2D0QB

Complex of fe-type nhase with cyclohexyl isocyanide, photo-activated for 1hr at 277k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title X-ray snap shots of Inhibitor Binding Process in Photo-reactive Nitrile Hydratase
rcsb
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2d0qB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d0qB02
2WSFE 2DXCA 2WSCE 3A8HB 2WSEE 3A8OB 2QDYB 2PVOB 1UGPB 2DD4B 2DPPB 3WVEB 3X24B 2PUKB 1DJ7B 2AHJB 2ZCFB 2DXCB 4OB0B 3LW5E 2PVGB 3HHTB 3A8MB 4KT0E 4XK8E 4RKUE 2CZ1B 2ZZDA 3A8GB 1PSFA 3QXEB 4FM4B 3WVDB 1GXIE 3QZ9B 2DD5A 1AHJB 4Y28E 2ZZDB 2PUOB 2CZ0B 3VYGA 1QP2A 2ZPGB 1QP3A 2ZPBB 2DD5B 2ZPEB 2D0QB 1JB0E 1PSEA 2PVDB 2ZPHB 1UGQB 4L6V5 1V29B 3QZ5B 3VYGB 3X20B 3X26B 5L8RE 2PU9B 3X28B 3A8LB 2CYZB 4OB2B 2O01E 1IREB 3VYHB 3QYGB 2CZ6B 1UGRB 2ZPIB 2ZPFB 2DXBA 4ZGJB 3QYHB 4ZGDB 1UGSB 4OB1B 3X25B 4OB3B 2DXBB 4ZGEB 2DD4A 2CZ7B
chains in the Genus database with same CATH superfamily
3MEUA 3H0IA 3JB9J 1BIAA 5LMKB 1I8FA 2LJ0A 3QWXX 4LDVA 2DMOA 1GCQA 4CFXB 2A3LA 1IZ6A 3C95A 3X24B 4ROEA 4AFUC 2HAXA 3CCRT 4C0GA 1H25B 3AT1B 2EW3A 1LNXA 3NHNA 2QQ8A 2A36A 5GANg 4YOZA 3CPWS 2MK5A 4J6XA 2K3XA 4BCJB 5AYFA 3VS7A 5A0LA 2O31A 2BE7D 2YLBA 1QVGS 5HQ0B 1WQ7A 3MY5B 2JTMA 2GBQA 2ROTA 2I40B 3VS6A 2RI5A 2KR3A 1TH7A 2DX1A 3RNJA 1AHJB 2P84A 3CMAA 4O6JA 1WDXA 3KUFA 2RJCA 3THKA 4PJMA 1WXBA 4J9HA 3OW2S 5IDNB 3GF5A 1JB0E 3EJ1B 2K2VA 3JB9I 1G83A 4M78G 2J06A 5GAOn 2E41A 4BACA 1IXDA 3CC4Q 1GCPA 1TU0B 4RTUA 3E1SA 3MIAB 5J39A 4BDZA 2YRDA 1VQ4T 1XO2A 3RERA 4D6WA 2PMIB 1M2VA 4C92F 2COWA 4J9EA 5CEIB 4F7UA 4BY7X 3C94A 1PRMC 5GAMh 1PKSA 2KRSA 3K7AM 4JRQA 1FMKA 5EG2A 2K57A 4AFZC 2IW9B 4MMKA 4ZGDB 5GJWB 1FKMA 4D8KA 1U1SA 2QI2A 2VUBA 4C8QC 1VIFA 3SD4A 3N5BB 2E65A 4A4GA 2QF7A 2DM1A 1ZA1B 1NEBA 4F14A 1UJYA 3CBMA 1BIBA 3BLHB 4M4ZA 2DIQA 2W10A 1VQ8A 1VQ6Q 2DEUA 1ZQ1A 4E6RA 1K9AA 2QGSA 4J9DA 1YITQ 3M5AA 2PUKB 1D3BB 1HJDA 2AHJB 2FEIA 3JCMP 2HCKA 2M0YA 3OYFA 5KYWB 1HXDA 3ULRB 2XU8A 2QQBA 1OX8A 3MKDA 5IF1B 2ZZDA 1V76A 1UE9A 4M75B 1QMCA 4J9FA 5HNBB 2ED0A 3LH0A 1H4LD 1OKWB 4MFEA 1G3NC 1V1CA 2RA2A 4L5GA 2DD5A 5CO7A 2PNIA 3CCST 5FU6C 4LD6A 5ICPB 1KHIA 2UZDB 3TREA 1T3SA 1ZUYA 3VRZA 1PKDB 4RTWA 2OTLT 2BS4A 3HP9A 4EOLB 1JJ2P 2WMAB 2VVKA 2XDPA 3OYIA 1KIKA 2KDSA 1IHWA 2KI7A 3QUIA 1AEYA 1IHVA 5L8RE 2W96A 1VQPT 3RKWA 4ESRA 2NWMA 2RK1A 2K79A 2C4GB 1B07A 2YSQA 2RI3A 2HL3A 3QYGB 1SHGA 3DKMA 5J3BA 1KSWA 1EIFA 1WA7A 2EQKA 1G3WA 4ME7A 1GRIA 1N4MA 1M1GA 4N0AC 4F7UE 2JMAA 3EHQA 3OMCA 3G7ZA 2CP6A 4ZGJB 5ACBA 2YRCA 4E2FB 5LJ5j 2L3QA 5DLQE 3INZA 1WXUA 3X25B 4OMPA 5EJCA 1FWZA 8AT1B 2D0NA 3MI9B 4KRDB 4KGVB 1W2BP 5KYYB 5IHNA 1RADB 2XICA 5C0MA 4M75G 4JZ3A 2G77A 3A8HB 1YWPA 4JX4A 4XTUA 6AT1B 4BBSM 2BZ8A 5LJ5f 3PVQA 1YI2T 1ZUUA 2PK2A 2MOXA 5GANd 2JXBA 2R5MA 1F5QB 1JJ2S 2J6FA 2DL4A 2BZYA 3CD6A 2P0PA 4LUEA 1RI9A 1FINB 4XU2A 2V8IA 3E19A 3I56Q 3OS1A 1VQ5A 1QVFP 2RMOA 2B86A 4FYXB 3ASKA 3CCJT 1SSHA 1KJWA 2RHIA 4QT7A 3S6WA 2W2HA 3NPFA 4F04B 2KEAA 4HNTA 1M5Q1 1GFDA 1KQ2A 3G71Q 3BG9A 2EKHA 3OYYA 2KAFA 3CC7A 3G4SQ 1H26B 3VS1A 1D1AA 1X27A 3RUXA 1QMZB 3G6EQ 2HD0A 1GH6B 1WJQA 2R57A 3LLRA 3HPWA 1MV3A 2WFYB 4LNPA 2QK0A 4MZTA 2LX7A 1X69A 3CCRA 4MIMA 5CCAA 4IKFA 2DRKA 2E3HA 4LDUA 2CCIB 4MFDA 3CMEQ 1Z9ZA 2PHGA 4OVAA 3CC2T 3VUBA 1K0XA 2O01E 2P0QA 1ZA2B 4M78A 4FSXA 5KCHA 4M77B 1W6XA 3H0HA 4QVZA 4CFWB 1UHCA 1QVFS 2DAQA 4LXCA 1W98B 4F7UF 3REBB 2HKNA 2DJQA 1JKWA 1S72T 5FROA 5A2QE 1NJIR 4LDXA 4KUDK 5EC7A 2NLUA 1X75C 2DVEA 3QIIA 2DLPA 2JJ9A 2A0FB 2QQAA 5KYUA 4FYWB 1M8VA 5C6SA 1Q81C 3S3OA 1BI3A 1TG0A 2AK5A 3EFSA 2A28A 2GFAA 5FWCA 4FYVB 4JRPA 4OP0A 4PJOC 2LMJA 4BI3A 3CPFA 4XQ3A 5IXBA 5I2SA 1VQ4A 1Q82C 4E7JA 2EJ9A 4YTLA 4EPCA 2EWNA 2QA4Q 4MMLA 2ZCFB 3O8VA 4OB0B 1VQ9T 1VA7A 2LNHB 1YIJQ 1VIEA 3FC3A 1VQMT 1OGUB 2AIRB 2LDMA 1UNGD 2E4HA 1VQKQ 2V1QA 2C6TB 2FRYA 4XK8E 4AG1C 1QLBA 1YJNQ 2ABLA 2BPMB 2LJ3A 3LX7A 1IGUA 3I55Q 4BCQB 2P4RA 2FPDA 2JM9A 4II1A 4C8QB 1H3ZA 4Y28E 2VGNA 5GANj 1KK7A 2EVRA 3A5ZB 3EFOA 4QVCA 2QDJA 1YJWQ 2BKDN 4BB7A 4M77G 3JCMe 2KK4A 4BCMB 2FG0A 4BE1A 4E7SA 3V8LA 1VQOQ 2QQSA 5FU7B 3Q1JA 1TXQA 4XTVA 1V29B 3QZ5B 4NC6A 4TTHA 4E7HA 4EOKB 2QQ9A 2QGGA 1NJIC 1OYXA 2SRCA 1M4ZA 1ZX6A 2LQNA 4R0KA 2OTJT 4J83A 2D1XA 3NFCA 2CP0A 4NS5A 3VV0A 3I5SA 3JCMb 2LCLA 1AISB 2H8HA 4OR5B 1N6AA 5HY6A 1B34B 1YFNA 2R5AA 4LUDA 3F5XB 3CCQQ 3CCSA 2C5OB 2DILA 2RQWA 1NLOC 4M7DB 1W70A 1I81A 1WI7A 1NEGA 2X4XA 2YXYA 1MNEA 4EOSB 4HLQA 2VXFA 4M78D 3CC7T 3HL8A 1JQQA 2FZGB 2BZXA 1MMNA 1VQLQ 3TNIB 2L3SA 1H27B 3OYJA 1VQPA 4BY6C 2DETA 3OYBA 2WSCE 4E47A 1BKBA 3QHSA 3CCLQ 3A8OB 1MUZA 5KYWA 1X6OA 3EH2A 2IW8B 2K5IA 2JS0A 2VWFA 4XU1A 1W1FA 4EOMB 5GAN4 1UGPB 2WJ9A 4AKHA 4C8QG 4M75A 1D0ZA 1BI2A 4A63B 1ZUKA 2DD4B 1OKVB 2QQRA 3WVEB 3KFVA 3ZBDA 2C5VB 2DXCB 3CCEQ 3C0CA 5FW9A 5I11A 1I5OB 5KCOA 1SSFA 1FMWA 1Q86C 1NE8A 2WEVB 1KQSP 4C92C 2G3RA 5FRMA 2RHZA 1S1NA 4LE9A 4QQ6A 1EFNA 2GQIA 1BYMA 3TEEA 2K6DA 2F5KA 5CYIB 1JOWA 1YJ9Q 3JCMh 3FRNA 4RTVA 1UFFA 2MI6A 3I56T 2MWOA 1AT1B 1NJIU 1YI2A 2GGRA 2XD0A 2K2MA 3DB3A 1WFWA 4AKGA 3JCMX 1M30A 3OQ5A 3BDLA 4PLLA 4FIBA 1AZGB 2ZPHB 3C4SA 1H1SB 4EOPB 5IDPB 4M7DG 5GAN3 3CCJA 1NLPC 5LJ5e 2EYWA 1P5EB 4KRCB 1W2BA 3RBBB 3JB9H 3MP8A 2JMCA 4QKUA 2ZGWA 1IREB 4M78F 2DIGA 2MYSA 2CZ6B 4PFZA 1X6BA 3VRYA 3QPHA 2E6NA 4X34A 2W99A 2RJDA 2DA9A 2HL5C 3GP8A 3BHVB 3HRSA 1T0HA 4DBRA 1HSQA 2L5QA 1ZSZB 1KD1R 5KYYA 2F5TX 2PQWA 1XOVA 3V8KA 2RHYA 1D09B 3QSUA 1QLYA 3EG9B 1VOLA 3VU3C 4RODA 4HT8A 4OB3B 4OF1A 2EYYA 4DA4A 3DJBA 1ZHIA 3VUZA 4D8DA 2M16A 4BXXX 3DL1A 4GBQA 2KRNA 4ZN1A 2QDYB 4JS5A 3L2RA 2C5NB 2XIDA 1VQ5T 2DZCA 4BCIB 4F7NB 2DL5A 3OY9A 3QO3A 3SWNA 4M75E 1Q95G 2J6OA 1QVPA 2WIHB 5LL6S 1R8OB 1NYGA 1W4SA 1WYXA 2RN8A 2FL7A 3LW5E 3L2QA 5CKEA 1OV3A 2QTXA 2EYQA 2OX7A 1QCNA 5GAN7 3I5RA 1IRXA 1S72A 5IXFA 2P0KA 1WHGA 3NMZC 1HD3A 1M90R 1ZBXA 4M75D 4IIMA 4KRTA 1OPLA 4C0ZA 1GXIE 5HK0A 3QZ9B 1K9MR 4BI4A 2FPEA 3BG3A 2MWPA 2LZ6B 5ECAA 4GLKA 4J7FA 1OZ2A 2DYBA 1GBQA 2CP5A 1RAIB 1H1QB 2OAUA 1RL2A 1UHFA 3DLMA 1JO8A 2KE9A 5LJ5h 2X1NB 4J9IA 4XAXB 2JTEA 4PJOB 2CCHB 1PM3A 1PSEA 2HDAA 4L59A 3TSZA 1VQ9A 3TVTA 1KD1C 3EGDB 1VQ7T 4M77A 1VQMA 2CJMB 1N8RR 1I4K1 3VKGA 1XJWB 1RUWA 1YJWT 3RKYA 2DTOA 2K4YA 3BDUA 5KH6A 1NYFA 2MAMA 4HCZA 3UA6A 2OJ2A 1OEBA 2GNCA 3VYHB 5D7UA 2JUFA 3GOXA 1XTDA 5EFQB 2HEQA 3FLGA 3TSWA 2YRVA 4HA8A 2KR6A 2QG9B 3PO3S 4B9WA 4BE2A 2QEXQ 2L3PA 3OBWA 2HQEA 4E7IA 4OB1B 4ELLA 5GAOm 1QWFA 3H4CA 4CC3A 4DEXA 2I2LA 4RUGA 2E6ZA 1M90C 3CCVT 1QCFA 1YCSB 1UG1A 2DO3A 5D6XA 2OTJA 3H8ZA 3O5ZA 1O9SA 1Y96B 2PVOB 3L42A 4EOJB 1K9MC 2V22B 2WIPB 2RQRA 4M75F 3M4YA 5L23A 2DPPB 1LPLA 3JSCA 1RAFB 3HFOA 3M0QA 3JCMf 5GANe 3L2WA 2AKLA 3J80E 2XG8D 4EDUA 4C5GA 1AOJA 4PJOG 3KXTA 4EMKB 3L2VA 1VYVA 3MY1B 4FM4B 2CKKA 2DTIA 4E7LA 2RF0A 3CBPA 2DKGA 3T9NA 4M7AB 1MMGA 4MZPA 4R55A 1N8RC 1FYNA 3EGXB 1VQNT 3D7SB 1KD1U 4M6VA 2RHUA 2RJFA 4NOYA 2K7AA 1FMVA 4FW1A 4BY6B 3REAB 1K73R 3PIPA 4CC4B 2AZVA 2HQXA 4BCOB 1UNLD 2KXCA 2O9SA 3KHIA 3CMAQ 1H8KA 4M77E 1B34A 5I22A 3X20B 