3X20B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 25 min
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x20B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x20B02
3QZ5B 3WVEB 3A8HB 3HHTB 1QP2A 3X24B 2WSEE 2PVDB 2PVGB 3X20B 2AHJB 2DXCB 3VYGB 2PUKB 2QDYB 3X28B 2ZPGB 4KT0E 2O01E 2ZPFB 2CZ0B 2ZZDB 3VYGA 2WSFE 2CYZB 3A8LB 1PSEA 2PUOB 3QYHB 5L8RE 1IREB 4XK8E 3QXEB 2ZPIB 3A8OB 4ZGEB 2DD5A 1UGQB 2DD4A 2DXBB 3VYHB 2ZCFB 2ZZDA 1AHJB 3QYGB 3X26B 3QZ9B 1PSFA 2DPPB 2DXBA 3LW5E 1QP3A 1JB0E 3X25B 3WVDB 1V29B 1UGSB 2CZ7B 2WSCE 2DXCA 4OB2B 1DJ7B 2ZPHB 4FM4B 4ZGDB 4OB1B 2PVOB 4Y28E 3A8MB 1UGPB 4OB0B 4L6V5 2CZ1B 2PU9B 2DD5B 3A8GB 2ZPEB 2DD4B 4ZGJB 4OB3B 1GXIE 2CZ6B 2ZPBB 4RKUE 1UGRB 2D0QB
chains in the Genus database with same CATH superfamily
5GANd 1ZP2A 3MY5B 5KYXB 3ER0A 2KSSA 4KUIA 1EX4A 3EH2A 3RKXA 5IHKA 4PJOC 3KFVA 1X6OA 3SHWA 2A0FB 3R6NA 3C12A 2QK0A 4C8QE 5HVYB 3DJBA 2FRYA 4KGZB 2M9UA 1YJNT 2FL7A 2HEQA 4LUEA 4M75E 3ZFJA 3A8LB 5FRNA 2O4XA 1M9SA 2NLUA 3EG9B 1YWOA 4E47A 1UE9A 3THKA 1IREB 2QTXA 4F7JB 2PTKA 4IIMA 1K0XA 1YITT 2E65A 4PJJA 1Q81R 1SSHA 3AHUA 5GAOl 4MMLA 1SKUB 3GNFB 3H0IA 4M77F 1QW1A 1Q81U 3PVQA 4E7KA 2QEXT 4M78E 2CT3A 3X26B 1YJNQ 4EOLB 1VQMQ 1RABB 4BCND 2WIPB 1NPPA 2P0PA 1V29B 2QGGA 4F7UB 4CC3A 2K5IA 1VQ5T 4F6UB 3JCMe 3QDFA 5LJ5d 1BCOA 1X01A 4BCOB 2NUZA 4JX5A 4UN0A 2BE9B 1UEBA 2NUTB 4M75F 4A4KA 1VQOQ 2EW3A 2JXBA 3SDZA 3SEMA 1IB8A 1FMKA 5GAN8 2XDPA 2BZ8A 2C0OA 3JB9F 4OB0B 2CP2A 3DKMA 4YOOA 5GAMh 4LDUA 3GOXA 2A28A 5D6XA 3CBOA 1OGUB 2DD4B 3OA6A 1YI2Q 3VKGA 4LDWA 1BCMA 2MMPA 3C94A 2P84A 1O75A 4JS5A 3G4SQ 3CCUT 2FB7A 2QXFA 2MOXA 1ZUUA 4OMPA 5KYWB 1YHQQ 3CCVT 2PHGA 3IQLA 4M78A 1LOJA 1P92A 1MMDA 3MJXA 3BLQB 2QDLA 1OZ2A 4EPCA 1K9AA 4E7IA 5GAOr 3KUFA 3MKDA 2FVUA 3I55A 1SEMA 2XKOC 4NL2A 2AIRB 2IVXA 1YNZA 4RG8A 2UUEB 1ZSZB 4EONB 4XTVA 2HKQB 4MZTA 4RCBA 1N4MA 2HMAA 1G83A 1XQHA 3TW6A 2EAYA 5L8RE 1TUGB 4Z8AA 3VV0A 2EQIA 3BDUA 1M27C 4EOQB 1NYGA 2DE0X 4CC2A 4M7DD 1H641 5ECAA 5CCAA 2FYKA 1Z9QA 2QEXQ 1ZBXA 1ZBJA 4PJOE 4JX6A 3HRUA 4E7ZA 2ECZA 2HL3A 2DYBA 3F70A 1RLPC 1JXMA 1AD5A 2WMBB 4F6WB 4F7LB 4HT8A 2EFIA 2OTJT 2LMJA 4X34A 3CEYA 3OS2A 4LDXA 1VQ5Q 4EOOB 3JCMc 2EGEA 4QQDA 2FHDA 3RESA 4R56A 4XTYA 1LNXA 3N5BB 2VUBA 4HNTA 2CCIB 2RJEA 3ASKA 4XTUA 3DDPB 2F69A 2SRCA 2D0NA 3G7ZA 1JSUB 4CC4B 3OMCA 4CFUD 4KH0B 2CUDA 1PRLC 4OB1B 2X3WD 5DQVA 2ZGWA 3TNWB 2KT1A 2EJGA 4C0FA 2BS4A 1TSFA 4DEXA 2ZPEB 2K3BA 3PVLA 1OPKA 2QDJA 1WFWA 2Y4YA 5CKDA 3R6OA 3I55Q 3G6EQ 3FDRA 3NDQA 2QQBA 2LP5A 3CPFA 2B8AA 4BCPB 4JRQA 2KEAA 2QASA 3EG9A 4AFZC 4C0DC 5FRMA 1W70A 4JRIA 2V22B 1HD3A 4Z89A 2F2WA 2FRWA 3CQTA 1H1SB 2PNIA 9ATCB 4BCMB 1UDLA 2XMFA 3NTHA 4HVVA 5FU6B 1UNGD 1TOVA 3PIOA 2KR6A 1PD0A 2EQJA 1VOMA 3QHWB 1QMZB 2X4XA 2CGHA 1FYNA 4AFQC 2DL3A 3EGDB 1S72A 3ZL7C 3M57A 3CCLQ 1G3SA 1KHIA 2F2XA 2BPMB 4C8QD 2DTOA 2O2OA 4TTHA 4C5EA 1ZSZC 1VQOA 1VQ9T 2V1RA 3RMQA 2KRSA 4IKFA 4BDYA 1G3TA 1QCNA 1VQ7A 1U3OA 5CYIB 3M0PA 2VXEA 1AHJB 2DIQA 2DO3A 3AT1B 4F04B 1W2BA 4EIKA 3JCMV 2WEVB 3OYEA 2R7GA 1W2BS 3B57A 3HO8A 1WHJA 3L2UA 4MFEA 2K3XA 2RJFA 3I56A 2L8DA 3CC2A 1AVZC 2O4XB 2DL4A 5KYUA 3G71Q 1T0HA 1K9MU 4B9XA 4YTLA 3A5ZB 4CFUB 4E7JA 2E6NA 1YIJQ 1N8RC 5ICPB 4FM4B 2EIFA 2KNBB 1GL5A 2MWOA 1WDXA 2FPFA 1YFNA 3EIDB 3BHUB 4KRDB 1GBQA 2O31A 1URCB 3CD6Q 3CC4A 1FMWA 1NPRA 4GBQA 2J05A 5KYYA 2DL8A 2MIOA 4ZGJB 4MDXA 4HT9A 4DBRA 2CS7A 3HL8A 2LCCA 2E1HA 2I53A 1I1JA 1M4ZA 4GLKA 4YC3B 4F7UF 3CCMA 1K9MC 4M7AE 1AZGB 2Y4XA 3G71T 5GMKj 3S3NA 1QVFA 2KRMA 2R5AA 3BY7A 3CD6A 4HCKA 4BD3A 4BCFB 1SF9A 3M4YA 4XU1A 1N8RU 1QP2A 2E5KA 2KE9A 4EMKB 1AEYA 3VYGB 2CKKA 2PJQA 3PIPA 1C9BA 2FEIA 2V26A 3JCMf 2E3IA 4BCJB 3EGXB 2KXDA 4MFDA 1VQNQ 2CZ0B 4XQ3A 1JJ2P 3RUXA 2XIDA 1PM3A 1Y0MA 1PNJA 1VYWB 4LD6A 2NUTA 3CCST 1N8RR 4F7NB 1O9SA 3MO8A 2C5XB 2HBWA 2YLBA 4M7AA 1B7TA 3QXEB 2IW9B 2LCLA 4ZGEB 3EG3A 4BBSM 3CCEQ 1Z9ZA 1ZLMA 5D6YA 1RAEB 3EAEA 2A3LA 1D0XA 2YXYA 1X43A 3FRNA 3GPLA 3M55A 3L42A 4D8DA 3TW7A 3KHIA 3HZJA 1VQ8A 3HPWA 2KQWA 4FYWB 1OU8A 4V2SA 1TG0A 3QDRB 3J80E 3SWNC 1MHNA 4HNUA 4ZNXA 4M77G 3E19A 1Q82C 1Q7YU 3LQ5B 2YRVA 4M6VA 5GJVB 3L2QA 2CZ7B 4J8OA 3UA6A 2EVRA 2WHBB 1KC8C 5HBEB 3EJ1B 2JOYA 2EPDA 4J7IA 3HSBA 3DOGB 2X51A 3T9NA 3CBPA 4F70B 1VIFA 2DA9A 2ROTA 3FJ5A 4OP0A 4XTWA 4CRLB 2JUFA 2K5LA 2YRCA 3OYYA 1XTDA 2RM4A 2DJQA 2R57A 2ATCB 2UZDB 1OI1A 1W4SA 1UJ0A 4M75G 1VQMT 4Z88A 2CDTA 3OBWA 2JN0A 5I2MA 2QQAA 4CFVB 2RHYA 3G6EA 1JO8A 1B3QA 4EOIB 1OZ3A 4LD9K 1GCQA 1W98B 1OI9B 2BKZB 1K8AU 1UGVA 3JCMh 4OGEA 4RTTA 4IUVA 3OYHA 1KJWA 5LJ5e 4HVWA 5IHIA 1Y71A 1KHCA 2DEQA 3U23A 2QYZA 1VINA 1FMVA 1B07A 2P4RA 3X24B 1M1KU 1EIFA 4DOWA 3QWYA 1OX8A 3JCMd 2RHXA 2BTTA 5IHYA 2JW4A 5LJ3f 1HYOA 1FWZA 1JJ2A 4BY7X 4HKEA 3MEVA 2WXVB 3CCSQ 4JX4A 5IDPB 1GFDA 3QWLA 2KI7A 1GH6B 2DVEA 3E2UA 3I35A 1E6HA 4IIOA 2KYBA 4JJNK 2GNCA 1PD1A 2J6FA 2HZYA 2AKKA 2JJ9A 1OV3A 1VQKQ 3M0QA 2JGZB 2ZAEA 1ACMB 3SB2A 1H26B 2EJFA 5FU7C 5IAYA 2HL5C 1I81A 2QGSA 3FB9A 4QVZA 1D3UB 1K73U 4D8KA 2DRMA 1IHWA 4IURA 4IUQA 4M7DB 1D1CA 2COYA 5DQWA 3P8HA 4HLQA 2I0NA 2LX7A 3FEOA 3POMA 4M77D 2GTJA 1VQKT 3E1SA 2DIGA 5KYYB 5IH2A 4JPBW 4KRCB 1NYFA 2HQXA 4YOSA 2DF6A 5DLQE 4PFPA 2RK2A 2LNHB 4DBFA 1CSKA 2VYTA 3QSUA 5KCHA 1WJRA 4PK4A 1KK7A 2A37A 3QJYA 5EJCA 5FU6C 1M5Q1 2BKDN 4PJNA 3OYAA 1VQ6T 3V7SA 1HK9A 1AT1B 4EC9B 3CCJQ 2DVJA 1RUWA 5GAN2 2OAUA 2LX9A 1ZQ1A 1WQWA 4M7DG 1BU2A 3MP8A 4J9FA 1VQ9Q 2RH2A 1XOVA 2AHJB 2DXCB 4NOYA 1GRIA 3KXTA 3DLLA 2NUPB 1AZEA 3TNHB 4BCQB 1N9RA 2HKNA 2QA4T 3MP6A 4F14A 4M7AB 1RAGB 1D1AA 1IRXA 2UZEB 3M0UA 3NFCA 3CMEA 2PK9B 2ZZDB 1D3BA 4J9GA 3CCJT 5GMKi 1WA7A 1T3SA 3SWNA 1Y7XA 4K11A 1F5QB 2E6ZA 4HVUA 1VQMA 2RHUA 3PE0A 3CCRA 1P5EB 4FYXB 2KMGA 2ZPIB 4CRIA 4CFNB 3REAB 2YLCA 1Q82U 3BG9A 4MIMA 5HQ0B 1RAHB 3CC4Q 5EFQB 2YUPA 4ATOA 4QQGA 3OW2P 1VA7A 4J6YA 3JCMW 1Y96B 2RF0A 2AK5A 3TNIB 5A2QE 4F7UA 4C92A 3GNGA 4M7AG 2YWWA 2CREA 4M77E 2ED0A 3EG0A 3DL1A 5HK0A 5ACBA 1QP3A 1SHGA 2KR3A 2X4JA 3OMGA 1AISB 3S3MA 2C5VB 2WSCE 2LNVA 3M56A 4M7AD 2DETA 4RUGA 4BCQD 2RQTA 2KT8A 1TWBA 2WFYB 2G3RA 1OU9A 2GF7A 1FVVB 3HRSA 5FWBA 4C0GA 1OIUB 1QLBA 5GAOn 2VGNA 2RQVA 1OKVB 2JZ2A 1M1KC 3EFSA 1R77A 3PMTA 5GAMd 4G6LB 4I3ZB 4OGRB 4HCCA 2EQKA 4P5NA 4FIBA 2HNIA 3PT9A 2YUNA 2J7IA 2YHTA 4UC4A 1NEGA 3TEEA 2QI2A 5BNJB 1ZHIA 1JSTB 5LL6S 4II5B 3JB9H 1BYMA 2PVGB 1TUCA 2JTMA 1JXOA 2RHZA 1M8VA 8ATCB 4FYYB 5LJ3d 3V7RA 2M0OA 4VUBA 1CKBA 2X4WA 4C5HA 3CD6T 2M1HA 2YT6A 4PL6A 3GP8A 3BFMA 3BG3A 2L89A 2ZPFB 5KYXA 3CCMT 1M30A 3I5SA 4N4IA 4M7DA 4JLGA 2PUOB 1QLYA 2C5NB 1G2BA 3V8KA 2YRDA 2Z0WA 4BY6C 3CC4T 3LGFA 4PJOD 3JCMJ 4GLMA 3OW2A 2LJ0A 3OB9A 2JS2A 2FZGB 1WI7A 2KYMA 3VS1A 1G3YA 1YITQ 4WF2A 1R8OB 2ZCFB 5GAMj 4HL4A 3EFOB 1WZOA 2KAFA 4F6SB 1FX7A 1PSFA 3CC2T 1KQSS 3CXCA 4L5GA 4BI3A 2HQHA 4BY1X 1NLOC 3WVDB 2LCSA 3OYKA 4FU6A 3CMEQ 2YSQA 1JU5C 2LQ8A 2QG9B 1PC0A 4LNPA 2XDBA 4BCGB 2IVWA 2V8JA 2F5KA 2EYYA 2UZLB 1VQ7T 4C92B 5IXBA 2LZ6B 4ELJA 3M0RA 4NSTB 4J9EA 4QKUA 3VS7A 1IXDA 2EYWA 2CP0A 1VQ9A 3UA7A 2RI2A 