2D0QB

Complex of fe-type nhase with cyclohexyl isocyanide, photo-activated for 1hr at 277k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snap shots of Inhibitor Binding Process in Photo-reactive Nitrile Hydratase
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2d0qB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d0qB02
3X24B 3LW5E 3X20B 1IREB 2DD5A 2PUKB 3HHTB 4L6V5 2WSFE 2DXCA 3X28B 4KT0E 1UGPB 2ZPGB 2PUOB 1QP3A 2QDYB 3VYGA 3VYHB 2DXBA 3A8MB 1UGRB 1PSFA 2CZ7B 3QZ5B 1QP2A 4ZGDB 2DD4B 1GXIE 2ZPBB 2CZ0B 4ZGJB 5L8RE 3QXEB 3QZ9B 1V29B 2O01E 4OB0B 2DXBB 2DPPB 4Y28E 2AHJB 2CZ1B 2DD5B 2WSCE 4OB1B 2D0QB 1UGSB 2DXCB 3WVEB 4RKUE 3WVDB 3X26B 2ZCFB 2PVGB 2PVDB 1JB0E 4XK8E 1PSEA 4FM4B 3A8LB 2ZPHB 3VYGB 3QYGB 2ZZDA 1UGQB 2PVOB 2CYZB 4ZGEB 2PU9B 2ZPFB 2ZPIB 3A8OB 4OB2B 2DD4A 3QYHB 2WSEE 3X25B 3A8HB 1AHJB 2CZ6B 2ZPEB 3A8GB 4OB3B 1DJ7B 2ZZDB
chains in the Genus database with same CATH superfamily
2QDLA 3LLRA 3E19A 3PT9A 1A0NB 2X4YA 4QKUA 3GNGA 3CXCA 4N4IA 5KYUB 2EQKA 1ACMB 3SD4A 3CCVA 2OTJT 2EYZA 4OP0A 4M75C 1ZUKA 4E2FB 2XI9A 2PUOB 4JRQA 4GBQA 1K1ZA 2JVVA 3UF4A 5J39A 2PHGA 1UTIA 1OIYB 1YI2T 1N27A 3TU4K 3JRZA 5GAOn 5GANf 1P5EB 4OMLA 1PC0A 3CQTA 2W2HA 2AKLA 1WDXA 2FRYA 4FW1A 2DD4B 5FRMA 4KUDK 2W0ZA 4ZGJB 2L3PA 2EIFA 3TSWA 1X6OA 5LJ3e 1M2OA 4EDUA 3RMQA 4PNOA 5GAN7 3OBWA 1N5ZA 4IIMA 1H27B 4CFWB 2M51A 3B57A 1MMAA 3DTOA 2O4XB 5J26A 4A4FA 4F7UG 4M7DE 2QAZA 3IQLA 2DAQA 5CQXA 5CCAA 3P8DA 2DVJA 1PRMC 2WIPB 1VQMQ 2LQKA 4CFUB 3OBYA 1M90U 3BDUA 4JRPA 4M78F 2PVGB 2G77A 1HSQA 4D8DA 3HKSA 4Z89A 1UNGD 1M3AA 4Z02A 1T0JA 2K3BA 3I9QA 5GAOp 1QMZB 4Y72B 4KBMB 4R55A 4NSTB 4C8QE 4BY7X 4MMLA 4RMOA 1N4MA 4EC9B 3UDCA 3H6ZA 3L2QA 2F2CA 3JSCA 2IVWA 4M4ZA 5IXFA 2CP2A 3GPLA 2F2XA 2LTOA 1LVKA 1QKXA 3EFOA 2QYZA 3OS0A 2RHYA 1I0CA 4N0AC 3TNIB 4DEYA 2MK5A 3C94A 5CKDA 1HJDA 5LJ3j 2F5KA 4DBHA 1BCMA 2WSFE 1FINB 1O75A 2COWA 4KT0E 5I21A 1YCSB 2CCHB 4F17A 1W70A 1VIEA 2F69A 4JUVA 1PD1A 3DDPB 5GAMd 1WLPB 3EFOB 5KE2A 2V8JA 2E3IA 4C0DC 3E9GA 5IHNA 2QDJA 1K0XA 1Q86U 1YJ9A 4I3ZB 2KRMA 2CP3A 4AFQC 1BI3A 3BDLA 1UNLD 4N0AA 5KYYB 3H8ZA 1RI0A 4F7UB 2B9RA 3L2VA 3NGPA 4NL3A 4M77D 2LJ0A 3QHRB 2LCLA 3RDVA 1M1KR 4QT7A 2KDSA 3LYIA 4J9FA 2DXBB 2RB6A 5GAN8 4LDUA 2EUFA 4BCMD 2PK2A 2A28A 1F1BB 1Y96A 3MEVA 4Z8AA 1D1AA 1OV3A 2QGSA 2C5NB 1QLYA 5LJ5h 3OS5A 4DOWA 2FVUA 1I07A 3MY5B 3I56T 2DIQA 1OULA 2YHTA 2A0FB 2Y4YA 1JJ2S 4M7DA 1RAAB 3MKDA 2LJ1A 2RI2A 1I81A 1UE9A 1AD6A 2C6TB 2FEIA 5GAOl 1MHNA 3HPWA 3REBB 2X51A 2NUTB 1Q82R 4GLKA 2ZPEB 3I56Q 3DB3A 4EC8B 1XTDA 2H8HA 3OYYA 4Y92A 4PJOG 1H26B 4FYWB 1DJ7B 1TFBA 3G4SA 1O9KB 1UEBA 4ATOA 4BCJB 3JCMe 1H4LD 2EVRA 2JT4A 3LW5E 