3X20B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 25 min
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x20B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x20B02
3QXEB 1PSEA 4L6V5 1UGQB 1JB0E 2ZPBB 4OB3B 2CZ0B 2CYZB 4OB2B 5L8RE 2ZPHB 4XK8E 2CZ1B 1IREB 1GXIE 3X28B 2ZPFB 3A8OB 3VYGB 3X26B 3A8LB 1UGRB 3VYGA 2ZPGB 2PVGB 1UGPB 3QYHB 1QP3A 4ZGEB 3WVEB 3X24B 2WSFE 1PSFA 2DPPB 2PU9B 4OB1B 2O01E 2DD4B 2PUOB 2DD4A 3A8MB 2ZCFB 3QYGB 3QZ5B 1DJ7B 1V29B 2CZ7B 1AHJB 2DD5B 3A8HB 2DD5A 2PVOB 2ZPIB 3A8GB 3VYHB 1UGSB 2CZ6B 3LW5E 1QP2A 2WSEE 3X25B 4ZGDB 3X20B 2QDYB 2PUKB 2DXCB 2DXCA 4KT0E 2PVDB 4RKUE 2ZPEB 3WVDB 2WSCE 4OB0B 2ZZDB 4ZGJB 2D0QB 2ZZDA 2AHJB 3HHTB 2DXBB 4Y28E 3QZ9B 4FM4B 2DXBA
chains in the Genus database with same CATH superfamily
1VQPA 2UUEB 4J8OA 1Y0MA 3LX7A 1YIJA 2I40B 4CC4B 3MP6A 4DBQA 5L2WB 1O9SA 2MMPA 1JQQA 3JCMb 1PD1A 1QVGP 5GMKh 3OYBA 1OGUB 3X28B 4FL6A 3JB9F 5GAN6 1Q86R 2KRSA 2OAWA 5CKFA 3PFSA 3M59A 1UTIA 5FW9A 3CCVQ 1IZ6A 1FMKA 4WCIA 4DA4A 3LH0A 2R5MA 3E19A 2JN0A 2CSIA 4AFSC 4MFEA 2O9VA 3PO3S 5A0DA 1H1PB 2D6FA 3C0CA 1W2BS 1YITA 1Y57A 2KYMA 3S3NA 4BXXX 2QQAA 1CSKA 3HL8A 4JS4A 4HT8A 2JS0A 4P5NA 1RAHB 4BCOB 2YWWA 4AKHA 2YDLA 1QW1A 1XJWB 3G33B 1QKXA 5IT9E 1TD6A 5FWCA 3CCQT 1Y07A 1AHJB 1VQOT 5HBEB 4M77B 4GBQA 2DEUA 1ZUYA 4MMLA 2F1LA 2KT1A 3S3OA 1JSUB 2PTKA 1VQ7Q 3CD6T 1SKUB 3CCVA 3EGUA 2RHXA 3NTKA 2COYA 5GMKe 1I07A 4M4ZA 4BCQB 1JJ2S 1YBYA 4F7UA 3CPWS 4DEYA 2PMIB 3GP8A 1VQNQ 4C8QG 2JZ2A 1AWOA 1LJOA 5KH6A 2QGFB 2HSPA 3M5AA 1HYOA 3OW2P 1YJ9T 5HK3A 1U1TA 2PVDB 1K73U 2AK5A 2ZPEB 3N5BB 3CXCS 4PFOA 4PJOF 2LQKA 1D0XA 3LYIA 4Z89A 4BCNB 3CMAA 2HBPA 1NYGA 2C5VB 1M27C 1K9AA 1TUCA 1VYUA 4FW1A 1WDXA 3UDCA 2CJMB 4R55A 3I55Q 3DDQB 1IHVA 1J3TA 3NTIA 4XAXB 1VQ7A 4IKFA 1X69A 1K8AR 1QCNA 4QVZA 4RTUA 2RJFA 3VS5A 1WGSA 4XK8E 1OKWB 3M4YA 2GTOA 1RUWA 4ZN3A 1ZP2A 3PE0A 2ZGWA 2DEQA 2ZPFB 5ICPB 4PJLA 3HBLA 2QA4A 3MPUB 2K4YA 2NUPB 2O9SA 4FW2A 4B6MA 1G3TA 3SD4A 5GANf 3CCQQ 1MHNA 2B8AA 1KSWA 3L2UA 1VQOQ 2GCXA 2M0YA 2FZKB 2X4YA 2MF2A 2RJEA 2I0NA 4LDXA 2EVRA 3J80E 2DJQA 2PU9B 4OMPA 1ZA1B 2LRQA 5KYUA 2BKZB 1UDLA 2X3WD 2EWNA 5EC7A 1BYMA 1KQ2A 3H4CA 2QAZA 2D0NA 3DLMA 4OR5B 3QJ6A 4EOMB 1AZGB 1YJ9Q 2EUFA 1OKVB 4G6LB 4M7AA 4F04B 4HKEA 1VQ8Q 3EG0A 2KE9A 4X9CA 2WPAB 2WFYB 2JOYA 5IHKA 3FLGA 4UC4A 1KD1R 2KI7A 1G3SA 2WSEE 2KXCA 4HNVA 1D1AA 3UATA 1Q82R 3CCQA 5LJ3h 2DVEA 2QDYB 1RLQC 2DXCB 2AIRB 4CI0C 3CD6A 1KC8C 4HLQA 4M77G 1UEBA 1H641 1H27B 1RADB 4EMKA 5IN1A 2L3PA 2LTOA 5DLOA 1CKAA 3VKHA 2W96A 2K9GA 3EG3A 2G3RA 1WIEA 2M9UA 1WHJA 2ZZDA 3PMTA 3PIOA 1H24B 1TS9A 2K5IA 3M0QA 3OYKA 1SRLA 3EOCB 2DXBA 3H8ZA 4NL2A 4FYXB 2X4JA 2HCKA 2QYZA 1T0HA 3VUZA 2ZPBB 3V8KA 3HZJA 3QYBA 1IGUA 5GAOr 4KULA 3OYFA 4OMLA 1WXUA 3MEAA 4M78B 3V8JA 2K3YA 1HXDA 2QASA 3GF5A 4E7LA 2L3RA 1QCFA 1SHFA 2HEQA 1B7TA 4F6UB 3LWHA 5KYYA 3EJ1B 3VYGA 3JAME 2DX1A 1QWEA 4HVUA 1D3BA 4M75B 5HKCA 4BY6C 2HKQB 3G4ST 1Q86U 1KHCA 3QIIA 2EQMA 4PFZA 1MMGA 5KYWB 2F69A 3KUFA 3CCJT 4HT9A 2AZSA 4ZN1A 2O4XB 3CMEA 1K8AC 2QDLA 4QVDA 5HQ0B 2KMGA 1Z9QA 4E7SA 3MP8A 3CC7A 4RTYA 2HSEB 2BZ8A 2O01E 2MWOA 2CP3A 2LP5A 2PUOB 1W4SA 4C8QA 4RTWA 2M1HA 3CCST 3K7AM 1O9KA 1G2BA 2ATCB 3VKGA 5LJ5j 3BE3A 2BZYA 3EG1A 4BD3A 2WXVB 1SRMA 1ZBJA 3TVTA 5FU7C 5CR2A 1Q81C 2EKHA 2LQ8A 1X6BA 2JGZB 5I2SA 2IIMA 5GAOn 4CRIA 1X27A 5GAN3 2MIOA 4M7DF 2EQUA 4CRLB 3BLQB 4XTWA 2DA9A 2P0PA 1LOJA 1F5QB 3WVDB 1WQ7A 2RA2A 1QKWA 1N27A 3CBMA 3PIPA 3JCMd 2CP0A 3M55A 2JT4A 4RODA 1OEBA 1YNZA 5LJ5d 4EOPB 4C92G 2E64A 3UA6A 1IB8A 4A4KA 3BDUA 1I1JA 3I5SA 1W1FA 2O31A 4OB3B 1ZUUA 1VQKQ 2FB7A 3SDZA 2UZLB 4A4HA 4PLIA 2V22B 2XU8A 2OAUA 4KGZB 5GANh 1K8AU 4J7FA 4AFUC 3BFMA 3S6WA 5CYIB 3M54A 1ZBXA 2GGRA 3OYNA 3BHVB 1BU2A 1UGPB 3CCSQ 4F17A 4C92E 2E41A 1EX4A 1QP3A 3OMCA 4D8DA 1M1KR 2DKGA 4KBMB 4BE0A 3NTHA 2QQBA 3ZL7C 7AT1B 4HCCA 2E3HA 2J6OA 2MI6A 1TXQA 3EGDA 2RO0A 2BIVA 3JCMe 3SB2A 1TFBA 1NPPA 1PWTA 3OS2A 1YI2T 1G3WA 1KQSS 3G4SA 4JS5A 3EHRA 1GUXB 1QCOA 4D6WA 2O2OA 5GAN4 3HFOA 3RIRA 2W9FA 1KQ1A 3CCJA 4JPBW 2X35A 3A8HB 1U3OA 4JX6A 4M77A 3ULRB 2RI3A 4ELLA 2LVMA 3RKWA 2CZ6B 3P8HA 2WJ9A 2QFZA 2L89A 2DZCA 4C92C 2KQWA 4GY5A 3PVLA 4OMNA 3GPLA 2FPDA 1WHGA 3H6ZA 3L1AA 4JJDA 5GAMh 4C0ZA 1KD1U 2DIGA 1BU1A 3SFMA 4AKGA 2COZA 4C5GA 1ABQA 3M56A 2IW8B 4MDXA 1Q82U 4M6VA 3BG9A 3Q1JA 4OMOA 1RLPC 1UJYA 3GNGA 1B3QA 3H0IA 4J9EA 2E3IA 2C06A 1FVVB 1H92A 4IMYB 3DTOA 1OQKA 4ELZC 4EMGA 1M3AA 4TTHA 4JUVA 1KJWA 3FEOA 3I5RA 1WPYA 5AT1B 1K1ZA 3TSWA 3DB4A 3QXEB 2DNUA 5LJ3g 1RACB 5CQYA 4M78F 3I9QA 4MFDA 1JRIA 2UZBB 5CKEA 4JRIA 1RAEB 4J9HA 1VQLQ 1KIKA 4F7SB 1OZ3A 2VV5A 5GAOp 1H1RB 3BG3A 3CC4A 5BNJB 1FKMA 3JCMW 4EORB 3M0SA 1YI2Q 2VVKA 3CCLA 1S1NA 4I3ZB 2NUPA 3VS6A 1Y71A 1IHWA 4YC3B 2HBWA 1JKWA 1LNXA 2K2MA 3KBGA 2GBQA 5GAN2 3DLLA 2MCNA 2DFUA 1OIUB 3BHTB 5FU6B 3E9GA 4BCMB 2RF0A 2Y90A 4BCGB 3QBYA 1QWFA 2VXFA 3RGFB 3M03A 2W10A 3G71A 3MEVA 2JXBA 2A08A 4JRPA 2R7GA 1ENWA 4E7HA 1YITT 1YJNA 3UPUA 4F7UE 2UZEB 3M58A 2V8KA 1VQMA 3OYYA 3EFSA 3RMSA 4Y91A 1QVFS 2NUTB 3VKIA 3QHRB 4AFZC 4IUTA 2LX7A 1UGVA 1QVPA 5CKHA 2WEVB 1OZ2A 4OGEA 3GTMS 1M1KC 3HRTA 1OIYB 4F6WB 4CFNB 1UNLD 1AT1B 1YJWT 1G8XA 4C92A 1U8RA 2DXCA 3OYLA 3VV0A 1WZOA 3SWNB 2CREA 3JB9G 1ZSZB 1E6HA 2DF6A 4GLKA 1WJSA 3GIBA 2QQSA 3BLRB 4LDVA 4II5B 2LC4A 2DXUA 2KDSA 3NPFA 1IGQA 4E7JA 2F5TX 5GMKi 4EOKB 4K11A 3OYMA 3MHXA 3JRZA 3CMAT 2EYWA 2F2CA 3E1SA 4ROEA 2MK5A 3WXMB 4OGRB 4BE1A 2HZYA 4EOSB 1I81A 2C0OA 2DBKA 2C0IA 2E5KA 1OU9A 1UB4A 2DILA 4J9CA 4C92D 2DL3A 2BKDN 1YFNA 1YITQ 4EPCA 2LZ6B 4JZ4A 4PJMA 2PVGB 1BCOA 3OA6A 2QA4T 1ABOA 1D1CA 2OTJT 1B34A 2RJCA 2RQRA 1M1GA 2E1HA 2HKNA 1VQ4A 4M7AE 2F2WA 2GQVA 1E9HB 3M0TA 3PVQA 2O4XA 2OTLA 3OY9A 3SEMA 3FC3A 1M1KU 4KH1B 1GL5A 2QEXA 3D7SB 2HD0A 2DD4B 4OF1A 4LE9A 2RD1A 4V2SA 3VRYA 4EOQB 4LD9K 1YJWQ 3TQ7P 2B86A 5IXBA 1TUDA 4PJOG 4JJCA 1ZHIA 1UG1A 1FMWA 4N0AC 1K9MR 5M9OA 4HCKA 4XTZA 3JCMJ 2FZCB 1GY3B 2VGNA 1VQ9A 1H28B 3DDPB 5FROA 3URGA 2QQRA 1D1BA 4UN0A 3MY1B 5IDNB 4QQGA 4M7AC 1YCSB 2CS7A 3VS3A 1KC8R 1PM3A 2CUDA 2L3SA 2IN3A 1RI9A 3CMAQ 4BY1X 1N6AA 1N8RC 3DOGB 2RHIA 4PJOE 1E6GA 1JXMA 2GFAA 1NE8A 3PNWC 2WSCE 2DK3A 4OB0B 2QQ9A 3REAB 4LN2A 1YJWA 1X2QA 1WI7A 2XD0A 2CP6A 4HCZA 4CFUD 3QHWB 1X01A 1WX6A 1M5Q1 3QSUA 1JO8A 4FM4B 4HA8A 1UNHD 2EGCA 5GAMg 3TSZA 2WACA 3BG5A 3UWNA 1QVGS 4EMKC 1AVZC 3OYAA 2QA4Q 8ATCB 2FPFA 1OPKA 3J7AF 5GMKl 2KSSA 1FXXA 1M90C 1RAIB 1YHQT 3T9NA 2CT4A 4PJOC 1N4MA 3EG9A 4M7DB 3JCMf 4DOWA 4C8QE 1BCMA 1M2VB 4QW2A 1SSHA 5LJ5f 1AD5A 2KRNA 2O88A 1ZLMA 1GRIA 4LDUA 3LGLA 4A4EA 2DE0X 1C0MA 4F14A 1VIEA 2DPPB 3O5ZA 4DBFA 3C4SA 4J5YA 4FSXA 4RCBA 1YN8A 3QJYA 3CMET 2OTJA 4MZTA 5I2MA 3CCEA 1RL2A 2DZ9A 2FRWA 2DMEA 2DTHA 5FWBA 1DJ7B 3CC7T 4R56A 1H4LD 1T3LA 4RTXA 3GNFB 1KG1A 2QXFA 2CZ7B 2DTOA 3EGXA 2E6ZA 2X1NB 4BCKB 2KBTA 1Q81R 5J3BA 4C8QC 1QMZB 3CD6Q 3OBWA 3ZFJA 2HQXA 4FX3B 2FYKA 4N0AA 2IW9B 3VS1A 3OW2S 3ZEHA 3FJPA 5FLXE 4LUEA 1GBRA 1G5VA 4PJNA 1PNJA 2NYSA 2K3BA 2PUKB 4FT2A 1ACMB 5D6YA 4QQDA 4KT0E 2LJ3A 