP 2EQMA 3OY9A 2DF6A 2M1HA 1H27B 2G77A 4O6JA 3QWXX 5D6WA 3J80E 4MZTA 2PVGB 4Y72B 1R77A 1ZUYA 2COZA 2E3HA 2DL3A 2ZGWA 2RJCA 1K4US 4DBRA 2LMJA 4E7ZA 2LW4A 3NPFA 3PIPA 2I2LA 2K3YA 3I5SA 4QQDA 1I0CA 1N9SA 2IVXA 2KBTA 3C12A 3INZA 1VYTA 2EJFA 1VYUA 2KI7A 3GP8A 2GF7A 5ECAA 2ENMA 4M75C 2K7AA 4ZNXA 3JB9H 3URGA 5KE3A 4F6UB 3H8ZA 4BI3A 4BD3A 5KYNA 1K0XA 3MKDA 5A0GA 4M7AF 2NUTA 2MOXA 2FPEA 3M0RA 4D8DA 2FZGB 3RKWA 1BCOA 5IH2A 2DKGA 3EH2A 1XO2A 1NZ9A 3DB3A 1CKAA 1KQSA 3OBWA 4J6YA 4RTYA 2PVOB 1JBMA 2OTLQ 2SRCA 3CCUQ 1ZSZC 3JSCA 4EOJB 4AG1C 4ROCA 4M78D 1M27C 1RI9A 1M2VA 3REBB 1WHKA 2D1XA 2O9VA 2KMGA 1O9KB 2BZYA 5GAMg 2KR6A 4QVCA 1LCKA 3PIOA 4M7DE 3S3MA 2J6OA 5CEIB 3RESA 3OW2A 4OGRB 1ZUUA 1I81A 1AISB 1WIEA 3SB2A 3QZ9B 1VQKQ 3C4SA 3V7SA 4O5VA 5GMKi 2C5OB 2YLCA 4E7SA 2RQRA 2X3WD 2PK2A 1JXMA 1G83A 3DLLA 2BE7D 1YP5A 2O4XA 3CPFA 4MFEA 3MJXA 2M9UA 1NPPA 1AD6A 1TS9A 3CC4Q 1B34A 4A63B 3CCMQ 5D6XA 1FWZA 2ZAEA 1O9KA 1G5VA 4E7LA 2CP5A 3E9GA 4YOOA 4RG2A 2QK0A 2F5TX 1FMVA 3CCSQ 2EVRA 3I56A 2JT4A 3M4GA 2JW4A 1VQ8Q 3OYJA 4HT8A 1JO8A 1YI2A 3A8OB 3OYHA 3BDUA 2RI5A 3G4ST 4LUEA 1NJIU 4Z6YA 4OMPA 2KXCA 3CD6A 3EGDA 1G3NC 3PMTA 2EWNA 1OPKA 3L2ZA 4FT2A 2I53A 1VIFA 2E12A 2QGSA 2RPNA 4IUUA 3KBGA 1ZA1B 2D6FA 5CK9A 1UTIA 4M7DF 1UJYA 3MEUA 2ZPGB 2YUPA 2A0FB 1QP3A 1T3LA 2DXBA 1XQHA 2WACA 4JRIA 1VQNQ 2LX9A 1VQ5Q 3M0UA 3EHRA 3EG9A 1AOJA 1UNHD 5GAN8 1Q7YC 1I8FA 3JCMf 4BY7X 3ER0A 4QVZA 1BYMA 3WVEB 4JLIA 3HRTA 3LW5E 2UUEB 4M75E 2WSEE 4OP0A 3PTAA 2LCSA 2DMEA 1WXUA 1R0CB 1PSEA 4J8OA 2COYA 3L2WA 3H9NA 4AI6A 3CXCA 4FYYB 2CJMB 2ROTA 4JPBW 1NJIR 2KK4A 2QI2A 4IUTA 3X20B 2O2OA 1U1SA 2GQVA 4ESRA 4OGCA 1ZQ1A 4J9DA 4M7AB 1VQOQ 2CREA 3LWIA 4N4HA 2JS2A 2M51A 3ULRB 4NL3A 5FLXE 1UGSB 2LCCA 3HL8A 4Z8AA 1SKUB 1FX7A 1OULA 4FYWB 3UT1A 4C92D 2FO0A 2YT6A 5LJ5e 3BDLA 4F17A 3OS2A 5ICPB 1UGVA 4XTWA 1IB8A 1M3BA 1QQJA 4YOSA 2QA4A 2FRYA 3RERA 2DL8A 2LZ6B 2E5QA 4ZGDB 3HFOA 3HSBA 2KAFA 1P92A 2DTIA 2IN3A 4QSHA 2CH4A 2IW6B 1UUEA 4TVRA 1W6XA 3KUFA 2X51A 2JVVA 1QVFS 4J9FA 5GAN3 4HNTA 8AT1B 3DOGB 3X24B 4BCKB 4M78A 4NSTB 1VQLQ 2CH4W 2QQSA 3OA6A 1H1PB 2CP3A 4M75F 3OYAA 4JZ4A 4JJNK 1S1NA 5GMKl 1H24B 4ZTJA 4J7IA 1RABB 4GLMA 5CKBA 1GCQC 2DAQA 3M56A 2AT1B 1QVGA 1KC8C 4QQGA 3OMGA 2K79A 4EMKA 4AFUC 4IUVA 2LQWA 3JV3A 3J81E 5GAMf 1S72Q 2W9ZA 5HNBB 2FG0A 2LQ8A 1SHGA 1PC0A 1WQWA 5GAOm 4E7KA 1VQ6Q 2YRCA 2CP0A 1W4SA 1YCSB 5FU7C 2MCNA 3CCJQ 5DQWA 1YJWQ 1BU2A 2WMAB 1BB9A 2RHYA 1TSFA 3PE0A 1ARKA 3RUXA 2K5IA 2DXCB 2V8IA 3JCMW 1WZOA 2W2HA 2BS2A 1N9RA 1UDLA 1LPLA 1M2OA 4PJMA 4E2FB 1YJNQ 1PG5B 1JEGA 4DBFA 3A5ZB 1K73U 1URCB 2I0NA 4ROEA 4PKCC 3MP6A 4R55A 2V22B 1W70A 5KYXB 4NOYA 1BI0A 4C8QD 3ZBDA 3CC7A 3SDZA 2X1NB 1AEYA 1YJ9T 1WJRA 5CYIB 1OGUB 2EYYA 5DLOA 5A0LA 2JTEA 2HL3A 3V8LA 2E64A 2RNAA 3QIIA 2XHCA 2FPDA 4LDXA 3CCVA 1JRIA 1UB4A 5KE2A 3QYBA 2WMBB 4BE0A 3H0IA 2A36A 1N5ZA 4II5B 3CBOA 2QEXT 2JJ9A 1U1TA 2F2CA 4Y28E 2DVJA 3HBLA 1I4K1 4M77A 2CT3A 4CRLB 1G3SA 3CCQQ 1YHQT 3CC2A 2VKNA 4F7UA 1K9MU 5HBHB 2YLBA 1ZHIA 2HKNA 1YNZA 4BCQB 4OMMA 3EG1A 1MMGA 5L8RE 6AT1B 3JB9D 1YITQ 5DQVA 4QW2A 3QJYA 3VS6A 1K73R 1OPLA 2PJQA 3NTKA 2LP5A 3ZFJA 3BLQB 1VQ9Q 1IGQA 4KGXB 2W10A 5L23A 1E7OA 2EKHA 2ESWA 2GCXA 3AHUA 4BCHB 2R7GA 2DX1A 3TVTA 4FL6A 2HAXA 2RO0A 4XQ3A 3CBPA 3B57A 3OS5A 4BCIB 5HQ0B 3EIDB 2PU9B 4PJOA 2L3PA 2YXYA 4C92A 4JS5A 2CCHB 4ZTFA 2ZZDA 2JZ2A 4F7NB 1YBYA 3PNWC 4F70B 1FKMA 1QWFA 2I40B 4JZ3A 1G3YA 4A4FA 4DBQA 1NEBA 2X3XD 2FEIA 1TUDA 2KGTA 4FCYA 1KD1U 1H92A 2DEUA 2JS0A 4M75B 4VUBA 2EJ9A 4G6LB 4OR5B 3HZJA 3VYGB 3DB4A 4J9EA 4P5NA 2E6NA 1BI1A 1K9MR 2MAMA 3A8LB 2QXFA 2MK5A 1ZSGA 3VS3A 1U3OA 2GQIA 1OYXA 2E1HA 2GNCA 4MIMA 1NG2A 4J9BA 4QQ6A 4EPCA 4FW2A 2DTHA 4RTUA 3MP8A 5CKHA 4FYVB 1AT1B 1D0ZA 2EGEA 4BI4A 2BKZB 1TOVA 4HXJA 5KYWA 2XICA 2CP2A 1W2BP 5IDPB 2L3SA 3LWHA 2KROA 2LJ1A 1HXDA 1WGSA 3QPHA 1PRMC 3F5XB 4HCCA 3SWNA 3MP1A 4N0AA 2O31A 2UZLB 3RBBB 5GAOr 1KD1R 2RK1A 2E3IA 1U5SA 5LJ3f 1VQ4T 3CXCP 1D1BA 2FB7A 2E41A 1JB0E 4KH1B 1T0JA 2OTJT 3OSVA 3H6ZA 4EMHA 3OYLA 1XOVA 3HFNA 3JRZA 3QJ6A 1D0XA 2O9SA 1GXIE 2BPMB 2XU8A 2YHTA 1KQ1A 3CPWS 2Y4XA 3TW6A 4L6V5 4F6WB 1X75C 2WFYB 1Y07A 1Q86C 2QGFB 3G4SA 4BE2A 3M0QA 4IIOA 4OGEA 5EG2A 2RHXA 1RAAB 1OKWB 4C8QA 3G71Q 2BE9B 3CMAT 3HPWA 2CUBA 2JM8A 2ECZA 3OYDA 1H26B 2HBWA 2C0OA 5KH6A 5FU6C 2ZPIB 4YC3B 3E2UA 1HJDA 2ED0A 3IQLA 4DQ2A 1X69A 3QYHB 4KBMB 3M9QA 4E7HA 3CPWA 4J5YA 4BCMB 2AKLA 1MMDA 1O9SA 2R57A 4II1A 4IMYB 2ATCB 3QO3A 1EIFA 2HCKA 2XG8D 2LT1A 1Q82R 2D8HA 4M7DG 1AD5A 1ZBJA 3QZ5B 2WHBB 1Y96B 4C5EA 4BBRM 3FIFA 4OMFB 2QASA 3CCEQ 4M78E 5DLQE 4FIBA 2VGNA 2E10A 4JDSA 3EFOA 3RGFB 1TU0B 2VXEA 3DL1A 2EYQA 4DEXA 3U23A 5GANf 3I55Q 1GBRA 2K5LA 2X4YA 2VWFA 1ENWA 3X28B 2VUBA 2LNHB 2BZXA 2F1LA 1WFWA 1JJ2P 3UDCA 1RL2A 5GAOq 3S3NA 2RJEA 4CFVB 1JXOA 1SPKA 4XAXB 2HDAA 5IT9E 5GAMj 1Z9ZA 2NUPA 5GJWB 2EQJA 3PO3S 2AZVA 2SEMA 4KT0E 1WJSA 3M54A 3LYIA 1PKSA 4HL4A 3PFSA 2ZPEB 4PJLA 2JUFA 5EFQB 2K2VA 2K3XA 4EC9B 2C5XB 2EQIA 3GIBA 3QXEB 2E5KA 3OB9A 2EQKA 4IIMA 2OX7A 1VQ7T 3NHNA 2BUDA 2VV5A 2BKDN 4HLQA 2CT4A 4OMQA 1PSFA 2FZCB 4IKFA 4KGVB 3BW1A 2W96A 2DBMA 1N4MA 3I5RA 1WHGA 3VUZA 3G6ET 2JMAA 7AT1B 2EIFA 2IIMA 2BS4A 4HNVA 3TEEA 1RAIB 5GMKe 2LRQA 1KFZA 3JCMV 3K7AM 3MY1B 4A4KA 3M0TA 1SRLA 1UG1A 5LMKB 3G33B 1IRXA 2KNBB 1SF9A 2Y4YA 3UF4A 3OYKA 4HA8A 3CMET 2ZPFB 3M03A 4QVDA 3HKSA 1TFBA 5I5ZB 1OL1B 4LDYA 4CC4B 2ZCFB 4BY6C 1OX9A 3TREA 2X4JA 4EOLB 2YUOA 4M75G 2CUDA 4WTOB 2LJ0A 3ZL7C 1VIEA 4OF1A 2NWMA 4MZPA 2D8JA 4XK8E 5HK0A 2L8DA 2YWWA 2EKOA 2DO3A 1PM3A 2L0AA 5AT1B 3P8HA 4LXCA 5GANd 1R0BG 3M0SA 1PNJA 3OYYA 4E47A 4XTYA 1H641 2QQBA 3VS4A 3TSWA 2EW3A 5FU7B 1LNXA 4CFUB 3CCRT 3LGFA 4AFSC 3G7ZA 3OYNA 5GAN4 4GLKA 3VS5A 2KEAA 4J9GA 1SRMA 1YIJT 3G1JA 4K11A 1WXBA 1LOJA 4Z88A 5LJ5g 4MDWA 3GNGA 1T0HA 1VYWB 1X6OA 4EOOB 1Q95G 1I07A 3I56Q 2UZBB 1QCNA 2E70A 1H1RB 2J05A 1Q7YU 3CCLT 3M5AA 1KHCA 1YI2Q 4C92E 4DOVA 1YJ9A 1VOLA 1WPYA 4ELZC 1FINB 2LVMA 4R56A 3PMIA 3BG9A 1IZ6A 3CD6Q 1OKVB 1OV3A 1TUGB 2QG9B 1VQ5A 1UJ0A 1VQPT 2QGGA 2DJQA 1VQMT 5KYYB 1W2BS 4LDUA 2JNGA 2MMPA 2EQUA 4M77D 1IGUA 5GMKh 2QEXA 4BE1A 3QYGB 1M1KC