2M51A 3WXMB 4HT9A 4C92B 2W9ZA 3MCAB 3V8JA 2DRMA 3QHWB 5IH2A 4M7DA 4PL6A 4GY5A 4GLMA 2FVUA 2HMAA 2JOYA 3I56A 2KT1A 3MO8A 2NUPA 1RACB 1KQ1A 4M77D 3H6ZA 4JJNK 1VUBA 1YCYA 1M90U 4F16A 1AWOA 2C5XB 5CK9A 4XU0A 1UDLA 2FZKB 2LCSA 3OYAA 4PFPA 3LQ5B 1SF9A 1K9MU 4EC8B 5I5ZB 2KVQG 2GTJA 1KQSA 3G71A 1YP5A 1KC8C 1VINA 5DY9A 1X2QA 2DD4A 3EH1A 3NTKA 2UUEB 2DXCA 4DBFA 5GANh 2LT1A 3META 3MJXA 4N0AA 2CH4A 4HVUA 4M7AG 4DBQA 3G1JA 4ANJA 2LJ1A 3CQTA 1OI1A 4CRIA 1MHNA 1OQKA 1YBYA 2R58A 2RPNA 1N8RU 3M57A 4C0DC 1E7PA 1DJ7B 3S3NA 5LJ3g 4FYYB 3UWNA 1K73C 2L0AA 4CFUB 3A8MB 1OU9A 2D6FA 1P92A 1M3BA 1VQ8Q 2COZA 1WXTA 2SEMA 2CGHA 2JW4A 1WHLA 1U1TA 1G8XA 2AKKA 2D8JA 2BKZB 4HVWA 5GAN8 1H641 3TW6A 4RMOA 3TN8B 4BCQD 1WJRA 4A4FA 2YWWA 2I0NA 2HKQB 4C8QD 1H24B 1EZZB 4OMOA 2EBPA 2JT4A 2WPAB 1G3TA 1CKAA 1X6GA 1F1BB 3MP1A 2DVJA 2BUDA 3QJYA 1JEGA 4Y72B 4PFOA 4FL6A 2V8JA 4VUBA 2DBMA 4FT2A 1Q81R 4YOOA 2QXFA 4BCMD 2IPOB 4Z8AA 2VYTA 4M77F 1H28B 4KUIA 1E6HA 1M1KC 5IAYA 3M53A 1BU2A 4F6UB 1Q82R 4MDXA 2CH4W 2DNUA 1ZSZA 4HCBA 1TFBA 2M1HA 2YDLA 4J7IA 4OB2B 4M7DE 4FX3B 2PTKA 4F17A 1KC8U 1H92A 2L89A 1OL2B 3TNWB 2R7GA 1SPKA 3EG9A 2K3BA 3LH5A 4JPBW 3LGFA 4JJCA 1RAAB 1YHQQ 1WZOA 1W2BS 5CKBA 2KRMA 1E6GA 3OS0A 2O4XB 1TWBA 2HNIA 1B3QA 3OMGA 3CCMQ 3FEOA 2D9TA 4M7DD 3TCJA 2JTFA 3OBYA 2D8HA 1VQ7A 3A98A 3TNHB 1IB8A 1K73U 2M0OA 2UZEB 2M9UA 1YJWA 4BI8B 2EUFA 4HCKA 5M9OA 3RR6A 5KYNA 3L1AA 5CQYA 2HBPA 3RKXA 1YWOA 2RJEA 3M4GA 4PK4A 3LWIA 3PT9A 3CC4T 2E10A 1ZLMA 4PJNA 2JS2A 2PJQA 1PD1A 2PVGB 4M78C 5FWBA 3RESA 1GBRA 2O2OA 4JX6A 2DJZA 2RQUA 4B9XA 3CD6Q 4IUVA 1PSFA 3M0TA 2RK2A 4RG8A 4JRIA 3QDRB 3M55A 3LGLA 4CRLB 4PJOA 4F7SB 1LCKA 2CP7A 2J05A 2RM4A 1XNIA 1AWXA 2CDTA 4Q5WA 3CCUQ 3PFSA 3EGDA 3CCVA 2J7IA 2EGEA 1UJ0A 4JLGA 5GMKi 3ZL7C 1TS9A 3CC7Q 1VQ6T 1D1BA 1SKUB 2RHXA 1VQLA 1YITT 4FCYA 2K3YA 1YN8A 3QHRB 3CCLA 2KSSA 2JVVA 3VJPA 3NDQA 2VB6A 3VKHA 3J81E 1VYWB 1VQNA 4M7DF 3CCRQ 1Q86R 3AHUA 1BU1A 2DMEA 4ATOA 1CKBA 3FJ5A 2A08A 4I3ZB 1N9RA 2X9HA 1QCOA 3HFNA 4XTYA 3V7CA 3FDRA 4R56A 5GANf 2QDLA 3JB9G 3JCMJ 1H1RB 4BCHB 4FT4A 4CI0C 4F70B 4BCKB 2X51A 3QYEA 5DLOA 1RAEB 2JZ2A 4M78E 1OULA 5GAOl 5LJ3d 2RB6A 2Y90A 1TOVA 1Q81U 5KE3A 5FU6B 4ELJA 3OS5A 4AI6A 4EMKA 4MDWA 2E1HA 2X4JA 4BDYA 2AT1B 4WCIA 3UF4A 4M7AA 1Q82U 3EGXA 5J26A 3EHRA 2LW4A 3NTHA 3GNFB 1TUDA 3QKJA 2UZBB 2W0ZA 1QKXA 2O88A 3QDFA 2QTVA 3MEAA 1D3BA 1NPPA 3BHTB 1VQ4Q 3A8GB 4JX5A 3UDCA 1X2KA 1BI1A 3HRTA 4G6LB 3CXCA 2XDDA 3OYDA 2H3EB 1PWTA 5A0DA 2LNVA 2RO0A 1KG1A 1M8MA 2J6KA 4JRKA 3SDZA 2BS3A 1JSUB 1M3AA 2CP2A 1C1AA 1QP2A 4MZMA 1BI0A 1QP3A 1ZSGA 1WQWA 4DOVA 3OYGA 4IUQA 2ZPEB 4OGCA 1RAGB 3FB9A 2A7YA 4CFNB 4PJOD 4C0DB 4M75C 2KMTA 4BY1X 2RH2A 3HO8A 5GMKm 2X4YA 4P5NA 1RAHB 3M0PA 5GAOr 2KYBA 2EGCA 5CKFA 1WPYA 2F2WA 2UZLB 1WHKA 3LYIA 2EJFA 3EFRA 3BW1A 1UGRB 3MP6A 4CC7A 1UNHD 1SRMA 3EG1A 3OA6A 2ZPIB 2ZPFB 5A0GA 3G71T 2LQKA 4AT1B 2W9FA 3URGA 3M54A 4JZ4A 3G4ST 3ZFJA 2LT4A 1I5LA 3G6ET 1M2OA 2F2XA 1UGSB 4EONB 2IG0A 3CCSQ 2K9GA 3TU4K 5HKCA 1JBMA 5CAIA 1HYOA 2E12A 3KBGA 2L3RA 3JCMQ 4IMYB 1YHQT 4OMQA 2EPDA 5GAMg 4DOWA 2OTLQ 2V26A 1UB4A 1BBZA 1KQSS 3DOGB 3CCMT 3DTOA 3CMET 3MEVA 1N27A 1VQPQ 8ATCB 3R6OA 3UATA 3OYHA 4ZTFA 1T0JA 5GAOp 4KT0E 4ORZA 2ED1A 1MV0B 1X01A 1Q86U 1WNLA 3QXEB 5CIUA 5GAN2 4J6YA 2IIMA 3FIFA 5LJ3j 3UT1A 2MIOA 2LC4A 4M7AD 4CFVB 4PJOF 4X9DA 5GAN6 2DF6A 2A37A 3S3MA 4CC2A 2CUBA 2PUOB 1M9SA 3JCMc 2KYMA 2QEXA 5IT9E 2PK9B 1QVGP 1LVKA 5CVIA 2IVWA 5CQXA 3CC4A 1G2BA 5FRNA 2VGMA 1WX6A 2P4TA 2ZAEA 3EG0A 3SWNC 4F7LB 1D3UB 1ACMB 1YI2Q 3X26B 2L8DA 3OYLA 2QA4T 2RQTA 4C5HA 1PHTA 3RMQA 1YIJT 3OW2P 2WXVB 3X28B 3QG1A 1VQKT 1KXUA 2O4XA 2E5KA 3OYNA 3VS2A 1CSKA 1YJNT 4WTOB 1KHCA 3I55T 1MGQA 1Y07A 5HBHB 3RGFB 3CCJQ 1B7TA 1TUGB 2GQVA 4UC4A 3TQ7P 3TW7A 3POMA 2NYSA 1GCQC 2HBWA 3P8HA 1A0NB 1JXMA 4EMHA 3JRZA 5KYUB 3UPUA 5CKHA 3F70A 3J7AF 1I1JA 3PVLA 1OI9B 1VQ6A 2HSPA 3DB4A 4LDYA 2DXBB 2LP5A 1YITA 3SEMA 1ABQA 2CZ7B 5CR2A 1VQOT 2COYA 4Y91A 2F1LA 4M77C 2WSEE 2EKOA 4RCCA 4J9CA 4OMLA 3GLXA 5GAN5 2HQHA 3DDPB 1JXOA 3MHXA 2QGFB 1R77A 4N4GA 1ENWA 4PJJA 2FB7A 2C06A 1GL5A 4ROCA 1JRIA 4M7AF 2KNBB 4BCNB 4EOIB 3CC2Q 3CCQT 4QQGA 1OIUB 4A4KA 1O9KB 2IW6B 4CFUD 1WHHA 5DQVA 5LJ5d 4V2SA 1K76A 3P8DA 1YNZA 2KROA 3WVDB 3EFOB 4F6SB 2DBKA 2KXDA 2Z0WA 3V7RA 3EGUA 1AD5A 1XQHA 1N9SA 5KE2A 1K8AC 4LD9K 1AVZC 9ATCB 1S72Q 4C5EA 4YOSA 1VQLT 1RI0A 3FJPA 3SB2A 1MNDA 1Q7YC 4CFMB 1KC8R 4C8QA 2RI2A 3VS3A 2VXEA 2ESWA 3CCLT 1LJOA 4DQ2A 2YHTA 3NGPA 4BCPB 1TSFA 3ZEHA 1WLPB 1R0BG 1PRLC 5IHYA 1RABB 1R0CB 2LCCA 1M3CA 3P8BB 3VYGB 4J8OA 3CCET 2HZYA 2WHBB 3M0RA 3CBOA 4UN0A 1VQ9Q 1IO6A 4Y92A 3LWHA 3VKIA 3QYBA 4RG2A 1VQMQ 3DDQB 5GJVB 1JSTB 1YJ9T 2QAZA 1QW1A 1M1FA 4WF2A 4AG2C 2I53A 3BLQB 5IHIA 1NBEB 4EOOB 1WJSA 5FU7C 5GAMd 3HBLA 2DL8A 1QWEA 5LQFB 3CXCP 2KMGA 3GNGA 4NL2A 3JV3A 2ECZA 3E2UA 1I0CA 1AZEA 4IIOA 1RLPC 4ZGEB 1UTIA 3PGGA 4QQDA 5GMKj 2NUTB 4TVRA 2WSFE 5D6YA 1D0XA 2X35A 2MF2A 3PTAA 4J9GA 3EIDB 1N5ZA 3UA7A 4LOCA 2CREA 2EYZA 1M1KR 3CEYA 3JB9D 4M7DC 3VS0A 1K8AU 2EJGA 3M56A 4KH1B 4JJBA 3ME9A 3MPUB 1OZ3A 2OTJQ 3G4SA 2LQ8A 1Y7XA 4HVVA 1Q7YU 4XTZA 3G6EA 2XI9A 2PZ1A 4HCCA 2KQWA 5HBJB 3B57A 2EGAA 4ELZC 2FZCB 2FPFA 1D1CA 3HB9A 2H3JA 1ZBJA 1U06A 4RTTA 3QJ6A 4RTXA 1YHQA 1TD6A 2CT3A 3I35A 1C0MA 1J3TA 3L2UA 4KULA 4OMNA 3CCMA 2CUDA 2E3IA 5HCKA 3CMEA 2E64A 3CXCS 4C8QE 3C12A 2M02A 2DXUA 3BHUB 2MPXC 2V1RA 4EIKA 4F7JB 5KYXB 3M0UA 3HRUA 1OL1B 1UGQB 4ZTJA 4XTXA 3OSVA 2Y4XA 5HK3A 4JLIA 1QKWA 4C92G 5GMKl 3OB9A 2QYZA 3OYMA 4AMCA 3HZJA 4J5YA 1PC0A 4YC3B 4HL4A 1ABOA 1JU5C 3EG3A 1NZ9A 1GUXB 5AT1B 2RNAA 1T3LA 1UECA 2B9RA 4NSTB 4BCGB 2HSEB 2BTTA 1M27C 4N4IA 7AT1B 4DEYA 4BBRM 2WMBB 1NM7A 4EOQB 3JB9F 1K4US 3CCUA 3SWNB 2QA4A 3DLLA 1QQJA 1YIJA 4KGXB 1VQKA 3SFMA 3BE3A 4FW2A 1X43A 1FXXA 4AFSC 1G5VA 3CPWA 2VV5A 4AKIA 3H9NA 2C0OA 2X3XD 3OYEA 4O5VA 4BE0A 1YJNA 2YUOA 5LJ3e 2ROLA 3I55A 1QVGA 1ZSZC 2KBTA 3BG5A 4RTYA 2JN0A 3H0FA 1SEMA 4J6WA 2EQJA 5GAMj 4F6WB 4PLIA 1BCOA 2BIVA 1UGVA 2CZ1B 4PKCC 1BCMA 4EC9B 3PE0A 1EX4A 3OW2A 2QEXT 2KGTA 4KBMB 4Z02A 1OU8A 1VQOA 5GAMf 2NUZA 3EAEA 2EAYA 2X3WD 3GTMS 1VOMA 4IURA 2KY9A 2VKNA 2AZSA 2CZ0B 4HNVA 5FGKB 1AWWA 1TUCA 1G3SA 1FX7A 1OIYB 2ZPGB 2GCXA 4C8QF 2ZPBB 2XMFA 2X4WA 3M59A 1D0YA 2PVDB 2V8KA 3JCMg 2DYIA 2G9XB 2YUQA 4B6MA 1U8RA 3CCQA 4II5B 1LOJA 1VQ5Q 3QWLA 2E5QA 4JUVA 5GAOq 1SRLA 3HKSA 2LTOA 1UEBA 1M1KU 3PIOA 2B8AA 5BNJB 1PD0A 2GF7A 3JCMV 3VS5A 3GBQA 4N4HA 3O0GD 3H41A 3OYKA 1HK9A 2FO0A 4XU3A 4NL3A 1O75A 5I21A 2DERA 2E70A 1SG5A 2DXBA 1UUEA 3PMIA 3SHWA 5IHKA 3EOCB 2F69A 1NG2A 3BLRB 4BUGA 4BD3A 3IQLA 1ZP2A 3PNWC 1M2VB 4OMFB 5LJ3h 3MEWA 4F7UB 4Z88A 3CCEA 3E9GA 4E7KA 3CMAT 2XKOC 2DEQA 2YLCA 2DFUA 1BB9A 2RQVA 5CKDA 2XK0A 1O9KA 4DBHA 1RLQC 1VQ7Q 2WACA 4XTWA 1GFCA 3PMTA 1YJ9A 2LRQA 4E7ZA 1I07A 4IUTA 1Y96A 2XHCA 3V7SA 5L2WB 2IVXA 3RMSA 1NPRA 1Y71A 4RKUE 2F2CA 2YT6A 4A53A 4JDSA 3OS2A 3BFMA 1PG5B 3BY7A 3NTIA 2Y4YA 2RD1A 2ZZDB 1VYUA 5IN1A 2O9VA 2VASA 3VYGA 4OGEA 1OOTA 3QWYA 2FYKA 2KT8A 1PCXA 3M03A 2MMPA 2DD5B 3JAME 2ENMA 2OI3A 2CSIA 