2KR6A 2A0FB 2LJ0A 3QUIA 2FG0A 3EFOB 4E7IA 2RHZA 4HNTA 2ROLA 2JM9A 2BS4A 5D6XA 1ZX6A 2DL4A 2M16A 3G7ZA 1K9MC 2EIFA 3OYGA 5KE3A 1RAAB 4BI3A 3HHTB 3LH5A 2RQTA 1VA7A 2DVJA 2LW4A 2X4WA 4ZTJA 1BI1A 2KK4A 2L5QA 4PJJA 5ECAA 2RN8A 4ANJA 1JBMA 2OJ2A 5A0LA 2ZPHB 1TTHB 5CCAA 1JSTB 4RUGA 1NEBA 3VS7A 2C4GB 1JEGA 3FB9A 1AZEA 5CAIA 3V7SA 2V1RA 5GAOl 5J26A 3MEWA 3CMEQ 4M7AD 1P5EB 2C5OB 5LJ3d 4BBSM 2RM4A 3GLXA 4A53A 3CC7Q 3MIAB 4PJOA 1YHQA 2YLCA 1AISB 1EFNA 4AKIA 4J6XA 4D8KA 4M77E 5KYXB 1D3UB 2J7IA 3AHUA 3QWYA 4OB1B 4MZPA 3B57A 3NFCA 1OL1B 4M7DG 2EBPA 1W2BA 1WA7A 3F70A 1V29B 5IAYA 3JCMP 2PJQA 3QWLA 2XHCA 4Z6YA 5ACBA 1PRLC 3TNWB 4EIKA 1UECA 2FZGB 4J9IA 1AWWA 4DQ2A 2VGMA 1QP2A 4WF2A 1X43A 3JB9J 1XO2A 1SPKA 2RHUA 2KR3A 1K9MU 2PQWA 4PJOD 3HFNA 2CGHA 2K2VA 4FT4A 4M77C 4M7DE 1MNEA 1VOLA 1SF9A 4CFMB 4C0DB 4RTVA 1ZA2B 1JJ2A 3EFRA 3HP9A 2YLBA 1H8KA 3CPWA 4GLMA 3CCUT 1KC8U 1IXDA 2PHGA 2LNVA 2XDPA 3P8BB 2ZAEA 1PRMC 2LQWA 3I56A 2YRVA 4XTXA 3CC2T 4BCPB 3HB9A 3QZ9B 5CQXA 3TCJA 5EJCA 1ZUKA 4J7IA 1AWXA 4CFXB 3CXCA 2EJ9A 1NJIR 1TG0A 4IUPA 4F16A 3DL1A 3CCRT 1HSQA 3L2ZA 4R0KA 4JLIA 1WNLA 2MWPA 1FWZA 1V1CA 2E4HA 4BBRM 3JCMh 3QG1A 4HVVA 5LJ5h 4C8QD 1UHFA 3A8OB 1ARKA 3CC4T 4C0FA 5LL6S 3JCMX 4KRCB 1OU8A 4PNOA 5DM7R 1H3HA 5DY9A 5HBJB 5HVYB 5I11A 3DJBA 3CCLT 5EFQB 3G4SQ 4Z8AA 3GBQA 4EONB 1JOWA 3CCJQ 4BCFB 4F7LB 2YHTA 4J9DA 3L2WA 2IVXA 1K4US 3CEYA 1N5ZA 2RMOA 3HO8A 3RKXA 4LUDA 1SHGA 3OYIA 2CCHB 3QDFA 5GMKm 2DD4A 4AFQC 2VUBA 4N4IA 3G71T 2YSQA 2DO3A 3TW7A 2XMFA 2Z0WA 2V8JA 2DD5B 4AG1C 1GFCA 3OBYA 1YJNT 1XNIA 5C0MA 3OYEA 1VQMT 3CCUQ 2QGSA 2JVVA 4PL6A 3LW5E 2DTIA 2V8IA 1M8MA 4M78G 3OB9A 1K0XA 2WIPB 4KUDK 2P0KA 4FIBA 5LJ5e 5FRNA 2E70A 1WHKA 1Q81U 2HDAA 1V76A 2R5AA 3QO3A 3MO8A 4M75G 1TUGB 1M30A 2P84A 2K57A 1MMAA 1NLPC 1D0ZA 1Y96B 1I5OB 2LNHB 1U06A 3QPHA 4M78E 4Y28E 6AT1B 4DEXA 2AZVA 3CC4Q 4XU0A 2J05A 3ASKA 4BI8B 2VXEA 3CCUA 4E7KA 2IW6B 1YWPA 1JB0E 2L3QA 4M75E 4ATOA 3CCLQ 4OB2B 4F70B 2K79A 2EW3A 3CC2A 3JV3A 1TOVA 4Z88A 3J81E 4OP0A 5KYUB 2C6TB 2I53A 2FPEA 2SRCA 1SSFA 4RTZA 2CT3A 2G77A 3CCRA 3EH2A 4MMKA 5CVIA 2D8HA 4M7DA 5D6WA 5AYFA 1B07A 3M53A 2LX9A 4M77D 5GAMd 1LPLA 3G71Q 3L42A 1HD3A 4E7ZA 4M78C 1RABB 2ESWA 5GAN7 1YJNQ 1NJIC 3RUXA 3QDRB 4FYWB 5GAN8 3M9QA 4MZMA 4BCQD 1VQMQ 2DXTA 4CFWB 4M75C 2AT1B 4IUUA 5IHIA 3JCMQ 3FRNA 1VQ4T 1H3ZA 2QTXA 2XIDA 5HNBB 2QTVA 2HQEA 2QGGA 2OTLT 3QZ5B 2QI2A 2LCSA 4QVCA 2QEXT 1G3NC 1AD6A 2YUPA 2JNGA 4AG2C 5GAOm 4F7JB 4XU2A 2GQIA 2EFIA 1M8VA 2K6DA 3F5XB 2WHBB 2W99A 1Q7YC 4BCND 2DERA 4EC8B 3LLRA 3OYHA 4OGCA 4M7DD 3MY5B 4FCYA 1RAGB 1ZQ1A 4OVAA 4AT1B 3X20B 1D09B 3THKA 1NM7A 2MYSA 1N8RR 2W9ZA 2V1QA 5GAN5 2JW4A 4X34A 4IURA 4IIMA 1VQ9T 5C6SA 4JJNK 2GTJA 3C95A 2FHDA 2OI3A 1WXTA 1X6OA 1S72T 2LDMA 2KROA 3R6NA 5KYYB 4EOOB 4PFPA 3BDLA 1OPLA 2B9RA 1OX9A 1TU0B 3QYEA 4TVRA 2NWMA 4FSSA 1D3BB 2KEAA 3INZA 5I21A 4KRTA 1PSEA 4L6V5 1RI0A 2PK9B 3V8LA 1OI1A 4LDWA 1BIAA 2NLUA 1M90R 2CYZB 3UA7A 3TNIB 3HKSA 1OI9B 3GOXA 1PD0A 1NJIU 4BDZA 2CZ1B 4Y92A 1IREB 2J06A 2E12A 8AT1B 4NS5A 2EGAA 2KAFA 1VQ4Q 2YRCA 3TN8B 1C9BA 1AWJA 1O9KB 1NPRA 2VYTA 2OTLQ 4F7UF 1BI3A 1PG5B 2QEXQ 1N9RA 3WVEB 4QT7A 1XQHA 1TH7A 2K7AA 1NLOC 3OQ5A 1Y7XA 1UHCA 5KYXA 3TNHB 2FVUA 1WLPB 2A37A 3L2RA 4M78A 2P4TA 1W2BP 1E7PA 4BB7A 2VC8A 4J9FA 5I5ZB 2ZCFB 5GMKj 1PCXA 3LQ5B 1XOVA 4M75A 1VQ9Q 4MIMA 2AKKA 4DOVA 1N9SA 4DBHA 5LJ3f 1QLBA 1KQSA 3CCET 2RQWA 1ZSGA 3V7RA 5KYWA 2CP5A 2H3JA 4PLLA 1BB9A 4XTVA 1GCQA 3E2UA 4E47A 3KXTA 4LNPA 4EOLB 4OMQA 3TEEA 4PK4A 2BPMB 4ORZA 3PMIA 5GANg 4BUGA 1VQ5T 5KYNA 1JJ2P 2BUDA 1VQ6A 5EG2A 3OS5A 2CKKA 3CPWP 4WTOB 2PK2A 1M3BA 2YUOA 1K73C 3LGFA 3NMZC 5IXFA 2LJ1A 1SEMA 2BE7D 2X3XD 2H3EB 4M78D 1UFFA 4BACA 3AT1B 3JB9I 4ZGJB 3DKMA 4HXJA 2A3LA 1YP5A 3VU3C 4LDYA 4HCBA 5HCKA 3CXCP 4HVWA 4M75D 1MV3A 1W98B 3I55T 2RJDA 4BCJB 2C0TA 5A2QE 5CK9A 2KMTA 2EQKA 3H9NA 2RPNA 5CIUA 3EIDB 4ELYC 3QWXX 3CCMA 1S72A 3EGDB 4BY6B 5DQWA 4QSHA 3MKDA 4NL3A 1KXUA 2E10A 2LT1A 4N4GA 4M7AF 1OL2B 1WHMA 3META 1GFDA 5KE2A 5GJWB 2ZPGB 2JMCA 2P0QA 1CKBA 3EG2A 1M3CA 3EAEA 2CUBA 3QYHB 2QF7A 2GNCA 1LVKA 2ED0A 4JX4A 4YTLA 2OTJQ 2DYIA 3CCEQ 5HK0A 1C1AA 3KHIA 2KT8A 4J83A 2PNIA 4AI6A 2L0AA 1K0SA 2BS3A 4IUVA 2D9TA 3NDQA 3HSBA 2CP2A 1VQ5Q 4BE2A 5FU7B 5A0GA 2DRKA 2KGTA 3HRUA 4X9DA 1D0YA 5FU6C 3CQTA 1VUBA 2MAMA 3EH1A 5CKBA 1VQ8T 3JCMc 3TW6A 4ROCA 2DD5A 2ZPIB 4A63B 3A8GB 4O6JA 3VYHB 1T0JA 4KH0B 1W6XA 3EHQA 2YUNA 1C6VX 1M4ZA 1QVFA 2VKNA 2RK1A 2EQJA 1GUXA 3TU4K 2LCLA 4RG8A 4YOOA 4KRDB 4OMFB 1N8RU 4E2FB 3OS0A 4JDSA 1VQNA 2DETA 2CH4W 4EOIB 3C12A 2NUZA 1VQ5A 2M0OA 5FGKB 1MMNA 1AOJA 3MJXA 5IHNA 2KRMA 4IUQA 1Y96A 2E5QA 2QG9B 3JB9H 2GF7A 2RI2A 3SWNC 2XI9A 2I2LA 3I56T 1ZSZC 1JXOA 3CBPA 4C8QF 1HK9A 3ZBDA 3RMQA 2EYQA 2K5FA 5LJ3j 2YT6A 1MNDA 4C0GA 1T3SA 3MEUA 1VINA 4BCIB 3I55A 1GXIE 5IHYA 3BLHB 2KXDA 1M90U 3BHUB 1YHQQ 2BE9B 2R58A 1NZ9A 3X26B 4BY7X 3A8LB 3MCAB 1H1SB 5GAOq 1Q86C 2EJGA 2LCCA 1U1SA 4RTTA 3C94A 3JB9D 2CH4A 2VWFA 1PKDB 2DAQA 2BZXA 4PKCC 4BCHB 2X4XA 2EKOA 3X24B 3VS4A 2DL7A 4FYVB 2A28A 3E9FA 2RK2A 1UNGD 2HNIA 1VQOA 2VASA 1VIFA 3A8MB 2COWA 3RBBB 4C92B 1FX7A 4J6YA 2MOXA 2K5LA 4L5GA 1H25B 5LMKB 2G6FX 5GAMf 2FEIA 1HJDA 2BS2A 2H8HA 4XU1A 4QQ6A 3G1JA 1OOTA 1UGSB 1UJ0A 4DBRA 4NOYA 4LD6A 4VUBA 3P8DA 1PC0A 4KGVB 5IH2A 3M57A 1YJ9A 2G9XB 4ZGDB 1F1BB 2E65A 2FO0A 1VQ8A 2LT4A 1BI0A 4EOJB 1KK7A 4AMCA 4EDUA 2X9HA 3H0FA 3I56Q 2DL8A 3S3MA 2Y4XA 3RERA 3ME9A 3POMA 2FL7A 5I22A 1M9SA 2JTMA 4RKUE 2NUTA 4FU6A 2XG8D 2D0QB 1NG2A 3OSSC 1A0NB 3U23A 1LCKA 2JUFA 4RG2A 1H1QB 2DJZA 1WQWA 5LJ3e 4CC3A 2J6FA 2BTTA 1UGQB 1G83A 3HRSA 1B34B 1Q95G 3RDVA 2XKOC 1VQKT 2DIQA 4B9XA 4BCMD 3JSCA 2CZ0B 2XDDA 2IVWA 3SWNA 4ZNXA 4Y72B 4J9GA 1ZSZA 2GFUA 2HMAA 3CBOA 1QVGA 4M77F 4CC7A 2DBMA 4MDWA 5IF1B 2YRDA 1R0BG 2FRYA 1R0CB 1TSFA 1UGRB 2CCIB 4F7NB 1OULA 3L2QA 3FIFA 4CFUB 4J6WA 2HL3A 1YWOA 2CP7A 2LMJA 2RB6A 1EIFA 1OYXA 4C5EA 2LQNA 4ZGEB 4JRQA 1QMCA 4C5HA 5DQVA 1NBEB 3OYCA 4BDYA 3TREA 5LQFB 4J9BA 4M7DC 1AEYA 2RQUA 2C5NB 1KHIA 3OMGA 5CEIB 4A54A 5GJVB 3L2VA 1QQJA 3RESA 3OSVA 3QYGB 1WJRA 2V26A 1KQSP 4NC6A 5GANj 1Q7YR 3PTAA 2RHYA 4RMOA 1M1FA 4ESRA 1RAFB 2JMAA 5D7UA 4F7UB 1KD1C 4BI4A 4Q5WA 3RKYA 1NYFA 5FRMA 1FMVA 1PKTA 1K76A 1Q82C 4C5IA 1IRXA 1SG5A 2E6NA 3A5ZB 2EYZA 2D1XA 2JS2A 4OMMA 2ROTA 1XTDA 3OW2A 4JJBA 2YUQA 4JLGA 1OX8A 3FJ5A 4YOSA 3O0GD 1UE9A 4KGXB 1O75A 3EG9B 3PGGA 1M2OA 3VS2A 5GANd 3CC2Q 1UUEA 4YOZA 1VQLT 4HNUA 4QKUA 2HAXA 1X75C 3M0RA 3CCRQ 2W0ZA 1BKBA 5GAMj 5L8RE 2D8JA 3G6ET 1JU5C 1GH6B 1BK2A 2MPXC 3MP1A 1QLYA 4Z02A 4B9WA 3KFVA 2JM8A 5KCHA 1VQKA 3O8VA 3VS0A 2EJFA 3HTRA 1MUZA 4ELJA 4EC9B 3EGXB 2ECZA 2R57A 3FDRA 3ER0A 2QQ8A 2VB6A 2IG0A 4C92F 1EZZB 4X1VA 2W2HA 2DL5A 2DYBA 3QKJA 2WSFE 1URCB 3CCSA 3V7CA 2ED1A 3CPFA 5GANe 2F5KA 1YCYA 2RQVA 2C5XB 3UF4A 1MV0B 1BI2A 1MGQA 2A7YA 2F2XA 2YXYA 5HBHB 4EMHA 1IO6A 1OV3A 1I0CA 4JRKA 2KNBB 2P4RA 5L23A 2Y4YA 4M7AB 4KUIA 1M2VA 2KY9A 2RNAA 1WFWA 3M0PA 4L59A 2JTFA 2SEMA 1QVFP 4XQ3A 2JTEA 3LWIA 3NHNA 1BIBA 2EAYA 3BY7A 2DRMA 1K73R 