chains in the Genus database with same CATH topology
4A53A 3QDRB 3A5ZB 1K73U 2R5MA 2PQWA 1VQPA 1QLBA 4BY6B 4PKCC 2DD4B 1YHQA 3MP6A 3PGGA 4XU3A 4R55A 5A2QE 3NTHA 1BIBA 1M4ZA 4M7AA 4NOYA 3WVDB 2EAYA 2QQRA 4L59A 4PJOG 1BI0A 1Q81C 4C8QD 3ZBDA 3CC7A 1U8RA 4PLLA 3SDZA 4JUVA 2OTLA 4M7AD 5I2MA 3M58A 2FYKA 3CCUA 1YJ9T 4X9DA 4N4IA 4C92G 3BY7A 4EDUA 3M53A 2DJZA 4IUQA 1WJRA 3NTIA 2DZ9A 5DM7R 2RD1A 2KVQG 3OW2S 3KXTA 3JCMe 1XTDA 5FROA 4C8QB 3OYFA 4M78F 2RHUA 3SWNC 5DLOA 4ZGEB 4N0AC 5A0LA 4L5GA 3E19A 3V8LA 4LD9K 3MO8A 4XTVA 4M6VA 2E64A 4HKEA 1BI2A 2MI6A 3QYEA 4J6WA 4KULA 1MGQA 2DVEA 1N6AA 2CZ1B 3QIIA 4NL2A 1KHIA 4B9WA 1Q82U 2HQXA 4N4GA 2XHCA 1N8RU 3FJPA 3CCVA 4LDXA 4PJOD 1JRIA 4C0ZA 5IN1A 1UGQB 2K5FA 5GAOn 3P8BB 2O4XB 4EMGA 1UB4A 2PUKB 5KE2A 3QYBA 4JX5A 4FM4B 3EAEA 3GLXA 4BB7A 4BE0A 5GMKj 1VQKA 4RKUE 2LNVA 5J3BA 1B34B 3CBOA 2QEXT 3M55A 1U1TA 4Y28E 3HBLA 1I4K1 3SD4A 3MEVA 2QDYB 1ZBXA 4M77A 2DEQA 4MMLA 4WF2A 5LJ3j 1UGPB 1YCYA 1OZ3A 3QKJA 5LJ5j 4JS4A 2CS7A 1AHJB 1G3SA 1YHQT 3CC2A 2XDBA 3QG1A 4F7UA 1UEBA 5EJCA 3BG3A 1K9MU 2YLBA 1ZHIA 2HD0A 2OTLT 3CC7T 4C8QC 3VJPA 5HKCA 3CCUT 3OMCA 2P0QA 5L8RE 3JB9D 4M77E 5CKEA 5CO7A 2XK0A 4BDZA 4MFDA 5FRNA 1KC8U 5HY6A 3QUIA 3CC4A 2X35A 4RCBA 4FU6A 3CCMA 2VYTA 2RHIA 3QJYA 4LDVA 4QW2A 3OYGA 4F7UE 4JLGA 4JRPA 5CVIA 4V2SA 1OI1A 2KDSA 3NTKA 1BIAA 4XTUA 5KCOA 4HT9A 2LT4A 3ZFJA 3TCJA 3CCSA 4CI0C 2H3JA 2D0QB 3L2UA 2GCXA 3JCMg 1VQ8A 3AHUA 2RH2A 3M4YA 4C8QE 2B8AA 4M7AE 2E65A 4FL6A 2HAXA 1WJQA 2RO0A 3CBPA 4XQ3A 4YTLA 4M7DC 3CCVT 3L42A 2YRVA 3OS5A 3V8KA 4Z02A 3S3OA 3VKHA 4J6XA 2PU9B 4PJOA 4PNOA 4AKIA 5C6SA 3F70A 2DXBB 1VQKT 1KG1A 3G71T 4Q5WA 3M59A 4C0FA 4C92A 4JS5A 4ZTFA 2F69A 2ZZDA 5GAN2 2JZ2A 1YBYA 2BIVA 2IVWA 3PNWC 1FKMA 4NS5A 1QW1A 4JRQA 2CZ7B 1G3YA 4A4FA 3RMSA 4BACA 1QVFA 4UC4A 2XD0A 4PJOE 3FDRA 4IURA 4MDXA 3BG5A 5CQXA 4OVAA 3CC2T 2EQMA 3OY9A 3VYHB 1X01A 4HCZA 1KD1U 3HO8A 4M75B 1TH7A 2QQ9A 4VUBA 2EJ9A 3J7AF 3JCMd 2M1HA 2G77A 2HNIA 4O6JA 5D6WA 3J80E 1M1KU 3HZJA 4ELJA 4MZTA 2PVGB 4C0DC 2AHJB 3QHSA 3QWLA 2Y90A 3CC4T 3CCMT 3VYGB 2DIQA 1VQNA 2V8JA 1UGRB 3DB4A 4P5NA 2M16A 3DLMA 2QQAA 3CCST 2ZGWA 2E6NA 2RJCA 3WXMB 1Q81U 4M7DD 1BI1A 2VC8A 4HCBA 2MAMA 1VQ8T 3FEOA 3VKIA 3A8LB 2QXFA 1VQ4A 1M5Q1 3JCMh 4C8QG 4ZGJB 4XU1A 5GAMe 1RI0A 3PIPA 3HB9A 2I2LA 2K3YA 4QQDA 3CCET 4M7DB 2OTJA 2D9TA 4X9CA 1OYXA 2E1HA 4OB2B 1N9SA 5GANj 2K57A 2E6ZA 3OYIA 4MIMA 1NJIC 3C12A 2L5QA 3INZA 3Q1JA 3CXCS 5J39A 4M77F 2EJFA 3JCMQ 2KSSA 3I55T 4QQ6A 3GP8A 1D3BB 4BI8B 2GF7A 4BBSM 4EPCA 2ZPHB 4M75C 4DOWA 4F7UF 3MCAB 5CIUA 2DTHA 2WSFE 3JB9H 3URGA 3MP8A 5KE3A 1DJ7B 5CKHA 3E1SA 3H8ZA 4X34A 4BI3A 4BD3A 4BI4A 2ZPBB 3OSSC 4ZN3A 3VKGA 5A0GA 1W2BA 2XICA 3JCMc 4M7AF 3E9FA 2LQKA 3V7CA 3CMAA 2K4YA 3RKWA 2DPPB 2LC4A 3LWHA 1VQOA 3GOXA 3ME9A 1O75A 2DKGA 1HXDA 1VQNT 1WGSA 3QPHA 1NZ9A 1VQ5T 4JX6A 3HRSA 3FB9A 4ATOA 3DB3A 5CR2A 1KQSA 3OBWA 4J6YA 3SWNA 4HCCA 2PVOB 3MP1A 1JBMA 4N0AA 4A4EA 2IG0A 1LJOA 5GAOr 2RK1A 5LJ3f 5LJ5f 3MEAA 4BDYA 3JCMJ 1VQ4T 1R8OB 2DXCA 4M7DA 3JSCA 4PJOF 2DXTA 2FB7A 2E41A 2QQ8A 4M78D 3JB9G 3OYEA 3ASKA 1JB0E 4J7FA 1I5LA 5FU6B 2OTJT 4C92F 3OSVA 4RMOA 2KMGA 3H6ZA 3C94A 5LL6S 4EMHA 3OYLA 1XOVA 5GAMg 2KR6A 4QVCA 2EJGA 3HFNA 3JRZA 3QJ6A 2DD5B 4MMKA 4E7IA 4M78B 3PIOA 2DD4A 4E7JA 4M7DE 1GXIE 3S3MA 3RESA 3OW2A 2XU8A 2YHTA 1KQ1A 3CPWS 2Y4XA 3TW6A 4L6V5 3JAME 1I81A 3MEWA 1X75C 1Q86C 1Y07A 4BE2A 3G4SA 2VGMA 4XTXA 4OGEA 5EG2A 3CEYA 2RHXA 3SB2A 2FL7A 1M1FA 3QZ9B 5HK3A 1BI3A 2V8KA 2KMTA 2DK3A 3C4SA 3O8VA 4C8QA 3CMAT 3V7SA 3HPWA 3JB9F 2A3LA 4O5VA 1VQOT 5GMKi 3A8GB 2YLCA 2BS3A 4EMKB 3OYDA 1VQLA 3CBMA 3JCMX 1K8AC 3DLLA 1XNIA 1H3ZA 2FVUA 2P4TA 2QFZA 5GAMd 5KH6A 3NFCA 4PLIA 4LD6A 5FU6C 2ZPIB 2O4XA 2RB6A 5CCAA 3V7RA 3CPFA 1QVGS 4MFEA 4DQ2A 2M9UA 4J83A 3QYHB 4KBMB 3A8MB 1NPPA 2KY9A 3M9QA 4RG8A 1G3WA 1V29B 4M78C 5A0DA 1B34A 4J5YA 3CPWA 3V8JA 4ME7A 1FWZA 5D6XA 1G5VA 4E7LA 1O9SA 3E9GA 2R57A 2HQEA 2DD5A 3QBYA 3QO3A 4II1A 2F5TX 1EIFA 4RG2A 3GPLA 1JJ2S 4M75D 5GAMh 2XG8D 2LT1A 3I56A 2DIGA 3TW7A 1Y71A 4M7DG 3M4GA 3QZ5B 1S72A 3OS0A 3OYJA 4HT8A 2KQWA 3TU4K 1YI2A 4LOCA 3LGLA 1Y96B 3HRUA 4C5EA 4BBRM 3FIFA 4OMFB 3A8OB 3OYHA 3BDUA 2WSCE 4M78E 5DLQE 2RI5A 3EFSA 4FIBA 3G4ST 4KUDK 1NJIU 4Z6YA 2VGNA 4EMKC 2E10A 4JDSA 3CD6A 1IREB 4Y91A 2VXEA 1VQ6A 3DL1A 3RKXA 3PMTA 2EWNA 2EYQA 3CCJA 4B9XA 5LJ3g 5GANf 1YJWA 1VQ7A 3MHXA 3L2ZA 2K5LA 1MHNA 2JN0A 2X4YA 4FT2A 1VIFA 2E12A 1VQLT 1N27A 2PVDB 3X28B 2VUBA 4IUUA 3KBGA 1M90U 2D6FA 2XDPA 3HP9A 5CK9A 4M7DF 2RI2A 2DTOA 3MEUA 1JJ2A 2ZPGB 4XU2A 3UDCA 1RL2A 2LDMA 3ZEHA 2PUOB 5GAOq 2RJEA 1QP3A 3S3NA 3G6EA 3LLRA 2DXBA 1YJNA 2JTMA 1XQHA 2C06A 2O01E 4XAXB 2WACA 4JRIA 1M1GA 5IT9E 2LX9A 2CGHA 2X4XA 4IUPA 5GAMj 4NC6A 3VV0A 1QP2A 2LTOA 3I56T 1Y7XA 2MWOA 5GANe 4MZMA 2EQJA 5GAOp 1S72T 2QDJA 5J26A 3CMEA 4M75A 4KT0E 5GAN8 1WJSA 3M54A 1YI2T 1I8FA 3LYIA 1Q7YC 1M90C 4HL4A 4OB3B 2ZPEB 3ER0A 3PFSA 4QVZA 3JCMf 5KCHA 3L2QA 4C8QF 2L3RA 4M78G 1BYMA 3WVEB 2JUFA 4JLIA 3HRTA 3A8HB 2K2VA 3LW5E 3M57A 2K3XA 3EFRA 3VYGA 3CD6T 3GIBA 3QXEB 2JOYA 4CRIA 3OB9A 1VQ6T 3SFMA 4M75E 2EQKA 3UPUA 2XIDA 2WSEE 4OP0A 3PTAA 3CCJT 1YJWT 1VQ7T 2BUDA 2VV5A 2BKDN 4HLQA 2R5AA 2X4WA 4M77B 4JX4A 5LJ3h 4C5IA 5LJ5h 1PSEA 4J8OA 1Q86U 1PSFA 3L2WA 2F5KA 4E7HA 4AI6A 4OB1B 2XDDA 4F7UB 3CXCA 3JB9J 4IKFA 2KK4A 2QI2A 3BW1A 4IUTA 5CKFA 3JB9I 3X20B 1KQ2A 1U1SA 2GQVA 3C95A 4KUIA 1WNLA 4OGCA 3VUZA 1ZQ1A 2P0KA 4M7AB 3H4CA 3G6ET 1YJNT 2XI9A 2EIFA 3OS1A 3LWIA 1K8AU 4A4HA 1D3BA 4N4HA 1HK9A 2BS4A 4HNVA 3TEEA 1K73C 2R58A 5GMKe 2LRQA 4NL3A 5FLXE 1UGSB 3CCQA 2LCCA 2OAUA 3HL8A 5DY9A 2GFUA 3JCMV 4A4KA 2XKOC 3L2VA 3CCRA 3KHIA 1FX7A 2Y4YA 3X25B 3CMET 