4EONB

Thr 160 phosphorylated cdk2 h84s, q85m, q131e - human cyclin a3 complex with the inhibitor ro3306
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eonB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eonB02
3BHTB 4I3ZB 5ICPB 1GH6B 5LMKB 2C4GB 2WPAB 3F5XB 1PKDB 1ZP2A 2CCIB 2W99A 1H27B 4EOIB 4BCJB 5EFQB 2CJMB 2UZBB 2WXVB 1FVVB 2G9XB 3LQ5B 1P5EB 3TN8B 4F7JB 4YOSA 1F5QB 4KRCB 2W9ZA 4YOOA 1H28B 5CEIB 2EUFA 3QHRB 3MY5B 2I53A 2PK9B 2F2CA 5HVYB 4F7NB 1OIYB 4CFVB 4EOJB 5I5ZB 3M03A 4CXAB 5ACBA 5HNBB 1QMZB 4BCGB 1URCB 1UNLD 4CFUD 1O9KA 1VINA 5L2WB 1AD6A 2WMAB 1G3NC 1O9KB 1H26B 3BLRB 1FINB 4ROEA 5IF1B 1H1RB 2W9FA 2C5OB 2I40B 4BCOB 4EOSB 4CFNB 4BCMB 2R7GA 3EOCB 2C5VB 4F7SB 1H4LD 4F7LB 2UZLB 4BCQD 2BPMB 3EJ1B 3BLHB 2PK2A 2QDJA 2C5NB 3TNIB 4EOPB 5HBJB 1OKWB 3BHVB 4BCFB 1E9HB 1OIUB 2V22B 1JSUB 1W98B 2C5XB 4YC3B 3MY1B 2W96A 5HQ0B 2IW8B 4BCNB 2JGZB 4EORB 3TNWB 5CYIB 5LQFB 3BLQB 5HBEB 4RODA 1UNHD 4F70B 4F6UB 4FX3B 5FGKB 2IVXA 4EOOB 1H1PB 2UUEB 2WMBB 3O0GD 1H1SB 2BKZB 5IDNB 2UZEB 3H4CA 1GUXA 4CRLB 1GUXB 4EONB 2X1NB 4IMYB 2W2HA 2WIHB 1XO2A 1OGUB 4NSTB 1N4MA 1TFBA 1JKWA 2WIPB 3K7AM 1JSTB 4F6WB 3MI9B 1H25B 4OR5B 5BNJB 2UZDB 3EIDB 4Y72B 4UN0A 4YOZA 1UNGD 4II5B 4BCKB 1OKVB 4EOLB 3RGFB 3QHWB 3DDQB 3POMA 4EOKB 4BCMD 4ROCA 2B9RA 4EOMB 3DDPB 1BU2A 1OL1B 4G6LB 4F6SB 3G33B 4EOQB 4OGRB 4CFUB 3MIAB 1VOLA 3DOGB 1VYWB 4EC8B 5IDPB 4BCHB 1AISB 4CFXB 1OL2B 2PMIB 4CFWB 1H24B 1KXUA 1C9BA 2IW9B 1H1QB 2WFYB 4CFMB 2CCHB 3TNHB 2WEVB 2PHGA 4BCND 4KRDB 4BCQB 2WHBB 4ELLA 1JOWA 2C6TB 1OI9B 1GY3B 3BHUB 4BCPB 2IW6B 4EC9B 4ELJA 1D3UB 4TTHA 4BCIB 5HBHB
chains in the Genus database with same CATH superfamily
3BHTB 5IHYA 5LMKB 1V29B 2CCIB 5EJCA 1F5QB 4KRCB 4YOOA 1H28B 5CEIB 3QHRB 2I53A 1OIYB 2CZ7B 4CFVB 5I5ZB 1UNLD 2ZZDB 3X24B 1AD6A 1H1RB 2R7GA 2DPPB 4F7SB 2DD4B 3BLHB 2QDJA 4EOPB 2D0QB 3MY1B 2DXCB 3X26B 2IW8B 5CYIB 5LQFB 3BLQB 4FX3B 2ZCFB 2IVXA 3O0GD 4CRLB 3HB9A 3VKHA 4NSTB 2QQ8A 1N4MA 1TFBA 3K7AM 4F6WB 2UZDB 4BXXX 2CZ6B 1UNGD 2ZPFB 4II5B 4BCKB 3QHWB 2B9RA 4F6SB 4EOQB 4OGRB 4CFUB 2ZPIB 1QLBA 2BS2A 4EC8B 5DQWA 5IDPB 2KMGA 4CFWB 1C9BA 2CZ1B 2WEVB 2PHGA 4KRDB 2WHBB 