4C8QC 1H1SB 1NLPC 2PUKB 2XHCA 1OX9A 2FPEA 2JS0A 2OAUA 2OTLT 3FRNA 3TREA 4LXCA 2E6NA 2EGCA 1OX8A 1ZBJA 2GNCA 3LWHA 4ZTJA 5KYXB 1VQ9T 4QW2A 4E7ZA 1ENWA 3JCMf 4AKGA 4JZ4A 2L5QA 1YHQQ 1W2BP 2OTJQ 1MV0B 2A08A 4IUQA 2K4YA 2J06A 3A8MB 3OYBA 4C92A 2DTIA 5GMKh 4C0GA 4ZGDB 1VQ7T 2HSEB 4CFNB 3CPFA 4RTWA 5GAN5 3M57A 1RAHB 5M9OA 4RODA 5DY9A 2HCKA 2GFUA 4QQ6A 4ELLA 1OZ3A 4KUIA 4E7SA 2DM1A 4K11A 2HD0A 3LGLA 1FWZA 1NG2A 4YC3B 1WIEA 2AHJB 2VWFA 1KG1A 2ATCB 2WSCE 1G5VA 4BCKB 5FU6C 1Y7XA 2D8JA 4F7SB 1OI1A 2IW6B 3WVEB 4C8QF 4F16A 4BE1A 1QWEA 2Y4XA 1X2QA 2JGZB 2MPXC 3WXMB 3DLLA 2QFZA 2CGHA 2MIOA 1WYXA 1HXDA 3LH0A 3HSBA 4BCFB 1OYXA 1C6VX 4WCIA 1RLPC 3SWNA 2M02A 1RACB 4JRIA 2BZYA 1M90C 4HL4A 4OB2B 3ZEHA 2LVMA 4VUBA 1RABB 3C4SA 3EGDB 3X25B 1AD5A 3BLRB 1Z9ZA 1M1KU 3VRZA 3EGUA 1FYNA 1WHLA 2KBTA 1ZP2A 1E7OA 4CC4B 4CC2A 3SEMA 1WHJA 2QGGA 3NHNA 1D0ZA 2HEQA 5GMKi 2RNAA 5IDNB 1OOTA 3CBMA 3OA6A 1Q82C 5HBEB 1TSFA 1JSUB 4PJOF 4JJBA 1IHVA 3ASKA 2K9GA 2DIGA 1UGVA 5L2WB 2MI6A 2YT6A 3SFMA 4NS5A 2FPDA 2QDYB 3KUFA 2OI3A 1AZGB 2R5MA 1BI2A 4MDWA 3THKA 4AT1B 3M0PA 2JXBA 2UZEB 1S1NA 2YLBA 5IN1A 4RUGA 3UT1A 4JDSA 2FZGB 2BUDA 5KH6A 4V2SA 2E5QA 1QVFP 3H4CA 2DKGA 1G83A 3M0TA 5KYUA 1FMWA 3OS1A 3M59A 3Q1JA 3EFRA 4HCZA 4MDXA 3I55T 2RF0A 1V29B 3H41A 2LNHB 1H28B 3TEEA 1M2VA 4CRIA 2NUPA 4ELJA 5GAN2 1RLQC 2JS2A 2YLCA 2DTOA 2RD1A 4M78D 4M75A 1VQKT 3CC7T 1V1CA 2VV5A 4JJCA 5HVYB 2FZKB 3CCMT 4CFVB 4J6YA 1YJNQ 1PKTA 3QO3A 3FJ5A 3GTMS 3P8BB 2ENMA 2WEVB 2JTFA 3I5SA 2WMBB 2CUBA 2QEXT 3OYKA 3CC7Q 5CQYA 3QHSA 3MI9B 1M4ZA 3RKYA 4J83A 3QJ6A 3PO3S 2LQ8A 2BPMB 1X6BA 2ROLA 2E1HA 2MOXA 2ROTA 1VQNT 4J9IA 2CKKA 2QA4Q 2YUOA 2RA2A 1FMKA 3CD6T 5ACBA 2I53A 3VRYA 3NPFA 1W1FA 2M1HA 4B9XA 4PJOB 5CKHA 2NWMA 1HD3A 1WQ7A 1O9SA 2P84A 3VUBA 4M7AE 4ESRA 1RAGB 5DLOA 1Q81R 2XDPA 2K6DA 4KH0B 2HL3A 1VQPA 3TSZA 4MMKA 3BLHB 3DKMA 1YI2Q 1U1TA 5EJCA 3OSSC 4FU6A 3V8KA 1NPRA 1UJYA 2DXTA 1PG5B 2RM4A 1K73R 4EMHA 4EOSB 1IZ6A 2MWOA 3CMEQ 2AIRB 1Y71A 4EOPB 2XDDA 1KD1R 4YOOA 3CCUA 4F70B 2YWWA 4C8QD 4C5HA 3MPUB 4C92E 4CFMB 2RJDA 5KCOA 1FVVB 3OSVA 2KT8A 3QDFA 4A4GA 1TD6A 2IIMA 5EC7A 2XKOC 2BTTA 1K0SA 3G6EA 2DD5B 4L5GA 3PGGA 3MCAB 1EFNA 3HRTA 4MFEA 3BHTB 2HBWA 3CC4A 2K2MA 4OMPA 3OMGA 3I5RA 1K76A 1N8RC 2P0QA 2EJ9A 1W2BS 1VQ7A 1JQQA 4LUDA 4D6WA 5A2QE 4BE2A 4RTZA 4BXXX 2CDTA 4C0ZA 3LQ5B 3M0RA 3G71T 1KC8C 3QYHB 2E65A 1WJRA 4M75G 3OB9A 1QVGA 1JU5C 1RUWA 4PLIA 5KYYA 4QQGA 1OQKA 3DJBA 3QSUA 2OTLQ 2WIHB 1YJWT 2EQMA 1ZSZC 3UPUA 4HVUA 2LW4A 4PFZA 4BY1X 1UHFA 1YIJT 1EX4A 4OGCA 4Z88A 5J3BA 2KXDA 3VKHA 3QIIA 3KHIA 3JCMV 3EHRA 2RK1A 3EAEA 5GANj 1AWOA 2KR3A 2X9HA 1U06A 5GMKj 2PTKA 1O9KA 1T0HA 5GANh 2DL7A 3SB2A 1VQ8A 