3NPFA 4N0AC 5CK9A 2E12A 3CCRT 3VUBA 3I56Q 1TTHB 2NUPA 2EQMA 2MCNA 2H3JA 3CCJA 5FROA 1NJIU 2K2MA 4PKCC 2VASA 3CMET 2QTVA 2ZPBB 2XG8D 4JDSA 4R0KA 2FPDA 1UTIA 2GGRA 3REBB 2QA4A 3NGPA 1QVPA 4ELZC 2EQUA 1CKAA 4JRPA 3LGLA 3MP1A 1H28B 8AT1B 2F2CA 2GQVA 3A98A 1BIBA 2QDYB 4JS4A 3QJ6A 4EMGA 1NE8A 4BI4A 1BK2A 1SSFA 2IG0A 4C8QA 2O9VA 4RTYA 4CXAB 4LE9A 3TSWA 2ED1A 1SRLA 4Y92A 1WJQA 2CYZB 2P0QA 2C0TA 4FX3B 2DEUA 1VQ6A 3ZEHA 3OY9A 1ARKA 3MY1B 1OEBA 4C92G 2CH4A 3LYIA 2VB6A 1XNIA 2MI6A 4BCIB 3QKJA 3ULRB 3CCUQ 1KD1R 3E9FA 3I9QA 2K79A 2QGFB 5LMKB 1SRMA 3V8JA 2PZ1A 1O9KA 3BG5A 1IGUA 4JZ4A 1OULA 3OBYA 3CMAQ 2I40B 2C0IA 4PLIA 2QF7A 4OMQA 4AKHA 4XU0A 4ANJA 4C5GA 1Y07A 3BLHB 1VQKA 4ROEA 2RI3A 3LH0A 1X69A 2LT4A 1QVFP 1MV3A 1YP5A 1I0CA 5J26A 2BZYA 1D09B 3CPWP 1N27A 1T0JA 1M3CA 4RTWA 1PKTA 2I2LA 3S3OA 1YWPA 1K73C 3UPUA 3VS4A 1DJ7B 2LC4A 3UT1A 4FSXA 3QG1A 1QKXA 3QUIA 3E9GA 3L2RA 3V7CA 3EHRA 4MZMA 5M9OA 3META 2DNUA 2B9RA 4B6MA 3EHQA 1SPKA 5D6WA 4JUVA 4A4HA 5CEIB 2FZKB 3VS6A 3RKYA 4J9BA 1YCSB 1EZZB 1ZSGA 3O0GD 2F5TX 1JOWA 4J9DA 1AWJA 4FL6A 3SD4A 2IW8B 2K3YA 5KYNA 4F7UE 3X20B 3CCVA 2K4YA 4X9DA 3JB9I 4ZN1A 3CCUA 2W0ZA 3JB9J 2JT4A 2W2HA 2CJMB 2C06A 3FJPA 2VV5A 3RERA 1GFCA 2DXUA 2KK4A 3TQ7P 2P0KA 3G6ET 4CFWB 1PRMC 4BE2A 1PWTA 2DRKA 4A4GA 4J6XA 1W1FA 2MAMA 2EBPA 2JTEA 2L3SA 3M54A 1QQJA 4KGVB 4OR5B 3J81E 1E9HB 3A8OB 1M3BA 4CI0C 2MK5A 5DM7R 2DYIA 2X3XD 4LOCA 2KVQG 2EKOA 1Q81C 1YJ9Q 3LH5A 3OYDA 4ELLA 5GAN5 2R58A 4BCNB 2ABLA 5D7UA 2DXBA 3PTAA 4XTZA 1HJDA 3CCQQ 5HCKA 3RR6A 1QVGA 3L2VA 2HCKA 1UGSB 3O8VA 4M75A 3VJPA 1WGSA 2MPXC 1LJOA 3KBGA 1VQ8T 2W10A 4PJOA 3LWHA 2CSQA 2RQUA 3EGXA 3GBQA 4QVCA 4Z02A 2DJZA 4L6V5 4RTVA 4ZTFA 4J9HA 2W9ZA 3RNJA 1NG2A 1WPYA 2VWFA 3QWXX 1I5LA 1WHLA 2ROLA 3CCMQ 1GXIE 5I5ZB 2BE7D 3CCSA 4LUDA 5A0DA 4Y91A 4RKUE 5CQXA 4BY6B 1YJNA 1IHVA 1RAAB 1JJ2S 3HHTB 3VU3C 4KULA 3OYGA 2D1XA 4FT4A 2NWMA 4WTOB 2CP5A 2MYSA 5EG2A 1M2VB 1C1AA 3X28B 1VUBA 3OYFA 4HCZA 3G71A 2XHCA 3UWNA 4EOSB 3VYGA 2E3HA 4M78G 2LTOA 3QYHB 4NC6A 4YOZA 1AWWA 1TFBA 4JJDA 5LJ5f 3FLGA 1UECA 3M9QA 2RA2A 4KBMB 5CIUA 2HSPA 2WIHB 1YJ9T 2JNGA 5EC7A 1PG5B 2OJ2A 3I5RA 4Y72B 2RJDA 5AT1B 3OQ5A 1UB4A 1G5VA 3C0CA 2V8IA 1D0YA 5GAN7 3EH1A 1UHCA 1KD1C 1WXBA 1QMCA 2GFAA 1UUEA 3I56T 1R0BG 1QVGP 5GANe 2EWNA 1X75C 1GUXB 3NHNA 2H8HA 4GY5A 4II1A 3QHRB 1F1BB 1PCXA 3RDVA 2EJ9A 2LJ1A 2DZ9A 4OMNA 1OQKA 4C8QB 2ZPHB 4OF1A 1C6VX 1I07A 3MPUB 5I2SA 4XAXB 1VQOT 3VS2A 4A4FA 3QBYA 5LJ5j 1QKWA 3M58A 4DOVA 2K9GA 3OW2S 4R55A 4BCHB 1WHHA 2DD5B 3MEUA 3TN8B 2DFUA 3H8ZA 4HA8A 1S72T 4BCKB 2JMCA 4C0ZA 3JB9G 2XK0A 4HXJA 1BI2A 4FYVB 3UF4A 4JRKA 2RHIA 4HNVA 4RTZA 1SG5A 2DBMA 2DTIA 3M53A 3VKHA 1TH7A 1Q95G 1OOTA 2PVDB 4IUPA 3NMZC 1GUXA 2AKLA 3VS5A 4M77B 4WCIA 4BCMD 1RI0A 3H6ZA 1ZX6A 2K7AA 1MMGA 1M90U 4KT0E 4PJOF 1TS9A 2UZBB 5IHNA 2AT1B 1VQLQ 1UNLD 3UDCA 4XU3A 1T3LA 5J3BA 4E7HA 1Q86R 1PHTA 2W99A 3Q1JA 3RIRA 5C6SA 5KYWA 3LX7A 2ESWA 3VS0A 4XTXA 1BKBA 4BACA 1VQPA 4M75B 2RNAA 3DB3A 3PMIA 4EMKC 2V8KA 1ZSZA 1M90C 1Y57A 3CC2Q 4MMKA 2DAQA 2BIVA 2CSIA 1JKWA 1NJIR 2IPOB 1IGQA 4L59A 4BXXX 2Y90A 5KE2A 2OTJA 1D3BB 3M03A 1QVGS 2E4HA 2DX1A 2L2PA 3RKWA 3TU4K 3H0FA 3MCAB 2JTFA 4CC7A 2M16A 3H9NA 2DXCA 4C0DB 2OTLQ 3G4ST 2OAWA 1YN8A 2RQRA 2CUBA 3FC3A 2L3RA 4ZGDB 5CKFA 3OS5A 3OS0A 1MV0B 3RGFB 1YBYA 1IZ6A 5GMKm 4J6WA 3QYEA 4RG2A 3D7SB 1VQ4Q 2G9XB 3A8GB 2O88A 1J3TA 3SWNB 1NZ9A 1WX6A 2LJ3A 2RQWA 5GAOp 1UG1A 2CCHB 5HNBB 3HFOA 3OSVA 4CFMB 1K8AR 2VVKA 2DMOA 3CC7T 4F7SB 1VQ4A 3OYCA 3I55T 3WVEB 2RK1A 3A8HB 2MF2A 1WXUA 5CAIA 3TREA 4QQ6A 2BS3A 3OYNA 1JEGA 1M3AA 4NS5A 4OMLA 4LDYA 3CXCP 2J6OA 4A54A 2G6FX 2ZPGB 5LJ3j 2W9FA 1GCPA 3ZBDA 3MHXA 3BHVB 2QA4Q 2K5FA 5CVIA 4BB7A 2WSFE 3BE3A 4KGXB 2D8HA 3BHTB 4M77C 2E64A 5HY6A 2GQIA 4AMCA 1FXXA 2E10A 5I22A 1JQQA 2QQSA 1X6GA 3JCMX 4BDZA 2QQ9A 1TU0B 2SEMA 4JJBA 4X9CA 2WJ9A 1UGQB 4X1VA 2YUQA 5CR2A 2DD4A 4AT1B 1VYTA 4FW1A 1X2QA 1D0ZA 1MNEA 3VRZA 4OGCA 1KIKA 1W2BP 3SFMA 2YUOA 1VQ5A 1AOJA 3EG2A 4OMFB 1OPLA 1YJWT 3GIBA 3A1PA 4DEYA 2DTHA 4ORZA 4M75C 1RAFB 2LW4A 3JRZA 5GAOm 3QYBA 3F5XB 1N9SA 4EDUA 1PKSA 5CKBA 4MDWA 3QHSA 3MIAB 2RB6A 2FO0A 3J7AF 4PNOA 3GTMS 2QEXA 3CMAA 3DLMA 2DLPA 4ZTJA 4M7DF 2LRQA 1KG1A 1H92A 1TXQA 5FU7B 3MEAA 1H1RB 3P8DA 1K4US 1B34B 3JCMg 4ROCA 4E7SA 1YITA 4FCYA 1UGPB 3OYBA 1M2OA 4FW2A 1YJWQ 5AYFA 5DY9A 2K2VA 1I8FA 2HDAA 3M5AA 1PKDB 2BS2A 1BIAA 2IIMA 5GANg 2DILA 1C0MA 3JCMb 2M0YA 2CZ6B 1H3ZA 2K6DA 4A4EA 2M02A 1VQ8Q 1G3NC 4PLLA 4A63B 3H0HA 2E5QA 4M78C 4C8QF 5GAOq 4RTUA 1GY3B 5IF1B 4BUGA 4TVRA 4JZ3A 4BBRM 1QCFA 1WLPB 3LLRA 1WQ7A 1YI2A 5KE3A 2COWA 2L0AA 2O01E 1ZUKA 2KBTA 4M7DE 1Y96A 3CCLT 3CPWA 1VYUA 1K0SA 1PSEA 4F7UG 2AZVA 3NTIA 4LN2A 2M51A 5I21A 2RPNA 4M4ZA 6AT1B 4QW2A 1ZA1B 2L5QA 2PK2A 2LDMA 2DD5A 4M78F 3VRYA 4C8QC 3BW1A 1HSQA 1NJIC 3S6WA 2D8JA 2FZCB 5KYUB 2RO0A 5GAMg 1H4LD 1M8MA 1FINB 1TUDA 2QAZA 4RCCA 2X9HA 3QZ9B 2ENMA 2XD0A 5GMKe 2DPPB 5IT9E 3OSSC 3M4GA 5HBJB 5L23A 3LW5E 2C6TB 1NM7A 1BI1A 4AKGA 2DL7A 1WHMA 2FG0A 4PFOA 1X2KA 1TD6A 1YIJT 1K1ZA 3CXCS 1Q86C 5IXFA 1XJWB 3JCMQ 2GBQA 2NYSA 1QWEA 1I4K1 5LJ5g 4N0AA 5FW9A 1VIEA 2DERA 2FPEA 3RMSA 5GMKl 4Y28E 3K7AM 1H25B 1MMAA 1JBMA 3G33B 3OYLA 2LQWA 5GANh 3DB4A 2HSEB 4IMYB 1M90R 3PFSA 1VQLT 4OB3B 4EOJB 3ME9A 2LQNA 2HAXA 1U1SA 2VKNA 4AG2C 1YI2T 2D0QB 2RN8A 1O9KB 2X35A 5A0GA 1VQ7Q 2MWPA 4QVDA 3VS3A 1MMNA 1NBEB 2EYZA 2OI3A 3HRTA 2DBKA 5GJWB 2COZA 2CH4W 2KY9A 2DKGA 1OIYB 1ABOA 1KC8U 1WHKA 1V76A 2A36A 3HTRA 5KCOA 2J06A 1VQNT 3PNWC 3QPHA 1K73R 3C95A 3JSCA 4ESRA 1OKWB 4AFSC 4ME7A 3CPWS 4AFUC 2WPAB 1BU1A 4O5VA 1S72Q 1OL1B 1ENWA 3EFOA 1H27B 1KD1U 1QVFS 2A08A 4J9IA 3CCQA 1V1CA 4PJOG 4XK8E 3CCET 4NL3A 5LJ5h 4M7DC 2B86A 2QQ8A 2C5OB 2OTLT 3EGDA 2DXBB 2E70A 4PFZA 4ZN3A 1ZA2B 4JJCA 4KRTA 5GAMf 3PGGA 3CMAT 3QYGB 3INZA 1K8AC 4PJMA 4E6RA 4M75D 2W96A 2J6KA 1VOLA 3H41A 1AWOA 5GAN3 3EOCB 1K9MR 5GAMe 2BUDA 1WNLA 4LDVA 1W6XA 3OS1A 2DZCA 1JB0E 3X25B 1KQSP 1YJWA 1RL2A 3DTOA 3BDLA 4DA4A 1H24B 2XDDA 3CC7Q 2G77A 1H8KA 4FT2A 5LQFB 2VGMA 1UHFA 1Q7YR 2LT1A 1G8XA 3TSZA 1YHQT 3CCVQ 2IW6B 1QCOA 2RD1A 3CCRQ 1GCQC 1H1PB 3H4CA 3HBLA 2A7YA 1N6AA 4M7AC 4BI8B 1KFZA 2HQEA 4RODA 2EUFA 2KDSA 2VXFA 3P8BB 1KQ2A 4D6WA 2XICA 2PQWA 4EOPB 2EYQA 1JRIA 4KH1B 1M1FA 3VUZA 1MUZA 1LCKA 3QO3A 4C92F 3EFRA 2QQRA 3QZ5B 4F16A 4JLIA 1IO6A 2PMIB 3NTKA 5FGKB 1X27A 2CT4A 1RLQC 4J83A 2WSEE 2OX7A 4HCBA 4C92C 2X1NB 5KH6A 2PUKB 4EOMB 5CKEA 1VQ4T 2WACA 3CC7A 3JV3A 2DL5A 1D1BA 2KMTA 5IN1A 3O5ZA 2D9TA 2KRNA 4IUTA 1WIEA 5I11A 3M0TA 2EKHA 3CBMA 4DBQA 1A0NB 4N4HA 4E7LA 2L3PA 5LJ3h 1B34A 1RACB 2EGCA 3TVTA 4J7FA 1UJYA 2X4YA 2YDLA 5LJ3g 1YHQA 4EC8B 2RJCA 1RAIB 4F17A 3G4SA 2ZZDA 1WYXA 4C92E 1Q86U 3HP9A 1OL2B 4QT7A 4FSSA 1WJSA 1GBRA 2DMEA 4KUDK 1UNHD 1LPLA 2KXCA 2DXTA 3HFNA 1KQSA 4BE0A 2JS0A 1VQ6Q 1R0CB 2CP3A 4J9CA 4RMOA 1M1KR 1LVKA 4B9WA 2XI9A 2HD0A 1U5SA 3URGA 4C5IA 5HKCA 1U8RA 4M78B 4M78D 3JAME 1KC8R 5IDNB 2JM9A 5J39A 2GCXA 1HXDA 1N5ZA 2GFUA 3RBBB 1VQPT 2OTLA 1BB9A 1QWFA 2JMAA 4ELYC 1Q7YC 5HBHB 2CZ1B 2F2VA 1G3WA 