4ELLA 1JOWA 2IW6B 4EC9B 1ZP2A 2W99A 1H27B 4EOIB 3NDQA 5EFQB 2AHJB 2UZBB 4F7JB 4HLQA 2EUFA 2PK9B 3GTMS 5HVYB 3M03A 5HNBB 4OB3B 3QXEB 1O9KA 1VINA 5L2WB 1H26B 5IF1B 1FINB 2W9FA 2PJQA 2ZPHB 4EOSB 2QGSA 4BCMB 3EOCB 3A8OB 4MIMA 1H4LD 4F7LB 2UZLB 4BCQD 3X20B 2DXBB 2C5NB 2CYZB 3TNIB 5DQVA 1E9HB 1OIUB 2V22B 4AKGA 2C5XB 5HQ0B 4BCNB 2JGZB 2KR6A 3TNWB 3X28B 4BY1X 1UNHD 4F70B 4F6UB 5FGKB 4JX4A 3QYGB 3VKGA 1H1SB 2BKZB 5IDNB 3QYHB 4EONB 2X1NB 4IMYB 4FM4B 2ZPBB 4MFEA 2QF7A 2WIPB 4BBSM 4EOKB 4ROCA 4EOMB 3DDPB 3MIAB 1VOLA 4AKIA 1UGPB 4BCHB 1OL2B 1H24B 4M6VA 4OB1B 2C6TB 1FKMA 1IREB 5ICPB 2C4GB 1ENWA 2WPAB 3F5XB 1PKDB 2CJMB 3LQ5B 3BG5A 3TN8B 4YOSA 4ZGJB 3A8HB 1TD6A 1UGSB 2DMEA 4CXAB 4CFUD 3BG3A 1O9KB 3BLRB 4ROEA 3KHIA 3A8GB 3VYHB 2I40B 4CFNB 3QYEA 2IN3A 3X25B 3QZ9B 1OKWB 3BHVB 4BCFB 3TW7A 1E7PA 3PO3S 4YC3B 4BBRM 2W96A 4EOOB 2UUEB 3QWLA 4ZGEB 1GUXA 3B57A 4HNUA 2WIHB 1XO2A 1OGUB 2DD5B 1JKWA 3WVDB 5BNJB 4BY7X 3EIDB 2ZPEB 4Y72B 4YOZA 1OKVB 2BS4A 3RGFB 4EOLB 4HNTA 4JX6A 3POMA 4BCMD 3HHTB 1BU2A 1OL1B 2ZPGB 3G33B 4AKHA 2PMIB 3DL1A 2G77A 2IW9B 1H1QB 2WFYB 2CCHB 4BCND 4ZGDB 1OI9B 4ELJA 4MFDA 1D3UB 2LW4A 4HNVA 4TTHA 5HBHB 4I3ZB 1GH6B 3VYGB 3DTOA 4BCJB 2WXVB 1FVVB 2G9XB 1P5EB 2CZ0B 2W9ZA 4OB0B 3MY5B 2F2CA 4F7NB 3HBLA 4EOJB 5ACBA 1QMZB 4BCGB 1URCB 3HO8A 3HZJA 2WMAB 1G3NC 4LOCA 4JX5A 2C5OB 3TW6A 1AHJB 3WVEB 4BCOB 2C5VB 2BPMB 3EJ1B 2PK2A 2WJ9A 2QDYB 5HBJB 2BS3A 1JSUB 1W98B 4EORB 4HL4A 5HBEB 4RODA 3QYBA 4AI6A 2QFZA 1H1PB 2WMBB 3DJBA 2UZEB 3H4CA 1GUXB 3A8LB 2W2HA 1JSTB 4QSHA 3MI9B 1UGRB 1H25B 4OR5B 4UN0A 4OB2B 3DDQB 4NC6A 4G6LB 1UGQB 3A8MB 3DOGB 1VYWB 1AISB 4CFXB 1KXUA 3BG9A 4CFMB 3TNHB 4BCQB 4Z6YA 1GY3B 3BHUB 4BCPB 3QZ5B 4BCIB
chains in the Genus database with same CATH topology
3BHTB 4I3ZB 5ICPB 1GH6B 5LMKB 2C4GB 2WPAB 3F5XB 1PKDB 1ZP2A 2CCIB 2W99A 1H27B 4EOIB 4BCJB 5EFQB 2CJMB 2UZBB 2WXVB 1FVVB 2G9XB 3LQ5B 1P5EB 3TN8B 4F7JB 4YOSA 1F5QB 4KRCB 2W9ZA 4YOOA 1H28B 5CEIB 2EUFA 3QHRB 3MY5B 2I53A 2PK9B 2F2CA 5HVYB 4F7NB 1OIYB 4CFVB 4EOJB 5I5ZB 3M03A 4CXAB 5ACBA 5HNBB 1QMZB 4BCGB 1URCB 1UNLD 4CFUD 1O9KA 1VINA 5L2WB 1AD6A 2WMAB 1G3NC 1O9KB 1H26B 3BLRB 1FINB 4ROEA 