4CC3A 3C0CA 4F7JB 5GMKe 2VUBA 3FLGA 1M27C 3RNJA 4HT9A 1VA7A 3CCVT 4WTOB 1G3YA 2EQJA 1E9HB 4PL6A 2CSQA 5LJ5e 5GANg 1VQ4Q 2PK9B 3JCMQ 2HDAA 3CBPA 2B8AA 4F6SB 4M77E 4XTYA 2EQIA 2XICA 1YHQT 1TWBA 1GCQC 2H3JA 3SDZA 4KGZB 3OW2A 1TUGB 2OAWA 4FSSA 2IVXA 4IURA 5FLXE 2EYYA 3MY1B 2K57A 4M7DG 5BNJB 1OU8A 2OX7A 2MMPA 1FX7A 2RN8A 1KC8U 2RQVA 2RHUA 3QDRB 4XK8E 2CP6A 2QEXA 3EIDB 2IPOB 1PSEA 3OY9A 2CUDA 4IUTA 2K2VA 5D6WA 5HY6A 3QPHA 4RTTA 1W4SA 3CD6A 3UA6A 1NE8A 3CMAT 2W9FA 1OPKA 2KQWA 2VC8A 1P92A 1SSFA 3CC7A 1RL2A 3CCJT 1ZSGA 2LDMA 3DL1A 2DL5A 5KE3A 3L1AA 4II5B 4IIOA 1BYMA 3M03A 2DVEA 5GAMj 3G1JA 2W10A 1WZOA 4OB3B 4E6RA 2I2LA 4BCND 4JJNK 5GMKl 1QLBA 5GAMe 4NC6A 1J3TA 2B86A 2O2OA 1NLOC 1KIKA 2V1QA 4RG2A 2EGAA 3J7AF 1WXUA 3V8JA 3N5BB 1KSWA 1K8AC 1VQKA 2DL3A 1IGUA 3S3NA 3RBBB 4BCPB 2FB7A 2QK0A 3X28B 5FU7B 2ZAEA 4E7HA 2RH2A 2HMAA 1D3UB 2XK0A 5GAOq 2KE9A 3CCSA 1VQ4T 5IT9E 3JAME 2QXFA 2E41A 4BI8B 2EKHA 1FXXA 1WJQA 1M1GA 1B7TA 1UGRB 1VIFA 1H3HA 2CZ7B 2J6KA 3OYFA 3HFNA 1EIFA 2LCSA 3OW2S 3H9NA 2IG0A 2CP7A 1WGSA 3FJPA 5FROA 1Q81C 1CKBA 1NM7A 2CZ0B 4ANJA 1VQ6Q 4KGVB 1EZZB 2BE7D 1I5OB 4M7DD 3G7ZA 3CCLA 2KMGA 4HNTA 1S72A 4DBQA 5IDPB 3MP1A 4JRKA 4XTZA 4G6LB 4IUPA 3EGXA 4M7AA 1WPYA 1YFNA 3EG0A 2I0NA 4LOCA 1QCFA 1YJNT 4ZNXA 1UGSB 1VQ5T 4OVAA 2DXCB 1VQ6T 1SHFA 1AVZC 3OW2P 1ZBXA 5CVIA 2BS4A 1PHTA 3RMSA 1YJ9T 2DMEA 1Y57A 3EHQA 3S3OA 1UGQB 2EGEA 1OL1B 3T9NA 1VQOT 1ZQ1A 4EMKC 2V26A 5LJ3d 2VB6A 1YITT 3RGFB 1D1BA 4ZGEB 4BB7A 1X27A 3CCRA 4BCGB 3A8OB 1NZ9A 2R5AA 2I40B 2VGMA 3PVQA 5HK3A 3BY7A 3VS7A 4FCYA 1C0MA 4UN0A 3CMAQ 1GUXB 1JOWA 2ABLA 3CCLT 3GF5A 3INZA 1N8RU 2DEQA 2KNBB 1GFDA 2GGRA 3UATA 4OMMA 3EH1A 5HQ0B 2DF6A 3JB9F 1JO8A 2R57A 1M2VB 2ESWA 1WA7A 2COZA 3M56A 4PJOE 4A63B 3M54A 1N6AA 3CC4T 1VQ8Q 1AWJA 1TU0B 1XO2A 1W98B 1VQ7Q 4XTVA 1PKSA 1UGPB 1OL2B 3V7CA 1LNXA 3J80E 2RPNA 2BZ8A 3HRSA 1NPPA 2EWNA 3JB9G 3MP8A 3MEAA 4M77B 3GIBA 2A3LA 1G8XA 2JMCA 5CKBA 3EG1A 3NTKA 2LT1A 3QWYA 2IW9B 3HP9A 2AT1B 2QA4A 3CCMQ 2EAYA 2ZPBB 1BB9A 1M8MA 4F14A 5DQWA 2L89A 3BE3A 5CK9A 1G3WA 3VS6A 2OTLA 4BCHB 4ZN1A 2QEXQ 2J05A 5CYIB 2VVKA 3I55A 1ZUUA 4M77C 2WPAB 3OYEA 3S3MA 1VQOA 3BG5A 1NYGA 2D1XA 4AMCA 5I11A 4M78G 4EONB 1ABQA 3CCJA 5IHYA 1YJNA 1M90R 4P5NA 1QKWA 2RHIA 4C5EA 3CMAA 3CMEA 3ZBDA 4M78A 4HVWA 1B34B 2RI5A 4BI4A 2VKNA 3WVDB 2ZCFB 1Q86R 2C0TA 1Z9QA 3D7SB 2QQ9A 1KQ1A 5C0MA 1LOJA 1BU2A 3L2WA 1JJ2A 2JNGA 4X1VA 4X9CA 5ICPB 4AFUC 2JW4A 2X4WA 2W9ZA 1MMNA 2DRMA 1MNDA 2LMJA 4M6VA 3EG9A 2ED1A 4J7FA 2QTXA 1KFZA 4M78B 1LCKA 1KK7A 1MV3A 2BIVA 4LDVA 2CCIB 4KRTA 1RI9A 1Q7YC 2O4XA 2BS3A 4FIBA 1BK2A 2X35A 4FYXB 4J5YA 1TTHB 4Y91A 2EFIA 1WHMA 1OU9A 2D0NA 2JTEA 1B07A 4AKIA 