2D0QB

Complex of fe-type nhase with cyclohexyl isocyanide, photo-activated for 1hr at 277k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snap shots of Inhibitor Binding Process in Photo-reactive Nitrile Hydratase
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2d0qB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d0qB02
4L6V5 2ZPEB 3X20B 2WSCE 3X24B 1DJ7B 4OB3B 1UGQB 3QYGB 4OB1B 1JB0E 3QZ9B 2ZPBB 2DD4B 2ZPGB 2DPPB 1PSEA 2WSEE 4OB2B 4OB0B 1QP2A 3A8GB 3VYHB 4Y28E 2O01E 2DXBB 2DXBA 3LW5E 3X25B 2DD5B 3A8OB 3A8LB 2DXCA 3A8MB 3QXEB 2PU9B 3HHTB 2CZ7B 4ZGDB 4XK8E 4KT0E 4FM4B 3WVDB 1V29B 1UGSB 2CZ0B 3X26B 1GXIE 2QDYB 2ZCFB 3QZ5B 1UGRB 3A8HB 1QP3A 5L8RE 4ZGJB 2ZPHB 1UGPB 2PVDB 2D0QB 2CYZB 1IREB 2DXCB 1AHJB 2ZZDB 3QYHB 2PUKB 2CZ6B 2ZZDA 3VYGA 3VYGB 2DD5A 2WSFE 2PUOB 2DD4A 1PSFA 4ZGEB 3X28B 2PVOB 2ZPFB 3WVEB 4RKUE 2PVGB 2CZ1B 2ZPIB 2AHJB
chains in the Genus database with same CATH superfamily
1WJRA 1YP5A 5EFQB 2JTEA 1GCQA 2J05A 4UC4A 2QDJA 1D0YA 2M0OA 3HTRA 2DL7A 1TUDA 4F7NB 2LVMA 2KROA 5CQXA 2SEMA 5A0LA 3LX7A 2FEIA 1LVKA 3NTIA 1OU9A 2KY9A 3O0GD 3UA6A 4BCND 1S72Q 4GLKA 4HNTA 1UGQB 2RQVA 3URGA 3QDFA 4L5GA 5LJ3h 2DMEA 2NUTA 4EORB 3CCQT 1PG5B 4YOZA 3BHTB 3GLXA 1JO8A 2DRKA 2F5KA 2ZGWA 2FRYA 1AD5A 4ZTFA 4JJNK 4KH1B 3EIDB 1VQOQ 2EJ9A 3QSUA 2UUEB 3JSCA 2JTFA 1G3SA 1N6AA 3RIRA 2DETA 4BY1X 3CCUT 1QVFA 4BBSM 1Q86R 5EG2A 3QXEB 1R0BG 2IG0A 3JCMf 4PKCC 5IHNA 1PKSA 5KCHA 1OULA 4JJBA 1SRLA 2E70A 4J9DA 2E3IA 2EPDA 1MV3A 3QPHA 1Y71A 2AZSA 4OGEA 1X6GA 4J83A 4O5VA 1UGRB 3OB9A 2JM8A 2K4YA 2FVUA 4ZTJA 1LPLA 4DQ2A 3REAB 1QMCA 4AKGA 1F5QB 5HVYB 1OIUB 4A4GA 1RAEB 1YCSB 4F6SB 4M75G 1IHWA 1N5ZA 4CFNB 4M77F 2NWMA 2EBPA 1FINB 1NPRA 3S3OA 1KD1R 4A53A 4M75D 3DOGB 3FLGA 3MCAB 4N0AA 2BS4A 8AT1B 1QVGS 3QHRB 2O2OA 3VKGA 2EGCA 1KQ2A 1FKMA 3AT1B 4BI8B 4E7SA 1AZEA 2W9ZA 4AT1B 4HA8A 3LH0A 4MFEA 5IHIA 4XTUA 5CKBA 2HQXA 2WACA 4EC8B 1UFFA 3RBBB 4KUDK 2GBQA 1YJ9A 1GFDA 3MJXA 5IDNB 1DJ7B 1UEBA 3H6ZA 2E6NA 5GAOp 3A98A 1D3BB 2JGZB 2KT8A 4J6YA 3HP9A 3CCQA 2XDDA 1MMAA 3RMQA 2EUFA 2O4XB 4BCQD 4RG2A 2E1HA 4CFUB 4PJNA 3MP6A 2EWNA 2QFZA 3H4CA 5GAN2 3CD6A 3G6ET 2X51A 4DEXA 3X25B 1YJNQ 3F70A 4J9FA 2F2CA 5LJ5g 4M7DA 1ZLMA 2DX1A 3PVQA 1VQLA 5GAMg 4M75A 4M75B 4ZGDB 1TSFA 4PJOB 2JS2A 3GNGA 3PFSA 3ME9A 2CP0A 4FT4A 2QASA 4LUEA 4D8KA 2C06A 2V8IA 1R0CB 1Q81U 4NC6A 2RB6A 3FIFA 4M77D 4BB7A 1N27A 3EAEA 5J39A 1X6BA 3EHQA 3MEVA 4KH0B 3JCMJ 3OYCA 2ECZA 3QDRB 3RR6A 4YOSA 3N5BB 3CBMA 2JS0A 3TSZA 1GBRA 1WQ7A 4FYWB 1UHFA 2CH4A 2DAQA 2K9GA 3M0QA 1G3YA 4IUVA 1ABOA 1KIKA 1LNXA 1RABB 4E6RA 1ZSZA 2YRVA 4C8QE 1KG1A 2KVQG 3S6WA 2IIMA 1H1PB 3HBLA 1K4US 1FVVB 3X28B 1M3BA 5IHKA 1NZ9A 1SRMA 1AWJA 1ZA1B 4KUIA 3MP8A 3TW7A 4C92C 1ACMB 1GL5A 2PHGA 5M9OA 2JW4A 3CCRQ 3FC3A 1BCOA 2DEUA 3EG9B 4CRIA 1YNZA 4AFZC 4KGXB 1M1KR 5D7UA 3I5RA 1JSTB 4HCZA 4C8QC 3RKWA 5LJ5f 3V7CA 2LW4A 3QYGB 2BS3A 3SDZA 1KK7A 2PK2A 3PMTA 1PSEA 1I81A 2IN3A 2O31A 1VYUA 3SD4A 1PM3A 3NTKA 5GANj 4M7AD 1ZUYA 4JLGA 3KBGA 3EFOA 4KBMB 4EONB 4KGVB 5GAOm 3OYKA 3LWIA 4XTXA 3QO3A 2JMCA 2RI2A 5GAN5 5FU7B 5KYUB 1QP2A 4AFUC 1W2BP 4M78B 3CBPA 2DXBA 4BCMB 2R58A 1Y7XA 4J5YA 1LCKA 4II1A 1XOVA 4ROCA 3KFVA 1WFWA 4JS5A 1VQ5A 4E7IA 2A7YA 1N9RA 1VUBA 2EKOA 2LZ6B 4PJJA 5I21A 2QA4T 1GUXB 3CMAT 5CQYA 1YI2A 2L2PA 2JZ2A 2EAYA 4MMLA 4D6WA 4HL4A 5KYNA 2YLBA 1K8AR 1OX9A 2ROTA 2C4GB 1VQKT 4BI3A 2GNCA 3UF4A 2M02A 2YUNA 3CCJT 4AG2C 3H9NA 1YI2Q 1O9KA 2SRCA 1RLQC 3JB9J 2KR6A 2RM4A 3QYEA 3M03A 4HCBA 1MMDA 2DRMA 1JRIA 4RTZA 2KMGA 5LJ5e 3OYLA 3JCMh 1KFZA 2CZ6B 1QVGA 2ZZDA 4XU2A 2DXUA 2NUPB 3M4YA 4BDYA 4OMNA 3OSVA 2WSFE 4Z8AA 1UTIA 1VQ8T 4C8QF 5FWCA 5KYYA 4RTXA 1N8RR 4PL6A 1E7OA 4ZN3A 1E6GA 4A4KA 4BCKB 3JAME 4CFWB 2P4RA 2KT1A 1M90C 2QYZA 2QGSA 4CC2A 5LJ5j 3OYDA 3MPUB 1NBEB 1WNLA 3RERA 3LYIA 3DB4A 4NL3A 2FRWA 1JB0E 1U8RA 1JEGA 3PNWC 4M4ZA 4DOVA 2DYIA 1QCNA 4HVWA 2GCXA 1X6OA 5LJ5d 1X69A 1KQSS 1S72T 2IVWA 3ULRB 4JJCA 1Y0MA 1NPPA 4ROEA 3G4SA 3CCQQ 2DEQA 3EH2A 5KE2A 1AZGB 2X35A 2RJCA 2C5XB 4M77A 3M59A 4F7LB 1M9SA 3VS4A 4IMYB 1FMWA 2QA4A 3V8KA 4N4GA 1QWEA 4DBQA 1YJWQ 2CUDA 3TSWA 2M9UA 3HHTB 4JRPA 2VC8A 2YUPA 3PGGA 4C8QD 2YRDA 1WIEA 1OL1B 2DKGA 4BCMD 5FW9A 2G6FX 5GMKm 3FRNA 3CXCA 1BI1A 1VQLQ 1B07A 1QMZB 1RAFB 3CMEQ 4MZTA 3ZFJA 1I07A 1IB8A 2HSEB 1IREB 1KSWA 3REBB 3BW1A 2LJ1A 2MWPA 5KCOA 1PKTA 5GAMe 3LGLA 3DJBA 4HXJA 4OGCA 1G5VA 1B34B 3CC4A 3FDRA 1UJ0A 3LGFA 2ABLA 4YOOA 2RH2A 2LRQA 1FMKA 1NM7A 3HFOA 3NPFA 3TCJA 2C5VB 4ELLA 3G71A 2QF7A 2A0FB 2M51A 1WGSA 3UPUA 2RA2A 1D0ZA 1RI9A 4JS4A 1W70A 1HK9A 1OL2B 2LDMA 1J3TA 2PVGB 4C5EA 2QQ9A 4J9IA 1G3NC 1ZHIA 3GNFB 2ZPEB 2E6ZA 5KYUA 2DJQA 2E41A 1WJQA 1NE8A 3M0SA 3RUXA 1K9MC 2JOYA 4Z6YA 3UA7A 2DYBA 1VQ9A 2C5OB 3EH1A 5DLQE 4JUVA 2CT4A 1RACB 2BPMB 1YWOA 2R5AA 2Y4XA 3BY7A 4BY6B 2YXYA 2EJFA 2QA4Q 3MEUA 4EMKA 1ZP2A 1AWXA 4O6JA 2OTLT 1E9HB 4QT7A 2KDSA 3BE3A 1N4MA 4C92F 3CC2T 4J9CA 3M0PA 1OZ2A 4Y72B 5GAOl 2BS2A 1ZUUA 4OR5B 2CH4W 2OAWA 2Y4YA 5GAN8 5D6WA 2UZDB 3HSBA 2W96A 2HL5C 1T3LA 1VQNT 2KRMA 1VQNQ 4JX4A 2GFUA 4EMKB 2AT1B 2EW3A 4MIMA 2V8JA 4ELYC 1YJNT 2F1LA 1O75A 1W2BS 4F04B 5GANe 2JVVA 5HK3A 1QQJA 2CZ0B 4FYXB 3OW2P 1JSUB 3VU3C 1NG2A 5CKFA 4DEYA 4D8DA 4PJMA 1UNGD 4LDXA 4C92D 2A37A 3H8ZA 1ENWA 3C95A 1JBMA 3CCLA 3F5XB 1VA7A 3TNHB 2ZPHB 2PNIA 3EFSA 3SWNB 4FW1A 2R7GA 1M4ZA 4FU6A 2J7IA 1MNDA 3CC4T 2GGRA 2F2XA 2LCSA 1AOJA 2X4JA 4JZ4A 4FSXA 1D1AA 3CMAA 4OMQA 2DE0X 1MV0B 2DMOA 4PLLA 2D0NA 1M8VA 2EFIA 4P5NA 1JU5C 5GMKi 1K73R 3PE0A 2ED0A 2PUOB 4JJDA 1KC8C 3CQTA 2LCCA 4PFZA 1QVPA 1YJ9Q 2COYA 4YTLA 3QWYA 3U23A 4Z89A 2ZPIB 4BCJB 1VINA 3CMET 2DJZA 1D1BA 3ASKA 3G6EA 1VQKA 1XNIA 5HQ0B 3PIOA 5FU6B 1QVFS 1GY3B 4M77G 2EQUA 3CCUQ 2OTLA 3DLMA 2VB6A 4MDWA 2FZCB 1M1KC 1H641 1WHHA 2BUDA 3OY9A 2YUQA 2X4XA 1K0SA 1QKXA 4C92E 2LT4A 4IUUA 5KYXB 3MHXA 3HRUA 1AT1B 2J06A 4Z88A 1OZ3A 3KHIA 3M55A 3Q1JA 3HRSA 3RESA 5CKHA 4PJOG 3RNJA 1N8RU 3V7RA 3A8LB 4C8QG 5KE3A 3V8LA 4OVAA 4FYYB 3E1SA 2DA9A 3NFCA 4F7SB 5LJ3d 4PJLA 5C0MA 3OS2A 2HBWA 2RHUA 3OYFA 3WXMB 1MHNA 5D6YA 2E4HA 1GCPA 2L3RA 1KD1C 1H28B 5GAN4 4BY6C 4EOQB 1KQSP 1D09B 1M1FA 1UGPB 3CC7T 4HT8A 1M90R 1KC8U 1R77A 2D1XA 4M78E 1U3OA 2K2MA 3M0TA 4C5HA 2DIGA 1JXMA 4M7AE 1FX7A 2M16A 3BLQB 1ARKA 1I5LA 4BE2A 4M75C 3VYGB 4LD9K 3CCEQ 3VS7A 3P8HA 3HB9A 3JCMW 1C1AA 1UB4A 4DOWA 4PJOD 2QQ8A 4OMFB 4KRTA 3M9QA 3FEOA 4JRKA 4ZGEB 2V1QA 2XI9A 4IUPA 1UUEA 4RKUE 5ECAA 1YITT 4FYVB 4A4FA 4DBRA 1BU1A 1UNLD 3GBQA 4BACA 1EZZB 5DQWA 1AEYA 3DLLA 1JKWA 3I56A 2DL3A 1Q81C 4C0ZA 4Z02A 2RI3A 4TTHA 4CFUD 1X2QA 2JN0A 5A0GA 4E7LA 4HT9A 1QWFA 2WIHB 1QKWA 2HKNA 2VV5A 1D0XA 1Y07A 5HNBB 1TWBA 2E64A 1BCMA 4MFDA 1U1SA 3I9QA 3OYBA 4BCFB 1T0JA 4IKFA 5GAN7 4HLQA 2J6OA 4M7DB 4BCGB 3CD6T 1BI0A 2V8KA 1YJ9T 2OTJQ 4LDUA 2O01E 3DTOA 4YC3B 2RQRA 3LW5E 4PJOA 2YUOA 3MEWA 2O88A 2WFYB 1K73C 4C8QA 3HZJA 3G4SQ 2R5MA 2VGNA 2OTJA 4JX6A 2WIPB 4FX3B 2CZ7B 4A4HA 4CC3A 4EOLB 1ZBXA 4C0GA 2DLPA 2K5IA 4QW2A 3TW6A 2NUZA 2M1HA 3VKHA 3BLHB 1URCB 2RO0A 2DIQA 1AVZC 4BCNB 4XTYA 4ZGJB 2KR3A 1BYMA 