4C92D 3UT1A 4HA8A 3OYKA 2ZPFB 2QTXA 4QVDA 2VXFA 5LJ3e 3HKSA 5LJ5e 3BDLA 1YITA 5GANg 1YIJA 3OS2A 4LDYA 4RCCA 3G71A 4PJOB 2ZCFB 4BY6C 4C5HA 2RM4A 4D6WA 4M77C 2RJFA 4BUGA 3RIRA 3TREA 3P8DA 4XTWA 4C92B 2X4JA 3X26B 2ZZDB 5C0MA 1VQ9A 4M75G 5CAIA 2QA4A 3RERA 5D6YA 1OZ2A 1VIEA 4A54A 4OF1A 2RHZA 3CCLA 2E5QA 4ZGDB 1BKBA 1E7PA 3HFOA 2KAFA 3HSBA 1P92A 4MZPA 2DTIA 4XK8E 5HK0A 2L8DA 1Q82C 4QSHA 1WQ7A 1N8RC 4M7AC 2DXUA 4A4GA 3R6OA 4PL6A 5GAN6 2EKOA 4TVRA 2DO3A 5IAYA 5M9OA 2CKKA 3KUFA 3PT9A 2JVVA 1QVFS 5GAN3 2QF7A 4HNTA 3P8HA 3X24B 1NPRA 2RA2A 4JRKA 5CQYA 5CKDA 5GANd 3GNFB 4M78A 1NE8A 3OYYA 2HBPA 3VUBA 1VQMA 2QQSA 4XTYA 4E47A 3OA6A 4AKGA 1H641 2QQBA 2MWPA 5FU7B 3UWNA 4M75F 3CCQT 3OYAA 1LNXA 3OYBA 4JJNK 1VUBA 4XTZA 5GMKl 3LGFA 4C5GA 3CCRT 4PJOC 2RJDA 3CCEA 4J7IA 3G7ZA 4ZTJA 2GFAA 3OYNA 1K9MC 5GAN4 4GLKA 5GAOl 3N5BB 4C92C 3T9NA 5CKBA 2DAQA 2EFIA 1YITT 3M56A 1YIJT 2WJ9A 2CZ6B 5GANh 4LDWA 1QVGA 3DKMA 3S6WA 1KC8C 4ELYC 4QQGA 1LOJA 3OMGA 5GAN7 3I55A 3L1AA 4EMKA 3HHTB 4FSXA 3GNGA 3OQ5A 4MDWA 5LJ5g 5I21A 3LH0A 1X6OA 3LX7A 4IUVA 1VQ9T 2QA4T 3JCMb 3J81E 2E70A 5GAMf 2CZ0B 1SSFA 2CYZB 3RMQA 3CCLT 1Q7YU 2NLUA 3M5AA 4AKHA 1KHCA 4C92E 2LQ8A 4DOVA 1WPYA 4ELZC 4ZN1A 5GMKm 1YJ9A 2LVMA 2G3RA 2P0PA 2A7YA 4R56A 1WQWA 3OYMA 3RKYA 2RI3A 3OBYA 5GAOm 3PMIA 4E7KA 1M8VA 1G3TA 4GY5A 4C0GA 5AYFA 4M77G 3BG9A 1IZ6A 4DA4A 4XU0A 3FLGA 4HNUA 4OB0B 1QVPA 2FHDA 1FXXA 1W4SA 4F7UG 3BFMA 5FU7C 1VQ5A 1VQPT 5I2SA 1M9SA 1VQMT 3JCMP 2RHYA 2LCLA 1W2BS 3SWNB 4LDUA 2L89A 2RK2A 5LJ3d 5LJ5d 1Y96A 4M7AG 2DZCA 5GAN5 3FC3A 3RUXA 2K5IA 4C0DB 2JNGA 3GF5A 2DXCB 2JTFA 3META 2V8IA 3FRNA 3JCMW 1KD1C 2MF2A 2EQUA 2MMPA 3OYCA 2BS2A 1N9RA 2M0OA 4M77D 1KQSS 4FT4A 3VU3C 5GMKh 2QEXA 4BE1A 3QYGB 3L2RA 3QSUA 1M1KC 5FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPI B;  2PVG B;  2AHJ B;  1UGS B;  2DD4 B;  3VYG B;  3QYH B;  3A8M B;  1UGR B;  3X25 B;  1V29 B;  2ZPF B;  3WVD B;  2DD5 A;  2ZCF B;  3A8L B;  4ZGJ B;  3X26 B;  3QZ5 B;  2ZZD B;  4ZGE B;  3A8O B;  4ZGD B;  4OB2 B;  2WSC E;  4XK8 E;  4RKU E;  2CZ1 B;  1IRE B;  2ZPH B;  1UGQ B;  2WSF E;  2PUK B;  4FM4 B;  1DJ7 B;  3X24 B;  2PVD B;  2ZPB B;  3X28 B;  4Y28 E;  2ZPG B;  2DPP B;  2QDY B;  2PUO B;  1UGP B;  1QP3 A;  1AHJ B;  2DXB A;  2O01 E;  2PVO B;  2CZ6 B;  5L8R E;  1QP2 A;  2DXC A;  3HHT B;  1JB0 E;  4KT0 E;  2CZ0 B;  2CYZ B;  4OB3 B;  2ZPE B;  2D0Q B;  3WVE B;  3A8H B;  3LW5 E;  2DD5 B;  2DD4 A;  3VYG A;  1GXI E;  3QXE B;  2WSE E;  4OB0 B;  2PU9 B;  4L6V 5;  1PSE A;  2DXB B;  1PSF A;  4OB1 B;  3QZ9 B;  2ZZD A;  3X20 B;  2CZ7 B;  3A8G B;  2DXC B;  3VYH B;  3QYG B; 
#chains in the Genus database with same CATH topology
 2ED1 A;  2R5M A;  2DD4 B;  1YHQ A;  1BCM A;  5KYU B;  2UZE B;  1M4Z A;  5BNJ B;  3WVD B;  1RAE B;  2EAY A;  2PNI A;  4L59 A;  1Q81 C;  4PLL A;  5I2M A;  2C0I A;  3BY7 A;  2DJZ A;  3NTI A;  5DM7 R;  2DZ9 A;  2RD1 A;  1EZZ B;  2DE0 X;  5FW9 A;  2OJ2 A;  3MO8 A;  4M6V A;  1Q7Y R;  1BBZ A;  2MI6 A;  4RKU E;  4KUL A;  2CZ1 B;  4PJO D;  2DYI A;  1HSQ A;  3FJP A;  1MUZ A;  2RQW A;  4FYX B;  2PUK B;  4BB7 A;  5J3B A;  1H28 B;  4DBH A;  3MEV A;  5IHK A;  2QDY B;  4BCQ D;  2DEQ A;  5LJ3 j;  4JS4 A;  1YCY A;  1OZ3 A;  2CS7 A;  2XDB A;  1GRI A;  3VRZ A;  1X2Q A;  1IO6 A;  1UEB A;  4PK4 A;  2HEQ A;  2OTL T;  3BLH B;  2QDL A;  4KGZ B;  3VJP A;  3CCU T;  3OMC A;  2P0Q A;  4CFM B;  5CKE A;  2XK0 A;  4BDZ A;  5FRN A;  4PFZ A;  1KC8 U;  1H1Q B;  3QUI A;  2V26 A;  4M7A A;  2VYT A;  2RHI A;  4JRP A;  3OYG A;  2C5V B;  5CVI A;  1OI1 A;  1BIA A;  4XTU A;  4EC8 B;  3MI9 B;  2QA4 Q;  2W9F A;  4EOK B;  3M4Y A;  4C8Q E;  2E65 A;  1X6G A;  1WJQ A;  4YTL A;  1ACM B;  1NLP C;  4Z02 A;  3VKH A;  2PZ1 A;  4JJD A;  4PNO A;  1VQK T;  1KG1 A;  4BY1 X;  4C0F A;  1TWB A;  2F69 A;  1M8M A;  3MIA B;  1EX4 A;  1F5Q B;  1JST B;  1ZUK A;  4F14 A;  4AFZ C;  1OI9 B;  1K9A A;  1JU5 C;  2Z0W A;  2CZ7 B;  4BAC A;  1QVF A;  4IUR A;  4OVA A;  1X01 A;  4HCZ A;  2YUQ A;  3THK A;  1TH7 A;  2QQ9 A;  3J7A F;  3JCM d;  1K76 A;  2AHJ B;  1PCX A;  3QHS A;  1I1J A;  2Y90 A;  1Z9Q A;  3CC4 T;  3VRY A;  3CCM T;  1ABO A;  2DIQ A;  1UGR B;  4F04 B;  1OX8 A;  4RTX A;  3CCS T;  3WXM B;  2EGA A;  1UHF A;  4HCB A;  3VS1 A;  1VQ8 T;  3FEO A;  1VQ4 A;  1QKX A;  2L3Q A;  4XU1 A;  1RI0 A;  3HB9 A;  4M7D B;  2OTJ A;  2D9T A;  4X9C A;  4OB2 B;  5GAN j;  5EC7 A;  2K57 A;  3Q1J A;  2PK9 B;  3JCM Q;  5IHI A;  1D3B B;  2DYB A;  2ZPH B;  2L2P A;  3MCA B;  1WHJ A;  3SEM A;  2BZ8 A;  1DJ7 B;  4X34 A;  3OSS C;  1H3H A;  4GBQ A;  2CCI B;  3VKG A;  4PFP A;  3JCM c;  3E9F A;  2LQK A;  3V7C A;  3CMA A;  2K4Y A;  2B9R A;  2LC4 A;  3RNJ A;  1O75 A;  3M0P A;  1VQN T;  1SSH A;  1VQ5 T;  3FB9 A;  5CR2 A;  4A4E A;  1KQS P;  2HL5 C;  3EJ1 B;  5LJ5 f;  2W0Z A;  3MEA A;  2V1R A;  3CC7 Q;  2DXC A;  1LVK A;  4HVV A;  4M7D A;  2QQ8 A;  1I5L A;  4PJJ A;  4JJB A;  5FU6 B;  1SG5 A;  1OIY B;  4F6S B;  3EG0 A;  2FRW A;  4EOM B;  1TTH B;  5LL6 S;  4FW1 A;  2EJG A;  3BHT B;  2DD5 B;  1NBE B;  4E7I A;  1V1C A;  2YSQ A;  4E7J A;  1WI7 A;  5KYX A;  2MIO A;  3OW2 P;  3BHV B;  1W1F A;  1KSW A;  3QHR B;  4OML A;  5FWC A;  3CCV Q;  4AFQ C;  2GGR A;  3I9Q A;  4XTX A;  3EGX B;  3CEY A;  1M1F A;  4EIK A;  3QDF A;  2V8K A;  2KMT A;  3O8V A;  3JB9 F;  4AG2 C;  3A1P A;  1VQO T;  1ABQ A;  3TNH B;  2BS3 A;  1MV3 A;  3CBM A;  1K8A C;  1H25 B;  1WHH A;  1XNI A;  1H3Z A;  2FVU A;  2QFZ A;  5GAM d;  3CC2 Q;  4PLI A;  3EG3 A;  3AT1 B;  4BCM D;  2RB6 A;  4KH0 B;  3V7R A;  4J83 A;  3A8M B;  2KY9 A;  4RG8 A;  4M78 C;  2K9G A;  2WPA B;  2JGZ B;  2HQE A;  2DD5 A;  1MND A;  1WA7 A;  3TW7 A;  1Y71 A;  3OS0 A;  2KQW A;  1PRL C;  3HRU A;  1MNE A;  4CC7 A;  4AT1 B;  2WSC E;  3EFS A;  3DTO A;  1K0S A;  4EMK C;  5L2W B;  1IRE B;  4Y91 A;  1YWO A;  1OIU B;  1VQ7 A;  4LNP A;  3MHX A;  1MHN