3VRZA 1P92A 1VOMA 4A4GA 3JCMV 4II1A 2AKLA 1G3YA 1GCQC 3IQLA 3VUBA 2KYBA 1VQPT 1VQ6T 4EMKB 4M75F 1TWBA 1YIJT 1VYTA 4RCCA 1R8OB 3R6OA 2ZZDB 4LXCA 3G6EQ 2AHJB 3PT9A 4F7UG 4A4FA 2RH2A 2DXBB 4C0DC 3NGPA 4F6SB 5GAMe 2EQIA 2EYYA 3OS1A 4IIOA 1R77A 1X2KA 4PJOB 3REBB 1WJQA 3UT1A 1I8FA 2JJ9A 2HQHA 2J6KA 2CDTA 4JX5A 4XTYA 2EYXA 3EFOA 2HL5C 3CCMT 3VJPA 5J39A 1U5SA 2PZ1A 2DM1A 1VQLA 3VYGB 4N4HA 9ATCB 5KCOA 3M0UA 3I35A 5IDPB 2DLPA 2IPOB 1FINB 1BBZA 5HY6A 5CO7A 1WYXA 3G6EA 5CKDA 2EGEA 1YI2A 2QK0A 2WMBB 2KVQG 1E7OA 1H26B 2A36A 1PSFA 3M4GA 2DMOA 3OYDA 1VYWB 2QDJA 1W70A 4O5VA 1KFZA 2ENMA 4E6RA 3CCVT 4C8QB 1WXBA 2CSQA 1I4K1 4XTUA 3H41A 3BW1A 1NEGA 2F2VA 3A98A 4NSTB 4CFVB 2XDBA 2WMAB 2WIHB 2PVOB 3OYJA 3MI9B 1VQPQ 2M51A 1VQ6Q 1YIJQ 1PHTA 1MMDA 3HPWA 3X25B 3DB3A 3RNJA 3JCMg 3H0HA 1Q7YU 4ME7A 1PKSA 2XK0A 4CC2A 5DLQE 3RR6A 2OX7A 1X6GA 5LJ5g 2ABLA 1WHHA 1GBQA 4JZ3A 4ZTFA 1FYNA 4XU3A 2L8DA 2L2PA 2RI5A 2UZDB 1WHLA 4M7AG 2M02A 1I5LA 1Z9ZA 2X51A 4CXAB 2XICA 3A1PA 3QHSA 1VQ7T 4FYYB 2K3XA 3SHWA 1VYVA 2EPDA 3CCMQ 1S72Q 4LOCA 1VQNT 1GCPA 4HL4A
chains in the Genus database with same CATH topology
5EJCA 3QXEB 2RI2A 3DB4A 5LJ3g 4J7IA 4M78F 5CQYA 3SWNC 1VQPA 3CXCA 2EJ9A 2XI9A 2I2LA 4J8OA 3I56T 4MFDA 1JRIA 3LX7A 1YIJA 4IUPA 3CBPA 4JRIA 5CKEA 3DL1A 3CCRT 3MP6A 4C8QF 1HK9A 3L2ZA 3ZBDA 4JLIA 1O9SA 1WNLA 1OZ3A 1FWZA 2MMPA 2MWPA 3RMQA 3JCMb 2VV5A 2EYQA 2K5FA 5LJ3j 4BBRM 5GMKh 5GAOp 3JCMh 3BG3A 3OYBA 3CC4A 4C0GA 3MEUA 3QG1A 3I55A 1GXIE 3X28B 1FKMA 4FL6A 3JCMW 5LJ5h 1M90U 4C8QD 3JB9F 5GAN6 3A8OB 2R58A 1NZ9A 5CKFA 3CC4T 3PFSA 4C0FA 3X26B 3A8LB 3CCLA 3MCAB 5LL6S 3M59A 3JCMX 1IZ6A 4PNOA 5DM7R 1Y71A 5GAOq 4DA4A 3LH0A 2R5MA 1Q86C 3E19A 2EJGA 2JN0A 5DY9A 3JB9H 2LCCA 1LNXA 1U1SA 3KBGA 4MFEA 3C94A 3JB9D 5GAN2 5A0DA 3DLLA 3CCLT 2DAQA 2D6FA 5FU6B 3E9GA 4PKCC 2Y90A 2X4XA 1W2BS 3QBYA 2EKOA 1YITA 3X24B 3S3NA 2VXFA 2YHTA 2QQAA 3E9FA 2RK2A 3L2WA 3HL8A 3CEYA 4JS4A 3RKXA 3HO8A 2HNIA 3G71A 3MEVA 4HT8A 3OYIA 4P5NA 4JRPA 4E7HA 5GMKm 4AKHA 1VQOA 1YITT 2DD4A 1VIFA 3A8MB 1QW1A 4C92B 1YJNA 1FX7A 4J6YA 4F7UE 3UPUA 2K5LA 3M58A 2V8KA 2VUBA 5IT9E 4N4IA 1VQMA 3G71T 3CCQT 3OYYA 2DO3A 3EFSA 4L5GA 3TW7A 1Y07A 2V8JA 1AHJB 2DD5B 3RMSA 4Y91A 1VQOT 1QVFS 4M77B 3OBYA 1YJNT 4MMLA 1XNIA 3VKIA 5GAMf 5C0MA 3OYEA 2BS2A 4IUTA 4XU1A 4QQ6A 3S3OA 1VQMT 2JVVA 1UGSB 1QVPA 4PL6A 3CD6T 5CKHA 1OZ2A 3LW5E 2RHXA 4OGEA 3CCVA 3NTKA 5GMKe 1M1KC 3HRTA 2DTIA 4NOYA 2V8IA 4LD6A 4M78G 3OB9A 3P8DA 4VUBA 1JJ2S 4KUDK 1YBYA 2P0KA 4FIBA 3M57A 1YJ9A 4F7UA 4ZGDB 5LJ5e 3CPWS 2E70A 5FRNA 1Q81U 2E65A 3GP8A 4C8QG 2R5AA 1VQ8A 2LT4A 2JZ2A 1BI0A 1YJWT 1LJOA 3QO3A 4C92A 4EDUA 5KH6A 1U8RA 3MO8A 4M75G 2DXCA 3M5AA 1YJ9T 3S3MA 2Y4XA 5HK3A 3RERA 1U1TA 3OYLA 2PVDB 3VV0A 3ME9A 3SWNB 2FL7A 3JB9G 2K57A 1K73U 1M9SA 2JTMA 4GLKA 1WJSA 4RKUE 2ZPEB 3GIBA 2QQSA 3N5BB 3CXCS 4PJOF 2LQKA 4FU6A 4LDVA 2XG8D 1Y96B 2D0QB 3LYIA 2LC4A 2DXUA 3CMAA 2HBPA 3OSSC 3QPHA 4M78E 2KDSA 2JUFA 4Y28E 2F5TX 2DJZA 4RG2A 4E7JA 5GMKi 1WQWA 5LJ3e 4XU0A 3UDCA 3OYMA 4R55A 3ASKA 4BI8B 3MHXA 3JRZA 1UGQB 2VXEA 3NTIA 3HRSA 1B34B 4XAXB 3CCUA 4E7KA 1VQ7A 3CMAT 4IKFA 2XKOC 3E1SA 1VQKT 1JB0E 2DIQA 4M75E 4QVZA 4B9XA 4BE1A 3JSCA 2CZ0B 3WXMB 2XDDA 4ATOA 4OB2B 2IVWA 1I81A 2RJFA 3SWNA 1WGSA 4XK8E 3CC2A 2GFUA 3CBOA 3M4YA 1QVGA 3J81E 4OP0A 4ZN3A 4M77F 2ZGWA 2DEQA 2ZPFB 4MDWA 3HBLA 4C92D 1UB4A 2QA4A 2BKDN 1SSFA 2K4YA 1UGRB 3CCRA 2G77A 4MMKA 5CVIA 4EPCA 4M7DA 5D6WA 5AYFA 3L2QA 3FIFA 2PVGB 2LX9A 3M53A 1G3TA 4J6WA 2RB6A 4M77D 3SD4A 5GAMd 5GANf 1EIFA 1OYXA 3OA6A 2QA4T 1MHNA 3L42A 4C5EA 1B34A 2B8AA 2RJCA 2OTJT 4ZGEB 4M78C 3L2UA 4JRQA 1M1GA 2E1HA 5GAN7 4C5HA 1VQ4A 2GCXA 3RUXA 3QDRB 1NJIC 4M7AE 2X4YA 2GQVA 2MF2A 5GAN8 2RJEA 3M9QA 4MZMA 3OYCA 4LDXA 4BDYA 2DXTA 3TREA 3J80E 2O4XA 4M7DC 2OTLA 3OY9A 1KHIA 3FC3A 3OMGA 1M1KU 2PU9B 4M75C 4A54A 2LRQA 4IUUA 2QEXA 3JCMQ 2HD0A 3FRNA 1VQ4T 1H3ZA 3L2VA 2DD4B 2QTXA 2XIDA 4OF1A 2HQEA 2RD1A 3RESA 2OTLT 3OSVA 4V2SA 3QYGB 3QZ5B 2QI2A 4LD9K 4QVCA 1WJRA 2EWNA 2QEXT 4NC6A 5GANj 1BYMA 4PJOG 1KQ2A 3H4CA 1ZHIA 3DLMA 3QJ6A 2JNGA 4M7AA 5GAOm 3PTAA 4HKEA 4N0AC 4XU2A 2EFIA 4X9CA 1M8VA 2JOYA 2RHYA 4RMOA 3FLGA 4UC4A 5M9OA 1Q7YC 1M1FA 1G3SA 2WSEE 4XTZA 3LLRA 3OYHA 3JCMJ 4OGCA 4M7DD 4HNVA 2VGNA 1VQ9A 4F7UB 1KD1C 1ZQ1A 5FROA 3URGA 2QQRA 4BI4A 4Q5WA 2DVEA 5LJ3h 3CCQA 3RKYA 4OVAA 3X20B 4M7AC 4QQGA 5FRMA 2CS7A 2QDYB 2DXCB 1Q82C 4C5IA 5GAN5 1VQ9T 4X34A 4IURA 4CI0C 2E6NA 3A5ZB 1N6AA 3CD6A 5C6SA 1N8RC 1KC8C 2RHIA 4HLQA 4M77G 1UEBA 4JJNK 4PJOE 2GFAA 1XTDA 3OW2A 1H641 1NE8A 4EMKA 5IN1A 2LTOA 4JLGA 3PNWC 5DLOA 2WSCE 3VKHA 2FHDA 3C95A 2DK3A 4OB0B 2QQ9A 1X6OA 2G3RA 1S72T 2M9UA 2LDMA 1YJWA 2ZZDA 3PMTA 3PIOA 3BDLA 2K5IA 1O75A 4HCZA 3PGGA 3OYKA 2XD0A 3QYEA 1X01A 4TVRA 1D3BB 1M5Q1 3QSUA 3INZA 5GANd 4FM4B 2DXBA 4HA8A 5GAMg 5I21A 2WACA 1PSEA 3BG5A 3H8ZA 4L6V5 4NL2A 3UWNA 1RI0A 1QVGS 4EMKC 2X4JA 4HNUA 1VQLT 3V8LA 1OI1A 2HAXA 1X75C 3OYAA 4LDWA 3VUZA 1BIAA 2NLUA 2ZPBB 3V8KA 2CYZB 3HZJA 1BKBA 3HKSA 3QYBA 3J7AF 5GMKl 5GAMj 5L8RE 3GOXA 5GAOr 1NJIU 4BDZA 2KSSA 4KULA 2CZ1B 1FXXA 3OYFA 1M90C 3MEAA 4M78B 3V8JA 1IREB 3G6ET 1YHQT 2K3YA 3T9NA 1HXDA 2E12A 3MP1A 3GF5A 4NS5A 2L3RA 4Z02A 4E7LA 4B9WA 3LWHA 2KAFA 4PJOC 5KCHA 1VQKA 4M7DB 3VYGA 3JAME 1NPRA 2VYTA 3O8VA 3JCMf 1D3BA 4M75B 2EJFA 5HKCA 4BY6C 4DOWA 4C8QE 4F7UF 4ELJA 4QW2A 1BI3A 3G4ST 1Q86U 1KHCA 3QIIA 1N9RA 2EQMA 2R57A 5LJ5f 3FDRA 2F69A 3ER0A 3WVEB 2QQ8A 1XQHA 1TH7A 2IG0A 4C92F 3KUFA 4LDUA 3LGLA 3CCJT 4HT9A 3OQ5A 1Y7XA 4A4EA 2O4XB 4ZN1A 3CMEA 1K8AC 4QVDA 2KMGA 3QKJA 2WSFE 3MP8A 1VIEA 2FVUA 2DPPB 3CCSA 3V7CA 3L2RA 3CPFA 4M78A 5GANe 3CC7A 2P4TA 3C4SA 2F5KA 4J5YA 1YCYA 4FSXA 1E7PA 4BB7A 4RCBA 2O01E 2MWOA 1BI2A 1MGQA 3QJYA 2PUOB 2A7YA 3CMET 1W4SA 2VC8A 4MZTA 2OTJA 5I2MA 4C8QA 1RL2A 3CCEA 4EMHA 2DZ9A 2ZCFB 5GMKj 2DTHA 2M1HA 3CCST 1DJ7B 3CC7T 4R56A 1XOVA 4JRKA 3GNFB 1KG1A 4M75A 2QXFA 2CZ7B 4MIMA 2Y4YA 4KUIA 4M7AB 3VKGA 4DOVA 1N9SA 5LJ5j 2KY9A 2DTOA 5LJ3f 1QLBA 1KQSA 2E6ZA 3CCET 3V7RA 4BD3A 2H3JA 4L59A 4PLLA 2JTFA 5J3BA 4XTVA 4E47A 3KXTA 4C8QC 3TEEA 3OBWA 4XQ3A 5FU7C 3LWIA 3ZFJA 2HQXA 1BIBA 5CR2A 1Q81C 2EAYA 3PMIA 2LQ8A 2FYKA 4N0AA 5GANg 3BY7A 4BUGA 1VQ5T 3OW2S 3ZEHA 5I2SA 3FJPA 5FLXE 1G5VA 2BUDA 5GAOn 1P92A 2PUKB 3OS5A 5EG2A 4CRIA 1VQ6A 4A4GA 3JCMV 2CKKA 4II1A 4FT2A 5GAN3 5D6YA 4QQDA 1G3YA 4KT0E 2KR6A 1K73C 3QUIA 4M7DF 3LGFA 2EQUA 3VUBA 1VQPT 4XTWA 1VQ6T 4EMKB 4M75F 4M78D 1YIJT 4RCCA 2P0PA 1LOJA 3WVDB 1R8OB 1WQ7A 3R6OA 4BACA 4E7IA 2RHZA 4HNTA 3JB9I 2ZZDB 2BS4A 4ZGJB 1N27A 2RA2A 3DKMA 2A3LA 2M16A 5D6XA 3CBMA 3G7ZA 3VU3C 1K9MC 2EIFA 3PIPA 2AHJB 5KE3A 3JCMd 3OYGA 4LDYA 3PT9A 4BI3A 3M55A 4A4FA 4F7UG 4HCBA 3HHTB 2RH2A 4M75D 2DXBB 4C0DC 3I55T 2RJDA 5GAMe 5LJ5d 3OS1A 5A2QE 4C92G 2E64A 2KMTA 5CK9A 2EQKA 4A4KA 4PJOB 2X4WA 3BDUA 4ZTJA 5CIUA 4ELYC 1BI1A 2KK4A 2L5QA 4OB3B 1WJQA 3UT1A 3CCMA 1S72A 2FB7A 3SDZA 4BY6B 4QSHA 1I8FA 1JBMA 4A4HA 5A0LA 4PLIA 2ZPHB 2XU8A 5CCAA 4NL3A 2OAUA 2E10A 4JX5A 2LT1A 4N4GA 4XTYA 4M7AF 5GANh 1K8AU 3CCMT 4J7FA 3META 3VJPA 