4KULA 2EQKA 2FPFA 4HKEA 2P84A 2D0QB 2YHTA 4LDVA 3VJPA 1OKVB 2H3EB 5GAOr 1WXTA 2KSSA 2DVEA 4PJOE 3I35A 4M7AF 1Q7YC 4X9CA 5IF1B 5A0DA 3THKA 2K5FA 2FZGB 1GH6B 4M7DE 4A63B 5GJVB 3EGUA 3JB9G 2LT1A 4C5GA 1WZOA 2ZAEA 1ABQA 1YITA 2B86A 2HCKA 2QGGA 1VQMA 3CPWA 2F2VA 1YHQQ 1OU8A 4CFMB 2GTJA 4PJOC 2RK2A 3EFOB 4XQ3A 4OP0A 1M3CA 2L89A 4F14A 5IH2A 3I55A 1RADB 3EGXB 2EYWA 1K8AU 3NTHA 1SF9A 1P92A 2E12A 2RQTA 3SFMA 2DXTA 3GP8A 4AKHA 5KYWB 3LH5A 3L42A 1WJSA 4M78A 1NJIC 3CC7A 5C6SA 1H25B 2DPPB 5DY9A 1TOVA 4XTWA 1U1TA 3OYYA 2KXDA 1U06A 2AZVA 2WJ9A 3V7SA 2DZCA 4V2SA 1K73U 5IDPB 1MGQA 1RAIB 1RUWA 4OMPA 2DBKA 1VIFA 1EIFA 3EGXA 1V76A 2HAXA 1PD0A 4FSSA 1OEBA 1GBQA 2XU8A 5CEIB 1I4K1 3META 3RMSA 3CXCS 2WPAB 5I2SA 2DBMA 4KRDB 3M57A 4OMOA 3JB9H 2BIVA 2D9TA 3LLRA 3DKMA 2KYBA 4PFOA 4KT0E 1D3BA 4J6XA 3VS5A 1K1ZA 2DF6A 3CCJQ 5LMKB 3EGDB 1UGSB 4NS5A 2KEAA 4C0DC 1PKDB 2FPDA 2VVKA 4BCPB 3CCVA 3A8HB 1QP3A 5A2QE 1EX4A 4XU1A 3SWNC 1YN8A 3E9FA 1Q95G 2MPXC 2I53A 2OTJT 1U5SA 4M7DD 3NMZC 5FGKB 4M77E 4PJOF 4EIKA 1HJDA 5LJ5h 2DVJA 2WEVB 2L3QA 3OYAA 3K7AM 2C0IA 4J9EA 4M75E 3OBYA 3E19A 1VQ7T 2UZLB 1CKBA 5GANd 2BE9B 4EDUA 1UDLA 2NUTB 1Q82C 2XK0A 3UATA 1VQ7Q 4RG8A 4RTYA 3GPLA 5CVIA 1BI3A 2OAUA 3O5ZA 5IT9E 1AWOA 4OMLA 1HSQA 4RTUA 3GTMS 1W1FA 1E7PA 1PHTA 3CCRT 1FYNA 1BB9A 5IHYA 1W6XA 4M7AA 1WHLA 3CCST 3JCMX 2BZYA 3BHUB 3QZ9B 3G6EQ 4F70B 2BTTA 2L3PA 3UDCA 3OYHA 3RDVA 3L1AA 2X3XD 1N9SA 2P4TA 3EHRA 2RHYA 3PIPA 4Y91A 1YIJA 4LN2A 2I40B 1YCYA 4JDSA 3MI9B 1C9BA 3VKIA 3A8GB 3I55T 1F1BB 3OYNA 2W0ZA 4LE9A 3M58A 3OW2S 3BLRB 2LQWA 4RCCA 3J7AF 2CP7A 1VQMT 2PZ1A 1WHMA 1GUXA 2QGFB 1MMNA 1MUZA 2K79A 4BY7X 1UHCA 2B8AA 2AIRB 2J6FA 2LX9A 1KHIA 2DERA 1LOJA 2CS7A 2UZBB 2C0TA 1M27C 3G71T 2VXFA 2QG9B 2LJ0A 2AKKA 3JB9F 4DA4A 3RGFB 2DXCB 3MKDA 4AG1C 2WHBB 1RI0A 1Y57A 1NEBA 3OMGA 4PK4A 2K3BA 3HFNA 1JJ2P 4F7UB 4F7UA 4M7AG 2WXVB 1G3TA 2NYSA 4XAXB 2X4WA 1S1NA 2GTOA 3C94A 1G2BA 5IAYA 2LCLA 4XTZA 2CDTA 2E5KA 2IW6B 3EG3A 4ORZA 3M0UA 3QKJA 2ZPFB 5HCKA 4GY5A 1BIBA 2P0KA 2AHJB 2QQAA 4EOMB 5I5ZB 4ZN1A 4XTVA 3JV3A 2W99A 3BFMA 3G33B 4N4HA 3TNWB 1VYTA 2D8JA 1MNEA 1T3SA 2HQEA 1SSFA 2PJQA 2YSQA 3CBOA 3M5AA 2K5LA 1XQHA 2BZ8A 2QTXA 4Y92A 1VQLT 4M7AC 2JUFA 3B57A 4Q5WA 3V8JA 3DB3A 1YIJT 1BK2A 3VS2A 5L23A 5FU7C 4OB0B 3OYGA 2QI2A 3QJ6A 1VQ5Q 1VQKQ 4BCIB 5IXBA 2RMOA 4IIOA 1KHCA 1PNJA 2DXBB 4M78C 4ELZC 2A08A 2DILA 1NJIU 2RPNA 2ATCB 2LC4A 1ZQ1A 2JTMA 1PWTA 2EYZA 1M90U 3H41A 4BE1A 3TU4K 2R57A 2FHDA 1BU2A 2G3RA 2CUBA 2KXCA 2RD1A 2ZCFB 2ESWA 4M78G 3CCMQ 3L2RA 1W2BA 4KRCB 2HL3A 3OYMA 5CKEA 1RL2A 2QQBA 2XHCA 4AFSC 1UGVA 2EVRA 3M4GA 1BIAA 1D1CA 2LMJA 4MMKA 2QQSA 2MK5A 4N4IA 1OI9B 2KRSA 5KYYB 1I0CA 4QQ6A 4JPBW 3O8VA 4QVCA 2RHIA 4L59A 2X4YA 2LTOA 2VWFA 1SG5A 1B3QA 2V26A 1TH7A 2HD0A 2HQHA 3CXCP 3M56A 1N8RC 2CCHB 1JJ2S 2MOXA 3L2WA 1BI2A 3TN8B 1UG1A 2O9SA 3TNIB 1IO6A 5CR2A 4GBQA 1ZUKA 4PLIA 3BHVB 3OMCA 4ESRA 2CZ1B 1NYGA 2KK4A 3QG1A 4VUBA 2CP2A 1YI2T 2DM1A 3G71Q 3MEAA 4E7HA 2OJ2A 4MZPA 3OYEA 1TUCA 1VOLA 4X1VA 3X24B 3P8DA 1FMVA 4QQGA 1I5OB 2EYYA 3CPWP 4IUQA 4RTTA 2OX7A 4RTWA 1H26B 1GRIA 4IIMA 2GFAA 2X3WD 3C0CA 4J7IA 1XJWB 5J3BA 3JCMc 2K3XA 3OS5A 3QIIA 2WSEE 2XD0A 3L2UA 1VQPQ 3JRZA 3L2ZA 2RQWA 2L5QA 3EG2A 2KYMA 8ATCB 3VYHB 4JRIA 1SHFA 2AKLA 2JNGA 5GAN3 2UZEB 5GAMh 1XO2A 4F7UE 2DXCA 2H3JA 2HBPA 2G77A 4M7DG 2PU9B 4BD3A 3I5SA 1NLPC 3CCSA 1M8MA 1OPLA 2GQIA 3QBYA 3RKXA 5IN1A 3GOXA 4K11A 4BXXX 1WX6A 2VUBA 3NHNA 1NLOC 4BUGA 3WVDB 1CSKA 7AT1B 4CRLB 2MAMA 1QLBA 2KE9A 4AMCA 3CCSQ 3RKYA 2JXBA 5GANh 3VV0A 5L8RE 3TQ7P 2H8HA 4HVUA 2CP3A 2CT3A 3JCMe 2VKNA 4F6WB 2MI6A 4LXCA 4JX5A 4AKIA 4M77C 1WXUA 1TXQA 4OF1A 4EOIB 2VASA 3CPWS 1WQWA 1NEGA 2CGHA 1VYVA 1UE9A 3G4ST 1W98B 4CI0C 2XKOC 1HYOA 2OI3A 3I56T 3ZBDA 3OS1A 4JRQA 3E9GA 2A36A 4WF2A 2V22B 2KGTA 2QEXA 1X43A 2RN8A 1ZSZB 1TU0B 5BNJB 2QQRA 5FRMA 4E7JA 2BKDN 1G3WA 2DO3A 1WHGA 4LD6A 3VUBA 2QDLA 4CC4B 3OBWA 4KGZB 2EYXA 4QVDA 1XTDA 2W10A 2HEQA 3PTAA 2PK9B 4LOCA 1X2KA 3HRTA 1Y96B 2COWA 3OS0A 2JJ9A 1Q82R 1SEMA 2K2VA 1OX8A 2P0QA 2F2WA 4OB3B 4CXAB 3DL1A 3JB9D 2IW8B 2RK1A 1HXDA 2LP5A 1M2OA 5GJWB 1HD3A 2EKHA 3TREA 2DL4A 2EQJA 1Y96A 4PFPA 1B34A 5DM7R 2YLCA 4C92G 1YJWA 2YWWA 1GFCA 5HBEB 2JM9A 4EMHA 4AI6A 4F7JB 3QWXX 3CCVQ 2LNHB 3CCJA 5GAMj 2E3HA 2A3LA 1KQSA 3A8OB 4F7UF 3CCET 3A8MB 1OPKA 2LQ8A 1VQ4T 5CCAA 3EOCB 2CSQA 2VGMA 2MF2A 2IPOB 2FO0A 1WA7A 5AYFA 2X1NB 2P0PA 4QSHA 2DZ9A 4EOPB 1V1CA 5I2MA 4RUGA 1VQOA 1QW1A 5LJ3f 1WHJA 2QDYB 3QZ5B 3M53A 4B9WA 2ED1A 1FWZA 4HNVA 1YFNA 1VQ9T 2HZYA 4FCYA 4OMMA 3C4SA 2MYSA 5FLXE 3CMAQ 1K9MU 1ZX6A 2DTHA 2KMTA 2W9FA 2RHZA 3UWNA 1H4LD 2IVXA 2CP5A 2CREA 2MIOA 4RMOA 3FB9A 2RF0A 4QQDA 4C92A 2Z0WA 4WCIA 2B9RA 2PQWA 3A1PA 4AFQC 1M5Q1 1FXXA 3JCMQ 5KYWA 1CKAA 1W4SA 4OGRB 3MIAB 3G1JA 2PVOB 5CKDA 5GANf 3FJ5A 1TFBA 1S72A 2LNVA 3LWHA 3H0IA 2K57A 3H0HA 2E5QA 3M54A 1YITQ 2WSCE 4ZNXA 2RHXA 4HVVA 1WYXA 2KI7A 1K0XA 2O9VA 1SKUB 2CKKA 4M6VA 2KBTA 4BDZA 3TVTA 4OB1B 4LNPA 4II5B 1H1RB 2ENMA 2PMIB 3VS6A 1Z9QA 4C5IA 3D7SB 4RTVA 4LDYA 3L2QA 3VS3A 2RQUA 2C6TB 4HCKA 4E7KA 5ICPB 5GAOn 2BE7D 2KAFA 2HSPA 2MCNA 5GMKj 1VQPA 2RJEA 1G83A 2LX7A 2EIFA 1O9KB 3J80E 1VQ6T 4RCBA 1K9MR 5GMKh 2HNIA 4E47A 2BKZB 4TVRA 1IXDA 3CEYA 2PTKA 1AD6A 3JCMb 4MDXA 1JXOA 4X9DA 3OSSC 2WMAB 2DNUA 2QTVA 2V1RA 1PD1A 4GLMA 1M3AA 5DQVA 1E6HA 2RJDA 4C8QB 3CCVT 2YDLA 1H24B 1H8KA 3EFRA 1AISB 3INZA 5I11A 2QEXQ 1M30A 5AT1B 5FU6C 5GAMf 2CSIA 2KNBB 1WDXA 1BBZA 2VYTA 5CO7A 3ZEHA 1OQKA 2DFUA 1QLYA 4F16A 2FL7A 2I2LA 5ACBA 1WLPB 3SHWA 2CJMB 3JB9I 3KUFA 3MY5B 1RAHB 1SHGA 3BG5A 5IXFA 4F7UG 2DD4A 4B9XA 1PSFA 4R56A 9ATCB 2FPEA 3WVEB 4FIBA 1G8XA 1YWPA 3QYBA 2VXEA 2F5TX 6AT1B 1PRLC 3CC2A 5I22A 4LUDA 3HKSA 1VIEA 3POMA 4LDWA 4HNUA 1IGUA 3AHUA 1JOWA 2EJGA 4J9HA 1H3ZA 4JZ3A 3PO3S 1Q86C 4R0KA 1WHKA 5GMKe 1YBYA 3BDLA 4J6WA 4J9GA 5KYXA 4XU0A 5CYIB 5FRNA 3VRYA 1SPKA 1IGQA 2C5NB 1M2VA 3SEMA 2NLUA 4B6MA 1Q82U 5LJ3g 2G9XB 3JCMP 3MY1B 3LQ5B 3DDQB 2RNAA 4Y28E 2A28A 1OGUB 5DLOA 5J26A 3QHSA 1QCOA 3VRZA 3T9NA 3VS1A 5EJCA 4CFXB 1UJYA 5CAIA 3MO8A 1BKBA 4RODA 1T0HA 4CC7A 3NDQA 4FM4B 3R6OA 3JCMg 4X34A 1WXBA 3X26B 4G6LB 2RI5A 1GCQC 1TTHB 1WPYA 3R6NA 1QCFA 1VQ8A 1AWWA 4J9BA 2LQKA 5HBHB 2YT6A 2LJ3A 3IQLA 4ANJA 1AHJB 2XG8D 1VQ6Q 2D6FA 2WMBB 5GMKl 2XIDA 3M0RA 3OA6A 2AK5A 1H92A 2W2HA 4NOYA 4ELJA 4ATOA 3CMEA 4NL2A 3CCLQ 4MZMA 1VYWB 4J7FA 1YJWT 1Q81R 1D3UB 2FYKA 4M78D 3DDPB 3OYIA 1X01A 2LQNA 2EQMA 3G7ZA 4HCCA 4M7DF 2DD5A 4M77B 5CIUA 4UN0A 2FZKB 5HY6A 2BZXA 3QJYA 1MMGA 3I56Q 1VQ9Q 2FB7A 1VQ6A 1H1SB 2M0YA 5FWBA 2HKQB 1Q86U 4J8OA 3E2UA 3HO8A 2D8HA 3PVLA 1QVFP 4L6V5 2HDAA 1LJOA 3H0FA 4N0AC 2E65A 2K7AA 3TEEA 4BBRM 5KH6A 1TS9A 1OI1A 5GAN6 1KC8R 1TD6A 1NYFA 1X75C 4QVZA 5HK0A 5CK9A 3EGDA 4C0FA 2ROLA 2IW9B 2ZPBB 2DD4B 1YHQA 4XU3A 1IZ6A 1I8FA 1PRMC 1QVGP 2RJFA 3C12A 1KQ1A 1H1QB 4OB2B 1PCXA 2Y90A 3VUZA 2CP6A 1R8OB 3CC7Q 2EYQA 1ZSGA 2MWOA 2YRCA 3QHWB 3EG9A 1IRXA 4CFVB 1A0NB 3CCMT 2QXFA 4QKUA 5LQFB 3VS0A 4EOJB 1M2VB 1VQ8Q 3EG1A 4BE0A 4C0DB 1V29B 2F69A 3P8BB 1GXIE 1KD1U 2XDBA 5GANg 3GIBA 