A;  2JN0 A;  1VQL T;  1N27 A;  4EOQ B;  1M90 U;  2RQU A;  1X6B A;  3HP9 A;  2RI2 A;  2HZY A;  2K6D A;  2DTO A;  2LDM A;  2PUO B;  1X27 A;  1YFN A;  3G6E A;  3LLR A;  2JTM A;  1ZSZ B;  2H8H A;  2O01 E;  5HCK A;  1M1G A;  1JOW A;  4IUP A;  1IHW A;  4NC6 A;  3VV0 A;  1QP2 A;  2LTO A;  2WXV B;  5IF1 B;  5GAN e;  4MZM A;  4J9I A;  1S72 T;  3CME A;  1OU9 A;  4M75 A;  1M90 C;  1YWP A;  3L2Q A;  4OB3 B;  1GUX B;  1I5O B;  1OQK A;  2FPF A;  4CFN B;  2L3R A;  4M78 G;  3A8H B;  3M57 A;  4CFW B;  2J06 A;  3VYG A;  4AMC A;  1VQ6 T;  4PJN A;  3SFM A;  1QCO A;  3CCJ T;  1YJW T;  2X4W A;  2R5A A;  5LJ3 h;  4R0K A;  4C5I A;  1Q86 U;  2F5K A;  4WCI A;  4OB1 B;  1B7T A;  2XDD A;  3JB9 J;  1FYN A;  2JXB A;  2C4G B;  1U06 A;  3LQ5 B;  2KRS A;  2YRD A;  3C95 A;  2FZK B;  3GBQ A;  4HVW A;  1TD6 A;  2P0K A;  1ZSZ A;  1YJN T;  3EG2 A;  2C6T B;  4JJC A;  2RQV A;  2J7I A;  1KK7 A;  2XKO C;  3EHQ A;  3CCR A;  3KHI A;  3MPU B;  1D1A A;  5IDN B;  2QTX A;  1WXT A;  1FVV B;  1YIJ A;  2E4H A;  1E9H B;  4RCC A;  3G71 A;  4C5H A;  1A0N B;  4M77 C;  2RJF A;  3DDP B;  4BUG A;  1X2K A;  3RIR A;  4KRC B;  3P8D A;  3X26 B;  2KYM A;  2YUN A;  5C0M A;  2F2W A;  1RLQ C;  5CAI A;  5D6Y A;  1OZ2 A;  4A54 A;  3CCL A;  1RAD B;  1BKB A;  1E7P A;  2AK5 A;  1Q82 C;  1N8R C;  3G4S Q;  2DXU A;  4A4G A;  3R6O A;  4PL6 A;  5GAN 6;  2EGC A;  4M4Z A;  3TSZ A;  3PVQ A;  3SHW A;  3PT9 A;  4ROD A;  2QF7 A;  4F7L B;  2BTT A;  5GJV B;  4CFU D;  1VQP A;  1VQM A;  2COW A;  3C0C A;  1NE8 A;  2HBP A;  3VUB A;  4KRT A;  1WDX A;  3CCQ T;  1VUB A;  4XTZ A;  4ELL A;  4C5G A;  4PJO C;  2G9X B;  1JKW A;  3CCE A;  5GAO l;  3N5B B;  4OMO A;  4C92 C;  1ZLM A;  3T9N A;  1YIT T;  2EFI A;  2DL5 A;  1GCP A;  2WJ9 A;  2CZ6 B;  5GAN h;  1RAG B;  3S6W A;  3DJB A;  5GAN 7;  5IXB A;  1QVG P;  3I55 A;  3L1A A;  4J9C A;  3HHT B;  5I21 A;  3LX7 A;  1VQ9 T;  2A08 A;  2O88 A;  2CZ0 B;  1SSF A;  2CYZ B;  2HKQ B;  3RMQ A;  2EYX A;  2NLU A;  5IHY A;  3EH1 A;  5GMK m;  2WIP B;  2G3R A;  2A7Y A;  2CSQ A;  3RKY A;  3OBY A;  1G3T A;  1XJW B;  4GY5 A;  2NUT B;  5AYF A;  1QMZ B;  4M77 G;  2OI3 A;  3FLG A;  1QVP A;  4OB0 B;  1RUW A;  2KE9 A;  2J6F A;  4F7U G;  3BFM A;  5I2S A;  1NYG A;  1M9S A;  2F2X A;  3JCM P;  2LCL A;  2RMO A;  5I22 A;  5HVY B;  2L89 A;  1D3U B;  5LJ3 d;  1Y96 A;  2DZC A;  3FC3 A;  3MET A;  4BCO B;  1AWW A;  3OYC A;  1KQS S;  1M2V B;  4FT4 A;  2MYS A;  3NDQ A;  1AWJ A;  3L2R A;  5FRM A;  3PVL A;  4TTH A;  3QDR B;  1IXD A;  2DET A;  1TXQ A;  1QLB A;  4EON B;  5A2Q E;  1KIK A;  1G8X A;  1UFF A;  2VB6 A;  3QHW B;  2QQR A;  2XMF A;  4PFO A;  4PJO G;  2OTL A;  4M7A D;  4JUV A;  1WHL A;  2FYK A;  3CCU A;  4X9D A;  4C92 G;  4EDU A;  1E6H A;  4BCF B;  2KT1 A;  3BHU B;  2LX7 A;  1GFD A;  1GH6 B;  1VOM A;  2KVQ G;  3OW2 S;  2LJ3 A;  3JCM e;  3OYF A;  4M78 F;  3SWN C;  4ZGE B;  4N0A C;  2PMI B;  4L5G A;  4XTV A;  4HKE A;  1BI2 A;  4C0D C;  1MGQ A;  3MY5 B;  2DBK A;  2HQX A;  2ROL A;  4N4G A;  4BCJ B;  4C0Z A;  5IN1 A;  1C9B A;  5GAO n;  2O4X B;  1Y57 A;  4EMG A;  4FM4 B;  4BCN B;  2CP7 A;  2AZS A;  3GLX A;  1AZG B;  1VQK A;  1M3C A;  2LNV A;  1B34 B;  3M55 A;  4CC2 A;  1ZBX A;  4UN0 A;  4MML A;  5LJ5 j;  1OL2 B;  3QKJ A;  1AHJ B;  4ANJ A;  3QG1 A;  1WLP B;  5EJC A;  3BG3 A;  2HD0 A;  1JQQ A;  2YDL A;  4C8Q C;  2QTV A;  1SHF A;  4M77 E;  5CO7 A;  5HY6 A;  3CC4 A;  4FU6 A;  3CCM A;  2K2M A;  3EGD B;  4F7U E;  4JLG A;  1Y0M A;  3VS7 A;  4F16 A;  5KCO A;  4HT9 A;  2LT4 A;  3CCS A;  2H3J A;  2D0Q B;  3L2U A;  9ATC B;  2WIH B;  1VQ8 A;  5ACB A;  2F2V A;  3S3O A;  1MV0 B;  4J6X A;  5C6S A;  2QAZ A;  3F70 A;  2DXB B;  4F7J B;  3G71 T;  4Q5W A;  3M59 A;  3KFV A;  1GCQ A;  5GAN 2;  1OOT A;  2BIV A;  3A98 A;  2GTJ A;  1QW1 A;  4RTZ A;  3RMS A;  4PJO E;  2KRN A;  3EG9 B;  4UC4 A;  2M0Y A;  3VYH B;  1PHT A;  3HO8 A;  2HNI A;  1M1K U;  4ELJ A;  3QWL A;  4J9H A;  4QT7 A;  4EOR B;  2CP6 A;  3NGP A;  1VQN A;  2V8J A;  2M16 A;  3DLM A;  2QQA A;  3O5Z A;  2DNU A;  4M7D D;  1Q81 U;  2VC8 A;  3VKI A;  1W98 B;  1M5Q 1;  3JCM h;  4C8Q G;  1YJ9 Q;  4ZGJ B;  2JMC A;  5GAM e;  3CCE T;  2EUF A;  1RAH B;  1AZE A;  3OYI A;  2E6Z A;  1NJI C;  2L5Q A;  3CXC S;  5J39 A;  4M77 F;  3TQ7 P;  2KSS A;  3I55 T;  4BI8 B;  4BBS M;  4DOW A;  4F7U F;  2P84 A;  5CIU A;  1QWE A;  2A28 A;  2WSF E;  2DER A;  4RTW A;  1NM7 A;  4EOS B;  3E1S A;  1MMN A;  2CDT A;  2ZPB B;  4ZN3 A;  1K1Z A;  1W2B A;  4LUD A;  4EOP B;  2HSP A;  2C0T A;  2M02 A;  1RAF B;  2QEX Q;  2DPP B;  1VQO A;  5HBE B;  2DM1 A;  3GOX A;  3ME9 A;  4BCP B;  5KYY A;  2WEV B;  4JX6 A;  3HRS A;  4ATO A;  3I35 A;  1BU1 A;  1YHQ Q;  2IG0 A;  1LJO A;  4BDY A;  3JCM J;  1D09 B;  1R8O B;  2DRM A;  1M1K R;  2D0N A;  4PJO F;  2DXT A;  2RN8 A;  3JB9 G;  3OYE A;  3ASK A;  4J7F A;  2UZD B;  4C92 F;  4RMO A;  2KYB A;  3C94 A;  2DMO A;  2GBQ A;  4MMK A;  1Q81 R;  4M78 B;  2DD4 A;  2GTO A;  5KYU A;  1UNL D;  2IW8 B;  1HD3 A;  3JAM E;  3MEW A;  1M30 A;  1VYV A;  2VGM A;  5IXF A;  1UHC A;  1YN8 A;  2FL7 A;  5HK3 A;  1BI3 A;  2DK3 A;  2PHG A;  2A3L A;  5HBJ B;  3A8G B;  5I11 A;  3VS0 A;  1H1S B;  4EMK B;  1VQL A;  3JCM X;  2EYZ A;  2P4T A;  3NFC A;  1UE9 A;  4LD6 A;  1QVG S;  5CCA A;  2DL7 A;  1OU8 A;  4FSS A;  5A0D A;  1G3W A;  1V29 B;  3H0H A;  3V8J A;  4ME7 A;  4CFX B;  3CPW P;  1ZA2 B;  1J3T A;  3QBY A;  3GPL A;  1JJ2 S;  4M75 D;  5GAM h;  3UA6 A;  2DIG A;  2IW9 B;  1S72 A;  1CSK A;  3RR6 A;  3TU4 K;  4LOC A;  2DA9 A;  3LGL A;  4KUD K;  4LN2 A;  1VQ6 A;  1PD0 A;  3FJ5 A;  3RKX A;  3CCJ A;  4B9X A;  5LJ3 g;  1YJW A;  1HYO A;  4RUG A;  3CQT A;  1ZP2 A;  2PVD B;  1EFN A;  2XDP A;  1B3Q A;  4DEY A;  1KXU A;  1JJ2 A;  1B07 A;  3HTR A;  3EGU A;  2JM9 A;  4XU2 A;  1AVZ C;  1KC8 R;  3ZEH A;  2DFU A;  2W99 A;  4ORZ A;  1YJN A;  2KRM A;  