5J39A 3FB9A 3BFMA 5CAIA 1VQLA 5KE2A 3VYGB 4N4HA 3V7SA 5KCOA 3S6WA 5GAOl 5J26A 2ZPGB 3MEWA 2P0QA 1ZBXA 3M54A 3OYNA 4M7AD 3EAEA 5LJ3d 4BBSM 1UGPB 2RM4A 3GLXA 4A53A 3QYHB 4C92E 5HY6A 2QF7A 2E41A 5CO7A 4PJOA 1QP3A 3OMCA 3G6EA 1YHQA 4JX4A 2DKGA 2YLCA 4KBMB 4YTLA 5CKDA 4BE0A 3NTHA 2QQBA 1YI2A 4HCCA 4AKIA 5HK0A 2MI6A 4J6XA 2KVQG 3KHIA 2RO0A 2BIVA 4J83A 4M77E 3JCMe 3SB2A 4AI6A 1NPPA 1PSFA 3M4GA 3OYDA 2QDJA 2BS3A 3OS2A 3AHUA 4IUVA 4O5VA 4OB1B 1YI2T 1G3WA 1KQSS 2D9TA 4MZPA 3NFCA 3G4SA 4JS5A 3CCVT 4C8QB 3HSBA 4D6WA 4BE2A 5GAN4 1I4K1 4XTUA 5FU7B 5A0GA 4M7DG 1W2BA 3HRUA 3HFOA 4X9DA 3RIRA 3F70A 3BW1A 1V29B 1KQ1A 5FU6C 5IAYA 3CCJA 1VUBA 3JCMP 2MAMA 3QWLA 2XDBA 5CKBA 2XHCA 1VQ8T 3A8HB 4Z6YA 3TW6A 2X35A 2DD5A 2PVOB 3JCMc 2ZPIB 3OYJA 4JX6A 4M77A 3A8GB 2RI3A 4O6JA 2LVMA 3VYHB 3RKWA 2CZ6B 3P8HA 2WJ9A 4DQ2A 2VGMA 1QP2A 4WF2A 3HPWA 2QFZA 3X25B 2L89A 2DZCA 3DB3A 3JCMg 4C92C 1Q7YU 3QZ9B 2KQWA 4GY5A 4ME7A 3JB9J 3GPLA 2XK0A 1M4ZA 2RHUA 5DLQE 1QVFA 1K9MU 3H6ZA 3L1AA 2RK1A 5LJ5g 5GAMh 2PQWA 4C0ZA 1KD1U 2DIGA 3HFNA 2CGHA 2K2VA 4FT4A 4PJOD 2EQJA 4M77C 3SFMA 3TU4K 4AKGA 4ZTFA 4XU3A 4M7DE 4C5GA 2L8DA 3M56A 4MDXA 4C0DB 2RI5A 1Q82U 1JJ2A 4M7AG 2LCLA 3EFRA 4M6VA 3HP9A 4RG8A 3BG9A 1I5LA 2YLBA 3Q1JA 3CPWA 4OMFB 1N8RU 3QHSA 3CCUT 2XICA 1KC8U 3GNGA 3OS0A 4JDSA 1VQ7T 2K3XA 1VQNA 1VQ5A 3C12A 2C06A 2M0OA 2LNVA 2XDPA 3P8BB 4ELZC 4EMGA 4IUQA 4JUVA 1Y96A 2YRVA 4XTXA 3I56A 2E5QA 3FEOA 3CC2T 4LOCA 1VQNT 3HB9A 1WPYA 5CQXA 2GF7A 3TCJA 4HL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QXE B;  1PSE A;  4L6V 5;  1UGQ B;  1JB0 E;  2ZPB B;  4OB3 B;  2CZ0 B;  2CYZ B;  4OB2 B;  5L8R E;  2ZPH B;  4XK8 E;  2CZ1 B;  1IRE B;  1GXI E;  3X28 B;  2ZPF B;  3A8O B;  3VYG B;  3X26 B;  3A8L B;  1UGR B;  3VYG A;  2ZPG B;  2PVG B;  1UGP B;  3QYH B;  1QP3 A;  4ZGE B;  3WVE B;  3X24 B;  2WSF E;  1PSF A;  2DPP B;  2PU9 B;  4OB1 B;  2O01 E;  2DD4 B;  2PUO B;  2DD4 A;  3A8M B;  2ZCF B;  3QYG B;  3QZ5 B;  1DJ7 B;  1V29 B;  2CZ7 B;  1AHJ B;  2DD5 B;  3A8H B;  2DD5 A;  2PVO B;  2ZPI B;  3A8G B;  3VYH B;  1UGS B;  2CZ6 B;  3LW5 E;  1QP2 A;  2WSE E;  3X25 B;  4ZGD B;  3X20 B;  2QDY B;  2PUK B;  2DXC B;  2DXC A;  4KT0 E;  2PVD B;  4RKU E;  2ZPE B;  3WVD B;  2WSC E;  4OB0 B;  2ZZD B;  4ZGJ B;  2D0Q B;  2ZZD A;  2AHJ B;  3HHT B;  2DXB B;  4Y28 E;  3QZ9 B;  4FM4 B;  2DXB A; 
#chains in the Genus database with same CATH topology
 1VQP A;  2UUE B;  4J8O A;  1Y0M A;  3LX7 A;  1YIJ A;  2I40 B;  4CC4 B;  3MP6 A;  4DBQ A;  5L2W B;  1O9S A;  2MMP A;  1JQQ A;  3JCM b;  1PD1 A;  1QVG P;  5GMK h;  3OYB A;  1OGU B;  3X28 B;  4FL6 A;  3JB9 F;  5GAN 6;  1Q86 R;  2KRS A;  2OAW A;  5CKF A;  3PFS A;  3M59 A;  1UTI A;  5FW9 A;  3CCV Q;  1IZ6 A;  1FMK A;  4WCI A;  4DA4 A;  3LH0 A;  2R5M A;  3E19 A;  2JN0 A;  2CSI A;  4AFS C;  4MFE A;  2O9V A;  3PO3 S;  5A0D A;  1H1P B;  2D6F A;  3C0C A;  1W2B S;  1YIT A;  1Y57 A;  2KYM A;  3S3N A;  4BXX X;  2QQA A;  1CSK A;  3HL8 A;  4JS4 A;  4HT8 A;  2JS0 A;  4P5N A;  1RAH B;  4BCO B;  2YWW A;  4AKH A;  2YDL A;  1QW1 A;  1XJW B;  3G33 B;  1QKX A;  5IT9 E;  1TD6 A;  5FWC A;  3CCQ T;  1Y07 A;  1AHJ B;  1VQO T;  5HBE B;  4M77 B;  4GBQ A;  2DEU A;  1ZUY A;  4MML A;  2F1L A;  2KT1 A;  3S3O A;  1JSU B;  2PTK A;  1VQ7 Q;  3CD6 T;  1SKU B;  3CCV A;  3EGU A;  2RHX A;  3NTK A;  2COY A;  5GMK e;  1I07 A;  4M4Z A;  4BCQ B;  1JJ2 S;  1YBY A;  4F7U A;  3CPW S;  4DEY A;  2PMI B;  3GP8 A;  1VQN Q;  4C8Q G;  2JZ2 A;  1AWO A;  1LJO A;  5KH6 A;  2QGF B;  2HSP A;  3M5A A;  1HYO A;  3OW2 P;  1YJ9 T;  5HK3 A;  1U1T A;  2PVD B;  1K73 U;  2AK5 A;  2ZPE B;  3N5B B;  3CXC S;  4PFO A;  4PJO F;  2LQK A;  1D0X A;  3LYI A;  4Z89 A;  4BCN B;  3CMA A;  2HBP A;  1NYG A;  2C5V B;  1M27 C;  1K9A A;  1TUC A;  1VYU A;  4FW1 A;  1WDX A;  3UDC A;  2CJM B;  4R55 A;  3I55 Q;  3DDQ B;  1IHV A;  1J3T A;  3NTI A;  4XAX B;  1VQ7 A;  4IKF A;  1X69 A;  1K8A R;  1QCN A;  4QVZ A;  4RTU A;  2RJF A;  3VS5 A;  1WGS A;  4XK8 E;  1OKW B;  3M4Y A;  2GTO A;  1RUW A;  4ZN3 A;  1ZP2 A;  3PE0 A;  2ZGW A;  2DEQ A;  2ZPF B;  5ICP B;  4PJL A;  3HBL A;  2QA4 A;  3MPU B;  2K4Y A;  2NUP B;  2O9S A;  4FW2 A;  4B6M A;  1G3T A;  3SD4 A;  5GAN f;  3CCQ Q;  1MHN A;  2B8A A;  1KSW A;  3L2U A;  1VQO Q;  2GCX A;  2M0Y A;  2FZK B;  2X4Y A;  2MF2 A;  2RJE A;  2I0N A;  4LDX A;  2EVR A;  3J80 E;  2DJQ A;  2PU9 B;  4OMP A;  1ZA1 B;  2LRQ A;  5KYU A;  2BKZ B;  1UDL A;  2X3W D;  2EWN A;  5EC7 A;  1BYM A;  1KQ2 A;  3H4C A;  2QAZ A;  2D0N A;  3DLM A;  4OR5 B;  3QJ6 A;  4EOM B;  1AZG B;  1YJ9 Q;  2EUF A;  1OKV B;  4G6L B;  4M7A A;  4F04 B;  4HKE A;  1VQ8 Q;  3EG0 A;  2KE9 A;  4X9C A;  2WPA B;  2WFY B;  2JOY A;  5IHK A;  3FLG A;  4UC4 A;  1KD1 R;  2KI7 A;  1G3S A;  2WSE E;  2KXC A;  4HNV A;  1D1A A;  3UAT A;  1Q82 R;  3CCQ A;  5LJ3 h;  2DVE A;  2QDY B;  1RLQ C;  2DXC B;  2AIR B;  4CI0 C;  3CD6 A;  1KC8 C;  4HLQ A;  4M77 G;  1UEB A;  1H64 1;  1H27 B;  1RAD B;  4EMK A;  5IN1 A;  2L3P A;  2LTO A;  5DLO A;  1CKA A;  3VKH A;  2W96 A;  2K9G A;  3EG3 A;  2G3R A;  1WIE A;  2M9U A;  1WHJ A;  2ZZD A;  3PMT A;  3PIO A;  1H24 B;  1TS9 A;  2K5I A;  3M0Q A;  3OYK A;  1SRL A;  3EOC B;  2DXB A;  3H8Z A;  4NL2 A;  4FYX B;  2X4J A;  2HCK A;  2QYZ A;  1T0H A;  3VUZ A;  2ZPB B;  3V8K A;  3HZJ A;  3QYB A;  1IGU A;  5GAO r;  4KUL A;  3OYF A;  4OML A;  1WXU A;  3MEA A;  4M78 B;  3V8J A;  2K3Y A;  1HXD A;  2QAS A;  3GF5 A;  4E7L A;  2L3R A;  1QCF A;  1SHF A;  2HEQ A;  1B7T A;  4F6U B;  3LWH A;  5KYY A;  3EJ1 B;  3VYG A;  3JAM E;  2DX1 A;  1QWE A;  4HVU A;  1D3B A;  4M75 B;  5HKC A;  4BY6 C;  2HKQ B;  3G4S T;  1Q86 U;  1KHC A;  3QII A;  2EQM A;  4PFZ A;  1MMG A;  5KYW B;  2F69 A;  3KUF A;  3CCJ T;  4HT9 A;  2AZS A;  4ZN1 A;  2O4X B;  3CME A;  1K8A C;  2QDL A;  4QVD A;  5HQ0 B;  2KMG A;  1Z9Q A;  4E7S A;  3MP8 A;  3CC7 A;  4RTY A;  2HSE B;  2BZ8 A;  2O01 E;  2MWO A;  2CP3 A;  2LP5 A;  2PUO B;  1W4S A;  4C8Q A;  4RTW A;  2M1H A;  3CCS T;  3K7A M;  1O9K A;  1G2B A;  2ATC B;  3VKG A;  5LJ5 j;  3BE3 A;  2BZY A;  3EG1 A;  4BD3 A;  2WXV B;  1SRM A;  1ZBJ A;  3TVT A;  5FU7 C;  5CR2 A;  1Q81 C;  2EKH A;  2LQ8 A;  1X6B A;  2JGZ B;  5I2S A;  2IIM A;  5GAO n;  4CRI A;  1X27 A;  5GAN 3;  2MIO A;  4M7D F;  2EQU A;  4CRL B;  3BLQ B;  4XTW A;  2DA9 A;  2P0P A;  1LOJ A;  1F5Q B;  3WVD B;  1WQ7 A;  2RA2 A;  1QKW A;  1N27 A;  3CBM A;  3PIP A;  3JCM d;  2CP0 A;  3M55 A;  2JT4 A;  4ROD A;  1OEB A;  1YNZ A;  5LJ5 d;  4EOP B;  4C92 G;  2E64 A;  3UA6 A;  1IB8 A;  4A4K A;  3BDU A;  1I1J A;  3I5S A;  1W1F A;  2O31 A;  4OB3 B;  1ZUU A;  1VQK Q;  2FB7 A;  3SDZ A;  2UZL B;  4A4H A;  4PLI A;  2V22 B;  2XU8 A;  2OAU A;  4KGZ B;  5GAN h;  1K8A U;  4J7F A;  4AFU C;  3BFM A;  3S6W A;  5CYI B;  3M54 A;  1ZBX A;  2GGR A;  3OYN A;  3BHV B;  1BU2 A;  1UGP B;  3CCS Q;  4F17 A;  4C92 E;  2E41 A;  1EX4 A;  1QP3 A;  3OMC A;  4D8D A;  1M1K R;  2DKG A;  4KBM B;  4BE0 A;  3NTH A;  2QQB A;  3ZL7 C;  