4M7AF 1MNDA 1AWXA 2PU9B 3CCEA 4QSHA 2OTJQ 4E2FB 5A0LA 5GAN4 3EGUA 1NEBA 2KGTA 3CCQT 1WHGA 3PO3S 3HB9A 1RADB 4PJOB 3OYJA 2D6FA 3FIFA 3LWIA 2AZSA 2P4TA 1UFFA 1VQNA 2LQKA 5GANf 1AD6A 2EYXA 1VQPQ 3JB9D 3VKIA 2RMOA 7AT1B 4C92D 4OVAA 2C4GB 1OX9A 4C8QG 1BI0A 1WXTA 4CFXB 1E7OA 4Q5WA 2IN3A 4EORB 2K57A 1EFNA 2O9SA 3BLRB 2V1QA 3OYMA 3V8LA 3MEWA 4XU2A 1VQLA 2R5MA 3MI9B 1KSWA 4DBHA 2RI5A 4O6JA 1X6BA 1NLPC 2DK3A 1BBZA 4DQ2A 3JCMP 3L2ZA 1M2VA 4A53A 5C0MA 1OYXA 3WXMB 3EG1A 2BZXA 3VYHB 4MZPA 3TCJA 2CP6A 4AI6A 3G1JA 2DM1A 1FKMA 3C4SA 1YIJA 1H3HA 1M1GA 1U1TA 1VYVA 1KQ1A 2L3QA 3DDQB 3M59A 2CP7A 2EGAA 3UATA 2KROA 1XO2A 1MGQA 4EOKB 3M0SA 2QFZA 5L2WB 2GTOA 3OYIA 2E41A 2XU8A 2WMAB 4AG1C 5FLXE 4N4GA 1KXUA 4OMOA 2F1LA 4EMHA 4OMMA 5LJ3e 1H1QB 1S1NA 2VC8A 5DLOA 1BI3A 5CO7A 4AKIA 1RI9A 4J5YA 4M77A 5CQYA 5GAN6 4OB2B 1U06A 5GANj 1Q82R 5FWCA 4BE1A 3QIIA 4Z6YA 1YJ9A 1E7PA 2PVOB 2JVVA 3A8MB 3GF5A 1SHFA 1ABQA 2HBPA 2JM8A 5GMKh 1ZUYA 3GLXA 3L2WA 2H3EB 1YCYA 5HK3A 1I5OB 3L1AA 4EMKA 4RTXA 3HKSA 3CCLA 4IUUA 1K76A 4PJLA 1E6GA 1UGRB 4LXCA 2LVMA 5CKHA
chains in the Genus database with same CATH topology
2F5TX 5GANd 4IUVA 3OYHA 4FL6A 3SD4A 5LJ5e 1Y71A 1KHCA 2DEQA 4PLLA 2E5QA 4M78C 4C8QF 5GAOq 2K3YA 3ER0A 3X24B 4F7UE 3X20B 2KSSA 4KUIA 1M1KU 4BUGA 1EIFA 4DOWA 3CCVA 3RKXA 4TVRA 4PJOC 3JCMd 2RHXA 2K4YA 4BBRM 1X6OA 4X9DA 3JB9I 4ZN1A 3CCUA 3C12A 5LJ3f 1FWZA 3LLRA 4C8QE 1JJ2A 1WQ7A 4HKEA 3MEVA 3JB9J 1YI2A 4JX4A 5KE3A 2O01E 2M9UA 1YJNT 3QWLA 1Y96A 4M7DE 3CCLT 3CPWA 2FL7A 2C06A 3FJPA 4M75E 2DVEA 3ZFJA 2VV5A 3RERA 3A8LB 1PSEA 2DXUA 2KK4A 5FRNA 2P0KA 2O4XA 3G6ET 4BE2A 1M9SA 2NLUA 4F7UG 4JJNK 4E47A 4A4GA 4J6XA 2MAMA 1IREB 2QTXA 3NTIA 3M54A 5I21A 3J81E 4QW2A 3A8OB 2L5QA 3SB2A 4CI0C 5DM7R 2LDMA 1YITT 2DD5A 2E65A 4M78F 2EJFA 4C8QC 3BW1A 3AHUA 5GAOl 5FU7C 4MMLA 4LOCA 3S6WA 1I81A 5IAYA 1NJIC 3GNFB 3FB9A 4QVZA 4M77F 2KVQG 2EKOA 1K73U 2RO0A 1QW1A 5GAMg 1Q81C 3OYDA 4IURA 1Q81U 4IUQA 4M7DB 4E7KA 2QEXT 4M78E 4RCCA 3X26B 3P8HA 4HLQA 3QZ9B 2XD0A 5GAN5 5GMKe 2R58A 2DPPB 5IT9E 3OSSC 2DXBA 3M4GA 4XTZA 3PTAA 3LW5E 3FEOA 4M77D 1NPPA 1QVGA 2P0PA 3L2VA 1V29B 1UGSB 1BI1A 1VQKT 4AKGA 3O8VA 3E1SA 2DIGA 4M75A 4F7UB 2K5IA 3VJPA 1VQ5T 1WGSA 1LJOA 3KBGA 3JCMe 5LJ5d 1VQ8T 1YIJT 1X01A 3CXCS 1Q86C 4JX5A 2HQXA 4PJOA 5DLQE 1UEBA 4M75F 2RK2A 4A4KA 3JCMQ 1I4K1 3LWHA 3SDZA 2VYTA 5LJ5g 4N0AA 3QSUA 1VIEA 5KCHA 5GAN8 1WJRA 2XDPA 3RMSA 5GMKl 4Y28E 4QVCA 3QJYA 5EJCA 3JB9F 4OB0B 4Z02A 2DJZA 4L6V5 5FU6C 4ZTFA 1M5Q1 2BKDN 3DKMA 1JBMA 5GAMh 3OYLA 1WPYA 4LDUA 5GANh 3DB4A 3GOXA 5D6XA 3OYAA 1I5LA 3CBOA 1VQ6T 3PFSA 1VQLT 2DD4B 3V7SA 1HK9A 3OA6A 4OB3B 2HAXA 3ME9A 3CCSA 3VKGA 1GXIE 1U1SA 4LDWA 5A0DA 4Y91A 4RKUE 5CQXA 4BY6B 1YJNA 2MMPA 5GAN2 1YI2T 3C94A 2D0QB 2OAUA 2LX9A 1O75A 1ZQ1A 4JS5A 1WQWA 1JJ2S 2X35A 5A0GA 3HHTB 2MWPA 4QVDA 2FB7A 3CCUT 4M7DG 2QXFA 3MP8A 3VU3C 4KULA 3OYGA 2RH2A 4FT4A 3CCVT 3HRTA 1XOVA 2AHJB 2DXCB 1LOJA 2KY9A 4M78A 2DKGA 4NOYA 5EG2A 1P92A 3KXTA 3DLLA 1OZ2A 4EPCA 1KC8U 1N9RA 5KCOA 4E7IA 1VQNT 5GAOr 2QA4T 3X28B 1VUBA 3KUFA 3PNWC 3QPHA 3C95A 2FVUA 3JSCA 3MP6A 3OYFA 4NL2A 2XKOC 4M7AB 4HCZA 3I55A 4ME7A 4RG8A 3G71A 2XHCA 3CPWS 3UWNA 3NFCA 4O5VA 3CMEA 4XTVA 2ZZDB 3VYGA 1D3BA 4MZTA 4RCBA 3CCJT 4M78G 5GMKi 1KD1U 1QVFS 1XQHA 2LTOA 3CCQA 3SWNA 1Y7XA 3TW6A 3QYHB 2EAYA 2E6ZA 4NC6A 5L8RE 4PJOG 2RHUA 4XK8E 3VV0A 4NL3A 1VQMA 3CCET 3CCRA 5LJ5h 3BDUA 4M7DC 2KMGA 2ZPIB 3FLGA 3M9QA 2RA2A 4KBMB 4CRIA 5LJ5f 2YLCA 5CIUA 3BG9A 4MIMA 1Q82U 2QQ8A 4M7DD 2OTLT 4ATOA 4QQGA 1YJ9T 2JNGA 1H641 2DXBB 4J6YA 2E70A 5CCAA 4ZN3A 2FYKA 1ZBXA 4PJOE 3JCMW 4JX6A 1Y96B 3HRUA 2RJDA 5GAMf 3PGGA 3OQ5A 1UB4A 3F70A 1G5VA 2V8IA 5A2QE 3QYGB 3INZA 4F7UA 1K8AC 3CMAT 4C92A 5GAN7 4M75D 3GNGA 1KD1C 4M7AG 4M77E 5GAN3 2GFAA 2EFIA 3I56T 5GAMe 2BUDA 1WNLA 1VQ8A 4HT8A 3DL1A 4LDVA 2OTJT 5GANe 5HK0A 4X34A 3CEYA 3OS1A 3OS2A 2DZCA 4M7AC 1QP3A 2EWNA 4LDXA 1JB0E 3X25B 3JCMc 1X75C 4GY5A 2X4JA 1RL2A 2FHDA 3OMGA 4QQDA 3RESA 4R56A 3S3MA 1YJWA 3BDLA 4II1A 4XTYA 1LNXA 2EJ9A 2WSCE 2DZ9A 3N5BB 2VUBA 4DA4A 4HNTA 2XDDA 2G77A 2LNVA 2RJEA 3M56A 4FT2A 4M7AD 2VGMA 3ASKA 4XTUA 2LT1A 2F69A 3G7ZA 4C8QB 3OMCA 2ZPHB 4OF1A 1YHQT 2G3RA 4OB1B 5I2SA 2RD1A 2GF7A 4XAXB 1VQOT 4A4FA 3QBYA 2ZGWA 5LJ5j 3M58A 3HRSA 3H4CA 2EJGA 3HBLA 2A7YA 1N6AA 4C0FA 4C0GA 4DOVA 3OW2S 1QLBA 4BI8B 2HQEA 2BS4A 2VGNA 5GAOn 4R55A 2KDSA 2DD5B 2JZ2A 2VXFA 3EFSA 3H8ZA 3MEUA 2ZPEB 3P8BB 4HA8A 4D6WA 2XICA 1KQ2A 2PQWA 3PMTA 5GAMd 1S72T 2QDJA 2EYQA 1JRIA 2Y4YA 1M1FA 3VUZA 4C0ZA 5CKDA 2EQKA 4P5NA 3R6OA 4HCCA 3JB9G 2XK0A 3FDRA 1BI2A 2HNIA 3QO3A 2QQBA 3PT9A 3EFRA 4FIBA 4C92F 4JRKA 2QQRA 3QZ5B 4HNVA 2RHIA 3CPFA 2B8AA 4JLIA 2YHTA 4UC4A 3TEEA 2QI2A 4JRQA 1ZHIA 2DTIA 3M53A 4C0DC 3NTKA 3VKHA 1TH7A 5FRMA 5LL6S 4JRIA 4J83A 3JB9H 2WSEE 1BYMA 2PVDB 2PVGB 4IUPA 2JTMA 4HCBA 2RHZA 4C92C 1M8VA 5LJ3d 4M77B 3V7RA 2M0OA 5KH6A 1RI0A 4VUBA 2PUKB 3H6ZA 2X4WA 5CKEA 4C5HA 3CD6T 3NTHA 2M1HA 1M90U 5FU6B 4KT0E 4PJOF 3PIOA 4PL6A 2KR6A 2WACA 3GP8A 3CC7A 1VQ4T 2EQJA 3BFMA 3BG3A 2L89A 2ZPFB 2KMTA 5IN1A 3CCMT 2D9TA 3UDCA 2X4XA 4XU3A 2CGHA 4IUTA 4N4IA 5J3BA 4JLGA 4E7HA 2PUOB 4M7DA 1S72A 3M57A 3Q1JA 3RIRA 5C6SA 3CBMA 3V8KA 1G3SA 3LX7A 4N4HA 4BY6C 3CC4T 4E7LA 1KHIA 4C8QD 2DTOA 3LGFA 4PJOD 3JCMJ 4XTXA 5LJ3h 3OW2A 4C5EA 3OB9A 1VQOA 1BKBA 1VQ9T 1B34A 4BACA 1VQPA 4J7FA 2X4YA 3RMQA 5LJ3g 4M75B 4IKFA 1YHQA 3PMIA 3DB3A 4BDYA 4EMKC 1G3TA 2RJCA 1G3YA 2OTJA 2V8KA 4WF2A 1M90C 1VQ7A 3G4SA 1R8OB 2ZCFB 2ZZDA 4C92E 5GAMj 4HL4A 4MMKA 2DAQA 1Q86U 3HP9A 2VXEA 1AHJB 2BIVA 2KAFA 2DIQA 1WJSA 2DO3A 1M1KC 1FX7A 1PSFA 3CC2T 4KUDK 1W2BA 1KQSS 3CXCA 3JCMV 4L5GA 3OYEA 2DXTA 3HFNA 1W2BS 4L59A 4BI3A 4BE0A 1KQSA 4RMOA 3HO8A 2Y90A 5KE2A 3WVDB 3L2UA 4MFEA 2K3XA 2RJFA 2XI9A 4B9WA 3I56A 1D3BB 2HD0A 2L8DA 4FU6A 3OYKA 1QVGS 3CC2A 2O4XB 2LQ8A 3RKWA 3TU4K 3URGA 4C5IA 5HKCA 2XDBA 3MCAB 1K9MU 2JTFA 2IVWA 2V8JA 1U8RA 2M16A 4C0DB 2DXCA 4M78B 4B9XA 2F5KA 4M78D 3JAME 3G4ST 1VQ7T 4YTLA 3A5ZB 4E7JA 4C92B 2E6NA 5J39A 4ELJA 1N8RC 2GCXA 3FC3A 2L3RA 1HXDA 4FM4B 2EIFA 4ZGDB 2GFUA 3OS5A 2MWOA 5CKFA 3OS0A 1VQPT 1VQ9A 2OTLA 4ELYC 1YBYA 1IZ6A 2RI2A 1Q7YC 5GMKm 2CZ1B 4N0AC 5CK9A 4J6WA 1G3WA 3QYEA 2E12A 4RG2A 2PU9B 3VUBA 3CCRT 3CC4A 4M7AF 3CCEA 4QSHA 1NPRA 5A0LA 3A8GB 5GAN4 2EQMA 3SWNB 1NZ9A 3CCQT 2H3JA 4ZGJB 4MDXA 4HT9A 5GAOp 2CS7A 3HB9A 3HL8A 3CCJA 5FROA 1NJIU 2LCCA 2E1HA 4PKCC 3HFOA 3OSVA 3OYJA 4PJOB 3CMET 1M4ZA 4GLKA 4F7UF 3CCMA 2ZPBB 2XG8D 1K9MC 3FIFA 2Y4XA 2D6FA 4M7AE 3G71T 4JDSA 5GMKj 3S3NA 3CC7T 3LWIA 1QVFA 2R5AA 1VQ4A 2P4TA 3BY7A 3OYCA 3I55T 3WVEB 3CD6A 2RK1A 3A8HB 2QA4A 2MF2A 4BD3A 1VQNA 1QVPA 2LQKA 3M4YA 4XU1A 1N8RU 5GANf 4ELZC 5CAIA 1QP2A 2EQUA 3TREA 4QQ6A 4EMKB 3VYGB 3LGLA 2BS3A 2CKKA 4JRPA 3MP1A 3PIPA 3OYNA 3JB9D 3VKIA 4NS5A 4LDYA 4C92D 2GQVA 4OVAA 4A54A 3JCMf 1BIBA 2QDYB 2ZPGB 5LJ3j 4JS4A 3QJ6A 1BI0A 4C8QG 4EMGA 1NE8A 4Q5WA 4BI4A 4MFDA 1SSFA 2IG0A 3ZBDA 2CZ0B 3MHXA 4XQ3A 4C8QA 2K5FA 2K57A 5CVIA 2XIDA 3RUXA 4BB7A 1WJQA 2CYZB 2P0QA 2WSFE 4LD6A 3OYMA 3CCST 3V8LA 3MEWA 