3X20B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 25 min
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x20B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x20B02
2QDYB 1JB0E 3A8MB 2ZPEB 2DXCA 2PVOB 3HHTB 2PUKB 3VYGB 2DD5A 1PSFA 2PVGB 2ZZDB 1PSEA 2DD4A 2O01E 2AHJB 4FM4B 1QP3A 3A8LB 3WVDB 2DD4B 3A8HB 2ZZDA 3QYGB 2ZPIB 3X25B 1QP2A 1DJ7B 2WSEE 4OB1B 2CZ6B 3X20B 5L8RE 3X24B 1GXIE 2ZPGB 3A8GB 4OB0B 2WSFE 2ZPHB 2CZ1B 1UGRB 2CYZB 4ZGDB 2ZCFB 2CZ0B 2PVDB 1UGSB 1UGQB 2D0QB 3LW5E 4RKUE 4ZGEB 4KT0E 3QXEB 3A8OB 3QZ9B 1AHJB 1V29B 2WSCE 3QYHB 2ZPBB 2DXCB 3X26B 1IREB 2DD5B 3VYGA 2PU9B 3X28B 2DXBA 4L6V5 2ZPFB 4Y28E 4OB2B 4ZGJB 2DXBB 3WVEB 2PUOB 4XK8E 2DPPB 2CZ7B 4OB3B 1UGPB 3VYHB 3QZ5B
chains in the Genus database with same CATH superfamily
4X9CA 3CCJQ 1ZLMA 1YJWT 3JB9I 3KUFA 3GBQA 2CT3A 3CCLA 1BIBA 3VYGB 1YP5A 1M90R 3TCJA 1YJWQ 3VV0A 2WEVB 1Q82C 2K3BA 1WXBA 4J6WA 1V1CA 1KXUA 1TG0A 3VJPA 4M77F 3HBLA 4JRQA 2BZYA 2Y4YA 2YRDA 3RKWA 2DMEA 5KYUB 2GFAA 3M4YA 1VYVA 1YJNA 5DY9A 3X20B 1VQPQ 1NE8A 5KYXA 1G3YA 4E7HA 1T0JA 5CK9A 4A53A 3M03A 2MIOA 2EFIA 3MY1B 5GAMh 4ROCA 4WCIA 2VXFA 2RHZA 4BY1X 1K76A 1M2VB 4IUTA 4EIKA 3OYNA 3L2UA 1QVFS 1BBZA 3UPUA 4F17A 1VQLA 2D8JA 1XOVA 1KQSA 4EOKB 2GFUA 3OS0A 4C5EA 2K2VA 3CC4T 2I2LA 3RDVA 1D1AA 5GANd 1W2BP 2CP3A 2KR3A 3M0QA 1JEGA 5FU6C 1ARKA 2CGHA 4KBMB 3QYBA 1FYNA 1KQSS 1VQ9T 4F04B 1G83A 1JSUB 4TVRA 4M7DB 1KIKA 1WQWA 3BLRB 1U1TA 1RI0A 4TTHA 3KFVA 4XQ3A 3OYIA 1IREB 1YNZA 1NYGA 4RG2A 3VYGA 4DBHA 4XU0A 1TUGB 1OU9A 1IB8A 3CCSQ 4BE2A 4BCNB 3M0UA 1K9MU 3SWNB 3QJ6A 2WMAB 2LNHB 1TSFA 1OULA 3CCST 3MEVA 1OPLA 2DJQA 4M77C 4NL3A 2C5VB 3EFSA 1UG1A 5IAYA 2DPPB 3QHSA 3V8JA 1KHCA 3HPWA 1R8OB 2SEMA 2YUNA 4KGZB 3MP1A 4F7SB 1WHKA 1U8RA 3URGA 3QKJA 4PJOF 2ZZDB 1KSWA 1JXMA 2HDAA 1TFBA 2UZDB 1KQ1A 2ABLA 4GY5A 2KK4A 4BCPB 3VS2A 2OAUA 2YLBA 2M1HA 4EOLB 1HK9A 3VS5A 4DA4A 2LQ8A 1HXDA 1QP2A 1VQ7A 2DTIA 1VQNT 2NYSA 1NG2A 4EMGA 1MHNA 3J81E 3OQ5A 1RADB 4BBRM 1HSQA 3I55T 5KYWA 3CMAT 5GMKm 4OR5B 1UGRB 2SRCA 2DMOA 2DTHA 2I53A 2FVUA 3ASKA 4NSTB 1G8XA 3G71A 3V7RA 2JOYA 5CAIA 3PMIA 3I56A 4ZGEB 3POMA 3ZL7C 3QXEB 3TNIB 4AI6A 1H641 1YHQA 3LGLA 1AHJB 4CFXB 4MMLA 1TTHB 2M02A 3CC4Q 2RI2A 3SFMA 4BI8B 4J6XA 3X26B 3AT1B 5J39A 4KRCB 1ZSZA 2MWOA 4OMQA 5IHKA 2XKOC 1UNHD 4M77B 1VUBA 4UN0A 3M0SA 1AWJA 1FMVA 4M7DF 2L0AA 1UNLD 4RODA 2ROTA 4XTUA 2FPEA 2A37A 3EGXA 1N8RC 1H25B 3H0IA 1EFNA 2CSQA 4AFUC 4J9FA 3P8HA 1R77A 4F7UG 4E7ZA 5ACBA 3QWXX 1M9SA 2RH2A 4HXJA 2PNIA 4XU2A 2CP7A 3CBPA 4B6MA 5C0MA 2HBWA 5DQVA 3V8KA 4C8QD 4IKFA 1VQ5A 2KYMA 1GCQA 3EAEA 8ATCB 3FJPA 2E65A 3OBWA 1JB0E 2KNBB 5HCKA 4M4ZA 1YIJQ 2DYBA 2OTJA 3U23A 2D9TA 1U3OA 2GGRA 2YLCA 1ABQA 3DLLA 3PTAA 3CCRQ 2V1RA 2E64A 1UFFA 1ZP2A 5KCHA 2K6DA 3F70A 2YRVA 2YUOA 3QYGB 4P5NA 2LT1A 5LJ3e 1OGUB 1X75C 1G3SA 5LQFB 2EQIA 4PFPA 4BCQB 4E7JA 3ER0A 2HZYA 2NUPA 3LLRA 4N4IA 1T0HA 2ED1A 2IIMA 1ZUYA 3JB9D 1KC8U 4JLGA 5AYFA 3JCMP 2D0QB 1Q81C 2ESWA 3OYGA 1NJIC 1RACB 2K5FA 1CSKA 1NBEB 1UDLA 2XG8D 2DAQA 2JVVA 3KHIA 1JBMA 4Y91A 4IIOA 2QASA 4BCFB 4BB7A 2LP5A 1TOVA 4II5B 2YUPA 3OS1A 3MHXA 5GAOn 2MI6A 2GNCA 3S3OA 3UDCA 4E6RA 4NOYA 2C5NB 4A4GA 3CCQA 2EPDA 4EDUA 3DL1A 2OTJT 4RTYA 1QLYA 1YWOA 1PNJA 2QEXT 3OW2A 5D6XA 5DM7R 2DF6A 1SHGA 4JX4A 2Y90A 4J9GA 2EBPA 4R56A 2EGCA 4M75F 3DJBA 5CIUA 4C92B 4J7FA 5HVYB 1VINA 2HD0A 2DXBB 1TXQA 1M3CA 1TUDA 4C0GA 2VYTA 1CKBA 1AZGB 2V8KA 4D6WA 3OYHA 1VOMA 2F5TX 2XIDA 4HNUA 2F2CA 1RAHB 2EQJA 5GAOr 2WACA 2AZSA 2E70A 3BDLA 3TNHB 1PWTA 5LJ5f 2DXUA 2PUKB 3KXTA 3GLXA 5GAMd 2QQRA 4K11A 4M78E 4OF1A 4OVAA 2EWNA 4JJDA 2DX1A 2DZCA 1E7OA 2J7IA 3NGPA 1I0CA 1VYTA 1M90C 2BPMB 4FM4B 5EC7A 2KVQG 5D7UA 3A8HB 1MNDA 4M7AD 2X35A 2BUDA 2WSEE 4R0KA 3G6ET 4M7DE 3HRUA 3NDQA 2KROA 1JXOA 3V7SA 1BI3A 2RHXA 4HL4A 1N4MA 3WXMB 3PE0A 4G6LB 1UJYA 2RHYA 3OYAA 3JCMf 3BE3A 1UGSB 2M0YA 4N4HA 2KY9A 4KGXB 1D0YA 4PJNA 2VVKA 3OB9A 3OYBA 4LN2A 4JS5A 1X6GA 4XTVA 3QZ9B 1Y07A 2EQMA 4A4EA 5LJ3g 2A36A 1K8AU 1GCPA 2RF0A 2EYXA 4C92F 4C92G 1QQJA 4E7IA 2K79A 5GMKe 2G3RA 2ED0A 3M4GA 1FXXA 3CCEQ 2YUQA 1HD3A 1EX4A 2J05A 3L2RA 3CCLQ 4LXCA 3GNFB 2LCSA 2EW3A 3HRTA 2NWMA 3GP8A 3CQTA 2ECZA 2DETA 5GANh 1H3HA 5LJ5g 2CP5A 2ZPFB 5GAOp 4JLIA 3FLGA 3CPWA 4PLLA 4M7AA 2YWWA 1H1RB 4OMMA 1H3ZA 4BCJB 3QUIA 2A0FB 4N0AC 2LX7A 2PK2A 2ZAEA 4HNVA 2EYWA 1JJ2A 3VYHB 4JRPA 2MYSA 3CBMA 2QDJA 1LCKA 2CT4A 4RTXA 2E4HA 2JMAA 1R0BG 1X2QA 2K5LA 3JRZA 3BHTB 1VQLQ 2DD5A 3CEYA 3HFOA 1VQ9Q 2P0QA 4OP0A 3L1AA 4D8DA 3CCET 3HZJA 1Y57A 4J5YA 2DEUA 1UB4A 1VQOQ 2YT6A 2CH4W 5FWCA 1B34A 2O4XB 2ZPIB 4OMNA 1Q95G 1NJIU 4JJBA 3CCVQ 3SWNC 3NTKA 3BW1A 2QA4A 5KE3A 1OL2B 2WXVB 3EH1A 3A8GB 3H0FA 4KH0B 4A63B 1NPPA 4KUIA 2YDLA 2XDDA 2PHGA 5FRMA 1PKDB 3G1JA 2JUFA 5CKEA 3GIBA 5I2MA 1X6BA 2CUBA 5C6SA 1VQMA 1K8AR 4RKUE 4HNTA 2GQIA 1UECA 5IXFA 1JOWA 3IQLA 3LGFA 5FU6B 1PHTA 3LWIA 3NMZC 1JO8A 3DTOA 1H1PB 2FRWA 3G4SQ 1UNGD 3UT1A 2L89A 3EIDB 4PJLA 2DXCB 1Q86C 4XTWA 4CFWB 1W98B 3H6ZA 4A4HA 4M78G 5KYNA 3PO3S 3CMAA 4XU1A 2RQTA 2DD5B 1VQ4T 1OIUB 4X1VA 2QDLA 4F6UB 2L8DA 1QKXA 1VQ6T 3AHUA 1S1NA 5GAN6 2F2WA 4OGRB 1OV3A 3QWYA 5HK3A 1ZUKA 3META 4QKUA 1BCMA 2LQKA 5ECAA 1VQ6Q 2VUBA 5LJ5h 2E3HA 4HT8A 4OGEA 3I55Q 1M1GA 2QQSA 4A4FA 3OS5A 4RTTA 4QVCA 2D8HA 3FC3A 5DLOA 3CBOA 1RLPC 2ZGWA 2QDYB 1SRMA 4CC3A 1YN8A 4MZMA 4HCBA 3M58A 1WYXA 3R6OA 2EKOA 3G71Q 2LX9A 4BCKB 2KDSA 1TS9A 4II1A 1UHCA 1ZA1B 1AD5A 2JT4A 4BI4A 2DD4A 4PJJA 4J9CA 3PGGA 2RM4A 4BI3A 1VQ8T 5LJ3f 5CCAA 2DD4B 3QYEA 1CKAA 4YOZA 3OS2A 2QAZA 1NLOC 4DBFA 3HFNA 3MEWA 4EOJB 1YJ9T 2IW9B 2RQRA 3H8ZA 4PNOA 1VQ4Q 2DKGA 4PJOC 2K4YA 1WIEA 4BE1A 5LJ5d 1YFNA 2HL3A 2R5MA 2D1XA 2DNUA 2XDPA 1Z9QA 2GQVA 3UF4A 1QVFP 2JNGA 2V26A 4EOOB 4JJNK 3LW5E 1A0NB 4IMYB 2V8IA 1WJQA 4X34A 3CCEA 2FHDA 1IHVA 3QJYA 2RQWA 2BS4A 1G3NC 4C5HA 5CKHA 2DERA 2KQWA 3KBGA 5KYUA 4BUGA 2DL8A 1VQKQ 2LJ1A 3QYHB 1QWEA 1MUZA 3RBBB 1PD1A 1TH7A 5GAMf 1OI1A 1VQ6A 4MFDA 1ZBJA 2C0IA 3S6WA 5FU7B 3SEMA 2L3SA 3CCRT 3G7ZA 3P8BB 1M30A 3HTRA 1H8KA 2JJ9A 2PQWA 2W9FA 2COWA 1BU1A 4ZN1A 4EONB 2NUTB 2HSEB 1QCOA 5HK0A 1WX6A 3OYJA 4YOSA 4Y28E 2OTJQ 2CJMB 4MMKA 5GJVB 2QEXQ 4XTXA 1PRLC 3FDRA 4C8QF 2NUPB 1K9MC 4YTLA 3MIAB 2LRQA 3PNWC 4I3ZB 1M2VA 5HNBB 4MDXA 1PM3A 2YSQA 2C0TA 3QZ5B 2CCIB 2RO0A 2DM1A 4F6WB 1W70A 2BS3A 2PVOB 4C0DB 4EMHA 3HHTB 4CFVB 4GLKA 3PT9A 2X3XD 5GAN4 4BXXX 1WHGA 4FIBA 1K8AC 5LJ3h 2XI9A 1SPKA 1NYFA 1G5VA 1IRXA 5IH2A 1X43A 3A5ZB 3CCVT 5J3BA 3VKIA 1UEBA 1RAEB 3BDUA 1SSHA 2P4RA 1E6GA 1I07A 2G6FX 4BACA 1AEYA 3PVQA 2VV5A 2FYKA 2RI5A 1BI2A 1MMNA 1K9MR 4XU3A 2ZPHB 4M78F 3BHVB 2E3IA 2DL7A 2O4XA 3PMTA 2CYZB 4LUEA 1OL1B 5L23A 3CCMQ 3FJ5A 1W2BA 5EG2A 2J6OA 5DLQE 5FROA 3VS3A 1ZSZC 3MP6A 3CCRA 2DO3A 1W4SA 2L3QA 2IG0A 4FL6A 2GF7A 1V29B 1N9RA 1PKTA 1WI7A 2WSCE 4JZ3A 2F2XA 4QW2A 5KYYB 1K9AA 1ZX6A 1N27A 3OBYA 2IVWA 5GAN2 4JRIA 1H26B 2EGAA 1VQ5T 1YHQQ 3OYEA 2JW4A 2HBPA 3L42A 3M56A 4EMKB 2XU8A 4M75E 2M0OA 4IUQA 2D0NA 1VQOT 1AISB 2A08A 4M77E 4AMCA 2CCHB 1BIAA 1YIJA 2BE9B 1AZEA 1B7TA 3PIOA 3CC2Q 