3X20B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 25 min
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x20B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x20B02
2DXCB 3X24B 3VYHB 3VYGA 1DJ7B 4XK8E 3QYGB 2ZZDB 2CZ7B 3A8MB 2CYZB 2ZPEB 3X26B 3QZ5B 3A8HB 3QXEB 2WSCE 3WVDB 2AHJB 2PVDB 2DD5A 4OB3B 1UGSB 4Y28E 1V29B 1GXIE 3X28B 1UGQB 3A8GB 1QP3A 2DD4A 2PVGB 2CZ6B 2ZPFB 2PUKB 1UGRB 1IREB 2D0QB 4KT0E 2CZ1B 2DXBA 3VYGB 2ZPGB 2QDYB 2WSFE 2ZPHB 4L6V5 2ZPBB 2PUOB 2PVOB 3LW5E 2WSEE 4RKUE 4FM4B 1UGPB 2DXCA 2DD5B 5L8RE 4OB0B 2O01E 3X25B 2DD4B 3WVEB 3QZ9B 2ZZDA 4ZGDB 2CZ0B 3A8LB 4ZGEB 1JB0E 3A8OB 3HHTB 2DXBB 2PU9B 1AHJB 3QYHB 1PSFA 3X20B 4ZGJB 4OB1B 2ZPIB 2ZCFB 1QP2A 1PSEA 2DPPB 4OB2B
chains in the Genus database with same CATH superfamily
2VB6A 1VQOT 1M2OA 4KUDK 3VYHB 2LNVA 4A4GA 1KIKA 3OYCA 1M3CA 4M77G 1JKWA 3CC4T 1M8MA 2OTJA 2QA4A 4JJNK 2D8JA 3OYGA 2QK0A 5DQWA 5A0LA 2ENMA 5DY9A 3VS1A 3QJ6A 3L2WA 4EONB 1TFBA 3QO3A 5LJ5d 2BKZB 3I55T 1IB8A 1V1CA 2PVDB 5I21A 3J7AF 2J6KA 1K8AU 4BI3A 3CCQT 3KUFA 1TSFA 1IO6A 5ICPB 3D7SB 3CCLT 2K2MA 5FU7B 3META 1RADB 4FX3B 2OJ2A 4BCFB 4GLMA 5ACBA 3MEWA 4KRTA 3L2UA 4MMLA 2D6FA 2F5TX 3JCMW 2HZYA 1CKAA 3EAEA 3EH1A 4Y91A 2K9GA 2B86A 2AK5A 4M75B 1NM7A 1W4SA 3HPWA 3LH0A 2L8DA 4M7AB 3GOXA 4M7DB 2HBPA 4JDSA 1XTDA 1C9BA 3G71T 4EOOB 3PMIA 1ZSZA 2GBQA 1H1RB 4CFXB 3JCMh 2QASA 4EOKB 3R6OA 1AWJA 3WVEB 3PMTA 2P0PA 2V8JA 2CZ0B 3A8LB 1OYXA 1KC8R 5CKDA 3PIOA 3DDPB 3G1JA 3RKXA 2DBMA 4AG1C 1YCSB 3OBWA 4C0DC 5GAN4 4RUGA 2DXUA 2LVMA 3CCSQ 1JJ2S 5HNBB 4HL4A 1H24B 3I35A 3T9NA 4XU2A 2VC8A 2QG9B 4OMQA 3QWXX 5IH2A 1XO2A 2GFAA 4EOPB 2XI9A 1H3ZA 1KK7A 2DVJA 2XMFA 2E64A 4MFDA 3BDUA 1N8RR 2CZ7B 1ABQA 4NS5A 3RR6A 3TQ7P 2IVXA 4OF1A 4XU0A 2CYZB 2DETA 1GUXA 2H8HA 4M78D 4J9IA 3MY5B 1PD1A 4LD9K 1RAAB 2RH2A 4AFUC 3G6EQ 1UGSB 3JV3A 1JXOA 1B7TA 2RI2A 1KG1A 4HVUA 2K5FA 3EFRA 1WXBA 4HNTA 2CP2A 1MV3A 5A2QE 2CZ6B 5I22A 4J6YA 3VUZA 4DEYA 2QGFB 4B6MA 4E6RA 3OYNA 4BCIB 2OAWA 4XAXB 2DX1A 4RG8A 3RUXA 5GAN8 5GAMe 3L2VA 4M78E 4M78G 3CMEQ 2PVOB 4RTZA 2W0ZA 1P92A 3INZA 3EG1A 1AVZC 2XD0A 3QWYA 1UGPB 1I8FA 7AT1B 1H92A 2JNGA 4AI6A 2WXVB 3TNIB 1IHWA 1KD1C 3KFVA 4J7FA 1M1GA 1IHVA 2LP5A 2FRWA 1BI0A 2LJ1A 1K73C 3JCMb 2AT1B 4ZGDB 1WFWA 4ELLA 3JSCA 4DOVA 2EIFA 4LDUA 4A4HA 4A63B 1OIUB 2O9VA 1WIEA 3GBQA 2I0NA 4FT2A 1YI2Q 2EQUA 1GCQC 4E7LA 4C5HA 4JX6A 1VUBA 1K9MU 1X2KA 2HKQB 2RI3A 1R0CB 1SSFA 3JCMg 5GAOr 3H0HA 1WXUA 2PNIA 4NSTB 1UNLD 3G6EA 3K7AM 1GRIA 3X24B 1AD5A 3ER0A 4TVRA 5GAMd 1FMVA 3TW6A 3VU3C 2W2HA 3J80E 1H27B 2PZ1A 1TUGB 5GJWB 3OYAA 3MPUB 2IN3A 5IHNA 2NLUA 2QEXT 1F5QB 1K76A 3VS6A 3CMEA 5CQXA 5EJCA 1UFFA 4E7KA 1FMKA 4OMNA 1W2BA 1RLPC 4MFEA 3CBOA 4YC3B 1Y57A 5D6YA 5HK0A 2OTLT 4JRPA 2GCXA 1N9SA 1W1FA 5GAOm 1UECA 4CFWB 2UZBB 2QTXA 3SWNC 4KT0E 1OKWB 1M2VA 1MNDA 2JM8A 3GNGA 4OGRB 2KDSA 4WTOB 3UATA 4BD3A 1Q86C 3KBGA 3EFOB 3G33B 3MEVA 1QVGP 3NFCA 1MMNA 2WSFE 5FW9A 1QVFA 5GANj 2WMBB 3H0IA 1B07A 1ZQ1A 3QHRB 1UB4A 2VYTA 1YWPA 2BS4A 3CMAQ 1YI2A 2SEMA 3N5BB 5KYUA 3O0GD 3VJPA 2KXDA 1H1PB 5L8RE 3VS4A 3GIBA 3LH5A 2EQKA 1G3SA 1M3AA 1SRLA 5I11A 3E2UA 2AKKA 2BE9B 1TXQA 2P0QA 2K7AA 2P4TA 2DZCA 4LXCA 2DMEA 1WXTA 3M9QA 1RLQC 3M53A 3SFMA 4IUTA 4M78F 4KGZB 4BY6B 4LE9A 4OB1B 4XTVA 1GFCA 1GBRA 1HD3A 2ZCFB 1QLYA 5GAN6 2LTOA 5EFQB 2KY9A 2DA9A 4JZ4A 5CAIA 3V8JA 3CPFA 4BE2A 3JCMP 3EG2A 3UT1A 1Q82C 2CKKA 4X9DA 1JXMA 5CKEA 2NYSA 1VQ8T 4PJOA 1I81A 4LDVA 2LNHB 3G7ZA 5AYFA 5GMKl 1VQ4T 4JRKA 4AFQC 4F7UA 5J39A 4FSSA 3EH2A 1NG2A 3VRYA 1PM3A 5C6SA 3CCMQ 1WYXA 1KQ2A 3A8HB 5GANf 2EAYA 1BYMA 2P4RA 2CP7A 3WVDB 1VYWB 2HQHA 4C5EA 3OS0A 3PE0A 2ED0A 3RKYA 2BZ8A 2F2CA 2JTFA 4PK4A 1BB9A 4C0GA 2FVUA 1QQJA 2F69A 2CSIA 2PVGB 2COZA 4PL6A 3CMAA 3EGDB 1BI2A 5LMKB 2ZGWA 3AHUA 2FB7A 3DB3A 2HEQA 3GLXA 2CZ1B 3QPHA 5D6WA 2O2OA 2VXFA 2KT1A 2DFUA 1W2BP 1Q7YC 5CIUA 3S6WA 2XG8D 1ZLMA 3HFNA 3M5AA 1ZUKA 4C92C 4O5VA 3RERA 2CP6A 5D6XA 2MYSA 2KRMA 3HKSA 1VQ6T 1ZA2B 2DXCA 4A4EA 3PFSA 5I2MA 3CCJQ 5KH6A 2GGRA 1QVFP 3RESA 2GQVA 4Z02A 4C8QC 2O01E 5KCHA 3B57A 1XOVA 2DD4B 3TNWB 4R55A 2VASA 1W6XA 2X4JA 2WIPB 3L2RA 5GMKj 2UUEB 1UGVA 6AT1B 1VQOQ 2KQWA 1OEBA 2YLBA 2R57A 1URCB 1UEBA 3PT9A 1PSFA 1SG5A 3CC4Q 2D9TA 2CSQA 4EMGA 3CCMA 4EOJB 2RD1A 3HTRA 4Y72B 3OA6A 3MIAB 1G83A 2BTTA 2KXCA 1BCOA 3TSZA 1JSUB 1QCOA 1UNHD 4CC4B 4EOLB 3C4SA 3I55Q 4LOCA 5GAN2 3G4SQ 3CCQQ 1VQ5T 3V8KA 4XK8E 1Y71A 2JOYA 3CCLQ 5EG2A 4DBQA 1RAIB 4WCIA 1E7PA 2EYYA 3M0PA 2VVKA 2KMTA 5KCOA 1IZ6A 2Y4YA 2WFYB 3TSWA 4C0FA 1H26B 1Y07A 4HCZA 4EMKB 2W96A 4OB3B 2ATCB 2NUZA 3RKWA 3URGA 3MO8A 4YOZA 1SHGA 1YNZA 2QDLA 1QLBA 2X3WD 3MEAA 3JCMe 4CFUD 2V8IA 1Q81R 1KQSP 2ROLA 4JRIA 5IT9E 2DJZA 3EG9B 3DL1A 3M03A 2O4XB 2MCNA 3CCJA 2D0QB 4NOYA 1PWTA 2YWWA 1T3LA 3BG9A 2A7YA 1U1SA 2YXYA 3G71Q 3QWLA 1T0HA 3O8VA 1HYOA 5HQ0B 4X9CA 2MOXA 1PCXA 2YUQA 3M0TA 2EWNA 4XU1A 2RHXA 2YRVA 2PJQA 1S1NA 2CDTA 4RMOA 2CP3A 4OMFB 1VQOA 1YHQT 2L2PA 1I07A 1SRMA 2UZLB 3CC4A 1GFDA 3JRZA 4ATOA 2E41A 3JB9I 4F04B 2DRKA 2F2WA 5CVIA 2LQNA 3I55A 1M1KR 5GAMj 4ZGEB 1VQLT 5IF1B 1PKSA 4L5GA 3QSUA 1H8KA 3CCQA 2DL3A 1QWEA 1UHFA 1PRLC 3QYHB 2C5XB 3DLMA 1D1CA 3CCLA 4ZGJB 1QVGS 1O9SA 4D6WA 4ZTJA 1QP2A 5CK9A 3EFSA 4IUPA 1D3BA 1OOTA 1TS9A 3QJYA 2JMCA 2RJEA 3O5ZA 3CPWP 3HBLA 3CC2T 1U06A 4FIBA 4ZN3A 3VYGA 4QQGA 5GANd 1AZEA 2KRSA 1Z9QA 4F14A 4PKCC 4IURA 2EKOA 1KD1U 2MMPA 1U5SA 4MZMA 1N5ZA 3BG3A 1MMDA 2WSCE 4AKGA 1G3TA 3G71A 2M0YA 2GFUA 4NC6A 1GCQA 2HL5C 1UNGD 2AZVA 1GXIE 1ENWA 4MIMA 2RK2A 2DL8A 3BW1A 4AKHA 4KBMB 3QHSA 2OI3A 1I0CA 4VUBA 2BS2A 5CCAA 4E7JA 2XICA 2Z0WA 3OYLA 3RGFB 4XTXA 2JN0A 1M90C 1VQPT 1ZX6A 4BUGA 1SHFA 3I56T 5GAMf 2KR6A 2ZPGB 1XJWB 5CQYA 4RODA 4DBHA 4M77C 1WQ7A 2X35A 1E7OA 1FWZA 1PG5B 2VUBA 1LOJA 3LQ5B 5KYWA 1YIJT 5KYXA 5DQVA 3QBYA 3L1AA 2GF7A 4OMMA 4QW2A 3VS5A 4II1A 4CFVB 3Q1JA 3QYBA 3DLLA 5IXFA 1MUZA 4A53A 2CJMB 1OI9B 1LVKA 2MWOA 2IW9B 3HZJA 3SWNA 4JS5A 2FG0A 2PU9B 4JJBA 1QCFA 2C0OA 2RPNA 3V8LA 4AFZC 2X4XA 5DLQE 3PO3S 2M0OA 2LW4A 2RQUA 4K11A 3H0FA 4IIMA 3M58A 4M7AA 2HDAA 1BKBA 4GY5A 3VRZA 3OMCA 3OW2P 4M7DA 2DYIA 8AT1B 1VIEA 3EHRA 4UC4A 1X27A 4MMKA 1ZSZB 2DL7A 2EYXA 3OYDA 1G5VA 2V1RA 2G9XB 3M56A 3OYYA 2OTLQ 3CCRT 4MDXA 3QHWB 2ZPEB 2KI7A 2RJFA 1G8XA 3M0SA 1JU5C 3THKA 4J8OA 4PJOF 5DLOA 3M4YA 4ZN1A 2L3QA 3EIDB 1NZ9A 3LGLA 2KRNA 1BCMA 2RMOA 1GL5A 2WACA 1K8AR 2K5LA 1UGRB 4EOSB 2KMGA 3TN8B 3BLHB 1YJWT 4QSHA 3FDRA 4J9CA 1Q82U 4I3ZB 4HVWA 3E9GA 3OS1A 3CEYA 4M6VA 2PHGA 3ME9A 1QVPA 1UE9A 3CXCA 1GUXB 1QKWA 2K3BA 2LQWA 1WJQA 5GMKm 1OZ3A 4EOIB 1M3BA 2A37A 2COWA 4ROEA 3HRSA 1YFNA 1LPLA 1JQQA 4EOQB 1KQSS 5LJ5h 4YTLA 4GLKA 4LD6A 1ACMB 3CD6T 2QEXA 4D8KA 3C0CA 5FWBA 1GBQA 1VQ8Q 5KE2A 1KQ1A 3JCMV 4EIKA 1HXDA 5GAOn 2BS3A 2MAMA 2OTLA 4XTUA 2ZPIB 4PLIA 4C92A 5GAN5 4FYVB 3GPLA 2LZ6B 1TOVA 1Q7YU 1E9HB 2IVWA 2HSPA 3BHVB 1VQ9T 4AKIA 3HP9A 1UUEA 3E19A 2FPFA 3REAB 4QKUA 3PNWC 2C6TB 2FZKB 4PJJA 4C8QA 3CCET 1OZ2A 3QYGB 1MMAA 3OYKA 2OAUA 4QVZA 3M55A 1RUWA 1UJ0A 3ASKA 1KC8C 3A8MB 2IW8B 4EDUA 4G6LB 4J9DA 