1OV3A 4R55A 4M7DC 2L8DA 3CC4Q 2JT4A 3PT9A 4EPCA 1KJWA 2PVDB 1IHVA 4BCHB 4E7ZA 1K9AA 1H27B 2EGEA 2ZZDB 3CPFA 2HMAA 1VQ5T 4M78F 4I3ZB 1RAAB 2MMPA 3BG3A 2XICA 3FJPA 2PUKB 1C0MA 2GF7A 1NJIR 2QAZA 2QK0A 4M75F 3HPWA 3MP1A 5D6XA 3OQ5A 1KXUA 4BCQB 3UT1A 5EC7A 3S3MA 3I55Q 4F6UB 3OW2A 1M1GA 1VQ4A 3EJ1B 3NGPA 1B7TA 1Q7YR 4F17A 4A4EA 5FROA 4BI4A 4PNOA 1TUGB 3L2VA 3X20B 3EG0A 1K76A 3J81E 3SB2A 3CCEA 1RAGB 4EOKB 3OYJA 1VQ7A 4ME7A 2DL8A 4C92B 4DBFA 2XDPA 2CCIB 2ZPGB 4BCOB 2JMAA 2KQWA 1VQOT 5HKCA 1ZA2B 1JJ2A 2DTOA 4FT2A 1SSHA 1O9SA 1OIYB 1ZBJA 1H3HA 4FW2A 3CCUA 2OTLQ 1EFNA 2EQIA 3JCMd 3QUIA 1I1JA 2COZA 1UECA 1TG0A 4NSTB 1WI7A 3GF5A 2DD5B 1OOTA 2O4XA 2E10A 4IUTA 2K3YA 4EC9B 1YIJQ 1ZSZC 2DTIA 4WTOB 1K8AC 4XK8E 2I0NA 3ZL7C 1OYXA 2XMFA 1YJNA 2EGAA 5LJ3e 4EOOB 4JLIA 5LJ3j 3CD6Q 3CCLT 3QWLA 2L0AA 4IURA 3KXTA 2NUPA 1VQNA 1C6VX 1P5EB 1RLPC 2KRNA 1VOMA 5L2WB 5GAMd 2CYZB 4A54A 1YHQT 5HBJB 1VQMQ 1Z9ZA 3CCMA 3PMIA 2FG0A 4FL6A 2L3SA 4DBHA 3QYHB 2GQVA 2DK3A 3A5ZB 4EMGA 3CC2Q 2J6KA 4EOSB 1UNHD 1Q7YU 1X27A 5GAOq 3CCRA 1VQ4Q 2K6DA 3S3NA 3VYGA 3BG9A 3HL8A 4E2FB 3JCMV 1OKWB 2C0OA 1M1KU 4EMKC 1VQPT 5LL6S 2QEXT 1PC0A 3SWNA 3BDUA 3ER0A 2X9HA 2DL5A 1JQQA 4M7AB
chains in the Genus database with same CATH topology
1WJRA 4UC4A 5CVIA 1BI3A 2ZPEB 2E6ZA 2QDJA 2M0OA 2E41A 1WJQA 1NE8A 2E5QA 2K57A 2OAUA 3M54A 3RUXA 5IT9E 2JOYA 4Z6YA 2WSCE 2LVMA 5CQXA 2RHXA 5A0LA 1VQ9A 3LX7A 1E7PA 3NTIA 3CCRT 5DLQE 2KY9A 2CKKA 4M6VA 4JUVA 4GLKA 2Y4XA 2R5AA 4HNTA 3BY7A 1UGQB 4BDZA 4M7AA 4OB1B 4BY6B 3JCMX 3CCST 3QZ9B 2EJFA 3URGA 4L5GA 3UDCA 5LJ3h 3MEUA 3OYHA 4EMKA 3L1AA 4O6JA 3CCQT 2OTLT 2KDSA 4C92F 1N9SA 3CC2T 2P4TA 3GLXA 2RHYA 2F5KA 4C5IA 2ZGWA 3PIPA 4LDYA 4Y91A 1YIJA 1OZ2A 3L2QA 1YCYA 4JDSA 5GAOl 4JJNK 2BS2A 4ZTFA 3VKIA 2EJ9A 3QSUA 3A8GB 3I55T 3JSCA 2JTFA 5GAN8 2Y4YA 1G3SA 5GAOn 1N6AA 2KAFA 5D6WA 3OYNA 3RIRA 3M58A 3HSBA 3OW2S 3CCUT 1QVFA 4BBSM 1VQNT 5GMKj 4RCCA 1VQPA 2RJEA 3J7AF 4JX4A 5EG2A 3QXEB 2EIFA 2GFUA 2IG0A 4EMKB 3JCMf 3J80E 1VQ6T 4PKCC 4RCBA 1VQMT 4MIMA 2V8JA 4ELYC 5KCHA 1YJNT 5GMKh 2HNIA 2E70A 1O75A 4E47A 5GANe 1W2BS 4TVRA 2JVVA 3CEYA 5HK3A 3QPHA 2CZ0B 1Y71A 3JCMb 4OGEA 3VU3C 4MDXA 5CKFA 2B8AA 4J83A 4X9DA 4O5VA 3OSSC 1UGRB 3OB9A 2LX9A 1KHIA 2K4YA 1LOJA 2FVUA 3H8ZA 2CS7A 4C92D 4ZTJA 4LDXA 3C95A 3G71T 4DQ2A 1JBMA 2VXFA 3CCLA 2ZPHB 4AKGA 2RJDA 4C8QB 3CCVT 4DA4A 3EFSA 3JB9F 3SWNB 2DXCB 3EFRA 4A4GA 1M4ZA 3INZA 4FU6A 1RI0A 4M75G 3CC4T 3OMGA 4M77F 5FU6C 3HFNA 5GAMf 4F7UB 2VYTA 4F7UA 5CO7A 3ZEHA 1NPRA 3S3OA 4M7AG 2X4JA 4A53A 4M75D 4FSXA 3CMAA 3FLGA 3MCAB 4N0AA 1G3TA 2FL7A 2BS4A 1QVGS 2I2LA 4PLLA 4XAXB 3VKGA 1M8VA 2X4WA 2EFIA 4P5NA 3JB9I 1KQ2A 1FKMA 5GMKi 3KUFA 2PUOB 3C94A 1KC8C 3BG5A 4BI8B 4F7UG 2LCCA 2DD4A 2LCLA 4XTZA 5IAYA 4B9XA 1QVPA 4JRQA 1PSFA 4R56A 3QKJA 2ZPFB 3WVEB 4YTLA 4FIBA 4HA8A 4GY5A 1BIBA 2P0KA 3QYBA 4MFEA 3LH0A 2VXEA 2ZPIB 2F5TX 2AHJB 2QQAA 4XTUA 5CKBA 2HQXA 2WACA 4ZN1A 3CMET 3CC2A 4XTVA 2DJZA 3BFMA 4N4HA 3HKSA 3ASKA 3G6EA 4KUDK 1VIEA 2HQEA 4LDWA 4HNUA 1XNIA 1VQKA 1SSFA 1YJ9A 3AHUA 3PIOA 5FU6B 1QVFS 3CBOA 2EJGA 3M5AA 1UEBA 1DJ7B 3H6ZA 1H3ZA 2K5LA 4M77G 1XQHA 2E6NA 5GAOp 1D3BB 1Q86C 2QTXA 2EQUA 5GMKe 4J6YA 1YBYA 3BDLA 1VQLT 4J6WA 4M7AC 3HP9A 4ATOA 3CCQA 4XU0A 2JUFA 2OTLA 4Q5WA 2XDDA 5FRNA 3DLMA 4MDWA 1M1KC 1H641 2BUDA 3OY9A 3V8JA 3DB3A 2X4XA 1YIJT 3RMQA 1K9MC 4C92E 2NLUA 2LT4A 2O4XB 4IUUA 4RG2A 1Q82U 2E1HA 5FU7C 4OB0B 3MP6A 5LJ3g 3OYGA 3JCMP 2QI2A 3MHXA 3HRUA 3QJ6A 2EWNA 1OZ3A 3KHIA 3M55A 3Q1JA 2QFZA 3H4CA 1KHCA 3HRSA 4Y28E 3RESA 5GAN2 2DXBB 5CKHA 3G6ET 3CD6A 4M78C 4PJOG 3X25B 1N8RU 4ELZC 5DLOA 5J26A 3V7RA 3F70A 3A8LB 3QHSA 1NJIU 3T9NA 4C8QG 5LJ5g 4M7DA 5KE3A 3V8LA 5EJCA 4OVAA 5CAIA 2LC4A 3MO8A 1ZQ1A 1BKBA 2JTMA 3E1SA 1VQLA 5GAMg 4M75A 3NFCA 4M75B 5LJ3d 4ZGDB 1M90U 4FM4B 3GNGA 3PFSA 4BE1A 3TU4K 3R6OA 3JCMg 5C0MA 3OS2A 2R57A 2FHDA 3ME9A 2RHUA 4X34A 3OYFA 3WXMB 4FT4A 3X26B 2G3RA 2RI5A 1MHNA 2RD1A 4M78G 2ZCFB 2C06A 5D6YA 2V8IA 3L2RA 1W2BA 3OYMA 2L3RA 1KD1C 5CKEA 5GAN4 1Q81U 1WPYA 1RL2A 2QQBA 4NC6A 2RB6A 2XHCA 3FIFA 4BY6C 1VQ8A 4M77D 4BB7A 1N27A 1M1FA 2LQKA 3M4GA 1UGPB 3EAEA 5J39A 1BIAA 4MMKA 2QQSA 4N4IA 3CC7T 1AHJB 3MEVA 2XG8D 4HT8A 3JCMJ 2D6FA 3OYCA 1KC8U 3QDRB 4QQ6A 5GMKl 2XIDA 3O8VA 3OA6A 4M78E 4C5HA 2DIGA 4ELJA 2RHIA 3CBMA 3N5BB 4L59A 4NOYA 2X4YA 4QVCA 2LTOA 3CMEA 3RERA 4NL2A 4M7AE 1WQ7A 4MZMA 1FX7A 2M16A 2DAQA 4J7FA 1YJWT 1TH7A 4M78D 2FYKA 2HD0A 3OYIA 1I5LA 4BE2A 4M75C 1X01A 3M56A 1G3YA 1N8RC 1JJ2S 4IUVA 3LWIA 3VYGB 2EQMA 3G7ZA 3L2WA 1BI2A 4HCCA 4LD9K 1LNXA 3P8HA 3HB9A 2DD5A 4M77B 5CIUA 3JCMW 1UB4A 2YRVA 5HY6A 4C8QE 4DOWA 4PJOD 2QQ8A 1KG1A 5CR2A 2KVQG 3S6WA 4OMFB 3QJYA 3M9QA 3FEOA 4JRKA 3HBLA 4PLIA 4ZGEB 3OMCA 3X28B 2FB7A 1VQ6A 2XI9A 4IUPA 4RKUE 1Q86U 2CZ1B 1YITT 1NZ9A 4J8OA 3HO8A 4A4FA 2KK4A 4KUIA 3QG1A 4VUBA 3MP8A 1YI2T 3TW7A 4C92C 3MEAA 4BACA 5M9OA 4E7HA 4L6V5 4PJOB 4MZPA 3OYEA 3FC3A 3DLLA 1LJOA 4N0AC 2E65A 3TEEA 3X24B 3P8DA 4CRIA 4BBRM 3I56A 1Q81C 4QQGA 4C0ZA 4Z02A 5KH6A 4IUQA 2RI3A 4HCZA 4C8QC 1OI1A 2JN0A 5GAN6 5A0GA 4E7LA 4HT9A 3RKWA 5LJ5f 1X75C 5HK0A 4QVZA 3V7CA 3QYGB 5CK9A 2BS3A 3SDZA 4C0FA 2GFAA 2ZPBB 2VV5A 2DD4B 4J7IA 1YHQA 1Y07A 5J3BA 3JCMc 3PMTA 1PSEA 1IZ6A 1I8FA 1I81A 2E64A 2K3XA 3OS5A 3QIIA 4XU3A 3SD4A 4MFDA 3NTKA 2WSEE 2RJFA 3L2UA 3C12A 1U1SA 5GANj 2XD0A 3GPLA 4JLGA 4M7AD 1KQ1A 3KBGA 4KBMB 3OYBA 3JRZA 3OYKA 5GAOm 4OB2B 2Y90A 3L2ZA 4HLQA 3VUZA 4XTXA 3QO3A 5GAN7 4IKFA 3CD6T 4M7DB 2L5QA 2RI2A 5GAN5 5FU7B 1BI0A 1QP2A 2V8KA 1YJ9T 4M78B 4LDUA 1R8OB 3VYHB 3CBPA 4JRIA 2EYQA 2O01E 2DXBA 2JNGA 3LW5E 2MWOA 2R58A 1Y7XA 4J5YA 5GAN3 4PJOA 3MEWA 4II1A 5GAMh 1XOVA 4F7UE 2DXCA 2H3JA 2HBPA 1K73C 2G77A 4JS5A 4C8QA 2PU9B 4E7IA 4BD3A 2A7YA 1VQ5A 3HZJA 1N9RA 1VUBA 2EKOA 2R5MA 5I21A 2VGNA 3CCMT 4JX6A 2QXFA 3CCSA 2QA4T 2OTJA 2CZ7B 4A4HA 3QBYA 3RKXA 3CMAT 5IN1A 5CQYA 1YI2A 3GOXA 4M7AB 2JZ2A 2EAYA 2VUBA 4MMLA 4BUGA 4HL4A 3WVDB 2YLBA 4D6WA 4C0DB 4BE0A 1V29B 1ZBXA 2F69A 3P8BB 4C0GA 2K5IA 1GXIE 4QW2A 2MAMA 1VQKT 3TW6A 2M1HA 1KD1U 1QLBA 3VKHA 4BI3A 2XDBA 3RKYA 5GANg 2RO0A 2DIQA 3CCJT 3GIBA 5GANh 4XTYA 5L8RE 2L8DA 4ZGJB 3VV0A 4R55A 3PT9A 4M7DC 4KULA 2EQKA 4EPCA 1BYMA 4HKEA 3JCMe 2PVDB 2D0QB 2MI6A 2YHTA 4JX5A 4LDVA 3VJPA 2KR6A 3JB9J 2ZZDB 2RM4A 3CPFA 4AKIA 5GAOr 3QYEA 2KSSA 4M77C 4HCBA 4M7DF 2DVEA 4M78F 1VQ5T 4PJOE 1JRIA 2MMPA 3BG3A 2XICA 4OF1A 2KMGA 5LJ5e 3OYLA 3FJPA 3CPWS 4M7AF 2PUKB 3JCMh 1WQWA 2CZ6B 2CGHA 2GF7A 1Q7YC 2ZZDA 4XU2A 4X9CA 3G4ST 1QVGA 2DXUA 4CI0C 2XKOC 3I56T 5A0DA 4M75F 3HPWA 3ZBDA 3OS1A 2K5FA 3E9GA 3M4YA 3MP1A 5D6XA 4WF2A 4BDYA 2QEXA 3OQ5A 4M7DE 3OSVA 2WSFE 1VQ8T 4C8QF 3JB9G 3UT1A 2LT1A 4C5GA 2QQRA 5FRMA 4E7JA 2BKDN 1YITA 1G3WA 2DO3A 4LD6A 3S3MA 1VQMA 3VUBA 4M7DG 3CPWA 3OW2A 1M1GA 3OBWA 1VQ4A 4PJOC 4PL6A 2RK2A 4QVDA 1XTDA 4A4EA 4ZN3A 5FROA 4A4KA 4BI4A 3PTAA 4PNOA 4LOCA 4XQ3A 3JAME 3HRTA 3L2VA 3X20B 1Y96B 4OP0A 2L89A 3OS0A 3I55A 1M90C 3J81E 3SB2A 3CCEA 2K2VA 2P0QA 1K8AU 3NTHA 3OYDA 5LJ5j 3OYJA 4OB3B 1VQ7A 1P92A 2E12A 3DL1A 4ME7A 1WNLA 2RK1A 3SFMA 3JB9D 