3PIPA 4LDWA 4L6V5 3FEOA 3CC2T 1VQMA 3CCST 5LQFB 2AKKA 2RHXA 2CSIA 1ZLMA 1VQNA 4OMFB 4LE9A 1QW1A 3VS4A 5KYWB 3PE0A 5EG2A 1RAEB 1BCOA 3VYGA 1SG5A 4M7DB 2DA9A 1PCXA 1VYWB 1VQ4A 2EYXA 1MMDA 3HBLA 1D09B 2DTHA 5CR2A 4HXJA 1VYUA 2M0YA 1WI7A 3KBGA 2ED0A 3BW1A 3META 4BUGA 3CCSQ 1H25B 2VYTA 1B34A 1KJWA 2NUTA 5IXBA 3PVLA 2BZXA 1Q7YR 3HFOA 4OMNA 1PRLC 4Q5WA 4OR5B 5KYWA 3QBYA 1YNZA 4CI0C 3E2UA 4M7DC 2LP5A 9ATCB 3CCQT 2DPPB 3G33B 3TNWB 4ROCA 3RUXA 1ZHIA 2FO0A 2KT1A 1KC8R 3OYGA 2W96A 4JX5A 1JEGA 4BD3A 4JPBW 4IMYB 5LJ5f 1KHCA 3CEYA 6AT1B 4CFUD 5LJ5d 1OEBA 4AG2C 4M75D 1IXDA 2JZ2A 1ZSZA 4AI6A 5I22A 1QCNA 2DZCA 3NTHA 3KFVA 2GF7A 4A54A 2PU9B 5IHKA 2YXYA 3RESA 4XQ3A 2LZ6B 2DRKA 2E70A 3RKXA 2FRWA 1G3NC 1UG1A 3RKWA 3NMZC 4M78C 4RTVA 1WXTA 3OYCA 4J9DA 2BE9B 5DQVA 1UFFA 5GAOm 2LQWA 3FC3A 2NUPB 1BI0A 2HSPA 1TXQA 1VQ9Q 1KD1C 3X20B 4JX6A 2RK2A 3NDQA 2X4JA 5A0LA 4KULA 5GAN3 1SEMA 1YBYA 4F6WB 1Q81U 1WHKA 3GOXA 2LQNA 1X01A 1Y07A 3CC4Q 1VQ8T 2HKQB 2WHBB 3ER0A 2K79A 2E12A 2JM8A 4FYYB 1YJWA 4ZN3A 3G6EQ 1SSHA 2KXCA 5LJ3h 1N8RR 4A53A 2O88A 4J7IA 1PKDB 2PQWA 2F5TX 4OMQA 3TQ7P 4JX4A 2NUZA 3PFSA 1NJIC 2K3YA 2RI3A 4HCKA 1YWOA 3HTRA 3QWLA 1UDLA 2DJQA 5I2MA 5GAN4 4LDYA 4CXAB 3EJ1B 2DYBA 3PNWC 3S6WA 1BU1A 5EFQB 1H92A 2KRNA 3H0HA 1JXMA 3I55Q 2YUPA 1VOLA 5CKEA 4ORZA 5IF1B 5AT1B 4DQ2A 1GL5A 5GMKm 2RQRA 3EFSA 3ULRB 1MMGA 1XNIA 1UB4A 4II1A 1X75C 5KYXA 1E6GA 1G3TA 2EJGA 1VQPQ 3CPWA 2KAFA 2ZPHB 1OZ2A 3U23A 2EPDA 5HBJB 2EW3A 4BCIB 3CCUT 1S72Q 1GBRA 2WMAB 3M0SA 2CJMB 4PJOD 2K5FA 2ZPFB 1D3BB 4RTYA 5I5ZB 1CKAA 2DD4A 4J8OA 5CAIA 3QWXX 4M7AF 1TOVA 3PMIA 4J6WA 4F7UA 3G6ET 2DL8A 1GCQA 4EMGA 4EOJB 3PIOA 2YDLA 1KQSA 1VQLQ 2G6FX 3CCJQ 3MJXA 4FSXA 2J7IA 4M75E 3GBQA 2JMAA 2CH4A 3TCJA 1YCYA 1Y96B 3A98A 4HNUA 1WQWA 4IUUA 3JCMX 4PJNA 3SWNC 3M4GA 1NJIU 2WACA 5D7UA 1V76A 4EOKB 2DMOA 4F7UF 2HKNA 1YHQA 2VXFA 2L8DA 3MEUA 2KYBA 2MCNA 1GY3B 1KXUA 1KHIA 1KQSP 1K9MR 1JBMA 2C5XB 2IW8B 4E7LA 1UJ0A 2KK4A 3QJYA 1U3OA 3OYAA 3BHUB 4F7LB 2VASA 2X3XD 4J9BA 4AG1C 1K8AR 3JCMg 1VQ5Q 4PFPA 1W6XA 2YRDA 3O8VA 3OMCA 1H24B 2RQWA 2LX7A 4LN2A 2CT4A 4ME7A 4J9GA 2YRCA 4OF1A 3CCUQ 1S72T 3QZ9B 4LD9K 1VQLA 2HBPA 4JJDA 3OS2A 1UNHD 1LPLA 1YWPA 4NOYA 1MNEA 2PJQA 2JOYA 2G3RA 2GTJA 2HQXA 4LNPA 2W99A 1H3ZA 1F5QB 3CCRQ 4EORB 2L3SA 1PD0A 5CEIB 1YJWQ 1QVGS 2QQ8A 4M77G 4BI3A 1I8FA 3H0IA 2E5KA 4C92C 1YIJA 1JB0E 3LGFA 2CP5A 4PJJA 3OYDA 3KXTA 1NYFA 4CRLB 1H1PB 1N9SA 2QQRA 2O31A 2DERA 3JB9J 1BBZA 4O6JA 1R8OB 3C95A 1R0CB 5DLQE 4R0KA 2M0OA 4OGEA 3CBOA 2M16A 2QF7A 4JS5A 2IN3A 2LNVA 2D9TA 2DFUA 1OGUB 5L23A 1NEGA 4HKEA 3MO8A 2VXEA 5HNBB 3G71A 5AYFA 3HL8A 1ZA2B 1AWWA 2DK3A 3JV3A 3BG3A 4J9EA 2PNIA 1QVFS 1GBQA 3LX7A 