4XU2A 4M77C 1VQLA 1VQ6A 2R5MA 1O9SA 3ZEHA 3OY9A 2E64A 3MO8A 4C92G 2RI5A 3LYIA 5HY6A 2YLBA 4O6JA 4M7AA 1FXXA 3QXEB 2E10A 1XNIA 2MI6A 2DK3A 2QQSA 4DQ2A 3JCMP 2LCLA 3L2ZA 3QKJA 4ZGEB 3E9FA 3JCMX 2QQ9A 4A53A 5C0MA 4BDZA 4BBSM 4X9CA 2WJ9A 1UGQB 1OYXA 3V8JA 5D6YA 3EAEA 3WXMB 3BG5A 5CR2A 2A3LA 2DD4A 3VYHB 3OBYA 4MZPA 3TCJA 3GPLA 3FRNA 4PLIA 2QF7A 4AI6A 3L42A 3M55A 1FKMA 3TW7A 3KHIA 3HZJA 4AKHA 3C4SA 1YIJA 4OGCA 3HPWA 1M1GA 1U1TA 2KQWA 1KQ1A 4XU0A 3M59A 3SFMA 4C5GA 1Y07A 1VQ5A 4V2SA 3QDRB 3J80E 1MGQA 4OMFB 3SWNC 1VQKA 3GIBA 1YJWT 1MHNA 4HNUA 2RI3A 2DTHA 4M77G 4M75C 3LH0A 2LT4A 2QFZA 3E19A 3OYIA 1Q82C 2E41A 3JRZA 5GAOm 3QYBA 1Q7YU 2XU8A 1N9SA 4EDUA 2YRVA 5J26A 5CKBA 4MDWA 4M6VA 5FLXE 4N4GA 3L2QA 2CZ7B 4J8OA 1N27A 3QHSA 2RB6A 1KC8C 3J7AF 4EMHA 4PNOA 5LJ3e 2QEXA 5DLOA 3CMAA 2VC8A 3DLMA 1BI3A 2I2LA 2JOYA 4J7IA 5CO7A 4AKIA 3S3OA 4ZTJA 4J5YA 4M77A 4M7DF 5CQYA 5GAN6 1K73C 3HSBA 2LRQA 3T9NA 3UPUA 1KG1A 4OB2B 3CBPA 5FU7B 1DJ7B 1VIFA 2LC4A 3MEAA 3UT1A 5GANj 3P8DA 4FSXA 4BE1A 3QG1A 4OP0A 3QIIA 4Z6YA 1B34B 2JUFA 2K5LA 4XTWA 3QUIA 3JCMg 1YJ9A 1E7PA 3OYYA 2PVOB 2JVVA 3E9GA 3L2RA 3V7CA 1YITA 3A8MB 1XTDA 2RM4A 3GF5A 1UGPB 3OYBA 2HBPA 2R57A 5GMKh 1OI1A 1W4SA 4M75G 1VQMT 5AYFA 3GLXA 3L2WA 3OBWA 4MZMA 2JN0A 5M9OA 5DY9A 5I2MA 1YCYA 2K2VA 1I8FA 3META 2QQAA 5HK3A 2RHYA 3G6EA 3M5AA 2BS2A 1BIAA 3L1AA 5GANg 5D6WA 4EMKA 1OZ3A 4JUVA 4A4HA 4LD9K 3HKSA 3JCMb 3CCLA 3RKYA 2CZ6B 1H3ZA 4A4EA 1K8AU 4IUUA 3JCMh 4OGEA 1UGRB 2LVMA 5CKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ5 B;  3WVE B;  3A8H B;  3HHT B;  1QP2 A;  3X24 B;  2WSE E;  2PVD B;  2PVG B;  3X20 B;  2AHJ B;  2DXC B;  3VYG B;  2PUK B;  2QDY B;  3X28 B;  2ZPG B;  4KT0 E;  2O01 E;  2ZPF B;  2CZ0 B;  2ZZD B;  3VYG A;  2WSF E;  2CYZ B;  3A8L B;  1PSE A;  2PUO B;  3QYH B;  5L8R E;  1IRE B;  4XK8 E;  3QXE B;  2ZPI B;  3A8O B;  4ZGE B;  2DD5 A;  1UGQ B;  2DD4 A;  2DXB B;  3VYH B;  2ZCF B;  2ZZD A;  1AHJ B;  3QYG B;  3X26 B;  3QZ9 B;  1PSF A;  2DPP B;  2DXB A;  3LW5 E;  1QP3 A;  1JB0 E;  3X25 B;  3WVD B;  1V29 B;  1UGS B;  2CZ7 B;  2WSC E;  2DXC A;  4OB2 B;  1DJ7 B;  2ZPH B;  4FM4 B;  4ZGD B;  4OB1 B;  2PVO B;  4Y28 E;  3A8M B;  1UGP B;  4OB0 B;  4L6V 5;  2CZ1 B;  2PU9 B;  2DD5 B;  3A8G B;  2ZPE B;  2DD4 B;  4ZGJ B;  4OB3 B;  1GXI E;  2CZ6 B;  2ZPB B;  4RKU E;  1UGR B;  2D0Q B; 
#chains in the Genus database with same CATH topology
 5GAN d;  1ZP2 A;  3MY5 B;  5KYX B;  3ER0 A;  2KSS A;  4KUI A;  1EX4 A;  3EH2 A;  3RKX A;  5IHK A;  4PJO C;  3KFV A;  1X6O A;  3SHW A;  2A0F B;  3R6N A;  3C12 A;  2QK0 A;  4C8Q E;  5HVY B;  3DJB A;  2FRY A;  4KGZ B;  2M9U A;  1YJN T;  2FL7 A;  2HEQ A;  4LUE A;  4M75 E;  3ZFJ A;  3A8L B;  5FRN A;  2O4X A;  1M9S A;  2NLU A;  3EG9 B;  1YWO A;  4E47 A;  1UE9 A;  3THK A;  1IRE B;  2QTX A;  4F7J B;  2PTK A;  4IIM A;  1K0X A;  1YIT T;  2E65 A;  4PJJ A;  1Q81 R;  1SSH A;  3AHU A;  5GAO l;  4MML A;  1SKU B;  3GNF B;  3H0I A;  4M77 F;  1QW1 A;  1Q81 U;  3PVQ A;  4E7K A;  2QEX T;  4M78 E;  2CT3 A;  3X26 B;  1YJN Q;  4EOL B;  1VQM Q;  1RAB B;  4BCN D;  2WIP B;  1NPP A;  2P0P A;  1V29 B;  2QGG A;  4F7U B;  4CC3 A;  2K5I A;  1VQ5 T;  4F6U B;  3JCM e;  3QDF A;  5LJ5 d;  1BCO A;  1X01 A;  4BCO B;  2NUZ A;  4JX5 A;  4UN0 A;  2BE9 B;  1UEB A;  2NUT B;  4M75 F;  4A4K A;  1VQO Q;  2EW3 A;  2JXB A;  3SDZ A;  3SEM A;  1IB8 A;  1FMK A;  5GAN 8;  2XDP A;  2BZ8 A;  2C0O A;  3JB9 F;  4OB0 B;  2CP2 A;  3DKM A;  4YOO A;  5GAM h;  4LDU A;  3GOX A;  2A28 A;  5D6X A;  3CBO A;  1OGU B;  2DD4 B;  3OA6 A;  1YI2 Q;  3VKG A;  4LDW A;  1BCM A;  2MMP A;  3C94 A;  2P84 A;  1O75 A;  4JS5 A;  3G4S Q;  3CCU T;  2FB7 A;  2QXF A;  2MOX A;  1ZUU A;  4OMP A;  5KYW B;  1YHQ Q;  3CCV T;  2PHG A;  3IQL A;  4M78 A;  1LOJ A;  1P92 A;  1MMD A;  3MJX A;  3BLQ B;  2QDL A;  1OZ2 A;  4EPC A;  1K9A A;  4E7I A;  5GAO r;  3KUF A;  3MKD A;  2FVU A;  3I55 A;  1SEM A;  2XKO C;  4NL2 A;  2AIR B;  2IVX A;  1YNZ A;  4RG8 A;  2UUE B;  1ZSZ B;  4EON B;  4XTV A;  2HKQ B;  4MZT A;  4RCB A;  1N4M A;  2HMA A;  1G83 A;  1XQH A;  3TW6 A;  2EAY A;  5L8R E;  1TUG B;  4Z8A A;  3VV0 A;  2EQI A;  3BDU A;  1M27 C;  4EOQ B;  1NYG A;  2DE0 X;  4CC2 A;  4M7D D;  1H64 1;  5ECA A;  5CCA A;  2FYK A;  1Z9Q A;  2QEX Q;  1ZBX A;  1ZBJ A;  4PJO E;  4JX6 A;  3HRU A;  4E7Z A;  2ECZ A;  2HL3 A;  2DYB A;  3F70 A;  1RLP C;  1JXM A;  1AD5 A;  2WMB B;  4F6W B;  4F7L B;  4HT8 A;  2EFI A;  2OTJ T;  2LMJ A;  4X34 A;  3CEY A;  3OS2 A;  4LDX A;  1VQ5 Q;  4EOO B;  3JCM c;  2EGE A;  4QQD A;  2FHD A;  3RES A;  4R56 A;  4XTY A;  1LNX A;  3N5B B;  2VUB A;  4HNT A;  2CCI B;  2RJE A;  3ASK A;  4XTU A;  3DDP B;  2F69 A;  2SRC A;  2D0N A;  3G7Z A;  1JSU B;  4CC4 B;  3OMC A;  4CFU D;  4KH0 B;  2CUD A;  1PRL C;  4OB1 B;  2X3W D;  5DQV A;  2ZGW A;  3TNW B;  2KT1 A;  2EJG A;  4C0F A;  2BS4 A;  1TSF A;  4DEX A;  2ZPE B;  2K3B A;  3PVL A;  1OPK A;  2QDJ A;  1WFW A;  2Y4Y A;  5CKD A;  3R6O A;  3I55 Q;  3G6E Q;  3FDR A;  3NDQ A;  2QQB A;  2LP5 A;  3CPF A;  2B8A A;  4BCP B;  4JRQ A;  2KEA A;  2QAS A;  3EG9 A;  4AFZ C;  4C0D C;  5FRM A;  1W70 A;  4JRI A;  2V22 B;  1HD3 A;  4Z89 A;  2F2W A;  2FRW A;  3CQT A;  1H1S B;  2PNI A;  9ATC B;  4BCM B;  1UDL A;  2XMF A;  3NTH A;  4HVV A;  5FU6 B;  1UNG D;  1TOV A;  3PIO A;  2KR6 A;  1PD0 A;  2EQJ A;  1VOM A;  3QHW B;  1QMZ B;  2X4X A;  2CGH A;  1FYN A;  4AFQ C;  2DL3 A;  3EGD B;  1S72 A;  3ZL7 C;  3M57 A;  3CCL Q;  1G3S A;  1KHI A;  2F2X A;  2BPM B;  4C8Q D;  2DTO A;  2O2O A;  4TTH A;  4C5E A;  1ZSZ C;  1VQO A;  1VQ9 T;  2V1R A;  3RMQ A;  2KRS A;  4IKF A;  4BDY A;  1G3T A;  1QCN A;  1VQ7 A;  1U3O A;  5CYI B;  3M0P A;  2VXE A;  1AHJ B;  2DIQ A;  2DO3 A;  3AT1 B;  4F04 B;  1W2B A;  4EIK A;  3JCM V;  2WEV B;  3OYE A;  2R7G A;  1W2B S;  3B57 A;  3HO8 A;  1WHJ A;  3L2U A;  4MFE A;  2K3X A;  2RJF A;  3I56 A;  2L8D A;  3CC2 A;  1AVZ C;  2O4X B;  2DL4 A;  5KYU A;  3G71 Q;  1T0H A;  1K9M U;  4B9X A;  4YTL A;  3A5Z B;  4CFU B;  4E7J A;  2E6N A;  1YIJ Q;  1N8R C;  5ICP B;  4FM4 B;  2EIF A;  2KNB B;  1GL5 A;  2MWO A;  1WDX A;  2FPF A;  1YFN A;  3EID B;  3BHU B;  4KRD B;  1GBQ A;  2O31 A;  1URC B;  3CD6 Q;  3CC4 A;  1FMW A;  1NPR A;  4GBQ A;  2J05 A;  5KYY A;  2DL8 A;  2MIO A;  4ZGJ B;  4MDX A;  4HT9 A;  4DBR A;  2CS7 A;  3HL8 A;  2LCC A;  2E1H A;  2I53 A;  1I1J A;  1M4Z A;  4GLK A;  4YC3 B;  4F7U F;  3CCM A;  1K9M C;  4M7A E;  1AZG B;  2Y4X A;  3G71 T;  5GMK j;  3S3N A;  1QVF A;  2KRM A;  2R5A A;  3BY7 A;  3CD6 A;  4HCK A;  4BD3 A;  4BCF B;  1SF9 A;  3M4Y A;  4XU1 A;  1N8R U;  1QP2 A;  2E5K A;  2KE9 A;  4EMK B;  1AEY A;  3VYG B;  2CKK A;  2PJQ A;  3PIP A;  1C9B A;  2FEI A;  2V26 A;  3JCM f;  2E3I A;  4BCJ B;  3EGX B;  2KXD A;  4MFD A;  1VQN Q;  2CZ0 B;  4XQ3 A;  1JJ2 P;  3RUX A;  2XID A;  1PM3 A;  1Y0M A;  1PNJ A;  1VYW B;  4LD6 A;  2NUT A;  3CCS T;  1N8R R;  4F7N B;  1O9S A;  3MO8 A;  2C5X B;  2HBW A;  2YLB A;  4M7A A;  1B7T A;  