5CYIB 5GAOm 5GMKh 2I0NA 3MKDA 3I56T 2KT1A 1WHMA 4F7JB 2PK9B 1MV3A 3PVLA 3OW2P 3EJ1B 5D6WA 1YI2T 1AVZC 2PUOB 1ABOA 3A98A 4OB3B 4FW1A 4HVUA 4HA8A 2YHTA 4M75C 4KRDB 2QQ8A 5CQXA 1E6HA 3NFCA 2RQVA 5FGKB 3MEUA 1M1KC 2JM8A 3DOGB 3ZEHA 1LNXA 1Q7YC 2VGMA 1PSFA 1QWFA 4CC2A 4O6JA 1TU0B 1YCSB 1QVPA 4BBSM 2B86A 1PSEA 2LJ0A 4PKCC 4M7AG 4M7AF 1BU2A 4DOWA 2KGTA 2X4XA 3CCLT 2G9XB 2RJFA 3QO3A 3H4CA 1Y96A 2C4GB 1E7PA 5HBEB 2NUZA 1JKWA 3X24B 2FPDA 2V22B 1WFWA 4KRTA 4QSHA 1KC8C 2WSFE 2PJQA 4MZPA 5KCOA 3EGDA 3HRSA 1GBRA 4PJMA 1YITT 3TREA 5GMKi 1C9BA 2BKZB 4ZGDB 1H24B 1SEMA 4J9HA 3TSZA 2X9HA 1BB9A 4LOCA 1PCXA 5IXBA 2KRSA 2ATCB 1D0XA 1VQKT 1VA7A 1WGSA 3CMET 3J7AF 5A0DA 2EJ9A 4PFOA 3OYYA 1Q7YU 1Q86R 3BLQB 1K73R 1O9SA 1M1KU 4C92D 1VQ7Q 3TEEA 3OYFA 4OMOA 2FZCB 1IGUA 2MK5A 4QT7A 2JTFA 1YIJT 1D3UB 1IO6A 5GANj 1BI0A 4ELYC 2EJFA 4HCZA 3G4ST 2EYZA 1H4LD 4Z6YA 1B07A 2X1NB 4M7AB 1NEBA 2LQWA 4M75B 3CCSA 2K57A 2KE9A 3CPFA 3B57A 3CD6T 1XTDA 3EG0A 3SD4A 2B9RA 5FWBA 4KULA 2DXBA 2KMTA 5GAMj 1WNLA 2QGSA 1VQNQ 2JXBA 4DBQA 4ZTJA 2BE7D 4UC4A 4ATOA 3RR6A 2QXFA 1PC0A 1ZSGA 1PG5B 1OEBA 3CMAQ 1H1SB 2F5KA 1JQQA 2DK3A 5HBHB 4AKHA 4VUBA 3JCMe 5IHIA 4HKEA 3TQ7P 1UTIA 1FVVB 4BCOB 3OY9A 5D6YA 2LCLA 4BCQD 4DBRA 4YOOA 5GAOl 2FZGB 1EZZB 3E19A 1AT1B 1ZA2B 3GOXA 1LOJA 2MF2A 1KHIA 2LMJA 5CR2A 3JB9H 2CSIA 5I21A 1XO2A 4M78B 2CP2A 1N9SA 1QP3A 2AZVA 3A8LB 4FSXA 3EGDB 2R5AA 2RNAA 4E47A 5KYXB 3TW6A 3I55A 3NHNA 3OSVA 3X25B 4OB1B 3EG3A 2EGEA 3QHRB 2C06A 1X2KA 3H41A 3RNJA 2VC8A 1GY3B 3M0TA 4MZTA 4L5GA 2KRMA 5CO7A 4PJOE 3CC7T 1RUWA 1YBYA 4RTWA 5GAN5 4J9BA 2CUDA 1AD6A 2Y4XA 4ME7A 2OX7A 3I9QA 5LJ3j 4BDYA 3RMQA 4AFQC 3J80E 1MV0B 1M8MA 3EG1A 4AFZC 3FEOA 1T3LA 2DL4A 5GAMe 1BK2A 5FRNA 1M3AA 2DXTA 1GUXA 1AWOA 1UE9A 2FL7A 1WJRA 3PFSA 2UZBB 1BCOA 1MGQA 1NEGA 2O2OA 2L3RA 3EFOB 1YJ9Q 5GJWB 2C5OB 4LD6A 3JB9G 2A28A 1M1KR 4XTYA 4C8QA 4V2SA 1I1JA 1QVGS 2HKNA 1Y0MA 5I22A 1S72Q 3REAB 4ESRA 3JCMQ 2DTOA 1JJ2S 2DBKA 1RAGB 2QQBA 2QK0A 2C5XB 3SWNA 3CD6A 5I5ZB 5I2SA 2MAMA 3RMSA 2QA4T 2AIRB 2HQXA 3NPFA 4C8QB 1H92A 3MJXA 1D0ZA 2JMCA 1WLPB 1QKWA 3P8DA 1D1CA 2E5QA 4FYWB 2ZPEB 4FX3B 3MEAA 2DVEA 4J9EA 3N5BB 4M7AE 2P84A 1K1ZA 3VUZA 4OMPA 2JN0A 3I35A 4QVZA 4AG1C 2H3JA 3VU3C 2RK1A 1SRLA 4LD9K 2ZZDA 2RHIA 2CP6A 2GTJA 1VOLA 2O9VA 2EJGA 4OB0B 1WHHA 2RB6A 2DJZA 2H8HA 3EG9B 3I56Q 1ENWA 2W10A 1RI9A 4FT4A 2KBTA 3CMEQ 4PJOB 1OPKA 2D6FA 1UGQB 2CH4A 1XJWB 4ELZC 3M9QA 1UHFA 1PD0A 2HQEA 3QG1A 3BFMA 3OMCA 3JCMV 4BD3A 3LH0A 5GAOq 4EMKC 2L5QA 1OKWB 4F7NB 1N6AA 4BCND 1NM7A 2X4JA 2IN3A 1Q82U 4C8QC 2FO0A 1K73U 2KI7A 4JPBW 5IDNB 1MMDA 4RUGA 6AT1B 3S3NA 2DFUA 3TN8B 4M7DD 2HL5C 4RCBA 1P5EB 2P0KA 4CFUB 2OJ2A 2X3WD 4JX6A 1OZ3A 5LMKB 3MP8A 4ZN3A 2DYIA 4LDXA 4CRIA 2QTXA 3M59A 3CC2T 4IUUA 5LJ5e 2JTEA 4M78A 4FYYB 2CS7A 3M0RA 3VUBA 2FG0A 1VYUA 4AKIA 3OMGA 1IZ6A 1Z9ZA 2LNVA 3VRYA 3CCQQ 1YI2Q 4BY7X 3LQ5B 2MCNA 1Q7YR 1Q86U 4E2FB 4EPCA 4QQ6A 1OOTA 3VS4A 3CCQT 1W2BS 4B9XA 3DB3A 2CP0A 5GANg 3JSCA 5J26A 2HQHA 2EYQA 1VQ7T 2MPXC 1VQ4A 3MCAB 2KR6A 2DA9A 4GLMA 4YC3B 3OYMA 1GCQC 3RESA 3CMEA 3O0GD 1NJIR 2VASA 2XDBA 5LJ3d 5AT1B 1YHQT 4EOIB 2COZA 1LVKA 5KH6A 1UJ0A 2MWPA 4RMOA 1W6XA 1OU8A 2WMBB 4M7DA 4JX5A 4PL6A 3FB9A 4C92A 1M8VA 2ZPGB 2V8JA 3VRZA 1TUCA 4JDSA 1ZQ1A 2QI2A 2W2HA 3CXCP 2OTLQ 3A1PA 3TU4K 1JSTB 1AOJA 3CPWP 2AK5A 2R57A 1YJ9A 2ZCFB 1BKBA 1C6VX 1RAAB 2OTLA 2V1QA 3QIIA 1QMCA 3CC2A 1RLQC 1K0SA 1HJDA 1IXDA 4R55A 3RKYA 1QW1A 3QHWB 1JU5C 1ZSZB 1D1BA 2DILA 1EIFA 2LT4A 3M53A 2W96A 3C12A 2VB6A 2WHBB 2LCCA 2IW8B 1QCFA 9ATCB 2LQNA 2DRMA 2KXDA 3NTIA 1YITA 4JJCA 3RGFB 3M0PA 2P0PA 4DEYA 2XMFA 5KYWB 4IURA 3CCMA 3CD6Q 5LL6S 1PKSA 3F5XB 5LJ5j 1NPRA 2BIVA 2F1LA 5DQWA 3HSBA 4M75A 2E12A 2JM9A 1GUXB 1RL2A 3DDPB 2M16A 4DOVA 3UATA 3G33B 2EKHA 4BCMB 2GTOA 2RHUA 1KFZA 4BCGB 1QMZB 4J8OA 1B34B 3JCMg 2EAYA 1KD1U 2PVGB 2DLPA 2BZXA 1W1FA 1GFCA 3OA6A 2MMPA 3WVDB 1SF9A 7AT1B 3JB9F 4M6VA 2E41A 2E5KA 4E7SA 3QDFA 1G3WA 4F16A 4HCCA 2EIFA 1WXUA 4J7IA 3H9NA 4A4KA 4J9IA 4WF2A 1RAIB 4CXAB 4L59A 1FKMA 2DBMA 4LDYA 4RCCA 5I11A 1O9KA 1M27C 3M57A 1M90U 4NC6A 1SKUB 5BNJB 1P92A 2HCKA 1Y7XA 4KT0E 2FEIA 5GAN7 1M5Q1 3RKXA 3BG5A 4CRLB 3EG2A 5GAN8 3T9NA 4EORB 1SHFA 1WXTA 4FYXB 2C0OA 4CC4B 3VS0A 2W99A 3EFRA 1OQKA 3O5ZA 3CCUQ 3CC7A 1VIFA 1VQ8Q 2EQKA 4IUPA 4E7KA 1VQMT 2AKKA 4AKGA 1N5ZA 5IHNA 2HEQA 2HMAA 1D3BA 4RTVA 1VQ8A 4ZGJB 3CC7Q 2F2VA 1WA7A 4KGVB 4EC9B 3DDQB 1V76A 5GMKl 2LW4A 1RABB 2YXYA 4M7DC 1I5OB 4FSSA 2CZ7B 1QVFA 3GTMS 2JS2A 3O8VA 4J6YA 3JB9J 3INZA 1VYWB 3CCMT 1WDXA 1B3QA 2KEAA 1S72A 4ELLA 5GANe 4AFSC 2C6TB 1X01A 4M78C 4JS4A 1FMWA 4C8QG 5HQ0B 2K5IA 2PMIB 4MFEA 3CXCS 3C95A 3OYDA 1E9HB 2FB7A 3H0HA 2CDTA 2HNIA 2DVJA 3QBYA 1Q81U 2A7YA 2DEQA 4PK4A 2FRYA 2IW6B 4M77D 3UWNA 2F69A 2K9GA 3QWLA 2CZ6B 5L8RE 3V8LA 1M3BA 3BG3A 3D7SB 4MDWA 2RMOA 1Y96B 2KMGA 1C0MA 2FZKB 5CVIA 3FRNA 3CPWS 2OAWA 2X51A 2XD0A 4C0ZA 4FT2A 5KYYA 3OYCA 3TW7A 4BCMD 3EGUA 2CZ1B 1C1AA 4Y92A 1G2BA 2PVDB 4ORZA 2KSSA 3JCMJ 2E1HA 3GF5A 1LPLA 4F14A 5CKFA 1OX8A 3JCMd 2O9SA 1VQPA 4KUDK 2K2MA 2J6KA 1VQ5Q 5GAN3 1U5SA 3E1SA 2NLUA 1OX9A 3LH5A 4E7LA 2R7GA 1WZOA 2O88A 4F7UF 3V7CA 4PJOA 4EMKA 2ZPBB 1NZ9A 3E2UA 2E10A 2DL5A 4LDVA 8AT1B 4IUVA 4F7UA 4Z02A 3HKSA 4LE9A 5HBJB 3DLMA 4PLIA 2G77A 2ROLA 2HKQB 2OI3A 3PIPA 5GMKj 3JCMc 1F1BB 1T3SA 1MNEA 3CCJA 1N8RU 3OYKA 3UA7A 4RTUA 4OB2B 4MIMA 2B8AA 1VQMQ 1UGVA 5IN1A 2E6ZA 2DZ9A 4OGCA 1ZUUA 4XK8E 2PZ1A 2EQUA 4NL2A 4F7UE 4WTOB 3JCMX 2UZEB 3L2WA 2YRCA 3RERA 4CC7A 4LUDA 3G4SA 4BE0A 3CCVA 1Q82R 3EFOA 3A8MB 1H28B 1ZBXA 3REBB 5EFQB 1OKVB 2LC4A 1K73C 4M7DG 2K7AA 3CCUA 2JS0A 2RA2A 1OYXA 3DB4A 1I8FA 2DIGA 2BTTA 1I5LA 4OMFB 1KC8R 1GH6B 4M77G 4QVDA 1VQPT 1IHWA 1XNIA 2UUEB 3TNWB 5HY6A 5A2QE 2AKLA 3TSWA 2JZ2A 4LDUA 4ZTFA 3BG9A 3SDZA 1YITQ 3MI9B 1GL5A 1QVGP 1WHLA 4XTZA 3G6EQ 4Z8AA 4ROEA 1KJWA 4HCKA 2PTKA 3VS7A 2QEXA 2KYBA 5M9OA 3CCJT 2E6NA 1WPYA 2VWFA 4IIMA 3K7AM 4Z89A 3E9GA 4KH1B 2RJEA 1FINB 2DRKA 3HO8A 2CKKA 3M54A 3HL8A 2RJDA 1PRMC 2J06A 1VQLT 2Z0WA 4CFUD 4CFNB 5L2WB 4EOPB 1QLBA 3OSSC 2K3XA 2I40B 4ELJA 1O9KB 4LNPA 3OYLA 2LZ6B 1KG1A 2EVRA 2PU9B 3L2VA 2X4WA 4EOQB 4ANJA 2L2PA 3E9FA 2WJ9A 3EHRA 4C92E 1M4ZA 4BY6B 2OTLT 2KT8A 2W0ZA 3CC4A 3C4SA 2LVMA 1X69A 1VIEA 2BZ8A 3RUXA 2QG9B 1VQOA 2RPNA 3WVEB 1Y71A 2GCXA 1M2OA 2RI3A 3MO8A 2W9ZA 1URCB 4PJOG 2WIPB 4JUVA 1RAFB 1X27A 4PJOD 2XICA 2J6FA 5A0GA 2QGFB 4A54A 3QSUA 2A3LA 4C8QE 4J9DA 4B9WA 1AWXA 2DXCA 2QFZA 4RTZA 3DKMA 4C5IA 3THKA 3L2QA 3EHQA 1KD1R 3LX7A 3SB2A 2AHJB 2LDMA 3BLHB 5KE2A 3HP9A 2KAFA 1YI2A 2RN8A 4QQGA 2BS2A 3CCUT 3VS6A 5GAMg 3R6NA 1OZ2A 1GXIE 4HVWA 4RG8A 4JZ4A 3NTHA 1LJOA 2XHCA 1FX7A 1VQKA 4BCHB 3L2ZA 3M5AA 2R58A 2HAXA 2M51A 3EGXB 1H1QB 1AWWA 3SHWA 4HVVA 4CI0C 4ZNXA 2CZ0B 1GFDA 1NLPC 1JRIA 2KRNA 2LJ3A 1YCYA 4AT1B 4BCIB 2UZLB 2QYZA 4M77A 2KXCA 4M7AC 1OIYB 1OI9B 2EYYA 5FU7C 4C0FA 3FIFA 3JCMh 4AG2C 5ICPB 1D3BB 3ULRB 3G71T 3BY7A 1KD1C 4O5VA 2X4YA 1J3TA 1UUEA 2VXEA 3QPHA 1O75A 3JCMb 4BDZA 2H3EB 4FCYA 1KK7A 4C0DC 3VKGA 5HKCA 3MY5B 4FYVB 3CXCA 2IPOB 3JV3A 