3X26B 3FJ5A 1VQMT 2QQAA 2W9ZA 5HBEB 2DMOA 2JJ9A 4OMOA 2XKOC 3MI9B 5CEIB 2JTEA 2KBTA 2CUDA 4GBQA 2G3RA 2EJFA 3H41A 2O88A 1UGQB 1N9RA 1OPKA 5EC7A 2YSQA 1WHMA 2A28A 1Y96A 2G6FX 4E47A 2PK2A 4AT1B 3CPWS 1X6GA 2QDJA 1N27A 2E12A 1AISB 2PUKB 4N4HA 2E65A 2FRYA 4CXAB 4A54A 1FYNA 1D0XA 1QWFA 1VQ6Q 5AT1B 1KHIA 2RJCA 2WHBB 4ESRA 4BI4A 4E7SA 1N8RC 2FZGB 2ESWA 2B9RA 1QW1A 5FU7C 1GH6B 1O9KA 2WMAB 1VQ8A 2CH4A 3WXMB 4PFPA 1RL2A 1ZP2A 3BLRB 4J83A 1VQ4A 2E6ZA 2QI2A 3VS7A 2GNCA 2F2XA 1D0YA 3FJPA 4DBFA 3V7CA 2FYKA 1GY3B 3FEOA 5HBHB 1O75A 3JAME 1H28B 4CRIA 1YN8A 4M75C 1YITT 1IGQA 5IHKA 1A0NB 3F5XB 5FRNA 3OSSC 3V7SA 4RTWA 4M7AC 1QCNA 5LJ3h 2C5OB 3J81E 4M7DC 3CCST 1VQ5Q 3MEUA 2HQXA 1Y7XA 4F6WB 1X43A 3OB9A 1NEBA 4M4ZA 5HKCA 1VQ7T 5GAN7 4F17A 4O6JA 1H1SB 3E9FA 1C1AA 5LJ5g 1VIFA 3NDQA 5KYUB 3NTHA 4BI8B 4X34A 3FRNA 3JCMX 4Z88A 1F1BB 1K9MR 4KH0B 4Z6YA 4C0ZA 1NYFA 4FT4A 4ELYC 1JJ2A 4BB7A 5GMKi 4CFUB 3QIIA 3VKIA 1HJDA 1VQ6A 2IG0A 2L3PA 3ZL7C 4AFSC 2YHTA 2EGEA 3MCAB 2J6FA 4NL2A 1OX9A 3MP6A 3JCMf 2Y90A 1OV3A 5FROA 4HT9A 4Y28E 1RAEB 4E7IA 4HVVA 2W99A 1WQWA 4FYWB 4B9WA 1FINB 2K3XA 1JO8A 4F7LB 5ECAA 3PIPA 5CKFA 3CCVT 3OW2S 4PJNA 2NUPB 4J5YA 2LX7A 5I5ZB 4RTYA 2DAQA 2M51A 4PJOB 1H3HA 2HAXA 1IREB 2WEVB 4KUIA 4YOOA 1Z9ZA 2IW6B 4C92D 1PKDB 4FW2A 1K9AA 1ZUUA 2Y4XA 4DA4A 2ZPBB 1WI7A 2P0KA 1OL2B 1SF9A 1I4K1 4LDYA 4KH1B 3OS2A 1UDLA 2KT8A 2RB6A 1VQLQ 4JX5A 1NPRA 4MDWA 2FEIA 5BNJB 4BY1X 1VQ5A 4RTUA 3UA6A 1WHGA 1OKVB 2L0AA 3OY9A 2NUTB 4FYYB 4ANJA 4BY7X 3DKMA 2YRDA 2D0NA 1VQNT 4BE1A 1GCPA 1OX8A 3CC2Q 3JB9H 2K2VA 3A8OB 2DF6A 4C92E 2ED1A 4LN2A 2X1NB 5GAN3 5IXBA 2EYZA 4M77A 1M90U 1AT1B 4XQ3A 1BI3A 4A4FA 4BCHB 2QGSA 5HK3A 4B9XA 2C06A 2MIOA 2DNUA 3GF5A 4J6XA 1TWBA 4HNVA 4C8QE 2E3HA 2DXCB 2X4YA 2M16A 1S72T 1ARKA 2QQ9A 1KHCA 1D09B 3DB4A 5IN1A 4BCJB 1C6VX 5LJ3g 1B34A 3OYFA 4CC7A 1YJ9T 1YHQA 1SSHA 1WNLA 5FRMA 1FX7A 2RA2A 4PLLA 5J3BA 4YOSA 2L89A 3TREA 1VQPQ 1FXXA 2GTJA 1JJ2P 2FPDA 3A8GB 1VQLA 2X51A 3EHQA 2DYBA 2DXTA 2C4GB 2DIQA 1VA7A 1YIJQ 2X9HA 4FL6A 1ZSGA 4E2FB 3TVTA 2R7GA 4AG2C 2F1LA 2EW3A 4R0KA 3GP8A 2QFZA 3S3OA 2EQIA 1WZOA 3MP8A 2LQ8A 2ZPHB 2MF2A 2O31A 3LWHA 2QF7A 2JW4A 3BDLA 4JPBW 1BBZA 3CC2A 4LUDA 4DQ2A 4II5B 2YDLA 2ZAEA 3QDRB 3OSVA 3P8HA 2V26A 4FYXB 3PVLA 2VGNA 4XTYA 4C0DB 3I5RA 4PFZA 4IUQA 4DEXA 2QTVA 4J9FA 8ATCB 2L3SA 2EVRA 3HSBA 3EGXA 1LJOA 2VKNA 2BIVA 4OVAA 2MI6A 2FHDA 3FLGA 3TW7A 3DJBA 2HL3A 1WDXA 1WA7A 3ZBDA 1AWWA 2HKNA 3NTIA 2CP0A 2ZZDA 4AMCA 1X01A 4IUUA 4EOMB 4LDWA 2DILA 4RTTA 3RNJA 1JB0E 1VYVA 4ORZA 2G77A 4CC2A 4FW1A 1RAFB 1AHJB 4PJOD 1UTIA 1KJWA 4Q5WA 2HCKA 4CFNB 2YUPA 2LJ0A 3CCRQ 1AEYA 1T0JA 2RJDA 4JZ3A 4C5GA 1VQPA 3CBPA 3BG5A 1NYGA 4OB2B 2JXBA 1AZGB 4CC3A 3QYEA 4JJCA 4JJDA 4NL3A 4PJLA 2W9FA 4BY6C 2DBKA 1YIJA 1VYUA 2E5KA 2FPEA 4BCOB 4C92F 2QQRA 3CCUT 2RNAA 3JCMd 3EOCB 4MZTA 4HKEA 4RTXA 4FU6A 4BCQB 4PJOG 4PJOE 2DD5A 1W98B 1YJWQ 4F7UG 4F7UE 2AIRB 2B8AA 2JZ2A 4C8QF 3NMZC 3BFMA 1D3BB 1QMCA 5KYYA 2EPDA 3VS3A 4M78A 2CCHB 2BPMB 5D7UA 2J06A 5LJ5e 3SD4A 3ZFJA 2DTOA 2X4WA 2YRCA 1RACB 4ELJA 1V76A 2DKGA 1M8VA 3SB2A 1WHKA 3TU4K 2DXBA 5A0GA 1M1FA 3VYGB 1K73U 2KSSA 4XU3A 1B3QA 1WLPB 3LX7A 2MPXC 2EUFA 3A1PA 2HMAA 3GNFB 4F6SB 1MV0B 2LMJA 3H6ZA 1R8OB 3FC3A 1NJIC 3L2ZA 3CD6Q 4RCCA 3NPFA 4HNUA 1SPKA 2LCCA 1KC8U 3OQ5A 2C0TA 4F70B 2ECZA 4OB0B 4Z8AA 3M4GA 3CCRA 1Q81C 3X25B 3P8BB 2KR3A 5M9OA 3QZ9B 2ROTA 1NLOC 1X75C 3CBMA 1VQ9Q 1TUDA 4BACA 1I5OB 3AT1B 2EGAA 4ELZC 3M0RA 4J9BA 4M77E 2YLCA 3OBYA 4QVDA 1BI1A 3CCEQ 3OYBA 3H4CA 5FU6C 3MHXA 2RM4A 4MZPA 2R5AA 1N8RU 3HO8A 5KYWB 5KYXB 2QAZA 4N4IA 3G4ST 3RMQA 1VQMQ 1YJWA 3H9NA 2E4HA 2KEAA 1UHCA 3A98A 2P84A 3M0QA 2D1XA 3M54A 3CQTA 2DERA 4N4GA 1W2BS 5IDPB 3PGGA 1X69A 2JS0A 1M1KC 1EIFA 2IPOB 2X3XD 1VQKT 3OYIA 4M75A 1HSQA 3QZ5B 3HL8A 3QXEB 1OIYB 3SWNB 1Q86U 1M5Q1 1K0SA 2HQEA 2K57A 4LUEA 4BBRM 5CKBA 5GMKe 1X6OA 3FB9A 1V29B 1FKMA 3M57A 2QEXQ 4N0AC 1KD1R 3CC7T 1QVFS 3CD6A 2V8KA 1K73R 2E3IA 1YJNT 4EMKC 2QXFA 4XTWA 5LJ3e 1BIBA 2CH4W 4L6V5 1VQ9A 4R56A 2PUOB 2OTJT 2QA4T 4KRDB 5HBJB 3SEMA 4RKUE 4FM4B 2LJ3A 2RQVA 4PNOA 2CP5A 4F16A 4F7UF 1YITQ 1OU8A 1KXUA 1W70A 5GANh 4BCQD 3CCEA 1E6HA 3DOGB 4BXXX 4OGCA 4PFOA 2CUBA 2VV5A 5LQFB 5HVYB 2XDBA 1VQMA 1VQ7Q 2KAFA 4EC8B 1WGSA 1RABB 4X1VA 4EPCA 3SDZA 2A0FB 3L2QA 1H4LD 4BCMB 2DZ9A 4J9HA 3JCMQ 1I5LA 1TU0B 3LWIA 4ROCA 2KVQG 3OYEA 2DL4A 2MK5A 1NPPA 2VWFA 1AWXA 4LNPA 3LLRA 2UZEB 3LYIA 5IAYA 4P5NA 4LDXA 2CGHA 2DPPB 1IGUA 4BCKB 1BK2A 3C12A 3VS2A 1TUCA 4ZNXA 5LJ3d 2K79A 1QVGA 2CT3A 1DJ7B 3DTOA 2JUFA 4HT8A 1PNJA 3BLQB 1Q86R 1JRIA 4M77F 1VQ4Q 2C5VB 3P8DA 2EQMA 3RIRA 2EGCA 3CCVQ 2E10A 1I1JA 2JMAA 2RQWA 3SHWA 1IXDA 3L42A 1PC0A 1YCYA 3NTKA 2LT1A 3QUIA 2KK4A 4M78C 3S3NA 1U1TA 3NHNA 3E1SA 1TH7A 1YWOA 4KGXB 4C92B 2A08A 5GAOq 2EQJA 1FMWA 1FVVB 1D1AA 5LL6S 2CS7A 3PVQA 1YITA 2ZPFB 1KFZA 2JS2A 3CCSA 1J3TA 4BBSM 2DLPA 2FL7A 3POMA 4OGEA 2I2LA 1ZUYA 3OYJA 3OS5A 2DK3A 4C8QB 1WHJA 1RI9A 1VQ7A 2RHUA 1X6BA 3LGFA 5FLXE 1EX4A 1VQNQ 2ABLA 2KROA 2JTMA 2A36A 1PHTA 1VOMA 2XK0A 1Q82R 4IIOA 1ZBJA 2LQKA 4HCCA 5GAOp 3QKJA 1ABOA 2QYZA 4PJMA 3VKHA 3QG1A 5IHYA 2RHYA 3RDVA 1Y96B 4J9GA 1M27C 2QQSA 1D0ZA 3HFOA 4M75D 2EBPA 2PK9B 5I2SA 1K8AC 1RAHB 2LDMA 4M7AD 3EGUA 2A3LA 2CT4A 1JOWA 3JCMc 4M7DD 1S72Q 1NBEB 2M02A 3BE3A 4JUVA 3X20B 4EMHA 2DO3A 5HY6A 4BDYA 5J26A 5GANg 4CI0C 3CCVA 5GMKh 2J05A 4DBRA 1YJ9Q 2WJ9A 3C95A 3JB9D 2H3JA 5DM7R 1QKXA 1O9KB 4A4KA 4KULA 4J9EA 2BZYA 3CXCP 1JSTB 2OX7A 3JB9J 3HB9A 3IQLA 4BDZA 4F7NB 2BKDN 4F6UB 3M59A 2AZSA 1M2VB 3EFOA 4M75G 4M75E 3RMSA 1Q7YR 2RQRA 2UZDB 2C0IA 2DVEA 3OMGA 3C94A 4M7AG 2YT6A 4M7AE 4EC9B 2M1HA 4M7DG 4M7DE 3I9QA 1H1QB 2DE0X 2AHJB 2EYWA 4BE0A 4Y92A 2QQ8A 4BCMD 2DL5A 3UDCA 3JB9G 3BHUB 1ZSZC 4FCYA 3VUBA 1VQNA 2KYMA 3MJXA 4JLIA 2JM9A 2XU8A 3EG0A 1EZZB 2GQIA 2J6OA 2L5QA 2LT4A 1U8RA 4IKFA 1G3WA 1M9SA 3V7RA 3EJ1B 3G6ET 4QT7A 3TCJA 3MY1B 4IMYB 2M9UA 2VGMA 2SRCA 2IIMA 3UPUA 3S3MA 4JRQA 1OL1B 2XDDA 3LW5E 4QQDA 3EG3A 1E6GA 2NWMA 2WSEE 5CO7A 4JX4A 2DRMA 4TTHA 3QDFA 1UJYA 1S72A 4CFMB 3GTMS 4JS4A 5CYIB 1VYTA 5LJ5j 2JVVA 2E1HA 4KRCB 1YHQQ 4WF2A 3U23A 1Q95G 2LRQA 1SKUB 1YJ9A 1R77A 1X2QA 2NUPA 1G3NC 3CMET 2DEQA 4F7UB 1G3YA 2F5KA 2JGZB 1D3UB 3BY7A 4L59A 4HXJA 1C0MA 1NLPC 4RG2A 2R5MA 4EORB 5IDNB 4XTZA 3PTAA 2RN8A 3H8ZA 3F70A 2RF0A 5GAMh 1KQSA 2EYQA 2XIDA 3NGPA 4BCNB 4C8QD 3CCUQ 5A0DA 4E7HA 1IRXA 2COYA 1K1ZA 2JT4A 3EGDA 5GJVB 1MGQA 2H3EB 2L3RA 2XHCA 2WIHB 3RBBB 1VINA 1G2BA 1YI2T 1NJIU 2NUTA 3FIFA 1OI1A 4C92G 2KYBA 4F7JB 1N4MA 3M0UA 2V22B 5L2WB 3ULRB 1OU9A 1WHLA 4RTVA 1OPLA 5C0MA 1Q81U 1WHHA 2MWPA 3JCMJ 2YUOA 2FO0A 2K6DA 2E5QA 4ZTFA 5KYNA 1ZHIA 4C8QG 4M77B 2F2VA 3X28B 5LJ5f 2EFIA 1MHNA 1QP3A 1CKBA 2DD4A 3BHTB 2DEUA 1OQKA 1LCKA 1TG0A 2QGGA 3KXTA 1JEGA 4M75F 2EKHA 4F7SB 2I53A 1H25B 3HRTA 2RHZA 2RI5A 1K9MC 1UG1A 5FU6B 4M7AF 4OP0A 1K0XA 3ZEHA 2CREA 4M7DF 3HRUA 3TNHB 1B34B 2K4YA 2R58A 3I56Q 1M30A 1K4US 2RO0A 3CPWA 1TD6A 4DOWA 1U3OA 2GTOA 3JB9F 1WX6A 2K5IA 1M1KU 2LCLA 2BZXA 1D1BA 1NEGA 2DM1A 2BE7D 2VXEA 2WPAB 1P5EB 