1AD6A 4PNOA 2C0IA 4EMKC 5HVYB 4JJDA 5DQWA 3CCVQ 1U5SA 2OTLA 5HBEB 3HTRA 1H3HA 2YUPA 1C9BA 2G6FX 2PU9B 4M7AC 4PJOE 4C5IA 2FRWA 4HKEA 1WHJA 2NUPB 3EG2A 5LJ5g 1VQ8T 3M9QA 1OX9A 4F7UG 4A4EA 2K5FA 2L2PA 4JS4A 1IGQA 5I2MA 5GMKe 4C92A 1OPKA 1WGSA 1ARKA 1MMDA 2CT4A 4QSHA 2CP3A 2NUTA 4QVDA 1VQNQ 2DL7A 2CS7A 1AWJA 3OSSC 1JJ2A 2DZ9A 4ZNXA 1Y57A 1Y0MA 2QASA 4Z89A 1C6VX 3M58A 1TTHB 1E9HB 4J9BA 1VYTA 4EMGA 3QBYA 3OYCA 2VC8A 1GY3B 2JGZB 2JNGA 2EQIA 1BK2A 3G33B 2DXTA 3JCMW 4Z6YA 2DE0X 2EYXA 2OAWA 2MCNA 2BE9B 3GIBA 3HHTB 3RDVA 2K5LA 4ZN3A 4BCND 4X9CA 2EQUA 3R6NA 4A4HA 5DM7R 2BS2A 4BCFB 4HNUA 4IUPA 3ER0A 5KYXA 2LVMA 4QW2A 3JCMd 2EFIA 2FHDA 1G3YA 3L2ZA 1WIEA 1PNJA 4M7AE 4C0FA 1FVVB 1SHFA 4HXJA 4CXAB 1E7OA 3U23A 3VS4A 4X1VA 2GFUA 2XDBA 1H1PB 2D0QB 2JM8A 1MMAA 4OGRB 4FSSA 4L6V5 1WHMA 5GMKh 3E9FA 1QVFA 1URCB 2DTHA 1U3OA 1GUXA 1PKTA 3A1PA 3CPWP 3A8LB 4K11A 2EQMA 2CYZB 4EORB 3M0SA 1K0SA 2QFZA 3CD6T 5FLXE 2LX9A 2CSQA 2DK3A 2EIFA 4IUUA 4OMMA 3CC2A 4FU6A 4C92E 5LJ3f 1KFZA 2F2VA 4KH0B 4RTZA 2C0TA 1K1ZA 2ATCB 2GTOA 4AFQC 4LDWA 3I9QA 3CCUT 3QYHB 4M78B 4LN2A 1Z9QA 2DL3A 3HSBA 4RCBA 2IN3A 1K8AR 4ELYC 3GPLA 3RIRA 4C92D 2YUNA 4KGZB 5GAMe 2LQWA 4A54A 5D6WA 4PJLA 1Q7YR
chains in the Genus database with same CATH topology
4TVRA 2WSFE 3MEUA 4BI8B 4BY6C 1VQPA 5D6YA 2WSCE 3OYBA 2X35A 1BIAA 4E47A 1BKBA 3JB9J 3QHSA 3A8OB 5M9OA 2MF2A 1X6OA 1I8FA 3L1AA 2K5IA 3PTAA 5CQYA 4XU1A 5GAN4 4LDVA 1UGPB 2HBPA 3RKXA 2WJ9A 4AKHA 2A3LA 1IZ6A 2RJEA 3C95A 3M4GA 1BI2A 4LOCA 3PT9A 2E10A 4M75A 3LWIA 2DD4B 2QQRA 3WVEB 3X24B 3ZBDA 3CEYA 2DXCB 3JB9D 3CCRT 2HAXA 4C0GA 4M7DC 1K8AU 2PVGB 4M78C 3RESA 5KCOA 2EJGA 3M56A 1SSFA 1LNXA 3ME9A 2QQ8A 1NE8A 4JX6A 1OZ3A 2DJZA 3G4SA 1Q86C 4C92C 5GANg 2LQ8A 1Y7XA 2G3RA 3CPWS 4B9XA 5FRMA 1Q7YU 4J6XA 4XTZA 2RHZA 4QQ6A 3G6EA 4IUVA 2K3XA 2XI9A 5AYFA 4HCCA 1BYMA 3TEEA 1PSFA 2KQWA 2RK2A 5A0LA 2F5KA 1QVGS 2YLBA 4RG8A 4JRIA 3QDRB 3M55A 5GMKj 1WQ7A 2JTMA 4ELZC 3JCMh 3FRNA 3LGLA 2RI5A 3HB9A 4PJOA 1TH7A 2MI6A 2H3JA 3I56T 1YHQA 2MWOA 3QJ6A 1AHJB 2RM4A 1XNIA 3CMAA 4Q5WA 3PFSA 4O6JA 1NJIU 3CCVA 3KUFA 2RJCA 3L2UA 1YI2A 4KULA 3CCMA 2XD0A 3DB3A 4AKGA 3CMEA 2E64A 3JCMX 4C8QE 3OQ5A 4JLGA 5GMKi 3BDLA 3C12A 4PLLA 3CXCS 3OW2S 3GF5A 2DXUA 4FIBA 1JB0E 1VQ6T 3HRUA 2ZPHB 2RHXA 3C4SA 1VQLA 1UGQB 4ZTJA 2K2VA 4XTXA 1YITT 3OSVA 2K3YA 4M7DG 3JB9I 2Y4XA 5HK3A 5GAN3 2KSSA 4JLIA 2JVVA 4M78G 3VJPA 3CCJA 3CCLA 5LJ5e 5GAOn 2E41A 4BACA 3VKHA 1W2BA 3J81E 3JB9H 3MP8A 4C92G 5GMKl 3E1SA 3OB9A 5J39A 2ZGWA 1VQNA 3OYMA 4M7DF 4BDZA 1IREB 4M78F 3HZJA 4J5YA 2DIGA 1VQ4T 2CZ6B 3RERA 3AHUA 4D6WA 3QPHA 2E6NA 4HL4A 4X34A 4C92F 2RJDA 3GP8A 1NZ9A 3HRSA 3C94A 4F7UA 5GAMh 4ATOA 1YJWT 2L5QA 4JRQA 3V7CA 1N9RA 3HFNA 4XTYA 3FDRA 4R56A 5EG2A 2K57A 2F5TX 5GANf 2PQWA 3JB9G 4N4IA 4MMKA 3JCMJ 4ZGDB 1XOVA 3V8KA 1FKMA 2RHYA 3QSUA 3VU3C 1U1SA 4FT4A 4BBRM 4CI0C 2QI2A 4OB3B 2VUBA 4C8QC 4HT8A 4OF1A 3QYEA 5DLOA 1VIFA 3SD4A 3N5BB 4DA4A 1ZHIA 2E65A 4A4GA 2QF7A 3VUZA 3CCUA 2JZ2A 3SWNB 3DLLA 2QA4A 4M78E 5GAOl 5LJ3d 2M16A 3CBMA 2RB6A 1BIBA 1YIJA 2Y90A 1Q81U 3SFMA 3DL1A 2DIQA 5KE3A 1VQKA 4JS5A 4ZN1A 1FXXA 2QDYB 3L2RA 2XIDA 1VQ5T 1VQ8A 2DZCA 1G5VA 5FU6B 3CPWA 2VV5A 4ELJA 4AKIA 1ZQ1A 3OS5A 3QO3A 3OY9A 3SWNA 4BE0A 4AI6A 4O5VA 3OYEA 4EMKA 1YJNA 5LJ3e 4MDWA 3M5AA 2E1HA 4M75E 3I55A 2X4JA 1QVGA 1QVPA 4BDYA 2PUKB 1D3BB 1R8OB 1W4SA 5LL6S 2AHJB 3BG5A 3JCMP 2FL7A 2JN0A 1Q82U 4M7AA 3LW5E 5J26A 4J6WA 2EQJA 3OYFA 5GAMj 3L2QA 3NTHA 4PLIA 3GNFB 5CKEA 1HXDA 2QTXA 3QKJA 2EYQA 2XU8A 2BIVA 2QQBA 5GAN7 3MEAA 1D3BA 2CZ1B 2ZZDA 4M75B 1S72A 1NPPA 2P0KA 4PKCC 3A8GB 4JX5A 3UDCA 3HRTA 1BI1A 3CC4T 1ZBXA 4M75D 3LH0A 4C0ZA 3CXCA 1GXIE 5HK0A 3QZ9B 2XDDA 3OW2A 2QEXT 4MFEA 4L5GA 2RA2A 3OYDA 2DD5A 4BI4A 3BG3A 2MWPA 4KBMB 4Z02A 5A0DA 5CO7A 2LNVA 3CCST 5FU6C 2RO0A 3EAEA 5GAMf 4LD6A 2EAYA 4GLKA 4J7FA 4IURA 1KG1A 1OZ2A 2KY9A 1KHIA 3TREA 4JRKA 3SDZA 2CZ0B 4HNVA 2BS3A 2OAUA 1G3SA 1RL2A 3DLMA 1FX7A 1QP2A 1BI0A 2ZPGB 1QP3A 4MZMA 5LJ5h 2GCXA 2BS4A 3HP9A 4C8QF 2ZPBB 2OTLT 1WQWA 4XAXB 2X4WA 4DOVA 3OYGA 4IUQA 3M59A 4PJOB 2ZPEB 2XDPA 3OYIA 1PSEA 4L59A 4OGCA 2KDSA 3FB9A 1VQ9A 2PVDB 2A7YA 4PJOD 2V8KA 3JCMg 3QUIA 4C0DB 1KD1C 1U8RA 1VQ7T 4M77A 4M75C 1VQMA 2KMTA 2RH2A 3CCQA 3HO8A 1I4K1 5L8RE 1LOJA 2X4YA 3VKGA 4P5NA 5GMKm 3QWLA 2E5QA 4JUVA 1VQPT 3RKWA 3RKYA 2DTOA 2K4YA 3BDUA 3HKSA 5GAOq 5GAOr 5CKFA 2LTOA 1UEBA 1M1KU 3PIOA 2B8AA 5KH6A 2MAMA 4HCZA 2GF7A 1WPYA 2RK1A 3JCMV 2RI3A 4N4HA 3OYKA 3VYHB 3QYGB 2JUFA 3DKMA 3LYIA 3GOXA 5J3BA 1HK9A 2EJFA 1XTDA 3EFRA 1EIFA 3BW1A 1UGRB 2EQKA 1G3WA 4ME7A 1O75A 3MP6A 4XU3A 5I21A 4NL3A 1M1GA 2E70A 3FLGA 4N0AC 3OA6A 2ZPIB 2ZPFB 5A0GA 3G71T 2DXBA 2LQKA 4F7UE 2YRVA 4HA8A 2KR6A 3URGA 3M54A 4B9WA 4BE2A 3PMIA 3OMCA 3G7ZA 3G4ST 4ZGJB 5LJ5j 3ZFJA 2LT4A 5DLQE 2F69A 3INZA 3OBWA 2HQEA 4E7IA 3G6ET 1I5LA 1UGSB 4OB1B 4BUGA 2IG0A 3X25B 4BD3A 5EJCA 1FWZA 3PNWC 5GAOm 3H4CA 3TU4K 4OMFB 5LJ3h 3MEWA 4F7UB 5HKCA 1JBMA 5CAIA 2I2LA 2E12A 3KBGA 2E6ZA 2L3RA 3JCMQ 1YHQT 2XICA 3CCEA 5C0MA 3E9GA 4M75G 4E7KA 5GAMg 4DOWA 1M90C 2G77A 3A8HB 3CMAT 4JX4A 4XTUA 1UB4A 4BBSM 2DEQA 2DO3A 2XKOC 2YLCA 5D6XA 5LJ5f 3H8ZA 3CCVT 1YI2T 2OTJA 1KQSS 5CKDA 1O9SA 1Y96B 2PVOB 2R5MA 3L42A 5GANd 2XK0A 3CCMT 1K9MC 1JJ2S 3CMET 4M7AD 3CD6A 2P0PA 4M75F 2WACA 4XTWA 3M4YA 3MEVA 4XU2A 2DPPB 2V8IA 3PMTA 1N27A 3JSCA 3E19A 1YJ9A 3HFOA 2LRQA 3JCMf 5GANe 4IUTA 1Y96A 3OS1A 2XHCA 3J80E 3R6OA 3L2WA 2XG8D 1VQ5A 3OYHA 3V7SA 4ZTFA 4EDUA 5GAOp 4KT0E 3RMSA 3ASKA 1NPRA 3CCJT 4C5GA 4PJOG 1Y71A 2RHIA 4RKUE 1X01A 3S6WA 1WNLA 4EMKB 3KXTA 3L2VA 1VQOA 1Q86U 3JB9F 4A53A 3QXEB 4FM4B 2CKKA 2DTIA 5CIUA 4E7LA 4HNTA 3CBPA 2DKGA 4J6YA 4JDSA 1M5Q1 4M7AB 4MZPA 3T9NA 5GAN2 3FIFA 4R55A 3OS2A 1N8RC 5LJ3j 3UT1A 1KQ2A 3BFMA 3BG9A 2LC4A 1KD1U 3BY7A 3OYYA 4PJOF 2KAFA 4M6VA 2RHUA 2RJFA 4NOYA 4X9DA 5GAN6 3CC7A 3NTIA 2Y4YA 3S3MA 2RD1A 3RUXA 2ZZDB 2PUOB 1M9SA 5IN1A 3JCMc 4BY6B 2HD0A 2QEXA 3VYGA 5IT9E 4OGEA 2R57A 1WJQA 2FYKA 3LLRA 3HPWA 5CVIA 3PIPA 2IVWA 5CQXA 3CC4A 2MMPA 4MZTA 2DD5B 2HQXA 3JAME 5FRNA 2VGMA 4PNOA 3CCRA 2P4TA 4MIMA 3SWNC 5CCAA 3KHIA 4IKFA 4EMKC 4M77E 1B34A 2OTLA 3X20B 3X26B 2L8DA 3OYLA 2QA4T 4LDUA 3WXMB 2PU9B 4C5HA 4M7AC 4C5IA 4HT9A 4MFDA 4PJOE 4HKEA 3RMQA 1YIJT 4OVAA 3CC2T 3X28B 3QG1A 4C8QG 4C92B 1VQKT 3V8JA 3MCAB 3VUBA 2O4XA 5LJ5g 3M9QA 3OYNA 1VQ8T 4F7UG 4M7DA 2O01E 4GY5A 2K5FA 2P0QA 4PL6A 4A4EA 2FVUA 4M78A 4FSXA 5KCHA 4M77B 4JS4A 1YJNT 2JOYA 3I56A 1KHCA 3MO8A 3I55T 4QVZA 1MGQA 5I2MA 1KQ1A 1Y07A 4M77D 3H6ZA 4C92A 1VUBA 5GMKe 1WGSA 2DAQA 4JJNK 1QVFS 1YCYA 4F7UF 2GQVA 4UC4A 1M90U 1VQNT 3TW7A 4QSHA 3P8HA 5CK9A 4XU0A 4QVDA 3OYAA 4EMHA 3JRZA 1K9MU 3UPUA 5CKHA 3F70A 2KVQG 1S72T 5FROA 2CS7A 3J7AF 1KQSA 5A2QE 3OSSC 4LDXA 1VQ6A 1JJ2A 3G71A 4KUDK 2DZ9A 2NLUA 1KC8C 1X75C 2DVEA 5DY9A 3DB4A 4LDYA 2DXBB 3QIIA 1YITA 2QQAA 1M8VA 2DD4A 5C6SA 1Q81C 2CZ7B 5CR2A 3S3OA 1BI3A 3M58A 3NTKA 2DXCA 1VQOT 5GANh 4Y91A 2LT1A 3META 4M77C 2WSEE 3EFSA 2EKOA 2GFAA 4RCCA 4EMGA 3QBYA 4N0AA 3OYCA 4JRPA 3GLXA 4OP0A 5GAN5 4M7AG 4PJOC 3MHXA 2VC8A 4BI3A 