1QCF A;  2C06 A;  2K3B A;  1TG0 A;  2CGH A;  2X4X A;  1H8K A;  2KXD A;  3I56 T;  1NYF A;  1Y7X A;  2MWO A;  5GAO p;  1VQ4 Q;  2QDJ A;  5J26 A;  5FWB A;  1YI2 T;  1NLO C;  5KCH A;  4C8Q F;  2OTJ Q;  3GTM S;  3EFR A;  3CD6 T;  3D7S B;  2JOY A;  4CRI A;  5D7U A;  1QMC A;  2XID A;  3UPU A;  2KT8 A;  1G2B A;  1IHV A;  4M77 B;  5LJ5 h;  4JX4 A;  2G6F X;  3DDQ B;  4F7U B;  1RAC B;  2EPD A;  4EOI B;  1C1A A;  1NEG A;  1KQ2 A;  2HMA A;  5CKF A;  3JB9 I;  1CKB A;  2J6K A;  3CMA Q;  4KUI A;  1WNL A;  3H4C A;  2XI9 A;  3OS1 A;  1QLY A;  1K8A U;  4A4H A;  1GBQ A;  2OAW A;  2LQN A;  1D3B A;  1HK9 A;  1C0M A;  1K73 C;  2R58 A;  1M3A A;  3TNI B;  3CCQ A;  2OAU A;  1WX6 A;  5DY9 A;  2GFU A;  3TNW B;  3L2V A;  3EOC B;  5IHN A;  3X25 B;  2VXF A;  5LJ3 e;  1YIT A;  5GAN g;  4PJO B;  4D6W A;  2RM4 A;  1V76 A;  4C92 B;  2HQH A;  2ZZD B;  3O0G D;  1QKW A;  1VQ9 A;  2RHZ A;  3BE3 A;  4RTT A;  2RF0 A;  1GFC A;  1PKT A;  4CXA B;  4OMN A;  2A37 A;  8ATC B;  1WQ7 A;  4M7A C;  2VAS A;  5IAY A;  5M9O A;  2CKK A;  2KR3 A;  2DIL A;  1H4L D;  1NPR A;  4JRK A;  2RA2 A;  5CQY A;  5CKD A;  3GNF B;  4LE9 A;  4AKG A;  2MWP A;  3TN8 B;  3UWN A;  3OYB A;  1UNG D;  2RJD A;  1F1B B;  2GFA A;  1K9M C;  1C6V X;  3EGX A;  2HSE B;  1WYX A;  4LDW A;  1K8A R;  3DKM A;  4ELY C;  4KRD B;  4FSX A;  3OQ5 A;  1MMA A;  3LH0 A;  1WHM A;  2QA4 T;  3JCM b;  4E6R A;  4AKH A;  4ZN1 A;  2P0P A;  3OYM A;  1KJW A;  1M8V A;  2RI3 A;  5KYW B;  1BK2 A;  4C0G A;  1PKD B;  1FMK A;  2DL4 A;  4DA4 A;  4XU0 A;  3VS2 A;  4HNU A;  1PWT A;  1T3S A;  2RQT A;  2FHD A;  1FXX A;  2C5N B;  1VQ7 Q;  4BCG B;  3H0F A;  4Y92 A;  1SEM A;  3SWN B;  2RK2 A;  2MPX C;  5LJ5 d;  4M7A G;  1VIN A;  5GAN 5;  3POM A;  1FMW A;  2AIR B;  3GF5 A;  4C0D B;  2JTF A;  4CC3 A;  3FRN A;  1KD1 C;  2MF2 A;  2M0O A;  3G6E Q;  3VU3 C;  2B86 A;  3QSU A;  1PD1 A;  1UEC A;  2EYW A;  4A53 A;  4HVU A;  4RTV A;  1AWX A;  2PQW A;  4BY6 B;  1D0Y A;  2P4R A;  2PTK A;  3PGG A;  3R6N A;  4XU3 A;  3NTH A;  1BIB A;  4LD9 K;  1U8R A;  2CSI A;  3CME Q;  5LQF B;  3LH5 A;  3M58 A;  4YOZ A;  4N4I A;  1JSU B;  4Z89 A;  2VVK A;  3M53 A;  4IUQ A;  3KXT A;  1GL5 A;  1XTD A;  5FRO A;  4C8Q B;  2RHU A;  1D1C A;  4F7S B;  3E19 A;  1P5E B;  4BCN D;  1M90 R;  4NL2 A;  3QYE A;  2ABL A;  2AKK A;  2DVE A;  4J6W A;  1N6A A;  1VA7 A;  2DLP A;  3H41 A;  1KHI A;  4BXX X;  3UAT A;  4B9W A;  1Q82 U;  4M7D C;  1N8R U;  1UGQ B;  2K5F A;  2X9H A;  3P8B B;  1X43 A;  1GUX A;  4JX5 A;  3EAE A;  3NMZ C;  1GY3 B;  5GMK j;  3SD4 A;  4WF2 A;  1UGP B;  4I3Z B;  3RDV A;  3CCR Q;  1AWO A;  3CC7 T;  3QWY A;  5HKC A;  1YIJ Q;  4MFD A;  1TUC A;  2X35 A;  4RCB A;  4LDV A;  4V2S A;  3EFO B;  1E6G A;  2NYS A;  2KDS A;  2H3E B;  3TCJ A;  4CI0 C;  2IPO B;  2QYZ A;  1Q86 R;  3JCM g;  4B6M A;  3CCL Q;  2RH2 A;  3BLR B;  2EBP A;  2B8A A;  5FGK B;  4M7A E;  3CCV T;  3L42 A;  2YRV A;  3V8K A;  1ZX6 A;  2DRK A;  4FX3 B;  2NUZ A;  4QKU A;  3REA B;  4HCK A;  4D8K A;  2V1Q A;  4AKI A;  4X1V A;  1VQP Q;  1VQM Q;  1OEB A;  2IVW A;  4JRQ A;  1RLP C;  4NS5 A;  1N8R R;  2NUP B;  2XD0 A;  3FDR A;  4MDX A;  3UA7 A;  3BG5 A;  5CQX A;  3CC2 T;  1QVF P;  2EQM A;  3OY9 A;  2DF6 A;  2M1H A;  1H27 B;  2G77 A;  4O6J A;  3QWX X;  5D6W A;  3J80 E;  4MZT A;  2PVG B;  4Y72 B;  1R77 A;  1ZUY A;  2COZ A;  2E3H A;  2DL3 A;  2ZGW A;  2RJC A;  1K4U S;  4DBR A;  2LMJ A;  4E7Z A;  2LW4 A;  3NPF A;  3PIP A;  2I2L A;  2K3Y A;  3I5S A;  4QQD A;  1I0C A;  1N9S A;  2IVX A;  2KBT A;  3C12 A;  3INZ A;  1VYT A;  2EJF A;  1VYU A;  2KI7 A;  3GP8 A;  2GF7 A;  5ECA A;  2ENM A;  4M75 C;  2K7A A;  4ZNX A;  3JB9 H;  3URG A;  5KE3 A;  4F6U B;  3H8Z A;  4BI3 A;  4BD3 A;  5KYN A;  1K0X A;  3MKD A;  5A0G A;  4M7A F;  2NUT A;  2MOX A;  2FPE A;  3M0R A;  4D8D A;  2FZG B;  3RKW A;  1BCO A;  5IH2 A;  2DKG A;  3EH2 A;  1XO2 A;  1NZ9 A;  3DB3 A;  1CKA A;  1KQS A;  3OBW A;  4J6Y A;  4RTY A;  2PVO B;  1JBM A;  2OTL Q;  2SRC A;  3CCU Q;  1ZSZ C;  3JSC A;  4EOJ B;  4AG1 C;  4ROC A;  4M78 D;  1M27 C;  1RI9 A;  1M2V A;  3REB B;  1WHK A;  2D1X A;  2O9V A;  2KMG A;  1O9K B;  2BZY A;  5GAM g;  2KR6 A;  4QVC A;  1LCK A;  3PIO A;  4M7D E;  3S3M A;  2J6O A;  5CEI B;  3RES A;  3OW2 A;  4OGR B;  1ZUU A;  1I81 A;  1AIS B;  1WIE A;  3SB2 A;  3QZ9 B;  1VQK Q;  3C4S A;  3V7S A;  4O5V A;  5GMK i;  2C5O B;  2YLC A;  4E7S A;  2RQR A;  2X3W D;  2PK2 A;  1JXM A;  1G83 A;  3DLL A;  2BE7 D;  1YP5 A;  2O4X A;  3CPF A;  4MFE A;  3MJX A;  2M9U A;  1NPP A;  1AD6 A;  1TS9 A;  3CC4 Q;  1B34 A;  4A63 B;  3CCM Q;  5D6X A;  1FWZ A;  2ZAE A;  1O9K A;  1G5V A;  4E7L A;  2CP5 A;  3E9G A;  4YOO A;  4RG2 A;  2QK0 A;  2F5T X;  1FMV A;  3CCS Q;  2EVR A;  3I56 A;  2JT4 A;  3M4G A;  2JW4 A;  1VQ8 Q;  3OYJ A;  4HT8 A;  1JO8 A;  1YI2 A;  3A8O B;  3OYH A;  3BDU A;  2RI5 A;  3G4S T;  4LUE A;  1NJI U;  4Z6Y A;  4OMP A;  2KXC A;  3CD6 A;  3EGD A;  1G3N C;  3PMT A;  2EWN A;  1OPK A;  3L2Z A;  4FT2 A;  2I53 A;  1VIF A;  2E12 A;  2QGS A;  2RPN A;  4IUU A;  3KBG A;  1ZA1 B;  2D6F A;  5CK9 A;  1UTI A;  4M7D F;  1UJY A;  3MEU A;  2ZPG B;  2YUP A;  2A0F B;  1QP3 A;  1T3L A;  2DXB A;  1XQH A;  2WAC A;  4JRI A;  1VQN Q;  2LX9 A;  1VQ5 Q;  3M0U A;  3EHR A;  3EG9 A;  1AOJ A;  1UNH D;  5GAN 8;  1Q7Y C;  1I8F A;  3JCM f;  4BY7 X;  3ER0 A;  4QVZ A;  1BYM A;  3WVE B;  4JLI A;  3HRT A;  3LW5 E;  2UUE B;  4M75 E;  2WSE E;  4OP0 A;  3PTA A;  2LCS A;  2DME A;  1WXU A;  1R0C B;  1PSE A;  4J8O A;  2COY A;  3L2W A;  3H9N A;  4AI6 A;  3CXC A;  4FYY B;  2CJM B;  2ROT A;  4JPB W;  1NJI R;  2KK4 A;  2QI2 A;  4IUT A;  3X20 B;  2O2O A;  1U1S A;  2GQV A;  4ESR A;  4OGC A;  1ZQ1 A;  4J9D A;  4M7A B;  1VQO Q;  2CRE A;  3LWI A;  4N4H A;  2JS2 A;  2M51 A;  3ULR B;  4NL3 A;  5FLX E;  1UGS B;  2LCC A;  3HL8 A;  4Z8A A;  1SKU B;  1FX7 A;  1OUL A;  