5IF1B 1H1RB 2W9FA 2C5OB 2I40B 4BCOB 4EOSB 4CFNB 4BCMB 2R7GA 3EOCB 2C5VB 4F7SB 1H4LD 4F7LB 2UZLB 4BCQD 2BPMB 3EJ1B 3BLHB 2PK2A 2QDJA 2C5NB 3TNIB 4EOPB 5HBJB 1OKWB 3BHVB 4BCFB 1E9HB 1OIUB 2V22B 1JSUB 1W98B 2C5XB 4YC3B 3MY1B 2W96A 5HQ0B 2IW8B 4BCNB 2JGZB 4EORB 3TNWB 5CYIB 5LQFB 3BLQB 5HBEB 4RODA 1UNHD 4F70B 4F6UB 4FX3B 5FGKB 2IVXA 4EOOB 1H1PB 2UUEB 2WMBB 3O0GD 1H1SB 2BKZB 5IDNB 2UZEB 3H4CA 1GUXA 4CRLB 1GUXB 4EONB 2X1NB 4IMYB 2W2HA 2WIHB 1XO2A 1OGUB 4NSTB 1N4MA 1TFBA 1JKWA 2WIPB 3K7AM 1JSTB 4F6WB 3MI9B 1H25B 4OR5B 5BNJB 2UZDB 3EIDB 4Y72B 4UN0A 4YOZA 1UNGD 4II5B 4BCKB 1OKVB 4EOLB 3RGFB 3QHWB 3DDQB 3POMA 4EOKB 4BCMD 4ROCA 2B9RA 4EOMB 3DDPB 1BU2A 1OL1B 4G6LB 4F6SB 3G33B 4EOQB 4OGRB 4CFUB 3MIAB 1VOLA 3DOGB 1VYWB 4EC8B 5IDPB 4BCHB 1AISB 4CFXB 1OL2B 2PMIB 4CFWB 1H24B 1KXUA 1C9BA 2IW9B 1H1QB 2WFYB 4CFMB 2CCHB 3TNHB 2WEVB 2PHGA 4BCND 4KRDB 4BCQB 2WHBB 4ELLA 1JOWA 2C6TB 1OI9B 1GY3B 3BHUB 4BCPB 2IW6B 4EC9B 4ELJA 1D3UB 4TTHA 4BCIB 5HBHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHT B;  4I3Z B;  5ICP B;  1GH6 B;  5LMK B;  2C4G B;  2WPA B;  3F5X B;  1PKD B;  1ZP2 A;  2CCI B;  2W99 A;  1H27 B;  4EOI B;  4BCJ B;  5EFQ B;  2CJM B;  2UZB B;  2WXV B;  1FVV B;  2G9X B;  3LQ5 B;  1P5E B;  3TN8 B;  4F7J B;  4YOS A;  1F5Q B;  4KRC B;  2W9Z A;  4YOO A;  1H28 B;  5CEI B;  2EUF A;  3QHR B;  3MY5 B;  2I53 A;  2PK9 B;  2F2C A;  5HVY B;  4F7N B;  1OIY B;  4CFV B;  4EOJ B;  5I5Z B;  3M03 A;  4CXA B;  5ACB A;  5HNB B;  1QMZ B;  4BCG B;  1URC B;  1UNL D;  4CFU D;  1O9K A;  1VIN A;  5L2W B;  1AD6 A;  2WMA B;  1G3N C;  1O9K B;  1H26 B;  3BLR B;  1FIN B;  4ROE A;  5IF1 B;  1H1R B;  2W9F A;  2C5O B;  2I40 B;  4BCO B;  4EOS B;  4CFN B;  4BCM B;  2R7G A;  3EOC B;  2C5V B;  4F7S B;  1H4L D;  4F7L B;  2UZL B;  4BCQ D;  2BPM B;  3EJ1 B;  3BLH B;  2PK2 A;  2QDJ A;  2C5N B;  3TNI B;  4EOP B;  5HBJ B;  1OKW B;  3BHV B;  4BCF B;  1E9H B;  1OIU B;  2V22 B;  1JSU B;  1W98 B;  2C5X B;  4YC3 B;  3MY1 B;  2W96 A;  5HQ0 B;  2IW8 B;  4BCN B;  2JGZ B;  4EOR B;  3TNW B;  5CYI B;  5LQF B;  3BLQ B;  5HBE B;  4ROD A;  1UNH D;  4F70 B;  4F6U B;  4FX3 B;  5FGK B;  2IVX A;  