1N8RR 1SG5A 1WJSA 1K4US 1FWZA 2AT1B 4BY6C 2BKDN 3X28B 5A0LA 5IDPB 2DL3A 1H27B 3I5SA 2QA4Q 2O31A 2DIQA 3GPLA 2QQAA 3JCMW 1JJ2P 2P4TA 4CFMB 4HLQA 1K0XA 2EUFA 1M1FA 3TVTA 2FPFA 2M9UA 4N0AA 4PFZA 4JRKA 3S3MA 2LTOA 4Z88A 4D8KA 4J83A 1R0CB 2DE0X 2K3YA 4N4GA 1KQ2A 1YJNT 3ZFJA 3ME9A 5CQYA 4FU6A 2WIHB 5CKBA 4F70B 5CEIB 2QGGA 3JAME 2O01E 1YJNQ 3C0CA 4OMLA 3Q1JA 5IT9E 1GRIA 5EJCA 1QCNA 2VGNA 2WPAB 4GBQA 4M78D 3ZBDA 1U06A 4DEXA 1BI1A 3HB9A 4EOSB 1DJ7B 1TWBA 5FLXE 4LDWA 1VQ9A 2QF7A 4F7LB 2RD1A 1TD6A 1ZHIA 1YJWA 1X6OA 4HT9A 1S72T 1BYMA 4Y72B 2RK2A 1SSFA 3BHUB 1F5QB 3VS1A 1QVGA 5GANf 3I5RA 4EC8B 3QDRB 2QTVA 3LYIA 4C5GA 2XK0A 4F7UB 4F6SB 4FW2A 3A8OB 2COYA 1Q81R 1G3TA 5IHYA 1I4K1 4NS5A 1MMAA 5IF1B 4QQDA 3OW2S 1GBQA 2VKNA 4EOMB 4M75G 1U1SA 3LWHA 1XQHA 4M75D 2WFYB 1D09B 2IVXA 2MOXA 3GNGA 2QQ9A 1I81A 5FW9A 3UA6A 1MMGA 3EG9A 1FMKA 3C94A 4L6V5 1ACMB 2HSPA 2RQUA 1KQSP 3VKHA 2CREA 3EH2A 4DQ2A 1WQ7A 1IGQA 4XAXB 3EOCB 2ENMA 4Q5WA 4C92C 5CKDA 1WHJA 2GBQA 3MPUB 3M55A 1HYOA 2L3PA 4X9DA 3G6EA 1VQNA 2JGZB 2JTMA 1UGPB 2RJCA 3RIRA 2NUTA 1YWPA
chains in the Genus database with same CATH topology
4AKHA 4VUBA 4X9CA 3JCMe 1YJWT 3JB9I 1S72A 3KUFA 5GANe 3CBMA 2QDJA 4HKEA 1X01A 2K5LA 3JRZA 4M78C 4JS4A 4C8QG 3OY9A 3CCLA 1BIBA 5D6YA 2K5IA 3VYGB 2DD5A 2LCLA 3TCJA 3CEYA 3VV0A 5GAOl 4MFEA 3E19A 3CXCS 1Q82C 3HFOA 3C95A 4J6WA 3GOXA 1LOJA 2MF2A 2P0QA 4OP0A 3L1AA 3CCET 1KHIA 3HZJA 5CR2A 3JB9H 4J5YA 3OYDA 5I21A 1UB4A 2FB7A 4M78B 3VJPA 4M77F 1Q81U 2HNIA 3QBYA 1N9SA 3HBLA 1QP3A 4JRQA 3A8LB 2Y4YA 4FSXA 2R5AA 3RKWA 2A7YA 4E47A 3TW6A 2DEQA 3I55A 3OSVA 1B34A 2O4XB 4M77D 2ZPIB 2GFAA 3M4YA 3UWNA 3X25B 1NJIU 1YJNA 2F69A 3QWLA 5DY9A 3SWNC 4OB1B 2CZ6B 3X20B 5L8RE 3V8LA 1NE8A 3BW1A 3BG3A 1G3YA 3NTKA 5KE3A 2QA4A 4E7HA 4MDWA 5CK9A 2C06A 4A53A 3A8GB 1Y96B 2EFIA 2KMGA 5CVIA 1NPPA 5GAMh 3FRNA 4KUIA 2VC8A 4MZTA 3CPWS 2XDDA 4L5GA 4C0ZA 2XD0A 4FT2A 3OYCA 3TW7A 5CO7A 5FRMA 4PJOE 3CC7T 2JUFA 2VXFA 5CKEA 1YBYA 3GIBA 2RHZA 5I2MA 2CZ1B 5C6SA 4IUTA 5GAN5 3OYNA 3L2UA 4LD9K 1VQMA 2PVDB 1QVFS 2Y4XA 3UPUA 4ME7A 2KSSA 1VQLA 4RKUE 1XOVA 3JCMJ 4HNTA 2E1HA 1KQSA 3GF5A 2GFUA 5LJ3j 5CKFA 3OS0A 4C5EA 2K2VA 3CC4T 4BDYA 2I2LA 3LGFA 5FU6B 3RMQA 3JCMd 3J80E 3LWIA 1VQPA 4KUDK 5GANd 5GAN3 3E1SA 2NLUA 3UT1A 4E7LA 3FEOA 5FU6C 5GAMe 2L89A 3V7CA 4F7UF 5FRNA 2CGHA 4KBMB 4PJOA 4EMKA 2ZPBB 1NZ9A 2DXCB 2DXTA 1Q86C 3QYBA 4XTWA 1KQSS 2FL7A 2E10A 1VQ9T 3H6ZA 1WJRA 3PFSA 4LDVA 4TVRA 4A4HA 1MGQA 1WQWA 4IUVA 4M7DB 1U1TA 4M78G 4F7UA 4Z02A 3HKSA 2L3RA 3DLMA 1RI0A 4XQ3A 3OYIA 4PLIA 3CMAA 2G77A 1IREB 4XU1A 4LD6A 2DD5B 4RG2A 3JCMc 3VYGA 4XU0A 5GMKj 3PIPA 3JB9G 1VQ4T 4XTYA 4C8QA 4V2SA 1QVGS 2L8DA 3AHUA 4BE2A 3CCJA 1N8RU 1VQ6T 1K9MU 5GAN6 3OYKA 3JCMQ 3SWNB 4OB2B 4MIMA 2B8AA 2DTOA 3QJ6A 1JJ2S 5HK3A 5IN1A 2E6ZA 3META 2LQKA 3CCST 2QQBA 2DZ9A 2VUBA 3MEVA 4OGCA 4M77C 4XK8E 5LJ5h 3SWNA 2EQUA 4NL2A 4F7UE 4OGEA 3JCMX 5I2SA 4NL3A 1M1GA 3EFSA 2QQSA 4HT8A 5IAYA 3L2WA 2MAMA 2DPPB 3RMSA 3OS5A 3QHSA 4A4FA 4QVCA 3FC3A 2QA4T 3V8JA 2HQXA 1KHCA 3CBOA 3HPWA 5DLOA 3RERA 4C8QB 2ZGWA 1R8OB 3G4SA 2QDYB 4BE0A 3CCVA 3P8DA 2E5QA 4MZMA 4HCBA 3A8MB 2ZPEB 3M58A 3R6OA 1ZBXA 2EKOA 3MEAA 2LX9A 2KDSA 2LC4A 3MP1A 1K73C 4M7DG 2DVEA 3CCUA 2RA2A 1OYXA 3DB4A 3N5BB 1U8RA 3URGA 4M7AE 3QKJA 4II1A 4PJOF 1I8FA 3VUZA 2DIGA 1I5LA 2ZZDB 4OMFB 4BI4A 2JN0A 2DD4A 4M77G 4QVZA 4QVDA 3PGGA 2H3JA 2RM4A 4BI3A 3VU3C 1VQPT 1VQ8T 2RK1A 1XNIA 1KQ1A 4GY5A 2KK4A 5LJ3f 5CCAA 2OAUA 2DD4B 2M1HA 2YLBA 3QYEA 5HY6A 1HK9A 2ZZDA 5A2QE 2RHIA 3OS2A 4DA4A 2LQ8A 1HXDA 1QP2A 3HFNA 2JZ2A 3MEWA 4LDUA 1YJ9T 1VQ7A 2DTIA 1VQNT 4ZTFA 2EJGA 3H8ZA 3BG9A 4PNOA 2DKGA 3SDZA 4EMGA 4PJOC 2K4YA 1MHNA 4OB0B 4BE1A 5LJ5d 2RB6A 2DJZA 3OQ5A 3J81E 4XTZA 4BBRM 3CD6A 2R5MA 3I55T 2XDPA 3CMAT 2GQVA 5GMKm 4FT4A 1UGRB 4PJOB 2JNGA 2QEXA 2DTHA 2FVUA 1UGQB 3ASKA 4JJNK 3LW5E 3G71A 2D6FA 3V7RA 4ELZC 2JOYA 3M9QA 5M9OA 5CAIA 3CCJT 3PMIA 3I56A 2E6NA 1WPYA 1WJQA 2V8IA 4ZGEB 4X34A 3CCEA 2HQEA 2FHDA 3QG1A 3QJYA 3E9GA 3BFMA 3OMCA 2BS4A 3QXEB 4AI6A 3JCMV 2RJEA 4BD3A 4C5HA 5CKHA 1H641 1YHQA 3LGLA 2KQWA 1AHJB 3KBGA 3LH0A 4MMLA 5GAOq 3HO8A 4EMKC 2L5QA 4BUGA 2CKKA 3HL8A 2RI2A 3QYHB 1N6AA 2RJDA 3M54A 2X4JA 1Q82U 3SFMA 4BI8B 1VQLT 4C8QC 4J6XA 1K73U 3X26B 5J39A 1TH7A 5GAMf 1OI1A 2MWOA 1VQ6A 4MFDA 3S6WA 5FU7B 2XKOC 3CCRT 1QLBA 3G7ZA 3S3NA 3OSSC 4M77B 1VUBA 4M7DD 4RCBA 3P8BB 2K3XA 4ELJA 3OYLA 2P0KA 2PQWA 1KG1A 2PU9B 4ZN1A 3L2VA 4M7DF 2X4WA 4JX6A 1OZ3A 4XTUA 5HK0A 3E9FA 3MP8A 2WJ9A 4C92E 1M4ZA 3OYJA 4ZN3A 4BY6B 1N8RC 2OTLT 4Y28E 4MMKA 3C4SA 2LVMA 4CRIA 3CC4A 4LDXA 2QTXA 1VIEA 3M59A 4IUUA 3RUXA 4XTXA 5LJ5e 3CC2T 3P8HA 4M78A 4F7UG 1VQOA 3WVEB 1M9SA 2RH2A 1Y71A 3FDRA 4C8QF 2CS7A 1K9MC 2GCXA 4YTLA 3VUBA 2LRQA 2RI3A 3MO8A 3PNWC 4XU2A 3CBPA 4AKIA 3OMGA 1IZ6A 5C0MA 4PJOG 3V8KA 4C8QD 2LNVA 4IKFA 4JUVA 4PJOD 4MDXA 1VQ5A 2XICA 1Q86U 3QZ5B 2RO0A 5A0GA 3EAEA 4EPCA 4QQ6A 3FJPA 4A54A 2E65A 3QSUA 2A3LA 3OBWA 4C8QE 1JB0E 4B9WA 3CCQT 1W2BS 2BS3A 2DXCA 2QFZA 4B9XA 2PVOB 3DKMA 3DB3A 4C0DB 3HHTB 4C5IA 4EMHA 2OTJA 5GANg 3JSCA 2D9TA 4GLKA 5J26A 2EYQA 1VQ7T 1VQ4A 2YLCA 3MCAB 3PT9A 3DLLA 5GAN4 2KR6A 4FIBA 3PTAA 1K8AC 5LJ3h 2XI9A 3OYMA 3L2QA 1G5VA 3RESA 3CMEA 2E64A 3LX7A 3SB2A 2XDBA 3CCVT 3A5ZB 5LJ3d 5KCHA 2AHJB 1YHQT 2LDMA 5J3BA 3VKIA 1UEBA 3F70A 5KE2A 3HP9A 2KAFA 5KH6A 1YI2A 3BDUA 2YRVA 4P5NA 3QYGB 2MWPA 4RMOA 4QQGA 2LT1A 5LJ3e 2BS2A 4BACA 3CCUT 4M7DA 1X75C 2VV5A 2FYKA 1G3SA 5GAMg 4JX5A 2RI5A 4PL6A 3FB9A 1OZ2A 1BI2A 4C92A 4RG8A 1M8VA 4E7JA 2ZPGB 3NTHA 1GXIE 2V8JA 3ER0A 4JDSA 1ZQ1A 1LJOA 2XHCA 1FX7A 1VQKA 2QI2A 3LLRA 3L2ZA 3M5AA 4N4IA 4XU3A 3TU4K 2R58A 2HAXA 2ZPHB 4M78F 3JB9D 1KC8U 4JLGA 5AYFA 2O4XA 2R57A 3PMTA 4CI0C 2CYZB 1YJ9A 2CZ0B 2ZCFB 1BKBA 3JCMP 2D0QB 1Q81C 3OYGA 1JRIA 1W2BA 1NJIC 1YCYA 2OTLA 5EG2A 2K5FA 3QIIA 5DLQE 5FROA 4M77A 2XG8D 2DAQA 3CC2A 3MP6A 2JVVA 3CCRA 2DO3A 4M7AC 3KHIA 1JBMA 1W4SA 2IG0A 4FL6A 2GF7A 4Y91A 4R55A 3RKYA 1QW1A 1V29B 4C0FA 1N9RA 2WSCE 5FU7C 3FIFA 4QW2A 3JCMh 4BB7A 1D3BB 1EIFA 1N27A 3G71T 3BY7A 3OBYA 1KD1C 2LT4A 2IVWA 3M53A 5GAN2 3C12A 3MHXA 4JRIA 4O5VA 3OS1A 2X4YA 5GAOn 2VXEA 3QPHA 1VQ5T 2MI6A 1O75A 2LCCA 3JCMb 4BDZA 3S3OA 3OYEA 3UDCA 4C0DC 2HBPA 3L42A 3M56A 4EMKB 3VKGA 2XU8A 4M75E 2M0OA 5HKCA 4IUQA 4NOYA 4A4GA 3CCQA 3CXCA 4EDUA 1VQOT 3DL1A 3NTIA 2OTJT 4M77E 1YITA 1BIAA 1WJSA 1YIJA 3PIOA 1FWZA 2QEXT 3OW2A 5D6XA 5DM7R 5GAOm 4BY6C 5GMKh 2BKDN 3X28B 2P0PA 4JX4A 2Y90A 4R56A 3I56T 5A0LA 4M75F 4IURA 3CCMA 5CIUA 4C92B 4J7FA 5LL6S 2HD0A 5LJ5j 2DXBB 1NPRA 2BIVA 2DIQA 2QQAA 5D6WA 3GPLA 3JCMW 1YI2T 2P4TA 2PUOB 4C0GA 4HLQA 2VYTA 3HSBA 4M75A 2V8KA 4D6WA 1M1FA 2E12A 3OYHA 2F5TX 4OB3B 1RL2A 2XIDA 2M16A 4HNUA 2M9UA 2EQJA 4HA8A 4JRKA 2YHTA 4N0AA 4DOVA 4M75C 2LTOA 3S3MA 2QQ8A 5CQXA 3NFCA 5GAOr 2WACA 2RHUA 2E70A 3BDLA 4J83A 4J8OA 3MEUA 5LJ5f 1B34B 3JCMg 1M1KC 2DXUA 2K3YA 3ZEHA 2PUKB 3KXTA 1LNXA 4N4GA 1Q7YC 2VGMA 2EAYA 1KQ2A 1YJNT 1PSFA 3GLXA 1KD1U 3ZFJA 3ME9A 2QQRA 5GAMd 4O6JA 5CQYA 4FU6A 4M78E 4OF1A 4OVAA 2EWNA 1QVPA 2PVGB 5CKBA 