3QXE B;  2IW9 B;  2LCL A;  4ZGE B;  3EG3 A;  4BBS M;  3CCE Q;  1Z9Z A;  1ZLM A;  5D6Y A;  1RAE B;  3EAE A;  2A3L A;  1D0X A;  2YXY A;  1X43 A;  3FRN A;  3GPL A;  3M55 A;  3L42 A;  4D8D A;  3TW7 A;  3KHI A;  3HZJ A;  1VQ8 A;  3HPW A;  2KQW A;  4FYW B;  1OU8 A;  4V2S A;  1TG0 A;  3QDR B;  3J80 E;  3SWN C;  1MHN A;  4HNU A;  4ZNX A;  4M77 G;  3E19 A;  1Q82 C;  1Q7Y U;  3LQ5 B;  2YRV A;  4M6V A;  5GJV B;  3L2Q A;  2CZ7 B;  4J8O A;  3UA6 A;  2EVR A;  2WHB B;  1KC8 C;  5HBE B;  3EJ1 B;  2JOY A;  2EPD A;  4J7I A;  3HSB A;  3DOG B;  2X51 A;  3T9N A;  3CBP A;  4F70 B;  1VIF A;  2DA9 A;  2ROT A;  3FJ5 A;  4OP0 A;  4XTW A;  4CRL B;  2JUF A;  2K5L A;  2YRC A;  3OYY A;  1XTD A;  2RM4 A;  2DJQ A;  2R57 A;  2ATC B;  2UZD B;  1OI1 A;  1W4S A;  1UJ0 A;  4M75 G;  1VQM T;  4Z88 A;  2CDT A;  3OBW A;  2JN0 A;  5I2M A;  2QQA A;  4CFV B;  2RHY A;  3G6E A;  1JO8 A;  1B3Q A;  4EOI B;  1OZ3 A;  4LD9 K;  1GCQ A;  1W98 B;  1OI9 B;  2BKZ B;  1K8A U;  1UGV A;  3JCM h;  4OGE A;  4RTT A;  4IUV A;  3OYH A;  1KJW A;  5LJ5 e;  4HVW A;  5IHI A;  1Y71 A;  1KHC A;  2DEQ A;  3U23 A;  2QYZ A;  1VIN A;  1FMV A;  1B07 A;  2P4R A;  3X24 B;  1M1K U;  1EIF A;  4DOW A;  3QWY A;  1OX8 A;  3JCM d;  2RHX A;  2BTT A;  5IHY A;  2JW4 A;  5LJ3 f;  1HYO A;  1FWZ A;  1JJ2 A;  4BY7 X;  4HKE A;  3MEV A;  2WXV B;  3CCS Q;  4JX4 A;  5IDP B;  1GFD A;  3QWL A;  2KI7 A;  1GH6 B;  2DVE A;  3E2U A;  3I35 A;  1E6H A;  4IIO A;  2KYB A;  4JJN K;  2GNC A;  1PD1 A;  2J6F A;  2HZY A;  2AKK A;  2JJ9 A;  1OV3 A;  1VQK Q;  3M0Q A;  2JGZ B;  2ZAE A;  1ACM B;  3SB2 A;  1H26 B;  2EJF A;  5FU7 C;  5IAY A;  2HL5 C;  1I81 A;  2QGS A;  3FB9 A;  4QVZ A;  1D3U B;  1K73 U;  4D8K A;  2DRM A;  1IHW A;  4IUR A;  4IUQ A;  4M7D B;  1D1C A;  2COY A;  5DQW A;  3P8H A;  4HLQ A;  2I0N A;  2LX7 A;  3FEO A;  3POM A;  4M77 D;  2GTJ A;  1VQK T;  3E1S A;  2DIG A;  5KYY B;  5IH2 A;  4JPB W;  4KRC B;  1NYF A;  2HQX A;  4YOS A;  2DF6 A;  5DLQ E;  4PFP A;  2RK2 A;  2LNH B;  4DBF A;  1CSK A;  2VYT A;  3QSU A;  5KCH A;  1WJR A;  4PK4 A;  1KK7 A;  2A37 A;  3QJY A;  5EJC A;  5FU6 C;  1M5Q 1;  2BKD N;  4PJN A;  3OYA A;  1VQ6 T;  3V7S A;  1HK9 A;  1AT1 B;  4EC9 B;  3CCJ Q;  2DVJ A;  1RUW A;  5GAN 2;  2OAU A;  2LX9 A;  1ZQ1 A;  1WQW A;  4M7D G;  1BU2 A;  3MP8 A;  4J9F A;  1VQ9 Q;  2RH2 A;  1XOV A;  2AHJ B;  2DXC B;  4NOY A;  1GRI A;  3KXT A;  3DLL A;  2NUP B;  1AZE A;  3TNH B;  4BCQ B;  1N9R A;  2HKN A;  2QA4 T;  3MP6 A;  4F14 A;  4M7A B;  1RAG B;  1D1A A;  1IRX A;  2UZE B;  3M0U A;  3NFC A;  3CME A;  2PK9 B;  2ZZD B;  1D3B A;  4J9G A;  3CCJ T;  5GMK i;  1WA7 A;  1T3S A;  3SWN A;  1Y7X A;  4K11 A;  1F5Q B;  2E6Z A;  4HVU A;  1VQM A;  2RHU A;  3PE0 A;  3CCR A;  1P5E B;  4FYX B;  2KMG A;  2ZPI B;  4CRI A;  4CFN B;  3REA B;  2YLC A;  1Q82 U;  3BG9 A;  4MIM A;  5HQ0 B;  1RAH B;  3CC4 Q;  5EFQ B;  2YUP A;  4ATO A;  4QQG A;  3OW2 P;  1VA7 A;  4J6Y A;  3JCM W;  1Y96 B;  2RF0 A;  2AK5 A;  3TNI B;  5A2Q E;  4F7U A;  4C92 A;  3GNG A;  4M7A G;  2YWW A;  2CRE A;  4M77 E;  2ED0 A;  3EG0 A;  3DL1 A;  5HK0 A;  5ACB A;  1QP3 A;  1SHG A;  2KR3 A;  2X4J A;  3OMG A;  1AIS B;  3S3M A;  2C5V B;  2WSC E;  2LNV A;  3M56 A;  4M7A D;  2DET A;  4RUG A;  4BCQ D;  2RQT A;  2KT8 A;  1TWB A;  2WFY B;  2G3R A;  1OU9 A;  2GF7 A;  1FVV B;  3HRS A;  5FWB A;  4C0G A;  1OIU B;  1QLB A;  5GAO n;  2VGN A;  2RQV A;  1OKV B;  2JZ2 A;  1M1K C;  3EFS A;  1R77 A;  3PMT A;  5GAM d;  4G6L B;  4I3Z B;  4OGR B;  4HCC A;  2EQK A;  4P5N A;  4FIB A;  2HNI A;  3PT9 A;  2YUN A;  2J7I A;  2YHT A;  4UC4 A;  1NEG A;  3TEE A;  2QI2 A;  5BNJ B;  1ZHI A;  1JST B;  5LL6 S;  4II5 B;  3JB9 H;  1BYM A;  2PVG B;  1TUC A;  2JTM A;  1JXO A;  2RHZ A;  1M8V A;  8ATC B;  4FYY B;  5LJ3 d;  3V7R A;  2M0O A;  4VUB A;  1CKB A;  2X4W A;  4C5H A;  3CD6 T;  2M1H A;  2YT6 A;  4PL6 A;  3GP8 A;  3BFM A;  3BG3 A;  2L89 A;  2ZPF B;  5KYX A;  3CCM T;  1M30 A;  3I5S A;  4N4I A;  4M7D A;  4JLG A;  2PUO B;  1QLY A;  2C5N B;  1G2B A;  3V8K A;  2YRD A;  2Z0W A;  4BY6 C;  3CC4 T;  3LGF A;  4PJO D;  3JCM J;  4GLM A;  3OW2 A;  2LJ0 A;  3OB9 A;  2JS2 A;  2FZG B;  1WI7 A;  2KYM A;  3VS1 A;  1G3Y A;  1YIT Q;  4WF2 A;  1R8O B;  2ZCF B;  5GAM j;  4HL4 A;  3EFO B;  1WZO A;  2KAF A;  4F6S B;  1FX7 A;  1PSF A;  3CC2 T;  1KQS S;  3CXC A;  4L5G A;  4BI3 A;  2HQH A;  4BY1 X;  1NLO C;  3WVD B;  2LCS A;  3OYK A;  4FU6 A;  3CME Q;  2YSQ A;  1JU5 C;  2LQ8 A;  2QG9 B;  1PC0 A;  4LNP A;  2XDB A;  4BCG B;  2IVW A;  2V8J A;  2F5K A;  2EYY A;  2UZL B;  1VQ7 T;  4C92 B;  5IXB A;  2LZ6 B;  4ELJ A;  3M0R A;  4NST B;  4J9E A;  4QKU A;  3VS7 A;  1IXD A;  2EYW A;  2CP0 A;  1VQ9 A;  3UA7 A;  2RI2 A;  3NPF A;  4N0A C;  5CK9 A;  2E12 A;  3CCR T;  3VUB A;  3I56 Q;  1TTH B;  2NUP A;  2EQM A;  2MCN A;  2H3J A;  3CCJ A;  5FRO A;  1NJI U;  2K2M A;  4PKC C;  2VAS A;  3CME T;  2QTV A;  2ZPB B;  2XG8 D;  4JDS A;  4R0K A;  2FPD A;  1UTI A;  2GGR A;  3REB B;  2QA4 A;  3NGP A;  1QVP A;  4ELZ C;  2EQU A;  1CKA A;  4JRP A;  3LGL A;  3MP1 A;  1H28 B;  8AT1 B;  2F2C A;  2GQV A;  3A98 A;  1BIB A;  2QDY B;  4JS4 A;  3QJ6 A;  4EMG A;  1NE8 A;  4BI4 A;  1BK2 A;  1SSF A;  2IG0 A;  4C8Q A;  2O9V A;  4RTY A;  4CXA B;  4LE9 A;  3TSW A;  2ED1 A;  1SRL A;  4Y92 A;  1WJQ A;  2CYZ B;  2P0Q A;  2C0T A;  4FX3 B;  2DEU A;  1VQ6 A;  3ZEH A;  3OY9 A;  1ARK A;  3MY1 B;  1OEB A;  4C92 G;  2CH4 A;  3LYI A;  2VB6 A;  1XNI A;  2MI6 A;  4BCI B;  3QKJ A;  3ULR B;  3CCU Q;  1KD1 R;  3E9F A;  3I9Q A;  2K79 A;  2QGF B;  5LMK B;  1SRM A;  3V8J A;  2PZ1 A;  1O9K A;  3BG5 A;  1IGU A;  4JZ4 A;  1OUL A;  3OBY A;  3CMA Q;  2I40 B;  2C0I A;  4PLI A;  2QF7 A;  4OMQ A;  4AKH A;  4XU0 A;  4ANJ A;  4C5G A;  1Y07 A;  3BLH B;  1VQK A;  4ROE A;  2RI3 A;  3LH0 A;  1X69 A;  2LT4 A;  1QVF P;  1MV3 A;  1YP5 A;  1I0C A;  5J26 A;  2BZY A;  1D09 B;  3CPW P;  1N27 A;  1T0J A;  1M3C A;  4RTW A;  1PKT A;  2I2L A;  3S3O A;  1YWP A;  1K73 C;  3UPU A;  3VS4 A;  1DJ7 B;  2LC4 A;  3UT1 A;  4FSX A;  3QG1 A;  1QKX A;  3QUI A;  3E9G A;  3L2R A;  3V7C A;  3EHR A;  4MZM A;  5M9O A;  3MET A;  2DNU A;  2B9R A;  4B6M A;  3EHQ A;  1SPK A;  5D6W A;  4JUV A;  4A4H A;  5CEI B;  2FZK B;  3VS6 A;  3RKY A;  4J9B A;  1YCS B;  1EZZ B;  1ZSG A;  3O0G D;  2F5T X;  1JOW A;  4J9D A;  1AWJ A;  4FL6 A;  3SD4 A;  2IW8 B;  2K3Y A;  5KYN A;  4F7U E;  3X20 B;  3CCV A;  2K4Y A;  4X9D A;  3JB9 I;  4ZN1 A;  3CCU A;  2W0Z A;  3JB9 J;  2JT4 A;  2W2H A;  2CJM B;  2C06 A;  3FJP A;  2VV5 A;  3RER A;  1GFC A;  2DXU A;  2KK4 A;  3TQ7 P;  2P0K A;  3G6E T;  4CFW B;  1PRM C;  4BE2 A;  1PWT A;  2DRK A;  4A4G A;  4J6X A;  1W1F A;  2MAM A;  2EBP A;  2JTE A;  2L3S A;  3M54 A;  1QQJ A;  4KGV B;  4OR5 B;  3J81 E;  1E9H B;  3A8O B;  1M3B A;  4CI0 C;  2MK5 A;  5DM7 R;  2DYI A;  2X3X D;  4LOC A;  2KVQ G;  2EKO A;  1Q81 C;  1YJ9 Q;  3LH5 A;  3OYD A;  4ELL A;  5GAN 5;  2R58 A;  4BCN B;  2ABL A;  5D7U A;  2DXB A;  3PTA A;  4XTZ A;  1HJD A;  3CCQ Q;  5HCK A;  3RR6 A;  1QVG A;  3L2V A;  2HCK A;  1UGS B;  3O8V A;  4M75 A;  3VJP A;  1WGS A;  2MPX C;  1LJO A;  3KBG A;  1VQ8 T;  2W10 A;  4PJO A;  3LWH A;  2CSQ A;  2RQU A;  3EGX A;  3GBQ A;  4QVC A;  4Z02 A;  2DJZ A;  4L6V 5;  4RTV A;  4ZTF A;  4J9H A;  2W9Z A;  3RNJ A;  1NG2 A;  1WPY A;  2VWF A;  3QWX X;  1I5L A;  1WHL A;  2ROL A;  3CCM Q;  1GXI E;  5I5Z B;  2BE7 D;  3CCS A;  4LUD A;  5A0D A;  4Y91 A;  4RKU E;  5CQX A;  4BY6 B;  1YJN A;  1IHV A;  1RAA B;  1JJ2 S;  3HHT B;  3VU3 C;  4KUL A;  3OYG A;  2D1X A;  4FT4 A;  2NWM A;  4WTO B;  2CP5 A;  2MYS A;  5EG2 A;  1M2V B;  1C1A A;  3X28 B;  1VUB A;  3OYF A;  4HCZ A;  3G71 A;  2XHC A;  3UWN A;  4EOS B;  3VYG A;  2E3H A;  4M78 G;  2LTO A;  3QYH B;  4NC6 A;  4YOZ A;  1AWW A;  1TFB A;  4JJD A;  5LJ5 f;  3FLG A;  1UEC A;  3M9Q A;  2RA2 A;  4KBM B;  5CIU A;  2HSP A;  2WIH B;  1YJ9 T;  2JNG A;  5EC7 A;  1PG5 B;  2OJ2 A;  3I5R A;  4Y72 B;  2RJD A;  5AT1 B;  3OQ5 A;  1UB4 A;  1G5V A;  3C0C A;  2V8I A;  1D0Y A;  5GAN 7;  3EH1 A;  1UHC A;  1KD1 C;  1WXB A;  1QMC A;  2GFA A;  1UUE A;  3I56 T;  1R0B G;  1QVG P;  5GAN e;  2EWN A;  1X75 C;  1GUX B;  3NHN A;  2H8H A;  4GY5 A;  4II1 A;  3QHR B;  1F1B B;  1PCX A;  3RDV A;  2EJ9 A;  2LJ1 A;  2DZ9 A;  4OMN A;  1OQK A;  4C8Q B;  2ZPH B;  4OF1 A;  1C6V X;  1I07 A;  3MPU B;  5I2S A;  4XAX B;  1VQO T;  3VS2 A;  4A4F A;  3QBY A;  5LJ5 j;  1QKW A;  3M58 A;  4DOV A;  2K9G A;  3OW2 S;  4R55 A;  4BCH B;  1WHH A;  2DD5 B;  3MEU A;  3TN8 B;  2DFU A;  3H8Z A;  4HA8 A;  1S72 T;  4BCK B;  2JMC A;  4C0Z A;  3JB9 G;  2XK0 A;  4HXJ A;  1BI2 A;  4FYV B;  3UF4 A;  4JRK A;  2RHI A;  4HNV A;  4RTZ A;  1SG5 A;  2DBM A;  2DTI A;  3M53 A;  3VKH A;  1TH7 A;  1Q95 G;  1OOT A;  2PVD B;  4IUP A;  3NMZ C;  1GUX A;  2AKL A;  3VS5 A;  4M77 B;  4WCI A;  4BCM D;  1RI0 A;  3H6Z A;  1ZX6 A;  2K7A A;  1MMG A;  1M90 U;  4KT0 E;  4PJO F;  1TS9 A;  2UZB B;  5IHN A;  2AT1 B;  1VQL Q;  1UNL D;  3UDC A;  4XU3 A;  1T3L A;  5J3B A;  4E7H A;  1Q86 R;  1PHT A;  2W99 A;  3Q1J A;  3RIR A;  5C6S A;  5KYW A;  3LX7 A;  2ESW A;  3VS0 A;  4XTX A;  1BKB A;  4BAC A;  1VQP A;  4M75 B;  2RNA A;  3DB3 A;  3PMI A;  4EMK C;  2V8K A;  1ZSZ A;  1M90 C;  1Y57 A;  3CC2 Q;  4MMK A;  2DAQ A;  2BIV A;  2CSI A;  1JKW A;  1NJI R;  2IPO B;  1IGQ A;  4L59 A;  4BXX X;  2Y90 A;  5KE2 A;  2OTJ A;  1D3B B;  3M03 A;  1QVG S;  2E4H A;  2DX1 A;  2L2P A;  3RKW A;  3TU4 K;  3H0F A;  3MCA B;  2JTF A;  4CC7 A;  2M16 A;  3H9N A;  2DXC A;  4C0D B;  2OTL Q;  3G4S T;  2OAW A;  1YN8 A;  2RQR A;  2CUB A;  3FC3 A;  2L3R A;  4ZGD B;  5CKF A;  3OS5 A;  3OS0 A;  1MV0 B;  3RGF B;  1YBY A;  1IZ6 A;  5GMK m;  4J6W A;  3QYE A;  4RG2 A;  3D7S B;  1VQ4 Q;  2G9X B;  3A8G B;  2O88 A;  1J3T A;  3SWN B;  1NZ9 A;  1WX6 A;  2LJ3 A;  2RQW A;  5GAO p;  1UG1 A;  2CCH B;  5HNB B;  3HFO A;  3OSV A;  4CFM B;  1K8A R;  2VVK A;  2DMO A;  3CC7 T;  4F7S B;  1VQ4 A;  3OYC A;  3I55 T;  3WVE B;  2RK1 A;  3A8H B;  2MF2 A;  1WXU A;  5CAI A;  3TRE A;  4QQ6 A;  2BS3 A;  3OYN A;  1JEG A;  1M3A A;  4NS5 A;  4OML A;  4LDY A;  3CXC P;  2J6O A;  4A54 A;  2G6F X;  2ZPG B;  5LJ3 j;  2W9F A;  1GCP A;  3ZBD A;  3MHX A;  3BHV B;  2QA4 Q;  2K5F A;  5CVI A;  4BB7 A;  2WSF E;  3BE3 A;  4KGX B;  2D8H A;  3BHT B;  4M77 C;  2E64 A;  5HY6 A;  2GQI A;  4AMC A;  1FXX A;  2E10 A;  5I22 A;  1JQQ A;  2QQS A;  1X6G A;  3JCM X;  4BDZ A;  2QQ9 A;  1TU0 B;  2SEM A;  4JJB A;  4X9C A;  2WJ9 A;  1UGQ B;  4X1V A;  2YUQ A;  5CR2 A;  2DD4 A;  4AT1 B;  1VYT A;  4FW1 A;  1X2Q A;  1D0Z A;  1MNE A;  3VRZ A;  4OGC A;  1KIK A;  1W2B P;  3SFM A;  2YUO A;  1VQ5 A;  1AOJ A;  3EG2 A;  4OMF B;  1OPL A;  1YJW T;  3GIB A;  3A1P A;  4DEY A;  2DTH A;  4ORZ A;  4M75 C;  1RAF B;  2LW4 A;  3JRZ A;  5GAO m;  3QYB A;  3F5X B;  1N9S A;  4EDU A;  1PKS A;  5CKB A;  4MDW A;  3QHS A;  3MIA B;  2RB6 A;  2FO0 A;  3J7A F;  4PNO A;  3GTM S;  2QEX A;  3CMA A;  3DLM A;  2DLP A;  4ZTJ A;  4M7D F;  2LRQ A;  1KG1 A;  1H92 A;  1TXQ A;  5FU7 B;  3MEA A;  1H1R B;  3P8D A;  1K4U S;  1B34 B;  3JCM g;  4ROC A;  4E7S A;  1YIT A;  4FCY A;  1UGP B;  3OYB A;  1M2O A;  4FW2 A;  1YJW Q;  5AYF A;  5DY9 A;  2K2V A;  1I8F A;  2HDA A;  3M5A A;  1PKD B;  2BS2 A;  1BIA A;  2IIM A;  5GAN g;  2DIL A;  1C0M A;  3JCM b;  2M0Y A;  2CZ6 B;  1H3Z A;  2K6D A;  4A4E A;  2M02 A;  1VQ8 Q;  1G3N C;  4PLL A;  4A63 B;  3H0H A;  2E5Q A;  4M78 C;  4C8Q F;  5GAO q;  4RTU A;  1GY3 B;  5IF1 B;  4BUG A;  4TVR A;  4JZ3 A;  4BBR M;  1QCF A;  1WLP B;  3LLR A;  1WQ7 A;  1YI2 A;  5KE3 A;  2COW A;  2L0A A;  2O01 E;  1ZUK A;  2KBT A;  4M7D E;  1Y96 A;  3CCL T;  3CPW A;  1VYU A;  1K0S A;  1PSE A;  4F7U G;  2AZV A;  3NTI A;  4LN2 A;  2M51 A;  5I21 A;  2RPN A;  4M4Z A;  6AT1 B;  4QW2 A;  1ZA1 B;  2L5Q A;  2PK2 A;  2LDM A;  2DD5 A;  4M78 F;  3VRY A;  4C8Q C;  3BW1 A;  1HSQ A;  1NJI C;  3S6W A;  2D8J A;  2FZC B;  5KYU B;  2RO0 A;  5GAM g;  1H4L D;  1M8M A;  1FIN B;  1TUD A;  2QAZ A;  4RCC A;  2X9H A;  3QZ9 B;  2ENM A;  2XD0 A;  5GMK e;  2DPP B;  5IT9 E;  3OSS C;  3M4G A;  5HBJ B;  5L23 A;  3LW5 E;  2C6T B;  1NM7 A;  1BI1 A;  4AKG A;  2DL7 A;  1WHM A;  2FG0 A;  4PFO A;  1X2K A;  1TD6 A;  1YIJ T;  1K1Z A;  3CXC S;  1Q86 C;  5IXF A;  1XJW B;  3JCM Q;  2GBQ A;  2NYS A;  1QWE A;  1I4K 1;  5LJ5 g;  4N0A A;  5FW9 A;  1VIE A;  2DER A;  2FPE A;  3RMS A;  5GMK l;  4Y28 E;  3K7A M;  1H25 B;  1MMA A;  1JBM A;  3G33 B;  3OYL A;  2LQW A;  5GAN h;  3DB4 A;  2HSE B;  4IMY B;  1M90 R;  3PFS A;  1VQL T;  4OB3 B;  4EOJ B;  3ME9 A;  2LQN A;  2HAX A;  1U1S A;  2VKN A;  4AG2 C;  1YI2 T;  2D0Q B;  2RN8 A;  1O9K B;  2X35 A;  5A0G A;  1VQ7 Q;  2MWP A;  4QVD A;  3VS3 A;  1MMN A;  1NBE B;  2EYZ A;  2OI3 A;  3HRT A;  2DBK A;  5GJW B;  2COZ A;  2CH4 W;  2KY9 A;  2DKG A;  1OIY B;  1ABO A;  1KC8 U;  1WHK A;  1V76 A;  2A36 A;  3HTR A;  5KCO A;  2J06 A;  1VQN T;  3PNW C;  3QPH A;  1K73 R;  3C95 A;  3JSC A;  4ESR A;  1OKW B;  4AFS C;  4ME7 A;  3CPW S;  4AFU C;  2WPA B;  1BU1 A;  4O5V A;  1S72 Q;  1OL1 B;  1ENW A;  3EFO A;  1H27 B;  1KD1 U;  1QVF S;  2A08 A;  4J9I A;  3CCQ A;  1V1C A;  4PJO G;  4XK8 E;  3CCE T;  4NL3 A;  5LJ5 h;  4M7D C;  2B86 A;  2QQ8 A;  2C5O B;  2OTL T;  3EGD A;  2DXB B;  2E70 A;  4PFZ A;  4ZN3 A;  1ZA2 B;  4JJC A;  4KRT A;  5GAM f;  3PGG A;  3CMA T;  3QYG B;  3INZ A;  1K8A C;  4PJM A;  4E6R A;  4M75 D;  2W96 A;  2J6K A;  1VOL A;  3H41 A;  1AWO A;  5GAN 3;  3EOC B;  1K9M R;  5GAM e;  2BUD A;  1WNL A;  4LDV A;  1W6X A;  3OS1 A;  2DZC A;  1JB0 E;  3X25 B;  1KQS P;  1YJW A;  1RL2 A;  3DTO A;  3BDL A;  4DA4 A;  1H24 B;  2XDD A;  3CC7 Q;  2G77 A;  1H8K A;  4FT2 A;  5LQF B;  2VGM A;  1UHF A;  1Q7Y R;  2LT1 A;  1G8X A;  3TSZ A;  1YHQ T;  3CCV Q;  2IW6 B;  1QCO A;  2RD1 A;  3CCR Q;  1GCQ C;  1H1P B;  3H4C A;  3HBL A;  2A7Y A;  1N6A A;  4M7A C;  4BI8 B;  1KFZ A;  2HQE A;  4ROD A;  2EUF A;  2KDS A;  2VXF A;  3P8B B;  1KQ2 A;  4D6W A;  2XIC A;  2PQW