1HXDA 2DXTA 3DB4A 3LYIA 4C92B 4NL3A 1JB0E 3GP8A 1U8RA 4AKHA 3PNWC 4DOVA 3L42A 3TREA 1WJSA 2XDPA 4M78A 1NJIC 2ZPGB 2GCXA 2DPPB 5DY9A 5C6SA 3CC7A 1X6OA 4XTWA 5LJ5d 2KQWA 1U1TA 1VQOT 3OYYA 1KQSS 1S72T 5HKCA 1JJ2A 2IVWA 2WJ9A 2EQJA 2DZCA 3V7SA 4V2SA 1Y96A 2DTOA 4FT2A 1B34A 5DM7R 1K73U 1NPPA 1O9SA 1MGQA 2YLCA 3G4SA 4C92G 3CCUA 2DEQA 5KE2A 1YJWA 3JCMd 1VIFA 1EIFA 3QUIA 2HAXA 4EMHA 4AI6A 2RJCA 2X35A 3GF5A 4M77A 2DD5B 3CCJA 2O4XA 5GAMj 2XU8A 2A3LA 1I4K1 1KQSA 3A8OB 1M9SA 3M59A 3META 4F7UF 2E10A 3CCET 4IUTA 3A8MB 2K3YA 3RMSA 3V8KA 2DTIA 4N4GA 3CXCS 2QA4A 2LQ8A 5I2SA 1VQ4T 2M9UA 3HHTB 4JRPA 4E7KA 3M57A 2VC8A 5CCAA 1K8AC 4C8QD 3PGGA 2VGMA 2MF2A 2BIVA 2D9TA 3DKMA 3LLRA 4XK8E 3JB9H 4KT0E 1D3BA 4J6XA 5AYFA 1OYXA 2P0PA 2DKGA 4QSHA 2DZ9A 5I2MA 1VQOA 1UGSB 1YJNA 4NS5A 5LJ3e 1QW1A 4JLIA 5LJ3f 2QDYB 4C0DC 3QZ5B 3M53A 4B9WA 5GMKm 1FWZA 4HNVA 3FRNA 5LJ3j 1BI1A 3CXCA 3CCLT 1VQ9T 3QWLA 4IURA 3CCVA 3KXTA 1VQNA 3A8HB 1QP3A 5A2QE 4MZTA 3C4SA 4XU1A 3SWNC 3ZFJA 5FLXE 3E9FA 5GAMd 1K9MU 2CYZB 1IREB 2DTHA 2KMTA 4A54A 2RHZA 1YHQT 3UWNA 3CCMA 3BW1A 3PMIA 2OTJT 4FL6A 2MWPA 5KCOA 4RMOA 4M7DD 4M77E 4PJOF 3FB9A 5GAMe 5LJ5h 3LGLA 3QYHB 2GQVA 4OGCA 1G5VA 3OYAA 2DK3A 3A5ZB 4QQDA 4EMGA 1B34B 3CC4A 3FDRA 4C92A 3LGFA 1Q7YU 5GAOq 3CCRA 2RH2A 4M75E 2LRQA 3HFOA 3OBYA 3S3NA 3VYGA 2PQWA 3BG9A 3E19A 3TCJA 3HL8A 3G71A 2QF7A 3JCMV 1VQ7T 1M5Q1 1FXXA 4EMKC 1WGSA 3JCMQ 3UPUA 1VQPT 2RA2A 1M1KU 5GANd 5LL6S 1W4SA 4EDUA 2QEXT 4JS4A 1Q82C 1HK9A 2LDMA 2PVOB 2XK0A 3SWNA 2PVGB 4C5EA 5CKDA 3BDUA 5GANf 2QQ9A 3ER0A 4RG8A 1S72A 2LNVA 3LWHA 1ZHIA 3GNFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6V 5;  2ZPE B;  3X20 B;  2WSC E;  3X24 B;  1DJ7 B;  4OB3 B;  1UGQ B;  3QYG B;  4OB1 B;  1JB0 E;  3QZ9 B;  2ZPB B;  2DD4 B;  2ZPG B;  2DPP B;  1PSE A;  2WSE E;  4OB2 B;  4OB0 B;  1QP2 A;  3A8G B;  3VYH B;  4Y28 E;  2O01 E;  2DXB B;  2DXB A;  3LW5 E;  3X25 B;  2DD5 B;  3A8O B;  3A8L B;  2DXC A;  3A8M B;  3QXE B;  2PU9 B;  3HHT B;  2CZ7 B;  4ZGD B;  4XK8 E;  4KT0 E;  4FM4 B;  3WVD B;  1V29 B;  1UGS B;  2CZ0 B;  3X26 B;  1GXI E;  2QDY B;  2ZCF B;  3QZ5 B;  1UGR B;  3A8H B;  1QP3 A;  5L8R E;  4ZGJ B;  2ZPH B;  1UGP B;  2PVD B;  2D0Q B;  2CYZ B;  1IRE B;  2DXC B;  1AHJ B;  2ZZD B;  3QYH B;  2PUK B;  2CZ6 B;  2ZZD A;  3VYG A;  3VYG B;  2DD5 A;  2WSF E;  2PUO B;  2DD4 A;  1PSF A;  4ZGE B;  3X28 B;  2PVO B;  2ZPF B;  3WVE B;  4RKU E;  2PVG B;  2CZ1 B;  2ZPI B;  2AHJ B; 
#chains in the Genus database with same CATH topology
 1WJR A;  1YP5 A;  5EFQ B;  2JTE A;  1GCQ A;  2J05 A;  4UC4 A;  2QDJ A;  1D0Y A;  2M0O A;  3HTR A;  2DL7 A;  1TUD A;  4F7N B;  2LVM A;  2KRO A;  5CQX A;  2SEM A;  5A0L A;  3LX7 A;  2FEI A;  1LVK A;  3NTI A;  1OU9 A;  2KY9 A;  3O0G D;  3UA6 A;  4BCN D;  1S72 Q;  4GLK A;  4HNT A;  1UGQ B;  2RQV A;  3URG A;  3QDF A;  4L5G A;  5LJ3 h;  2DME A;  2NUT A;  4EOR B;  3CCQ T;  1PG5 B;  4YOZ A;  3BHT B;  3GLX A;  1JO8 A;  2DRK A;  2F5K A;  2ZGW A;  2FRY A;  1AD5 A;  4ZTF A;  4JJN K;  4KH1 B;  3EID B;  1VQO Q;  2EJ9 A;  3QSU A;  2UUE B;  3JSC A;  2JTF A;  1G3S A;  1N6A A;  3RIR A;  2DET A;  4BY1 X;  3CCU T;  1QVF A;  4BBS M;  1Q86 R;  5EG2 A;  3QXE B;  1R0B G;  2IG0 A;  3JCM f;  4PKC C;  5IHN A;  1PKS A;  5KCH A;  1OUL A;  4JJB A;  1SRL A;  2E70 A;  4J9D A;  2E3I A;  2EPD A;  1MV3 A;  3QPH A;  1Y71 A;  2AZS A;  4OGE A;  1X6G A;  4J83 A;  4O5V A;  1UGR B;  3OB9 A;  2JM8 A;  2K4Y A;  2FVU A;  4ZTJ A;  1LPL A;  4DQ2 A;  3REA B;  1QMC A;  4AKG A;  1F5Q B;  5HVY B;  1OIU B;  4A4G A;  1RAE B;  1YCS B;  4F6S B;  4M75 G;  1IHW A;  1N5Z A;  4CFN B;  4M77 F;  2NWM A;  2EBP A;  1FIN B;  1NPR A;  3S3O A;  1KD1 R;  4A53 A;  4M75 D;  3DOG B;  3FLG A;  3MCA B;  4N0A A;  2BS4 A;  8AT1 B;  1QVG S;  3QHR B;  2O2O A;  3VKG A;  2EGC A;  1KQ2 A;  1FKM A;  3AT1 B;  4BI8 B;  4E7S A;  1AZE A;  2W9Z A;  4AT1 B;  4HA8 A;  3LH0 A;  4MFE A;  5IHI A;  4XTU A;  5CKB A;  2HQX A;  2WAC A;  4EC8 B;  1UFF A;  3RBB B;  4KUD K;  2GBQ A;  1YJ9 A;  1GFD A;  3MJX A;  5IDN B;  1DJ7 B;  1UEB A;  3H6Z A;  2E6N A;  5GAO p;  3A98 A;  1D3B B;  2JGZ B;  2KT8 A;  4J6Y A;  3HP9 A;  3CCQ A;  2XDD A;  1MMA A;  3RMQ A;  2EUF A;  2O4X B;  4BCQ D;  4RG2 A;  2E1H A;  4CFU B;  4PJN A;  3MP6 A;  2EWN A;  2QFZ A;  3H4C A;  5GAN 2;  3CD6 A;  3G6E T;  2X51 A;  4DEX A;  3X25 B;  1YJN Q;  3F70 A;  4J9F A;  2F2C A;  5LJ5 g;  4M7D A;  1ZLM A;  2DX1 A;  3PVQ A;  1VQL A;  5GAM g;  4M75 A;  4M75 B;  4ZGD B;  1TSF A;  4PJO B;  2JS2 A;  3GNG A;  3PFS A;  3ME9 A;  2CP0 A;  4FT4 A;  2QAS A;  4LUE A;  4D8K A;  2C06 A;  2V8I A;  1R0C B;  1Q81 U;  4NC6 A;  2RB6 A;  3FIF A;  4M77 D;  4BB7 A;  1N27 A;  3EAE A;  5J39 A;  1X6B A;  3EHQ A;  3MEV A;  4KH0 B;  3JCM J;  3OYC A;  2ECZ A;  3QDR B;  3RR6 A;  4YOS A;  3N5B B;  3CBM A;  2JS0 A;  3TSZ A;  1GBR A;  1WQ7 A;  4FYW B;  1UHF A;  2CH4 A;  2DAQ A;  2K9G A;  3M0Q A;  1G3Y A;  4IUV A;  1ABO A;  1KIK A;  1LNX A;  1RAB B;  4E6R A;  1ZSZ A;  2YRV A;  4C8Q E;  1KG1 A;  2KVQ G;  3S6W A;  2IIM A;  1H1P B;  3HBL A;  1K4U S;  1FVV B;  3X28 B;  1M3B A;  5IHK A;  1NZ9 A;  1SRM A;  1AWJ A;  1ZA1 B;  4KUI A;  3MP8 A;  3TW7 A;  4C92 C;  1ACM B;  1GL5 A;  2PHG A;  5M9O A;  2JW4 A;  3CCR Q;  3FC3 A;  1BCO A;  2DEU A;  3EG9 B;  4CRI A;  1YNZ A;  4AFZ C;  4KGX B;  1M1K R;  5D7U A;  3I5R A;  1JST B;  4HCZ A;  4C8Q C;  3RKW A;  5LJ5 f;  3V7C A;  2LW4 A;  3QYG B;  2BS3 A;  3SDZ A;  1KK7 A;  2PK2 A;  3PMT A;  1PSE A;  1I81 A;  2IN3 A;  2O31 A;  1VYU A;  3SD4 A;  1PM3 A;  3NTK A;  5GAN j;  4M7A D;  1ZUY A;  4JLG A;  3KBG A;  3EFO A;  4KBM B;  4EON B;  4KGV B;  5GAO m;  3OYK A;  3LWI A;  4XTX A;  3QO3 A;  2JMC A;  2RI2 A;  5GAN 5;  5FU7 B;  5KYU B;  1QP2 A;  4AFU C;  1W2B P;  4M78 B;  3CBP A;  2DXB A;  4BCM B;  2R58 A;  1Y7X A;  4J5Y A;  1LCK A;  4II1 A;  1XOV A;  4ROC A;  3KFV A;  1WFW A;  4JS5 A;  1VQ5 A;  4E7I A;  2A7Y A;  1N9R A;  1VUB A;  2EKO A;  2LZ6 B;  4PJJ A;  5I21 A;  2QA4 T;  1GUX B;  3CMA T;  5CQY A;  1YI2 A;  2L2P A;  2JZ2 A;  2EAY A;  4MML A;  4D6W A;  4HL4 A;  5KYN A;  2YLB A;  1K8A R;  1OX9 A;  2ROT A;  2C4G B;  1VQK T;  4BI3 A;  2GNC A;  3UF4 A;  2M02 A;  2YUN A;  3CCJ T;  4AG2 C;  3H9N A;  1YI2 Q;  1O9K A;  2SRC A;  1RLQ C;  3JB9 J;  2KR6 A;  2RM4 A;  3QYE A;  3M03 A;  4HCB A;  1MMD A;  2DRM A;  1JRI A;  4RTZ A;  2KMG A;  5LJ5 e;  3OYL A;  3JCM h;  1KFZ A;  2CZ6 B;  1QVG A;  2ZZD A;  4XU2 A;  2DXU A;  2NUP B;  3M4Y A;  4BDY A;  4OMN A;  3OSV A;  2WSF E;  4Z8A A;  1UTI A;  1VQ8 T;  4C8Q F;  5FWC A;  5KYY A;  4RTX A;  1N8R R;  4PL6 A;  1E7O A;  4ZN3 A;  1E6G A;  4A4K A;  4BCK B;  3JAM E;  4CFW B;  2P4R A;  2KT1 A;  1M90 C;  2QYZ A;  2QGS A;  4CC2 A;  5LJ5 j;  3OYD A;  3MPU B;  1NBE B;  1WNL A;  3RER A;  3LYI A;  3DB4 A;  4NL3 A;  2FRW A;  1JB0 E;  1U8R A;  1JEG A;  3PNW C;  4M4Z A;  4DOV A;  2DYI A;  1QCN A;  4HVW A;  2GCX A;  1X6O A;  5LJ5 d;  1X69 A;  1KQS S;  1S72 T;  2IVW A;  3ULR B;  4JJC A;  1Y0M A;  1NPP