7AT1 B;  4HCC A;  2E3H A;  2J6O A;  2MI6 A;  1TXQ A;  3EGD A;  2RO0 A;  2BIV A;  3JCM e;  3SB2 A;  1TFB A;  1NPP A;  1PWT A;  3OS2 A;  1YI2 T;  1G3W A;  1KQS S;  3G4S A;  4JS5 A;  3EHR A;  1GUX B;  1QCO A;  4D6W A;  2O2O A;  5GAN 4;  3HFO A;  3RIR A;  2W9F A;  1KQ1 A;  3CCJ A;  4JPB W;  2X35 A;  3A8H B;  1U3O A;  4JX6 A;  4M77 A;  3ULR B;  2RI3 A;  4ELL A;  2LVM A;  3RKW A;  2CZ6 B;  3P8H A;  2WJ9 A;  2QFZ A;  2L89 A;  2DZC A;  4C92 C;  2KQW A;  4GY5 A;  3PVL A;  4OMN A;  3GPL A;  2FPD A;  1WHG A;  3H6Z A;  3L1A A;  4JJD A;  5GAM h;  4C0Z A;  1KD1 U;  2DIG A;  1BU1 A;  3SFM A;  4AKG A;  2COZ A;  4C5G A;  1ABQ A;  3M56 A;  2IW8 B;  4MDX A;  1Q82 U;  4M6V A;  3BG9 A;  3Q1J A;  4OMO A;  1RLP C;  1UJY A;  3GNG A;  1B3Q A;  3H0I A;  4J9E A;  2E3I A;  2C06 A;  1FVV B;  1H92 A;  4IMY B;  3DTO A;  1OQK A;  4ELZ C;  4EMG A;  1M3A A;  4TTH A;  4JUV A;  1KJW A;  3FEO A;  3I5R A;  1WPY A;  5AT1 B;  1K1Z A;  3TSW A;  3DB4 A;  3QXE B;  2DNU A;  5LJ3 g;  1RAC B;  5CQY A;  4M78 F;  3I9Q A;  4MFD A;  1JRI A;  2UZB B;  5CKE A;  4JRI A;  1RAE B;  4J9H A;  1VQL Q;  1KIK A;  4F7S B;  1OZ3 A;  2VV5 A;  5GAO p;  1H1R B;  3BG3 A;  3CC4 A;  5BNJ B;  1FKM A;  3JCM W;  4EOR B;  3M0S A;  1YI2 Q;  2VVK A;  3CCL A;  1S1N A;  4I3Z B;  2NUP A;  3VS6 A;  1Y71 A;  1IHW A;  4YC3 B;  2HBW A;  1JKW A;  1LNX A;  2K2M A;  3KBG A;  2GBQ A;  5GAN 2;  3DLL A;  2MCN A;  2DFU A;  1OIU B;  3BHT B;  5FU6 B;  3E9G A;  4BCM B;  2RF0 A;  2Y90 A;  4BCG B;  3QBY A;  1QWF A;  2VXF A;  3RGF B;  3M03 A;  2W10 A;  3G71 A;  3MEV A;  2JXB A;  2A08 A;  4JRP A;  2R7G A;  1ENW A;  4E7H A;  1YIT T;  1YJN A;  3UPU A;  4F7U E;  2UZE B;  3M58 A;  2V8K A;  1VQM A;  3OYY A;  3EFS A;  3RMS A;  4Y91 A;  1QVF S;  2NUT B;  3VKI A;  3QHR B;  4AFZ C;  4IUT A;  2LX7 A;  1UGV A;  1QVP A;  5CKH A;  2WEV B;  1OZ2 A;  4OGE A;  3GTM S;  1M1K C;  3HRT A;  1OIY B;  4F6W B;  4CFN B;  1UNL D;  1AT1 B;  1YJW T;  1G8X A;  4C92 A;  1U8R A;  2DXC A;  3OYL A;  3VV0 A;  1WZO A;  3SWN B;  2CRE A;  3JB9 G;  1ZSZ B;  1E6H A;  2DF6 A;  4GLK A;  1WJS A;  3GIB A;  2QQS A;  3BLR B;  4LDV A;  4II5 B;  2LC4 A;  2DXU A;  2KDS A;  3NPF A;  1IGQ A;  4E7J A;  2F5T X;  5GMK i;  4EOK B;  4K11 A;  3OYM A;  3MHX A;  3JRZ A;  3CMA T;  2EYW A;  2F2C A;  3E1S A;  4ROE A;  2MK5 A;  3WXM B;  4OGR B;  4BE1 A;  2HZY A;  4EOS B;  1I81 A;  2C0O A;  2DBK A;  2C0I A;  2E5K A;  1OU9 A;  1UB4 A;  2DIL A;  4J9C A;  4C92 D;  2DL3 A;  2BKD N;  1YFN A;  1YIT Q;  4EPC A;  2LZ6 B;  4JZ4 A;  4PJM A;  2PVG B;  1BCO A;  3OA6 A;  2QA4 T;  1ABO A;  1D1C A;  2OTJ T;  1B34 A;  2RJC A;  2RQR A;  1M1G A;  2E1H A;  2HKN A;  1VQ4 A;  4M7A E;  2F2W A;  2GQV A;  1E9H B;  3M0T A;  3PVQ A;  2O4X A;  2OTL A;  3OY9 A;  3SEM A;  3FC3 A;  1M1K U;  4KH1 B;  1GL5 A;  2QEX A;  3D7S B;  2HD0 A;  2DD4 B;  4OF1 A;  4LE9 A;  2RD1 A;  4V2S A;  3VRY A;  4EOQ B;  4LD9 K;  1YJW Q;  3TQ7 P;  2B86 A;  5IXB A;  1TUD A;  4PJO G;  4JJC A;  1ZHI A;  1UG1 A;  1FMW A;  4N0A C;  1K9M R;  5M9O A;  4HCK A;  4XTZ A;  3JCM J;  2FZC B;  1GY3 B;  2VGN A;  1VQ9 A;  1H28 B;  3DDP B;  5FRO A;  3URG A;  2QQR A;  1D1B A;  4UN0 A;  3MY1 B;  5IDN B;  4QQG A;  4M7A C;  1YCS B;  2CS7 A;  3VS3 A;  1KC8 R;  1PM3 A;  2CUD A;  2L3S A;  2IN3 A;  1RI9 A;  3CMA Q;  4BY1 X;  1N6A A;  1N8R C;  3DOG B;  2RHI A;  4PJO E;  1E6G A;  1JXM A;  2GFA A;  1NE8 A;  3PNW C;  2WSC E;  2DK3 A;  4OB0 B;  2QQ9 A;  3REA B;  4LN2 A;  1YJW A;  1X2Q A;  1WI7 A;  2XD0 A;  2CP6 A;  4HCZ A;  4CFU D;  3QHW B;  1X01 A;  1WX6 A;  1M5Q 1;  3QSU A;  1JO8 A;  4FM4 B;  4HA8 A;  1UNH D;  2EGC A;  5GAM g;  3TSZ A;  2WAC A;  3BG5 A;  3UWN A;  1QVG S;  4EMK C;  1AVZ C;  3OYA A;  2QA4 Q;  8ATC B;  2FPF A;  1OPK A;  3J7A F;  5GMK l;  2KSS A;  1FXX A;  1M90 C;  1RAI B;  1YHQ T;  3T9N A;  2CT4 A;  4PJO C;  1N4M A;  3EG9 A;  4M7D B;  3JCM f;  4DOW A;  4C8Q E;  1BCM A;  1M2V B;  4QW2 A;  1SSH A;  5LJ5 f;  1AD5 A;  2KRN A;  2O88 A;  1ZLM A;  1GRI A;  4LDU A;  3LGL A;  4A4E A;  2DE0 X;  1C0M A;  4F14 A;  1VIE A;  2DPP B;  3O5Z A;  4DBF A;  3C4S A;  4J5Y A;  4FSX A;  4RCB A;  1YN8 A;  3QJY A;  3CME T;  2OTJ A;  4MZT A;  5I2M A;  3CCE A;  1RL2 A;  2DZ9 A;  2FRW A;  2DME A;  2DTH A;  5FWB A;  1DJ7 B;  3CC7 T;  4R56 A;  1H4L D;  1T3L A;  4RTX A;  3GNF B;  1KG1 A;  2QXF A;  2CZ7 B;  2DTO A;  3EGX A;  2E6Z A;  2X1N B;  4BCK B;  2KBT A;  1Q81 R;  5J3B A;  4C8Q C;  1QMZ B;  3CD6 Q;  3OBW A;  3ZFJ A;  2HQX A;  4FX3 B;  2FYK A;  4N0A A;  2IW9 B;  3VS1 A;  3OW2 S;  3ZEH A;  3FJP A;  5FLX E;  4LUE A;  1GBR A;  1G5V A;  4PJN A;  1PNJ A;  2NYS A;  2K3B A;  2PUK B;  4FT2 A;  1ACM B;  5D6Y A;  4QQD A;  4KT0 E;  2LJ3 A;  2KR6 A;  2A0F B;  2LJ0 A;  3QUI A;  2FG0 A;  3EFO B;  4E7I A;  2RHZ A;  4HNT A;  2ROL A;  2JM9 A;  2BS4 A;  5D6X A;  1ZX6 A;  2DL4 A;  2M16 A;  3G7Z A;  1K9M C;  2EIF A;  3OYG A;  5KE3 A;  1RAA B;  4BI3 A;  3HHT B;  3LH5 A;  2RQT A;  1VA7 A;  2DVJ A;  2LW4 A;  2X4W A;  4ZTJ A;  1BI1 A;  2KK4 A;  2L5Q A;  4PJJ A;  5ECA A;  2RN8 A;  4ANJ A;  1JBM A;  2OJ2 A;  5A0L A;  2ZPH B;  1TTH B;  5CCA A;  1JST B;  4RUG A;  1NEB A;  3VS7 A;  2C4G B;  1JEG A;  3FB9 A;  1AZE A;  5CAI A;  3V7S A;  2V1R A;  5GAO l;  5J26 A;  3MEW A;  3CME Q;  4M7A D;  1P5E B;  2C5O B;  5LJ3 d;  4BBS M;  2RM4 A;  3GLX A;  4A53 A;  3CC7 Q;  3MIA B;  4PJO A;  1YHQ A;  2YLC A;  1AIS B;  1EFN A;  4AKI A;  4J6X A;  4D8K A;  4M77 E;  5KYX B;  1D3U B;  2J7I A;  3AHU A;  3QWY A;  4OB1 B;  4MZP A;  3B57 A;  3NFC A;  1OL1 B;  4M7D G;  2EBP A;  1W2B A;  1WA7 A;  3F70 A;  1V29 B;  5IAY A;  3JCM P;  2PJQ A;  3QWL A;  2XHC A;  4Z6Y A;  5ACB A;  1PRL C;  3TNW B;  4EIK A;  1UEC A;  2FZG B;  4J9I A;  1AWW A;  4DQ2 A;  2VGM A;  1QP2 A;  4WF2 A;  1X43 A;  3JB9 J;  1XO2 A;  1SPK A;  2RHU A;  2KR3 A;  1K9M U;  2PQW A;  4PJO D;  3HFN A;  2CGH A;  2K2V A;  4FT4 A;  4M77 C;  4M7D E;  1MNE A;  1VOL A;  1SF9 A;  4CFM B;  4C0D B;  4RTV A;  1ZA2 B;  1JJ2 A;  3EFR A;  3HP9 A;  2YLB A;  1H8K A;  3CPW A;  4GLM A;  3CCU T;  1KC8 U;  1IXD A;  2PHG A;  2LNV A;  2XDP A;  3P8B B;  2ZAE A;  1PRM C;  2LQW A;  3I56 A;  2YRV A;  4XTX A;  3CC2 T;  4BCP B;  3HB9 A;  3QZ9 B;  5CQX A;  3TCJ A;  5EJC A;  1ZUK A;  4J7I A;  1AWX A;  4CFX B;  3CXC A;  2EJ9 A;  1NJI R;  1TG0 A;  4IUP A;  4F16 A;  3DL1 A;  3CCR T;  1HSQ A;  3L2Z A;  4R0K A;  4JLI A;  1WNL A;  2MWP A;  1FWZ A;  1V1C A;  2E4H A;  4BBR M;  3JCM h;  3QG1 A;  4HVV A;  5LJ5 h;  4C8Q D;  1UHF A;  3A8O B;  1ARK A;  3CC4 T;  4C0F A;  5LL6 S;  3JCM X;  4KRC B;  1OU8 A;  4PNO A;  5DM7 R;  1H3H A;  5DY9 A;  5HBJ B;  5HVY B;  5I11 A;  3DJB A;  3CCL T;  5EFQ B;  3G4S Q;  4Z8A A;  3GBQ A;  4EON B;  1JOW A;  3CCJ Q;  4BCF B;  4F7L B;  2YHT A;  4J9D A;  3L2W A;  2IVX A;  1K4U S;  3CEY A;  1N5Z A;  2RMO A;  3HO8 A;  3RKX A;  4LUD A;  1SHG A;  3OYI A;  2CCH B;  3QDF A;  5GMK m;  2DD4 A;  4AFQ C;  2VUB A;  4N4I A;  3G71 T;  2YSQ A;  2DO3 A;  3TW7 