2BUDA 4E7ZA 1VOLA 4N0AA 3CCUA 1Y0MA 2DIGA 4HLQA 5LJ3j 1TTHB 1NE8A 2HSEB 1YBYA 3CMAT 1OULA 5CKHA 4EMKA 1CSKA 5GAOl 3HHTB 1N6AA 1HK9A 1WPYA 1QMZB 3UA7A 2RHIA 1M4ZA 1MNEA 1ZBXA 3MP1A 1NJIR 1VQKQ 5HCKA 2O9SA 1XQHA 4JLGA 3REBB 4UN0A 3EG9A 1MMGA 2O4XA 2EJ9A 1M90R 2LX9A 2AKLA 2J7IA 1BIAA 1AOJA 2HNIA 4IUVA 2E70A 3EGXB 2KNBB 3CC7Q 2C5NB 2KE9A 2I40B 2ZZDB 3VKGA 5GAMg 3KHIA 2EJGA 4ME7A 1OGUB 1LNXA 4D8DA 2LC4A 1BU2A 1YJNQ 4BCGB 1PRMC 4C5IA 3R6NA 2K3YA 3I56A 5GANe 4FSXA 2PMIB 2YUNA 2PQWA 2RQTA 4OMPA 2PTKA 2OTJQ 2QA4Q 3CCMT 1PD0A 5FWCA 4KGVB 3VV0A 3CXCS 2DJQA 3UWNA 5LJ3f 4J7IA 4BCND 1R0BG 4HCKA 9ATCB 2CCIB 2HBWA 2DTHA 1YP5A 5IHIA 1JBMA 2QDYB 4V2SA 4OMLA 1XNIA 1RAGB 2RK1A 1AWOA 1RI0A 4BCPB 3MKDA 4J6WA 3G4SA 3OW2A 1ZA1B 1KSWA 2DTIA 3OYMA 4HA8A 2D8HA 4Z89A 4PJOC 2DD5B 2KGTA 5L23A 1BU1A 3DDQB 4QQ6A 2E6NA 1H641 5CR2A 1VQKA 5KYYB 4M77D 4M78B 1T3SA 2QQBA 3I5SA 4RCBA 1WJRA 1PKTA 2HD0A 4QVCA 4CRLB 1WJSA 2LCSA 2DXBB 3CCJT 3CC7A 5FGKB 2V1QA 4HCBA 2W10A 2FZCB 5KE3A 4OR5B 3OYHA 1SEMA 1EFNA 3TEEA 3VS0A 1PSEA 3UF4A 2XDPA 1YJNA 3A5ZB 1AD6A
chains in the Genus database with same CATH topology
3C4SA 3C12A 3NTHA 1VQOT 4BI8B 4X34A 4KUDK 3VYHB 2LNVA 4LOCA 3FRNA 4A4GA 5LJ3d 3JCMX 5GAN2 3OYCA 1QVGA 4M77G 1VQ5T 3V8KA 3CC4T 1DJ7B 2JUFA 4HT8A 4Z6YA 4XK8E 2QA4A 4JJNK 2OTJA 3OYGA 4C0ZA 4FT4A 1JRIA 1Y71A 2JOYA 4M77F 4BB7A 4ELYC 5EG2A 5A0LA 3P8DA 5GMKi 1JJ2A 5DY9A 1E7PA 2EQMA 3QIIA 3QJ6A 3RIRA 3VKIA 3L2WA 2KMTA 5KCOA 2E10A 1IZ6A 1VQ6A 2IG0A 2Y4YA 3QO3A 4C0FA 1Y07A 3L42A 4HCZA 4EMKB 2YHTA 5LJ5d 1YCYA 3MCAB 3NTKA 2LT1A 3QUIA 2KK4A 4M78C 3I55T 1U1TA 5I21A 2PVDB 3J7AF 3E1SA 4OB3B 4NL2A 3MP6A 4BI3A 3JCMf 3RKWA 3CCQT 1TH7A 2Y90A 3KUFA 5FROA 4HT9A 4Y28E 3URGA 4E7IA 3MO8A 4C92B 5GAOq 1WQWA 4B9WA 2EQJA 3CCLT 1QLBA 3MEAA 2K3XA 3JCMe 2V8IA 5FU7B 5LL6S 2CS7A 1YITA 3META 5CKFA 3PIPA 3CCVT 3OW2S 2ZPFB 4JRIA 4J5YA 5IT9E 2DJZA 2DAQA 3DL1A 2O4XB 3CCJA 4PJOB 3MEWA 2HAXA 3L2UA 3CCSA 1IREB 2D0QB 4BBSM 4MMLA 2D6FA 4NOYA 2FL7A 4OGEA 3BG9A 2A7YA 1U1SA 2F5TX 2I2LA 3JCMW 3QWLA 4KUIA 3O8VA 2DK3A 3OS5A 3OYJA 4C8QB 4C92D 3EAEA 4X9CA 1VQ7A 2Y4XA 4DA4A 4Y91A 2RHUA 2EWNA 2ZPBB 4XU1A 2P0KA 2RHXA 2YRVA 3LGFA 4RMOA 5FLXE 1I4K1 4M75B 4LDYA 3OS2A 4OMFB 1W4SA 1VQOA 1YHQT 2RB6A 2JTMA 4JX5A 1NPRA 3HPWA 3LH0A 1VQNT 4MDWA 2L8DA 4M7AB 3GOXA 1VQ5A 3CC4A 2XK0A 4M7DB 2HBPA 3JRZA 4JDSA 1XTDA 2LQKA 3G71T 3PMIA 5GAOp 3QKJA 4HCCA 4ATOA 3VKHA 2E41A 3JB9I 1JJ2S 3QG1A 3JCMh 2RHYA 3OY9A 3R6OA 1Y96B 5CVIA 3WVEB 2QQSA 3HFOA 3PMTA 3DKMA 2P0PA 4M75D 5I2SA 1K8AC 2V8JA 2CZ0B 3I55A 4BE1A 5GAMj 3A8LB 4ZGEB 1OYXA 4L5GA 1VQLT 2LDMA 3QSUA 3CCQA 2K2VA 3A8OB 5CKDA 3PIOA 4C92E 3JB9H 4M7AD 4BDYA 2A3LA 4M7DD 3JCMc 5GAN3 3RKXA 3QYHB 4JUVA 3DLMA 3X20B 3OBWA 4C0DC 4ZGJB 4EMHA 1QVGS 3CCLA 4M77A 1M90U 2DO3A 5HY6A 1O9SA 4XQ3A 5J26A 1BI3A 4A4FA 4D6WA 5GANg 5HK3A 1QP2A 5GAN4 4CI0C 3CCVA 5GMKh 4ZTJA 5CK9A 2DXUA 2LVMA 3EFSA 4B9XA 2WJ9A 3C95A 4IUPA 3JB9D 1D3BA 2H3JA 5DM7R 3GF5A 4HL4A 4J6XA 4A4KA 3QJYA 4KULA 2RJEA 3CC2T 3HBLA 3T9NA 4HNVA 4XU2A 2VC8A 4FIBA 4C8QE 3JB9J 3HB9A 4BDZA 2DXCB 2X4YA 2M16A 1S72T 2GFAA 2BKDN 3VYGA 3M59A 2QQ9A 4ZN3A 1KHCA 2XI9A 1H3ZA 3DB4A 5IN1A 4M75G 4M75E 3RMSA 2E64A 4MFDA 4QQGA 3BDUA 5LJ3g 1B34A 2DVEA 5GANd 3OYFA 1YJ9T 3OMGA 3C94A 4IURA 4PKCC 2EKOA 1YHQA 1KD1U 2CZ7B 2MMPA 4MZMA 4NS5A 4M7AG 4M7AE 2M1HA 1WNLA 4OF1A 4XU0A 2CYZB 3BG3A 5FRMA 4M7DG 1FX7A 2RA2A 4PLLA 4M7DE 2WSCE 4AKGA 1G3TA 4M78D 5J3BA 3G71A 2AHJB 4BE0A 2L89A 3TREA 4LD9K 2QQ8A 1FXXA 2RH2A 2GFUA 4NC6A 1UGSB 3UDCA 3JB9G 2RI2A 1GXIE 1KG1A 2K5FA 4MIMA 3EFRA 2RK2A 3BW1A 4AKHA 4HNTA 2DPPB 3QHSA 3A8GB 4KBMB 3VUBA 1VQNA 4VUBA 5CCAA 2BS2A 1VQLA 4JLIA 5A2QE 2CZ6B 2DXTA 2DIQA 4E7JA 2XU8A 4J6YA 2XICA 3VUZA 4FL6A 3OYLA 4XTXA 2JN0A 2L5QA 2LT4A 1U8RA 1M90C 2C06A 3OYNA 4IKFA 1VQPT 1G3WA 1M9SA 3V7RA 4XAXB 4BUGA 3I56T 3G6ET 5GAMf 3TCJA 2KR6A 2ZPGB 4RG8A 2QFZA 3GP8A 3S3OA 5CQYA 2M9UA 2VGMA 3MP8A 4M77C 2LQ8A 1WQ7A 3RUXA 2ZPHB 2MF2A 3LWHA 3UPUA 2QF7A 5GAN8 3BDLA 5GAMe 3S3MA 2X35A 4JRQA 3L2VA 4M78E 4M78G 1FWZA 2PVOB 2XDDA 3LW5E 3CC2A 4QQDA 4DQ2A 2VUBA 1LOJA 1P92A 3INZA 1YIJT 2WSEE 5CO7A 4JX4A 1S72A 3QBYA 2XD0A 4JS4A 1UGPB 1I8FA 3L1AA 3QDRB 3OSVA 2GF7A 3P8HA 2JNGA 5LJ5j 2JVVA 4AI6A 2E1HA 4QW2A 2VGNA 4XTYA 4C0DB 4II1A 4IUQA 1K8AU 4WF2A 3Q1JA 1KD1C 3QYBA 4J7FA 2LRQA 3DLLA 1YJ9A 1M1GA 3HSBA 1LJOA 1BI0A 2BIVA 4OVAA 1K73C 2MI6A 3CMET 2FHDA 3FLGA 3JCMb 3TW7A 2DEQA 3ZBDA 4F7UB 3NTIA 2ZZDA 1G3YA 1X01A 4IUUA 4ZGDB 2F5KA 3JSCA 4LDWA 4A53A 3BY7A 4L59A 2MWOA 4DOVA 1JB0E 3HZJA 2EIFA 4LDUA 4A4HA 3SWNA 4JS5A 4RG2A 2G77A 2R5MA 2PU9B 1AHJB 4FT2A 2EQUA 4XTZA 3PTAA 4PJOD 3H8ZA 4Q5WA 4E7LA 4C5HA 4JX6A 3F70A 3V8LA 1VUBA 2X4XA 5GAMh 5DLQE 1K9MU 1KQSA 2M0OA 2EYQA 2RI3A 2XIDA 4C8QD 1SSFA 3M58A 5A0DA 4E7HA 3JCMg 4M7AA 5GAOr 2RJDA 1BKBA 4GY5A 4C5GA 3OMCA 1VQPA 4M7DA 3CBPA 1MGQA 3G6EA 3BG5A 4OB2B 2L3RA 2XHCA 1VIEA 3QYEA 3X24B 4UC4A 1YI2T 1NJIU 4MMKA 4NL3A 3FIFA 1OI1A 3ER0A 4C92G 3OYDA 4BY6C 1G5VA 4TVRA 5GAMd 3M56A 3OYYA 3TW6A 3VU3C 3J80E 1YIJA 3CCRT 4C92F 2QQRA 3CCUT 4MDXA 3JCMd 2ZPEB 3OYAA 4MZTA 4HKEA 1Q81U 4FU6A 5C0MA 2RJFA 2MWPA 4PJOG 3JCMJ 4PJOE 2E5QA 2NLUA 2QEXT 2DD5A 4J8OA 4ZTFA 4PJOF 1ZHIA 5DLOA 4C8QG 4F7UG 4M77B 4F7UE 3CMEA 3M4YA 2B8AA 5CQXA 5EJCA 3X28B 4ZN1A 4E7KA 5LJ5f 1W2BA 2EFIA 4MFEA 2JZ2A 3CBOA 5D6YA 5HK0A 2OTLT 1MHNA 1NZ9A 1QP3A 3LGLA 2DD4A 3BFMA 1D3BB 4C8QF 4JRPA 2GCXA 4M78A 1N9SA 5LJ5e 3SD4A 5GAOm 3ZFJA 2DTOA 2WACA 2X4WA 2QTXA 3KXTA 2K5LA 1UGRB 4ELJA 4M75F 2DKGA 1M8VA 3SB2A 3SWNC 4KT0E 3TU4K 2KMGA 2DXBA 3HRTA 5A0GA 1M1FA 3GNGA 2RHZA 3VYGB 2RI5A 4QSHA 2KDSA 3FDRA 2KSSA 5FU6B 1YJWT 1K73U 4XU3A 4M7AF 4OP0A 1Q82U 4BD3A 1Q86C 3KBGA 3ZEHA 4M7DF 3HRUA 3LX7A 3E9GA 3MEVA 1B34B 2K4YA 2R58A 2WSFE 3CEYA 3NFCA 3OS1A 1QVFA 3GNFB 5GANj 4M6VA 2RO0A 3H6ZA 1R8OB 3ME9A 1QVPA 3CPWA 4DOWA 3CXCA 3FC3A 1ZQ1A 1NJIC 1UB4A 2VYTA 3L2ZA 3JB9F 1VQKT 2BS4A 4RCCA 1YI2A 2K5IA 1WJQA 4HNUA 3N5BB 1OZ3A 2LCCA 5GMKm 2LCLA 1M1KU 1KC8U 3VJPA 3OQ5A 1K9MC 2VXEA 5L8RE 3HRSA 3GIBA 2BUDA 4OB0B 3M4GA 2EQKA 3CCRA 1G3SA 4N0AA 3CCUA 1Q81C 3X25B 2DIGA 4HLQA 3P8BB 5LJ3j 1KQSS 5M9OA 3QZ9B 5LJ5h 1NE8A 4YTLA 4GLKA 4LD6A 1X75C 3CBMA 1YBYA 4BACA 3CD6T 2QEXA 3CMAT 4ELZC 2P0QA 4M77E 5CKHA 2P4TA 2DZCA 4EMKA 5GAOl 3HHTB 2YLCA 3M9QA 3OBYA 5KE2A 1KQ1A 1N6AA 1HK9A 3M53A 4IUTA 1WPYA 3SFMA 3JCMV 1HXDA 2RHIA 4M78F 4QVDA 5GAOn 2BS3A 1M4ZA 2MAMA 4BY6B 2OTLA 1BI1A 4OB1B 4XTVA 4XTUA 2ZPIB 4PLIA 4C92A 5GAN5 2ZCFB 1ZBXA 3GPLA 3MP1A 5GAN6 3OYBA 3H4CA 2LTOA 1Q7YU 2KY9A 5FU6C 3MHXA 5CAIA 2RM4A 4MZPA 2IVWA 2R5AA 3CPFA 3HO8A 3V8JA 4BE2A 1VQ9T 1N8RU 4AKIA 3HP9A 4N4IA 3E19A 3UT1A 3JCMP 1XQHA 4JLGA 3G4ST 3RMQA 1Q82C 2CKKA 4X9DA 1YJWA 2O4XA 5CKEA 1VQ8T 4PJOA 2EJ9A 1I81A 3PNWC 4LDVA 3G7ZA 2LX9A 5AYFA 5GMKl 1VQ4T 1BIAA 4JRKA 2HNIA 4IUVA 2E70A 3M54A 4C8QA 4F7UA 5J39A 4N4GA 3CCET 1OZ2A 1W2BS 3PGGA 3QYGB 3OYKA 2OAUA 4QVZA 2ZZDB 1M1KC 3M55A 3VKGA 3ASKA 3KHIA 1EIFA 5C6SA 5GAMg 1KC8C 3A8MB 2EJGA 4EDUA 3OYIA 4M75A 3X26B 4ME7A 1KQ2A 3QZ5B 1LNXA 