4EOO B;  1H1P B;  2UUE B;  2WMB B;  3O0G D;  1H1S B;  2BKZ B;  5IDN B;  2UZE B;  3H4C A;  1GUX A;  4CRL B;  1GUX B;  4EON B;  2X1N B;  4IMY B;  2W2H A;  2WIH B;  1XO2 A;  1OGU B;  4NST B;  1N4M A;  1TFB A;  1JKW A;  2WIP B;  3K7A M;  1JST B;  4F6W B;  3MI9 B;  1H25 B;  4OR5 B;  5BNJ B;  2UZD B;  3EID B;  4Y72 B;  4UN0 A;  4YOZ A;  1UNG D;  4II5 B;  4BCK B;  1OKV B;  4EOL B;  3RGF B;  3QHW B;  3DDQ B;  3POM A;  4EOK B;  4BCM D;  4ROC A;  2B9R A;  4EOM B;  3DDP B;  1BU2 A;  1OL1 B;  4G6L B;  4F6S B;  3G33 B;  4EOQ B;  4OGR B;  4CFU B;  3MIA B;  1VOL A;  3DOG B;  1VYW B;  4EC8 B;  5IDP B;  4BCH B;  1AIS B;  4CFX B;  1OL2 B;  2PMI B;  4CFW B;  1H24 B;  1KXU A;  1C9B A;  2IW9 B;  1H1Q B;  2WFY B;  4CFM B;  2CCH B;  3TNH B;  2WEV B;  2PHG A;  4BCN D;  4KRD B;  4BCQ B;  2WHB B;  4ELL A;  1JOW A;  2C6T B;  1OI9 B;  1GY3 B;  3BHU B;  4BCP B;  2IW6 B;  4EC9 B;  4ELJ A;  1D3U B;  4TTH A;  4BCI B;  5HBH B; 
#chains in the Genus database with same CATH topology
 3BHT B;  5IHY A;  5LMK B;  1V29 B;  2CCI B;  5EJC A;  1F5Q B;  4KRC B;  4YOO A;  1H28 B;  5CEI B;  3QHR B;  2I53 A;  1OIY B;  2CZ7 B;  4CFV B;  5I5Z B;  1UNL D;  2ZZD B;  3X24 B;  1AD6 A;  1H1R B;  2R7G A;  2DPP B;  4F7S B;  2DD4 B;  3BLH B;  2QDJ A;  4EOP B;  2D0Q B;  3MY1 B;  2DXC B;  3X26 B;  2IW8 B;  5CYI B;  5LQF B;  3BLQ B;  4FX3 B;  2ZCF B;  2IVX A;  3O0G D;  4CRL B;  3HB9 A;  3VKH A;  4NST B;  2QQ8 A;  1N4M A;  1TFB A;  3K7A M;  4F6W B;  2UZD B;  4BXX X;  2CZ6 B;  1UNG D;  2ZPF B;  4II5 B;  4BCK B;  3QHW B;  2B9R A;  4F6S B;  4EOQ B;  4OGR B;  4CFU B;  2ZPI B;  1QLB A;  2BS2 A;  4EC8 B;  5DQW A;  5IDP B;  2KMG A;  4CFW B;  1C9B A;  2CZ1 B;  2WEV B;  2PHG A;  4KRD B;  2WHB B;  4ELL A;  1JOW A;  2IW6 B;  4EC9 B;  1ZP2 A;  2W99 A;  1H27 B;  4EOI B;  3NDQ A;  5EFQ B;  2AHJ B;  2UZB B;  4F7J B;  4HLQ A;  2EUF A;  2PK9 B;  3GTM S;  5HVY B;  3M03 A;  5HNB B;  4OB3 B;  3QXE B;  1O9K A;  1VIN A;  5L2W B;  1H26 B;  5IF1 B;  1FIN B;  2W9F A;  2PJQ A;  2ZPH B;  4EOS B;  2QGS A;  4BCM B;  3EOC B;  3A8O B;  4MIM A;  1H4L D;  4F7L B;  2UZL B;  4BCQ D;  3X20 B;  2DXB B;  2C5N B;  2CYZ B;  3TNI B;  5DQV A;  1E9H B;  1OIU B;  2V22 B;  4AKG A;  2C5X B;  5HQ0 B;  4BCN B;  2JGZ B;  2KR6 A;  3TNW B;  3X28 B;  4BY1 X;  1UNH D;  4F70 B;  4F6U B;  5FGK B;  4JX4 A;  3QYG B;  3VKG A;  1H1S B;  2BKZ B;  5IDN B;  3QYH B;  4EON B;  2X1N B;  4IMY B;  4FM4 B;  2ZPB B;  4MFE A;  2QF7 A;  2WIP B;  4BBS M;  4EOK B;  4ROC A;  4EOM B;  3DDP B;  3MIA B;  1VOL A;  4AKI A;  1UGP B;  4BCH B;  1OL2 B;  1H24 B;  4M6V A;  4OB1 B;  2C6T B;  1FKM A;  1IRE B;  5ICP B;  2C4G B;  1ENW A;  2WPA B;  3F5X B;  1PKD B;  2CJM B;  3LQ5 B;  3BG5 A;  3TN8 B;  4YOS A;  4ZGJ B;  3A8H B;  1TD6 A;  1UGS B;  2DME A;  4CXA B;  4CFU D;  3BG3 A;  1O9K B;  3BLR B;  4ROE A;  3KHI A;  3A8G B;  3VYH B;  2I40 B;  4CFN B;  3QYE A;  2IN3 A;  3X25 B;  3QZ9 B;  1OKW B;  3BHV B;  4BCF B;  3TW7 A;  1E7P A;  3PO3 S;  4YC3 B;  4BBR M;  2W96 A;  4EOO B;  2UUE B;  3QWL A;  4ZGE B;  1GUX A;  3B57 A;  4HNU A;  2WIH B;  1XO2 A;  1OGU B;  2DD5 B;  1JKW A;  3WVD B;  5BNJ B;  4BY7 X;  3EID B;  2ZPE B;  4Y72 B;  4YOZ A;  1OKV B;  2BS4 A;  3RGF B;  4EOL B;  4HNT A;  4JX6 A;  3POM A;  4BCM D;  3HHT B;  1BU2 A;  1OL1 B;  2ZPG B;  3G33 B;  4AKH A;  2PMI B;  3DL1 A;  2G77 A;  2IW9 B;  1H1Q B;  2WFY B;  2CCH B;  4BCN D;  4ZGD B;  1OI9 B;  4ELJ A;  4MFD A;  1D3U B;  2LW4 A;  4HNV A;  4TTH A;  5HBH B;  4I3Z B;  1GH6 B;  3VYG B;  3DTO A;  4BCJ B;  2WXV B;  1FVV B;  2G9X B;  1P5E B;  2CZ0 B;  2W9Z A;  4OB0 B;  3MY5 B;  2F2C A;  4F7N B;  3HBL A;  4EOJ B;  5ACB A;  1QMZ B;  4BCG B;  1URC B;  3HO8 A;  3HZJ A;  2WMA B;  1G3N C;  4LOC A;  4JX5 A;  2C5O B;  3TW6 A;  1AHJ B;  3WVE B;  4BCO B;  2C5V B;  2BPM B;  3EJ1 B;  2PK2 A;  2WJ9 A;  2QDY B;  5HBJ B;  2BS3 A;  1JSU B;  1W98 B;  4EOR B;  4HL4 A;  5HBE B;  4ROD A;  3QYB A;  4AI6 A;  2QFZ A;  1H1P B;  2WMB B;  3DJB A;  2UZE B;  3H4C A;  1GUX B;  3A8L B;  2W2H A;  1JST B;  4QSH A;  3MI9 B;  1UGR B;  1H25 B;  4OR5 B;  4UN0 A;  4OB2 B;  3DDQ B;  4NC6 A;  4G6L B;  1UGQ B;  3A8M B;  3DOG B;  1VYW B;  1AIS B;  4CFX B;  1KXU A;  3BG9 A;  4CFM B;  3TNH B;  4BCQ B;  4Z6Y A;  1GY3 B;  3BHU B;  4BCP B;  3QZ5 B;  4BCI B; 
#chains in the Genus database with same CATH homology