A;  2XMF A;  2Z0W A;  2V8J A;  2DD5 B;  4AG1 C;  1GFC A;  3OBY A;  1YJN T;  1XNI A;  5C0M A;  3OYE A;  1VQM T;  3CCU Q;  2QGS A;  2JVV A;  4PL6 A;  3LW5 E;  2DTI A;  2V8I A;  1M8M A;  4M78 G;  3OB9 A;  1K0X A;  2WIP B;  4KUD K;  2P0K A;  4FIB A;  5LJ5 e;  5FRN A;  2E70 A;  1WHK A;  1Q81 U;  2HDA A;  1V76 A;  2R5A A;  3QO3 A;  3MO8 A;  4M75 G;  1TUG B;  1M30 A;  2P84 A;  2K57 A;  1MMA A;  1NLP C;  1D0Z A;  1Y96 B;  1I5O B;  2LNH B;  1U06 A;  3QPH A;  4M78 E;  4Y28 E;  6AT1 B;  4DEX A;  2AZV A;  3CC4 Q;  4XU0 A;  2J05 A;  3ASK A;  4BI8 B;  2VXE A;  3CCU A;  4E7K A;  2IW6 B;  1YWP A;  1JB0 E;  2L3Q A;  4M75 E;  4ATO A;  3CCL Q;  4OB2 B;  4F70 B;  2K79 A;  2EW3 A;  3CC2 A;  3JV3 A;  1TOV A;  4Z88 A;  3J81 E;  4OP0 A;  5KYU B;  2C6T B;  2I53 A;  2FPE A;  2SRC A;  1SSF A;  4RTZ A;  2CT3 A;  2G77 A;  3CCR A;  3EH2 A;  4MMK A;  5CVI A;  2D8H A;  4M7D A;  5D6W A;  5AYF A;  1B07 A;  3M53 A;  2LX9 A;  4M77 D;  5GAM d;  1LPL A;  3G71 Q;  3L42 A;  1HD3 A;  4E7Z A;  4M78 C;  1RAB B;  2ESW A;  5GAN 7;  1YJN Q;  1NJI C;  3RUX A;  3QDR B;  4FYW B;  5GAN 8;  3M9Q A;  4MZM A;  4BCQ D;  1VQM Q;  2DXT A;  4CFW B;  4M75 C;  2AT1 B;  4IUU A;  5IHI A;  3JCM Q;  3FRN A;  1VQ4 T;  1H3Z A;  2QTX A;  2XID A;  5HNB B;  2QTV A;  2HQE A;  2QGG A;  2OTL T;  3QZ5 B;  2QI2 A;  2LCS A;  4QVC A;  2QEX T;  1G3N C;  1AD6 A;  2YUP A;  2JNG A;  4AG2 C;  5GAO m;  4F7J B;  4XU2 A;  2GQI A;  2EFI A;  1M8V A;  2K6D A;  3F5X B;  2WHB B;  2W99 A;  1Q7Y C;  4BCN D;  2DER A;  4EC8 B;  3LLR A;  3OYH A;  4OGC A;  4M7D D;  3MY5 B;  4FCY A;  1RAG B;  1ZQ1 A;  4OVA A;  4AT1 B;  3X20 B;  1D09 B;  3THK A;  1NM7 A;  2MYS A;  1N8R R;  2W9Z A;  2V1Q A;  5GAN 5;  2JW4 A;  4X34 A;  4IUR A;  4IIM A;  1VQ9 T;  5C6S A;  4JJN K;  2GTJ A;  3C95 A;  2FHD A;  2OI3 A;  1WXT A;  1X6O A;  1S72 T;  2LDM A;  2KRO A;  3R6N A;  5KYY B;  4EOO B;  4PFP A;  3BDL A;  1OPL A;  2B9R A;  1OX9 A;  1TU0 B;  3QYE A;  4TVR A;  2NWM A;  4FSS A;  1D3B B;  2KEA A;  3INZ A;  5I21 A;  4KRT A;  1PSE A;  4L6V 5;  1RI0 A;  2PK9 B;  3V8L A;  1OI1 A;  4LDW A;  1BIA A;  2NLU A;  1M90 R;  2CYZ B;  3UA7 A;  3TNI B;  3HKS A;  1OI9 B;  3GOX A;  1PD0 A;  1NJI U;  4BDZ A;  2CZ1 B;  4Y92 A;  1IRE B;  2J06 A;  2E12 A;  8AT1 B;  4NS5 A;  2EGA A;  2KAF A;  1VQ4 Q;  2YRC A;  3TN8 B;  1C9B A;  1AWJ A;  1O9K B;  1NPR A;  2VYT A;  2OTL Q;  4F7U F;  1BI3 A;  1PG5 B;  2QEX Q;  1N9R A;  3WVE B;  4QT7 A;  1XQH A;  1TH7 A;  2K7A A;  1NLO C;  3OQ5 A;  1Y7X A;  1UHC A;  5KYX A;  3TNH B;  2FVU A;  1WLP B;  2A37 A;  3L2R A;  4M78 A;  2P4T A;  1W2B P;  1E7P A;  4BB7 A;  2VC8 A;  4J9F A;  5I5Z B;  2ZCF B;  5GMK j;  1PCX A;  3LQ5 B;  1XOV A;  4M75 A;  1VQ9 Q;  4MIM A;  2AKK A;  4DOV A;  1N9S A;  4DBH A;  5LJ3 f;  1QLB A;  1KQS A;  3CCE T;  2RQW A;  1ZSG A;  3V7R A;  5KYW A;  2CP5 A;  2H3J A;  4PLL A;  1BB9 A;  4XTV A;  1GCQ A;  3E2U A;  4E47 A;  3KXT A;  4LNP A;  4EOL B;  4OMQ A;  3TEE A;  4PK4 A;  2BPM B;  4ORZ A;  3PMI A;  5GAN g;  4BUG A;  1VQ5 T;  5KYN A;  1JJ2 P;  2BUD A;  1VQ6 A;  5EG2 A;  3OS5 A;  2CKK A;  3CPW P;  4WTO B;  2PK2 A;  1M3B A;  2YUO A;  1K73 C;  3LGF A;  3NMZ C;  5IXF A;  2LJ1 A;  1SEM A;  2BE7 D;  2X3X D;  2H3E B;  4M78 D;  1UFF A;  4BAC A;  3AT1 B;  3JB9 I;  4ZGJ B;  3DKM A;  4HXJ A;  2A3L A;  1YP5 A;  3VU3 C;  4LDY A;  4HCB A;  5HCK A;  3CXC P;  4HVW A;  4M75 D;  1MV3 A;  1W98 B;  3I55 T;  2RJD A;  4BCJ B;  2C0T A;  5A2Q E;  5CK9 A;  2KMT A;  2EQK A;  3H9N A;  2RPN A;  5CIU A;  3EID B;  4ELY C;  3QWX X;  3CCM A;  1S72 A;  3EGD B;  4BY6 B;  5DQW A;  4QSH A;  3MKD A;  4NL3 A;  1KXU A;  2E10 A;  2LT1 A;  4N4G A;  4M7A F;  1OL2 B;  1WHM A;  3MET A;  1GFD A;  5KE2 A;  5GJW B;  2ZPG B;  2JMC A;  2P0Q A;  1CKB A;  3EG2 A;  1M3C A;  3EAE A;  2CUB A;  3QYH B;  2QF7 A;  2GNC A;  1LVK A;  2ED0 A;  4JX4 A;  4YTL A;  2OTJ Q;  2DYI A;  3CCE Q;  5HK0 A;  1C1A A;  3KHI A;  2KT8 A;  4J83 A;  2PNI A;  4AI6 A;  2L0A A;  1K0S A;  2BS3 A;  4IUV A;  2D9T A;  3NDQ A;  3HSB A;  2CP2 A;  1VQ5 Q;  4BE2 A;  5FU7 B;  5A0G A;  2DRK A;  2KGT A;  3HRU A;  4X9D A;  1D0Y A;  5FU6 C;  3CQT A;  1VUB A;  2MAM A;  3EH1 A;  5CKB A;  1VQ8 T;  3JCM c;  3TW6 A;  4ROC A;  2DD5 A;  2ZPI B;  4A63 B;  3A8G B;  4O6J A;  3VYH B;  1T0J A;  4KH0 B;  1W6X A;  3EHQ A;  2YUN A;  1C6V X;  1M4Z A;  1QVF A;  2VKN A;  2RK1 A;  2EQJ A;  1GUX A;  3TU4 K;  2LCL A;  4RG8 A;  4YOO A;  4KRD B;  4OMF B;  1N8R U;  4E2F B;  3OS0 A;  4JDS A;  1VQN A;  2DET A;  2CH4 W;  4EOI B;  3C12 A;  2NUZ A;  1VQ5 A;  2M0O A;  5FGK B;  1MMN A;  1AOJ A;  3MJX A;  5IHN A;  2KRM A;  4IUQ A;  1Y96 A;  2E5Q A;  2QG9 B;  3JB9 H;  2GF7 A;  2RI2 A;  3SWN C;  2XI9 A;  2I2L A;  3I56 T;  1ZSZ C;  1JXO A;  3CBP A;  4C8Q F;  1HK9 A;  3ZBD A;  3RMQ A;  2EYQ A;  2K5F A;  5LJ3 j;  2YT6 A;  1MND A;  4C0G A;  1T3S A;  3MEU A;  1VIN A;  4BCI B;  3I55 A;  1GXI E;  5IHY A;  3BLH B;  2KXD A;  1M90 U;  3BHU B;  1YHQ Q;  2BE9 B;  2R58 A;  1NZ9 A;  3X26 B;  4BY7 X;  3A8L B;  3MCA B;  1H1S B;  5GAO q;  1Q86 C;  2EJG A;  2LCC A;  1U1S A;  4RTT A;  3C94 A;  3JB9 D;  2CH4 A;  2VWF A;  1PKD B;  2DAQ A;  2BZX A;  4PKC C;  4BCH B;  2X4X A;  2EKO A;  3X24 B;  3VS4 A;  2DL7 A;  4FYV B;  2A28 A;  3E9F A;  2RK2 A;  1UNG D;  2HNI A;  1VQO A;  2VAS A;  1VIF A;  3A8M B;  2COW A;  3RBB B;  4C92 B;  1FX7 A;  4J6Y A;  2MOX A;  2K5L A;  4L5G A;  1H25 B;  5LMK B;  2G6F X;  5GAM f;  2FEI A;  1HJD A;  2BS2 A;  2H8H A;  4XU1 A;  4QQ6 A;  3G1J A;  1OOT A;  1UGS B;  1UJ0 A;  4DBR A;  4NOY A;  4LD6 A;  4VUB A;  3P8D A;  1PC0 A;  4KGV B;  5IH2 A;  3M57 A;  1YJ9 A;  2G9X B;  4ZGD B;  1F1B B;  2E65 A;  2FO0 A;  1VQ8 A;  2LT4 A;  1BI0 A;  4EOJ B;  1KK7 A;  4AMC A;  4EDU A;  2X9H A;  3H0F A;  3I56 Q;  2DL8 A;  3S3M A;  2Y4X A;  3RER A;  3ME9 A;  3POM A;  2FL7 A;  5I22 A;  1M9S A;  2JTM A;  4RKU E;  2NUT A;  4FU6 A;  2XG8 D;  2D0Q B;  1NG2 A;  3OSS C;  1A0N B;  3U23 A;  1LCK A;  2JUF A;  4RG2 A;  1H1Q B;  2DJZ A;  1WQW A;  5LJ3 e;  4CC3 A;  2J6F A;  2BTT A;  1UGQ B;  1G83 A;  3HRS A;  1B34 B;  1Q95 G;  3RDV A;  2XKO C;  1VQK T;  2DIQ A;  4B9X A;  4BCM D;  3JSC A;  2CZ0 B;  2XDD A;  2IVW A;  3SWN A;  4ZNX A;  4Y72 B;  4J9G A;  1ZSZ A;  2GFU A;  2HMA A;  3CBO A;  1QVG A;  4M77 F;  4CC7 A;  2DBM A;  4MDW A;  5IF1 B;  2YRD A;  1R0B G;  2FRY A;  1R0C B;  1TSF A;  1UGR B;  2CCI B;  4F7N B;  1OUL A;  3L2Q A;  3FIF A;  4CFU B;  4J6W A;  2HL3 A;  1YWO A;  2CP7 A;  2LMJ A;  2RB6 A;  1EIF A;  1OYX A;  4C5E A;  2LQN A;  4ZGE B;  4JRQ A;  1QMC A;  4C5H A;  5DQV A;  1NBE B;  3OYC A;  4BDY A;  3TRE A;  5LQF B;  4J9B A;  4M7D C;  1AEY A;  2RQU A;  2C5N B;  1KHI A;  3OMG A;  5CEI B;  4A54 A;  5GJV B;  3L2V A;  1QQJ A;  3RES A;  3OSV A;  3QYG B;  1WJR A;  2V26 A;  1KQS P;  4NC6 A;  5GAN j;  1Q7Y R;  3PTA A;  2RHY A;  4RMO A;  1M1F A;  4ESR A;  1RAF B;  2JMA A;  5D7U A;  4F7U B;  1KD1 C;  4BI4 A;  4Q5W A;  3RKY A;  1NYF A;  5FRM A;  1FMV