3CPFA 4XQ3A 1OI1A 4N4GA 4CRIA 1MHNA 1YBYA 2R58A 1N8RU 5I2SA 2JNGA 1VQ4A 2FB7A 1Q82C 3M57A 4E7JA 2EJ9A 4YTLA 4C0DC 4EPCA 2C06A 1E7PA 2DXTA 2EWNA 1DJ7B 1JRIA 4MMLA 2ZCFB 3O8VA 4OB0B 3JCMW 3S3NA 5LJ3g 4Z6YA 1VQ9T 4M7AF 3UWNA 1VIEA 3FC3A 1VQMT 1K73C 2LDMA 3GIBA 3HHTB 3A8MB 4QQGA 3CCQT 2D6FA 1P92A 2K5LA 4ZN3A 4A4KA 4X9CA 2CGHA 4XK8E 2EQUA 4A4HA 5LJ5d 1QLBA 3P8DA 5DM7R 4V2SA 1YJWA 1U1TA 2BS2A 3LX7A 3WVDB 5GAN8 1H641 3TW6A 4RMOA 4HNUA 3V7RA 4II1A 1WJRA 4IUPA 3ER0A 4C8QB 4A4FA 1XQHA 1H3ZA 1N9SA 2LVMA 4QW2A 4Y28E 2VGNA 5KE2A 3JCMd 2EFIA 5GANj 2FHDA 4C8QD 1K8AC 4LD9K 1G3YA 3L2ZA 3A5ZB 4QVCA 2QDJA 4C5EA 4M7AE 2BKDN 1G3TA 1RI0A 3FJPA 3SB2A 3MP1A 4C0FA 1VQLT 2BUDA 3QJYA 1Q7YC 4BB7A 4M77G 4C8QA 2RI2A 2VXEA 4FL6A 2KK4A 3JCMe 3CCLT 2V8JA 4VUBA 2GFUA 2XDBA 2D0QB 1LJOA 4BE1A 4FT2A 4DQ2A 3V8LA 2QXFA 2YHTA 3ZEHA 2QQSA 5FU7B 4L6V5 2VYTA 3Q1JA 2LCCA 4M77F 4KUIA 4XTVA 1V29B 3QZ5B 4NC6A 3VYGB 3E9FA 3P8BB 5IAYA 5GMKh 2QQ9A 4J8OA 4E7HA 1M1KC 1QVFA 2DTHA 3CCET 3M53A 1NJIC 1OYXA 4MDXA 1M4ZA 3A8LB 4HCBA 2OTJT 2M1HA 4J83A 3CBOA 3NFCA 3VV0A 2EQMA 2CYZB 4J7IA 4OB2B 4NS5A 3LWHA 4M7DE 3JCMb 3VKIA 2QFZA 3QYBA 2LCLA 4RG2A 5FLXE 1KC8U 3CD6T 2L89A 2LX9A 1N6AA 5HY6A 1B34B 2R5AA 2DK3A 2EIFA 3CCSA 4IUUA 3CC2A 4FU6A 4C92E 1YJ9T 5LJ3f 1QW1A 1M1FA 3LGFA 4WF2A 1W2BS 5CKBA 3OS0A 2O4XB 2HNIA 1WJSA 4M7DB 5FU7C 1I81A 4LDWA 2X4XA 5GAMd 3OMGA 3QYHB 3HBLA 4M78B 3FEOA 3CCUT 2D9TA 3HSBA 4M7DD 4RCBA 3TCJA 2JTFA 4HLQA 2VXFA 3OBYA 2KMGA 3GNGA 4NL2A 4M78D 3CC7T 3HL8A 4ELYC 1VQ7A 3GPLA 3RIRA 4C92D 4ZGEB 4QQDA 3PGGA 5GAMe 1K73U 2M0OA 4A54A 2M9UA 5D6WA 3OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF E;  2DXC A;  2WSC E;  3A8H B;  2WSE E;  3A8O B;  2QDY B;  2PVO B;  1UGP B;  2DD4 B;  2DPP B;  3WVE B;  3X24 B;  2PUK B;  1DJ7 B;  2AHJ B;  2ZCF B;  2DXC B;  4OB0 B;  3LW5 E;  2PVG B;  3HHT B;  3A8M B;  4KT0 E;  4XK8 E;  4RKU E;  2CZ1 B;  2ZZD A;  3A8G B;  1PSF A;  3QXE B;  4FM4 B;  3WVD B;  1GXI E;  3QZ9 B;  2DD5 A;  1AHJ B;  4Y28 E;  2ZZD B;  2PUO B;  2CZ0 B;  3VYG A;  1QP2 A;  2ZPG B;  1QP3 A;  2ZPB B;  2DD5 B;  2ZPE B;  2D0Q B;  1JB0 E;  1PSE A;  2PVD B;  2ZPH B;  1UGQ B;  4L6V 5;  1V29 B;  3QZ5 B;  3VYG B;  3X20 B;  3X26 B;  5L8R E;  2PU9 B;  3X28 B;  3A8L B;  2CYZ B;  4OB2 B;  2O01 E;  1IRE B;  3VYH B;  3QYG B;  2CZ6 B;  1UGR B;  2ZPI B;  2ZPF B;  2DXB A;  4ZGJ B;  3QYH B;  4ZGD B;  1UGS B;  4OB1 B;  3X25 B;  4OB3 B;  2DXB B;  4ZGE B;  2DD4 A;  2CZ7 B; 
#chains in the Genus database with same CATH topology
 3MEU A;  3H0I A;  3JB9 J;  1BIA A;  5LMK B;  1I8F A;  2LJ0 A;  3QWX X;  4LDV A;  2DMO A;  1GCQ A;  4CFX B;  2A3L A;  1IZ6 A;  3C95 A;  3X24 B;  4ROE A;  4AFU C;  2HAX A;  3CCR T;  4C0G A;  1H25 B;  3AT1 B;  2EW3 A;  1LNX A;  3NHN A;  2QQ8 A;  2A36 A;  5GAN g;  4YOZ A;  3CPW S;  2MK5 A;  4J6X A;  2K3X A;  4BCJ B;  5AYF A;  3VS7 A;  5A0L A;  2O31 A;  2BE7 D;  2YLB A;  1QVG S;  5HQ0 B;  1WQ7 A;  3MY5 B;  2JTM A;  2GBQ A;  2ROT A;  2I40 B;  3VS6 A;  2RI5 A;  2KR3 A;  1TH7 A;  2DX1 A;  3RNJ A;  1AHJ B;  2P84 A;  3CMA A;  4O6J A;  1WDX A;  3KUF A;  2RJC A;  3THK A;  4PJM A;  1WXB A;  4J9H A;  3OW2 S;  5IDN B;  3GF5 A;  1JB0 E;  3EJ1 B;  2K2V A;  3JB9 I;  1G83 A;  4M78 G;  2J06 A;  5GAO n;  2E41 A;  4BAC A;  1IXD A;  3CC4 Q;  1GCP A;  1TU0 B;  4RTU A;  3E1S A;  3MIA B;  5J39 A;  4BDZ A;  2YRD A;  1VQ4 T;  1XO2 A;  3RER A;  4D6W A;  2PMI B;  1M2V A;  4C92 F;  2COW A;  4J9E A;  5CEI B;  4F7U A;  4BY7 X;  3C94 A;  1PRM C;  5GAM h;  1PKS A;  2KRS A;  3K7A M;  4JRQ A;  1FMK A;  5EG2 A;  2K57 A;  4AFZ C;  2IW9 B;  4MMK A;  4ZGD B;  5GJW B;  1FKM A;  4D8K A;  1U1S A;  2QI2 A;  2VUB A;  4C8Q C;  1VIF A;  3SD4 A;  3N5B B;  2E65 A;  4A4G A;  2QF7 A;  2DM1 A;  1ZA1 B;  1NEB A;  4F14 A;  1UJY A;  3CBM A;  1BIB A;  3BLH B;  4M4Z A;  2DIQ A;  2W10 A;  1VQ8 A;  1VQ6 Q;  2DEU A;  1ZQ1 A;  4E6R A;  1K9A A;  2QGS A;  4J9D A;  1YIT Q;  3M5A A;  2PUK B;  1D3B B;  1HJD A;  2AHJ B;  2FEI A;  3JCM P;  2HCK A;  2M0Y A;  3OYF A;  5KYW B;  1HXD A;  3ULR B;  2XU8 A;  2QQB A;  1OX8 A;  3MKD A;  5IF1 B;  2ZZD A;  1V76 A;  1UE9 A;  4M75 B;  1QMC A;  4J9F A;  5HNB B;  2ED0 A;  3LH0 A;  1H4L D;  1OKW B;  4MFE A;  1G3N C;  1V1C A;  2RA2 A;  4L5G A;  2DD5 A;  5CO7 A;  2PNI A;  3CCS T;  5FU6 C;  4LD6 A;  5ICP B;  1KHI A;  2UZD B;  3TRE A;  1T3S A;  1ZUY A;  3VRZ A;  1PKD B;  4RTW A;  2OTL T;  2BS4 A;  3HP9 A;  4EOL B;  1JJ2 P;  2WMA B;  2VVK A;  2XDP A;  3OYI A;  1KIK A;  2KDS A;  1IHW A;  2KI7 A;  3QUI A;  1AEY A;  1IHV A;  5L8R E;  2W96 A;  1VQP T;  3RKW A;  4ESR A;  2NWM A;  2RK1 A;  2K79 A;  2C4G B;  1B07 A;  2YSQ A;  2RI3 A;  2HL3 A;  3QYG B;  1SHG A;  3DKM A;  5J3B A;  1KSW A;  1EIF A;  1WA7 A;  2EQK A;  1G3W A;  4ME7 A;  1GRI A;  1N4M A;  1M1G A;  4N0A C;  4F7U E;  2JMA A;  3EHQ A;  3OMC A;  3G7Z A;  2CP6 A;  4ZGJ B;  5ACB A;  2YRC A;  4E2F B;  5LJ5 j;  2L3Q A;  5DLQ E;  3INZ A;  1WXU A;  3X25 B;  4OMP A;  5EJC A;  1FWZ A;  8AT1 B;  2D0N A;  3MI9 B;  4KRD B;  4KGV B;  1W2B P;  5KYY B;  5IHN A;  1RAD B;  2XIC A;  5C0M A;  4M75 G;  4JZ3 A;  2G77 A;  3A8H B;  1YWP A;  4JX4 A;  4XTU A;  6AT1 B;  4BBS M;  2BZ8 A;  5LJ5 f;  3PVQ A;  1YI2 T;  1ZUU A;  2PK2 A;  2MOX A;  5GAN d;  2JXB A;  2R5M A;  1F5Q B;  1JJ2 S;  2J6F A;  2DL4 A;  2BZY A;  3CD6 A;  2P0P A;  4LUE A;  1RI9 A;  1FIN B;  4XU2 A;  2V8I A;  3E19 A;  3I56 Q;  3OS1 A;  1VQ5 A;  1QVF P;  2RMO A;  2B86 A;  4FYX B;  3ASK A;  3CCJ T;  1SSH A;  1KJW A;  2RHI A;  4QT7 A;  3S6W A;  2W2H A;  3NPF A;  4F04 B;  2KEA A;  4HNT A;  1M5Q 1;  1GFD A;  1KQ2 A;  3G71 Q;  3BG9 A;  2EKH A;  3OYY A;  2KAF A;  3CC7 A;  3G4S Q;  1H26 B;  3VS1 A;  1D1A A;  1X27 A;  3RUX A;  1QMZ B;  3G6E Q;  2HD0 A;  1GH6 B;  1WJQ A;  2R57 A;  3LLR A;  3HPW A;  1MV3 A;  2WFY B;  4LNP A;  2QK0 A;  4MZT A;  2LX7 A;  1X69 A;  3CCR A;  4MIM A;  5CCA A;  4IKF A;  2DRK A;  2E3H A;  4LDU A;  2CCI B;  4MFD A;  3CME Q;  1Z9Z A;  2PHG A;  4OVA A;  3CC2 T;  3VUB A;  1K0X A;  2O01 E;  2P0Q A;  1ZA2 B;  4M78 A;  4FSX A;  5KCH A;  4M77 B;  1W6X A;  3H0H A;  4QVZ A;  4CFW B;  1UHC A;  1QVF S;  2DAQ A;  4LXC A;  1W98 B;  4F7U F;  3REB B;  2HKN A;  2DJQ A;  1JKW A;  1S72 T;  5FRO A;  5A2Q E;  1NJI R;  4LDX A;  4KUD K;  5EC7 A;  2NLU A;  1X75 C;  2DVE A;  3QII A;  2DLP A;  2JJ9 A;  2A0F B;  2QQA A;  5KYU A;  4FYW B;  1M8V A;  5C6S A;  1Q81 C;  3S3O A;  1BI3 A;  1TG0 A;  2AK5 A;  3EFS A;  2A28 A;  2GFA A;  5FWC A;  4FYV B;  4JRP A;  4OP0 A;  4PJO C;  2LMJ A;  4BI3 A;  3CPF A;  4XQ3 A;  5IXB A;  5I2S A;  1VQ4 A;  1Q82 C;  4E7J A;  2EJ9 A;  4YTL A;  4EPC A;  2EWN A;  2QA4 Q;  4MML A;  2ZCF B;  3O8V A;  4OB0 B;  1VQ9 T;  1VA7 A;  2LNH B;  1YIJ Q;  1VIE A;  3FC3 A;  1VQM T;  1OGU B;  2AIR B;  2LDM A;  1UNG D;  2E4H A;  1VQK Q;  2V1Q A;  2C6T B;  2FRY A;  4XK8 E;  4AG1 C;  1QLB A;  1YJN Q;  2ABL A;  2BPM B;  2LJ3 A;  3LX7 A;  1IGU A;  3I55 Q;  4BCQ B;  2P4R A;  2FPD A;  2JM9 A;  4II1 A;  4C8Q B;  1H3Z