A;  4EOP B;  2EYQ A;  1JRI A;  4KH1 B;  1M1F A;  3VUZ A;  1MUZ A;  1LCK A;  3QO3 A;  4C92 F;  3EFR A;  2QQR A;  3QZ5 B;  4F16 A;  4JLI A;  1IO6 A;  2PMI B;  3NTK A;  5FGK B;  1X27 A;  2CT4 A;  1RLQ C;  4J83 A;  2WSE E;  2OX7 A;  4HCB A;  4C92 C;  2X1N B;  5KH6 A;  2PUK B;  4EOM B;  5CKE A;  1VQ4 T;  2WAC A;  3CC7 A;  3JV3 A;  2DL5 A;  1D1B A;  2KMT A;  5IN1 A;  3O5Z A;  2D9T A;  2KRN A;  4IUT A;  1WIE A;  5I11 A;  3M0T A;  2EKH A;  3CBM A;  4DBQ A;  1A0N B;  4N4H A;  4E7L A;  2L3P A;  5LJ3 h;  1B34 A;  1RAC B;  2EGC A;  3TVT A;  4J7F A;  1UJY A;  2X4Y A;  2YDL A;  5LJ3 g;  1YHQ A;  4EC8 B;  2RJC A;  1RAI B;  4F17 A;  3G4S A;  2ZZD A;  1WYX A;  4C92 E;  1Q86 U;  3HP9 A;  1OL2 B;  4QT7 A;  4FSS A;  1WJS A;  1GBR A;  2DME A;  4KUD K;  1UNH D;  1LPL A;  2KXC A;  2DXT A;  3HFN A;  1KQS A;  4BE0 A;  2JS0 A;  1VQ6 Q;  1R0C B;  2CP3 A;  4J9C A;  4RMO A;  1M1K R;  1LVK A;  4B9W A;  2XI9 A;  2HD0 A;  1U5S A;  3URG A;  4C5I A;  5HKC A;  1U8R A;  4M78 B;  4M78 D;  3JAM E;  1KC8 R;  5IDN B;  2JM9 A;  5J39 A;  2GCX A;  1HXD A;  1N5Z A;  2GFU A;  3RBB B;  1VQP T;  2OTL A;  1BB9 A;  1QWF A;  2JMA A;  4ELY C;  1Q7Y C;  5HBH B;  2CZ1 B;  2F2V A;  1G3W A;  4M7A F;  1MND A;  1AWX A;  2PU9 B;  3CCE A;  4QSH A;  2OTJ Q;  4E2F B;  5A0L A;  5GAN 4;  3EGU A;  1NEB A;  2KGT A;  3CCQ T;  1WHG A;  3PO3 S;  3HB9 A;  1RAD B;  4PJO B;  3OYJ A;  2D6F A;  3FIF A;  3LWI A;  2AZS A;  2P4T A;  1UFF A;  1VQN A;  2LQK A;  5GAN f;  1AD6 A;  2EYX A;  1VQP Q;  3JB9 D;  3VKI A;  2RMO A;  7AT1 B;  4C92 D;  4OVA A;  2C4G B;  1OX9 A;  4C8Q G;  1BI0 A;  1WXT A;  4CFX B;  1E7O A;  4Q5W A;  2IN3 A;  4EOR B;  2K57 A;  1EFN A;  2O9S A;  3BLR B;  2V1Q A;  3OYM A;  3V8L A;  3MEW A;  4XU2 A;  1VQL A;  2R5M A;  3MI9 B;  1KSW A;  4DBH A;  2RI5 A;  4O6J A;  1X6B A;  1NLP C;  2DK3 A;  1BBZ A;  4DQ2 A;  3JCM P;  3L2Z A;  1M2V A;  4A53 A;  5C0M A;  1OYX A;  3WXM B;  3EG1 A;  2BZX A;  3VYH B;  4MZP A;  3TCJ A;  2CP6 A;  4AI6 A;  3G1J A;  2DM1 A;  1FKM A;  3C4S A;  1YIJ A;  1H3H A;  1M1G A;  1U1T A;  1VYV A;  1KQ1 A;  2L3Q A;  3DDQ B;  3M59 A;  2CP7 A;  2EGA A;  3UAT A;  2KRO A;  1XO2 A;  1MGQ A;  4EOK B;  3M0S A;  2QFZ A;  5L2W B;  2GTO A;  3OYI A;  2E41 A;  2XU8 A;  2WMA B;  4AG1 C;  5FLX E;  4N4G A;  1KXU A;  4OMO A;  2F1L A;  4EMH A;  4OMM A;  5LJ3 e;  1H1Q B;  1S1N A;  2VC8 A;  5DLO A;  1BI3 A;  5CO7 A;  4AKI A;  1RI9 A;  4J5Y A;  4M77 A;  5CQY A;  5GAN 6;  4OB2 B;  1U06 A;  5GAN j;  1Q82 R;  5FWC A;  4BE1 A;  3QII A;  4Z6Y A;  1YJ9 A;  1E7P A;  2PVO B;  2JVV A;  3A8M B;  3GF5 A;  1SHF A;  1ABQ A;  2HBP A;  2JM8 A;  5GMK h;  1ZUY A;  3GLX A;  3L2W A;  2H3E B;  1YCY A;  5HK3 A;  1I5O B;  3L1A A;  4EMK A;  4RTX A;  3HKS A;  3CCL A;  4IUU A;  1K76 A;  4PJL A;  1E6G A;  1UGR B;  4LXC A;  2LVM A;  5CKH A; 
#chains in the Genus database with same CATH homology
 2F5T X;  5GAN d;  4IUV A;  3OYH A;  4FL6 A;  3SD4 A;  5LJ5 e;  1Y71 A;  1KHC A;  2DEQ A;  4PLL A;  2E5Q A;  4M78 C;  4C8Q F;  5GAO q;  2K3Y A;  3ER0 A;  3X24 B;  4F7U E;  3X20 B;  2KSS A;  4KUI A;  1M1K U;  4BUG A;  1EIF A;  4DOW A;  3CCV A;  3RKX A;  4TVR A;  4PJO C;  3JCM d;  2RHX A;  2K4Y A;  4BBR M;  1X6O A;  4X9D A;  3JB9 I;  4ZN1 A;  3CCU A;  3C12 A;  5LJ3 f;  1FWZ A;  3LLR A;  4C8Q E;  1JJ2 A;  1WQ7 A;  4HKE A;  3MEV A;  3JB9 J;  1YI2 A;  4JX4 A;  5KE3 A;  2O01 E;  2M9U A;  1YJN T;  3QWL A;  1Y96 A;  4M7D E;  3CCL T;  3CPW A;  2FL7 A;  2C06 A;  3FJP A;  4M75 E;  2DVE A;  3ZFJ A;  2VV5 A;  3RER A;  3A8L B;  1PSE A;  2DXU A;  2KK4 A;  5FRN A;  2P0K A;  2O4X A;  3G6E T;  4BE2 A;  1M9S A;  2NLU A;  4F7U G;  4JJN K;  4E47 A;  4A4G A;  4J6X A;  2MAM A;  1IRE B;  2QTX A;  3NTI A;  3M54 A;  5I21 A;  3J81 E;  4QW2 A;  3A8O B;  2L5Q A;  3SB2 A;  4CI0 C;  5DM7 R;  2LDM A;  1YIT T;  2DD5 A;  2E65 A;  4M78 F;  2EJF A;  4C8Q C;  3BW1 A;  3AHU A;  5GAO l;  5FU7 C;  4MML A;  4LOC A;  3S6W A;  1I81 A;  5IAY A;  1NJI C;  3GNF B;  3FB9 A;  4QVZ A;  4M77 F;  2KVQ G;  2EKO A;  1K73 U;  2RO0 A;  1QW1 A;  5GAM g;  1Q81 C;  3OYD A;  4IUR A;  1Q81 U;  4IUQ A;  4M7D B;  4E7K A;  2QEX T;  4M78 E;  4RCC A;  3X26 B;  3P8H A;  4HLQ A;  3QZ9 B;  2XD0 A;  5GAN 5;  5GMK e;  2R58 A;  2DPP B;  5IT9 E;  3OSS C;  2DXB A;  3M4G A;  4XTZ A;  3PTA A;  3LW5 E;  3FEO A;  4M77 D;  1NPP A;  1QVG A;  2P0P A;  3L2V A;  1V29 B;  1UGS B;  1BI1 A;  1VQK T;  4AKG A;  3O8V A;  3E1S A;  2DIG A;  4M75 A;  4F7U B;  2K5I A;  3VJP A;  1VQ5 T;  1WGS A;  1LJO A;  3KBG A;  3JCM e;  5LJ5 d;  1VQ8 T;  1YIJ T;  1X01 A;  3CXC S;  1Q86 C;  4JX5 A;  2HQX A;  4PJO A;  5DLQ E;  1UEB A;  4M75 F;  2RK2 A;  4A4K A;  3JCM Q;  1I4K 1;  3LWH A;  3SDZ A;  2VYT A;  5LJ5 g;  4N0A A;  3QSU A;  1VIE A;  5KCH A;  5GAN 8;  1WJR A;  2XDP A;  3RMS A;  5GMK l;  4Y28 E;  4QVC A;  3QJY A;  5EJC A;  3JB9 F;  4OB0 B;  4Z02 A;  2DJZ A;  4L6V 5;  5FU6 C;  4ZTF A;  1M5Q 1;  2BKD N;  3DKM A;  1JBM A;  5GAM h;  3OYL A;  1WPY A;  4LDU A;  5GAN h;  3DB4 A;  3GOX A;  5D6X A;  3OYA A;  1I5L A;  3CBO A;  1VQ6 T;  3PFS A;  1VQL T;  2DD4 B;  3V7S A;  1HK9 A;  3OA6 A;  4OB3 B;  2HAX A;  3ME9 A;  3CCS A;  3VKG A;  1GXI E;  1U1S A;  4LDW A;  5A0D A;  4Y91 A;  4RKU E;  5CQX A;  4BY6 B;  1YJN A;  2MMP A;  5GAN 2;  1YI2 T;  3C94 A;  2D0Q B;  2OAU A;  2LX9 A;  1O75 A;  1ZQ1 A;  4JS5 A;  1WQW A;  1JJ2 S;  2X35 A;  5A0G A;  3HHT B;  2MWP A;  4QVD A;  2FB7 A;  3CCU T;  4M7D G;  2QXF A;  3MP8 A;  3VU3 C;  4KUL A;  3OYG A;  2RH2 A;  4FT4 A;  3CCV T;  3HRT A;  1XOV A;  2AHJ B;  2DXC B;  1LOJ A;  2KY9 A;  4M78 A;  2DKG A;  4NOY A;  5EG2 A;  1P92 A;  3KXT A;  3DLL A;  1OZ2 A;  4EPC A;  1KC8 U;  1N9R A;  5KCO A;  4E7I A;  1VQN T;  5GAO r;  2QA4 T;  3X28 B;  1VUB A;  3KUF A;  3PNW C;  3QPH A;  3C95 A;  2FVU A;  3JSC A;  3MP6 A;  3OYF A;  4NL2 A;  2XKO C;  4M7A B;  4HCZ A;  3I55 A;  4ME7 A;  4RG8 A;  3G71 A;  2XHC A;  3CPW S;  3UWN A;  3NFC A;  4O5V A;  3CME A;  4XTV A;  2ZZD B;  3VYG A;  1D3B A;  4MZT A;  4RCB A;  3CCJ T;  4M78 G;  5GMK i;  1KD1 U;  1QVF S;  1XQH A;  2LTO A;  3CCQ A;  3SWN A;  1Y7X A;  3TW6 A;  3QYH B;  2EAY A;  2E6Z A;  4NC6 A;  5L8R E;  4PJO G;  2RHU A;  4XK8 E;  3VV0 A;  4NL3 A;  1VQM A;  3CCE T;  3CCR A;  5LJ5 h;  3BDU A;  4M7D C;  2KMG A;  2ZPI B;  3FLG A;  3M9Q A;  2RA2 A;  4KBM B;  4CRI A;  5LJ5 f;  2YLC A;  5CIU A;  3BG9 A;  4MIM A;  1Q82 U;  2QQ8 A;  4M7D D;  2OTL T;  4ATO A;  4QQG A;  1YJ9 T;  2JNG A;  1H64 1;  2DXB B;  4J6Y A;  2E70 A;  5CCA A;  4ZN3 A;  2FYK A;  1ZBX A;  4PJO E;  3JCM W;  4JX6 A;  1Y96 B;  3HRU A;  2RJD A;  5GAM f;  3PGG A;  3OQ5 A;  1UB4 A;  3F70 A;  1G5V A;  2V8I A;  5A2Q E;  3QYG B;  3INZ A;  4F7U A;  1K8A C;  3CMA T;  4C92 A;  5GAN 7;  4M75 D;  3GNG A;  1KD1 C;  4M7A G;  4M77 E;  5GAN 3;  2GFA A;  2EFI A;  3I56 T;  5GAM e;  2BUD A;  1WNL A;  1VQ8 A;  4HT8 A;  3DL1 A;  4LDV A;  2OTJ T;  5GAN e;  5HK0 A;  4X34 A;  3CEY A;  3OS1 A;  3OS2 A;  2DZC A;  