3A8HB 3QXEB 2QQAA 2LC4A 3HL8A 2EAYA 5GANf 1VQMT 1BYMA 3SWNB 3WVDB 1Q86U 4C5EA 3OS0A 1M5Q1 4C5IA 2HQEA 2K57A 3RKYA 4BBRM 2K3YA 2XKOC 5CKBA 3I56A 5GANe 4FSXA 2JTFA 5GMKe 1X6OA 3FB9A 1V29B 1FKMA 2EJFA 2FVUA 2G3RA 3M57A 4C0GA 1UGQB 4N0AC 2F69A 1N9RA 2PQWA 3CC7T 1Y96A 2PVGB 4E47A 1QVFS 2V8KA 4PL6A 3CMAA 3CCMT 3CD6A 3VV0A 3CPWS 3CXCS 2QDJA 1BI2A 1N27A 2E12A 2PUKB 4N4HA 2ZGWA 3UWNA 5LJ3f 4J7IA 2E65A 3AHUA 3S3NA 4A54A 1YJNT 2FB7A 3DB3A 4EMKC 3GLXA 2QXFA 2CZ1B 3QPHA 1KHIA 5D6WA 2VXFA 4XTWA 2DTHA 2RJCA 1Q7YC 5CIUA 3S6WA 4BI4A 5LJ3e 1JBMA 2QDYB 1BIBA 2XG8D 1N8RC 4V2SA 3HFNA 1XNIA 3M5AA 4C92C 4L6V5 2RK1A 1VQ9A 4R56A 1QW1A 2PUOB 1RI0A 4O5VA 2OTJT 2QA4T 3RERA 3G4SA 4J6WA 5D6XA 3OW2A 5FU7C 1VQ8A 4RKUE 4FM4B 2DTIA 4PNOA 3OYMA 3WXMB 4HA8A 4F7UF 1RL2A 4J83A 1VQ4A 3HKSA 2E6ZA 1VQ6T 4PJOC 2DXCA 4A4EA 2DD5B 3PFSA 2QI2A 5GANh 3CCEA 5I2MA 5KH6A 4OGCA 4QQ6A 2E6NA 1H641 2GQVA 3RESA 4Z02A 4C8QC 2O01E 3FJPA 5CR2A 5KCHA 3V7CA 2FYKA 1VQKA 2VV5A 1XOVA 3FEOA 2DD4B 2XDBA 4M77D 1VQMA 4M78B 2KAFA 4R55A 1WGSA 2QQBA 2X4JA 1O75A 4EPCA 3JAME 3L2RA 4RCBA 3SDZA 4CRIA 1WJRA 4M75C 3L2QA 2HD0A 4QVCA 3JCMQ 2DZ9A 5GMKj 1YITT 1I5LA 3LWIA 1WJSA 5FRNA 3OSSC 2DXBB 3V7SA 4M7AC 2KVQG 2KQWA 2YLBA 2R57A 5LJ3h 1UEBA 3PT9A 3J81E 3CCJT 1PSFA 3CCST 4M7DC 3CC7A 3OYEA 3MEUA 4HCBA 2HQXA 2D9TA 1Y7XA 4EMGA 3OB9A 3CCMA 1NPPA 2RD1A 5KE3A 3OYHA 3OA6A 5HKCA 1VQ7T 5GAN7 3LLRA 3TEEA 1PSEA 2XDPA 4O6JA 1YJNA 3LYIA 5IAYA 3E9FA 4P5NA 3A5ZB 4LDXA 2CGHA 5LJ5g 1VIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXC B;  3X24 B;  3VYH B;  3VYG A;  1DJ7 B;  4XK8 E;  3QYG B;  2ZZD B;  2CZ7 B;  3A8M B;  2CYZ B;  2ZPE B;  3X26 B;  3QZ5 B;  3A8H B;  3QXE B;  2WSC E;  3WVD B;  2AHJ B;  2PVD B;  2DD5 A;  4OB3 B;  1UGS B;  4Y28 E;  1V29 B;  1GXI E;  3X28 B;  1UGQ B;  3A8G B;  1QP3 A;  2DD4 A;  2PVG B;  2CZ6 B;  2ZPF B;  2PUK B;  1UGR B;  1IRE B;  2D0Q B;  4KT0 E;  2CZ1 B;  2DXB A;  3VYG B;  2ZPG B;  2QDY B;  2WSF E;  2ZPH B;  4L6V 5;  2ZPB B;  2PUO B;  2PVO B;  3LW5 E;  2WSE E;  4RKU E;  4FM4 B;  1UGP B;  2DXC A;  2DD5 B;  5L8R E;  4OB0 B;  2O01 E;  3X25 B;  2DD4 B;  3WVE B;  3QZ9 B;  2ZZD A;  4ZGD B;  2CZ0 B;  3A8L B;  4ZGE B;  1JB0 E;  3A8O B;  3HHT B;  2DXB B;  2PU9 B;  1AHJ B;  3QYH B;  1PSF A;  3X20 B;  4ZGJ B;  4OB1 B;  2ZPI B;  2ZCF B;  1QP2 A;  1PSE A;  2DPP B;  4OB2 B; 
#chains in the Genus database with same CATH topology
 2VB6 A;  1VQO T;  1M2O A;  4KUD K;  3VYH B;  2LNV A;  4A4G A;  1KIK A;  3OYC A;  1M3C A;  4M77 G;  1JKW A;  3CC4 T;  1M8M A;  2OTJ A;  2QA4 A;  4JJN K;  2D8J A;  3OYG A;  2QK0 A;  5DQW A;  5A0L A;  2ENM A;  5DY9 A;  3VS1 A;  3QJ6 A;  3L2W A;  4EON B;  1TFB A;  3QO3 A;  5LJ5 d;  2BKZ B;  3I55 T;  1IB8 A;  1V1C A;  2PVD B;  5I21 A;  3J7A F;  2J6K A;  1K8A U;  4BI3 A;  3CCQ T;  3KUF A;  1TSF A;  1IO6 A;  5ICP B;  3D7S B;  3CCL T;  2K2M A;  5FU7 B;  3MET A;  1RAD B;  4FX3 B;  2OJ2 A;  4BCF B;  4GLM A;  5ACB A;  3MEW A;  4KRT A;  3L2U A;  4MML A;  2D6F A;  2F5T X;  3JCM W;  2HZY A;  1CKA A;  3EAE A;  3EH1 A;  4Y91 A;  2K9G A;  2B86 A;  2AK5 A;  4M75 B;  1NM7 A;  1W4S A;  3HPW A;  3LH0 A;  2L8D A;  4M7A B;  3GOX A;  4M7D B;  2HBP A;  4JDS A;  1XTD A;  1C9B A;  3G71 T;  4EOO B;  3PMI A;  1ZSZ A;  2GBQ A;  1H1R B;  4CFX B;  3JCM h;  2QAS A;  4EOK B;  3R6O A;  1AWJ A;  3WVE B;  3PMT A;  2P0P A;  2V8J A;  2CZ0 B;  3A8L B;  1OYX A;  1KC8 R;  5CKD A;  3PIO A;  3DDP B;  3G1J A;  3RKX A;  2DBM A;  4AG1 C;  1YCS B;  3OBW A;  4C0D C;  5GAN 4;  4RUG A;  2DXU A;  2LVM A;  3CCS Q;  1JJ2 S;  5HNB B;  4HL4 A;  1H24 B;  3I35 A;  3T9N A;  4XU2 A;  2VC8 A;  2QG9 B;  4OMQ A;  3QWX X;  5IH2 A;  1XO2 A;  2GFA A;  4EOP B;  2XI9 A;  1H3Z A;  1KK7 A;  2DVJ A;  2XMF A;  2E64 A;  4MFD A;  3BDU A;  1N8R R;  2CZ7 B;  1ABQ A;  4NS5 A;  3RR6 A;  3TQ7 P;  2IVX A;  4OF1 A;  4XU0 A;  2CYZ B;  2DET A;  1GUX A;  2H8H A;  4M78 D;  4J9I A;  3MY5 B;  1PD1 A;  4LD9 K;  1RAA B;  2RH2 A;  4AFU C;  3G6E Q;  1UGS B;  3JV3 A;  1JXO A;  1B7T A;  2RI2 A;  1KG1 A;  4HVU A;  2K5F A;  3EFR A;  1WXB A;  4HNT A;  2CP2 A;  1MV3 A;  5A2Q E;  2CZ6 B;  5I22 A;  4J6Y A;  3VUZ A;  4DEY A;  2QGF B;  4B6M A;  4E6R A;  3OYN A;  4BCI B;  2OAW A;  4XAX B;  2DX1 A;  4RG8 A;  3RUX A;  5GAN 8;  5GAM e;  3L2V A;  4M78 E;  4M78 G;  3CME Q;  2PVO B;  4RTZ A;  2W0Z A;  1P92 A;  3INZ A;  3EG1 A;  1AVZ C;  2XD0 A;  3QWY A;  1UGP B;  1I8F A;  7AT1 B;  1H92 A;  2JNG A;  4AI6 A;  2WXV B;  3TNI B;  1IHW A;  1KD1 C;  3KFV A;  4J7F A;  1M1G A;  1IHV A;  2LP5 A;  2FRW A;  1BI0 A;  2LJ1 A;  1K73 C;  3JCM b;  2AT1 B;  4ZGD B;  1WFW A;  4ELL A;  3JSC A;  4DOV A;  2EIF A;  4LDU A;  4A4H A;  4A63 B;  1OIU B;  2O9V A;  1WIE A;  3GBQ A;  2I0N A;  4FT2 A;  1YI2 Q;  2EQU A;  1GCQ C;  4E7L A;  4C5H A;  4JX6 A;  1VUB A;  1K9M U;  1X2K A;  2HKQ B;  2RI3 A;  1R0C B;  1SSF A;  3JCM g;  5GAO r;  3H0H A;  1WXU A;  2PNI A;  4NST B;  1UNL D;  3G6E A;  3K7A M;  1GRI A;  3X24 B;  1AD5 A;  3ER0 A;  4TVR A;  5GAM d;  1FMV A;  3TW6 A;  3VU3 C;  2W2H A;  3J80 E;  1H27 B;  2PZ1 A;  1TUG B;  5GJW B;  3OYA A;  3MPU B;  2IN3 A;  5IHN A;  2NLU A;  2QEX T;  1F5Q B;  1K76 A;  3VS6 A;  3CME A;  5CQX A;  5EJC A;  1UFF A;  4E7K A;  1FMK A;  4OMN A;  1W2B A;  1RLP C;  4MFE A;  3CBO A;  4YC3 B;  1Y57 A;  5D6Y A;  5HK0 A;  2OTL T;  4JRP A;  2GCX A;  1N9S A;  1W1F A;  5GAO m;  1UEC A;  4CFW B;  2UZB B;  2QTX A;  3SWN C;  4KT0 E;  1OKW B;  1M2V A;  1MND A;  2JM8 A;  3GNG A;  4OGR B;  2KDS A;  4WTO B;  3UAT A;  4BD3 A;  1Q86 C;  3KBG A;  3EFO B;  3G33 B;  3MEV A;  1QVG P;  3NFC A;  1MMN A;  2WSF E;  5FW9 A;  1QVF A;  5GAN j;  2WMB B;  3H0I A;  1B07 A;  1ZQ1 A;  3QHR B;  1UB4 A;  2VYT A;  1YWP A;  2BS4 A;  3CMA Q;  1YI2 A;  2SEM A;  3N5B B;  5KYU A;  3O0G D;  3VJP A;  2KXD A;  1H1P B;  5L8R E;  3VS4 A;  3GIB A;  3LH5 A;  2EQK A;  1G3S A;  1M3A A;  1SRL A;  5I11 A;  3E2U A;  2AKK A;  2BE9 B;  1TXQ A;  2P0Q A;  2K7A A;  2P4T A;  2DZC A;  4LXC A;  2DME A;  1WXT A;  3M9Q A;  1RLQ C;  3M53 A;  3SFM A;  4IUT A;  4M78 F;  4KGZ B;  4BY6 B;  4LE9 A;  4OB1 B;  4XTV A;  1GFC A;  1GBR A;  1HD3 A;  2ZCF B;  1QLY A;  5GAN 6;  2LTO A;  5EFQ B;  2KY9 A;  2DA9 A;  4JZ4 A;  5CAI A;  3V8J A;  3CPF A;  4BE2 A;  3JCM P;  3EG2 A;  3UT1 A;  1Q82 C;  2CKK A;  4X9D A;  1JXM A;  5CKE A;  2NYS A;  1VQ8 T;  4PJO A;  1I81 A;  4LDV A;  2LNH B;  3G7Z A;  5AYF A;  5GMK l;  1VQ4 T;  4JRK A;  4AFQ C;  4F7U A;  5J39 A;  4FSS A;  3EH2 A;  1NG2 A;  3VRY A;  1PM3 A;  5C6S A;  3CCM Q;  1WYX A;  1KQ2 A;  3A8H B;  5GAN f;  2EAY A;  1BYM A;  2P4R A;  2CP7 A;  3WVD B;  1VYW B;  2HQH A;  4C5E A;  3OS0 A;  3PE0 A;  2ED0 A;  3RKY A;  2BZ8 A;  2F2C A;  2JTF A;  4PK4 A;  1BB9 A;  4C0G A;  2FVU A;  1QQJ A;  2F69 A;  2CSI A;  2PVG B;  2COZ A;  4PL6 A;  3CMA A;  3EGD B;  1BI2 A;  5LMK B;  2ZGW A;  3AHU A;  2FB7 A;  3DB3 A;  2HEQ A;  3GLX A;  2CZ1 B;  3QPH A;  5D6W A;  2O2O A;  2VXF A;  2KT1 A;  2DFU A;  1W2B P;  