A;  4Y28 E;  2VGN A;  5GAN j;  1KK7 A;  2EVR A;  3A5Z B;  3EFO A;  4QVC A;  2QDJ A;  1YJW Q;  2BKD N;  4BB7 A;  4M77 G;  3JCM e;  2KK4 A;  4BCM B;  2FG0 A;  4BE1 A;  4E7S A;  3V8L A;  1VQO Q;  2QQS A;  5FU7 B;  3Q1J A;  1TXQ A;  4XTV A;  1V29 B;  3QZ5 B;  4NC6 A;  4TTH A;  4E7H A;  4EOK B;  2QQ9 A;  2QGG A;  1NJI C;  1OYX A;  2SRC A;  1M4Z A;  1ZX6 A;  2LQN A;  4R0K A;  2OTJ T;  4J83 A;  2D1X A;  3NFC A;  2CP0 A;  4NS5 A;  3VV0 A;  3I5S A;  3JCM b;  2LCL A;  1AIS B;  2H8H A;  4OR5 B;  1N6A A;  5HY6 A;  1B34 B;  1YFN A;  2R5A A;  4LUD A;  3F5X B;  3CCQ Q;  3CCS A;  2C5O B;  2DIL A;  2RQW A;  1NLO C;  4M7D B;  1W70 A;  1I81 A;  1WI7 A;  1NEG A;  2X4X A;  2YXY A;  1MNE A;  4EOS B;  4HLQ A;  2VXF A;  4M78 D;  3CC7 T;  3HL8 A;  1JQQ A;  2FZG B;  2BZX A;  1MMN A;  1VQL Q;  3TNI B;  2L3S A;  1H27 B;  3OYJ A;  1VQP A;  4BY6 C;  2DET A;  3OYB A;  2WSC E;  4E47 A;  1BKB A;  3QHS A;  3CCL Q;  3A8O B;  1MUZ A;  5KYW A;  1X6O A;  3EH2 A;  2IW8 B;  2K5I A;  2JS0 A;  2VWF A;  4XU1 A;  1W1F A;  4EOM B;  5GAN 4;  1UGP B;  2WJ9 A;  4AKH A;  4C8Q G;  4M75 A;  1D0Z A;  1BI2 A;  4A63 B;  1ZUK A;  2DD4 B;  1OKV B;  2QQR A;  3WVE B;  3KFV A;  3ZBD A;  2C5V B;  2DXC B;  3CCE Q;  3C0C A;  5FW9 A;  5I11 A;  1I5O B;  5KCO A;  1SSF A;  1FMW A;  1Q86 C;  1NE8 A;  2WEV B;  1KQS P;  4C92 C;  2G3R A;  5FRM A;  2RHZ A;  1S1N A;  4LE9 A;  4QQ6 A;  1EFN A;  2GQI A;  1BYM A;  3TEE A;  2K6D A;  2F5K A;  5CYI B;  1JOW A;  1YJ9 Q;  3JCM h;  3FRN A;  4RTV A;  1UFF A;  2MI6 A;  3I56 T;  2MWO A;  1AT1 B;  1NJI U;  1YI2 A;  2GGR A;  2XD0 A;  2K2M A;  3DB3 A;  1WFW A;  4AKG A;  3JCM X;  1M30 A;  3OQ5 A;  3BDL A;  4PLL A;  4FIB A;  1AZG B;  2ZPH B;  3C4S A;  1H1S B;  4EOP B;  5IDP B;  4M7D G;  5GAN 3;  3CCJ A;  1NLP C;  5LJ5 e;  2EYW A;  1P5E B;  4KRC B;  1W2B A;  3RBB B;  3JB9 H;  3MP8 A;  2JMC A;  4QKU A;  2ZGW A;  1IRE B;  4M78 F;  2DIG A;  2MYS A;  2CZ6 B;  4PFZ A;  1X6B A;  3VRY A;  3QPH A;  2E6N A;  4X34 A;  2W99 A;  2RJD A;  2DA9 A;  2HL5 C;  3GP8 A;  3BHV B;  3HRS A;  1T0H A;  4DBR A;  1HSQ A;  2L5Q A;  1ZSZ B;  1KD1 R;  5KYY A;  2F5T X;  2PQW A;  1XOV A;  3V8K A;  2RHY A;  1D09 B;  3QSU A;  1QLY A;  3EG9 B;  1VOL A;  3VU3 C;  4ROD A;  4HT8 A;  4OB3 B;  4OF1 A;  2EYY A;  4DA4 A;  3DJB A;  1ZHI A;  3VUZ A;  4D8D A;  2M16 A;  4BXX X;  3DL1 A;  4GBQ A;  2KRN A;  4ZN1 A;  2QDY B;  4JS5 A;  3L2R A;  2C5N B;  2XID A;  1VQ5 T;  2DZC A;  4BCI B;  4F7N B;  2DL5 A;  3OY9 A;  3QO3 A;  3SWN A;  4M75 E;  1Q95 G;  2J6O A;  1QVP A;  2WIH B;  5LL6 S;  1R8O B;  1NYG A;  1W4S A;  1WYX A;  2RN8 A;  2FL7 A;  3LW5 E;  3L2Q A;  5CKE A;  1OV3 A;  2QTX A;  2EYQ A;  2OX7 A;  1QCN A;  5GAN 7;  3I5R A;  1IRX A;  1S72 A;  5IXF A;  2P0K A;  1WHG A;  3NMZ C;  1HD3 A;  1M90 R;  1ZBX A;  4M75 D;  4IIM A;  4KRT A;  1OPL A;  4C0Z A;  1GXI E;  5HK0 A;  3QZ9 B;  1K9M R;  4BI4 A;  2FPE A;  3BG3 A;  2MWP A;  2LZ6 B;  5ECA A;  4GLK A;  4J7F A;  1OZ2 A;  2DYB A;  1GBQ A;  2CP5 A;  1RAI B;  1H1Q B;  2OAU A;  1RL2 A;  1UHF A;  3DLM A;  1JO8 A;  2KE9 A;  5LJ5 h;  2X1N B;  4J9I A;  4XAX B;  2JTE A;  4PJO B;  2CCH B;  1PM3 A;  1PSE A;  2HDA A;  4L59 A;  3TSZ A;  1VQ9 A;  3TVT A;  1KD1 C;  3EGD B;  1VQ7 T;  4M77 A;  1VQM A;  2CJM B;  1N8R R;  1I4K 1;  3VKG A;  1XJW B;  1RUW A;  1YJW T;  3RKY A;  2DTO A;  2K4Y A;  3BDU A;  5KH6 A;  1NYF A;  2MAM A;  4HCZ A;  3UA6 A;  2OJ2 A;  1OEB A;  2GNC A;  3VYH B;  5D7U A;  2JUF A;  3GOX A;  1XTD A;  5EFQ B;  2HEQ A;  3FLG A;  3TSW A;  2YRV A;  4HA8 A;  2KR6 A;  2QG9 B;  3PO3 S;  4B9W A;  4BE2 A;  2QEX Q;  2L3P A;  3OBW A;  2HQE A;  4E7I A;  4OB1 B;  4ELL A;  5GAO m;  1QWF A;  3H4C A;  4CC3 A;  4DEX A;  2I2L A;  4RUG A;  2E6Z A;  1M90 C;  3CCV T;  1QCF A;  1YCS B;  1UG1 A;  2DO3 A;  5D6X A;  2OTJ A;  3H8Z A;  3O5Z A;  1O9S A;  1Y96 B;  2PVO B;  3L42 A;  4EOJ B;  1K9M C;  2V22 B;  2WIP B;  2RQR A;  4M75 F;  3M4Y A;  5L23 A;  2DPP B;  1LPL A;  3JSC A;  1RAF B;  3HFO A;  3M0Q A;  3JCM f;  5GAN e;  3L2W A;  2AKL A;  3J80 E;  2XG8 D;  4EDU A;  4C5G A;  1AOJ A;  4PJO G;  3KXT A;  4EMK B;  3L2V A;  1VYV A;  3MY1 B;  4FM4 B;  2CKK A;  2DTI A;  4E7L A;  2RF0 A;  3CBP A;  2DKG A;  3T9N A;  4M7A B;  1MMG A;  4MZP A;  4R55 A;  1N8R C;  1FYN A;  3EGX B;  1VQN T;  3D7S B;  1KD1 U;  4M6V A;  2RHU A;  2RJF A;  4NOY A;  2K7A A;  1FMV A;  4FW1 A;  4BY6 B;  3REA B;  1K73 R;  3PIP A;  4CC4 B;  2AZV A;  2HQX A;  4BCO B;  1UNL D;  2KXC A;  2O9S A;  3KHI A;  3CMA Q;  1H8K A;  4M77 E;  1B34 A;  5I22 A;  3X20 B;  2M51 A;  3WXM B;  4HT9 A;  4C92 B;  2W9Z A;  3MCA B;  3V8J A;  2DRM A;  3QHW B;  5IH2 A;  4M7D A;  4PL6 A;  4GY5 A;  4GLM A;  2FVU A;  2HMA A;  2JOY A;  3I56 A;  2KT1 A;  3MO8 A;  2NUP A;  1RAC B;  1KQ1 A;  4M77 D;  3H6Z A;  4JJN K;  1VUB A;  1YCY A;  1M90 U;  4F16 A;  1AWO A;  2C5X B;  5CK9 A;  4XU0 A;  1UDL A;  2FZK B;  2LCS A;  3OYA A;  4PFP A;  3LQ5 B;  1SF9 A;  1K9M U;  4EC8 B;  5I5Z B;  2KVQ G;  2GTJ A;  1KQS A;  3G71 A;  1YP5 A;  1KC8 C;  1VIN A;  5DY9 A;  1X2Q A;  2DD4 A;  3EH1 A;  3NTK A;  2UUE B;  2DXC A;  4DBF A;  5GAN h;  2LT1 A;  3MET A;  3MJX A;  4N0A A;  2CH4 A;  4HVU A;  4M7A G;  4DBQ A;  3G1J A;  4ANJ A;  2LJ1 A;  3CQT A;  1OI1 A;  4CRI A;  1MHN A;  1OQK A;  1YBY A;  2R58 A;  2RPN A;  1N8R U;  3M57 A;  4C0D C;  1E7P A;  1DJ7 B;  3S3N A;  5LJ3 g;  4FYY B;  3UWN A;  1K73 C;  2L0A A;  4CFU B;  3A8M B;  1OU9 A;  2D6F A;  1P92 A;  1M3B A;  1VQ8 Q;  2COZ A;  1WXT A;  2SEM A;  2CGH A;  2JW4 A;  1WHL A;  1U1T A;  1G8X A;  2AKK A;  2D8J A;  2BKZ B;  4HVW A;  5GAN 8;  1H64 1;  3TW6 A;  4RMO A;  3TN8 B;  4BCQ D;  1WJR A;  4A4F A;  2YWW A;  2I0N A;  2HKQ B;  4C8Q D;  1H24 B;  1EZZ B;  4OMO A;  2EBP A;  2JT4 A;  2WPA B;  1G3T A;  1CKA A;  1X6G A;  1F1B B;  3MP1 A;  2DVJ A;  2BUD A;  3QJY A;  1JEG A;  4Y72 B;  4PFO A;  4FL6 A;  2V8J A;  4VUB A;  2DBM A;  4FT2 A;  1Q81 R;  4YOO A;  2QXF A;  4BCM D;  2IPO B;  4Z8A A;  2VYT A;  4M77 F;  1H28 B;  4KUI A;  1E6H A;  1M1K C;  5IAY A;  3M53 A;  1BU2 A;  4F6U B;  1Q82 R;  4MDX A;  2CH4 W;  2DNU A;  1ZSZ A;  4HCB A;  1TFB A;  2M1H A;  2YDL A;  4J7I A;  4OB2 B;  4M7D E;  4FX3 B;  2PTK A;  4F17 A;  1KC8 U;  1H92 A;  2L89 A;  1OL2 B;  3TNW B;  2R7G A;  1SPK A;  3EG9 A;  2K3B A;  3LH5 A;  4JPB W;  3LGF A;  4JJC A;  1RAA B;  1YHQ Q;  1WZO A;  1W2B S;  5CKB A;  2KRM A;  1E6G A;  3OS0 A;  2O4X B;  1TWB A;  2HNI A;  1B3Q A;  3OMG A;  3CCM Q;  3FEO A;  2D9T A;  4M7D D;  3TCJ A;  2JTF A;  3OBY A;  2D8H A;  1VQ7 A;  3A98 A;  3TNH B;  1IB8 A;  1K73 U;  2M0O A;  2UZE B;  2M9U A;  1YJW A;  4BI8 B;  2EUF A;  4HCK A;  5M9O A;  3RR6 A;  5KYN A;  3L1A A;  5CQY A;  2HBP A;  3RKX A;  1YWO A;  2RJE A;  3M4G A;  4PK4 A;  3LWI A;  3PT9 A;  3CC4 T;  2E10 A;  1ZLM A;  4PJN A;  2JS2 A;  2PJQ A;  1PD1 A;  2PVG B;  4M78 C;  5FWB A;  3RES A;  1GBR A;  2O2O A;  4JX6 A;  2DJZ A;  2RQU A;  4B9X A;  3CD6 Q;  4IUV A;  1PSF A;  3M0T A;  2RK2 A;  4RG8 A;  4JRI