4M7A C;  1QP3 A;  2EWN A;  4LDX A;  1JB0 E;  3X25 B;  3JCM c;  1X75 C;  4GY5 A;  2X4J A;  1RL2 A;  2FHD A;  3OMG A;  4QQD A;  3RES A;  4R56 A;  3S3M A;  1YJW A;  3BDL A;  4II1 A;  4XTY A;  1LNX A;  2EJ9 A;  2WSC E;  2DZ9 A;  3N5B B;  2VUB A;  4DA4 A;  4HNT A;  2XDD A;  2G77 A;  2LNV A;  2RJE A;  3M56 A;  4FT2 A;  4M7A D;  2VGM A;  3ASK A;  4XTU A;  2LT1 A;  2F69 A;  3G7Z A;  4C8Q B;  3OMC A;  2ZPH B;  4OF1 A;  1YHQ T;  2G3R A;  4OB1 B;  5I2S A;  2RD1 A;  2GF7 A;  4XAX B;  1VQO T;  4A4F A;  3QBY A;  2ZGW A;  5LJ5 j;  3M58 A;  3HRS A;  3H4C A;  2EJG A;  3HBL A;  2A7Y A;  1N6A A;  4C0F A;  4C0G A;  4DOV A;  3OW2 S;  1QLB A;  4BI8 B;  2HQE A;  2BS4 A;  2VGN A;  5GAO n;  4R55 A;  2KDS A;  2DD5 B;  2JZ2 A;  2VXF A;  3EFS A;  3H8Z A;  3MEU A;  2ZPE B;  3P8B B;  4HA8 A;  4D6W A;  2XIC A;  1KQ2 A;  2PQW A;  3PMT A;  5GAM d;  1S72 T;  2QDJ A;  2EYQ A;  1JRI A;  2Y4Y A;  1M1F A;  3VUZ A;  4C0Z A;  5CKD A;  2EQK A;  4P5N A;  3R6O A;  4HCC A;  3JB9 G;  2XK0 A;  3FDR A;  1BI2 A;  2HNI A;  3QO3 A;  2QQB A;  3PT9 A;  3EFR A;  4FIB A;  4C92 F;  4JRK A;  2QQR A;  3QZ5 B;  4HNV A;  2RHI A;  3CPF A;  2B8A A;  4JLI A;  2YHT A;  4UC4 A;  3TEE A;  2QI2 A;  4JRQ A;  1ZHI A;  2DTI A;  3M53 A;  4C0D C;  3NTK A;  3VKH A;  1TH7 A;  5FRM A;  5LL6 S;  4JRI A;  4J83 A;  3JB9 H;  2WSE E;  1BYM A;  2PVD B;  2PVG B;  4IUP A;  2JTM A;  4HCB A;  2RHZ A;  4C92 C;  1M8V A;  5LJ3 d;  4M77 B;  3V7R A;  2M0O A;  5KH6 A;  1RI0 A;  4VUB A;  2PUK B;  3H6Z A;  2X4W A;  5CKE A;  4C5H A;  3CD6 T;  3NTH A;  2M1H A;  1M90 U;  5FU6 B;  4KT0 E;  4PJO F;  3PIO A;  4PL6 A;  2KR6 A;  2WAC A;  3GP8 A;  3CC7 A;  1VQ4 T;  2EQJ A;  3BFM A;  3BG3 A;  2L89 A;  2ZPF B;  2KMT A;  5IN1 A;  3CCM T;  2D9T A;  3UDC A;  2X4X A;  4XU3 A;  2CGH A;  4IUT A;  4N4I A;  5J3B A;  4JLG A;  4E7H A;  2PUO B;  4M7D A;  1S72 A;  3M57 A;  3Q1J A;  3RIR A;  5C6S A;  3CBM A;  3V8K A;  1G3S A;  3LX7 A;  4N4H A;  4BY6 C;  3CC4 T;  4E7L A;  1KHI A;  4C8Q D;  2DTO A;  3LGF A;  4PJO D;  3JCM J;  4XTX A;  5LJ3 h;  3OW2 A;  4C5E A;  3OB9 A;  1VQO A;  1BKB A;  1VQ9 T;  1B34 A;  4BAC A;  1VQP A;  4J7F A;  2X4Y A;  3RMQ A;  5LJ3 g;  4M75 B;  4IKF A;  1YHQ A;  3PMI A;  3DB3 A;  4BDY A;  4EMK C;  1G3T A;  2RJC A;  1G3Y A;  2OTJ A;  2V8K A;  4WF2 A;  1M90 C;  1VQ7 A;  3G4S A;  1R8O B;  2ZCF B;  2ZZD A;  4C92 E;  5GAM j;  4HL4 A;  4MMK A;  2DAQ A;  1Q86 U;  3HP9 A;  2VXE A;  1AHJ B;  2BIV A;  2KAF A;  2DIQ A;  1WJS A;  2DO3 A;  1M1K C;  1FX7 A;  1PSF A;  3CC2 T;  4KUD K;  1W2B A;  1KQS S;  3CXC A;  3JCM V;  4L5G A;  3OYE A;  2DXT A;  3HFN A;  1W2B S;  4L59 A;  4BI3 A;  4BE0 A;  1KQS A;  4RMO A;  3HO8 A;  2Y90 A;  5KE2 A;  3WVD B;  3L2U A;  4MFE A;  2K3X A;  2RJF A;  2XI9 A;  4B9W A;  3I56 A;  1D3B B;  2HD0 A;  2L8D A;  4FU6 A;  3OYK A;  1QVG S;  3CC2 A;  2O4X B;  2LQ8 A;  3RKW A;  3TU4 K;  3URG A;  4C5I A;  5HKC A;  2XDB A;  3MCA B;  1K9M U;  2JTF A;  2IVW A;  2V8J A;  1U8R A;  2M16 A;  4C0D B;  2DXC A;  4M78 B;  4B9X A;  2F5K A;  4M78 D;  3JAM E;  3G4S T;  1VQ7 T;  4YTL A;  3A5Z B;  4E7J A;  4C92 B;  2E6N A;  5J39 A;  4ELJ A;  1N8R C;  2GCX A;  3FC3 A;  2L3R A;  1HXD A;  4FM4 B;  2EIF A;  4ZGD B;  2GFU A;  3OS5 A;  2MWO A;  5CKF A;  3OS0 A;  1VQP T;  1VQ9 A;  2OTL A;  4ELY C;  1YBY A;  1IZ6 A;  2RI2 A;  1Q7Y C;  5GMK m;  2CZ1 B;  4N0A C;  5CK9 A;  4J6W A;  1G3W A;  3QYE A;  2E12 A;  4RG2 A;  2PU9 B;  3VUB A;  3CCR T;  3CC4 A;  4M7A F;  3CCE A;  4QSH A;  1NPR A;  5A0L A;  3A8G B;  5GAN 4;  2EQM A;  3SWN B;  1NZ9 A;  3CCQ T;  2H3J A;  4ZGJ B;  4MDX A;  4HT9 A;  5GAO p;  2CS7 A;  3HB9 A;  3HL8 A;  3CCJ A;  5FRO A;  1NJI U;  2LCC A;  2E1H A;  4PKC C;  3HFO A;  3OSV A;  3OYJ A;  4PJO B;  3CME T;  1M4Z A;  4GLK A;  4F7U F;  3CCM A;  2ZPB B;  2XG8 D;  1K9M C;  3FIF A;  2Y4X A;  2D6F A;  4M7A E;  3G71 T;  4JDS A;  5GMK j;  3S3N A;  3CC7 T;  3LWI A;  1QVF A;  2R5A A;  1VQ4 A;  2P4T A;  3BY7 A;  3OYC A;  3I55 T;  3WVE B;  3CD6 A;  2RK1 A;  3A8H B;  2QA4 A;  2MF2 A;  4BD3 A;  1VQN A;  1QVP A;  2LQK A;  3M4Y A;  4XU1 A;  1N8R U;  5GAN f;  4ELZ C;  5CAI A;  1QP2 A;  2EQU A;  3TRE A;  4QQ6 A;  4EMK B;  3VYG B;  3LGL A;  2BS3 A;  2CKK A;  4JRP A;  3MP1 A;  3PIP A;  3OYN A;  3JB9 D;  3VKI A;  4NS5 A;  4LDY A;  4C92 D;  2GQV A;  4OVA A;  4A54 A;  3JCM f;  1BIB A;  2QDY B;  2ZPG B;  5LJ3 j;  4JS4 A;  3QJ6 A;  1BI0 A;  4C8Q G;  4EMG A;  1NE8 A;  4Q5W A;  4BI4 A;  4MFD A;  1SSF A;  2IG0 A;  3ZBD A;  2CZ0 B;  3MHX A;  4XQ3 A;  4C8Q A;  2K5F A;  2K57 A;  5CVI A;  2XID A;  3RUX A;  4BB7 A;  1WJQ A;  2CYZ B;  2P0Q A;  2WSF E;  4LD6 A;  3OYM A;  3CCS T;  3V8L A;  3MEW A;  4XU2 A;  4M77 C;  1VQL A;  1VQ6 A;  2R5M A;  1O9S A;  3ZEH A;  3OY9 A;  2E64 A;  3MO8 A;  4C92 G;  2RI5 A;  3LYI A;  5HY6 A;  2YLB A;  4O6J A;  4M7A A;  1FXX A;  3QXE B;  2E10 A;  1XNI A;  2MI6 A;  2DK3 A;  2QQS A;  4DQ2 A;  3JCM P;  2LCL A;  3L2Z A;  3QKJ A;  4ZGE B;  3E9F A;  3JCM X;  2QQ9 A;  4A53 A;  5C0M A;  4BDZ A;  4BBS M;  4X9C A;  2WJ9 A;  1UGQ B;  1OYX A;  3V8J A;  5D6Y A;  3EAE A;  3WXM B;  3BG5 A;  5CR2 A;  2A3L A;  2DD4 A;  3VYH B;  3OBY A;  4MZP A;  3TCJ A;  3GPL A;  3FRN A;  4PLI A;  2QF7 A;  4AI6 A;  3L42 A;  3M55 A;  1FKM A;  3TW7 A;  3KHI A;  3HZJ A;  4AKH A;  3C4S A;  1YIJ A;  4OGC A;  3HPW A;  1M1G A;  1U1T A;  2KQW A;  1KQ1 A;  4XU0 A;  3M59 A;  3SFM A;  4C5G A;  1Y07 A;  1VQ5 A;  4V2S A;  3QDR B;  3J80 E;  1MGQ A;  4OMF B;  3SWN C;  1VQK A;  3GIB A;  1YJW T;  1MHN A;  4HNU A;  2RI3 A;  2DTH A;  4M77 G;  4M75 C;  3LH0 A;  2LT4 A;  2QFZ A;  3E19 A;  3OYI A;  1Q82 C;  2E41 A;  3JRZ A;  5GAO m;  3QYB A;  1Q7Y U;  2XU8 A;  1N9S A;  4EDU A;  2YRV A;  5J26 A;  5CKB A;  4MDW A;  4M6V A;  5FLX E;  4N4G A;  3L2Q A;  2CZ7 B;  4J8O A;  1N27 A;  3QHS A;  2RB6 A;  1KC8 C;  3J7A F;  4EMH A;  4PNO A;  5LJ3 e;  2QEX A;  5DLO A;  3CMA A;  2VC8 A;  3DLM A;  1BI3 A;  2I2L A;  2JOY A;  4J7I A;  5CO7 A;  4AKI A;  3S3O A;  4ZTJ A;  4J5Y A;  4M77 A;  4M7D F;  5CQY A;  5GAN 6;  1K73 C;  3HSB A;  2LRQ A;  3T9N A;  3UPU A;  1KG1 A;  4OB2 B;  3CBP A;  5FU7 B;  1DJ7 B;  1VIF A;  2LC4 A;  3MEA A;  3UT1 A;  5GAN j;  3P8D A;  4FSX A;  4BE1 A;  3QG1 A;  4OP0 A;  3QII A;  4Z6Y A;  1B34 B;  2JUF A;  2K5L A;  4XTW A;  3QUI A;  3JCM g;  1YJ9 A;  1E7P A;  3OYY A;  2PVO B;  2JVV A;  3E9G A;  3L2R A;  3V7C A;  1YIT A;  3A8M B;  1XTD A;  2RM4 A;  3GF5 A;  1UGP B;  3OYB A;  2HBP A;  2R57 A;  5GMK h;  1OI1 A;  1W4S A;  4M75 G;  1VQM T;  5AYF A;  3GLX A;  3L2W A;  3OBW A;  4MZM A;  2JN0 A;  5M9O A;  5DY9 A;  5I2M A;  1YCY A;  2K2V A;  1I8F A;  3MET A;  2QQA A;  5HK3 A;  2RHY A;  3G6E A;  3M5A A;  2BS2 A;  1BIA A;  3L1A A;  5GAN g;  5D6W A;  4EMK A;  1OZ3 A;  4JUV A;  4A4H A;  4LD9 K;  3HKS A;  3JCM b;  3CCL A;  3RKY A;  2CZ6 B;  1H3Z A;  4A4E A;  1K8A U;  4IUU A;  3JCM h;  4OGE A;  1UGR B;  2LVM A;  5CKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...