1Q7Y C;  5CIU A;  3S6W A;  2XG8 D;  1ZLM A;  3HFN A;  3M5A A;  1ZUK A;  4C92 C;  4O5V A;  3RER A;  2CP6 A;  5D6X A;  2MYS A;  2KRM A;  3HKS A;  1VQ6 T;  1ZA2 B;  2DXC A;  4A4E A;  3PFS A;  5I2M A;  3CCJ Q;  5KH6 A;  2GGR A;  1QVF P;  3RES A;  2GQV A;  4Z02 A;  4C8Q C;  2O01 E;  5KCH A;  3B57 A;  1XOV A;  2DD4 B;  3TNW B;  4R55 A;  2VAS A;  1W6X A;  2X4J A;  2WIP B;  3L2R A;  5GMK j;  2UUE B;  1UGV A;  6AT1 B;  1VQO Q;  2KQW A;  1OEB A;  2YLB A;  2R57 A;  1URC B;  1UEB A;  3PT9 A;  1PSF A;  1SG5 A;  3CC4 Q;  2D9T A;  2CSQ A;  4EMG A;  3CCM A;  4EOJ B;  2RD1 A;  3HTR A;  4Y72 B;  3OA6 A;  3MIA B;  1G83 A;  2BTT A;  2KXC A;  1BCO A;  3TSZ A;  1JSU B;  1QCO A;  1UNH D;  4CC4 B;  4EOL B;  3C4S A;  3I55 Q;  4LOC A;  5GAN 2;  3G4S Q;  3CCQ Q;  1VQ5 T;  3V8K A;  4XK8 E;  1Y71 A;  2JOY A;  3CCL Q;  5EG2 A;  4DBQ A;  1RAI B;  4WCI A;  1E7P A;  2EYY A;  3M0P A;  2VVK A;  2KMT A;  5KCO A;  1IZ6 A;  2Y4Y A;  2WFY B;  3TSW A;  4C0F A;  1H26 B;  1Y07 A;  4HCZ A;  4EMK B;  2W96 A;  4OB3 B;  2ATC B;  2NUZ A;  3RKW A;  3URG A;  3MO8 A;  4YOZ A;  1SHG A;  1YNZ A;  2QDL A;  1QLB A;  2X3W D;  3MEA A;  3JCM e;  4CFU D;  2V8I A;  1Q81 R;  1KQS P;  2ROL A;  4JRI A;  5IT9 E;  2DJZ A;  3EG9 B;  3DL1 A;  3M03 A;  2O4X B;  2MCN A;  3CCJ A;  2D0Q B;  4NOY A;  1PWT A;  2YWW A;  1T3L A;  3BG9 A;  2A7Y A;  1U1S A;  2YXY A;  3G71 Q;  3QWL A;  1T0H A;  3O8V A;  1HYO A;  5HQ0 B;  4X9C A;  2MOX A;  1PCX A;  2YUQ A;  3M0T A;  2EWN A;  4XU1 A;  2RHX A;  2YRV A;  2PJQ A;  1S1N A;  2CDT A;  4RMO A;  2CP3 A;  4OMF B;  1VQO A;  1YHQ T;  2L2P A;  1I07 A;  1SRM A;  2UZL B;  3CC4 A;  1GFD A;  3JRZ A;  4ATO A;  2E41 A;  3JB9 I;  4F04 B;  2DRK A;  2F2W A;  5CVI A;  2LQN A;  3I55 A;  1M1K R;  5GAM j;  4ZGE B;  1VQL T;  5IF1 B;  1PKS A;  4L5G A;  3QSU A;  1H8K A;  3CCQ A;  2DL3 A;  1QWE A;  1UHF A;  1PRL C;  3QYH B;  2C5X B;  3DLM A;  1D1C A;  3CCL A;  4ZGJ B;  1QVG S;  1O9S A;  4D6W A;  4ZTJ A;  1QP2 A;  5CK9 A;  3EFS A;  4IUP A;  1D3B A;  1OOT A;  1TS9 A;  3QJY A;  2JMC A;  2RJE A;  3O5Z A;  3CPW P;  3HBL A;  3CC2 T;  1U06 A;  4FIB A;  4ZN3 A;  3VYG A;  4QQG A;  5GAN d;  1AZE A;  2KRS A;  1Z9Q A;  4F14 A;  4PKC C;  4IUR A;  2EKO A;  1KD1 U;  2MMP A;  1U5S A;  4MZM A;  1N5Z A;  3BG3 A;  1MMD A;  2WSC E;  4AKG A;  1G3T A;  3G71 A;  2M0Y A;  2GFU A;  4NC6 A;  1GCQ A;  2HL5 C;  1UNG D;  2AZV A;  1GXI E;  1ENW A;  4MIM A;  2RK2 A;  2DL8 A;  3BW1 A;  4AKH A;  4KBM B;  3QHS A;  2OI3 A;  1I0C A;  4VUB A;  2BS2 A;  5CCA A;  4E7J A;  2XIC A;  2Z0W A;  3OYL A;  3RGF B;  4XTX A;  2JN0 A;  1M90 C;  1VQP T;  1ZX6 A;  4BUG A;  1SHF A;  3I56 T;  5GAM f;  2KR6 A;  2ZPG B;  1XJW B;  5CQY A;  4ROD A;  4DBH A;  4M77 C;  1WQ7 A;  2X35 A;  1E7O A;  1FWZ A;  1PG5 B;  2VUB A;  1LOJ A;  3LQ5 B;  5KYW A;  1YIJ T;  5KYX A;  5DQV A;  3QBY A;  3L1A A;  2GF7 A;  4OMM A;  4QW2 A;  3VS5 A;  4II1 A;  4CFV B;  3Q1J A;  3QYB A;  3DLL A;  5IXF A;  1MUZ A;  4A53 A;  2CJM B;  1OI9 B;  1LVK A;  2MWO A;  2IW9 B;  3HZJ A;  3SWN A;  4JS5 A;  2FG0 A;  2PU9 B;  4JJB A;  1QCF A;  2C0O A;  2RPN A;  3V8L A;  4AFZ C;  2X4X A;  5DLQ E;  3PO3 S;  2M0O A;  2LW4 A;  2RQU A;  4K11 A;  3H0F A;  4IIM A;  3M58 A;  4M7A A;  2HDA A;  1BKB A;  4GY5 A;  3VRZ A;  3OMC A;  3OW2 P;  4M7D A;  2DYI A;  8AT1 B;  1VIE A;  3EHR A;  4UC4 A;  1X27 A;  4MMK A;  1ZSZ B;  2DL7 A;  2EYX A;  3OYD A;  1G5V A;  2V1R A;  2G9X B;  3M56 A;  3OYY A;  2OTL Q;  3CCR T;  4MDX A;  3QHW B;  2ZPE B;  2KI7 A;  2RJF A;  1G8X A;  3M0S A;  1JU5 C;  3THK A;  4J8O A;  4PJO F;  5DLO A;  3M4Y A;  4ZN1 A;  2L3Q A;  3EID B;  1NZ9 A;  3LGL A;  2KRN A;  1BCM A;  2RMO A;  1GL5 A;  2WAC A;  1K8A R;  2K5L A;  1UGR B;  4EOS B;  2KMG A;  3TN8 B;  3BLH B;  1YJW T;  4QSH A;  3FDR A;  4J9C A;  1Q82 U;  4I3Z B;  4HVW A;  3E9G A;  3OS1 A;  3CEY A;  4M6V A;  2PHG A;  3ME9 A;  1QVP A;  1UE9 A;  3CXC A;  1GUX B;  1QKW A;  2K3B A;  2LQW A;  1WJQ A;  5GMK m;  1OZ3 A;  4EOI B;  1M3B A;  2A37 A;  2COW A;  4ROE A;  3HRS A;  1YFN A;  1LPL A;  1JQQ A;  4EOQ B;  1KQS S;  5LJ5 h;  4YTL A;  4GLK A;  4LD6 A;  1ACM B;  3CD6 T;  2QEX A;  4D8K A;  3C0C A;  5FWB A;  1GBQ A;  1VQ8 Q;  5KE2 A;  1KQ1 A;  3JCM V;  4EIK A;  1HXD A;  5GAO n;  2BS3 A;  2MAM A;  2OTL A;  4XTU A;  2ZPI B;  4PLI A;  4C92 A;  5GAN 5;  4FYV B;  3GPL A;  2LZ6 B;  1TOV A;  1Q7Y U;  1E9H B;  2IVW A;  2HSP A;  3BHV B;  1VQ9 T;  4AKI A;  3HP9 A;  1UUE A;  3E19 A;  2FPF A;  3REA B;  4QKU A;  3PNW C;  2C6T B;  2FZK B;  4PJJ A;  4C8Q A;  3CCE T;  1OZ2 A;  3QYG B;  1MMA A;  3OYK A;  2OAU A;  4QVZ A;  3M55 A;  1RUW A;  1UJ0 A;  3ASK A;  1KC8 C;  3A8M B;  2IW8 B;  4EDU A;  4G6L B;  4J9D A;  3X26 B;  3FJ5 A;  1VQM T;  2QQA A;  2W9Z A;  5HBE B;  2DMO A;  2JJ9 A;  4OMO A;  2XKO C;  3MI9 B;  5CEI B;  2JTE A;  2KBT A;  2CUD A;  4GBQ A;  2G3R A;  2EJF A;  3H41 A;  2O88 A;  1UGQ B;  1N9R A;  1OPK A;  5EC7 A;  2YSQ A;  1WHM A;  2A28 A;  1Y96 A;  2G6F X;  4E47 A;  2PK2 A;  4AT1 B;  3CPW S;  1X6G A;  2QDJ A;  1N27 A;  2E12 A;  1AIS B;  2PUK B;  4N4H A;  2E65 A;  2FRY A;  4CXA B;  4A54 A;  1FYN A;  1D0X A;  1QWF A;  1VQ6 Q;  5AT1 B;  1KHI A;  2RJC A;  2WHB B;  4ESR A;  4BI4 A;  4E7S A;  1N8R C;  2FZG B;  2ESW A;  2B9R A;  1QW1 A;  5FU7 C;  1GH6 B;  1O9K A;  2WMA B;  1VQ8 A;  2CH4 A;  3WXM B;  4PFP A;  1RL2 A;  1ZP2 A;  3BLR B;  4J83 A;  1VQ4 A;  2E6Z A;  2QI2 A;  3VS7 A;  2GNC A;  2F2X A;  1D0Y A;  3FJP A;  4DBF A;  3V7C A;  2FYK A;  1GY3 B;  3FEO A;  5HBH B;  1O75 A;  3JAM E;  1H28 B;  4CRI A;  1YN8 A;  4M75 C;  1YIT T;  1IGQ A;  5IHK A;  1A0N B;  3F5X B;  5FRN A;  3OSS C;  3V7S A;  4RTW A;  4M7A C;  1QCN A;  5LJ3 h;  2C5O B;  3J81 E;  4M7D C;  3CCS T;  1VQ5 Q;  3MEU A;  2HQX A;  1Y7X A;  4F6W B;  1X43 A;  3OB9 A;  1NEB A;  4M4Z A;  5HKC A;  1VQ7 T;  5GAN 7;  4F17 A;  4O6J A;  1H1S B;  3E9F A;  1C1A A;  5LJ5 g;  1VIF A;  3NDQ A;  5KYU B;  3NTH A;  4BI8 B;  4X34 A;  3FRN A;  3JCM X;  4Z88 A;  1F1B B;  1K9M R;  4KH0 B;  4Z6Y A;  4C0Z A;  1NYF A;  4FT4 A;  4ELY C;  1JJ2 A;  4BB7 A;  5GMK i;  4CFU B;  3QII A;  3VKI A;  1HJD A;  1VQ6 A;  2IG0 A;  2L3P A;  3ZL7 C;  4AFS C;  2YHT A;  2EGE A;  3MCA B;  2J6F A;  4NL2 A;  1OX9 A;  3MP6 A;  3JCM f;  2Y90 A;  1OV3 A;  5FRO A;  4HT9 A;  4Y28 E;  1RAE B;  4E7I A;  4HVV A;  2W99 A;  1WQW A;  4FYW B;  4B9W A;  1FIN B;  2K3X A;  1JO8 A;  4F7L B;  5ECA A;  3PIP A;  5CKF A;  3CCV T;  3OW2 S;  4PJN A;  2NUP B;  4J5Y A;  2LX7 A;  5I5Z B;  4RTY A;  2DAQ A;  2M51 A;  4PJO B;  1H3H A;  2HAX A;  1IRE B;  2WEV B;  4KUI A;  4YOO A;  1Z9Z A;  2IW6 B;  4C92 D;  1PKD B;  4FW2 A;  1K9A A;  1ZUU A;  2Y4X A;  4DA4 A;  2ZPB B;  1WI7 A;  2P0K A;  1OL2 B;  1SF9 A;  1I4K 1;  4LDY A;  4KH1 B;  3OS2 A;  1UDL A;  2KT8 A;  2RB6 A;  1VQL Q;  4JX5 A;  1NPR A;  4MDW A;  2FEI A;  5BNJ B;  4BY1 X;  1VQ5 A;  4RTU A;  3UA6 A;  1WHG A;  1OKV B;  2L0A A;  3OY9 A;  2NUT B;  4FYY B;  4ANJ A;  4BY7 X;  3DKM A;  2YRD A;  2D0N A;  1VQN T;  4BE1 A;  1GCP A;  1OX8 A;  3CC2 Q;  3JB9 H;  2K2V A;  3A8O B;  2DF6 A;  4C92 E;  2ED1 A;  4LN2 A;  2X1N B;  5GAN 3;  5IXB A;  2EYZ A;  4M77 A;  1M90 U;  1AT1 B;  4XQ3 A;  1BI3 A;  4A4F A;  4BCH B;  2QGS A;  5HK3 A;  4B9X A;  2C06 A;  2MIO A;  2DNU A;  3GF5 A;  4J6X A;  1TWB A;  4HNV A;  4C8Q E;  2E3H A;  2DXC B;  2X4Y A;  2M16 A;  1S72 T;  1ARK A;  2QQ9 A;  1KHC A;  1D09 B;  3DB4 A;  5IN1 A;  4BCJ B;  1C6V X;  5LJ3 g;  1B34 A;  3OYF A;  4CC7 A;  1YJ9 T;  1YHQ A;  1SSH A;  1WNL A;  5FRM A;  1FX7 A;  2RA2 A;  4PLL A;  5J3B A;  4YOS A;  2L89 A;  3TRE A;  1VQP Q;  1FXX A;  2GTJ A;  1JJ2 P;  2FPD A;  3A8G B;  1VQL A;  2X51 A;  3EHQ A;  2DYB A;  2DXT A;  2C4G B;  2DIQ A;  1VA7 A;  1YIJ Q;  2X9H A;  4FL6 A;  1ZSG A;  4E2F B;  3TVT A;  2R7G A;  4AG2 C;  2F1L A;  2EW3 A;  4R0K A;  3GP8 A;  2QFZ A;  3S3O A;  2EQI A;  1WZO A;  3MP8 A;  2LQ8 A;  2ZPH B;  2MF2 A;  2O31 A;  3LWH A;  2QF7 A;  2JW4 A;  3BDL A;  4JPB W;  1BBZ A;  3CC2 A;  4LUD A;  4DQ2 A;  4II5 B;  2YDL A;  2ZAE A;  3QDR B;  3OSV A;  3P8H A;  2V26 A;  4FYX B;  3PVL A;  2VGN A;  4XTY A;  4C0D B;  3I5R A;  4PFZ A;  4IUQ A;  4DEX A;  2QTV A;  4J9F A;  8ATC B;  2L3S A;  2EVR A;  3HSB A;  3EGX A;  1LJO A;  2VKN A;  2BIV A;  4OVA A;  2MI6 A;  2FHD A;  3FLG A;  3TW7 A;  3DJB A;  2HL3 A;  1WDX A;  1WA7 A;  3ZBD A;  1AWW A;  2HKN A;  3NTI A;  2CP0 A;  2ZZD A;  4AMC A;  1X01 A;  4IUU A;  4EOM B;  4LDW A;  2DIL A;  4RTT A;  3RNJ A;  1JB0 E;  1VYV A;  4ORZ A;  2G77 A;  4CC2 A;  4FW1 A;  1RAF B;  1AHJ B;  4PJO D;  1UTI A;  1KJW A;  4Q5W A;  2HCK A;  4CFN B;  2YUP A;  2LJ0 A;  3CCR Q;  1AEY A;  1T0J A;  2RJD A;  4JZ3 A;  4C5G A;  1VQP A;  3CBP A;  3BG5 A;  1NYG A;  4OB2 B;  2JXB A;  1AZG B;  4CC3 A;  3QYE A;  4JJC A;  4JJD A;  4NL3 A;  4PJL A;  2W9F A;  4BY6 C;  2DBK A;  1YIJ A;  1VYU A;  2E5K A;  2FPE A;  4BCO B;  4C92 F;  2QQR A;  3CCU T;  2RNA A;  3JCM d;  3EOC B;  4MZT A;  4HKE A;  4RTX A;  4FU6 A;  4BCQ B;  4PJO G;  4PJO E;  2DD5 A;  1W98 B;  1YJW Q;  4F7U G;  4F7U E;  2AIR B;  2B8A A;  2JZ2 A;  4C8Q F;  3NMZ C;  3BFM A;  1D3B B;  1QMC A;  5KYY A;  2EPD A;  3VS3 A;  4M78 A;  2CCH B;  2BPM B;  5D7U A;  2J06 A;  5LJ5 e;  3SD4 A;  3ZFJ A;  2DTO A;  2X4W A;  2YRC A;  1RAC B;  4ELJ A;  1V76 A;  2DKG A;  1M8V A;  3SB2 A;  1WHK A;  3TU4 K;  2DXB A;  5A0G A;  1M1F A;  3VYG B;  1K73 U;  2KSS A;  4XU3 A;  1B3Q A;  1WLP B;  3LX7 A;  2MPX C;  2EUF A;  3A1P A;  2HMA A;  3GNF B;  4F6S B;  1MV0 B;  2LMJ A;  3H6Z A;  1R8O B;  3FC3 A;  1NJI C;  3L2Z A;  3CD6 Q;  4RCC A;  3NPF A;  4HNU A;  1SPK A;  2LCC A;  1KC8 U;  3OQ5 A;  2C0T A;  4F70 B;  2ECZ A;  4OB0 B;  4Z8A A;  3M4G A;  3CCR A;  1Q81 C;  3X25 B;  3P8B B;  2KR3 A;  5M9O A;  3QZ9 B;  2ROT A;  1NLO C;  1X75 C;  3CBM A;  1VQ9 Q;  1TUD A;  4BAC A;  1I5O B;  3AT1 B;  2EGA A;  4ELZ C;  3M0R A;  4J9B A;  4M77 E;  2YLC A;  3OBY A;  4QVD A;  1BI1 A;  3CCE Q;  3OYB A;  3H4C A;  5FU6 C;  3MHX A;  2RM4 A;  4MZP A;  2R5A A;  1N8R U;  3HO8 A;  5KYW B;  5KYX B;  2QAZ A;  4N4I A;  3G4S T;  3RMQ A;  1VQM Q;  1YJW A;  3H9N A;  2E4H A;  2KEA A;  1UHC A;  3A98 A;  2P84 A;  3M0Q A;  2D1X A;  3M54 A;  3CQT A;  2DER A;  4N4G A;  1W2B S;  5IDP B;  3PGG A;  1X69 A;  2JS0 A;  1M1K C;  1EIF A;  2IPO B;  2X3X D;  1VQK T;  3OYI A;  4M75 A;  1HSQ A;  3QZ5 B;  3HL8 A;  3QXE B;  1OIY B;  3SWN B;  1Q86 U;  1M5Q 1;  1K0S A;  2HQE A;  2K57 A;  4LUE A;  4BBR M;  5CKB A;  5GMK e;  1X6O A;  3FB9 A;  1V29 B;  1FKM A;  3M57 A;  2QEX Q;  4N0A C;  1KD1 R;  3CC7 T;  1QVF S;  3CD6 A;  2V8K A;  1K73 R;  2E3I A;  1YJN T;  4EMK C;  2QXF A;  4XTW A;  5LJ3 e;  1BIB A;  2CH4 W;  4L6V 5;  1VQ9 A;  4R56 A;  2PUO B;  2OTJ T;  2QA4 T;  4KRD B;  5HBJ B;  3SEM A;  4RKU E;  4FM4 B;  2LJ3 A;  2RQV A;  4PNO A;  2CP5 A;  4F16 A;  4F7U F;  1YIT Q;  1OU8 A;  1KXU A;  1W70 A;  5GAN h;  4BCQ D;  3CCE A;  1E6H A;  3DOG B;  4BXX X;  4OGC A;  4PFO A;  2CUB A;  2VV5 A;  5LQF B;  5HVY B;  2XDB A;  1VQM A;  1VQ7 Q;  2KAF A;  4EC8 B;  1WGS A;  1RAB B;  4X1V A;  4EPC A;  3SDZ A;  2A0F B;  3L2Q A;  1H4L D;  4BCM B;  2DZ9 A;  4J9H A;  3JCM Q;  1I5L A;  1TU0 B;  3LWI A;  4ROC A;  2KVQ G;  3OYE A;  2DL4 A;  2MK5 A;  1NPP A;  2VWF A;  1AWX A;  4LNP A;  3LLR A;  2UZE B;  3LYI A;  5IAY A;  4P5N A;  4LDX A;  2CGH A;  2DPP B;  1IGU A;  4BCK B;  1BK2 A;  3C12 A;  3VS2 A;  1TUC A;  4ZNX A;  5LJ3 d;  2K79 A;  1QVG A;  2CT3 A;  1DJ7 B;  3DTO A;  2JUF A;  4HT8 A;  1PNJ A;  3BLQ B;  1Q86 R;  1JRI A;  4M77 F;  1VQ4 Q;  2C5V B;  3P8D A;  2EQM A;  3RIR A;  2EGC A;  3CCV Q;  2E10 A;  1I1J A;  2JMA A;  2RQW A;  3SHW A;  1IXD A;  3L42 A;  1PC0 A;  1YCY A;  3NTK A;  2LT1 A;  3QUI A;  2KK4 A;  4M78 C;  3S3N A;  1U1T A;  3NHN A;  3E1S A;  1TH7 A;  1YWO A;  4KGX B;  4C92 B;  2A08 A;  5GAO q;  2EQJ A;  1FMW A;  1FVV B;  1D1A A;  5LL6 S;  2CS7 A;  3PVQ A;  1YIT A;  2ZPF B;  1KFZ A;  2JS2 A;  3CCS A;  1J3T A;  4BBS M;  2DLP A;  2FL7 A;  3POM A;  4OGE A;  2I2L A;  1ZUY A;  3OYJ A;  3OS5 A;  2DK3 A;  4C8Q B;  1WHJ A;  1RI9 A;  1VQ7 A;  2RHU A;  1X6B A;  3LGF A;  5FLX E;  1EX4 A;  1VQN Q;  2ABL A;  2KRO A;  2JTM A;  2A36 A;  1PHT A;  1VOM A;  2XK0 A;  1Q82 R;  4IIO A;  1ZBJ A;  2LQK A;  4HCC A;  5GAO p;  3QKJ A;  1ABO A;  2QYZ A;  4PJM A;  3VKH A;  3QG1 A;  5IHY A;  2RHY A;  3RDV A;  1Y96 B;  4J9G A;  1M27 C;  2QQS A;  1D0Z A;  3HFO A;  4M75 D;  2EBP A;  2PK9 B;  5I2S A;  1K8A C;  1RAH B;  2LDM A;  4M7A D;  3EGU A;  2A3L A;  2CT4 A;  1JOW A;  3JCM c;  4M7D D;  1S72 Q;  1NBE B;  2M02 A;  3BE3 A;  4JUV A;  3X20 B;  4EMH A;  2DO3 A;  5HY6 A;  4BDY A;  5J26 A;  5GAN g;  4CI0 C;  3CCV A;  5GMK h;  2J05 A;  4DBR A;  1YJ9 Q;  2WJ9 A;  3C95 A;  3JB9 D;  2H3J A;  5DM7 R;  1QKX A;  1O9K B;  4A4K A;  4KUL A;  4J9E A;  2BZY A;  3CXC P;  1JST B;  2OX7 A;  3JB9 J;  3HB9 A;  3IQL A;  4BDZ A;  4F7N B;  2BKD N;  4F6U B;  3M59 A;  2AZS A;  1M2V B;  3EFO A;  4M75 G;  4M75 E;  3RMS A;  1Q7Y R;  2RQR A;  2UZD B;  2C0I A;  2DVE A;  3OMG A;  3C94 A;  4M7A G;  2YT6 A;  4M7A E;  4EC9 B;  2M1H A;  4M7D G;  4M7D E;  3I9Q A;  1H1Q B;  2DE0 X;  2AHJ B;  2EYW A;  4BE0 A;  4Y92 A;  2QQ8 A;  4BCM D;  2DL5 A;  3UDC A;  3JB9 G;  3BHU B;  1ZSZ C;  4FCY A;  3VUB A;  1VQN A;  2KYM A;  3MJX A;  4JLI A;  2JM9 A;  2XU8 A;  3EG0 A;  1EZZ B;  2GQI A;  2J6O A;  2L5Q A;  2LT4 A;  1U8R A;  4IKF A;  1G3W A;  1M9S A;  3V7R A;  3EJ1 B;  3G6E T;  4QT7 A;  3TCJ A;  3MY1 B;  4IMY B;  2M9U A;  2VGM A;  2SRC A;  2IIM A;  3UPU A;  3S3M A;  4JRQ A;  1OL1 B;  2XDD A;  3LW5 E;  4QQD A;  3EG3 A;  1E6G A;  2NWM A;  2WSE E;  5CO7 A;  4JX4 A;  2DRM A;  4TTH A;  3QDF A;  1UJY A;  1S72 A;  4CFM B;  3GTM S;  4JS4 A;  5CYI B;  1VYT A;  5LJ5 j;  2JVV A;  2E1H A;  4KRC B;  1YHQ Q;  4WF2 A;  3U23 A;  1Q95 G;  2LRQ A;  1SKU B;  1YJ9 A;  1R77 A;  1X2Q A;  2NUP A;  1G3N C;  3CME T;  2DEQ A;  4F7U B;  1G3Y A;  2F5K A;  2JGZ B;  1D3U B;  3BY7 A;  4L59 