4FYW B;  3UT1 A;  4C92 D;  2FO0 A;  2YT6 A;  5LJ5 e;  3BDL A;  4F17 A;  3OS2 A;  5ICP B;  1UGV A;  4XTW A;  1IB8 A;  1M3B A;  1QQJ A;  4YOS A;  2QA4 A;  2FRY A;  3RER A;  2DL8 A;  2LZ6 B;  2E5Q A;  4ZGD B;  3HFO A;  3HSB A;  2KAF A;  1P92 A;  2DTI A;  2IN3 A;  4QSH A;  2CH4 A;  2IW6 B;  1UUE A;  4TVR A;  1W6X A;  3KUF A;  2X51 A;  2JVV A;  1QVF S;  4J9F A;  5GAN 3;  4HNT A;  8AT1 B;  3DOG B;  3X24 B;  4BCK B;  4M78 A;  4NST B;  1VQL Q;  2CH4 W;  2QQS A;  3OA6 A;  1H1P B;  2CP3 A;  4M75 F;  3OYA A;  4JZ4 A;  4JJN K;  1S1N A;  5GMK l;  1H24 B;  4ZTJ A;  4J7I A;  1RAB B;  4GLM A;  5CKB A;  1GCQ C;  2DAQ A;  3M56 A;  2AT1 B;  1QVG A;  1KC8 C;  4QQG A;  3OMG A;  2K79 A;  4EMK A;  4AFU C;  4IUV A;  2LQW A;  3JV3 A;  3J81 E;  5GAM f;  1S72 Q;  2W9Z A;  5HNB B;  2FG0 A;  2LQ8 A;  1SHG A;  1PC0 A;  1WQW A;  5GAO m;  4E7K A;  1VQ6 Q;  2YRC A;  2CP0 A;  1W4S A;  1YCS B;  5FU7 C;  2MCN A;  3CCJ Q;  5DQW A;  1YJW Q;  1BU2 A;  2WMA B;  1BB9 A;  2RHY A;  1TSF A;  3PE0 A;  1ARK A;  3RUX A;  2K5I A;  2DXC B;  2V8I A;  3JCM W;  1WZO A;  2W2H A;  2BS2 A;  1N9R A;  1UDL A;  1LPL A;  1M2O A;  4PJM A;  4E2F B;  1YJN Q;  1PG5 B;  1JEG A;  4DBF A;  3A5Z B;  1K73 U;  1URC B;  2I0N A;  4ROE A;  4PKC C;  3MP6 A;  4R55 A;  2V22 B;  1W70 A;  5KYX B;  4NOY A;  1BI0 A;  4C8Q D;  3ZBD A;  3CC7 A;  3SDZ A;  2X1N B;  1AEY A;  1YJ9 T;  1WJR A;  5CYI B;  1OGU B;  2EYY A;  5DLO A;  5A0L A;  2JTE A;  2HL3 A;  3V8L A;  2E64 A;  2RNA A;  3QII A;  2XHC A;  2FPD A;  4LDX A;  3CCV A;  1JRI A;  1UB4 A;  5KE2 A;  3QYB A;  2WMB B;  4BE0 A;  3H0I A;  2A36 A;  1N5Z A;  4II5 B;  3CBO A;  2QEX T;  2JJ9 A;  1U1T A;  2F2C A;  4Y28 E;  2DVJ A;  3HBL A;  1I4K 1;  4M77 A;  2CT3 A;  4CRL B;  1G3S A;  3CCQ Q;  1YHQ T;  3CC2 A;  2VKN A;  4F7U A;  1K9M U;  5HBH B;  2YLB A;  1ZHI A;  2HKN A;  1YNZ A;  4BCQ B;  4OMM A;  3EG1 A;  1MMG A;  5L8R E;  6AT1 B;  3JB9 D;  1YIT Q;  5DQV A;  4QW2 A;  3QJY A;  3VS6 A;  1K73 R;  1OPL A;  2PJQ A;  3NTK A;  2LP5 A;  3ZFJ A;  3BLQ B;  1VQ9 Q;  1IGQ A;  4KGX B;  2W10 A;  5L23 A;  1E7O A;  2EKH A;  2ESW A;  2GCX A;  3AHU A;  4BCH B;  2R7G A;  2DX1 A;  3TVT A;  4FL6 A;  2HAX A;  2RO0 A;  4XQ3 A;  3CBP A;  3B57 A;  3OS5 A;  4BCI B;  5HQ0 B;  3EID B;  2PU9 B;  4PJO A;  2L3P A;  2YXY A;  4C92 A;  4JS5 A;  2CCH B;  4ZTF A;  2ZZD A;  2JZ2 A;  4F7N B;  1YBY A;  3PNW C;  4F70 B;  1FKM A;  1QWF A;  2I40 B;  4JZ3 A;  1G3Y A;  4A4F A;  4DBQ A;  1NEB A;  2X3X D;  2FEI A;  1TUD A;  2KGT A;  4FCY A;  1KD1 U;  1H92 A;  2DEU A;  2JS0 A;  4M75 B;  4VUB A;  2EJ9 A;  4G6L B;  4OR5 B;  3HZJ A;  3VYG B;  3DB4 A;  4J9E A;  4P5N A;  2E6N A;  1BI1 A;  1K9M R;  2MAM A;  3A8L B;  2QXF A;  2MK5 A;  1ZSG A;  3VS3 A;  1U3O A;  2GQI A;  1OYX A;  2E1H A;  2GNC A;  4MIM A;  1NG2 A;  4J9B A;  4QQ6 A;  4EPC A;  4FW2 A;  2DTH A;  4RTU A;  3MP8 A;  5CKH A;  4FYV B;  1AT1 B;  1D0Z A;  2EGE A;  4BI4 A;  2BKZ B;  1TOV A;  4HXJ A;  5KYW A;  2XIC A;  2CP2 A;  1W2B P;  5IDP B;  2L3S A;  3LWH A;  2KRO A;  2LJ1 A;  1HXD A;  1WGS A;  3QPH A;  1PRM C;  3F5X B;  4HCC A;  3SWN A;  3MP1 A;  4N0A A;  2O31 A;  2UZL B;  3RBB B;  5GAO r;  1KD1 R;  2RK1 A;  2E3I A;  1U5S A;  5LJ3 f;  1VQ4 T;  3CXC P;  1D1B A;  2FB7 A;  2E41 A;  1JB0 E;  4KH1 B;  1T0J A;  2OTJ T;  3OSV A;  3H6Z A;  4EMH A;  3OYL A;  1XOV A;  3HFN A;  3JRZ A;  3QJ6 A;  1D0X A;  2O9S A;  1GXI E;  2BPM B;  2XU8 A;  2YHT A;  1KQ1 A;  3CPW S;  2Y4X A;  3TW6 A;  4L6V 5;  4F6W B;  1X75 C;  2WFY B;  1Y07 A;  1Q86 C;  2QGF B;  3G4S A;  4BE2 A;  3M0Q A;  4IIO A;  4OGE A;  5EG2 A;  2RHX A;  1RAA B;  1OKW B;  4C8Q A;  3G71 Q;  2BE9 B;  3CMA T;  3HPW A;  2CUB A;  2JM8 A;  2ECZ A;  3OYD A;  1H26 B;  2HBW A;  2C0O A;  5KH6 A;  5FU6 C;  2ZPI B;  4YC3 B;  3E2U A;  1HJD A;  2ED0 A;  3IQL A;  4DQ2 A;  1X69 A;  3QYH B;  4KBM B;  3M9Q A;  4E7H A;  3CPW A;  4J5Y A;  4BCM B;  2AKL A;  1MMD A;  1O9S A;  2R57 A;  4II1 A;  4IMY B;  2ATC B;  3QO3 A;  1EIF A;  2HCK A;  2XG8 D;  2LT1 A;  1Q82 R;  2D8H A;  4M7D G;  1AD5 A;  1ZBJ A;  3QZ5 B;  2WHB B;  1Y96 B;  4C5E A;  4BBR M;  3FIF A;  4OMF B;  2QAS A;  3CCE Q;  4M78 E;  5DLQ E;  4FIB A;  2VGN A;  2E10 A;  4JDS A;  3EFO A;  3RGF B;  1TU0 B;  2VXE A;  3DL1 A;  2EYQ A;  4DEX A;  3U23 A;  5GAN f;  3I55 Q;  1GBR A;  2K5L A;  2X4Y A;  2VWF A;  1ENW A;  3X28 B;  2VUB A;  2LNH B;  2BZX A;  2F1L A;  1WFW A;  1JJ2 P;  3UDC A;  1RL2 A;  5GAO q;  3S3N A;  2RJE A;  4CFV B;  1JXO A;  1SPK A;  4XAX B;  2HDA A;  5IT9 E;  5GAM j;  1Z9Z A;  2NUP A;  5GJW B;  2EQJ A;  3PO3 S;  2AZV A;  2SEM A;  4KT0 E;  1WJS A;  3M54 A;  3LYI A;  1PKS A;  4HL4 A;  3PFS A;  2ZPE B;  4PJL A;  2JUF A;  5EFQ B;  2K2V A;  2K3X A;  4EC9 B;  2C5X B;  2EQI A;  3GIB A;  3QXE B;  2E5K A;  3OB9 A;  2EQK A;  4IIM A;  2OX7 A;  1VQ7 T;  3NHN A;  2BUD A;  2VV5 A;  2BKD N;  4HLQ A;  2CT4 A;  4OMQ A;  1PSF A;  2FZC B;  4IKF A;  4KGV B;  3BW1 A;  2W96 A;  2DBM A;  1N4M A;  3I5R A;  1WHG A;  3VUZ A;  3G6E T;  2JMA A;  7AT1 B;  2EIF A;  2IIM A;  2BS4 A;  4HNV A;  3TEE A;  1RAI B;  5GMK e;  2LRQ A;  1KFZ A;  3JCM V;  3K7A M;  3MY1 B;  4A4K A;  3M0T A;  1SRL A;  1UG1 A;  5LMK B;  3G33 B;  1IRX A;  2KNB B;  1SF9 A;  2Y4Y A;  3UF4 A;  3OYK A;  4HA8 A;  3CME T;  2ZPF B;  3M03 A;  4QVD A;  3HKS A;  1TFB A;  5I5Z B;  1OL1 B;  4LDY A;  4CC4 B;  2ZCF B;  4BY6 C;  1OX9 A;  3TRE A;  2X4J A;  4EOL B;  2YUO A;  4M75 G;  2CUD A;  4WTO B;  2LJ0 A;  3ZL7 C;  1VIE A;  4OF1 A;  2NWM A;  4MZP A;  2D8J A;  4XK8 E;  5HK0 A;  2L8D A;  2YWW A;  2EKO A;  2DO3 A;  1PM3 A;  2L0A A;  5AT1 B;  3P8H A;  4LXC A;  5GAN d;  1R0B G;  3M0S A;  1PNJ A;  3OYY A;  4E47 A;  4XTY A;  1H64 1;  2QQB A;  3VS4 A;  3TSW A;  2EW3 A;  5FU7 B;  1LNX A;  4CFU B;  3CCR T;  3LGF A;  4AFS C;  3G7Z A;  3OYN A;  5GAN 4;  4GLK A;  3VS5 A;  2KEA A;  4J9G A;  1SRM A;  1YIJ T;  3G1J A;  4K11 A;  1WXB A;  1LOJ A;  4Z88 A;  5LJ5 g;  4MDW A;  3GNG A;  1T0H A;  1VYW B;  1X6O A;  4EOO B;  1Q95 G;  1I07 A;  3I56 Q;  2UZB B;  1QCN A;  2E70 A;  1H1R B;  2J05 A;  1Q7Y U;  3CCL T;  3M5A A;  1KHC A;  1YI2 Q;  4C92 E;  4DOV A;  1YJ9 A;  1VOL A;  1WPY A;  4ELZ C;  1FIN B;  2LVM A;  4R56 A;  3PMI A;  3BG9 A;  1IZ6 A;  3CD6 Q;  1OKV B;  1OV3 A;  1TUG B;  2QG9 B;  1VQ5 A;  1UJ0 A;  1VQP T;  2QGG A;  2DJQ A;  1VQM T;  5KYY B;  1W2B S;  4LDU A;  2JNG A;  2MMP A;  2EQU A;  4M77 D;  1IGU A;  5GMK h;  2QEX A;  4BE1 A;  3QYG B;  1M1K C; 