4BBSM 1PSEA 2DZCA 2O01E 4PKCC 3JAME 4M7AG 4M7AF 1M90C 3OA6A 4FM4B 2MMPA 3WVDB 3Q1JA 4DOWA 2KVQG 2VGNA 5EJCA 5IT9E 2X4XA 4M78D 3A8HB 3CCLT 3JB9F 3ZBDA 4M6VA 4M7AD 2RJFA 2E41A 3H4CA 3HB9A 1BI1A 2X35A 2BUDA 1DJ7B 1Y96A 2WSEE 5FLXE 1G3WA 3G6ET 4M7DE 1E7PA 3HRUA 4HCCA 3X24B 2EIFA 4J7IA 4LDWA 4A4KA 1VQ9A 2QF7A 1KC8C 4QSHA 2RD1A 3V7SA 1ZHIA 1YJWA 1X6OA 4WF2A 1BI3A 2WSFE 1S72T 4HT9A 2RHXA 4MZPA 5KCOA 1BYMA 4L59A 3HRSA 1FKMA 4HL4A 2RK2A 4LDYA 1SSFA 4RCCA 3WXMB 1YITT 2RHYA 3OYAA 3TREA 5GMKi 3JCMf 1QVGA 4ZGDB 3M57A 1UGSB 4N4HA 5GANf 1M90U 2KY9A 3QDRB 4LOCA 4NC6A 1P92A 3LYIA 3OB9A 4C5GA 2XK0A 3OYBA 4JS5A 1VQKT 1Y7XA 1WGSA 4KT0E 4F7UB 5GAN7 3CMET 1M5Q1 3J7AF 5A0DA 2EJ9A 4XTVA 3A8OB 3OYYA 1Q7YU 1G3TA 3QZ9B 3RKXA 1O9SA 1M1KU 3BG5A 1Y07A 2EQMA 4A4EA 4C92D 1I4K1 4NS5A 5LJ3g 3TEEA 3OYFA 1K8AU 5GAN8 4QQDA 3OW2S 2JTFA 3T9NA 1YIJT 4C92F 5GANj 4C92G 1BI0A 4ELYC 2EJFA 4M75G 4E7IA 4HCZA 1U1SA 5GMKe 3LWHA 1XQHA 2G3RA 3G4ST 3M4GA 1FXXA 4M75D 4Z6YA 3EFRA 3L2RA 4M7AB 3GNFB 3GNGA 3HRTA 4M75B 1VIFA 3CC7A 3CCSA 2EQKA 2QQ9A 2K57A 1I81A 3GP8A 3CPFA 3CD6T 1XTDA 4IUPA 4E7KA 1VQMT 5GANh 4AKGA 3SD4A 4KULA 1D3BA 5LJ5g 3C94A 2DXBA 2KMTA 2ZPFB 4L6V5 5GAMj 5GAOp 1WNLA 3VKHA 3FLGA 4JLIA 4ZGJB 1VQ8A 4DQ2A 1WQ7A 3CPWA 4PLLA 4XAXB 4M7AA 4ZTJA 4Q5WA 4C92C 5CKDA 4UC4A 5GMKl 4ATOA 3M55A 2QXFA 4X9DA 4M7DC 3G6EA 1H3ZA 1VQNA 3QUIA 3QO3A 4N0AC 2CZ7B 1QVFA 4HNVA 2JTMA 1UGPB 2F5KA 2DK3A 2RJCA 3O8VA 4J6YA 3RIRA 3VYHB 3JB9J 3INZA 1JJ2A 3CCMT 4JRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDY B;  1JB0 E;  3A8M B;  2ZPE B;  2DXC A;  2PVO B;  3HHT B;  2PUK B;  3VYG B;  2DD5 A;  1PSF A;  2PVG B;  2ZZD B;  1PSE A;  2DD4 A;  2O01 E;  2AHJ B;  4FM4 B;  1QP3 A;  3A8L B;  3WVD B;  2DD4 B;  3A8H B;  2ZZD A;  3QYG B;  2ZPI B;  3X25 B;  1QP2 A;  1DJ7 B;  2WSE E;  4OB1 B;  2CZ6 B;  3X20 B;  5L8R E;  3X24 B;  1GXI E;  2ZPG B;  3A8G B;  4OB0 B;  2WSF E;  2ZPH B;  2CZ1 B;  1UGR B;  2CYZ B;  4ZGD B;  2ZCF B;  2CZ0 B;  2PVD B;  1UGS B;  1UGQ B;  2D0Q B;  3LW5 E;  4RKU E;  4ZGE B;  4KT0 E;  3QXE B;  3A8O B;  3QZ9 B;  1AHJ B;  1V29 B;  2WSC E;  3QYH B;  2ZPB B;  2DXC B;  3X26 B;  1IRE B;  2DD5 B;  3VYG A;  2PU9 B;  3X28 B;  2DXB A;  4L6V 5;  2ZPF B;  4Y28 E;  4OB2 B;  4ZGJ B;  2DXB B;  3WVE B;  2PUO B;  4XK8 E;  2DPP B;  2CZ7 B;  4OB3 B;  1UGP B;  3VYH B;  3QZ5 B; 
#chains in the Genus database with same CATH topology
 4X9C A;  3CCJ Q;  1ZLM A;  1YJW T;  3JB9 I;  3KUF A;  3GBQ A;  2CT3 A;  3CCL A;  1BIB A;  3VYG B;  1YP5 A;  1M90 R;  3TCJ A;  1YJW Q;  3VV0 A;  2WEV B;  1Q82 C;  2K3B A;  1WXB A;  4J6W A;  1V1C A;  1KXU A;  1TG0 A;  3VJP A;  4M77 F;  3HBL A;  4JRQ A;  2BZY A;  2Y4Y A;  2YRD A;  3RKW A;  2DME A;  5KYU B;  2GFA A;  3M4Y A;  1VYV A;  1YJN A;  5DY9 A;  3X20 B;  1VQP Q;  1NE8 A;  5KYX A;  1G3Y A;  4E7H A;  1T0J A;  5CK9 A;  4A53 A;  3M03 A;  2MIO A;  2EFI A;  3MY1 B;  5GAM h;  4ROC A;  4WCI A;  2VXF A;  2RHZ A;  4BY1 X;  1K76 A;  1M2V B;  4IUT A;  4EIK A;  3OYN A;  3L2U A;  1QVF S;  1BBZ A;  3UPU A;  4F17 A;  1VQL A;  2D8J A;  1XOV A;  1KQS A;  4EOK B;  2GFU A;  3OS0 A;  4C5E A;  2K2V A;  3CC4 T;  2I2L A;  3RDV A;  1D1A A;  5GAN d;  1W2B P;  2CP3 A;  2KR3 A;  3M0Q A;  1JEG A;  5FU6 C;  1ARK A;  2CGH A;  4KBM B;  3QYB A;  1FYN A;  1KQS S;  1VQ9 T;  4F04 B;  1G83 A;  1JSU B;  4TVR A;  4M7D B;  1KIK A;  1WQW A;  3BLR B;  1U1T A;  1RI0 A;  4TTH A;  3KFV A;  4XQ3 A;  3OYI A;  1IRE B;  1YNZ A;  1NYG A;  4RG2 A;  3VYG A;  4DBH A;  4XU0 A;  1TUG B;  1OU9 A;  1IB8 A;  3CCS Q;  4BE2 A;  4BCN B;  3M0U A;  1K9M U;  3SWN B;  3QJ6 A;  2WMA B;  2LNH B;  1TSF A;  1OUL A;  3CCS T;  3MEV A;  1OPL A;  2DJQ A;  4M77 C;  4NL3 A;  2C5V B;  3EFS A;  1UG1 A;  5IAY A;  2DPP B;  3QHS A;  3V8J A;  1KHC A;  3HPW A;  1R8O B;  2SEM A;  2YUN A;  4KGZ B;  3MP1 A;  4F7S B;  1WHK A;  1U8R A;  3URG A;  3QKJ A;  4PJO F;  2ZZD B;  1KSW A;  1JXM A;  2HDA A;  1TFB A;  2UZD B;  1KQ1 A;  2ABL A;  4GY5 A;  2KK4 A;  4BCP B;  3VS2 A;  2OAU A;  2YLB A;  2M1H A;  4EOL B;  1HK9 A;  3VS5 A;  4DA4 A;  2LQ8 A;  1HXD A;  1QP2 A;  1VQ7 A;  2DTI A;  1VQN T;  2NYS A;  1NG2 A;  4EMG A;  1MHN A;  3J81 E;  3OQ5 A;  1RAD B;  4BBR M;  1HSQ A;  3I55 T;  5KYW A;  3CMA T;  5GMK m;  4OR5 B;  1UGR B;  2SRC A;  2DMO A;  2DTH A;  2I53 A;  2FVU A;  3ASK A;  4NST B;  1G8X A;  3G71 A;  3V7R A;  2JOY A;  5CAI A;  3PMI A;  3I56 A;  4ZGE B;  3POM A;  3ZL7 C;  3QXE B;  3TNI B;  4AI6 A;  1H64 1;  1YHQ A;  3LGL A;  1AHJ B;  4CFX B;  4MML A;  1TTH B;  2M02 A;  3CC4 Q;  2RI2 A;  3SFM A;  4BI8 B;  4J6X A;  3X26 B;  3AT1 B;  5J39 A;  4KRC B;  1ZSZ A;  2MWO A;  4OMQ A;  5IHK A;  2XKO C;  1UNH D;  4M77 B;  1VUB A;  4UN0 A;  3M0S A;  1AWJ A;  1FMV A;  4M7D F;  2L0A A;  1UNL D;  4ROD A;  2ROT A;  4XTU A;  2FPE A;  2A37 A;  3EGX A;  1N8R C;  1H25 B;  3H0I A;  1EFN A;  2CSQ A;  4AFU C;  4J9F A;  3P8H A;  1R77 A;  4F7U G;  4E7Z A;  5ACB A;  3QWX X;  1M9S A;  2RH2 A;  4HXJ A;  2PNI A;  4XU2 A;  2CP7 A;  3CBP A;  4B6M A;  5C0M A;  2HBW A;  5DQV A;  3V8K A;  4C8Q D;  4IKF A;  1VQ5 A;  2KYM A;  1GCQ A;  3EAE A;  8ATC B;  3FJP A;  2E65 A;  3OBW A;  1JB0 E;  2KNB B;  5HCK A;  4M4Z A;  1YIJ Q;  2DYB A;  2OTJ A;  3U23 A;  2D9T A;  1U3O A;  2GGR A;  2YLC A;  1ABQ A;  3DLL A;  3PTA A;  3CCR Q;  2V1R A;  2E64 A;  1UFF A;  1ZP2 A;  5KCH A;  2K6D A;  3F70 A;  2YRV A;  2YUO A;  3QYG B;  4P5N A;  2LT1 A;  5LJ3 e;  1OGU B;  1X75 C;  1G3S A;  5LQF B;  2EQI A;  4PFP A;  4BCQ B;  4E7J A;  3ER0 A;  2HZY A;  2NUP A;  3LLR A;  4N4I A;  1T0H A;  2ED1 A;  2IIM A;  1ZUY A;  3JB9 D;  1KC8 U;  4JLG A;  5AYF A;  3JCM P;  2D0Q B;  1Q81 C;  2ESW A;  3OYG A;  1NJI C;  1RAC B;  2K5F A;  1CSK A;  1NBE B;  1UDL A;  2XG8 D;  2DAQ A;  2JVV A;  3KHI A;  1JBM A;  4Y91 A;  4IIO A;  2QAS A;  4BCF B;  4BB7 A;  2LP5 A;  1TOV A;  4II5 B;  2YUP A;  3OS1 A;  3MHX A;  5GAO n;  2MI6 A;  2GNC A;  3S3O A;  3UDC A;  4E6R A;  4NOY A;  2C5N B;  4A4G A;  3CCQ A;  2EPD A;  4EDU A;  3DL1 A;  2OTJ T;  4RTY A;  1QLY A;  1YWO A;  1PNJ A;  2QEX T;  3OW2 A;  5D6X A;  5DM7 R;  2DF6 A;  1SHG A;  4JX4 A;  2Y90 A;  4J9G A;  2EBP A;  4R56 A;  2EGC A;  4M75 F;  3DJB A;  5CIU A;  4C92 B;  4J7F A;  5HVY B;  1VIN A;  2HD0 A;  2DXB B;  1TXQ A;  1M3C A;  1TUD A;  4C0G A;  2VYT A;  1CKB A;  1AZG B;  2V8K A;  4D6W A;  3OYH A;  1VOM A;  2F5T X;  2XID A;  4HNU A;  2F2C A;  1RAH B;  2EQJ A;  5GAO r;  2WAC A;  2AZS A;  2E70 A;  3BDL A;  3TNH B;  1PWT A;  5LJ5 f;  2DXU A;  2PUK B;  3KXT A;  3GLX A;  5GAM d;  2QQR A;  4K11 A;  4M78 E;  4OF1 A;  4OVA A;  2EWN A;  4JJD A;  2DX1 A;  2DZC A;  1E7O A;  2J7I A;  3NGP A;  1I0C A;  1VYT A;  1M90 C;  2BPM B;  4FM4 B;  5EC7 A;  2KVQ G;  5D7U A;  3A8H B;  1MND A;  4M7A D;  2X35 A;  2BUD A;  2WSE E;  4R0K A;  3G6E T;  4M7D E;  3HRU A;  3NDQ A;  2KRO A;  1JXO A;  3V7S A;  1BI3 A;  2RHX A;  4HL4 A;  1N4M A;  3WXM B;  3PE0 A;  4G6L B;  1UJY A;  2RHY A;  3OYA A;  3JCM f;  