A;  3QDR B;  3M55 A;  3LGL A;  4CRL B;  4PJO A;  4F7S B;  1LCK A;  2CP7 A;  2J05 A;  2RM4 A;  1XNI A;  1AWX A;  2CDT A;  4Q5W A;  3CCU Q;  3PFS A;  3EGD A;  3CCV A;  2J7I A;  2EGE A;  1UJ0 A;  4JLG A;  5GMK i;  3ZL7 C;  1TS9 A;  3CC7 Q;  1VQ6 T;  1D1B A;  1SKU B;  2RHX A;  1VQL A;  1YIT T;  4FCY A;  2K3Y A;  1YN8 A;  3QHR B;  3CCL A;  2KSS A;  2JVV A;  3VJP A;  3NDQ A;  2VB6 A;  3VKH A;  3J81 E;  1VYW B;  1VQN A;  4M7D F;  3CCR Q;  1Q86 R;  3AHU A;  1BU1 A;  2DME A;  4ATO A;  1CKB A;  3FJ5 A;  2A08 A;  4I3Z B;  1N9R A;  2X9H A;  1QCO A;  3HFN A;  4XTY A;  3V7C A;  3FDR A;  4R56 A;  5GAN f;  2QDL A;  3JB9 G;  3JCM J;  1H1R B;  4BCH B;  4FT4 A;  4CI0 C;  4F70 B;  4BCK B;  2X51 A;  3QYE A;  5DLO A;  1RAE B;  2JZ2 A;  4M78 E;  1OUL A;  5GAO l;  5LJ3 d;  2RB6 A;  2Y90 A;  1TOV A;  1Q81 U;  5KE3 A;  5FU6 B;  4ELJ A;  3OS5 A;  4AI6 A;  4EMK A;  4MDW A;  2E1H A;  2X4J A;  4BDY A;  2AT1 B;  4WCI A;  3UF4 A;  4M7A A;  1Q82 U;  3EGX A;  5J26 A;  3EHR A;  2LW4 A;  3NTH A;  3GNF B;  1TUD A;  3QKJ A;  2UZB B;  2W0Z A;  1QKX A;  2O88 A;  3QDF A;  2QTV A;  3MEA A;  1D3B A;  1NPP A;  3BHT B;  1VQ4 Q;  3A8G B;  4JX5 A;  3UDC A;  1X2K A;  1BI1 A;  3HRT A;  4G6L B;  3CXC A;  2XDD A;  3OYD A;  2H3E B;  1PWT A;  5A0D A;  2LNV A;  2RO0 A;  1KG1 A;  1M8M A;  2J6K A;  4JRK A;  3SDZ A;  2BS3 A;  1JSU B;  1M3A A;  2CP2 A;  1C1A A;  1QP2 A;  4MZM A;  1BI0 A;  1QP3 A;  1ZSG A;  1WQW A;  4DOV A;  3OYG A;  4IUQ A;  2ZPE B;  4OGC A;  1RAG B;  3FB9 A;  2A7Y A;  4CFN B;  4PJO D;  4C0D B;  4M75 C;  2KMT A;  4BY1 X;  2RH2 A;  3HO8 A;  5GMK m;  2X4Y A;  4P5N A;  1RAH B;  3M0P A;  5GAO r;  2KYB A;  2EGC A;  5CKF A;  1WPY A;  2F2W A;  2UZL B;  1WHK A;  3LYI A;  2EJF A;  3EFR A;  3BW1 A;  1UGR B;  3MP6 A;  4CC7 A;  1UNH D;  1SRM A;  3EG1 A;  3OA6 A;  2ZPI B;  2ZPF B;  5A0G A;  3G71 T;  2LQK A;  4AT1 B;  2W9F A;  3URG A;  3M54 A;  4JZ4 A;  3G4S T;  3ZFJ A;  2LT4 A;  1I5L A;  3G6E T;  1M2O A;  2F2X A;  1UGS B;  4EON B;  2IG0 A;  3CCS Q;  2K9G A;  3TU4 K;  5HKC A;  1JBM A;  5CAI A;  1HYO A;  2E12 A;  3KBG A;  2L3R A;  3JCM Q;  4IMY B;  1YHQ T;  4OMQ A;  2EPD A;  5GAM g;  4DOW A;  2OTL Q;  2V26 A;  1UB4 A;  1BBZ A;  1KQS S;  3DOG B;  3CCM T;  3DTO A;  3CME T;  3MEV A;  1N27 A;  1VQP Q;  8ATC B;  3R6O A;  3UAT A;  3OYH A;  4ZTF A;  1T0J A;  5GAO p;  4KT0 E;  4ORZ A;  2ED1 A;  1MV0 B;  1X01 A;  1Q86 U;  1WNL A;  3QXE B;  5CIU A;  5GAN 2;  4J6Y A;  2IIM A;  3FIF A;  5LJ3 j;  3UT1 A;  2MIO A;  2LC4 A;  4M7A D;  4CFV B;  4PJO F;  4X9D A;  5GAN 6;  2DF6 A;  2A37 A;  3S3M A;  4CC2 A;  2CUB A;  2PUO B;  1M9S A;  3JCM c;  2KYM A;  2QEX A;  5IT9 E;  2PK9 B;  1QVG P;  1LVK A;  5CVI A;  2IVW A;  5CQX A;  3CC4 A;  1G2B A;  5FRN A;  2VGM A;  1WX6 A;  2P4T A;  2ZAE A;  3EG0 A;  3SWN C;  4F7L B;  1D3U B;  1ACM B;  1YI2 Q;  3X26 B;  2L8D A;  3OYL A;  2QA4 T;  2RQT A;  4C5H A;  1PHT A;  3RMQ A;  1YIJ T;  3OW2 P;  2WXV B;  3X28 B;  3QG1 A;  1VQK T;  1KXU A;  2O4X A;  2E5K A;  3OYN A;  3VS2 A;  1CSK A;  1YJN T;  4WTO B;  1KHC A;  3I55 T;  1MGQ A;  1Y07 A;  5HBH B;  3RGF B;  3CCJ Q;  1B7T A;  1TUG B;  2GQV A;  4UC4 A;  3TQ7 P;  3TW7 A;  3POM A;  2NYS A;  1GCQ C;  2HBW A;  3P8H A;  1A0N B;  1JXM A;  4EMH A;  3JRZ A;  5KYU B;  3UPU A;  5CKH A;  3F70 A;  3J7A F;  1I1J A;  3PVL A;  1OI9 B;  1VQ6 A;  2HSP A;  3DB4 A;  4LDY A;  2DXB B;  2LP5 A;  1YIT A;  3SEM A;  1ABQ A;  2CZ7 B;  5CR2 A;  1VQO T;  2COY A;  4Y91 A;  2F1L A;  4M77 C;  2WSE E;  2EKO A;  4RCC A;  4J9C A;  4OML A;  3GLX A;  5GAN 5;  2HQH A;  3DDP B;  1JXO A;  3MHX A;  2QGF B;  1R77 A;  4N4G A;  1ENW A;  4PJJ A;  2FB7 A;  2C06 A;  1GL5 A;  4ROC A;  1JRI A;  4M7A F;  2KNB B;  4BCN B;  4EOI B;  3CC2 Q;  3CCQ T;  4QQG A;  1OIU B;  4A4K A;  1O9K B;  2IW6 B;  4CFU D;  1WHH A;  5DQV A;  5LJ5 d;  4V2S A;  1K76 A;  3P8D A;  1YNZ A;  2KRO A;  3WVD B;  3EFO B;  4F6S B;  2DBK A;  2KXD A;  2Z0W A;  3V7R A;  3EGU A;  1AD5 A;  1XQH A;  1N9S A;  5KE2 A;  1K8A C;  4LD9 K;  1AVZ C;  9ATC B;  1S72 Q;  4C5E A;  4YOS A;  1VQL T;  1RI0 A;  3FJP A;  3SB2 A;  1MND A;  1Q7Y C;  4CFM B;  1KC8 R;  4C8Q A;  2RI2 A;  3VS3 A;  2VXE A;  2ESW A;  3CCL T;  1LJO A;  4DQ2 A;  2YHT A;  3NGP A;  4BCP B;  1TSF A;  3ZEH A;  1WLP B;  1R0B G;  1PRL C;  5IHY A;  1RAB B;  1R0C B;  2LCC A;  1M3C A;  3P8B B;  3VYG B;  4J8O A;  3CCE T;  2HZY A;  2WHB B;  3M0R A;  3CBO A;  4UN0 A;  1VQ9 Q;  1IO6 A;  4Y92 A;  3LWH A;  3VKI A;  3QYB A;  4RG2 A;  1VQM Q;  3DDQ B;  5GJV B;  1JST B;  1YJ9 T;  2QAZ A;  1QW1 A;  1M1F A;  4WF2 A;  4AG2 C;  2I53 A;  3BLQ B;  5IHI A;  1NBE B;  4EOO B;  1WJS A;  5FU7 C;  5GAM d;  3HBL A;  2DL8 A;  1QWE A;  5LQF B;  3CXC P;  2KMG A;  3GNG A;  4NL2 A;  3JV3 A;  2ECZ A;  3E2U A;  1I0C A;  1AZE A;  4IIO A;  1RLP C;  4ZGE B;  1UTI A;  3PGG A;  4QQD A;  5GMK j;  2NUT B;  4TVR A;  2WSF E;  5D6Y A;  1D0X A;  2X35 A;  2MF2 A;  3PTA A;  4J9G A;  3EID B;  1N5Z A;  3UA7 A;  4LOC A;  2CRE A;  2EYZ A;  1M1K R;  3CEY A;  3JB9 D;  4M7D C;  3VS0 A;  1K8A U;  2EJG A;  3M56 A;  4KH1 B;  4JJB A;  3ME9 A;  3MPU B;  1OZ3 A;  2OTJ Q;  3G4S A;  2LQ8 A;  1Y7X A;  4HVV A;  1Q7Y U;  4XTZ A;  3G6E A;  2XI9 A;  2PZ1 A;  4HCC A;  2KQW A;  5HBJ B;  3B57 A;  2EGA A;  4ELZ C;  2FZC B;  2FPF A;  1D1C A;  3HB9 A;  2H3J A;  1ZBJ A;  1U06 A;  4RTT A;  3QJ6 A;  4RTX A;  1YHQ A;  1TD6 A;  2CT3 A;  3I35 A;  1C0M A;  1J3T A;  3L2U A;  4KUL A;  4OMN A;  3CCM A;  2CUD A;  2E3I A;  5HCK A;  3CME A;  2E64 A;  3CXC S;  4C8Q E;  3C12 A;  2M02 A;  2DXU A;  3BHU B;  2MPX C;  2V1R A;  4EIK A;  4F7J B;  5KYX B;  3M0U A;  3HRU A;  1OL1 B;  1UGQ B;  4ZTJ A;  4XTX A;  3OSV A;  2Y4X A;  5HK3 A;  4JLI A;  1QKW A;  4C92 G;  5GMK l;  3OB9 A;  2QYZ A;  3OYM A;  4AMC A;  3HZJ A;  4J5Y A;  1PC0 A;  4YC3 B;  4HL4 A;  1ABO A;  1JU5 C;  3EG3 A;  1NZ9 A;  1GUX B;  5AT1 B;  2RNA A;  1T3L A;  1UEC A;  2B9R A;  4NST B;  4BCG B;  2HSE B;  2BTT A;  1M27 C;  4N4I A;  7AT1 B;  4DEY A;  4BBR M;  2WMB B;  1NM7 A;  4EOQ B;  3JB9 F;  1K4U S;  3CCU A;  3SWN B;  2QA4 A;  3DLL A;  1QQJ A;  1YIJ A;  4KGX B;  1VQK A;  3SFM A;  3BE3 A;  4FW2 A;  1X43 A;  1FXX A;  4AFS C;  1G5V A;  3CPW A;  2VV5 A;  4AKI A;  3H9N A;  2C0O A;  2X3X D;  3OYE A;  4O5V A;  4BE0 A;  1YJN A;  2YUO A;  5LJ3 e;  2ROL A;  3I55 A;  1QVG A;  1ZSZ C;  2KBT A;  3BG5 A;  4RTY A;  2JN0 A;  3H0F A;  1SEM A;  4J6W A;  2EQJ A;  5GAM j;  4F6W B;  4PLI A;  1BCO A;  2BIV A;  1UGV A;  2CZ1 B;  4PKC C;  1BCM A;  4EC9 B;  3PE0 A;  1EX4 A;  3OW2 A;  2QEX T;  2KGT A;  4KBM B;  4Z02 A;  1OU8 A;  1VQO A;  5GAM f;  2NUZ A;  3EAE A;  2EAY A;  2X3W D;  3GTM S;  1VOM A;  4IUR A;  2KY9 A;  2VKN A;  2AZS A;  2CZ0 B;  4HNV A;  5FGK B;  1AWW A;  1TUC A;  1G3S A;  1FX7 A;  1OIY B;  2ZPG B;  2GCX A;  4C8Q F;  2ZPB B;  2XMF A;  2X4W A;  3M59 A;  1D0Y A;  2PVD B;  2V8K A;  3JCM g;  2DYI A;  2G9X B;  2YUQ A;  4B6M A;  1U8R A;  3CCQ A;  4II5 B;  1LOJ A;  1VQ5 Q;  3QWL A;  2E5Q