5CO7A 2FYKA 3LWIA 1OKVB 2F2VA 1I4K1 3JCMb 3L2UA 1KQ2A 2P0PA 4A4EA 3CXCP 5FRNA 1WFWA 2A7YA 4FX3B 2M9UA 2O9SA 4XU1A 4N4HA 3CCEQ 2LJ3A 3GNFB 3CD6Q 4XU3A 2FPFA 5FU7C 2K5LA 1MGQA 4EOIB 3HO8A 3TNHB 2A37A 1GXIE 5FWBA 4EOQB 1M5Q1 1ZA1B 4F7UE 3M53A 1NEBA 1IB8A 3EH2A 3UWNA 2FL7A 2DBKA 3M55A 2J6OA 4HT8A 1FKMA 1H1QB 2QQBA 4BY6B 4JLGA 2AK5A 2C06A 2OTJA 2HNIA 2E3HA 4DBRA 5C6SA 2DETA 3MIAB 4AFSC 2EBPA 1BIBA 3VS2A 2DBMA 2D0QB 4BACA 3JCMd 4EMKB 1BI1A 4NL2A 2C5OB 2KGTA 2XDBA 2DNUA 1K9MU 2WXVB 4M7AD 1HYOA 2EYWA 4IUVA 4RG8A 1VQNQ 2GQVA 4UC4A 3JCMh 4C8QG 1RAFB 4E47A 2PZ1A 3CCLQ 1TUDA 2P4TA 3A8LB 2QA4T 4BCQD 2ZZDA 2JTMA 4OGRB 4MFDA 4QVZA 3GP8A 3LH5A 2PVOB 2V8KA 4C8QB 1M9SA 2CYZB 1LJOA 4M75F 4HNVA 1KD1U 3VKGA 1RADB 3M5AA 1RAIB 2WSEE 2UZDB 2KMTA 2Z0WA 3A8HB 2RJEA 4MZTA 2BS2A 1ZX6A 1IRXA 1YITQ 3A8GB 3NTIA 5IAYA 3VS0A 1VOMA 2FG0A 1OI9B 4XTWA 3REAB 4R56A 2O9VA 2ZZDB 1I5LA 3X24B 3CPWP 1U5SA 2V8IA 1R77A 2L2PA 3E9FA 4PKCC 3O0GD 2YUNA 1HK9A 4J6XA 2QI2A 3L2ZA 2DEUA 2DXCA 2DILA 2CS7A 1K73C 1OIUB 1VQ9A 2GBQA 2KRSA 2LC4A 4PK4A 1AWXA 4KRDB 4TTHA 1SPKA 2ZPGB 2LCCA 4KH1B 1UHCA 4HVVA 1X69A 4HA8A 4HCBA 3RERA 3VYHB 4YOSA 3CCVQ 4N4GA 2COYA 3VS3A 4ZTFA 3QZ5B 4QVDA 1SRLA 1JRIA 2GTOA 2LT4A 1YITA 3V7RA 5CKFA 5HKCA 2ECZA 4XU2A 2EQUA 1CSKA 3VKIA 3CCQQ 3CC2A 4EPCA 4E7KA 2RQTA 1PWTA 3NFCA 3CCEA 2J6FA 2F1LA 5ECAA 3QUIA 4C92F 5HBHB 1T3LA 1ZSZB 4FT2A 5GAOr 2UUEB 4BBSM 3DLMA 1SF9A 1Q82U 1VQ5A 2O01E 3M58A 1VQMT 4BCMB 4Z6YA 2CZ1B 1VQPT 2DYIA 4QVCA 3VS1A 3JCMP 3AHUA 4DOVA 3G71Q 2LRQA 3ME9A 2KVQG 1AOJA 4RKUE 4C5IA 1GCPA 1U8RA 4M78E 2FHDA 1AT1B 1JJ2P 1ARKA 1T3SA 3QYBA 2MWPA 3H0FA 1YP5A 2F2WA 4M77A 3VJPA 4DEXA 1AISB 2EJFA 3V8LA 1M3CA 2ZPIB 5LL6S 5LJ5j 3E1SA 2E10A 4LUEA 1U1SA 2HL5C 2D6FA 3HZJA 4BBRM 3L2RA 2MYSA 1AHJB 5CIUA 3EOCB 2YSQA 1IGQA 2EKOA 4HLQA 3VUZA 1PNJA 2ZGWA 1GRIA 1GH6B 4C5GA 3TN8B 4M75B 1E7PA 2EYQA 3VV0A 2XMFA 3CMET 4M7DF 2XD0A 1B3QA 1X43A 4QQDA 5DM7R 5A0GA 1YN8A 3MP6A 2UZBB 3HRUA 4OMOA 1XQHA 4AFZC 1QP3A 3R6NA 1QCOA 2DZ9A 4M7AC 2HZYA 3TW7A 3I35A 3SWNB 1D3BA 1OPLA 1E6HA 1JSTB 1TG0A 1AZEA 2OJ2A 3M9QA 4PFOA 2GCXA 5FU6B 1WX6A 1M3BA 5FW9A 2YRVA 4C0FA 2E64A 2G9XB 1SRMA 3QG1A 1M8VA 4BCQB 4TVRA 4OB1B 2QG9B 2C0OA 4XTXA 2RQUA 3MHXA 3QKJA 3G4SQ 2E6ZA 1VQOQ 2K5IA 2VGNA 5GAMf 1IO6A 4F7NB 4KGXB 1QVFA 1VINA 2SEMA 3JB9D 1K9MC 2DO3A 1R0BG 2RMOA 1QMCA 4O5VA 3VYGB 1QVPA 1XOVA 1TS9A 1C9BA 5HK0A 2BKZB 3CC2Q 3OYIA 4GLMA 2XIDA 2V1RA 5GANe 5LJ5g 4ROEA 4CFXB 3CCRT 1G2BA 3G4ST 1QQJA 4PJLA 1K8AU 2RJCA 1VQKQ 1H641 2KROA 4BDZA 4D8KA 2C0IA 2A36A 4FL6A 1JKWA 1IHWA 4FW2A 4YTLA 2D8HA 4XAXB 3VS5A 1VQ6A 3OYJA 2QTVA 3BHVB 1YI2A 2JN0A 1OKWB 4JS4A 1IREB 2L0AA 2P4RA 3OQ5A 4PJMA 4RCCA 