3BE3 A;  1UGS B;  2M0Y A;  4N4H A;  2KY9 A;  4KGX B;  1D0Y A;  4PJN A;  2VVK A;  3OB9 A;  3OYB A;  4LN2 A;  4JS5 A;  1X6G A;  4XTV A;  3QZ9 B;  1Y07 A;  2EQM A;  4A4E A;  5LJ3 g;  2A36 A;  1K8A U;  1GCP A;  2RF0 A;  2EYX A;  4C92 F;  4C92 G;  1QQJ A;  4E7I A;  2K79 A;  5GMK e;  2G3R A;  2ED0 A;  3M4G A;  1FXX A;  3CCE Q;  2YUQ A;  1HD3 A;  1EX4 A;  2J05 A;  3L2R A;  3CCL Q;  4LXC A;  3GNF B;  2LCS A;  2EW3 A;  3HRT A;  2NWM A;  3GP8 A;  3CQT A;  2ECZ A;  2DET A;  5GAN h;  1H3H A;  5LJ5 g;  2CP5 A;  2ZPF B;  5GAO p;  4JLI A;  3FLG A;  3CPW A;  4PLL A;  4M7A A;  2YWW A;  1H1R B;  4OMM A;  1H3Z A;  4BCJ B;  3QUI A;  2A0F B;  4N0A C;  2LX7 A;  2PK2 A;  2ZAE A;  4HNV A;  2EYW A;  1JJ2 A;  3VYH B;  4JRP A;  2MYS A;  3CBM A;  2QDJ A;  1LCK A;  2CT4 A;  4RTX A;  2E4H A;  2JMA A;  1R0B G;  1X2Q A;  2K5L A;  3JRZ A;  3BHT B;  1VQL Q;  2DD5 A;  3CEY A;  3HFO A;  1VQ9 Q;  2P0Q A;  4OP0 A;  3L1A A;  4D8D A;  3CCE T;  3HZJ A;  1Y57 A;  4J5Y A;  2DEU A;  1UB4 A;  1VQO Q;  2YT6 A;  2CH4 W;  5FWC A;  1B34 A;  2O4X B;  2ZPI B;  4OMN A;  1Q95 G;  1NJI U;  4JJB A;  3CCV Q;  3SWN C;  3NTK A;  3BW1 A;  2QA4 A;  5KE3 A;  1OL2 B;  2WXV B;  3EH1 A;  3A8G B;  3H0F A;  4KH0 B;  4A63 B;  1NPP A;  4KUI A;  2YDL A;  2XDD A;  2PHG A;  5FRM A;  1PKD B;  3G1J A;  2JUF A;  5CKE A;  3GIB A;  5I2M A;  1X6B A;  2CUB A;  5C6S A;  1VQM A;  1K8A R;  4RKU E;  4HNT A;  2GQI A;  1UEC A;  5IXF A;  1JOW A;  3IQL A;  3LGF A;  5FU6 B;  1PHT A;  3LWI A;  3NMZ C;  1JO8 A;  3DTO A;  1H1P B;  2FRW A;  3G4S Q;  1UNG D;  3UT1 A;  2L89 A;  3EID B;  4PJL A;  2DXC B;  1Q86 C;  4XTW A;  4CFW B;  1W98 B;  3H6Z A;  4A4H A;  4M78 G;  5KYN A;  3PO3 S;  3CMA A;  4XU1 A;  2RQT A;  2DD5 B;  1VQ4 T;  1OIU B;  4X1V A;  2QDL A;  4F6U B;  2L8D A;  1QKX A;  1VQ6 T;  3AHU A;  1S1N A;  5GAN 6;  2F2W A;  4OGR B;  1OV3 A;  3QWY A;  5HK3 A;  1ZUK A;  3MET A;  4QKU A;  1BCM A;  2LQK A;  5ECA A;  1VQ6 Q;  2VUB A;  5LJ5 h;  2E3H A;  4HT8 A;  4OGE A;  3I55 Q;  1M1G A;  2QQS A;  4A4F A;  3OS5 A;  4RTT A;  4QVC A;  2D8H A;  3FC3 A;  5DLO A;  3CBO A;  1RLP C;  2ZGW A;  2QDY B;  1SRM A;  4CC3 A;  1YN8 A;  4MZM A;  4HCB A;  3M58 A;  1WYX A;  3R6O A;  2EKO A;  3G71 Q;  2LX9 A;  4BCK B;  2KDS A;  1TS9 A;  4II1 A;  1UHC A;  1ZA1 B;  1AD5 A;  2JT4 A;  4BI4 A;  2DD4 A;  4PJJ A;  4J9C A;  3PGG A;  2RM4 A;  4BI3 A;  1VQ8 T;  5LJ3 f;  5CCA A;  2DD4 B;  3QYE A;  1CKA A;  4YOZ A;  3OS2 A;  2QAZ A;  1NLO C;  4DBF A;  3HFN A;  3MEW A;  4EOJ B;  1YJ9 T;  2IW9 B;  2RQR A;  3H8Z A;  4PNO A;  1VQ4 Q;  2DKG A;  4PJO C;  2K4Y A;  1WIE A;  4BE1 A;  5LJ5 d;  1YFN A;  2HL3 A;  2R5M A;  2D1X A;  2DNU A;  2XDP A;  1Z9Q A;  2GQV A;  3UF4 A;  1QVF P;  2JNG A;  2V26 A;  4EOO B;  4JJN K;  3LW5 E;  1A0N B;  4IMY B;  2V8I A;  1WJQ A;  4X34 A;  3CCE A;  2FHD A;  1IHV A;  3QJY A;  2RQW A;  2BS4 A;  1G3N C;  4C5H A;  5CKH A;  2DER A;  2KQW A;  3KBG A;  5KYU A;  4BUG A;  2DL8 A;  1VQK Q;  2LJ1 A;  3QYH B;  1QWE A;  1MUZ A;  3RBB B;  1PD1 A;  1TH7 A;  5GAM f;  1OI1 A;  1VQ6 A;  4MFD A;  1ZBJ A;  2C0I A;  3S6W A;  5FU7 B;  3SEM A;  2L3S A;  3CCR T;  3G7Z A;  3P8B B;  1M30 A;  3HTR A;  1H8K A;  2JJ9 A;  2PQW A;  2W9F A;  2COW A;  1BU1 A;  4ZN1 A;  4EON B;  2NUT B;  2HSE B;  1QCO A;  5HK0 A;  1WX6 A;  3OYJ A;  4YOS A;  4Y28 E;  2OTJ Q;  2CJM B;  4MMK A;  5GJV B;  2QEX Q;  4XTX A;  1PRL C;  3FDR A;  4C8Q F;  2NUP B;  1K9M C;  4YTL A;  3MIA B;  2LRQ A;  3PNW C;  4I3Z B;  1M2V A;  5HNB B;  4MDX A;  1PM3 A;  2YSQ A;  2C0T A;  3QZ5 B;  2CCI B;  2RO0 A;  2DM1 A;  4F6W B;  1W70 A;  2BS3 A;  2PVO B;  4C0D B;  4EMH A;  3HHT B;  4CFV B;  4GLK A;  3PT9 A;  2X3X D;  5GAN 4;  4BXX X;  1WHG A;  4FIB A;  1K8A C;  5LJ3 h;  2XI9 A;  1SPK A;  1NYF A;  1G5V A;  1IRX A;  5IH2 A;  1X43 A;  3A5Z B;  3CCV T;  5J3B A;  3VKI A;  1UEB A;  1RAE B;  3BDU A;  1SSH A;  2P4R A;  1E6G A;  1I07 A;  2G6F X;  4BAC A;  1AEY A;  3PVQ A;  2VV5 A;  2FYK A;  2RI5 A;  1BI2 A;  1MMN A;  1K9M R;  4XU3 A;  2ZPH B;  4M78 F;  3BHV B;  2E3I A;  2DL7 A;  2O4X A;  3PMT A;  2CYZ B;  4LUE A;  1OL1 B;  5L23 A;  3CCM Q;  3FJ5 A;  1W2B A;  5EG2 A;  2J6O A;  5DLQ E;  5FRO A;  3VS3 A;  1ZSZ C;  3MP6 A;  3CCR A;  2DO3 A;  1W4S A;  2L3Q A;  2IG0 A;  4FL6 A;  2GF7 A;  1V29 B;  1N9R A;  1PKT A;  1WI7 A;  2WSC E;  4JZ3 A;  2F2X A;  4QW2 A;  5KYY B;  1K9A A;  1ZX6 A;  1N27 A;  3OBY A;  2IVW A;  5GAN 2;  4JRI A;  1H26 B;  2EGA A;  1VQ5 T;  1YHQ Q;  3OYE A;  2JW4 A;  2HBP A;  3L42 A;  3M56 A;  4EMK B;  2XU8 A;  4M75 E;  2M0O A;  4IUQ A;  2D0N A;  1VQO T;  1AIS B;  2A08 A;  4M77 E;  4AMC A;  2CCH B;  1BIA A;  1YIJ A;  2BE9 B;  1AZE A;  1B7T A;  3PIO A;  3CC2 Q;  5CYI B;  5GAO m;  5GMK h;  2I0N A;  3MKD A;  3I56 T;  2KT1 A;  1WHM A;  4F7J B;  2PK9 B;  1MV3 A;  3PVL A;  3OW2 P;  3EJ1 B;  5D6W A;  1YI2 T;  1AVZ C;  2PUO B;  1ABO A;  3A98 A;  4OB3 B;  4FW1 A;  4HVU A;  4HA8 A;  2YHT A;  4M75 C;  4KRD B;  2QQ8 A;  5CQX A;  1E6H A;  3NFC A;  2RQV A;  5FGK B;  3MEU A;  1M1K C;  2JM8 A;  3DOG B;  3ZEH A;  1LNX A;  1Q7Y C;  2VGM A;  1PSF A;  1QWF A;  4CC2 A;  4O6J A;  1TU0 B;  1YCS B;  1QVP A;  4BBS M;  2B86 A;  1PSE A;  2LJ0 A;  4PKC C;  4M7A G;  4M7A F;  1BU2 A;  4DOW A;  2KGT A;  2X4X A;  3CCL T;  2G9X B;  2RJF A;  3QO3 A;  3H4C A;  1Y96 A;  2C4G B;  1E7P A;  5HBE B;  2NUZ A;  1JKW A;  3X24 B;  2FPD A;  2V22 B;  1WFW A;  4KRT A;  4QSH A;  1KC8 C;  2WSF E;  2PJQ A;  4MZP A;  5KCO A;  3EGD A;  3HRS A;  1GBR A;  4PJM A;  1YIT T;  3TRE A;  5GMK i;  1C9B A;  2BKZ B;  4ZGD B;  1H24 B;  1SEM A;  4J9H A;  3TSZ A;  2X9H A;  1BB9 A;  4LOC A;  1PCX A;  5IXB A;  2KRS A;  2ATC B;  1D0X A;  1VQK T;  1VA7 A;  1WGS A;  3CME T;  3J7A F;  5A0D A;  2EJ9 A;  4PFO A;  3OYY A;  1Q7Y U;  1Q86 R;  3BLQ B;  1K73 R;  1O9S A;  1M1K U;  4C92 D;  1VQ7 Q;  3TEE A;  3OYF A;  4OMO A;  2FZC B;  1IGU A;  2MK5 A;  4QT7 A;  2JTF A;  1YIJ T;  1D3U B;  1IO6 A;  5GAN j;  1BI0 A;  4ELY C;  2EJF A;  4HCZ A;  3G4S T;  2EYZ A;  1H4L D;  4Z6Y A;  1B07 A;  2X1N B;  4M7A B;  1NEB A;  2LQW A;  4M75 B;  3CCS A;  2K57 A;  2KE9 A;  3CPF A;  3B57 A;  3CD6 T;  1XTD A;  3EG0 A;  3SD4 A;  2B9R A;  5FWB A;  4KUL A;  2DXB A;  2KMT A;  5GAM j;  1WNL A;  2QGS A;  1VQN Q;  2JXB A;  4DBQ A;  4ZTJ A;  2BE7 D;  4UC4 A;  4ATO A;  3RR6 A;  2QXF A;  1PC0 A;  1ZSG A;  1PG5 B;  1OEB A;  3CMA Q;  1H1S B;  2F5K A;  1JQQ A;  2DK3 A;  5HBH B;  4AKH A;  4VUB A;  3JCM e;  5IHI A;  4HKE A;  3TQ7 P;  1UTI A;  1FVV B;  4BCO B;  3OY9 A;  5D6Y A;  2LCL A;  4BCQ D;  4DBR A;  4YOO A;  5GAO l;  2FZG B;  1EZZ B;  3E19 A;  1AT1 B;  1ZA2 B;  3GOX A;  1LOJ A;  2MF2 A;  1KHI A;  2LMJ A;  5CR2 A;  3JB9 H;  2CSI A;  5I21 A;  1XO2 A;  4M78 B;  2CP2 A;  1N9S A;  1QP3 A;  2AZV A;  3A8L B;  4FSX A;  3EGD B;  2R5A A;  2RNA A;  4E47 A;  5KYX B;  3TW6 A;  3I55 A;  3NHN A;  3OSV A;  3X25 B;  4OB1 B;  3EG3 A;  2EGE A;  3QHR B;  2C06 A;  1X2K A;  3H41 A;  3RNJ A;  2VC8 