A;  4ROE A;  3G4S A;  3CCQ Q;  2DEQ A;  3EH2 A;  5KE2 A;  1AZG B;  2X35 A;  2RJC A;  2C5X B;  4M77 A;  3M59 A;  4F7L B;  1M9S A;  3VS4 A;  4IMY B;  1FMW A;  2QA4 A;  3V8K A;  4N4G A;  1QWE A;  4DBQ A;  1YJW Q;  2CUD A;  3TSW A;  2M9U A;  3HHT B;  4JRP A;  2VC8 A;  2YUP A;  3PGG A;  4C8Q D;  2YRD A;  1WIE A;  1OL1 B;  2DKG A;  4BCM D;  5FW9 A;  2G6F X;  5GMK m;  3FRN A;  3CXC A;  1BI1 A;  1VQL Q;  1B07 A;  1QMZ B;  1RAF B;  3CME Q;  4MZT A;  3ZFJ A;  1I07 A;  1IB8 A;  2HSE B;  1IRE B;  1KSW A;  3REB B;  3BW1 A;  2LJ1 A;  2MWP A;  5KCO A;  1PKT A;  5GAM e;  3LGL A;  3DJB A;  4HXJ A;  4OGC A;  1G5V A;  1B34 B;  3CC4 A;  3FDR A;  1UJ0 A;  3LGF A;  2ABL A;  4YOO A;  2RH2 A;  2LRQ A;  1FMK A;  1NM7 A;  3HFO A;  3NPF A;  3TCJ A;  2C5V B;  4ELL A;  3G71 A;  2QF7 A;  2A0F B;  2M51 A;  1WGS A;  3UPU A;  2RA2 A;  1D0Z A;  1RI9 A;  4JS4 A;  1W70 A;  1HK9 A;  1OL2 B;  2LDM A;  1J3T A;  2PVG B;  4C5E A;  2QQ9 A;  4J9I A;  1G3N C;  1ZHI A;  3GNF B;  2ZPE B;  2E6Z A;  5KYU A;  2DJQ A;  2E41 A;  1WJQ A;  1NE8 A;  3M0S A;  3RUX A;  1K9M C;  2JOY A;  4Z6Y A;  3UA7 A;  2DYB A;  1VQ9 A;  2C5O B;  3EH1 A;  5DLQ E;  4JUV A;  2CT4 A;  1RAC B;  2BPM B;  1YWO A;  2R5A A;  2Y4X A;  3BY7 A;  4BY6 B;  2YXY A;  2EJF A;  2QA4 Q;  3MEU A;  4EMK A;  1ZP2 A;  1AWX A;  4O6J A;  2OTL T;  1E9H B;  4QT7 A;  2KDS A;  3BE3 A;  1N4M A;  4C92 F;  3CC2 T;  4J9C A;  3M0P A;  1OZ2 A;  4Y72 B;  5GAO l;  2BS2 A;  1ZUU A;  4OR5 B;  2CH4 W;  2OAW A;  2Y4Y A;  5GAN 8;  5D6W A;  2UZD B;  3HSB A;  2W96 A;  2HL5 C;  1T3L A;  1VQN T;  2KRM A;  1VQN Q;  4JX4 A;  2GFU A;  4EMK B;  2AT1 B;  2EW3 A;  4MIM A;  2V8J A;  4ELY C;  1YJN T;  2F1L A;  1O75 A;  1W2B S;  4F04 B;  5GAN e;  2JVV A;  5HK3 A;  1QQJ A;  2CZ0 B;  4FYX B;  3OW2 P;  1JSU B;  3VU3 C;  1NG2 A;  5CKF A;  4DEY A;  4D8D A;  4PJM A;  1UNG D;  4LDX A;  4C92 D;  2A37 A;  3H8Z A;  1ENW A;  3C95 A;  1JBM A;  3CCL A;  3F5X B;  1VA7 A;  3TNH B;  2ZPH B;  2PNI A;  3EFS A;  3SWN B;  4FW1 A;  2R7G A;  1M4Z A;  4FU6 A;  2J7I A;  1MND A;  3CC4 T;  2GGR A;  2F2X A;  2LCS A;  1AOJ A;  2X4J A;  4JZ4 A;  4FSX A;  1D1A A;  3CMA A;  4OMQ A;  2DE0 X;  1MV0 B;  2DMO A;  4PLL A;  2D0N A;  1M8V A;  2EFI A;  4P5N A;  1JU5 C;  5GMK i;  1K73 R;  3PE0 A;  2ED0 A;  2PUO B;  4JJD A;  1KC8 C;  3CQT A;  2LCC A;  4PFZ A;  1QVP A;  1YJ9 Q;  2COY A;  4YTL A;  3QWY A;  3U23 A;  4Z89 A;  2ZPI B;  4BCJ B;  1VIN A;  3CME T;  2DJZ A;  1D1B A;  3ASK A;  3G6E A;  1VQK A;  1XNI A;  5HQ0 B;  3PIO A;  5FU6 B;  1QVF S;  1GY3 B;  4M77 G;  2EQU A;  3CCU Q;  2OTL A;  3DLM A;  2VB6 A;  4MDW A;  2FZC B;  1M1K C;  1H64 1;  1WHH A;  2BUD A;  3OY9 A;  2YUQ A;  2X4X A;  1K0S A;  1QKX A;  4C92 E;  2LT4 A;  4IUU A;  5KYX B;  3MHX A;  3HRU A;  1AT1 B;  2J06 A;  4Z88 A;  1OZ3 A;  3KHI A;  3M55 A;  3Q1J A;  3HRS A;  3RES A;  5CKH A;  4PJO G;  3RNJ A;  1N8R U;  3V7R A;  3A8L B;  4C8Q G;  5KE3 A;  3V8L A;  4OVA A;  4FYY B;  3E1S A;  2DA9 A;  3NFC A;  4F7S B;  5LJ3 d;  4PJL A;  5C0M A;  3OS2 A;  2HBW A;  2RHU A;  3OYF A;  3WXM B;  1MHN A;  5D6Y A;  2E4H A;  1GCP A;  2L3R A;  1KD1 C;  1H28 B;  5GAN 4;  4BY6 C;  4EOQ B;  1KQS P;  1D09 B;  1M1F A;  1UGP B;  3CC7 T;  4HT8 A;  1M90 R;  1KC8 U;  1R77 A;  2D1X A;  4M78 E;  1U3O A;  2K2M A;  3M0T A;  4C5H A;  2DIG A;  1JXM A;  4M7A E;  1FX7 A;  2M16 A;  3BLQ B;  1ARK A;  1I5L A;  4BE2 A;  4M75 C;  3VYG B;  4LD9 K;  3CCE Q;  3VS7 A;  3P8H A;  3HB9 A;  3JCM W;  1C1A A;  1UB4 A;  4DOW A;  4PJO D;  2QQ8 A;  4OMF B;  4KRT A;  3M9Q A;  3FEO A;  4JRK A;  4ZGE B;  2V1Q A;  2XI9 A;  4IUP A;  1UUE A;  4RKU E;  5ECA A;  1YIT T;  4FYV B;  4A4F A;  4DBR A;  1BU1 A;  1UNL D;  3GBQ A;  4BAC A;  1EZZ B;  5DQW A;  1AEY A;  3DLL A;  1JKW A;  3I56 A;  2DL3 A;  1Q81 C;  4C0Z A;  4Z02 A;  2RI3 A;  4TTH A;  4CFU D;  1X2Q A;  2JN0 A;  5A0G A;  4E7L A;  4HT9 A;  1QWF A;  2WIH B;  1QKW A;  2HKN A;  2VV5 A;  1D0X A;  1Y07 A;  5HNB B;  1TWB A;  2E64 A;  1BCM A;  4MFD A;  1U1S A;  3I9Q A;  3OYB A;  4BCF B;  1T0J A;  4IKF A;  5GAN 7;  4HLQ A;  2J6O A;  4M7D B;  4BCG B;  3CD6 T;  1BI0 A;  2V8K A;  1YJ9 T;  2OTJ Q;  4LDU A;  2O01 E;  3DTO A;  4YC3 B;  2RQR A;  3LW5 E;  4PJO A;  2YUO A;  3MEW A;  2O88 A;  2WFY B;  1K73 C;  4C8Q A;  3HZJ A;  3G4S Q;  2R5M A;  2VGN A;  2OTJ A;  4JX6 A;  2WIP B;  4FX3 B;  2CZ7 B;  4A4H A;  4CC3 A;  4EOL B;  1ZBX A;  4C0G A;  2DLP A;  2K5I A;  4QW2 A;  3TW6 A;  2NUZ A;  2M1H A;  3VKH A;  3BLH B;  1URC B;  2RO0 A;  2DIQ A;  1AVZ C;  4BCN B;  4XTY A;  4ZGJ B;  2KR3 A;  1BYM A;  4KUL A;  2EQK A;  2FPF A;  4HKE A;  2P84 A;  2D0Q B;  2YHT A;  4LDV A;  3VJP A;  1OKV B;  2H3E B;  5GAO r;  1WXT A;  2KSS A;  2DVE A;  4PJO E;  3I35 A;  4M7A F;  1Q7Y C;  4X9C A;  5IF1 B;  5A0D A;  3THK A;  2K5F A;  2FZG B;  1GH6 B;  4M7D E;  4A63 B;  5GJV B;  3EGU A;  3JB9 G;  2LT1 A;  4C5G A;  1WZO A;  2ZAE A;  1ABQ A;  1YIT A;  2B86 A;  2HCK A;  2QGG A;  1VQM A;  3CPW A;  2F2V A;  1YHQ Q;  1OU8 A;  4CFM B;  2GTJ A;  4PJO C;  2RK2 A;  3EFO B;  4XQ3 A;  4OP0 A;  1M3C A;  2L89 A;  4F14 A;  5IH2 A;  3I55 A;  1RAD B;  3EGX B;  2EYW A;  1K8A U;  3NTH A;  1SF9 A;  1P92 A;  2E12 A;  2RQT A;  3SFM A;  2DXT A;  3GP8 A;  4AKH A;  5KYW B;  3LH5 A;  3L42 A;  1WJS A;  4M78 A;  1NJI C;  3CC7 A;  5C6S A;  1H25 B;  2DPP B;  5DY9 A;  1TOV A;  4XTW A;  1U1T A;  3OYY A;  2KXD A;  1U06 A;  2AZV A;  2WJ9 A;  3V7S A;  2DZC A;  4V2S A;  1K73 U;  5IDP B;  1MGQ A;  1RAI B;  1RUW A;  4OMP A;  2DBK A;  1VIF A;  1EIF A;  3EGX A;  1V76 A;  2HAX A;  1PD0 A;  4FSS A;  1OEB A;  1GBQ A;  2XU8 A;  5CEI B;  1I4K 1;  3MET A;  3RMS A;  3CXC S;  2WPA B;  5I2S A;  2DBM A;  4KRD B;  3M57 A;  4OMO A;  3JB9 H;  2BIV A;  2D9T A;  3LLR A;  3DKM A;  2KYB A;  4PFO A;  4KT0 E;  1D3B A;  4J6X A;  3VS5 A;  1K1Z A;  2DF6 A;  3CCJ Q;  5LMK B;  3EGD B;  1UGS B;  4NS5 A;  2KEA A;  4C0D C;  1PKD B;  2FPD A;  2VVK A;  4BCP B;  3CCV A;  3A8H B;  1QP3 A;  5A2Q E;  1EX4 A;  4XU1 A;  3SWN C;  1YN8 A;  3E9F A;  1Q95 G;  2MPX C;  2I53 A;  2OTJ T;  1U5S A;  4M7D D;  3NMZ C;  5FGK B;  4M77 E;  4PJO F;  4EIK A;  1HJD A;  5LJ5 h;  2DVJ A;  2WEV B;  2L3Q A;  3OYA A;  3K7A M;  2C0I A;  4J9E A;  4M75 E;  3OBY A;  3E19 A;  1VQ7 T;  2UZL B;  1CKB A;  5GAN d;  2BE9 B;  4EDU A;  1UDL A;  2NUT B;  1Q82 C;  2XK0 A;  3UAT A;  1VQ7 Q;  4RG8 A;  4RTY A;  3GPL A;  5CVI A;  1BI3 A;  2OAU A;  3O5Z A;  5IT9 E;  1AWO A;  4OML A;  1HSQ A;  4RTU A;  3GTM S;  1W1F A;  1E7P A;  1PHT A;  3CCR T;  1FYN A;  1BB9 A;  5IHY A;  1W6X A;  4M7A A;  1WHL A;  3CCS T;  3JCM X;  2BZY A;  3BHU B;  3QZ9 B;  3G6E Q;  4F70 B;  2BTT A;  2L3P A;  3UDC A;  3OYH A;  3RDV A;  3L1A A;  2X3X D;  1N9S A;  2P4T A;  3EHR A;  2RHY A;  3PIP A;  4Y91 A;  1YIJ A;  4LN2 A;  2I40 B;  1YCY A;  4JDS A;  3MI9 B;  1C9B A;  3VKI A;  3A8G B;  3I55 T;  1F1B B;  3OYN A;  2W0Z A;  4LE9 A;  3M58 A;  3OW2 S;  3BLR B;  2LQW A;  4RCC A;  3J7A F;  2CP7 A;  1VQM T;  2PZ1 A;  