5GAMh 3HHTB 3J81E 3SHWA 1YIJQ 1NJIR 2CH4W 4C0DB 4LDXA 2DX1A 4M77F 3A5ZB 2E4HA 4YOZA 3PMTA 2HQEA 2X3WD 4E7JA 4XTUA 1M1FA 1MUZA 2X1NB 4MIMA 4C92D 2DXBA 2WJ9A 1G3SA 3C12A 2C5VB 5LJ3g 2KR6A 1QP2A 2PMIB 3DDQB 1X6GA 2FZCB 1BKBA 3PTAA 2DLPA 1K9AA 4ELZC 2GFAA 5L8RE 3R6OA 3K7AM 1SKUB 1GUXA 1WNLA 2CT3A 3QXEB 2AZSA 4B9WA 4IKFA 4PJOA 1PM3A 8ATCB 1URCB 7AT1B 4OB0B 4Y28E 2QASA 2X4XA 3CCET 4BE0A 5KYNA 3CPWS 3DOGB 4X9DA 3O5ZA 4C92B 1VUBA 2NLUA 3BLQB 2L3QA 1BIAA 1D0XA 2GQIA 2KI7A 3X26B 3ZL7C 2CREA 4F6UB 1Q95G 5GJWB 4FM4B 2RHZA 1ABOA 3QYGB 3JB9I 4F04B 5D6XA 3ZFJA 2KY9A 3EG3A 5FGKB 5IHIA 1NBEB 1C1AA 1ZUYA 3TVTA 2JM9A 2LX9A 2QGFB 4AKHA 5LJ3f 3JCMW 5GANd 4HCCA 2HAXA 3BG9A 1FMVA 2QQSA 3JB9H 3FDRA 2Y90A 1TH7A 3FIFA 4M7AG 3M0UA 2RO0A 1YJ9Q 1D1CA 2AZVA 2HQHA 2K7AA 3OYLA 1N9RA 3GLXA 3TW6A 1M1KC 2DE0X 4XU0A 2KYMA 3EGXB 4JLIA 3M4YA 4M7AB 4DBFA 5KCHA 1WXBA 1K4US 5LMKB 1Q7YU 3I56A 2DD5A 3DB4A 4J9CA 4GY5A 1M30A 2BKDN 2V22B 3F5XB 3URGA 4ELYC 1H8KA 2DXUA 4FT4A 4PJOC 4RTUA 2QQAA 4EMKA 3JCMJ 2JUFA 1UECA 3L42A 3RIRA 3F70A 2MAMA 1WHHA 3MEWA 5FWCA 1GFCA 2DL4A 2UZLB 2K3XA 1PSFA 5D6YA 4BDYA 4C8QA 3EG2A 1TUCA 1D0YA 1I1JA 5A0DA 3JCMc 4C92G 3RR6A 1UUEA 4DA4A 3EGDA 3EG9B 2XU8A 2WFYB 4E7IA 1Y0MA 3M0QA 1AEYA 4FYVB 3CXCS 1QWFA 1VYTA 3V7SA 3VU3C 3CCMA 2KEAA 5HCKA 3CCQA 2RJFA 4BCNB 4A4HA 3FB9A 2P0KA 2SRCA 2XG8D 1KQSS 1VYVA 4EOOB 2CP0A 2R7GA 4KRCB 4WF2A 1K73U 4EIKA 3POMA 4RTXA 2YUQA 3AT1B 5GJVB 3OYNA 2H3EB 4L59A 2PVDB 1H1RB 3P8HA 3QHWB 1XJWB 1Q86C 3UA7A 4BCOB 2R58A 4MZPA 4A4KA 4J9HA 3QYEA 1WJSA 1JXOA 3HB9A 4X34A 2DJZA 8AT1B 2KSSA 3A1PA 5IH2A 4EOMB 3OYMA 2JJ9A 5GAMg 5GAN6 4JZ3A 3BFMA 5I2SA 4B6MA 1SHGA 4MZMA 4BY6C 1X2KA 2CZ6B 4LD6A 4PLLA 1W2BA 4QSHA 1WHGA 1QVGP 2NYSA 2L3RA 3OYHA 2MF2A 4RCBA 2C4GB 4CC7A 1VQLT 4EOLB
chains in the Genus database with same CATH topology
3X24B 2BS3A 3LLRA 2X35A 2V8IA 4FIBA 4J5YA 4Y91A 3E19A 3PT9A 3VUBA 3E9FA 4PKCC 2EFIA 4M7AE 5DLOA 2X4YA 2XDPA 3GNGA 1VQPA 4AKIA 3PIPA 3CXCA 1HK9A 4LDWA 4MMKA 4L6V5 4J6XA 2QI2A 3FEOA 3L2ZA 4N4IA 2DXCA 3DKMA 3CC2T 2CS7A 1K73C 1VQMA 3CCST 2EQKA 1VQ9A 3SD4A 3CCVA 2RHXA 2LC4A 1Q7YC 1VQNA 2ZPGB 2OTJT 1U1TA 5EJCA 3OSSC 4FU6A 4OMFB 3V8KA 1QW1A 4OP0A 4M75C 2LCCA 2XI9A 2PUOB 5EG2A 4JRQA 4HCBA 1NPRA 4HA8A 2JVVA 3RERA 3VYHB 3VYGA 5J39A 4N4GA 1YI2T 4M7DB 2DXTA 1N27A 3TU4K 3JRZA 5GAOn 3QZ5B 4QVDA 5GANf 4ZTFA 2LT4A 1JRIA 2RM4A 1VQ4A 1YITA 3HBLA 3V7RA 2DTHA 5CKFA 4EMHA 5HKCA 5CR2A 1IZ6A 2MWOA 4XU2A 3KBGA 2EQUA 2DD4B 3VKIA 3CC2A 3BW1A 3META 4BUGA 4EPCA 1Y71A 4KUDK 4E7KA 5FRMA 2XDDA 2VYTA 4ZGJB 1B34A 3NFCA 3CCEA 2EIFA 3CCUA 1X6OA 3HFOA 3QUIA 4C8QD 4EDUA 3RMQA 4PNOA 4C92F 4C5HA 3OBWA 5LJ3e 5GAN7 4FT2A 