A;  4HXJ A;  1C0M A;  1NLP C;  4RG2 A;  2R5M A;  4EOR B;  5IDN B;  4XTZ A;  3PTA A;  2RN8 A;  3H8Z A;  3F70 A;  2RF0 A;  5GAM h;  1KQS A;  2EYQ A;  2XID A;  3NGP A;  4BCN B;  4C8Q D;  3CCU Q;  5A0D A;  4E7H A;  1IRX A;  2COY A;  1K1Z A;  2JT4 A;  3EGD A;  5GJV B;  1MGQ A;  2H3E B;  2L3R A;  2XHC A;  2WIH B;  3RBB B;  1VIN A;  1G2B A;  1YI2 T;  1NJI U;  2NUT A;  3FIF A;  1OI1 A;  4C92 G;  2KYB A;  4F7J B;  1N4M A;  3M0U A;  2V22 B;  5L2W B;  3ULR B;  1OU9 A;  1WHL A;  4RTV A;  1OPL A;  5C0M A;  1Q81 U;  1WHH A;  2MWP A;  3JCM J;  2YUO A;  2FO0 A;  2K6D A;  2E5Q A;  4ZTF A;  5KYN A;  1ZHI A;  4C8Q G;  4M77 B;  2F2V A;  3X28 B;  5LJ5 f;  2EFI A;  1MHN A;  1QP3 A;  1CKB A;  2DD4 A;  3BHT B;  2DEU A;  1OQK A;  1LCK A;  1TG0 A;  2QGG A;  3KXT A;  1JEG A;  4M75 F;  2EKH A;  4F7S B;  2I53 A;  1H25 B;  3HRT A;  2RHZ A;  2RI5 A;  1K9M C;  1UG1 A;  5FU6 B;  4M7A F;  4OP0 A;  1K0X A;  3ZEH A;  2CRE A;  4M7D F;  3HRU A;  3TNH B;  1B34 B;  2K4Y A;  2R58 A;  3I56 Q;  1M30 A;  1K4U S;  2RO0 A;  3CPW A;  1TD6 A;  4DOW A;  1U3O A;  2GTO A;  3JB9 F;  1WX6 A;  2K5I A;  1M1K U;  2LCL A;  2BZX A;  1D1B A;  1NEG A;  2DM1 A;  2BE7 D;  2VXE A;  2WPA B;  1P5E B;  2BUD A;  4E7Z A;  1VOL A;  4N0A A;  3CCU A;  1Y0M A;  2DIG A;  4HLQ A;  5LJ3 j;  1TTH B;  1NE8 A;  2HSE B;  1YBY A;  3CMA T;  1OUL A;  5CKH A;  4EMK A;  1CSK A;  5GAO l;  3HHT B;  1N6A A;  1HK9 A;  1WPY A;  1QMZ B;  3UA7 A;  2RHI A;  1M4Z A;  1MNE A;  1ZBX A;  3MP1 A;  1NJI R;  1VQK Q;  5HCK A;  2O9S A;  1XQH A;  4JLG A;  3REB B;  4UN0 A;  3EG9 A;  1MMG A;  2O4X A;  2EJ9 A;  1M90 R;  2LX9 A;  2AKL A;  2J7I A;  1BIA A;  1AOJ A;  2HNI A;  4IUV A;  2E70 A;  3EGX B;  2KNB B;  3CC7 Q;  2C5N B;  2KE9 A;  2I40 B;  2ZZD B;  3VKG A;  5GAM g;  3KHI A;  2EJG A;  4ME7 A;  1OGU B;  1LNX A;  4D8D A;  2LC4 A;  1BU2 A;  1YJN Q;  4BCG B;  1PRM C;  4C5I A;  3R6N A;  2K3Y A;  3I56 A;  5GAN e;  4FSX A;  2PMI B;  2YUN A;  2PQW A;  2RQT A;  4OMP A;  2PTK A;  2OTJ Q;  2QA4 Q;  3CCM T;  1PD0 A;  5FWC A;  4KGV B;  3VV0 A;  3CXC S;  2DJQ A;  3UWN A;  5LJ3 f;  4J7I A;  4BCN D;  1R0B G;  4HCK A;  9ATC B;  2CCI B;  2HBW A;  2DTH A;  1YP5 A;  5IHI A;  1JBM A;  2QDY B;  4V2S A;  4OML A;  1XNI A;  1RAG B;  2RK1 A;  1AWO A;  1RI0 A;  4BCP B;  3MKD A;  4J6W A;  3G4S A;  3OW2 A;  1ZA1 B;  1KSW A;  2DTI A;  3OYM A;  4HA8 A;  2D8H A;  4Z89 A;  4PJO C;  2DD5 B;  2KGT A;  5L23 A;  1BU1 A;  3DDQ B;  4QQ6 A;  2E6N A;  1H64 1;  5CR2 A;  1VQK A;  5KYY B;  4M77 D;  4M78 B;  1T3S A;  2QQB A;  3I5S A;  4RCB A;  1WJR A;  1PKT A;  2HD0 A;  4QVC A;  4CRL B;  1WJS A;  2LCS A;  2DXB B;  3CCJ T;  3CC7 A;  5FGK B;  2V1Q A;  4HCB A;  2W10 A;  2FZC B;  5KE3 A;  4OR5 B;  3OYH A;  1SEM A;  1EFN A;  3TEE A;  3VS0 A;  1PSE A;  3UF4 A;  2XDP A;  1YJN A;  3A5Z B;  1AD6 A; 
#chains in the Genus database with same CATH homology
 3C4S A;  3C12 A;  3NTH A;  1VQO T;  4BI8 B;  4X34 A;  4KUD K;  3VYH B;  2LNV A;  4LOC A;  3FRN A;  4A4G A;  5LJ3 d;  3JCM X;  5GAN 2;  3OYC A;  1QVG A;  4M77 G;  1VQ5 T;  3V8K A;  3CC4 T;  1DJ7 B;  2JUF A;  4HT8 A;  4Z6Y A;  4XK8 E;  2QA4 A;  4JJN K;  2OTJ A;  3OYG A;  4C0Z A;  4FT4 A;  1JRI A;  1Y71 A;  2JOY A;  4M77 F;  4BB7 A;  4ELY C;  5EG2 A;  5A0L A;  3P8D A;  5GMK i;  1JJ2 A;  5DY9 A;  1E7P A;  2EQM A;  3QII A;  3QJ6 A;  3RIR A;  3VKI A;  3L2W A;  2KMT A;  5KCO A;  2E10 A;  1IZ6 A;  1VQ6 A;  2IG0 A;  2Y4Y A;  3QO3 A;  4C0F A;  1Y07 A;  3L42 A;  4HCZ A;  4EMK B;  2YHT A;  5LJ5 d;  1YCY A;  3MCA B;  3NTK A;  2LT1 A;  3QUI A;  2KK4 A;  4M78 C;  3I55 T;  1U1T A;  5I21 A;  2PVD B;  3J7A F;  3E1S A;  4OB3 B;  4NL2 A;  3MP6 A;  4BI3 A;  3JCM f;  3RKW A;  3CCQ T;  1TH7 A;  2Y90 A;  3KUF A;  5FRO A;  4HT9 A;  4Y28 E;  3URG A;  4E7I A;  3MO8 A;  4C92 B;  5GAO q;  1WQW A;  4B9W A;  2EQJ A;  3CCL T;  1QLB A;  3MEA A;  2K3X A;  3JCM e;  2V8I A;  5FU7 B;  5LL6 S;  2CS7 A;  1YIT A;  3MET A;  5CKF A;  3PIP A;  3CCV T;  3OW2 S;  2ZPF B;  4JRI A;  4J5Y A;  5IT9 E;  2DJZ A;  2DAQ A;  3DL1 A;  2O4X B;  3CCJ A;  4PJO B;  3MEW A;  2HAX A;  3L2U A;  3CCS A;  1IRE B;  2D0Q B;  4BBS M;  4MML A;  2D6F A;  4NOY A;  2FL7 A;  4OGE A;  3BG9 A;  2A7Y A;  1U1S A;  2F5T X;  2I2L A;  3JCM W;  3QWL A;  4KUI A;  3O8V A;  2DK3 A;  3OS5 A;  3OYJ A;  4C8Q B;  4C92 D;  3EAE A;  4X9C A;  1VQ7 A;  2Y4X A;  4DA4 A;  4Y91 A;  2RHU A;  2EWN A;  2ZPB B;  4XU1 A;  2P0K A;  2RHX A;  2YRV A;  3LGF A;  4RMO A;  5FLX E;  1I4K 1;  4M75 B;  4LDY A;  3OS2 A;  4OMF B;  1W4S A;  1VQO A;  1YHQ T;  2RB6 A;  2JTM A;  4JX5 A;  1NPR A;  3HPW A;  3LH0 A;  1VQN T;  4MDW A;  2L8D A;  4M7A B;  3GOX A;  1VQ5 A;  3CC4 A;  2XK0 A;  4M7D B;  2HBP A;  3JRZ A;  4JDS A;  1XTD A;  2LQK A;  3G71 T;  3PMI A;  5GAO p;  3QKJ A;  4HCC A;  4ATO A;  3VKH A;  2E41 A;  3JB9 I;  1JJ2 S;  3QG1 A;  3JCM h;  2RHY A;  3OY9 A;  3R6O A;  1Y96 B;  5CVI A;  3WVE B;  2QQS A;  3HFO A;  3PMT A;  3DKM A;  2P0P A;  4M75 D;  5I2S A;  1K8A C;  2V8J A;  2CZ0 B;  3I55 A;  4BE1 A;  5GAM j;  3A8L B;  4ZGE B;  1OYX A;  4L5G A;  1VQL T;  2LDM A;  3QSU A;  3CCQ A;  2K2V A;  3A8O B;  5CKD A;  3PIO A;  4C92 E;  3JB9 H;  4M7A D;  4BDY A;  2A3L A;  4M7D D;  3JCM c;  5GAN 3;  3RKX A;  3QYH B;  4JUV A;  3DLM A;  3X20 B;  3OBW A;  4C0D C;  4ZGJ B;  4EMH A;  1QVG S;  3CCL A;  4M77 A;  1M90 U;  2DO3 A;  5HY6 A;  1O9S A;  4XQ3 A;  5J26 A;  1BI3 A;  4A4F A;  4D6W A;  5GAN g;  5HK3 A;  1QP2 A;  5GAN 4;  4CI0 C;  3CCV A;  5GMK h;  4ZTJ A;  5CK9 A;  2DXU A;  2LVM A;  3EFS A;  4B9X A;  2WJ9 A;  3C95 A;  4IUP A;  3JB9 D;  1D3B A;  2H3J A;  5DM7 R;  3GF5 A;  4HL4 A;  4J6X A;  4A4K A;  3QJY A;  4KUL A;  2RJE A;  3CC2 T;  3HBL A;  3T9N A;  4HNV A;  4XU2 A;  2VC8 A;  4FIB A;  4C8Q E;  3JB9 J;  3HB9 A;  4BDZ A;  2DXC B;  2X4Y A;  2M16 A;  1S72 T;  2GFA A;  2BKD N;  3VYG A;  3M59 A;  2QQ9 A;  4ZN3 A;  1KHC A;  2XI9 A;  1H3Z A;  3DB4 A;  5IN1 A;  4M75 G;  4M75 E;  3RMS A;  2E64 A;  4MFD A;  4QQG A;  3BDU A;  5LJ3 g;  1B34 A;  2DVE A;  5GAN d;  3OYF A;  1YJ9 T;  3OMG A;  3C94 A;  4IUR A;  4PKC C;  2EKO A;  1YHQ A;  1KD1 U;  2CZ7 B;  2MMP A;  4MZM A;  4NS5 A;  4M7A G;  4M7A E;  2M1H A;  1WNL A;  4OF1 A;  4XU0 A;  2CYZ B;  3BG3 A;  5FRM A;  4M7D G;  1FX7 A;  2RA2 A;  4PLL A;  4M7D E;  2WSC E;  4AKG A;  1G3T A;  4M78 D;  5J3B A;  3G71 A;  2AHJ B;  4BE0 A;  2L89 A;  3TRE A;  4LD9 K;  2QQ8 A;  1FXX A;  2RH2 A;  2GFU A;  4NC6 A;  1UGS B;  3UDC A;  3JB9 G;  2RI2 A;  1GXI E;  1KG1 A;  2K5F A;  4MIM A;  3EFR A;  2RK2 A;  3BW1 A;  4AKH A;  4HNT A;  2DPP B;  3QHS A;  3A8G B;  4KBM B;  3VUB A;  1VQN A;  4VUB A;  5CCA A;  2BS2 A;  1VQL A;  4JLI A;  5A2Q E;  2CZ6 B;  2DXT A;  2DIQ A;  4E7J A;  2XU8 A;  4J6Y A;  2XIC A;  3VUZ A;  4FL6 A;  3OYL A;  4XTX A;  2JN0 A;  2L5Q A;  2LT4 A;  1U8R A;  1M90 C;  2C06 A;  3OYN A;  4IKF A;  1VQP T;  1G3W A;  1M9S A;  3V7R A;  4XAX B;  4BUG A;  3I56 T;  3G6E T;  5GAM f;  3TCJ A;  2KR6 A;  