A;  1PKT A;  1K76 A;  1Q82 C;  4C5I A;  1IRX A;  1SG5 A;  2E6N A;  3A5Z B;  2EYZ A;  2D1X A;  2JS2 A;  4OMM A;  2ROT A;  1XTD A;  3OW2 A;  4JJB A;  2YUQ A;  4JLG A;  1OX8 A;  3FJ5 A;  4YOS A;  3O0G D;  1UE9 A;  4KGX B;  1O75 A;  3EG9 B;  3PGG A;  1M2O A;  3VS2 A;  5GAN d;  3CC2 Q;  1UUE A;  4YOZ A;  1VQL T;  4HNU A;  4QKU A;  2HAX A;  1X75 C;  3M0R A;  3CCR Q;  2W0Z A;  1BKB A;  5GAM j;  5L8R E;  2D8J A;  3G6E T;  1JU5 C;  1GH6 B;  1BK2 A;  2MPX C;  3MP1 A;  1QLY A;  4Z02 A;  4B9W A;  3KFV A;  2JM8 A;  5KCH A;  1VQK A;  3O8V A;  3VS0 A;  2EJF A;  3HTR A;  1MUZ A;  4ELJ A;  4EC9 B;  3EGX B;  2ECZ A;  2R57 A;  3FDR A;  3ER0 A;  2QQ8 A;  2VB6 A;  2IG0 A;  4C92 F;  1EZZ B;  4X1V A;  2W2H A;  2DL5 A;  2DYB A;  3QKJ A;  2WSF E;  1URC B;  3CCS A;  3V7C A;  2ED1 A;  3CPF A;  5GAN e;  2F5K A;  1YCY A;  2RQV A;  2C5X B;  3UF4 A;  1MV0 B;  1BI2 A;  1MGQ A;  2A7Y A;  2F2X A;  2YXY A;  5HBH B;  4EMH A;  1IO6 A;  1OV3 A;  1I0C A;  4JRK A;  2KNB B;  2P4R A;  5L23 A;  2Y4Y A;  4M7A B;  4KUI A;  1M2V A;  2KY9 A;  2RNA A;  1WFW A;  3M0P A;  4L59 A;  2JTF A;  2SEM A;  1QVF P;  4XQ3 A;  2JTE A;  3LWI A;  3NHN A;  1BIB A;  2EAY A;  3BY7 A;  2DRM A;  1K73 R;  3VRZ A;  1P92 A;  1VOM A;  4A4G A;  3JCM V;  4II1 A;  2AKL A;  1G3Y A;  1GCQ C;  3IQL A;  3VUB A;  2KYB A;  1VQP T;  1VQ6 T;  4EMK B;  4M75 F;  1TWB A;  1YIJ T;  1VYT A;  4RCC A;  1R8O B;  3R6O A;  2ZZD B;  4LXC A;  3G6E Q;  2AHJ B;  3PT9 A;  4F7U G;  4A4F A;  2RH2 A;  2DXB B;  4C0D C;  3NGP A;  4F6S B;  5GAM e;  2EQI A;  2EYY A;  3OS1 A;  4IIO A;  1R77 A;  1X2K A;  4PJO B;  3REB B;  1WJQ A;  3UT1 A;  1I8F A;  2JJ9 A;  2HQH A;  2J6K A;  2CDT A;  4JX5 A;  4XTY A;  2EYX A;  3EFO A;  2HL5 C;  3CCM T;  3VJP A;  5J39 A;  1U5S A;  2PZ1 A;  2DM1 A;  1VQL A;  3VYG B;  4N4H A;  9ATC B;  5KCO A;  3M0U A;  3I35 A;  5IDP B;  2DLP A;  2IPO B;  1FIN B;  1BBZ A;  5HY6 A;  5CO7 A;  1WYX A;  3G6E A;  5CKD A;  2EGE A;  1YI2 A;  2QK0 A;  2WMB B;  2KVQ G;  1E7O A;  1H26 B;  2A36 A;  1PSF A;  3M4G A;  2DMO A;  3OYD A;  1VYW B;  2QDJ A;  1W70 A;  4O5V A;  1KFZ A;  2ENM A;  4E6R A;  3CCV T;  4C8Q B;  1WXB A;  2CSQ A;  1I4K 1;  4XTU A;  3H41 A;  3BW1 A;  1NEG A;  2F2V A;  3A98 A;  4NST B;  4CFV B;  2XDB A;  2WMA B;  2WIH B;  2PVO B;  3OYJ A;  3MI9 B;  1VQP Q;  2M51 A;  1VQ6 Q;  1YIJ Q;  1PHT A;  1MMD A;  3HPW A;  3X25 B;  3DB3 A;  3RNJ A;  3JCM g;  3H0H A;  1Q7Y U;  4ME7 A;  1PKS A;  2XK0 A;  4CC2 A;  5DLQ E;  3RR6 A;  2OX7 A;  1X6G A;  5LJ5 g;  2ABL A;  1WHH A;  1GBQ A;  4JZ3 A;  4ZTF A;  1FYN A;  4XU3 A;  2L8D A;  2L2P A;  2RI5 A;  2UZD B;  1WHL A;  4M7A G;  2M02 A;  1I5L A;  1Z9Z A;  2X51 A;  4CXA B;  2XIC A;  3A1P A;  3QHS A;  1VQ7 T;  4FYY B;  2K3X A;  3SHW A;  1VYV A;  2EPD A;  3CCM Q;  1S72 Q;  4LOC A;  1VQN T;  1GCP A;  4HL4 A; 
#chains in the Genus database with same CATH homology
 5EJC A;  3QXE B;  2RI2 A;  3DB4 A;  5LJ3 g;  4J7I A;  4M78 F;  5CQY A;  3SWN C;  1VQP A;  3CXC A;  2EJ9 A;  2XI9 A;  2I2L A;  4J8O A;  3I56 T;  4MFD A;  1JRI A;  3LX7 A;  1YIJ A;  4IUP A;  3CBP A;  4JRI A;  5CKE A;  3DL1 A;  3CCR T;  3MP6 A;  4C8Q F;  1HK9 A;  3L2Z A;  3ZBD A;  4JLI A;  1O9S A;  1WNL A;  1OZ3 A;  1FWZ A;  2MMP A;  2MWP A;  3RMQ A;  3JCM b;  2VV5 A;  2EYQ A;  2K5F A;  5LJ3 j;  4BBR M;  5GMK h;  5GAO p;  3JCM h;  3BG3 A;  3OYB A;  3CC4 A;  4C0G A;  3MEU A;  3QG1 A;  3I55 A;  1GXI E;  3X28 B;  1FKM A;  4FL6 A;  3JCM W;  5LJ5 h;  1M90 U;  4C8Q D;  3JB9 F;  5GAN 6;  3A8O B;  2R58 A;  1NZ9 A;  5CKF A;  3CC4 T;  3PFS A;  4C0F A;  3X26 B;  3A8L B;  3CCL A;  3MCA B;  5LL6 S;  3M59 A;  3JCM X;  1IZ6 A;  4PNO A;  5DM7 R;  1Y71 A;  5GAO q;  4DA4 A;  3LH0 A;  2R5M A;  1Q86 C;  3E19 A;  2EJG A;  2JN0 A;  5DY9 A;  3JB9 H;  2LCC A;  1LNX A;  1U1S A;  3KBG A;  4MFE A;  3C94 A;  3JB9 D;  5GAN 2;  5A0D A;  3DLL A;  3CCL T;  2DAQ A;  2D6F A;  5FU6 B;  3E9G A;  4PKC C;  2Y90 A;  2X4X A;  1W2B S;  3QBY A;  2EKO A;  1YIT A;  3X24 B;  3S3N A;  2VXF A;  2YHT A;  2QQA A;  3E9F A;  2RK2 A;  3L2W A;  3HL8 A;  3CEY A;  4JS4 A;  3RKX A;  3HO8 A;  2HNI A;  3G71 A;  3MEV A;  4HT8 A;  3OYI A;  4P5N A;  4JRP A;  4E7H A;  5GMK m;  4AKH A;  1VQO A;  1YIT T;  2DD4 A;  1VIF A;  3A8M B;  1QW1 A;  4C92 B;  1YJN A;  1FX7 A;  4J6Y A;  4F7U E;  3UPU A;  2K5L A;  3M58 A;  2V8K A;  2VUB A;  5IT9 E;  4N4I A;  1VQM A;  3G71 T;  3CCQ T;  3OYY A;  2DO3 A;  3EFS A;  4L5G A;  3TW7 A;  1Y07 A;  2V8J A;  1AHJ B;  2DD5 B;  3RMS A;  4Y91 A;  1VQO T;  1QVF S;  4M77 B;  3OBY A;  1YJN T;  4MML A;  1XNI A;  3VKI A;  5GAM f;  5C0M A;  3OYE A;  2BS2 A;  4IUT A;  4XU1 A;  4QQ6 A;  3S3O A;  1VQM T;  2JVV A;  1UGS B;  1QVP A;  4PL6 A;  3CD6 T;  5CKH A;  1OZ2 A;  3LW5 E;  2RHX A;  4OGE A;  3CCV A;  3NTK A;  5GMK e;  1M1K C;  3HRT A;  2DTI A;  4NOY A;  2V8I A;  4LD6 A;  4M78 G;  3OB9 A;  3P8D A;  4VUB A;  1JJ2 S;  4KUD K;  1YBY A;  2P0K A;  4FIB A;  3M57 A;  1YJ9 A;  4F7U A;  4ZGD B;  5LJ5 e;  3CPW S;  2E70 A;  5FRN A;  1Q81 U;  2E65 A;  3GP8 A;  4C8Q G;  2R5A A;  1VQ8 A;  2LT4 A;  2JZ2 A;  1BI0 A;  1YJW T;  1LJO A;  3QO3 A;  4C92 A;  4EDU A;  5KH6 A;  1U8R A;  3MO8 A;  4M75 G;  2DXC A;  3M5A A;  1YJ9 T;  3S3M A;  2Y4X A;  5HK3 A;  3RER A;  1U1T A;  3OYL A;  2PVD B;  3VV0 A;  3ME9 A;  3SWN B;  2FL7 A;  3JB9 G;  2K57 A;  1K73 U;  1M9S A;  2JTM A;  4GLK A;  1WJS A;  4RKU E;  2ZPE B;  3GIB A;  2QQS A;  3N5B B;  3CXC S;  4PJO F;  2LQK A;  4FU6 A;  4LDV A;  2XG8 D;  1Y96 B;  2D0Q B;  3LYI A;  2LC4 A;  2DXU A;  3CMA A;  2HBP A;  3OSS C;  3QPH A;  4M78 E;  2KDS A;  2JUF A;  4Y28 E;  2F5T X;  2DJZ A;  4RG2 A;  4E7J A;  5GMK i;  1WQW A;  5LJ3 e;  4XU0 A;  3UDC A;  3OYM A;  4R55 A;  3ASK A;  4BI8 B;  3MHX A;  3JRZ A;  1UGQ B;  2VXE A;  3NTI A;  3HRS A;  1B34 B;  4XAX B;  3CCU A;  4E7K A;  1VQ7 A;  3CMA T;  4IKF A;  2XKO C;  3E1S A;  1VQK T;  1JB0 E;  2DIQ A;  4M75 E;  4QVZ A;  4B9X A;  4BE1 A;  3JSC A;  2CZ0 B;  3WXM B;  2XDD A;  4ATO A;  4OB2 B;  2IVW A;  1I81 A;  2RJF A;  3SWN A;  1WGS A;  4XK8 E;  3CC2 A;  2GFU A;  3CBO A;  3M4Y A;  1QVG A;  3J81 E;  4OP0 A;  4ZN3 A;  4M77 F;  2ZGW A;  2DEQ A;  2ZPF B;  4MDW A;  3HBL A;  4C92 D;  1UB4 A;  2QA4 A;  2BKD N;  1SSF A;  2K4Y A;  1UGR B;  3CCR A;  2G77 A;  4MMK A;  5CVI A;  4EPC A;  4M7D A;  5D6W A;  5AYF A;  3L2Q A;  3FIF A;  2PVG B;  2LX9 A;  3M53 A;  1G3T A;  4J6W A;  2RB6 A;  4M77 D;  3SD4 A;  5GAM d;  5GAN f;  1EIF A;  1OYX A;  3OA6 A;  2QA4 T;  1MHN A;  3L42 A;  4C5E A;  1B34 A;  2B8A A;  2RJC A;  2OTJ T;  4ZGE B;  4M78 C;  3L2U A;  4JRQ A;  1M1G A;  2E1H A;  5GAN 7;  4C5H A;  1VQ4 A;  2GCX A;  3RUX A;  3QDR B;  1NJI C;  4M7A E;  2X4Y A;  2GQV A;  2MF2 A;  5GAN 8;  2RJE A;  3M9Q A;  4MZM A;  3OYC A;  4LDX A;  4BDY A;  2DXT A;  3TRE A;  3J80 E;  2O4X A;  4M7D C;  2OTL A;  3OY9 A;  1KHI A;  3FC3 A;  3OMG A;  1M1K U;  2PU9 B;  4M75 C;  4A54 A;  2LRQ A;  4IUU A;  2QEX A;  3JCM Q;  2HD0 A;  3FRN A;  