1WHM A;  1GUX A;  2QGF B;  1MMN A;  1MUZ A;  2K79 A;  4BY7 X;  1UHC A;  2B8A A;  2AIR B;  2J6F A;  2LX9 A;  1KHI A;  2DER A;  1LOJ A;  2CS7 A;  2UZB B;  2C0T A;  1M27 C;  3G71 T;  2VXF A;  2QG9 B;  2LJ0 A;  2AKK A;  3JB9 F;  4DA4 A;  3RGF B;  2DXC B;  3MKD A;  4AG1 C;  2WHB B;  1RI0 A;  1Y57 A;  1NEB A;  3OMG A;  4PK4 A;  2K3B A;  3HFN A;  1JJ2 P;  4F7U B;  4F7U A;  4M7A G;  2WXV B;  1G3T A;  2NYS A;  4XAX B;  2X4W A;  1S1N A;  2GTO A;  3C94 A;  1G2B A;  5IAY A;  2LCL A;  4XTZ A;  2CDT A;  2E5K A;  2IW6 B;  3EG3 A;  4ORZ A;  3M0U A;  3QKJ A;  2ZPF B;  5HCK A;  4GY5 A;  1BIB A;  2P0K A;  2AHJ B;  2QQA A;  4EOM B;  5I5Z B;  4ZN1 A;  4XTV A;  3JV3 A;  2W99 A;  3BFM A;  3G33 B;  4N4H A;  3TNW B;  1VYT A;  2D8J A;  1MNE A;  1T3S A;  2HQE A;  1SSF A;  2PJQ A;  2YSQ A;  3CBO A;  3M5A A;  2K5L A;  1XQH A;  2BZ8 A;  2QTX A;  4Y92 A;  1VQL T;  4M7A C;  2JUF A;  3B57 A;  4Q5W A;  3V8J A;  3DB3 A;  1YIJ T;  1BK2 A;  3VS2 A;  5L23 A;  5FU7 C;  4OB0 B;  3OYG A;  2QI2 A;  3QJ6 A;  1VQ5 Q;  1VQK Q;  4BCI B;  5IXB A;  2RMO A;  4IIO A;  1KHC A;  1PNJ A;  2DXB B;  4M78 C;  4ELZ C;  2A08 A;  2DIL A;  1NJI U;  2RPN A;  2ATC B;  2LC4 A;  1ZQ1 A;  2JTM A;  1PWT A;  2EYZ A;  1M90 U;  3H41 A;  4BE1 A;  3TU4 K;  2R57 A;  2FHD A;  1BU2 A;  2G3R A;  2CUB A;  2KXC A;  2RD1 A;  2ZCF B;  2ESW A;  4M78 G;  3CCM Q;  3L2R A;  1W2B A;  4KRC B;  2HL3 A;  3OYM A;  5CKE A;  1RL2 A;  2QQB A;  2XHC A;  4AFS C;  1UGV A;  2EVR A;  3M4G A;  1BIA A;  1D1C A;  2LMJ A;  4MMK A;  2QQS A;  2MK5 A;  4N4I A;  1OI9 B;  2KRS A;  5KYY B;  1I0C A;  4QQ6 A;  4JPB W;  3O8V A;  4QVC A;  2RHI A;  4L59 A;  2X4Y A;  2LTO A;  2VWF A;  1SG5 A;  1B3Q A;  2V26 A;  1TH7 A;  2HD0 A;  2HQH A;  3CXC P;  3M56 A;  1N8R C;  2CCH B;  1JJ2 S;  2MOX A;  3L2W A;  1BI2 A;  3TN8 B;  1UG1 A;  2O9S A;  3TNI B;  1IO6 A;  5CR2 A;  4GBQ A;  1ZUK A;  4PLI A;  3BHV B;  3OMC A;  4ESR A;  2CZ1 B;  1NYG A;  2KK4 A;  3QG1 A;  4VUB A;  2CP2 A;  1YI2 T;  2DM1 A;  3G71 Q;  3MEA A;  4E7H A;  2OJ2 A;  4MZP A;  3OYE A;  1TUC A;  1VOL A;  4X1V A;  3X24 B;  3P8D A;  1FMV A;  4QQG A;  1I5O B;  2EYY A;  3CPW P;  4IUQ A;  4RTT A;  2OX7 A;  4RTW A;  1H26 B;  1GRI A;  4IIM A;  2GFA A;  2X3W D;  3C0C A;  4J7I A;  1XJW B;  5J3B A;  3JCM c;  2K3X A;  3OS5 A;  3QII A;  2WSE E;  2XD0 A;  3L2U A;  1VQP Q;  3JRZ A;  3L2Z A;  2RQW A;  2L5Q A;  3EG2 A;  2KYM A;  8ATC B;  3VYH B;  4JRI A;  1SHF A;  2AKL A;  2JNG A;  5GAN 3;  2UZE B;  5GAM h;  1XO2 A;  4F7U E;  2DXC A;  2H3J A;  2HBP A;  2G77 A;  4M7D G;  2PU9 B;  4BD3 A;  3I5S A;  1NLP C;  3CCS A;  1M8M A;  1OPL A;  2GQI A;  3QBY A;  3RKX A;  5IN1 A;  3GOX A;  4K11 A;  4BXX X;  1WX6 A;  2VUB A;  3NHN A;  1NLO C;  4BUG A;  3WVD B;  1CSK A;  7AT1 B;  4CRL B;  2MAM A;  1QLB A;  2KE9 A;  4AMC A;  3CCS Q;  3RKY A;  2JXB A;  5GAN h;  3VV0 A;  5L8R E;  3TQ7 P;  2H8H A;  4HVU A;  2CP3 A;  2CT3 A;  3JCM e;  2VKN A;  4F6W B;  2MI6 A;  4LXC A;  4JX5 A;  4AKI A;  4M77 C;  1WXU A;  1TXQ A;  4OF1 A;  4EOI B;  2VAS A;  3CPW S;  1WQW A;  1NEG A;  2CGH A;  1VYV A;  1UE9 A;  3G4S T;  1W98 B;  4CI0 C;  2XKO C;  1HYO A;  2OI3 A;  3I56 T;  3ZBD A;  3OS1 A;  4JRQ A;  3E9G A;  2A36 A;  4WF2 A;  2V22 B;  2KGT A;  2QEX A;  1X43 A;  2RN8 A;  1ZSZ B;  1TU0 B;  5BNJ B;  2QQR A;  5FRM A;  4E7J A;  2BKD N;  1G3W A;  2DO3 A;  1WHG A;  4LD6 A;  3VUB A;  2QDL A;  4CC4 B;  3OBW A;  4KGZ B;  2EYX A;  4QVD A;  1XTD A;  2W10 A;  2HEQ A;  3PTA A;  2PK9 B;  4LOC A;  1X2K A;  3HRT A;  1Y96 B;  2COW A;  3OS0 A;  2JJ9 A;  1Q82 R;  1SEM A;  2K2V A;  1OX8 A;  2P0Q A;  2F2W A;  4OB3 B;  4CXA B;  3DL1 A;  3JB9 D;  2IW8 B;  2RK1 A;  1HXD A;  2LP5 A;  1M2O A;  5GJW B;  1HD3 A;  2EKH A;  3TRE A;  2DL4 A;  2EQJ A;  1Y96 A;  4PFP A;  1B34 A;  5DM7 R;  2YLC A;  4C92 G;  1YJW A;  2YWW A;  1GFC A;  5HBE B;  2JM9 A;  4EMH A;  4AI6 A;  4F7J B;  3QWX X;  3CCV Q;  2LNH B;  3CCJ A;  5GAM j;  2E3H A;  2A3L A;  1KQS A;  3A8O B;  4F7U F;  3CCE T;  3A8M B;  1OPK A;  2LQ8 A;  1VQ4 T;  5CCA A;  3EOC B;  2CSQ A;  2VGM A;  2MF2 A;  2IPO B;  2FO0 A;  1WA7 A;  5AYF A;  2X1N B;  2P0P A;  4QSH A;  2DZ9 A;  4EOP B;  1V1C A;  5I2M A;  4RUG A;  1VQO A;  1QW1 A;  5LJ3 f;  1WHJ A;  2QDY B;  3QZ5 B;  3M53 A;  4B9W A;  2ED1 A;  1FWZ A;  4HNV A;  1YFN A;  1VQ9 T;  2HZY A;  4FCY A;  4OMM A;  3C4S A;  2MYS A;  5FLX E;  3CMA Q;  1K9M U;  1ZX6 A;  2DTH A;  2KMT A;  2W9F A;  2RHZ A;  3UWN A;  1H4L D;  2IVX A;  2CP5 A;  2CRE A;  2MIO A;  4RMO A;  3FB9 A;  2RF0 A;  4QQD A;  4C92 A;  2Z0W A;  4WCI A;  2B9R A;  2PQW A;  3A1P A;  4AFQ C;  1M5Q 1;  1FXX A;  3JCM Q;  5KYW A;  1CKA A;  1W4S A;  4OGR B;  3MIA B;  3G1J A;  2PVO B;  5CKD A;  5GAN f;  3FJ5 A;  1TFB A;  1S72 A;  2LNV A;  3LWH A;  3H0I A;  2K57 A;  3H0H A;  2E5Q A;  3M54 A;  1YIT Q;  2WSC E;  4ZNX A;  2RHX A;  4HVV A;  1WYX A;  2KI7 A;  1K0X A;  2O9V A;  1SKU B;  2CKK A;  4M6V A;  2KBT A;  4BDZ A;  3TVT A;  4OB1 B;  4LNP A;  4II5 B;  1H1R B;  2ENM A;  2PMI B;  3VS6 A;  1Z9Q A;  4C5I A;  3D7S B;  4RTV A;  4LDY A;  3L2Q A;  3VS3 A;  2RQU A;  2C6T B;  4HCK A;  4E7K A;  5ICP B;  5GAO n;  2BE7 D;  2KAF A;  2HSP A;  2MCN A;  5GMK j;  1VQP A;  2RJE A;  1G83 A;  2LX7 A;  2EIF A;  1O9K B;  3J80 E;  1VQ6 T;  4RCB A;  1K9M R;  5GMK h;  2HNI A;  4E47 A;  2BKZ B;  4TVR A;  1IXD A;  3CEY A;  2PTK A;  1AD6 A;  3JCM b;  4MDX A;  1JXO A;  4X9D A;  3OSS C;  2WMA B;  2DNU A;  2QTV A;  2V1R A;  1PD1 A;  4GLM A;  1M3A A;  5DQV A;  1E6H A;  2RJD A;  4C8Q B;  3CCV T;  2YDL A;  1H24 B;  1H8K A;  3EFR A;  1AIS B;  3INZ A;  5I11 A;  2QEX Q;  1M30 A;  5AT1 B;  5FU6 C;  5GAM f;  2CSI A;  2KNB B;  1WDX A;  1BBZ A;  2VYT A;  5CO7 A;  3ZEH A;  1OQK A;  2DFU A;  1QLY A;  4F16 A;  2FL7 A;  2I2L A;  5ACB A;  1WLP B;  3SHW A;  2CJM B;  3JB9 I;  3KUF A;  3MY5 B;  1RAH B;  1SHG A;  3BG5 A;  5IXF A;  4F7U G;  2DD4 A;  4B9X A;  1PSF A;  4R56 A;  9ATC B;  2FPE A;  3WVE B;  4FIB A;  1G8X A;  1YWP A;  3QYB A;  2VXE A;  2F5T X;  6AT1 B;  1PRL C;  3CC2 A;  5I22 A;  4LUD A;  3HKS A;  1VIE A;  3POM A;  4LDW A;  4HNU A;  1IGU A;  3AHU A;  1JOW A;  2EJG A;  4J9H A;  1H3Z A;  4JZ3 A;  3PO3 S;  1Q86 C;  4R0K A;  1WHK A;  5GMK e;  1YBY A;  3BDL A;  4J6W A;  4J9G A;  5KYX A;  4XU0 A;  5CYI B;  5FRN A;  3VRY A;  1SPK A;  1IGQ A;  2C5N B;  1M2V A;  3SEM A;  2NLU A;  4B6M A;  1Q82 U;  5LJ3 g;  2G9X B;  3JCM P;  3MY1 B;  3LQ5 B;  3DDQ B;  2RNA A;  4Y28 E;  2A28 A;  1OGU B;  5DLO A;  5J26 A;  3QHS A;  1QCO A;  3VRZ A;  3T9N A;  3VS1 A;  5EJC A;  4CFX B;  1UJY A;  5CAI A;  3MO8 A;  1BKB A;  4ROD A;  1T0H A;  4CC7 A;  3NDQ A;  4FM4 B;  3R6O A;  3JCM g;  4X34 A;  1WXB A;  3X26 B;  4G6L B;  2RI5 A;  1GCQ C;  1TTH B;  1WPY A;  3R6N A;  1QCF A;  1VQ8 A;  1AWW A;  4J9B A;  2LQK A;  5HBH B;  2YT6 A;  2LJ3 A;  3IQL A;  4ANJ A;  1AHJ B;  2XG8 D;  1VQ6 Q;  2D6F A;  2WMB B;  5GMK l;  2XID A;  3M0R A;  3OA6 A;  2AK5 A;  1H92 A;  2W2H A;  4NOY A;  4ELJ A;  4ATO A;  3CME A;  4NL2 A;  3CCL Q;  4MZM A;  1VYW B;  4J7F A;  1YJW T;  1Q81 R;  1D3U B;  2FYK A;  4M78 D;  3DDP B;  3OYI A;  1X01 A;  2LQN A;  2EQM A;  3G7Z A;  4HCC A;  4M7D F;  2DD5 A;  4M77 B;  5CIU A;  4UN0 A;  2FZK B;  5HY6 A;  2BZX A;  3QJY A;  1MMG A;  3I56 Q;  1VQ9 Q;  2FB7 A;  1VQ6 A;  1H1S B;  2M0Y A;  5FWB A;  2HKQ B;  1Q86 U;  4J8O A;  3E2U A;  3HO8 A;  2D8H A;  3PVL A;  1QVF P;  4L6V 5;  2HDA A;  1LJO A;  3H0F A;  4N0A C;  2E65 A;  2K7A A;  3TEE A;  4BBR M;  5KH6 A;  1TS9 A;  1OI1 A;  5GAN 6;  1KC8 R;  1TD6 A;  1NYF A;  1X75 C;  4QVZ A;  5HK0 A;  5CK9 A;  3EGD A;  4C0F A;  2ROL A;  2IW9 B;  2ZPB B;  2DD4 B;  1YHQ A;  4XU3 A;  1IZ6 A;  1I8F A;  1PRM C;  1QVG P;  2RJF A;  3C12 A;  1KQ1 A;  1H1Q B;  4OB2 B;  1PCX A;  2Y90 A;  3VUZ A;  2CP6 A;  1R8O B;  3CC7 Q;  2EYQ A;  1ZSG A;  2MWO A;  2YRC A;  3QHW B;  3EG9 A;  1IRX A;  4CFV B;  1A0N B;  3CCM T;  2QXF A;  4QKU A;  5LQF B;  3VS0 A;  4EOJ B;  1M2V B;  1VQ8 Q;  3EG1 A;  4BE0 A;  4C0D B;  1V29 B;  2F69 A;  3P8B B;  1GXI E;  1KD1 U;  2XDB A;  5GAN g;  3GIB A;  1OV3 A;  4R55 A;  4M7D C;  2L8D A;  3CC4 Q;  2JT4 A;  3PT9 A;  4EPC A;  1KJW A;  2PVD B;  1IHV A;  4BCH B;  4E7Z A;  1K9A A;  1H27 B;  2EGE A;  2ZZD B;  3CPF A;  2HMA A;  1VQ5 T;  4M78 F;  4I3Z B;  1RAA B;  2MMP A;  3BG3 A;  2XIC A;  3FJP A;  2PUK B;  1C0M A;  2GF7 A;  1NJI R;  2QAZ A;  2QK0 A;  4M75 F;  3HPW A;  3MP1 A;  5D6X A;  3OQ5 A;  1KXU A;  4BCQ B;  3UT1 A;  5EC7 A;  3S3M A;  3I55 Q;  4F6U B;  3OW2 A;  1M1G A;  1VQ4 A;  3EJ1 B;  3NGP A;  1B7T A;  1Q7Y R;  4F17 A;  4A4E A;  5FRO A;  4BI4 A;  4PNO A;  1TUG B;  3L2V A;  3X20 B;  3EG0 A;  1K76 A;  3J81 E;  3SB2 A;  3CCE A;  1RAG B;  4EOK B;  3OYJ A;  1VQ7 A;  4ME7 A;  2DL8 A;  4C92 B;  4DBF A;  2XDP A;  2CCI B;  2ZPG B;  4BCO B;  2JMA A;  2KQW A;  1VQO T;  5HKC A;  1ZA2 B;  1JJ2 A;  2DTO A;  4FT2 A;  1SSH A;  1O9S A;  1OIY B;  1ZBJ A;  1H3H A;  4FW2 A;  3CCU A;  2OTL Q;  1EFN A;  2EQI A;  3JCM d;  3QUI A;  1I1J A;  2COZ A;  1UEC A;  1TG0 A;  4NST B;  1WI7 A;  3GF5 A;  2DD5 B;  1OOT A;  2O4X A;  2E10 A;  4IUT A;  2K3Y A;  4EC9 B;  1YIJ Q;  1ZSZ C;  2DTI A;  4WTO B;  1K8A C;  4XK8 E;  2I0N A;  3ZL7 C;  1OYX A;  2XMF A;  1YJN A;  2EGA A;  5LJ3 e;  4EOO B;  4JLI A;  5LJ3 j;  3CD6 Q;  3CCL T;  3QWL A;  2L0A A;  4IUR A;  3KXT A;  2NUP A;  1VQN A;  1C6V X;  1P5E B;  1RLP C;  2KRN A;  1VOM A;  5L2W B;  5GAM d;  2CYZ B;  4A54 A;  1YHQ T;  5HBJ B;  1VQM Q;  1Z9Z A;  3CCM A;  3PMI A;  2FG0 A;  4FL6 A;  2L3S A;  4DBH A;  3QYH B;  2GQV A;  2DK3 A;  3A5Z B;  4EMG A;  3CC2 Q;  2J6K A;  4EOS B;  1UNH D;  1Q7Y U;  1X27 A;  5GAO q;  3CCR A;  1VQ4 Q;  2K6D A;  3S3N A;  3VYG A;  3BG9 A;  3HL8 A;  4E2F B;  3JCM V;  1OKW B;  2C0O A;  1M1K U;  4EMK C;  1VQP T;  5LL6 S;  2QEX T;  1PC0 A;  3SWN A;  3BDU A;  3ER0 A;  2X9H A;  2DL5 A;  1JQQ A;  4M7A B; 
#chains in the Genus database with same CATH homology
 1WJR A;  4UC4 A;  5CVI A;  1BI3 A;  2ZPE B;  2E6Z A;  2QDJ A;  2M0O A;  2E41 A;  1WJQ A;  1NE8 A;  2E5Q A;  2K57 A;  2OAU A;  3M54 A;  3RUX A;  5IT9 E;  2JOY A;  4Z6Y A;  2WSC E;  2LVM A;  5CQX A;  2RHX A;  5A0L A;  1VQ9 A;  3LX7 A;  1E7P A;  3NTI A;  3CCR T;  5DLQ E;  2KY9 A;  2CKK A;  4M6V A;  4JUV A;  4GLK A;  2Y4X A;  2R5A A;  4HNT A;  3BY7 A;  1UGQ B;  4BDZ A;  4M7A A;  4OB1 B;  4BY6 B;  3JCM X;  3CCS T;  3QZ9 B;  2EJF A;  3URG A;  4L5G A;  3UDC A;  5LJ3 h;  3MEU A;  3OYH A;  4EMK A;  3L1A A;  4O6J A;  3CCQ T;  2OTL T;  2KDS A;  4C92 F;  1N9S A;  3CC2 T;  2P4T A;  3GLX A;  2RHY A;  2F5K A;  4C5I A;  2ZGW A;  3PIP A;  4LDY A;  4Y91 A;  1YIJ A;  1OZ2 A;  3L2Q A;  1YCY A;  4JDS A;  5GAO l;  4JJN K;  2BS2 A;  4ZTF A;  3VKI A;  2EJ9 A;  3QSU A;  3A8G B;  3I55 T;  3JSC A;  2JTF A;  5GAN 8;  2Y4Y A;  1G3S A;  5GAO n;  1N6A A;  2KAF A;  5D6W A;  3OYN A;  3RIR A;  3M58 A;  3HSB A;  3OW2 S;  3CCU T;  1QVF A;  4BBS M;  1VQN T;  5GMK j;  4RCC A;  1VQP A;  2RJE A;  3J7A F;  4JX4 A;  5EG2 A;  3QXE B;  2EIF A;  2GFU A;  2IG0 A;  4EMK B;  3JCM f;  3J80 E;  1VQ6 T;  4PKC C;  4RCB A;  1VQM T;  4MIM A;  2V8J A;  4ELY C;  5KCH A;  1YJN T;  5GMK h;  2HNI A;  2E70 A;  1O75 A;  4E47 A;  5GAN e;  1W2B S;  4TVR A;  2JVV A;  3CEY A;  5HK3 A;  3QPH A;  2CZ0 B;  1Y71 A;  3JCM b;  4OGE A;  3VU3 C;  4MDX A;  5CKF A;  2B8A A;  4J83 A;  4X9D A;  4O5V A;  3OSS C;  1UGR B;  3OB9 A;  2LX9 A;  1KHI A;  2K4Y A;  1LOJ A;  2FVU A;  3H8Z A;  2CS7 A;  4C92 D;  4ZTJ A;  4LDX A;  3C95 A;  3G71 T;  4DQ2 A;  1JBM A;  2VXF A;  3CCL A;  2ZPH B;  4AKG A;  2RJD A;  4C8Q B;  3CCV T;  4DA4 A;  3EFS A;  3JB9 F;  3SWN B;  2DXC B;  3EFR A;  4A4G A;  1M4Z A;  3INZ A;  4FU6 A;  1RI0 A;  4M75 G;  3CC4 T;  3OMG A;  4M77 F;  5FU6 C;  3HFN A;  5GAM f;  4F7U B;  2VYT A;  4F7U A;  5CO7 A;  3ZEH A;  1NPR A;  3S3O A;  4M7A G;  2X4J A;  4A53 A;  4M75 D;  4FSX A;  3CMA A;  3FLG A;  3MCA B;  4N0A A;  1G3T A;  2FL7 A;  2BS4 A;  1QVG S;  2I2L A;  4PLL A;  4XAX B;  3VKG A;  1M8V A;  2X4W A;  2EFI A;  4P5N A;  3JB9 I;  1KQ2 A;  1FKM A;  5GMK i;  3KUF A;  2PUO B;  3C94 A;  1KC8 C;  3BG5 A;  4BI8 B;  4F7U G;  2LCC A;  2DD4 A;  2LCL A;  4XTZ A;  5IAY A;  4B9X A;  1QVP A;  4JRQ A;  1PSF A;  4R56 A;  3QKJ A;  2ZPF B;  3WVE B;  4YTL A;  4FIB A;  4HA8 A;  4GY5 A;  1BIB A;  2P0K A;  3QYB A;  4MFE A;  3LH0 A;  2VXE A;  2ZPI B;  2F5T X;  2AHJ B;  2QQA A;  4XTU A;  5CKB A;  2HQX A;  2WAC A;  4ZN1 A;  3CME T;  3CC2 A;  4XTV A;  2DJZ A;  3BFM A;  4N4H A;  3HKS A;  3ASK A;  3G6E A;  4KUD K;  1VIE A;  2HQE A;  4LDW A;  4HNU A;  1XNI A;  1VQK A;  1SSF A;  1YJ9 A;  3AHU A;  3PIO A;  5FU6 B;  1QVF S;  3CBO A;  2EJG A;  3M5A A;  1UEB A;  1DJ7 B;  3H6Z A;  1H3Z A;  2K5L A;  4M77 G;  1XQH A;  2E6N A;  5GAO p;  1D3B B;  1Q86 C;  2QTX A;  2EQU A;  5GMK e;  4J6Y A;  1YBY A;  3BDL A;  1VQL T;  4J6W A;  4M7A C;  3HP9 A;  4ATO A;  3CCQ A;  4XU0 A;  2JUF A;  2OTL A;  4Q5W A;  2XDD A;  5FRN A;  3DLM A;  4MDW A;  1M1K C;  1H64 1;  2BUD A;  3OY9 A;  3V8J A;  3DB3 A;  2X4X A;  1YIJ T;  3RMQ A;  1K9M C;  4C92 E;  2NLU A;  2LT4 A;  2O4X B;  4IUU A;  4RG2 A;  1Q82 U;  2E1H A;  5FU7 C;  4OB0 B;  3MP6 A;  5LJ3 g;  3OYG A;  3JCM P;  2QI2 A;  3MHX A;  3HRU A;  3QJ6 A;  2EWN A;  1OZ3 A;  3KHI A;  3M55 A;  3Q1J A;  2QFZ A;  3H4C A;  1KHC A;  3HRS A;  4Y28 E;  3RES A;  5GAN 2;  2DXB B;  5CKH A;  3G6E T;  3CD6 A;  4M78 C;  4PJO G;  3X25 B;  1N8R U;  4ELZ C;  5DLO A;  5J26 A;  3V7R A;  3F70 A;  3A8L B;  3QHS A;  1NJI U;  3T9N A;  4C8Q G;  5LJ5 g;  4M7D A;  5KE3 A;  3V8L A;  5EJC A;  4OVA A;  5CAI A;  2LC4 A;  3MO8 A;  1ZQ1 A;  1BKB A;  2JTM A;  3E1S A;  1VQL A;  5GAM g;  4M75 A;  3NFC A;  4M75 B;  5LJ3 d;  4ZGD B;  1M90 U;  4FM4 B;  3GNG A;  3PFS A;  4BE1 A;  3TU4 K;  3R6O A;  3JCM g;  5C0M A;  3OS2 A;  2R57 A;  2FHD A;  3ME9 A;  2RHU A;  4X34 A;  3OYF A;  3WXM B;  4FT4 A;  3X26 B;  2G3R A;  2RI5 A;  1MHN A;  2RD1 A;  4M78 G;  2ZCF B;  2C06 A;  5D6Y A;  2V8I A;  3L2R A;  1W2B A;  