A;  1GY3 B;  3M0T A;  4MZT A;  4L5G A;  2KRM A;  5CO7 A;  4PJO E;  3CC7 T;  1RUW A;  1YBY A;  4RTW A;  5GAN 5;  4J9B A;  2CUD A;  1AD6 A;  2Y4X A;  4ME7 A;  2OX7 A;  3I9Q A;  5LJ3 j;  4BDY A;  3RMQ A;  4AFQ C;  3J80 E;  1MV0 B;  1M8M A;  3EG1 A;  4AFZ C;  3FEO A;  1T3L A;  2DL4 A;  5GAM e;  1BK2 A;  5FRN A;  1M3A A;  2DXT A;  1GUX A;  1AWO A;  1UE9 A;  2FL7 A;  1WJR A;  3PFS A;  2UZB B;  1BCO A;  1MGQ A;  1NEG A;  2O2O A;  2L3R A;  3EFO B;  1YJ9 Q;  5GJW B;  2C5O B;  4LD6 A;  3JB9 G;  2A28 A;  1M1K R;  4XTY A;  4C8Q A;  4V2S A;  1I1J A;  1QVG S;  2HKN A;  1Y0M A;  5I22 A;  1S72 Q;  3REA B;  4ESR A;  3JCM Q;  2DTO A;  1JJ2 S;  2DBK A;  1RAG B;  2QQB A;  2QK0 A;  2C5X B;  3SWN A;  3CD6 A;  5I5Z B;  5I2S A;  2MAM A;  3RMS A;  2QA4 T;  2AIR B;  2HQX A;  3NPF A;  4C8Q B;  1H92 A;  3MJX A;  1D0Z A;  2JMC A;  1WLP B;  1QKW A;  3P8D A;  1D1C A;  2E5Q A;  4FYW B;  2ZPE B;  4FX3 B;  3MEA A;  2DVE A;  4J9E A;  3N5B B;  4M7A E;  2P84 A;  1K1Z A;  3VUZ A;  4OMP A;  2JN0 A;  3I35 A;  4QVZ A;  4AG1 C;  2H3J A;  3VU3 C;  2RK1 A;  1SRL A;  4LD9 K;  2ZZD A;  2RHI A;  2CP6 A;  2GTJ A;  1VOL A;  2O9V A;  2EJG A;  4OB0 B;  1WHH A;  2RB6 A;  2DJZ A;  2H8H A;  3EG9 B;  3I56 Q;  1ENW A;  2W10 A;  1RI9 A;  4FT4 A;  2KBT A;  3CME Q;  4PJO B;  1OPK A;  2D6F A;  1UGQ B;  2CH4 A;  1XJW B;  4ELZ C;  3M9Q A;  1UHF A;  1PD0 A;  2HQE A;  3QG1 A;  3BFM A;  3OMC A;  3JCM V;  4BD3 A;  3LH0 A;  5GAO q;  4EMK C;  2L5Q A;  1OKW B;  4F7N B;  1N6A A;  4BCN D;  1NM7 A;  2X4J A;  2IN3 A;  1Q82 U;  4C8Q C;  2FO0 A;  1K73 U;  2KI7 A;  4JPB W;  5IDN B;  1MMD A;  4RUG A;  6AT1 B;  3S3N A;  2DFU A;  3TN8 B;  4M7D D;  2HL5 C;  4RCB A;  1P5E B;  2P0K A;  4CFU B;  2OJ2 A;  2X3W D;  4JX6 A;  1OZ3 A;  5LMK B;  3MP8 A;  4ZN3 A;  2DYI A;  4LDX A;  4CRI A;  2QTX A;  3M59 A;  3CC2 T;  4IUU A;  5LJ5 e;  2JTE A;  4M78 A;  4FYY B;  2CS7 A;  3M0R A;  3VUB A;  2FG0 A;  1VYU A;  4AKI A;  3OMG A;  1IZ6 A;  1Z9Z A;  2LNV A;  3VRY A;  3CCQ Q;  1YI2 Q;  4BY7 X;  3LQ5 B;  2MCN A;  1Q7Y R;  1Q86 U;  4E2F B;  4EPC A;  4QQ6 A;  1OOT A;  3VS4 A;  3CCQ T;  1W2B S;  4B9X A;  3DB3 A;  2CP0 A;  5GAN g;  3JSC A;  5J26 A;  2HQH A;  2EYQ A;  1VQ7 T;  2MPX C;  1VQ4 A;  3MCA B;  2KR6 A;  2DA9 A;  4GLM A;  4YC3 B;  3OYM A;  1GCQ C;  3RES A;  3CME A;  3O0G D;  1NJI R;  2VAS A;  2XDB A;  5LJ3 d;  5AT1 B;  1YHQ T;  4EOI B;  2COZ A;  1LVK A;  5KH6 A;  1UJ0 A;  2MWP A;  4RMO A;  1W6X A;  1OU8 A;  2WMB B;  4M7D A;  4JX5 A;  4PL6 A;  3FB9 A;  4C92 A;  1M8V A;  2ZPG B;  2V8J A;  3VRZ A;  1TUC A;  4JDS A;  1ZQ1 A;  2QI2 A;  2W2H A;  3CXC P;  2OTL Q;  3A1P A;  3TU4 K;  1JST B;  1AOJ A;  3CPW P;  2AK5 A;  2R57 A;  1YJ9 A;  2ZCF B;  1BKB A;  1C6V X;  1RAA B;  2OTL A;  2V1Q A;  3QII A;  1QMC A;  3CC2 A;  1RLQ C;  1K0S A;  1HJD A;  1IXD A;  4R55 A;  3RKY A;  1QW1 A;  3QHW B;  1JU5 C;  1ZSZ B;  1D1B A;  2DIL A;  1EIF A;  2LT4 A;  3M53 A;  2W96 A;  3C12 A;  2VB6 A;  2WHB B;  2LCC A;  2IW8 B;  1QCF A;  9ATC B;  2LQN A;  2DRM A;  2KXD A;  3NTI A;  1YIT A;  4JJC A;  3RGF B;  3M0P A;  2P0P A;  4DEY A;  2XMF A;  5KYW B;  4IUR A;  3CCM A;  3CD6 Q;  5LL6 S;  1PKS A;  3F5X B;  5LJ5 j;  1NPR A;  2BIV A;  2F1L A;  5DQW A;  3HSB A;  4M75 A;  2E12 A;  2JM9 A;  1GUX B;  1RL2 A;  3DDP B;  2M16 A;  4DOV A;  3UAT A;  3G33 B;  2EKH A;  4BCM B;  2GTO A;  2RHU A;  1KFZ A;  4BCG B;  1QMZ B;  4J8O A;  1B34 B;  3JCM g;  2EAY A;  1KD1 U;  2PVG B;  2DLP A;  2BZX A;  1W1F A;  1GFC A;  3OA6 A;  2MMP A;  3WVD B;  1SF9 A;  7AT1 B;  3JB9 F;  4M6V A;  2E41 A;  2E5K A;  4E7S A;  3QDF A;  1G3W A;  4F16 A;  4HCC A;  2EIF A;  1WXU A;  4J7I A;  3H9N A;  4A4K A;  4J9I A;  4WF2 A;  1RAI B;  4CXA B;  4L59 A;  1FKM A;  2DBM A;  4LDY A;  4RCC A;  5I11 A;  1O9K A;  1M27 C;  3M57 A;  1M90 U;  4NC6 A;  1SKU B;  5BNJ B;  1P92 A;  2HCK A;  1Y7X A;  4KT0 E;  2FEI A;  5GAN 7;  1M5Q 1;  3RKX A;  3BG5 A;  4CRL B;  3EG2 A;  5GAN 8;  3T9N A;  4EOR B;  1SHF A;  1WXT A;  4FYX B;  2C0O A;  4CC4 B;  3VS0 A;  2W99 A;  3EFR A;  1OQK A;  3O5Z A;  3CCU Q;  3CC7 A;  1VIF A;  1VQ8 Q;  2EQK A;  4IUP A;  4E7K A;  1VQM T;  2AKK A;  4AKG A;  1N5Z A;  5IHN A;  2HEQ A;  2HMA A;  1D3B A;  4RTV A;  1VQ8 A;  4ZGJ B;  3CC7 Q;  2F2V A;  1WA7 A;  4KGV B;  4EC9 B;  3DDQ B;  1V76 A;  5GMK l;  2LW4 A;  1RAB B;  2YXY A;  4M7D C;  1I5O B;  4FSS A;  2CZ7 B;  1QVF A;  3GTM S;  2JS2 A;  3O8V A;  4J6Y A;  3JB9 J;  3INZ A;  1VYW B;  3CCM T;  1WDX A;  1B3Q A;  2KEA A;  1S72 A;  4ELL A;  5GAN e;  4AFS C;  2C6T B;  1X01 A;  4M78 C;  4JS4 A;  1FMW A;  4C8Q G;  5HQ0 B;  2K5I A;  2PMI B;  4MFE A;  3CXC S;  3C95 A;  3OYD A;  1E9H B;  2FB7 A;  3H0H A;  2CDT A;  2HNI A;  2DVJ A;  3QBY A;  1Q81 U;  2A7Y A;  2DEQ A;  4PK4 A;  2FRY A;  2IW6 B;  4M77 D;  3UWN A;  2F69 A;  2K9G A;  3QWL A;  2CZ6 B;  5L8R E;  3V8L A;  1M3B A;  3BG3 A;  3D7S B;  4MDW A;  2RMO A;  1Y96 B;  2KMG A;  1C0M A;  2FZK B;  5CVI A;  3FRN A;  3CPW S;  2OAW A;  2X51 A;  2XD0 A;  4C0Z A;  4FT2 A;  5KYY A;  3OYC A;  3TW7 A;  4BCM D;  3EGU A;  2CZ1 B;  1C1A A;  4Y92 A;  1G2B A;  2PVD B;  4ORZ A;  2KSS A;  3JCM J;  2E1H A;  3GF5 A;  1LPL A;  4F14 A;  5CKF A;  1OX8 A;  3JCM d;  2O9S A;  1VQP A;  4KUD K;  2K2M A;  2J6K A;  1VQ5 Q;  5GAN 3;  1U5S A;  3E1S A;  2NLU A;  1OX9 A;  3LH5 A;  4E7L A;  2R7G A;  1WZO A;  2O88 A;  4F7U F;  3V7C A;  4PJO A;  4EMK A;  2ZPB B;  1NZ9 A;  3E2U A;  2E10 A;  2DL5 A;  4LDV A;  8AT1 B;  4IUV A;  4F7U A;  4Z02 A;  3HKS A;  4LE9 A;  5HBJ B;  3DLM A;  4PLI A;  2G77 A;  2ROL A;  2HKQ B;  2OI3 A;  3PIP A;  5GMK j;  3JCM c;  1F1B B;  1T3S A;  1MNE A;  3CCJ A;  1N8R U;  3OYK A;  3UA7 A;  4RTU A;  4OB2 B;  4MIM A;  2B8A A;  1VQM Q;  1UGV A;  5IN1 A;  2E6Z A;  2DZ9 A;  4OGC A;  1ZUU A;  4XK8 E;  2PZ1 A;  2EQU A;  4NL2 A;  4F7U E;  4WTO B;  3JCM X;  2UZE B;  3L2W A;  2YRC A;  3RER A;  4CC7 A;  4LUD A;  3G4S A;  4BE0 A;  3CCV A;  1Q82 R;  3EFO A;  3A8M B;  1H28 B;  1ZBX A;  3REB B;  5EFQ B;  1OKV B;  2LC4 A;  1K73 C;  4M7D G;  2K7A A;  3CCU A;  2JS0 A;  2RA2 A;  1OYX A;  3DB4 A;  1I8F A;  2DIG A;  2BTT A;  1I5L A;  4OMF B;  1KC8 R;  1GH6 B;  4M77 G;  4QVD A;  1VQP T;  1IHW A;  1XNI A;  2UUE B;  3TNW B;  5HY6 A;  5A2Q E;  2AKL A;  3TSW A;  2JZ2 A;  4LDU A;  4ZTF A;  3BG9 A;  3SDZ A;  1YIT Q;  3MI9 B;  1GL5 A;  1QVG P;  1WHL A;  4XTZ A;  3G6E Q;  4Z8A A;  4ROE A;  1KJW A;  4HCK A;  2PTK A;  3VS7 A;  2QEX A;  2KYB A;  5M9O A;  3CCJ T;  2E6N A;  1WPY A;  2VWF A;  4IIM A;  3K7A M;  4Z89 A;  3E9G A;  4KH1 B;  2RJE A;  1FIN B;  2DRK A;  3HO8 A;  2CKK A;  3M54 A;  3HL8 A;  2RJD A;  1PRM C;  2J06 A;  1VQL T;  2Z0W A;  4CFU D;  4CFN B;  5L2W B;  4EOP B;  1QLB A;  3OSS C;  2K3X A;  2I40 B;  4ELJ A;  1O9K B;  4LNP A;  3OYL A;  2LZ6 B;  1KG1 A;  2EVR A;  2PU9 B;  3L2V A;  2X4W A;  4EOQ B;  4ANJ A;  2L2P A;  3E9F A;  2WJ9 A;  3EHR A;  4C92 E;  1M4Z A;  4BY6 B;  2OTL T;  2KT8 A;  2W0Z A;  3CC4 A;  3C4S A;  2LVM