A;  4JUV A;  5GAO q;  1SRL A;  3HKS A;  2LTO A;  1UEB A;  1M1K U;  3PIO A;  2B8A A;  5BNJ B;  1PD0 A;  2GF7 A;  3JCM V;  3VS5 A;  3GBQ A;  4N4H A;  3O0G D;  3H41 A;  3OYK A;  1HK9 A;  2FO0 A;  4XU3 A;  4NL3 A;  1O75 A;  5I21 A;  2DER A;  2E70 A;  1SG5 A;  2DXB A;  1UUE A;  3PMI A;  3SHW A;  5IHK A;  3EOC B;  2F69 A;  1NG2 A;  3BLR B;  4BUG A;  4BD3 A;  3IQL A;  1ZP2 A;  3PNW C;  1M2V B;  4OMF B;  5LJ3 h;  3MEW A;  4F7U B;  4Z88 A;  3CCE A;  3E9G A;  4E7K A;  3CMA T;  2XKO C;  2DEQ A;  2YLC A;  2DFU A;  1BB9 A;  2RQV A;  5CKD A;  2XK0 A;  1O9K A;  4DBH A;  1RLQ C;  1VQ7 Q;  2WAC A;  4XTW A;  1GFC A;  3PMT A;  1YJ9 A;  2LRQ A;  4E7Z A;  1I07 A;  4IUT A;  1Y96 A;  2XHC A;  3V7S A;  5L2W B;  2IVX A;  3RMS A;  1NPR A;  1Y71 A;  4RKU E;  2F2C A;  2YT6 A;  4A53 A;  4JDS A;  3OS2 A;  3BFM A;  1PG5 B;  3BY7 A;  3NTI A;  2Y4Y A;  2RD1 A;  2ZZD B;  1VYU A;  5IN1 A;  2O9V A;  2VAS A;  3VYG A;  4OGE A;  1OOT A;  3QWY A;  2FYK A;  2KT8 A;  1PCX A;  3M03 A;  2MMP A;  2DD5 B;  3JAM E;  2ENM A;  2OI3 A;  2CSI A;  1AD6 A;  4PNO A;  2C0I A;  4EMK C;  5HVY B;  4JJD A;  5DQW A;  3CCV Q;  1U5S A;  2OTL A;  5HBE B;  3HTR A;  1H3H A;  2YUP A;  1C9B A;  2G6F X;  2PU9 B;  4M7A C;  4PJO E;  4C5I A;  2FRW A;  4HKE A;  1WHJ A;  2NUP B;  3EG2 A;  5LJ5 g;  1VQ8 T;  3M9Q A;  1OX9 A;  4F7U G;  4A4E A;  2K5F A;  2L2P A;  4JS4 A;  1IGQ A;  5I2M A;  5GMK e;  4C92 A;  1OPK A;  1WGS A;  1ARK A;  1MMD A;  2CT4 A;  4QSH A;  2CP3 A;  2NUT A;  4QVD A;  1VQN Q;  2DL7 A;  2CS7 A;  1AWJ A;  3OSS C;  1JJ2 A;  2DZ9 A;  4ZNX A;  1Y57 A;  1Y0M A;  2QAS A;  4Z89 A;  1C6V X;  3M58 A;  1TTH B;  1E9H B;  4J9B A;  1VYT A;  4EMG A;  3QBY A;  3OYC A;  2VC8 A;  1GY3 B;  2JGZ B;  2JNG A;  2EQI A;  1BK2 A;  3G33 B;  2DXT A;  3JCM W;  4Z6Y A;  2DE0 X;  2EYX A;  2OAW A;  2MCN A;  2BE9 B;  3GIB A;  3HHT B;  3RDV A;  2K5L A;  4ZN3 A;  4BCN D;  4X9C A;  2EQU A;  3R6N A;  4A4H A;  5DM7 R;  2BS2 A;  4BCF B;  4HNU A;  4IUP A;  3ER0 A;  5KYX A;  2LVM A;  4QW2 A;  3JCM d;  2EFI A;  2FHD A;  1G3Y A;  3L2Z A;  1WIE A;  1PNJ A;  4M7A E;  4C0F A;  1FVV B;  1SHF A;  4HXJ A;  4CXA B;  1E7O A;  3U23 A;  3VS4 A;  4X1V A;  2GFU A;  2XDB A;  1H1P B;  2D0Q B;  2JM8 A;  1MMA A;  4OGR B;  4FSS A;  4L6V 5;  1WHM A;  5GMK h;  3E9F A;  1QVF A;  1URC B;  2DTH A;  1U3O A;  1GUX A;  1PKT A;  3A1P A;  3CPW P;  3A8L B;  4K11 A;  2EQM A;  2CYZ B;  4EOR B;  3M0S A;  1K0S A;  2QFZ A;  3CD6 T;  5FLX E;  2LX9 A;  2CSQ A;  2DK3 A;  2EIF A;  4IUU A;  4OMM A;  3CC2 A;  4FU6 A;  4C92 E;  5LJ3 f;  1KFZ A;  2F2V A;  4KH0 B;  4RTZ A;  2C0T A;  1K1Z A;  2ATC B;  2GTO A;  4AFQ C;  4LDW A;  3I9Q A;  3CCU T;  3QYH B;  4M78 B;  4LN2 A;  1Z9Q A;  2DL3 A;  3HSB A;  4RCB A;  2IN3 A;  1K8A R;  4ELY C;  3GPL A;  3RIR A;  4C92 D;  2YUN A;  4KGZ B;  5GAM e;  2LQW A;  4A54 A;  5D6W A;  4PJL A;  1Q7Y R; 
#chains in the Genus database with same CATH homology
 4TVR A;  2WSF E;  3MEU A;  4BI8 B;  4BY6 C;  1VQP A;  5D6Y A;  2WSC E;  3OYB A;  2X35 A;  1BIA A;  4E47 A;  1BKB A;  3JB9 J;  3QHS A;  3A8O B;  5M9O A;  2MF2 A;  1X6O A;  1I8F A;  3L1A A;  2K5I A;  3PTA A;  5CQY A;  4XU1 A;  5GAN 4;  4LDV A;  1UGP B;  2HBP A;  3RKX A;  2WJ9 A;  4AKH A;  2A3L A;  1IZ6 A;  2RJE A;  3C95 A;  3M4G A;  1BI2 A;  4LOC A;  3PT9 A;  2E10 A;  4M75 A;  3LWI A;  2DD4 B;  2QQR A;  3WVE B;  3X24 B;  3ZBD A;  3CEY A;  2DXC B;  3JB9 D;  3CCR T;  2HAX A;  4C0G A;  4M7D C;  1K8A U;  2PVG B;  4M78 C;  3RES A;  5KCO A;  2EJG A;  3M56 A;  1SSF A;  1LNX A;  3ME9 A;  2QQ8 A;  1NE8 A;  4JX6 A;  1OZ3 A;  2DJZ A;  3G4S A;  1Q86 C;  4C92 C;  5GAN g;  2LQ8 A;  1Y7X A;  2G3R A;  3CPW S;  4B9X A;  5FRM A;  1Q7Y U;  4J6X A;  4XTZ A;  2RHZ A;  4QQ6 A;  3G6E A;  4IUV A;  2K3X A;  2XI9 A;  5AYF A;  4HCC A;  1BYM A;  3TEE A;  1PSF A;  2KQW A;  2RK2 A;  5A0L A;  2F5K A;  1QVG S;  2YLB A;  4RG8 A;  4JRI A;  3QDR B;  3M55 A;  5GMK j;  1WQ7 A;  2JTM A;  4ELZ C;  3JCM h;  3FRN A;  3LGL A;  2RI5 A;  3HB9 A;  4PJO A;  1TH7 A;  2MI6 A;  2H3J A;  3I56 T;  1YHQ A;  2MWO A;  3QJ6 A;  1AHJ B;  2RM4 A;  1XNI A;  3CMA A;  4Q5W A;  3PFS A;  4O6J A;  1NJI U;  3CCV A;  3KUF A;  2RJC A;  3L2U A;  1YI2 A;  4KUL A;  3CCM A;  2XD0 A;  3DB3 A;  4AKG A;  3CME A;  2E64 A;  3JCM X;  4C8Q E;  3OQ5 A;  4JLG A;  5GMK i;  3BDL A;  3C12 A;  4PLL A;  3CXC S;  3OW2 S;  3GF5 A;  2DXU A;  4FIB A;  1JB0 E;  1VQ6 T;  3HRU A;  2ZPH B;  2RHX A;  3C4S A;  1VQL A;  1UGQ B;  4ZTJ A;  2K2V A;  4XTX A;  1YIT T;  3OSV A;  2K3Y A;  4M7D G;  3JB9 I;  2Y4X A;  5HK3 A;  5GAN 3;  2KSS A;  4JLI A;  2JVV A;  4M78 G;  3VJP A;  3CCJ A;  3CCL A;  5LJ5 e;  5GAO n;  2E41 A;  4BAC A;  3VKH A;  1W2B A;  3J81 E;  3JB9 H;  3MP8 A;  4C92 G;  5GMK l;  3E1S A;  3OB9 A;  5J39 A;  2ZGW A;  1VQN A;  3OYM A;  4M7D F;  4BDZ A;  1IRE B;  4M78 F;  3HZJ A;  4J5Y A;  2DIG A;  1VQ4 T;  2CZ6 B;  3RER A;  3AHU A;  4D6W A;  3QPH A;  2E6N A;  4HL4 A;  4X34 A;  4C92 F;  2RJD A;  3GP8 A;  1NZ9 A;  3HRS A;  3C94 A;  4F7U A;  5GAM h;  4ATO A;  1YJW T;  2L5Q A;  4JRQ A;  3V7C A;  1N9R A;  3HFN A;  4XTY A;  3FDR A;  4R56 A;  5EG2 A;  2K57 A;  2F5T X;  5GAN f;  2PQW A;  3JB9 G;  4N4I A;  4MMK A;  3JCM J;  4ZGD B;  1XOV A;  3V8K A;  1FKM A;  2RHY A;  3QSU A;  3VU3 C;  1U1S A;  4FT4 A;  4BBR M;  4CI0 C;  2QI2 A;  4OB3 B;  2VUB A;  4C8Q C;  4HT8 A;  4OF1 A;  3QYE A;  5DLO A;  1VIF A;  3SD4 A;  3N5B B;  4DA4 A;  1ZHI A;  2E65 A;  4A4G A;  2QF7 A;  3VUZ A;  3CCU A;  2JZ2 A;  3SWN B;  3DLL A;  2QA4 A;  4M78 E;  5GAO l;  5LJ3 d;  2M16 A;  3CBM A;  2RB6 A;  1BIB A;  1YIJ A;  2Y90 A;  1Q81 U;  3SFM A;  3DL1 A;  2DIQ A;  5KE3 A;  1VQK A;  4JS5 A;  4ZN1 A;  1FXX A;  2QDY B;  3L2R A;  2XID A;  1VQ5 T;  1VQ8 A;  2DZC A;  1G5V A;  5FU6 B;  3CPW A;  2VV5 A;  4ELJ A;  4AKI A;  1ZQ1 A;  3OS5 A;  3QO3 A;  3OY9 A;  3SWN A;  4BE0 A;  4AI6 A;  4O5V A;  3OYE A;  4EMK A;  1YJN A;  5LJ3 e;  4MDW A;  3M5A A;  2E1H A;  4M75 E;  3I55 A;  2X4J A;  1QVG A;  1QVP A;  4BDY A;  2PUK B;  1D3B B;  1R8O B;  1W4S A;  5LL6 S;  2AHJ B;  3BG5 A;  3JCM P;  2FL7 A;  2JN0 A;  1Q82 U;  4M7A A;  3LW5 E;  5J26 A;  4J6W A;  2EQJ A;  3OYF A;  5GAM j;  3L2Q A;  3NTH A;  4PLI A;  3GNF B;  5CKE A;  1HXD A;  2QTX A;  3QKJ A;  2EYQ A;  2XU8 A;  2BIV A;  2QQB A;  5GAN 7;  3MEA A;  1D3B A;  2CZ1 B;  2ZZD A;  4M75 B;  1S72 A;  1NPP A;  2P0K A;  4PKC C;  3A8G B;  4JX5 A;  3UDC A;  3HRT A;  1BI1 A;  3CC4 T;  1ZBX A;  4M75 D;  3LH0 A;  4C0Z A;  3CXC A;  1GXI E;  5HK0 A;  3QZ9 B;  2XDD A;  3OW2 A;  2QEX T;  4MFE A;  4L5G A;  2RA2 A;  3OYD A;  2DD5 A;  4BI4 A;  3BG3 A;  2MWP A;  4KBM B;  4Z02 A;  5A0D A;  5CO7 A;  2LNV A;  3CCS T;  5FU6 C;  2RO0 A;  3EAE A;  5GAM f;  4LD6 A;  2EAY A;  4GLK A;  4J7F A;  4IUR A;  1KG1 A;  1OZ2 A;  2KY9 A;  1KHI A;  3TRE A;  4JRK A;  3SDZ A;  2CZ0 B;  4HNV A;  2BS3 A;  2OAU A;  1G3S A;  1RL2 A;  3DLM A;  1FX7 A;  1QP2 A;  1BI0 A;  2ZPG B;  1QP3 A;  4MZM A;  5LJ5 h;  2GCX A;  2BS4 