3OYM A;  2L3R A;  1KD1 C;  5CKE A;  5GAN 4;  1Q81 U;  1WPY A;  1RL2 A;  2QQB A;  4NC6 A;  2RB6 A;  2XHC A;  3FIF A;  4BY6 C;  1VQ8 A;  4M77 D;  4BB7 A;  1N27 A;  1M1F A;  2LQK A;  3M4G A;  1UGP B;  3EAE A;  5J39 A;  1BIA A;  4MMK A;  2QQS A;  4N4I A;  3CC7 T;  1AHJ B;  3MEV A;  2XG8 D;  4HT8 A;  3JCM J;  2D6F A;  3OYC A;  1KC8 U;  3QDR B;  4QQ6 A;  5GMK l;  2XID A;  3O8V A;  3OA6 A;  4M78 E;  4C5H A;  2DIG A;  4ELJ A;  2RHI A;  3CBM A;  3N5B B;  4L59 A;  4NOY A;  2X4Y A;  4QVC A;  2LTO A;  3CME A;  3RER A;  4NL2 A;  4M7A E;  1WQ7 A;  4MZM A;  1FX7 A;  2M16 A;  2DAQ A;  4J7F A;  1YJW T;  1TH7 A;  4M78 D;  2FYK A;  2HD0 A;  3OYI A;  1I5L A;  4BE2 A;  4M75 C;  1X01 A;  3M56 A;  1G3Y A;  1N8R C;  1JJ2 S;  4IUV A;  3LWI A;  3VYG B;  2EQM A;  3G7Z A;  3L2W A;  1BI2 A;  4HCC A;  4LD9 K;  1LNX A;  3P8H A;  3HB9 A;  2DD5 A;  4M77 B;  5CIU A;  3JCM W;  1UB4 A;  2YRV A;  5HY6 A;  4C8Q E;  4DOW A;  4PJO D;  2QQ8 A;  1KG1 A;  5CR2 A;  2KVQ G;  3S6W A;  4OMF B;  3QJY A;  3M9Q A;  3FEO A;  4JRK A;  3HBL A;  4PLI A;  4ZGE B;  3OMC A;  3X28 B;  2FB7 A;  1VQ6 A;  2XI9 A;  4IUP A;  4RKU E;  1Q86 U;  2CZ1 B;  1YIT T;  1NZ9 A;  4J8O A;  3HO8 A;  4A4F A;  2KK4 A;  4KUI A;  3QG1 A;  4VUB A;  3MP8 A;  1YI2 T;  3TW7 A;  4C92 C;  3MEA A;  4BAC A;  5M9O A;  4E7H A;  4L6V 5;  4PJO B;  4MZP A;  3OYE A;  3FC3 A;  3DLL A;  1LJO A;  4N0A C;  2E65 A;  3TEE A;  3X24 B;  3P8D A;  4CRI A;  4BBR M;  3I56 A;  1Q81 C;  4QQG A;  4C0Z A;  4Z02 A;  5KH6 A;  4IUQ A;  2RI3 A;  4HCZ A;  4C8Q C;  1OI1 A;  2JN0 A;  5GAN 6;  5A0G A;  4E7L A;  4HT9 A;  3RKW A;  5LJ5 f;  1X75 C;  5HK0 A;  4QVZ A;  3V7C A;  3QYG B;  5CK9 A;  2BS3 A;  3SDZ A;  4C0F A;  2GFA A;  2ZPB B;  2VV5 A;  2DD4 B;  4J7I A;  1YHQ A;  1Y07 A;  5J3B A;  3JCM c;  3PMT A;  1PSE A;  1IZ6 A;  1I8F A;  1I81 A;  2E64 A;  2K3X A;  3OS5 A;  3QII A;  4XU3 A;  3SD4 A;  4MFD A;  3NTK A;  2WSE E;  2RJF A;  3L2U A;  3C12 A;  1U1S A;  5GAN j;  2XD0 A;  3GPL A;  4JLG A;  4M7A D;  1KQ1 A;  3KBG A;  4KBM B;  3OYB A;  3JRZ A;  3OYK A;  5GAO m;  4OB2 B;  2Y90 A;  3L2Z A;  4HLQ A;  3VUZ A;  4XTX A;  3QO3 A;  5GAN 7;  4IKF A;  3CD6 T;  4M7D B;  2L5Q A;  2RI2 A;  5GAN 5;  5FU7 B;  1BI0 A;  1QP2 A;  2V8K A;  1YJ9 T;  4M78 B;  4LDU A;  1R8O B;  3VYH B;  3CBP A;  4JRI A;  2EYQ A;  2O01 E;  2DXB A;  2JNG A;  3LW5 E;  2MWO A;  2R58 A;  1Y7X A;  4J5Y A;  5GAN 3;  4PJO A;  3MEW A;  4II1 A;  5GAM h;  1XOV A;  4F7U E;  2DXC A;  2H3J A;  2HBP A;  1K73 C;  2G77 A;  4JS5 A;  4C8Q A;  2PU9 B;  4E7I A;  4BD3 A;  2A7Y A;  1VQ5 A;  3HZJ A;  1N9R A;  1VUB A;  2EKO A;  2R5M A;  5I21 A;  2VGN A;  3CCM T;  4JX6 A;  2QXF A;  3CCS A;  2QA4 T;  2OTJ A;  2CZ7 B;  4A4H A;  3QBY A;  3RKX A;  3CMA T;  5IN1 A;  5CQY A;  1YI2 A;  3GOX A;  4M7A B;  2JZ2 A;  2EAY A;  2VUB A;  4MML A;  4BUG A;  4HL4 A;  3WVD B;  2YLB A;  4D6W A;  4C0D B;  4BE0 A;  1V29 B;  1ZBX A;  2F69 A;  3P8B B;  4C0G A;  2K5I A;  1GXI E;  4QW2 A;  2MAM A;  1VQK T;  3TW6 A;  2M1H A;  1KD1 U;  1QLB A;  3VKH A;  4BI3 A;  2XDB A;  3RKY A;  5GAN g;  2RO0 A;  2DIQ A;  3CCJ T;  3GIB A;  5GAN h;  4XTY A;  5L8R E;  2L8D A;  4ZGJ B;  3VV0 A;  4R55 A;  3PT9 A;  4M7D C;  4KUL A;  2EQK A;  4EPC A;  1BYM A;  4HKE A;  3JCM e;  2PVD B;  2D0Q B;  2MI6 A;  2YHT A;  4JX5 A;  4LDV A;  3VJP A;  2KR6 A;  3JB9 J;  2ZZD B;  2RM4 A;  3CPF A;  4AKI A;  5GAO r;  3QYE A;  2KSS A;  4M77 C;  4HCB A;  4M7D F;  2DVE A;  4M78 F;  1VQ5 T;  4PJO E;  1JRI A;  2MMP A;  3BG3 A;  2XIC A;  4OF1 A;  2KMG A;  5LJ5 e;  3OYL A;  3FJP A;  3CPW S;  4M7A F;  2PUK B;  3JCM h;  1WQW A;  2CZ6 B;  2CGH A;  2GF7 A;  1Q7Y C;  2ZZD A;  4XU2 A;  4X9C A;  3G4S T;  1QVG A;  2DXU A;  4CI0 C;  2XKO C;  3I56 T;  5A0D A;  4M75 F;  3HPW A;  3ZBD A;  3OS1 A;  2K5F A;  3E9G A;  3M4Y A;  3MP1 A;  5D6X A;  4WF2 A;  4BDY A;  2QEX A;  3OQ5 A;  4M7D E;  3OSV A;  2WSF E;  1VQ8 T;  4C8Q F;  3JB9 G;  3UT1 A;  2LT1 A;  4C5G A;  2QQR A;  5FRM A;  4E7J A;  2BKD N;  1YIT A;  1G3W A;  2DO3 A;  4LD6 A;  3S3M A;  1VQM A;  3VUB A;  4M7D G;  3CPW A;  3OW2 A;  1M1G A;  3OBW A;  1VQ4 A;  4PJO C;  4PL6 A;  2RK2 A;  4QVD A;  1XTD A;  4A4E A;  4ZN3 A;  5FRO A;  4A4K A;  4BI4 A;  3PTA A;  4PNO A;  4LOC A;  4XQ3 A;  3JAM E;  3HRT A;  3L2V A;  3X20 B;  1Y96 B;  4OP0 A;  2L89 A;  3OS0 A;  3I55 A;  1M90 C;  3J81 E;  3SB2 A;  3CCE A;  2K2V A;  2P0Q A;  1K8A U;  3NTH A;  3OYD A;  5LJ5 j;  3OYJ A;  4OB3 B;  1VQ7 A;  1P92 A;  2E12 A;  3DL1 A;  4ME7 A;  1WNL A;  2RK1 A;  3SFM A;  3JB9 D;  1HXD A;  2DXT A;  3DB4 A;  3LYI A;  4C92 B;  4NL3 A;  1JB0 E;  3GP8 A;  1U8R A;  4AKH A;  3PNW C;  4DOV A;  3L42 A;  3TRE A;  1WJS A;  2XDP A;  4M78 A;  1NJI C;  2ZPG B;  2GCX A;  2DPP B;  5DY9 A;  5C6S A;  3CC7 A;  1X6O A;  4XTW A;  5LJ5 d;  2KQW A;  1U1T A;  1VQO T;  3OYY A;  1KQS S;  1S72 T;  5HKC A;  1JJ2 A;  2IVW A;  2WJ9 A;  2EQJ A;  2DZC A;  3V7S A;  4V2S A;  1Y96 A;  2DTO A;  4FT2 A;  1B34 A;  5DM7 R;  1K73 U;  1NPP A;  1O9S A;  1MGQ A;  2YLC A;  3G4S A;  4C92 G;  3CCU A;  2DEQ A;  5KE2 A;  1YJW A;  3JCM d;  1VIF A;  1EIF A;  3QUI A;  2HAX A;  4EMH A;  4AI6 A;  2RJC A;  2X35 A;  3GF5 A;  4M77 A;  2DD5 B;  3CCJ A;  2O4X A;  5GAM j;  2XU8 A;  2A3L A;  1I4K 1;  1KQS A;  3A8O B;  1M9S A;  3M59 A;  3MET A;  4F7U F;  2E10 A;  3CCE T;  4IUT A;  3A8M B;  2K3Y A;  3RMS A;  3V8K A;  2DTI A;  4N4G A;  3CXC S;  2QA4 A;  2LQ8 A;  5I2S A;  1VQ4 T;  2M9U A;  3HHT B;  4JRP A;  4E7K A;  3M57 A;  2VC8 A;  5CCA A;  1K8A C;  4C8Q D;  3PGG A;  2VGM A;  2MF2 A;  2BIV A;  2D9T A;  3DKM A;  3LLR A;  4XK8 E;  3JB9 H;  4KT0 E;  1D3B A;  4J6X A;  5AYF A;  1OYX A;  2P0P A;  2DKG A;  4QSH A;  2DZ9 A;  5I2M A;  1VQO A;  1UGS B;  1YJN A;  4NS5 A;  5LJ3 e;  1QW1 A;  4JLI A;  5LJ3 f;  2QDY B;  4C0D C;  3QZ5 B;  3M53 A;  4B9W A;  5GMK m;  1FWZ A;  4HNV A;  3FRN A;  5LJ3 j;  1BI1 A;  3CXC A;  3CCL T;  1VQ9 T;  3QWL A;  4IUR A;  3CCV A;  3KXT A;  1VQN A;  3A8H B;  1QP3 A;  5A2Q E;  4MZT A;  3C4S A;  4XU1 A;  3SWN C;  3ZFJ A;  5FLX E;  3E9F A;  5GAM d;  1K9M U;  2CYZ B;  1IRE B;  2DTH A;  2KMT A;  4A54 A;  2RHZ A;  1YHQ T;  3UWN A;  3CCM A;  3BW1 A;  3PMI A;  2OTJ T;  4FL6 A;  2MWP A;  5KCO A;  4RMO A;  4M7D D;  4M77 E;  4PJO F;  3FB9 A;  5GAM e;  5LJ5 h;  3LGL A;  3QYH B;  2GQV A;  4OGC A;  1G5V A;  3OYA A;  2DK3 A;  3A5Z B;  4QQD A;  4EMG A;  1B34 B;  3CC4 A;  3FDR A;  4C92 A;  3LGF A;  1Q7Y U;  5GAO q;  3CCR A;  2RH2 A;  4M75 E;  2LRQ A;  3HFO A;  3OBY A;  3S3N A;  3VYG A;  2PQW A;  3BG9 A;  3E19 A;  3TCJ A;  3HL8 A;  3G71 A;  2QF7 A;  3JCM V;  1VQ7 T;  1M5Q 1;  1FXX A;  4EMK C;  1WGS A;  3JCM Q;  3UPU A;  1VQP T;  2RA2 A;  1M1K U;  5GAN d;  5LL6 S;  1W4S A;  4EDU A;  2QEX T;  4JS4 A;  1Q82 C;  1HK9 A;  2LDM A;  2PVO B;  2XK0 A;  3SWN A;  2PVG B;  4C5E A;  5CKD A;  3BDU A;  5GAN f;  2QQ9 A;  3ER0 A;  4RG8 A;  1S72 A;  2LNV A;  3LWH A;  1ZHI A;  3GNF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...