2ZPG B;  4RG8 A;  2QFZ A;  3GP8 A;  3S3O A;  5CQY A;  2M9U A;  2VGM A;  3MP8 A;  4M77 C;  2LQ8 A;  1WQ7 A;  3RUX A;  2ZPH B;  2MF2 A;  3LWH A;  3UPU A;  2QF7 A;  5GAN 8;  3BDL A;  5GAM e;  3S3M A;  2X35 A;  4JRQ A;  3L2V A;  4M78 E;  4M78 G;  1FWZ A;  2PVO B;  2XDD A;  3LW5 E;  3CC2 A;  4QQD A;  4DQ2 A;  2VUB A;  1LOJ A;  1P92 A;  3INZ A;  1YIJ T;  2WSE E;  5CO7 A;  4JX4 A;  1S72 A;  3QBY A;  2XD0 A;  4JS4 A;  1UGP B;  1I8F A;  3L1A A;  3QDR B;  3OSV A;  2GF7 A;  3P8H A;  2JNG A;  5LJ5 j;  2JVV A;  4AI6 A;  2E1H A;  4QW2 A;  2VGN A;  4XTY A;  4C0D B;  4II1 A;  4IUQ A;  1K8A U;  4WF2 A;  3Q1J A;  1KD1 C;  3QYB A;  4J7F A;  2LRQ A;  3DLL A;  1YJ9 A;  1M1G A;  3HSB A;  1LJO A;  1BI0 A;  2BIV A;  4OVA A;  1K73 C;  2MI6 A;  3CME T;  2FHD A;  3FLG A;  3JCM b;  3TW7 A;  2DEQ A;  3ZBD A;  4F7U B;  3NTI A;  2ZZD A;  1G3Y A;  1X01 A;  4IUU A;  4ZGD B;  2F5K A;  3JSC A;  4LDW A;  4A53 A;  3BY7 A;  4L59 A;  2MWO A;  4DOV A;  1JB0 E;  3HZJ A;  2EIF A;  4LDU A;  4A4H A;  3SWN A;  4JS5 A;  4RG2 A;  2G77 A;  2R5M A;  2PU9 B;  1AHJ B;  4FT2 A;  2EQU A;  4XTZ A;  3PTA A;  4PJO D;  3H8Z A;  4Q5W A;  4E7L A;  4C5H A;  4JX6 A;  3F70 A;  3V8L A;  1VUB A;  2X4X A;  5GAM h;  5DLQ E;  1K9M U;  1KQS A;  2M0O A;  2EYQ A;  2RI3 A;  2XID A;  4C8Q D;  1SSF A;  3M58 A;  5A0D A;  4E7H A;  3JCM g;  4M7A A;  5GAO r;  2RJD A;  1BKB A;  4GY5 A;  4C5G A;  3OMC A;  1VQP A;  4M7D A;  3CBP A;  1MGQ A;  3G6E A;  3BG5 A;  4OB2 B;  2L3R A;  2XHC A;  1VIE A;  3QYE A;  3X24 B;  4UC4 A;  1YI2 T;  1NJI U;  4MMK A;  4NL3 A;  3FIF A;  1OI1 A;  3ER0 A;  4C92 G;  3OYD A;  4BY6 C;  1G5V A;  4TVR A;  5GAM d;  3M56 A;  3OYY A;  3TW6 A;  3VU3 C;  3J80 E;  1YIJ A;  3CCR T;  4C92 F;  2QQR A;  3CCU T;  4MDX A;  3JCM d;  2ZPE B;  3OYA A;  4MZT A;  4HKE A;  1Q81 U;  4FU6 A;  5C0M A;  2RJF A;  2MWP A;  4PJO G;  3JCM J;  4PJO E;  2E5Q A;  2NLU A;  2QEX T;  2DD5 A;  4J8O A;  4ZTF A;  4PJO F;  1ZHI A;  5DLO A;  4C8Q G;  4F7U G;  4M77 B;  4F7U E;  3CME A;  3M4Y A;  2B8A A;  5CQX A;  5EJC A;  3X28 B;  4ZN1 A;  4E7K A;  5LJ5 f;  1W2B A;  2EFI A;  4MFE A;  2JZ2 A;  3CBO A;  5D6Y A;  5HK0 A;  2OTL T;  1MHN A;  1NZ9 A;  1QP3 A;  3LGL A;  2DD4 A;  3BFM A;  1D3B B;  4C8Q F;  4JRP A;  2GCX A;  4M78 A;  1N9S A;  5LJ5 e;  3SD4 A;  5GAO m;  3ZFJ A;  2DTO A;  2WAC A;  2X4W A;  2QTX A;  3KXT A;  2K5L A;  1UGR B;  4ELJ A;  4M75 F;  2DKG A;  1M8V A;  3SB2 A;  3SWN C;  4KT0 E;  3TU4 K;  2KMG A;  2DXB A;  3HRT A;  5A0G A;  1M1F A;  3GNG A;  2RHZ A;  3VYG B;  2RI5 A;  4QSH A;  2KDS A;  3FDR A;  2KSS A;  5FU6 B;  1YJW T;  1K73 U;  4XU3 A;  4M7A F;  4OP0 A;  1Q82 U;  4BD3 A;  1Q86 C;  3KBG A;  3ZEH A;  4M7D F;  3HRU A;  3LX7 A;  3E9G A;  3MEV A;  1B34 B;  2K4Y A;  2R58 A;  2WSF E;  3CEY A;  3NFC A;  3OS1 A;  1QVF A;  3GNF B;  5GAN j;  4M6V A;  2RO0 A;  3H6Z A;  1R8O B;  3ME9 A;  1QVP A;  3CPW A;  4DOW A;  3CXC A;  3FC3 A;  1ZQ1 A;  1NJI C;  1UB4 A;  2VYT A;  3L2Z A;  3JB9 F;  1VQK T;  2BS4 A;  4RCC A;  1YI2 A;  2K5I A;  1WJQ A;  4HNU A;  3N5B B;  1OZ3 A;  2LCC A;  5GMK m;  2LCL A;  1M1K U;  1KC8 U;  3VJP A;  3OQ5 A;  1K9M C;  2VXE A;  5L8R E;  3HRS A;  3GIB A;  2BUD A;  4OB0 B;  3M4G A;  2EQK A;  3CCR A;  1G3S A;  4N0A A;  3CCU A;  1Q81 C;  3X25 B;  2DIG A;  4HLQ A;  3P8B B;  5LJ3 j;  1KQS S;  5M9O A;  3QZ9 B;  5LJ5 h;  1NE8 A;  4YTL A;  4GLK A;  4LD6 A;  1X75 C;  3CBM A;  1YBY A;  4BAC A;  3CD6 T;  2QEX A;  3CMA T;  4ELZ C;  2P0Q A;  4M77 E;  5CKH A;  2P4T A;  2DZC A;  4EMK A;  5GAO l;  3HHT B;  2YLC A;  3M9Q A;  3OBY A;  5KE2 A;  1KQ1 A;  1N6A A;  1HK9 A;  3M53 A;  4IUT A;  1WPY A;  3SFM A;  3JCM V;  1HXD A;  2RHI A;  4M78 F;  4QVD A;  5GAO n;  2BS3 A;  1M4Z A;  2MAM A;  4BY6 B;  2OTL A;  1BI1 A;  4OB1 B;  4XTV A;  4XTU A;  2ZPI B;  4PLI A;  4C92 A;  5GAN 5;  2ZCF B;  1ZBX A;  3GPL A;  3MP1 A;  5GAN 6;  3OYB A;  3H4C A;  2LTO A;  1Q7Y U;  2KY9 A;  5FU6 C;  3MHX A;  5CAI A;  2RM4 A;  4MZP A;  2IVW A;  2R5A A;  3CPF A;  3HO8 A;  3V8J A;  4BE2 A;  1VQ9 T;  1N8R U;  4AKI A;  3HP9 A;  4N4I A;  3E19 A;  3UT1 A;  3JCM P;  1XQH A;  4JLG A;  3G4S T;  3RMQ A;  1Q82 C;  2CKK A;  4X9D A;  1YJW A;  2O4X A;  5CKE A;  1VQ8 T;  4PJO A;  2EJ9 A;  1I81 A;  3PNW C;  4LDV A;  3G7Z A;  2LX9 A;  5AYF A;  5GMK l;  1VQ4 T;  1BIA A;  4JRK A;  2HNI A;  4IUV A;  2E70 A;  3M54 A;  4C8Q A;  4F7U A;  5J39 A;  4N4G A;  3CCE T;  1OZ2 A;  1W2B S;  3PGG A;  3QYG B;  3OYK A;  2OAU A;  4QVZ A;  2ZZD B;  1M1K C;  3M55 A;  3VKG A;  3ASK A;  3KHI A;  1EIF A;  5C6S A;  5GAM g;  1KC8 C;  3A8M B;  2EJG A;  4EDU A;  3OYI A;  4M75 A;  3X26 B;  4ME7 A;  1KQ2 A;  3QZ5 B;  1LNX A;  3A8H B;  3QXE B;  2QQA A;  2LC4 A;  3HL8 A;  2EAY A;  5GAN f;  1VQM T;  1BYM A;  3SWN B;  3WVD B;  1Q86 U;  4C5E A;  3OS0 A;  1M5Q 1;  4C5I A;  2HQE A;  2K57 A;  3RKY A;  4BBR M;  2K3Y A;  2XKO C;  5CKB A;  3I56 A;  5GAN e;  4FSX A;  2JTF A;  5GMK e;  1X6O A;  3FB9 A;  1V29 B;  1FKM A;  2EJF A;  2FVU A;  2G3R A;  3M57 A;  4C0G A;  1UGQ B;  4N0A C;  2F69 A;  1N9R A;  2PQW A;  3CC7 T;  1Y96 A;  2PVG B;  4E47 A;  1QVF S;  2V8K A;  4PL6 A;  3CMA A;  3CCM T;  3CD6 A;  3VV0 A;  3CPW S;  3CXC S;  2QDJ A;  1BI2 A;  1N27 A;  2E12 A;  2PUK B;  4N4H A;  2ZGW A;  3UWN A;  5LJ3 f;  4J7I A;  2E65 A;  3AHU A;  3S3N A;  4A54 A;  1YJN T;  2FB7 A;  3DB3 A;  4EMK C;  3GLX A;  2QXF A;  2CZ1 B;  3QPH A;  1KHI A;  5D6W A;  2VXF A;  4XTW A;  2DTH A;  2RJC A;  1Q7Y C;  5CIU A;  3S6W A;  4BI4 A;  5LJ3 e;  1JBM A;  2QDY B;  1BIB A;  2XG8 D;  1N8R C;  4V2S A;  3HFN A;  1XNI A;  3M5A A;  4C92 C;  4L6V 5;  2RK1 A;  1VQ9 A;  4R56 A;  1QW1 A;  2PUO B;  1RI0 A;  4O5V A;  2OTJ T;  2QA4 T;  3RER A;  3G4S A;  4J6W A;  5D6X A;  3OW2 A;  5FU7 C;  1VQ8 A;  4RKU E;  4FM4 B;  2DTI A;  4PNO A;  3OYM A;  3WXM B;  4HA8 A;  4F7U F;  1RL2 A;  4J83 A;  1VQ4 A;  3HKS A;  2E6Z A;  1VQ6 T;  4PJO C;  2DXC A;  4A4E A;  2DD5 B;  3PFS A;  2QI2 A;  5GAN h;  3CCE A;  5I2M A;  5KH6 A;  4OGC A;  4QQ6 A;  2E6N A;  1H64 1;  2GQV A;  3RES A;  4Z02 A;  4C8Q C;  2O01 E;  3FJP A;  5CR2 A;  5KCH A;  3V7C A;  2FYK A;  1VQK A;  2VV5 A;  1XOV A;  3FEO A;  2DD4 B;  2XDB A;  4M77 D;  1VQM A;  4M78 B;  2KAF A;  4R55 A;  1WGS A;  2QQB A;  2X4J A;  1O75 A;  4EPC A;  3JAM E;  3L2R A;  4RCB A;  3SDZ A;  4CRI A;  1WJR A;  4M75 C;  3L2Q A;  2HD0 A;  4QVC A;  3JCM Q;  2DZ9 A;  5GMK j;  1YIT T;  1I5L A;  3LWI A;  1WJS A;  5FRN A;  3OSS C;  2DXB B;  3V7S A;  4M7A C;  2KVQ G;  2KQW A;  2YLB A;  2R57 A;  5LJ3 h;  1UEB A;  3PT9 A;  3J81 E;  3CCJ T;  1PSF A;  3CCS T;  4M7D C;  3CC7 A;  3OYE A;  3MEU A;  4HCB A;  2HQX A;  2D9T A;  1Y7X A;  4EMG A;  3OB9 A;  3CCM A;  1NPP A;  2RD1 A;  5KE3 A;  3OYH A;  3OA6 A;  5HKC A;  1VQ7 T;  5GAN 7;  3LLR A;  3TEE A;  1PSE A;  2XDP A;  4O6J A;  1YJN A;  3LYI A;  5IAY A;  3E9F A;  4P5N A;  3A5Z B;  4LDX A;  2CGH A;  5LJ5 g;  1VIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...