A;  1X69 A;  1VIE A;  2BZ8 A;  3RUX A;  2QG9 B;  1VQO A;  2RPN A;  3WVE B;  1Y71 A;  2GCX A;  1M2O A;  2RI3 A;  3MO8 A;  2W9Z A;  1URC B;  4PJO G;  2WIP B;  4JUV A;  1RAF B;  1X27 A;  4PJO D;  2XIC A;  2J6F A;  5A0G A;  2QGF B;  4A54 A;  3QSU A;  2A3L A;  4C8Q E;  4J9D A;  4B9W A;  1AWX A;  2DXC A;  2QFZ A;  4RTZ A;  3DKM A;  4C5I A;  3THK A;  3L2Q A;  3EHQ A;  1KD1 R;  3LX7 A;  3SB2 A;  2AHJ B;  2LDM A;  3BLH B;  5KE2 A;  3HP9 A;  2KAF A;  1YI2 A;  2RN8 A;  4QQG A;  2BS2 A;  3CCU T;  3VS6 A;  5GAM g;  3R6N A;  1OZ2 A;  1GXI E;  4HVW A;  4RG8 A;  4JZ4 A;  3NTH A;  1LJO A;  2XHC A;  1FX7 A;  1VQK A;  4BCH B;  3L2Z A;  3M5A A;  2R58 A;  2HAX A;  2M51 A;  3EGX B;  1H1Q B;  1AWW A;  3SHW A;  4HVV A;  4CI0 C;  4ZNX A;  2CZ0 B;  1GFD A;  1NLP C;  1JRI A;  2KRN A;  2LJ3 A;  1YCY A;  4AT1 B;  4BCI B;  2UZL B;  2QYZ A;  4M77 A;  2KXC A;  4M7A C;  1OIY B;  1OI9 B;  2EYY A;  5FU7 C;  4C0F A;  3FIF A;  3JCM h;  4AG2 C;  5ICP B;  1D3B B;  3ULR B;  3G71 T;  3BY7 A;  1KD1 C;  4O5V A;  2X4Y A;  1J3T A;  1UUE A;  2VXE A;  3QPH A;  1O75 A;  3JCM b;  4BDZ A;  2H3E B;  4FCY A;  1KK7 A;  4C0D C;  3VKG A;  5HKC A;  3MY5 B;  4FYV B;  3CXC A;  2IPO B;  3JV3 A;  1N8R R;  1SG5 A;  1WJS A;  1K4U S;  1FWZ A;  2AT1 B;  4BY6 C;  2BKD N;  3X28 B;  5A0L A;  5IDP B;  2DL3 A;  1H27 B;  3I5S A;  2QA4 Q;  2O31 A;  2DIQ A;  3GPL A;  2QQA A;  3JCM W;  1JJ2 P;  2P4T A;  4CFM B;  4HLQ A;  1K0X A;  2EUF A;  1M1F A;  3TVT A;  2FPF A;  2M9U A;  4N0A A;  4PFZ A;  4JRK A;  3S3M A;  2LTO A;  4Z88 A;  4D8K A;  4J83 A;  1R0C B;  2DE0 X;  2K3Y A;  4N4G A;  1KQ2 A;  1YJN T;  3ZFJ A;  3ME9 A;  5CQY A;  4FU6 A;  2WIH B;  5CKB A;  4F70 B;  5CEI B;  2QGG A;  3JAM E;  2O01 E;  1YJN Q;  3C0C A;  4OML A;  3Q1J A;  5IT9 E;  1GRI A;  5EJC A;  1QCN A;  2VGN A;  2WPA B;  4GBQ A;  4M78 D;  3ZBD A;  1U06 A;  4DEX A;  1BI1 A;  3HB9 A;  4EOS B;  1DJ7 B;  1TWB A;  5FLX E;  4LDW A;  1VQ9 A;  2QF7 A;  4F7L B;  2RD1 A;  1TD6 A;  1ZHI A;  1YJW A;  1X6O A;  4HT9 A;  1S72 T;  1BYM A;  4Y72 B;  2RK2 A;  1SSF A;  3BHU B;  1F5Q B;  3VS1 A;  1QVG A;  5GAN f;  3I5R A;  4EC8 B;  3QDR B;  2QTV A;  3LYI A;  4C5G A;  2XK0 A;  4F7U B;  4F6S B;  4FW2 A;  3A8O B;  2COY A;  1Q81 R;  1G3T A;  5IHY A;  1I4K 1;  4NS5 A;  1MMA A;  5IF1 B;  4QQD A;  3OW2 S;  1GBQ A;  2VKN A;  4EOM B;  4M75 G;  1U1S A;  3LWH A;  1XQH A;  4M75 D;  2WFY B;  1D09 B;  2IVX A;  2MOX A;  3GNG A;  2QQ9 A;  1I81 A;  5FW9 A;  3UA6 A;  1MMG A;  3EG9 A;  1FMK A;  3C94 A;  4L6V 5;  1ACM B;  2HSP A;  2RQU A;  1KQS P;  3VKH A;  2CRE A;  3EH2 A;  4DQ2 A;  1WQ7 A;  1IGQ A;  4XAX B;  3EOC B;  2ENM A;  4Q5W A;  4C92 C;  5CKD A;  1WHJ A;  2GBQ A;  3MPU B;  3M55 A;  1HYO A;  2L3P A;  4X9D A;  3G6E A;  1VQN A;  2JGZ B;  2JTM A;  1UGP B;  2RJC A;  3RIR A;  2NUT A;  1YWP A; 
#chains in the Genus database with same CATH homology
 4AKH A;  4VUB A;  4X9C A;  3JCM e;  1YJW T;  3JB9 I;  1S72 A;  3KUF A;  5GAN e;  3CBM A;  2QDJ A;  4HKE A;  1X01 A;  2K5L A;  3JRZ A;  4M78 C;  4JS4 A;  4C8Q G;  3OY9 A;  3CCL A;  1BIB A;  5D6Y A;  2K5I A;  3VYG B;  2DD5 A;  2LCL A;  3TCJ A;  3CEY A;  3VV0 A;  5GAO l;  4MFE A;  3E19 A;  3CXC S;  1Q82 C;  3HFO A;  3C95 A;  4J6W A;  3GOX A;  1LOJ A;  2MF2 A;  2P0Q A;  4OP0 A;  3L1A A;  3CCE T;  1KHI A;  3HZJ A;  5CR2 A;  3JB9 H;  4J5Y A;  3OYD A;  5I21 A;  1UB4 A;  2FB7 A;  4M78 B;  3VJP A;  4M77 F;  1Q81 U;  2HNI A;  3QBY A;  1N9S A;  3HBL A;  1QP3 A;  4JRQ A;  3A8L B;  2Y4Y A;  4FSX A;  2R5A A;  3RKW A;  2A7Y A;  4E47 A;  3TW6 A;  2DEQ A;  3I55 A;  3OSV A;  1B34 A;  2O4X B;  4M77 D;  2ZPI B;  2GFA A;  3M4Y A;  3UWN A;  3X25 B;  1NJI U;  1YJN A;  2F69 A;  3QWL A;  5DY9 A;  3SWN C;  4OB1 B;  2CZ6 B;  3X20 B;  5L8R E;  3V8L A;  1NE8 A;  3BW1 A;  3BG3 A;  1G3Y A;  3NTK A;  5KE3 A;  2QA4 A;  4E7H A;  4MDW A;  5CK9 A;  2C06 A;  4A53 A;  3A8G B;  1Y96 B;  2EFI A;  2KMG A;  5CVI A;  1NPP A;  5GAM h;  3FRN A;  4KUI A;  2VC8 A;  4MZT A;  3CPW S;  2XDD A;  4L5G A;  4C0Z A;  2XD0 A;  4FT2 A;  3OYC A;  3TW7 A;  5CO7 A;  5FRM A;  4PJO E;  3CC7 T;  2JUF A;  2VXF A;  5CKE A;  1YBY A;  3GIB A;  2RHZ A;  5I2M A;  2CZ1 B;  5C6S A;  4IUT A;  5GAN 5;  3OYN A;  3L2U A;  4LD9 K;  1VQM A;  2PVD B;  1QVF S;  2Y4X A;  3UPU A;  4ME7 A;  2KSS A;  1VQL A;  4RKU E;  1XOV A;  3JCM J;  4HNT A;  2E1H A;  1KQS A;  3GF5 A;  2GFU A;  5LJ3 j;  5CKF A;  3OS0 A;  4C5E A;  2K2V A;  3CC4 T;  4BDY A;  2I2L A;  3LGF A;  5FU6 B;  3RMQ A;  3JCM d;  3J80 E;  3LWI A;  1VQP A;  4KUD K;  5GAN d;  5GAN 3;  3E1S A;  2NLU A;  3UT1 A;  4E7L A;  3FEO A;  5FU6 C;  5GAM e;  2L89 A;  3V7C A;  4F7U F;  5FRN A;  2CGH A;  4KBM B;  4PJO A;  4EMK A;  2ZPB B;  1NZ9 A;  2DXC B;  2DXT A;  1Q86 C;  3QYB A;  4XTW A;  1KQS S;  2FL7 A;  2E10 A;  1VQ9 T;  3H6Z A;  1WJR A;  3PFS A;  4LDV A;  4TVR A;  4A4H A;  1MGQ A;  1WQW A;  4IUV A;  4M7D B;  1U1T A;  4M78 G;  4F7U A;  4Z02 A;  3HKS A;  2L3R A;  3DLM A;  1RI0 A;  4XQ3 A;  3OYI A;  4PLI A;  3CMA A;  2G77 A;  1IRE B;  4XU1 A;  4LD6 A;  2DD5 B;  4RG2 A;  3JCM c;  3VYG A;  4XU0 A;  5GMK j;  3PIP A;  3JB9 G;  1VQ4 T;  4XTY A;  4C8Q A;  4V2S A;  1QVG S;  2L8D A;  3AHU A;  4BE2 A;  3CCJ A;  1N8R U;  1VQ6 T;  1K9M U;  5GAN 6;  3OYK A;  3JCM Q;  3SWN B;  4OB2 B;  4MIM A;  2B8A A;  2DTO A;  3QJ6 A;  1JJ2 S;  5HK3 A;  5IN1 A;  2E6Z A;  3MET A;  2LQK A;  3CCS T;  2QQB A;  2DZ9 A;  2VUB A;  3MEV A;  4OGC A;  4M77 C;  4XK8 E;  5LJ5 h;  3SWN A;  2EQU A;  4NL2 A;  4F7U E;  4OGE A;  3JCM X;  5I2S A;  4NL3 A;  1M1G A;  3EFS A;  2QQS A;  4HT8 A;  5IAY A;  3L2W A;  2MAM A;  2DPP B;  3RMS A;  3OS5 A;  3QHS A;  4A4F A;  4QVC A;  3FC3 A;  2QA4 T;  3V8J A;  2HQX A;  1KHC A;  3CBO A;  3HPW A;  5DLO A;  3RER A;  4C8Q B;  2ZGW A;  1R8O B;  3G4S A;  2QDY B;  4BE0 A;  3CCV A;  3P8D A;  2E5Q A;  4MZM A;  4HCB A;  3A8M B;  2ZPE B;  3M58 A;  3R6O A;  1ZBX A;  2EKO A;  3MEA A;  2LX9 A;  2KDS A;  2LC4 A;  3MP1 A;  1K73 C;  4M7D G;  2DVE A;  3CCU A;  2RA2 A;  1OYX A;  3DB4 A;  3N5B B;  1U8R A;  3URG A;  4M7A E;  3QKJ A;  4II1 A;  4PJO F;  1I8F A;  3VUZ A;  2DIG A;  1I5L A;  2ZZD B;  4OMF B;  4BI4 A;  2JN0 A;  2DD4 A;  4M77 G;  4QVZ A;  4QVD A;  3PGG A;  2H3J A;  2RM4 A;  4BI3 A;  3VU3 C;  1VQP T;  1VQ8 T;  2RK1 A;  1XNI A;  1KQ1 A;  4GY5 A;  2KK4 A;  5LJ3 f;  5CCA A;  2OAU A;  2DD4 B;  2M1H A;  2YLB A;  3QYE A;  5HY6 A;  1HK9 A;  2ZZD A;  5A2Q E;  2RHI A;  3OS2 A;  4DA4 A;  2LQ8 A;  1HXD A;  1QP2 A;  3HFN A;  2JZ2 A;  3MEW A;  4LDU A;  1YJ9 T;  1VQ7 A;  2DTI A;  1VQN T;  4ZTF A;  2EJG A;  3H8Z A;  3BG9 A;  4PNO A;  2DKG A;  3SDZ A;  4EMG A;  4PJO C;  2K4Y A;  1MHN A;  4OB0 B;  4BE1 A;  5LJ5 d;  2RB6 A;  2DJZ A;  3OQ5 A;  3J81 E;  4XTZ A;  4BBR M;  3CD6 A;  2R5M A;  3I55 T;  2XDP A;  3CMA T;  2GQV A;  5GMK m;  4FT4 A;  1UGR B;  4PJO B;  2JNG A;  2QEX A;  2DTH A;  2FVU A;  1UGQ B;  3ASK A;  4JJN K;  3LW5 E;  3G71 A;  2D6F A;  3V7R A;  4ELZ C;  