#chains in the Genus database with same CATH homology
 4A53 A;  3QDR B;  3A5Z B;  1K73 U;  2R5M A;  2PQW A;  1VQP A;  1QLB A;  4BY6 B;  4PKC C;  2DD4 B;  1YHQ A;  3MP6 A;  3PGG A;  4XU3 A;  4R55 A;  5A2Q E;  3NTH A;  1BIB A;  1M4Z A;  4M7A A;  4NOY A;  3WVD B;  2EAY A;  2QQR A;  4L59 A;  4PJO G;  1BI0 A;  1Q81 C;  4C8Q D;  3ZBD A;  3CC7 A;  1U8R A;  4PLL A;  3SDZ A;  4JUV A;  2OTL A;  4M7A D;  5I2M A;  3M58 A;  2FYK A;  3CCU A;  1YJ9 T;  4X9D A;  4N4I A;  4C92 G;  3BY7 A;  4EDU A;  3M53 A;  2DJZ A;  4IUQ A;  1WJR A;  3NTI A;  2DZ9 A;  5DM7 R;  2RD1 A;  2KVQ G;  3OW2 S;  3KXT A;  3JCM e;  1XTD A;  5FRO A;  4C8Q B;  3OYF A;  4M78 F;  2RHU A;  3SWN C;  5DLO A;  4ZGE B;  4N0A C;  5A0L A;  4L5G A;  3E19 A;  3V8L A;  4LD9 K;  3MO8 A;  4XTV A;  4M6V A;  2E64 A;  4HKE A;  1BI2 A;  2MI6 A;  3QYE A;  4J6W A;  4KUL A;  1MGQ A;  2DVE A;  1N6A A;  2CZ1 B;  3QII A;  4NL2 A;  1KHI A;  4B9W A;  1Q82 U;  2HQX A;  4N4G A;  2XHC A;  1N8R U;  3FJP A;  3CCV A;  4LDX A;  4PJO D;  1JRI A;  4C0Z A;  5IN1 A;  1UGQ B;  2K5F A;  5GAO n;  3P8B B;  2O4X B;  4EMG A;  1UB4 A;  2PUK B;  5KE2 A;  3QYB A;  4JX5 A;  4FM4 B;  3EAE A;  3GLX A;  4BB7 A;  4BE0 A;  5GMK j;  1VQK A;  4RKU E;  2LNV A;  5J3B A;  1B34 B;  3CBO A;  2QEX T;  3M55 A;  1U1T A;  4Y28 E;  3HBL A;  1I4K 1;  3SD4 A;  3MEV A;  2QDY B;  1ZBX A;  4M77 A;  2DEQ A;  4MML A;  4WF2 A;  5LJ3 j;  1UGP B;  1YCY A;  1OZ3 A;  3QKJ A;  5LJ5 j;  4JS4 A;  2CS7 A;  1AHJ B;  1G3S A;  1YHQ T;  3CC2 A;  2XDB A;  3QG1 A;  4F7U A;  1UEB A;  5EJC A;  3BG3 A;  1K9M U;  2YLB A;  1ZHI A;  2HD0 A;  2OTL T;  3CC7 T;  4C8Q C;  3VJP A;  5HKC A;  3CCU T;  3OMC A;  2P0Q A;  5L8R E;  3JB9 D;  4M77 E;  5CKE A;  5CO7 A;  2XK0 A;  4BDZ A;  4MFD A;  5FRN A;  1KC8 U;  5HY6 A;  3QUI A;  3CC4 A;  2X35 A;  4RCB A;  4FU6 A;  3CCM A;  2VYT A;  2RHI A;  3QJY A;  4LDV A;  4QW2 A;  3OYG A;  4F7U E;  4JLG A;  4JRP A;  5CVI A;  4V2S A;  1OI1 A;  2KDS A;  3NTK A;  1BIA A;  4XTU A;  5KCO A;  4HT9 A;  2LT4 A;  3ZFJ A;  3TCJ A;  3CCS A;  4CI0 C;  2H3J A;  2D0Q B;  3L2U A;  2GCX A;  3JCM g;  1VQ8 A;  3AHU A;  2RH2 A;  3M4Y A;  4C8Q E;  2B8A A;  4M7A E;  2E65 A;  4FL6 A;  2HAX A;  1WJQ A;  2RO0 A;  3CBP A;  4XQ3 A;  4YTL A;  4M7D C;  3CCV T;  3L42 A;  2YRV A;  3OS5 A;  3V8K A;  4Z02 A;  3S3O A;  3VKH A;  4J6X A;  2PU9 B;  4PJO A;  4PNO A;  4AKI A;  5C6S A;  3F70 A;  2DXB B;  1VQK T;  1KG1 A;  3G71 T;  4Q5W A;  3M59 A;  4C0F A;  4C92 A;  4JS5 A;  4ZTF A;  2F69 A;  2ZZD A;  5GAN 2;  2JZ2 A;  1YBY A;  2BIV A;  2IVW A;  3PNW C;  1FKM A;  4NS5 A;  1QW1 A;  4JRQ A;  2CZ7 B;  1G3Y A;  4A4F A;  3RMS A;  4BAC A;  1QVF A;  4UC4 A;  2XD0 A;  4PJO E;  3FDR A;  4IUR A;  4MDX A;  3BG5 A;  5CQX A;  4OVA A;  3CC2 T;  2EQM A;  3OY9 A;  3VYH B;  1X01 A;  4HCZ A;  1KD1 U;  3HO8 A;  4M75 B;  1TH7 A;  2QQ9 A;  4VUB A;  2EJ9 A;  3J7A F;  3JCM d;  2M1H A;  2G77 A;  2HNI A;  4O6J A;  5D6W A;  3J80 E;  1M1K U;  3HZJ A;  4ELJ A;  4MZT A;  2PVG B;  4C0D C;  2AHJ B;  3QHS A;  3QWL A;  2Y90 A;  3CC4 T;  3CCM T;  3VYG B;  2DIQ A;  1VQN A;  2V8J A;  1UGR B;  3DB4 A;  4P5N A;  2M16 A;  3DLM A;  2QQA A;  3CCS T;  2ZGW A;  2E6N A;  2RJC A;  3WXM B;  1Q81 U;  4M7D D;  1BI1 A;  2VC8 A;  4HCB A;  2MAM A;  1VQ8 T;  3FEO A;  3VKI A;  3A8L B;  2QXF A;  1VQ4 A;  1M5Q 1;  3JCM h;  4C8Q G;  4ZGJ B;  4XU1 A;  5GAM e;  1RI0 A;  3PIP A;  3HB9 A;  2I2L A;  2K3Y A;  4QQD A;  3CCE T;  4M7D B;  2OTJ A;  2D9T A;  4X9C A;  1OYX A;  2E1H A;  4OB2 B;  1N9S A;  5GAN j;  2K57 A;  2E6Z A;  3OYI A;  4MIM A;  1NJI C;  3C12 A;  2L5Q A;  3INZ A;  3Q1J A;  3CXC S;  5J39 A;  4M77 F;  2EJF A;  3JCM Q;  2KSS A;  3I55 T;  4QQ6 A;  3GP8 A;  1D3B B;  4BI8 B;  2GF7 A;  4BBS M;  4EPC A;  2ZPH B;  4M75 C;  4DOW A;  4F7U F;  3MCA B;  5CIU A;  2DTH A;  2WSF E;  3JB9 H;  3URG A;  3MP8 A;  5KE3 A;  1DJ7 B;  5CKH A;  3E1S A;  3H8Z A;  4X34 A;  4BI3 A;  4BD3 A;  4BI4 A;  2ZPB B;  3OSS C;  4ZN3 A;  3VKG A;  5A0G A;  1W2B A;  2XIC A;  3JCM c;  4M7A F;  3E9F A;  2LQK A;  3V7C A;  3CMA A;  2K4Y A;  3RKW A;  2DPP B;  2LC4 A;  3LWH A;  1VQO A;  3GOX A;  3ME9 A;  1O75 A;  2DKG A;  1HXD A;  1VQN T;  1WGS A;  3QPH A;  1NZ9 A;  1VQ5 T;  4JX6 A;  3HRS A;  3FB9 A;  4ATO A;  3DB3 A;  5CR2 A;  1KQS A;  3OBW A;  4J6Y A;  3SWN A;  4HCC A;  2PVO B;  3MP1 A;  1JBM A;  4N0A A;  4A4E A;  2IG0 A;  1LJO A;  5GAO r;  2RK1 A;  5LJ3 f;  5LJ5 f;  3MEA A;  4BDY A;  3JCM J;  1VQ4 T;  1R8O B;  2DXC A;  4M7D A;  3JSC A;  4PJO F;  2DXT A;  2FB7 A;  2E41 A;  2QQ8 A;  4M78 D;  3JB9 G;  3OYE A;  3ASK A;  1JB0 E;  4J7F A;  1I5L A;  5FU6 B;  2OTJ T;  4C92 F;  3OSV A;  4RMO A;  2KMG A;  3H6Z A;  3C94 A;  5LL6 S;  4EMH A;  3OYL A;  1XOV A;  5GAM g;  2KR6 A;  4QVC A;  2EJG A;  3HFN A;  3JRZ A;  3QJ6 A;  2DD5 B;  4MMK A;  4E7I A;  4M78 B;  3PIO A;  2DD4 A;  4E7J A;  4M7D E;  1GXI E;  3S3M A;  3RES A;  3OW2 A;  2XU8 A;  2YHT A;  1KQ1 A;  3CPW S;  2Y4X A;  3TW6 A;  4L6V 5;  3JAM E;  1I81 A;  3MEW A;  1X75 C;  1Q86 C;  1Y07 A;  4BE2 A;  3G4S A;  2VGM A;  4XTX A;  4OGE A;  5EG2 A;  3CEY A;  2RHX A;  3SB2 A;  2FL7 A;  1M1F A;  3QZ9 B;  5HK3 A;  1BI3 A;  2V8K A;  2KMT A;  2DK3 A;  3C4S A;  3O8V A;  4C8Q A;  3CMA T;  3V7S