A;  3HP9 A;  4C8Q F;  2ZPB B;  2OTL T;  1WQW A;  4XAX B;  2X4W A;  4DOV A;  3OYG A;  4IUQ A;  3M59 A;  4PJO B;  2ZPE B;  2XDP A;  3OYI A;  1PSE A;  4L59 A;  4OGC A;  2KDS A;  3FB9 A;  1VQ9 A;  2PVD B;  2A7Y A;  4PJO D;  2V8K A;  3JCM g;  3QUI A;  4C0D B;  1KD1 C;  1U8R A;  1VQ7 T;  4M77 A;  4M75 C;  1VQM A;  2KMT A;  2RH2 A;  3CCQ A;  3HO8 A;  1I4K 1;  5L8R E;  1LOJ A;  2X4Y A;  3VKG A;  4P5N A;  5GMK m;  3QWL A;  2E5Q A;  4JUV A;  1VQP T;  3RKW A;  3RKY A;  2DTO A;  2K4Y A;  3BDU A;  3HKS A;  5GAO q;  5GAO r;  5CKF A;  2LTO A;  1UEB A;  1M1K U;  3PIO A;  2B8A A;  5KH6 A;  2MAM A;  4HCZ A;  2GF7 A;  1WPY A;  2RK1 A;  3JCM V;  2RI3 A;  4N4H A;  3OYK A;  3VYH B;  3QYG B;  2JUF A;  3DKM A;  3LYI A;  3GOX A;  5J3B A;  1HK9 A;  2EJF A;  1XTD A;  3EFR A;  1EIF A;  3BW1 A;  1UGR B;  2EQK A;  1G3W A;  4ME7 A;  1O75 A;  3MP6 A;  4XU3 A;  5I21 A;  4NL3 A;  1M1G A;  2E70 A;  3FLG A;  4N0A C;  3OA6 A;  2ZPI B;  2ZPF B;  5A0G A;  3G71 T;  2DXB A;  2LQK A;  4F7U E;  2YRV A;  4HA8 A;  2KR6 A;  3URG A;  3M54 A;  4B9W A;  4BE2 A;  3PMI A;  3OMC A;  3G7Z A;  3G4S T;  4ZGJ B;  5LJ5 j;  3ZFJ A;  2LT4 A;  5DLQ E;  2F69 A;  3INZ A;  3OBW A;  2HQE A;  4E7I A;  3G6E T;  1I5L A;  1UGS B;  4OB1 B;  4BUG A;  2IG0 A;  3X25 B;  4BD3 A;  5EJC A;  1FWZ A;  3PNW C;  5GAO m;  3H4C A;  3TU4 K;  4OMF B;  5LJ3 h;  3MEW A;  4F7U B;  5HKC A;  1JBM A;  5CAI A;  2I2L A;  2E12 A;  3KBG A;  2E6Z A;  2L3R A;  3JCM Q;  1YHQ T;  2XIC A;  3CCE A;  5C0M A;  3E9G A;  4M75 G;  4E7K A;  5GAM g;  4DOW A;  1M90 C;  2G77 A;  3A8H B;  3CMA T;  4JX4 A;  4XTU A;  1UB4 A;  4BBS M;  2DEQ A;  2DO3 A;  2XKO C;  2YLC A;  5D6X A;  5LJ5 f;  3H8Z A;  3CCV T;  1YI2 T;  2OTJ A;  1KQS S;  5CKD A;  1O9S A;  1Y96 B;  2PVO B;  2R5M A;  3L42 A;  5GAN d;  2XK0 A;  3CCM T;  1K9M C;  1JJ2 S;  3CME T;  4M7A D;  3CD6 A;  2P0P A;  4M75 F;  2WAC A;  4XTW A;  3M4Y A;  3MEV A;  4XU2 A;  2DPP B;  2V8I A;  3PMT A;  1N27 A;  3JSC A;  3E19 A;  1YJ9 A;  3HFO A;  2LRQ A;  3JCM f;  5GAN e;  4IUT A;  1Y96 A;  3OS1 A;  2XHC A;  3J80 E;  3R6O A;  3L2W A;  2XG8 D;  1VQ5 A;  3OYH A;  3V7S A;  4ZTF A;  4EDU A;  5GAO p;  4KT0 E;  3RMS A;  3ASK A;  1NPR A;  3CCJ T;  4C5G A;  4PJO G;  1Y71 A;  2RHI A;  4RKU E;  1X01 A;  3S6W A;  1WNL A;  4EMK B;  3KXT A;  3L2V A;  1VQO A;  1Q86 U;  3JB9 F;  4A53 A;  3QXE B;  4FM4 B;  2CKK A;  2DTI A;  5CIU A;  4E7L A;  4HNT A;  3CBP A;  2DKG A;  4J6Y A;  4JDS A;  1M5Q 1;  4M7A B;  4MZP A;  3T9N A;  5GAN 2;  3FIF A;  4R55 A;  3OS2 A;  1N8R C;  5LJ3 j;  3UT1 A;  1KQ2 A;  3BFM A;  3BG9 A;  2LC4 A;  1KD1 U;  3BY7 A;  3OYY A;  4PJO F;  2KAF A;  4M6V A;  2RHU A;  2RJF A;  4NOY A;  4X9D A;  5GAN 6;  3CC7 A;  3NTI A;  2Y4Y A;  3S3M A;  2RD1 A;  3RUX A;  2ZZD B;  2PUO B;  1M9S A;  5IN1 A;  3JCM c;  4BY6 B;  2HD0 A;  2QEX A;  3VYG A;  5IT9 E;  4OGE A;  2R57 A;  1WJQ A;  2FYK A;  3LLR A;  3HPW A;  5CVI A;  3PIP A;  2IVW A;  5CQX A;  3CC4 A;  2MMP A;  4MZT A;  2DD5 B;  2HQX A;  3JAM E;  5FRN A;  2VGM A;  4PNO A;  3CCR A;  2P4T A;  4MIM A;  3SWN C;  5CCA A;  3KHI A;  4IKF A;  4EMK C;  4M77 E;  1B34 A;  2OTL A;  3X20 B;  3X26 B;  2L8D A;  3OYL A;  2QA4 T;  4LDU A;  3WXM B;  2PU9 B;  4C5H A;  4M7A C;  4C5I A;  4HT9 A;  4MFD A;  4PJO E;  4HKE A;  3RMQ A;  1YIJ T;  4OVA A;  3CC2 T;  3X28 B;  3QG1 A;  4C8Q G;  4C92 B;  1VQK T;  3V8J A;  3MCA B;  3VUB A;  2O4X A;  5LJ5 g;  3M9Q A;  3OYN A;  1VQ8 T;  4F7U G;  4M7D A;  2O01 E;  4GY5 A;  2K5F A;  2P0Q A;  4PL6 A;  4A4E A;  2FVU A;  4M78 A;  4FSX A;  5KCH A;  4M77 B;  4JS4 A;  1YJN T;  2JOY A;  3I56 A;  1KHC A;  3MO8 A;  3I55 T;  4QVZ A;  1MGQ A;  5I2M A;  1KQ1 A;  1Y07 A;  4M77 D;  3H6Z A;  4C92 A;  1VUB A;  5GMK e;  1WGS A;  2DAQ A;  4JJN K;  1QVF S;  1YCY A;  4F7U F;  2GQV A;  4UC4 A;  1M90 U;  1VQN T;  3TW7 A;  4QSH A;  3P8H A;  5CK9 A;  4XU0 A;  4QVD A;  3OYA A;  4EMH A;  3JRZ A;  1K9M U;  3UPU A;  5CKH A;  3F70 A;  2KVQ G;  1S72 T;  5FRO A;  2CS7 A;  3J7A F;  1KQS A;  5A2Q E;  3OSS C;  4LDX A;  1VQ6 A;  1JJ2 A;  3G71 A;  4KUD K;  2DZ9 A;  2NLU A;  1KC8 C;  1X75 C;  2DVE A;  5DY9 A;  3DB4 A;  4LDY A;  2DXB B;  3QII A;  1YIT A;  2QQA A;  1M8V A;  2DD4 A;  5C6S A;  1Q81 C;  2CZ7 B;  5CR2 A;  3S3O A;  1BI3 A;  3M58 A;  3NTK A;  2DXC A;  1VQO T;  5GAN h;  4Y91 A;  2LT1 A;  3MET A;  4M77 C;  2WSE E;  3EFS A;  2EKO A;  2GFA A;  4RCC A;  4EMG A;  3QBY A;  4N0A A;  3OYC A;  4JRP A;  3GLX A;  4OP0 A;  5GAN 5;  4M7A G;  4PJO C;  3MHX A;  2VC8 A;  4BI3 A;  3CPF A;  4XQ3 A;  1OI1 A;  4N4G A;  4CRI A;  1MHN A;  1YBY A;  2R58 A;  1N8R U;  5I2S A;  2JNG A;  1VQ4 A;  2FB7 A;  1Q82 C;  3M57 A;  4E7J A;  2EJ9 A;  4YTL A;  4C0D C;  4EPC A;  2C06 A;  1E7P A;  2DXT A;  2EWN A;  1DJ7 B;  1JRI A;  4MML A;  2ZCF B;  3O8V A;  4OB0 B;  3JCM W;  3S3N A;  5LJ3 g;  4Z6Y A;  1VQ9 T;  4M7A F;  3UWN A;  1VIE A;  3FC3 A;  1VQM T;  1K73 C;  2LDM A;  3GIB A;  3HHT B;  3A8M B;  4QQG A;  3CCQ T;  2D6F A;  1P92 A;  2K5L A;  4ZN3 A;  4A4K A;  4X9C A;  2CGH A;  4XK8 E;  2EQU A;  4A4H A;  5LJ5 d;  1QLB A;  3P8D A;  5DM7 R;  4V2S A;  1YJW A;  1U1T A;  2BS2 A;  3LX7 A;  3WVD B;  5GAN 8;  1H64 1;  3TW6 A;  4RMO A;  4HNU A;  3V7R A;  4II1 A;  1WJR A;  4IUP A;  3ER0 A;  4C8Q B;  4A4F A;  1XQH A;  1H3Z A;  1N9S A;  2LVM A;  4QW2 A;  4Y28 E;  2VGN A;  5KE2 A;  3JCM d;  2EFI A;  5GAN j;  2FHD A;  4C8Q D;  1K8A C;  4LD9 K;  1G3Y A;  3L2Z A;  3A5Z B;  4QVC A;  2QDJ A;  4C5E A;  4M7A E;  2BKD N;  1G3T A;  1RI0 A;  3FJP A;  3SB2 A;  3MP1 A;  4C0F A;  1VQL T;  2BUD A;  3QJY A;  1Q7Y C;  4BB7 A;  4M77 G;  4C8Q A;  2RI2 A;  2VXE A;  4FL6 A;  2KK4 A;  3JCM e;  3CCL T;  2V8J A;  4VUB A;  2GFU A;  2XDB A;  2D0Q B;  1LJO A;  4BE1 A;  4FT2 A;  4DQ2 A;  3V8L A;  2QXF A;  2YHT A;  3ZEH A;  2QQS A;  5FU7 B;  4L6V 5;  2VYT A;  3Q1J A;  2LCC A;  4M77 F;  4KUI A;  4XTV A;  1V29 B;  3QZ5 B;  4NC6 A;  3VYG B;  3E9F A;  3P8B B;  5IAY A;  5GMK h;  2QQ9 A;  4J8O A;  4E7H A;  1M1K C;  1QVF A;  2DTH A;  3CCE T;  3M53 A;  1NJI C;  1OYX A;  4MDX A;  1M4Z A;  3A8L B;  4HCB A;  2OTJ T;  2M1H A;  4J83 A;  3CBO A;  3NFC A;  3VV0 A;  2EQM A;  2CYZ B;  4J7I A;  4OB2 B;  4NS5 A;  3LWH A;  4M7D E;  3JCM b;  3VKI A;  2QFZ A;  3QYB A;  2LCL A;  4RG2 A;  5FLX E;  1KC8 U;  3CD6 T;  2L89 A;  2LX9 A;  1N6A A;  5HY6 A;  1B34 B;  2R5A A;  2DK3 A;  2EIF A;  3CCS A;  4IUU A;  3CC2 A;  4FU6 A;  4C92 E;  1YJ9 T;  5LJ3 f;  1QW1 A;  1M1F A;  3LGF A;  4WF2 A;  1W2B S;  5CKB A;  3OS0 A;  2O4X B;  2HNI A;  1WJS A;  4M7D B;  5FU7 C;  1I81 A;  4LDW A;  2X4X A;  5GAM d;  3OMG A;  3QYH B;  3HBL A;  4M78 B;  3FEO A;  3CCU T;  2D9T A;  3HSB A;  4M7D D;  4RCB A;  3TCJ A;  2JTF A;  4HLQ A;  2VXF A;  3OBY A;  2KMG A;  3GNG A;  4NL2 A;  4M78 D;  3CC7 T;  3HL8 A;  4ELY C;  1VQ7 A;  3GPL A;  3RIR A;  4C92 D;  4ZGE B;  4QQD A;  3PGG A;  5GAM e;  1K73 U;  2M0O A;  4A54 A;  2M9U A;  5D6W A;  3OYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...