 3BHT B;  4I3Z B;  5ICP B;  1GH6 B;  5LMK B;  2C4G B;  2WPA B;  3F5X B;  1PKD B;  1ZP2 A;  2CCI B;  2W99 A;  1H27 B;  4EOI B;  4BCJ B;  5EFQ B;  2CJM B;  2UZB B;  2WXV B;  1FVV B;  2G9X B;  3LQ5 B;  1P5E B;  3TN8 B;  4F7J B;  4YOS A;  1F5Q B;  4KRC B;  2W9Z A;  4YOO A;  1H28 B;  5CEI B;  2EUF A;  3QHR B;  3MY5 B;  2I53 A;  2PK9 B;  2F2C A;  5HVY B;  4F7N B;  1OIY B;  4CFV B;  4EOJ B;  5I5Z B;  3M03 A;  4CXA B;  5ACB A;  5HNB B;  1QMZ B;  4BCG B;  1URC B;  1UNL D;  4CFU D;  1O9K A;  1VIN A;  5L2W B;  1AD6 A;  2WMA B;  1G3N C;  1O9K B;  1H26 B;  3BLR B;  1FIN B;  4ROE A;  5IF1 B;  1H1R B;  2W9F A;  2C5O B;  2I40 B;  4BCO B;  4EOS B;  4CFN B;  4BCM B;  2R7G A;  3EOC B;  2C5V B;  4F7S B;  1H4L D;  4F7L B;  2UZL B;  4BCQ D;  2BPM B;  3EJ1 B;  3BLH B;  2PK2 A;  2QDJ A;  2C5N B;  3TNI B;  4EOP B;  5HBJ B;  1OKW B;  3BHV B;  4BCF B;  1E9H B;  1OIU B;  2V22 B;  1JSU B;  1W98 B;  2C5X B;  4YC3 B;  3MY1 B;  2W96 A;  5HQ0 B;  2IW8 B;  4BCN B;  2JGZ B;  4EOR B;  3TNW B;  5CYI B;  5LQF B;  3BLQ B;  5HBE B;  4ROD A;  1UNH D;  4F70 B;  4F6U B;  4FX3 B;  5FGK B;  2IVX A;  4EOO B;  1H1P B;  2UUE B;  2WMB B;  3O0G D;  1H1S B;  2BKZ B;  5IDN B;  2UZE B;  3H4C A;  1GUX A;  4CRL B;  1GUX B;  4EON B;  2X1N B;  4IMY B;  2W2H A;  2WIH B;  1XO2 A;  1OGU B;  4NST B;  1N4M A;  1TFB A;  1JKW A;  2WIP B;  3K7A M;  1JST B;  4F6W B;  3MI9 B;  1H25 B;  4OR5 B;  5BNJ B;  2UZD B;  3EID B;  4Y72 B;  4UN0 A;  4YOZ A;  1UNG D;  4II5 B;  4BCK B;  1OKV B;  4EOL B;  3RGF B;  3QHW B;  3DDQ B;  3POM A;  4EOK B;  4BCM D;  4ROC A;  2B9R A;  4EOM B;  3DDP B;  1BU2 A;  1OL1 B;  4G6L B;  4F6S B;  3G33 B;  4EOQ B;  4OGR B;  4CFU B;  3MIA B;  1VOL A;  3DOG B;  1VYW B;  4EC8 B;  5IDP B;  4BCH B;  1AIS B;  4CFX B;  1OL2 B;  2PMI B;  4CFW B;  1H24 B;  1KXU A;  1C9B A;  2IW9 B;  1H1Q B;  2WFY B;  4CFM B;  2CCH B;  3TNH B;  2WEV B;  2PHG A;  4BCN D;  4KRD B;  4BCQ B;  2WHB B;  4ELL A;  1JOW A;  2C6T B;  1OI9 B;  1GY3 B;  3BHU B;  4BCP B;  2IW6 B;  4EC9 B;  4ELJ A;  1D3U B;  4TTH A;  4BCI B;  5HBH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...