A;  3HPW A;  3JB9 F;  2A3L A;  4O5V A;  1VQO T;  5GMK i;  3A8G B;  2YLC A;  2BS3 A;  4EMK B;  3OYD A;  1VQL A;  3CBM A;  3JCM X;  1K8A C;  3DLL A;  1XNI A;  1H3Z A;  2FVU A;  2P4T A;  2QFZ A;  5GAM d;  5KH6 A;  3NFC A;  4PLI A;  4LD6 A;  5FU6 C;  2ZPI B;  2O4X A;  2RB6 A;  5CCA A;  3V7R A;  3CPF A;  1QVG S;  4MFE A;  4DQ2 A;  2M9U A;  4J83 A;  3QYH B;  4KBM B;  3A8M B;  1NPP A;  2KY9 A;  3M9Q A;  4RG8 A;  1G3W A;  1V29 B;  4M78 C;  5A0D A;  1B34 A;  4J5Y A;  3CPW A;  3V8J A;  4ME7 A;  1FWZ A;  5D6X A;  1G5V A;  4E7L A;  1O9S A;  3E9G A;  2R57 A;  2HQE A;  2DD5 A;  3QBY A;  3QO3 A;  4II1 A;  2F5T X;  1EIF A;  4RG2 A;  3GPL A;  1JJ2 S;  4M75 D;  5GAM h;  2XG8 D;  2LT1 A;  3I56 A;  2DIG A;  3TW7 A;  1Y71 A;  4M7D G;  3M4G A;  3QZ5 B;  1S72 A;  3OS0 A;  3OYJ A;  4HT8 A;  2KQW A;  3TU4 K;  1YI2 A;  4LOC A;  3LGL A;  1Y96 B;  3HRU A;  4C5E A;  4BBR M;  3FIF A;  4OMF B;  3A8O B;  3OYH A;  3BDU A;  2WSC E;  4M78 E;  5DLQ E;  2RI5 A;  3EFS A;  4FIB A;  3G4S T;  4KUD K;  1NJI U;  4Z6Y A;  2VGN A;  4EMK C;  2E10 A;  4JDS A;  3CD6 A;  1IRE B;  4Y91 A;  2VXE A;  1VQ6 A;  3DL1 A;  3RKX A;  3PMT A;  2EWN A;  2EYQ A;  3CCJ A;  4B9X A;  5LJ3 g;  5GAN f;  1YJW A;  1VQ7 A;  3MHX A;  3L2Z A;  2K5L A;  1MHN A;  2JN0 A;  2X4Y A;  4FT2 A;  1VIF A;  2E12 A;  1VQL T;  1N27 A;  2PVD B;  3X28 B;  2VUB A;  4IUU A;  3KBG A;  1M90 U;  2D6F A;  2XDP A;  3HP9 A;  5CK9 A;  4M7D F;  2RI2 A;  2DTO A;  3MEU A;  1JJ2 A;  2ZPG B;  4XU2 A;  3UDC A;  1RL2 A;  2LDM A;  3ZEH A;  2PUO B;  5GAO q;  2RJE A;  1QP3 A;  3S3N A;  3G6E A;  3LLR A;  2DXB A;  1YJN A;  2JTM A;  1XQH A;  2C06 A;  2O01 E;  4XAX B;  2WAC A;  4JRI A;  1M1G A;  5IT9 E;  2LX9 A;  2CGH A;  2X4X A;  4IUP A;  5GAM j;  4NC6 A;  3VV0 A;  1QP2 A;  2LTO A;  3I56 T;  1Y7X A;  2MWO A;  5GAN e;  4MZM A;  2EQJ A;  5GAO p;  1S72 T;  2QDJ A;  5J26 A;  3CME A;  4M75 A;  4KT0 E;  5GAN 8;  1WJS A;  3M54 A;  1YI2 T;  1I8F A;  3LYI A;  1Q7Y C;  1M90 C;  4HL4 A;  4OB3 B;  2ZPE B;  3ER0 A;  3PFS A;  4QVZ A;  3JCM f;  5KCH A;  3L2Q A;  4C8Q F;  2L3R A;  4M78 G;  1BYM A;  3WVE B;  2JUF A;  4JLI A;  3HRT A;  3A8H B;  2K2V A;  3LW5 E;  3M57 A;  2K3X A;  3EFR A;  3VYG A;  3CD6 T;  3GIB A;  3QXE B;  2JOY A;  4CRI A;  3OB9 A;  1VQ6 T;  3SFM A;  4M75 E;  2EQK A;  3UPU A;  2XID A;  2WSE E;  4OP0 A;  3PTA A;  3CCJ T;  1YJW T;  1VQ7 T;  2BUD A;  2VV5 A;  2BKD N;  4HLQ A;  2R5A A;  2X4W A;  4M77 B;  4JX4 A;  5LJ3 h;  4C5I A;  5LJ5 h;  1PSE A;  4J8O A;  1Q86 U;  1PSF A;  3L2W A;  2F5K A;  4E7H A;  4AI6 A;  4OB1 B;  2XDD A;  4F7U B;  3CXC A;  3JB9 J;  4IKF A;  2KK4 A;  2QI2 A;  3BW1 A;  4IUT A;  5CKF A;  3JB9 I;  3X20 B;  1KQ2 A;  1U1S A;  2GQV A;  3C95 A;  4KUI A;  1WNL A;  4OGC A;  3VUZ A;  1ZQ1 A;  2P0K A;  4M7A B;  3H4C A;  3G6E T;  1YJN T;  2XI9 A;  2EIF A;  3OS1 A;  3LWI A;  1K8A U;  4A4H A;  1D3B A;  4N4H A;  1HK9 A;  2BS4 A;  4HNV A;  3TEE A;  1K73 C;  2R58 A;  5GMK e;  2LRQ A;  4NL3 A;  5FLX E;  1UGS B;  3CCQ A;  2LCC A;  2OAU A;  3HL8 A;  5DY9 A;  2GFU A;  3JCM V;  4A4K A;  2XKO C;  3L2V A;  3CCR A;  3KHI A;  1FX7 A;  2Y4Y A;  3X25 B;  3CME T;  4C92 D;  3UT1 A;  4HA8 A;  3OYK A;  2ZPF B;  2QTX A;  4QVD A;  2VXF A;  5LJ3 e;  3HKS A;  5LJ5 e;  3BDL A;  1YIT A;  5GAN g;  1YIJ A;  3OS2 A;  4LDY A;  4RCC A;  3G71 A;  4PJO B;  2ZCF B;  4BY6 C;  4C5H A;  2RM4 A;  4D6W A;  4M77 C;  2RJF A;  4BUG A;  3RIR A;  3TRE A;  3P8D A;  4XTW A;  4C92 B;  2X4J A;  3X26 B;  2ZZD B;  5C0M A;  1VQ9 A;  4M75 G;  5CAI A;  2QA4 A;  3RER A;  5D6Y A;  1OZ2 A;  1VIE A;  4A54 A;  4OF1 A;  2RHZ A;  3CCL A;  2E5Q A;  4ZGD B;  1BKB A;  1E7P A;  3HFO A;  2KAF A;  3HSB A;  1P92 A;  4MZP A;  2DTI A;  4XK8 E;  5HK0 A;  2L8D A;  1Q82 C;  4QSH A;  1WQ7 A;  1N8R C;  4M7A C;  2DXU A;  4A4G A;  3R6O A;  4PL6 A;  5GAN 6;  2EKO A;  4TVR A;  2DO3 A;  5IAY A;  5M9O A;  2CKK A;  3KUF A;  3PT9 A;  2JVV A;  1QVF S;  5GAN 3;  2QF7 A;  4HNT A;  3P8H A;  3X24 B;  1NPR A;  2RA2 A;  4JRK A;  5CQY A;  5CKD A;  5GAN d;  3GNF B;  4M78 A;  1NE8 A;  3OYY A;  2HBP A;  3VUB A;  1VQM A;  2QQS A;  4XTY A;  4E47 A;  3OA6 A;  4AKG A;  1H64 1;  2QQB A;  2MWP A;  5FU7 B;  3UWN A;  4M75 F;  3CCQ T;  3OYA A;  1LNX A;  3OYB A;  4JJN K;  1VUB A;  4XTZ A;  5GMK l;  3LGF A;  4C5G A;  3CCR T;  4PJO C;  2RJD A;  3CCE A;  4J7I A;  3G7Z A;  4ZTJ A;  2GFA A;  3OYN A;  1K9M C;  5GAN 4;  4GLK A;  5GAO l;  3N5B B;  4C92 C;  3T9N A;  5CKB A;  2DAQ A;  2EFI A;  1YIT T;  3M56 A;  1YIJ T;  2WJ9 A;  2CZ6 B;  5GAN h;  4LDW A;  1QVG A;  3DKM A;  3S6W A;  1KC8 C;  4ELY C;  4QQG A;  1LOJ A;  3OMG A;  5GAN 7;  3I55 A;  3L1A A;  4EMK A;  3HHT B;  4FSX A;  3GNG A;  3OQ5 A;  4MDW A;  5LJ5 g;  5I21 A;  3LH0 A;  1X6O A;  3LX7 A;  4IUV A;  1VQ9 T;  2QA4 T;  3JCM b;  3J81 E;  2E70 A;  5GAM f;  2CZ0 B;  1SSF A;  2CYZ B;  3RMQ A;  3CCL T;  1Q7Y U;  2NLU A;  3M5A A;  4AKH A;  1KHC A;  4C92 E;  2LQ8 A;  4DOV A;  1WPY A;  4ELZ C;  4ZN1 A;  5GMK m;  1YJ9 A;  2LVM A;  2G3R A;  2P0P A;  2A7Y A;  4R56 A;  1WQW A;  3OYM A;  3RKY A;  2RI3 A;  3OBY A;  5GAO m;  3PMI A;  4E7K A;  1M8V A;  1G3T A;  4GY5 A;  4C0G A;  5AYF A;  4M77 G;  3BG9 A;  1IZ6 A;  4DA4 A;  4XU0 A;  3FLG A;  4HNU A;  4OB0 B;  1QVP A;  2FHD A;  1FXX A;  1W4S A;  4F7U G;  3BFM A;  5FU7 C;  1VQ5 A;  1VQP T;  5I2S A;  1M9S A;  1VQM T;  3JCM P;  2RHY A;  2LCL A;  1W2B S;  3SWN B;  4LDU A;  2L89 A;  2RK2 A;  5LJ3 d;  5LJ5 d;  1Y96 A;  4M7A G;  2DZC A;  5GAN 5;  3FC3 A;  3RUX A;  2K5I A;  4C0D B;  2JNG A;  3GF5 A;  2DXC B;  2JTF A;  3MET A;  2V8I A;  3FRN A;  3JCM W;  1KD1 C;  2MF2 A;  2EQU A;  2MMP A;  3OYC A;  2BS2 A;  1N9R A;  2M0O A;  4M77 D;  1KQS S;  4FT4 A;  3VU3 C;  5GMK h;  2QEX A;  4BE1 A;  3QYG B;  3L2R A;  3QSU A;  1M1K C;  5FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...