1VQ4 T;  1H3Z A;  3L2V A;  2DD4 B;  2QTX A;  2XID A;  4OF1 A;  2HQE A;  2RD1 A;  3RES A;  2OTL T;  3OSV A;  4V2S A;  3QYG B;  3QZ5 B;  2QI2 A;  4LD9 K;  4QVC A;  1WJR A;  2EWN A;  2QEX T;  4NC6 A;  5GAN j;  1BYM A;  4PJO G;  1KQ2 A;  3H4C A;  1ZHI A;  3DLM A;  3QJ6 A;  2JNG A;  4M7A A;  5GAO m;  3PTA A;  4HKE A;  4N0A C;  4XU2 A;  2EFI A;  4X9C A;  1M8V A;  2JOY A;  2RHY A;  4RMO A;  3FLG A;  4UC4 A;  5M9O A;  1Q7Y C;  1M1F A;  1G3S A;  2WSE E;  4XTZ A;  3LLR A;  3OYH A;  3JCM J;  4OGC A;  4M7D D;  4HNV A;  2VGN A;  1VQ9 A;  4F7U B;  1KD1 C;  1ZQ1 A;  5FRO A;  3URG A;  2QQR A;  4BI4 A;  4Q5W A;  2DVE A;  5LJ3 h;  3CCQ A;  3RKY A;  4OVA A;  3X20 B;  4M7A C;  4QQG A;  5FRM A;  2CS7 A;  2QDY B;  2DXC B;  1Q82 C;  4C5I A;  5GAN 5;  1VQ9 T;  4X34 A;  4IUR A;  4CI0 C;  2E6N A;  3A5Z B;  1N6A A;  3CD6 A;  5C6S A;  1N8R C;  1KC8 C;  2RHI A;  4HLQ A;  4M77 G;  1UEB A;  4JJN K;  4PJO E;  2GFA A;  1XTD A;  3OW2 A;  1H64 1;  1NE8 A;  4EMK A;  5IN1 A;  2LTO A;  4JLG A;  3PNW C;  5DLO A;  2WSC E;  3VKH A;  2FHD A;  3C95 A;  2DK3 A;  4OB0 B;  2QQ9 A;  1X6O A;  2G3R A;  1S72 T;  2M9U A;  2LDM A;  1YJW A;  2ZZD A;  3PMT A;  3PIO A;  3BDL A;  2K5I A;  1O75 A;  4HCZ A;  3PGG A;  3OYK A;  2XD0 A;  3QYE A;  1X01 A;  4TVR A;  1D3B B;  1M5Q 1;  3QSU A;  3INZ A;  5GAN d;  4FM4 B;  2DXB A;  4HA8 A;  5GAM g;  5I21 A;  2WAC A;  1PSE A;  3BG5 A;  3H8Z A;  4L6V 5;  4NL2 A;  3UWN A;  1RI0 A;  1QVG S;  4EMK C;  2X4J A;  4HNU A;  1VQL T;  3V8L A;  1OI1 A;  2HAX A;  1X75 C;  3OYA A;  4LDW A;  3VUZ A;  1BIA A;  2NLU A;  2ZPB B;  3V8K A;  2CYZ B;  3HZJ A;  1BKB A;  3HKS A;  3QYB A;  3J7A F;  5GMK l;  5GAM j;  5L8R E;  3GOX A;  5GAO r;  1NJI U;  4BDZ A;  2KSS A;  4KUL A;  2CZ1 B;  1FXX A;  3OYF A;  1M90 C;  3MEA A;  4M78 B;  3V8J A;  1IRE B;  3G6E T;  1YHQ T;  2K3Y A;  3T9N A;  1HXD A;  2E12 A;  3MP1 A;  3GF5 A;  4NS5 A;  2L3R A;  4Z02 A;  4E7L A;  4B9W A;  3LWH A;  2KAF A;  4PJO C;  5KCH A;  1VQK A;  4M7D B;  3VYG A;  3JAM E;  1NPR A;  2VYT A;  3O8V A;  3JCM f;  1D3B A;  4M75 B;  2EJF A;  5HKC A;  4BY6 C;  4DOW A;  4C8Q E;  4F7U F;  4ELJ A;  4QW2 A;  1BI3 A;  3G4S T;  1Q86 U;  1KHC A;  3QII A;  1N9R A;  2EQM A;  2R57 A;  5LJ5 f;  3FDR A;  2F69 A;  3ER0 A;  3WVE B;  2QQ8 A;  1XQH A;  1TH7 A;  2IG0 A;  4C92 F;  3KUF A;  4LDU A;  3LGL A;  3CCJ T;  4HT9 A;  3OQ5 A;  1Y7X A;  4A4E A;  2O4X B;  4ZN1 A;  3CME A;  1K8A C;  4QVD A;  2KMG A;  3QKJ A;  2WSF E;  3MP8 A;  1VIE A;  2FVU A;  2DPP B;  3CCS A;  3V7C A;  3L2R A;  3CPF A;  4M78 A;  5GAN e;  3CC7 A;  2P4T A;  3C4S A;  2F5K A;  4J5Y A;  1YCY A;  4FSX A;  1E7P A;  4BB7 A;  4RCB A;  2O01 E;  2MWO A;  1BI2 A;  1MGQ A;  3QJY A;  2PUO B;  2A7Y A;  3CME T;  1W4S A;  2VC8 A;  4MZT A;  2OTJ A;  5I2M A;  4C8Q A;  1RL2 A;  3CCE A;  4EMH A;  2DZ9 A;  2ZCF B;  5GMK j;  2DTH A;  2M1H A;  3CCS T;  1DJ7 B;  3CC7 T;  4R56 A;  1XOV A;  4JRK A;  3GNF B;  1KG1 A;  4M75 A;  2QXF A;  2CZ7 B;  4MIM A;  2Y4Y A;  4KUI A;  4M7A B;  3VKG A;  4DOV A;  1N9S A;  5LJ5 j;  2KY9 A;  2DTO A;  5LJ3 f;  1QLB A;  1KQS A;  2E6Z A;  3CCE T;  3V7R A;  4BD3 A;  2H3J A;  4L59 A;  4PLL A;  2JTF A;  5J3B A;  4XTV A;  4E47 A;  3KXT A;  4C8Q C;  3TEE A;  3OBW A;  4XQ3 A;  5FU7 C;  3LWI A;  3ZFJ A;  2HQX A;  1BIB A;  5CR2 A;  1Q81 C;  2EAY A;  3PMI A;  2LQ8 A;  2FYK A;  4N0A A;  5GAN g;  3BY7 A;  4BUG A;  1VQ5 T;  3OW2 S;  3ZEH A;  5I2S A;  3FJP A;  5FLX E;  1G5V A;  2BUD A;  5GAO n;  1P92 A;  2PUK B;  3OS5 A;  5EG2 A;  4CRI A;  1VQ6 A;  4A4G A;  3JCM V;  2CKK A;  4II1 A;  4FT2 A;  5GAN 3;  5D6Y A;  4QQD A;  1G3Y A;  4KT0 E;  2KR6 A;  1K73 C;  3QUI A;  4M7D F;  3LGF A;  2EQU A;  3VUB A;  1VQP T;  4XTW A;  1VQ6 T;  4EMK B;  4M75 F;  4M78 D;  1YIJ T;  4RCC A;  2P0P A;  1LOJ A;  3WVD B;  1R8O B;  1WQ7 A;  3R6O A;  4BAC A;  4E7I A;  2RHZ A;  4HNT A;  3JB9 I;  2ZZD B;  2BS4 A;  4ZGJ B;  1N27 A;  2RA2 A;  3DKM A;  2A3L A;  2M16 A;  5D6X A;  3CBM A;  3G7Z A;  3VU3 C;  1K9M C;  2EIF A;  3PIP A;  2AHJ B;  5KE3 A;  3JCM d;  3OYG A;  4LDY A;  3PT9 A;  4BI3 A;  3M55 A;  4A4F A;  4F7U G;  4HCB A;  3HHT B;  2RH2 A;  4M75 D;  2DXB B;  4C0D C;  3I55 T;  2RJD A;  5GAM e;  5LJ5 d;  3OS1 A;  5A2Q E;  4C92 G;  2E64 A;  2KMT A;  5CK9 A;  2EQK A;  4A4K A;  4PJO B;  2X4W A;  3BDU A;  4ZTJ A;  5CIU A;  4ELY C;  1BI1 A;  2KK4 A;  2L5Q A;  4OB3 B;  1WJQ A;  3UT1 A;  3CCM A;  1S72 A;  2FB7 A;  3SDZ A;  4BY6 B;  4QSH A;  1I8F A;  1JBM A;  4A4H A;  5A0L A;  4PLI A;  2ZPH B;  2XU8 A;  5CCA A;  4NL3 A;  2OAU A;  2E10 A;  4JX5 A;  2LT1 A;  4N4G A;  4XTY A;  4M7A F;  5GAN h;  1K8A U;  3CCM T;  4J7F A;  3MET A;  3VJP A;  5J39 A;  3FB9 A;  3BFM A;  5CAI A;  1VQL A;  5KE2 A;  3VYG B;  4N4H A;  3V7S A;  5KCO A;  3S6W A;  5GAO l;  5J26 A;  2ZPG B;  3MEW A;  2P0Q A;  1ZBX A;  3M54 A;  3OYN A;  4M7A D;  3EAE A;  5LJ3 d;  4BBS M;  1UGP B;  2RM4 A;  3GLX A;  4A53 A;  3QYH B;  4C92 E;  5HY6 A;  2QF7 A;  2E41 A;  5CO7 A;  4PJO A;  1QP3 A;  3OMC A;  3G6E A;  1YHQ A;  4JX4 A;  2DKG A;  2YLC A;  4KBM B;  4YTL A;  5CKD A;  4BE0 A;  3NTH A;  2QQB A;  1YI2 A;  4HCC A;  4AKI A;  5HK0 A;  2MI6 A;  4J6X A;  2KVQ G;  3KHI A;  2RO0 A;  2BIV A;  4J83 A;  4M77 E;  3JCM e;  3SB2 A;  4AI6 A;  1NPP A;  1PSF A;  3M4G A;  3OYD A;  2QDJ A;  2BS3 A;  3OS2 A;  3AHU A;  4IUV A;  4O5V A;  4OB1 B;  1YI2 T;  1G3W A;  1KQS S;  2D9T A;  4MZP A;  3NFC A;  3G4S A;  4JS5 A;  3CCV T;  4C8Q B;  3HSB A;  4D6W A;  4BE2 A;  5GAN 4;  1I4K 1;  4XTU A;  5FU7 B;  5A0G A;  4M7D G;  1W2B A;  3HRU A;  3HFO A;  4X9D A;  3RIR A;  3F70 A;  3BW1 A;  1V29 B;  1KQ1 A;  5FU6 C;  5IAY A;  3CCJ A;  1VUB A;  3JCM P;  2MAM A;  3QWL A;  2XDB A;  5CKB A;  2XHC A;  1VQ8 T;  3A8H B;  4Z6Y A;  3TW6 A;  2X35 A;  2DD5 A;  2PVO B;  3JCM c;  2ZPI B;  3OYJ A;  4JX6 A;  4M77 A;  3A8G B;  2RI3 A;  4O6J A;  2LVM A;  3VYH B;  3RKW A;  2CZ6 B;  3P8H A;  2WJ9 A;  4DQ2 A;  2VGM A;  1QP2 A;  4WF2 A;  3HPW A;  2QFZ A;  3X25 B;  2L89 A;  2DZC A;  3DB3 A;  3JCM g;  4C92 C;  1Q7Y U;  3QZ9 B;  2KQW A;  4GY5 A;  4ME7 A;  3JB9 J;  3GPL A;  2XK0 A;  1M4Z A;  2RHU A;  5DLQ E;  1QVF A;  1K9M U;  3H6Z A;  3L1A A;  2RK1 A;  5LJ5 g;  5GAM h;  2PQW A;  4C0Z A;  1KD1 U;  2DIG A;  3HFN A;  2CGH A;  2K2V A;  4FT4 A;  4PJO D;  2EQJ A;  4M77 C;  3SFM A;  3TU4 K;  4AKG A;  4ZTF A;  4XU3 A;  4M7D E;  4C5G A;  2L8D A;  3M56 A;  4MDX A;  4C0D B;  2RI5 A;  1Q82 U;  1JJ2 A;  4M7A G;  2LCL A;  3EFR A;  4M6V A;  3HP9 A;  4RG8 A;  3BG9 A;  1I5L A;  2YLB A;  3Q1J A;  3CPW A;  4OMF B;  1N8R U;  3QHS A;  3CCU T;  2XIC A;  1KC8 U;  3GNG A;  3OS0 A;  4JDS A;  1VQ7 T;  2K3X A;  1VQN A;  1VQ5 A;  3C12 A;  2C06 A;  2M0O A;  2LNV A;  2XDP A;  3P8B B;  4ELZ C;  4EMG A;  4IUQ A;  4JUV A;  1Y96 A;  2YRV A;  4XTX A;  3I56 A;  2E5Q A;  3FEO A;  3CC2 T;  4LOC A;  1VQN T;  3HB9 A;  1WPY A;  5CQX A;  2GF7 A;  3TCJ A;  4HL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...