4Q5WA 4C92E 5GAOr 4BBSM 2RJDA 3DLMA 5KCOA 3QBYA 1Q82U 3OSVA 4CI0C 1VQ5A 2O01E 3M58A 2O4XB 4A4GA 4M7DC 5J26A 4A4FA 3CCQT 1VQMT 4F7UG 2DPPB 2XKOC 4Z6YA 3RUXA 1ZHIA 4M7DE 2CZ1B 2DD5B 3G6EA 4L5GA 1VQPT 3PGGA 4QVCA 2DAQA 3OYGA 3MCAB 5CQXA 3HRTA 3JCMP 4JX5A 3AHUA 4MFEA 4DOVA 4BD3A 5CCAA 2LRQA 3CC4A 3P8DA 3ME9A 2KVQG 5LJ5f 1KHCA 4RKUE 3CEYA 2LQKA 4C5IA 3OBYA 1M90U 3BDUA 4JRPA 3OMGA 4M78F 2PVGB 2G77A 4M78E 2FHDA 1U8RA 5LJ5d 1N8RC 2P0QA 4M75D 2JZ2A 3HKSA 2EJ9A 1W2BS 3QYBA 1VQ7A 2MWPA 4Z02A 4AI6A 4D6WA 4M77A 5A2QE 5GAOp 3VJPA 2DZCA 2EJFA 3NTHA 4BE2A 3V8LA 2GF7A 4A54A 2PU9B 4KBMB 4R55A 2ZPIB 3RESA 4C8QE 4MDXA 4C0ZA 5LL6S 5LJ5j 4MMLA 4XQ3A 3E1SA 2E10A 4RMOA 3UDCA 2E70A 1U1SA 3H6ZA 3QYHB 2E65A 3RKXA 3G71T 3L2QA 1KC8C 1WJRA 3JSCA 3OB9A 2IVWA 4M75G 1QVGA 2D6FA 3HZJA 4PLIA 3RKWA 4BBRM 3L2RA 1AHJB 4M78C 4QQGA 5CIUA 2LTOA 3GPLA 3QSUA 3OYCA 1YJWT 2EKOA 2EQMA 4HLQA 3VUZA 5GAOm 3UPUA 3OS0A 3FC3A 2RHYA 1BI0A 2ZGWA 4N0AC 4C5GA 1KD1C 3X20B 4JX6A 2RK2A 1YIJT 4M75B 4OGCA 3C94A 5CKDA 2X4JA 5J3BA 5A0LA 4KULA 5GAN3 1E7PA 2F5KA 5LJ3j 3VKHA 1YBYA 3QIIA 2EYQA 3KHIA 2WSFE 1Q81U 1Q86C 3JCMV 3VV0A 3CMET 1O75A 4M7DF 2XD0A 4KT0E 3GOXA 2RK1A 1X01A 1Y07A 3EAEA 4QQDA 1VQ8T 5I21A 5DM7R 5A0GA 5GANj 3MP6A 3ER0A 1VIEA 3HRUA 2F69A 2E12A 4JUVA 1XQHA 5GAMd 1YJWA 1QP3A 4ZN3A 4HCCA 5KE2A 2DZ9A 2V8JA 5GMKj 5GANh 4M7AC 5LJ3h 4A53A 3TW7A 4C0DC 4J7IA 2PQWA 3E9GA 3SB2A 2QDJA 2F5TX 3SWNB 1VQ8A 4JX4A 1Q86U 1YJ9A 3PFSA 1NJIC 2K3YA 2RI3A 1D3BA 3QWLA 5GMKe 2VUBA 1BI3A 5I2MA 3BDLA 3FLGA 4LDYA 4N0AA 5GAN4 4HT9A 3H8ZA 3PNWC 3S6WA 3CCVT 1RI0A 1G3YA 2EQJA 4F7UB 3L2VA 4NL3A 4M77D 3M9QA 2LCLA 2KDSA 2GCXA 3LYIA 4PL6A 5FU6B 5LJ5e 5GANg 3JCMQ 3CBPA 2B8AA 2DXBB 2RB6A 2YRVA 4C0FA 5GAN8 5CKEA 4LDUA 2E64A 4M77E 4XTYA 2XICA 1YHQT 4DQ2A 3MEVA 1Y96A 5GMKm 3QG1A 2H3JA 1M8VA 4TVRA 3SDZA 4OB1B 4XTXA 3OW2A 3EFSA 5LJ5h 3OS5A 3MHXA 2FVUA 3QKJA 4DOWA 2E6ZA 4IURA 2K5IA 2VGNA 5FLXE 1XNIA 1UB4A 2K57A 4II1A 4M7DG 5GAMf 1X75C 2MMPA 1FX7A 1KC8U 1QVFA 1G3TA 2RHUA 2EJGA 3QDRB 4XK8E 3I56T 2QEXA 3CPWA 1PSEA 2DIQA 2DO3A 4IUTA 3OY9A 2YHTA 3JB9D 2K2VA 2KAFA 4O5VA 2ZPHB 1OZ2A 2Y4YA 3VYGB 5D6WA 1QVPA 3QPHA 1JJ2S 1XOVA 5HY6A 1W4SA 5HK0A 3CD6A 4M7DA 3CMAT 1NE8A 3CCUT 2RI2A 2KQWA 2VC8A 1P92A 3OYIA 1I81A 2XIDA 1SSFA 2K5FA 2ZPFB 4PJOD 5GANe 1D3BB 1RL2A 5LJ5g 3CC7A 3CCJT 3CCRT 2LDMA 3DL1A 2DD4A 3G4ST 4J8OA 5CAIA 5KE3A 5GAOl 4M7AF 1MHNA 3L1AA 3HPWA 1BYMA 3PMIA 4J6WA 2DVEA 1K8AU 2RJCA 4F7UA 1H641 5GAMj 3G6ET 4GLKA 4EMGA 2ZPEB 3DB3A 4OB3B 3PIOA 1KQSA 4BDZA 1XTDA 3OYYA 2I2LA 4PJOG 4FL6A 4JJNK 4FSXA 1DJ7B 4YTLA 5GMKl 1QLBA 4M75E 3G4SA 5GAMe 1UEBA 4XAXB 4ATOA 1VQ6A 4NC6A 3JCMe 3OYJA 3LW5E 1YI2A 2JN0A 4C8QC 