2JOY A;  3M9Q A;  5M9O A;  5CAI A;  3CCJ T;  3PMI A;  3I56 A;  2E6N A;  1WPY A;  1WJQ A;  2V8I A;  4ZGE B;  4X34 A;  3CCE A;  2HQE A;  2FHD A;  3QG1 A;  3QJY A;  3E9G A;  3BFM A;  3OMC A;  2BS4 A;  3QXE B;  4AI6 A;  3JCM V;  2RJE A;  4BD3 A;  4C5H A;  5CKH A;  1H64 1;  1YHQ A;  3LGL A;  2KQW A;  1AHJ B;  3KBG A;  3LH0 A;  4MML A;  5GAO q;  3HO8 A;  4EMK C;  2L5Q A;  4BUG A;  2CKK A;  3HL8 A;  2RI2 A;  3QYH B;  1N6A A;  2RJD A;  3M54 A;  2X4J A;  1Q82 U;  3SFM A;  4BI8 B;  1VQL T;  4C8Q C;  4J6X A;  1K73 U;  3X26 B;  5J39 A;  1TH7 A;  5GAM f;  1OI1 A;  2MWO A;  1VQ6 A;  4MFD A;  3S6W A;  5FU7 B;  2XKO C;  3CCR T;  1QLB A;  3G7Z A;  3S3N A;  3OSS C;  4M77 B;  1VUB A;  4M7D D;  4RCB A;  3P8B B;  2K3X A;  4ELJ A;  3OYL A;  2P0K A;  2PQW A;  1KG1 A;  2PU9 B;  4ZN1 A;  3L2V A;  4M7D F;  2X4W A;  4JX6 A;  1OZ3 A;  4XTU A;  5HK0 A;  3E9F A;  3MP8 A;  2WJ9 A;  4C92 E;  1M4Z A;  3OYJ A;  4ZN3 A;  4BY6 B;  1N8R C;  2OTL T;  4Y28 E;  4MMK A;  3C4S A;  2LVM A;  4CRI A;  3CC4 A;  4LDX A;  2QTX A;  1VIE A;  3M59 A;  4IUU A;  3RUX A;  4XTX A;  5LJ5 e;  3CC2 T;  3P8H A;  4M78 A;  4F7U G;  1VQO A;  3WVE B;  1M9S A;  2RH2 A;  1Y71 A;  3FDR A;  4C8Q F;  2CS7 A;  1K9M C;  2GCX A;  4YTL A;  3VUB A;  2LRQ A;  2RI3 A;  3MO8 A;  3PNW C;  4XU2 A;  3CBP A;  4AKI A;  3OMG A;  1IZ6 A;  5C0M A;  4PJO G;  3V8K A;  4C8Q D;  2LNV A;  4IKF A;  4JUV A;  4PJO D;  4MDX A;  1VQ5 A;  2XIC A;  1Q86 U;  3QZ5 B;  2RO0 A;  5A0G A;  3EAE A;  4EPC A;  4QQ6 A;  3FJP A;  4A54 A;  2E65 A;  3QSU A;  2A3L A;  3OBW A;  4C8Q E;  1JB0 E;  4B9W A;  3CCQ T;  1W2B S;  2BS3 A;  2DXC A;  2QFZ A;  4B9X A;  2PVO B;  3DKM A;  3DB3 A;  4C0D B;  3HHT B;  4C5I A;  4EMH A;  2OTJ A;  5GAN g;  3JSC A;  2D9T A;  4GLK A;  5J26 A;  2EYQ A;  1VQ7 T;  1VQ4 A;  2YLC A;  3MCA B;  3PT9 A;  3DLL A;  5GAN 4;  2KR6 A;  4FIB A;  3PTA A;  1K8A C;  5LJ3 h;  2XI9 A;  3OYM A;  3L2Q A;  1G5V A;  3RES A;  3CME A;  2E64 A;  3LX7 A;  3SB2 A;  2XDB A;  3CCV T;  3A5Z B;  5LJ3 d;  5KCH A;  2AHJ B;  1YHQ T;  2LDM A;  5J3B A;  3VKI A;  1UEB A;  3F70 A;  5KE2 A;  3HP9 A;  2KAF A;  5KH6 A;  1YI2 A;  3BDU A;  2YRV A;  4P5N A;  3QYG B;  2MWP A;  4RMO A;  4QQG A;  2LT1 A;  5LJ3 e;  2BS2 A;  4BAC A;  3CCU T;  4M7D A;  1X75 C;  2VV5 A;  2FYK A;  1G3S A;  5GAM g;  4JX5 A;  2RI5 A;  4PL6 A;  3FB9 A;  1OZ2 A;  1BI2 A;  4C92 A;  4RG8 A;  1M8V A;  4E7J A;  2ZPG B;  3NTH A;  1GXI E;  2V8J A;  3ER0 A;  4JDS A;  1ZQ1 A;  1LJO A;  2XHC A;  1FX7 A;  1VQK A;  2QI2 A;  3LLR A;  3L2Z A;  3M5A A;  4N4I A;  4XU3 A;  3TU4 K;  2R58 A;  2HAX A;  2ZPH B;  4M78 F;  3JB9 D;  1KC8 U;  4JLG A;  5AYF A;  2O4X A;  2R57 A;  3PMT A;  4CI0 C;  2CYZ B;  1YJ9 A;  2CZ0 B;  2ZCF B;  1BKB A;  3JCM P;  2D0Q B;  1Q81 C;  3OYG A;  1JRI A;  1W2B A;  1NJI C;  1YCY A;  2OTL A;  5EG2 A;  2K5F A;  3QII A;  5DLQ E;  5FRO A;  4M77 A;  2XG8 D;  2DAQ A;  3CC2 A;  3MP6 A;  2JVV A;  3CCR A;  2DO3 A;  4M7A C;  3KHI A;  1JBM A;  1W4S A;  2IG0 A;  4FL6 A;  2GF7 A;  4Y91 A;  4R55 A;  3RKY A;  1QW1 A;  1V29 B;  4C0F A;  1N9R A;  2WSC E;  5FU7 C;  3FIF A;  4QW2 A;  3JCM h;  4BB7 A;  1D3B B;  1EIF A;  1N27 A;  3G71 T;  3BY7 A;  3OBY A;  1KD1 C;  2LT4 A;  2IVW A;  3M53 A;  5GAN 2;  3C12 A;  3MHX A;  4JRI A;  4O5V A;  3OS1 A;  2X4Y A;  5GAO n;  2VXE A;  3QPH A;  1VQ5 T;  2MI6 A;  1O75 A;  2LCC A;  3JCM b;  4BDZ A;  3S3O A;  3OYE A;  3UDC A;  4C0D C;  2HBP A;  3L42 A;  3M56 A;  4EMK B;  3VKG A;  2XU8 A;  4M75 E;  2M0O A;  5HKC A;  4IUQ A;  4NOY A;  4A4G A;  3CCQ A;  3CXC A;  4EDU A;  1VQO T;  3DL1 A;  3NTI A;  2OTJ T;  4M77 E;  1YIT A;  1BIA A;  1WJS A;  1YIJ A;  3PIO A;  1FWZ A;  2QEX T;  3OW2 A;  5D6X A;  5DM7 R;  5GAO m;  4BY6 C;  5GMK h;  2BKD N;  3X28 B;  2P0P A;  4JX4 A;  2Y90 A;  4R56 A;  3I56 T;  5A0L A;  4M75 F;  4IUR A;  3CCM A;  5CIU A;  4C92 B;  4J7F A;  5LL6 S;  2HD0 A;  5LJ5 j;  2DXB B;  1NPR A;  2BIV A;  2DIQ A;  2QQA A;  5D6W A;  3GPL A;  3JCM W;  1YI2 T;  2P4T A;  2PUO B;  4C0G A;  4HLQ A;  2VYT A;  3HSB A;  4M75 A;  2V8K A;  4D6W A;  1M1F A;  2E12 A;  3OYH A;  2F5T X;  4OB3 B;  1RL2 A;  2XID A;  2M16 A;  4HNU A;  2M9U A;  2EQJ A;  4HA8 A;  4JRK A;  2YHT A;  4N0A A;  4DOV A;  4M75 C;  2LTO A;  3S3M A;  2QQ8 A;  5CQX A;  3NFC A;  5GAO r;  2WAC A;  2RHU A;  2E70 A;  3BDL A;  4J83 A;  4J8O A;  3MEU A;  5LJ5 f;  1B34 B;  3JCM g;  1M1K C;  2DXU A;  2K3Y A;  3ZEH A;  2PUK B;  3KXT A;  1LNX A;  4N4G A;  1Q7Y C;  2VGM A;  2EAY A;  1KQ2 A;  1YJN T;  1PSF A;  3GLX A;  1KD1 U;  3ZFJ A;  3ME9 A;  2QQR A;  5GAM d;  4O6J A;  5CQY A;  4FU6 A;  4M78 E;  4OF1 A;  4OVA A;  2EWN A;  1QVP A;  2PVG B;  5CKB A;  4BBS M;  1PSE A;  2DZC A;  2O01 E;  4PKC C;  3JAM E;  4M7A G;  4M7A F;  1M90 C;  3OA6 A;  4FM4 B;  2MMP A;  3WVD B;  3Q1J A;  4DOW A;  2KVQ G;  2VGN A;  5EJC A;  5IT9 E;  2X4X A;  4M78 D;  3A8H B;  3CCL T;  3JB9 F;  3ZBD A;  4M6V A;  4M7A D;  2RJF A;  2E41 A;  3H4C A;  3HB9 A;  1BI1 A;  2X35 A;  2BUD A;  1DJ7 B;  1Y96 A;  2WSE E;  5FLX E;  1G3W A;  3G6E T;  4M7D E;  1E7P A;  3HRU A;  4HCC A;  3X24 B;  2EIF A;  4J7I A;  4LDW A;  4A4K A;  1VQ9 A;  2QF7 A;  1KC8 C;  4QSH A;  2RD1 A;  3V7S A;  1ZHI A;  1YJW A;  1X6O A;  4WF2 A;  1BI3 A;  2WSF E;  1S72 T;  4HT9 A;  2RHX A;  4MZP A;  5KCO A;  1BYM A;  4L59 A;  3HRS A;  1FKM A;  4HL4 A;  2RK2 A;  4LDY A;  1SSF A;  4RCC A;  3WXM B;  1YIT T;  2RHY A;  3OYA A;  3TRE A;  5GMK i;  3JCM f;  1QVG A;  4ZGD B;  3M57 A;  1UGS B;  4N4H A;  5GAN f;  1M90 U;  2KY9 A;  3QDR B;  4LOC A;  4NC6 A;  1P92 A;  3LYI A;  3OB9 A;  4C5G A;  2XK0 A;  3OYB A;  4JS5 A;  1VQK T;  1Y7X A;  1WGS A;  4KT0 E;  4F7U B;  5GAN 7;  3CME T;  1M5Q 1;  3J7A F;  5A0D A;  2EJ9 A;  4XTV A;  3A8O B;  3OYY A;  1Q7Y U;  1G3T A;  3QZ9 B;  3RKX A;  1O9S A;  1M1K U;  3BG5 A;  1Y07 A;  2EQM A;  4A4E A;  4C92 D;  1I4K 1;  4NS5 A;  5LJ3 g;  3TEE A;  3OYF A;  1K8A U;  5GAN 8;  4QQD A;  3OW2 S;  2JTF A;  3T9N A;  1YIJ T;  4C92 F;  5GAN j;  4C92 G;  1BI0 A;  4ELY C;  2EJF A;  4M75 G;  4E7I A;  4HCZ A;  1U1S A;  5GMK e;  3LWH A;  1XQH A;  2G3R A;  3G4S T;  3M4G A;  1FXX A;  4M75 D;  4Z6Y A;  3EFR A;  3L2R A;  4M7A B;  3GNF B;  3GNG A;  3HRT A;  4M75 B;  1VIF A;  3CC7 A;  3CCS A;  2EQK A;  2QQ9 A;  2K57 A;  1I81 A;  3GP8 A;  3CPF A;  3CD6 T;  1XTD A;  4IUP A;  4E7K A;  1VQM T;  5GAN h;  4AKG A;  3SD4 A;  4KUL A;  1D3B A;  5LJ5 g;  3C94 A;  2DXB A;  2KMT A;  2ZPF B;  4L6V 5;  5GAM j;  5GAO p;  1WNL A;  3VKH A;  3FLG A;  4JLI A;  4ZGJ B;  1VQ8 A;  4DQ2 A;  1WQ7 A;  3CPW A;  4PLL A;  4XAX B;  4M7A A;  4ZTJ A;  4Q5W A;  4C92 C;  5CKD A;  4UC4 A;  5GMK l;  4ATO A;  3M55 A;  2QXF A;  4X9D A;  4M7D C;  3G6E A;  1H3Z A;  1VQN A;  3QUI A;  3QO3 A;  4N0A C;  2CZ7 B;  1QVF A;  4HNV A;  2JTM A;  1UGP B;  2F5K A;  2DK3 A;  2RJC A;  3O8V A;  4J6Y A;  3RIR A;  3VYH B;  3JB9 J;  3INZ A;  1JJ2 A;  3CCM T;  4JRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...