3TCJA 1YCYA 4JS4A 1IREB 1Y96B 4RG2A 3OQ5A 3J7AF 2PUKB 2XHCA 4HNUA 1WQWA 4IUUA 4RCCA 3V8JA 5GAMh 3HHTB 3N5BB 3J81E 2OAUA 1K8AC 1VQKA 2OTLT 3FRNA 3TREA 4C0DB 3S3NA 2E6NA 2FB7A 4LDXA 3X28B 4M77F 3A5ZB 5FU7B 3JCMX 4E7HA 2RH2A 3SWNC 3LWHA 2XK0A 3M4GA 5GAOq 4ZTJA 2WACA 3PMTA 3CCSA 4QW2A 5IT9E 3JAME 1VQ4T 1VQ9T 2HQEA 3JCMf 4F7UF 1YHQA 2VXFA 4E7JA 2L8DA 4AKGA 3MEUA 4XTUA 2L5QA 2QXFA 2E41A 1M1FA 4BI8B 4MIMA 1FXXA 4IUQA 1WJQA 2DXBA 1KHIA 1M1GA 4C92D 2K4YA 3A8MB 1UGRB 2WJ9A 1JBMA 1G3SA 1VIFA 2CZ7B 3C12A 5LJ3g 4E7LA 2KK4A 2KR6A 3OYFA 1QP2A 3HFNA 1EIFA 3QJYA 3OW2S 2IG0A 1WGSA 3OYBA 3OYAA 4C92A 1BKBA 3FJPA 3PTAA 2DTIA 2ZZDB 5FROA 5GMKh 4C0GA 4ZGDB 3JCMg 1VQ7T 1Q81C 4ELZC 2GFAA 3O8VA 2CZ0B 3CPFA 3OMCA 5L8RE 4ME7A 3R6OA 5GAN5 3M57A 1WNLA 4M7DD 3QXEB 5M9OA 4B9WA 3G7ZA 4OF1A 3CCLA 5DY9A 1S72T 2KMGA 3QZ9B 2GFUA 4HNTA 4QQ6A 1S72A 1VQLA 4IKFA 4LD9K 4PJOA 2HBPA 1OZ3A 4KUIA 3OS2A 2HD0A 3MP1A 1K73U 4OB0B 4JRKA 4NOYA 3LGLA 4XTZA 4Y28E 4IUPA 4M7AA 1FWZA 1WPYA 2X4XA 2JOYA 3CCET 2G3RA 2AHJB 1KG1A 2HQXA 4BE0A 3CPWS 4LOCA 2WSCE 4X9DA 1H3ZA 1YJNT 4C92B 1G5VA 1VUBA 5FU6C 2NLUA 1UGSB 1VQ5T 4OVAA 1BIAA 1Y7XA 2DXCB 1OI1A 3WVEB 1VQ6T 4C8QF 1QVGS 2QQ8A 4M77G 4BI3A 1ZBXA 2Y4XA 1I8FA 5CVIA 4BE1A 3X26B 2BS4A 4C92C 3RMSA 3WXMB 1YIJA 1YJ9T 1JB0E 3LGFA 3DLLA 2QFZA 2CGHA 4FM4B 3OYDA 1HXDA 2RHZA 3QYGB 3LH0A 1UGQB 3JB9I 3KXTA 3S3OA 3HSBA 1N9SA 2QQRA 5D6XA 1OYXA 1ZQ1A 3T9NA 4EMKC 3JB9J 1VQOT 5LJ3d 3SWNA 1YITT 4O6JA 4JRIA 4ZGEB 1R8OB 2KY9A 3ZFJA 4BB7A 3CCRA 3C95A 1M90C 3A8OB 5DLQE 4HL4A 4OB2B 2LX9A 1NZ9A 2LVMA 4AKHA 2R5AA 4VUBA 5LJ3f 3ZEHA 5GANd 3JCMW 2M0OA 2VGMA 4OGEA 5HK3A 4BACA 3BY7A 2HAXA 3CBOA 3BG9A 2M16A 3C4SA 3X25B 2QQSA 2QF7A 4JS5A 3FDRA 2Y90A 3JB9H 2LNVA 2D9TA 1TH7A 3FIFA 4M7AG 2RO0A 1K9MC 1M1KU 3CCLT 3GF5A 3INZA 4HKEA 2DEQA 3MO8A 2VXEA 3OYLA 1N8RU 1N9RA 3GLXA 3TW6A 1M1KC 3G71A 4XU0A 4JLIA 4M7AB 3JB9F 3M4YA 5KCHA 5AYFA 3HL8A 2R57A 2DK3A 3BG3A 5GMKi 1Q7YU 3I56A 2DD5A 3CBMA 1QVFS 3OA6A 1Q82C 3DB4A 3M56A 3LX7A 4PJOE 3M54A 2FYKA 4GY5A 5CO7A 1N6AA 2BKDN 4PJOF 3URGA 3LWIA 1I4K1 4ELYC 3CC4T 4FT4A 2DXUA 4PJOC 3JCMb 3L2UA 4EMKA 2QQAA 3ASKA 4XTVA 1KQ2A 2P0PA 1UGPB 3JCMJ 4A4EA 2JUFA 3V7CA 1LNXA 3J80E 5FRNA 2A7YA 2DIGA 2M9UA 3L42A 4XU1A 3RIRA 3F70A 4N4HA 2MAMA 1NPPA 2MI6A 3HRSA 3MEWA 3SFMA 3GNFB 4NS5A 2EWNA 3JB9G 4XU3A 2QDYB 3KUFA 2R5MA 3MP8A 4MDWA 1BI2A 2K3XA 5FU7C 2K5LA 1PSFA 3MEAA 4M77B 5D6YA 4BDYA 1MGQA 4C8QA 3GIBA 2A3LA 2YLBA 5CKBA 5IN1A 3HO8A 3NTKA 2LT1A 3UT1A 5A0DA 3JCMc 4C92G 4JDSA 3HP9A 5KH6A 2BUDA 4V2SA 4DA4A 2QA4A 1GXIE 2E5QA 3H4CA 2DKGA 1M5Q1 2XU8A 2EAYA 2ZPBB 4F7UE 3M53A 4E7IA 3OS1A 3M59A 2L89A 3UWNA 3CXCS 3Q1JA 3EFRA 1G3WA 4HCZA 5CK9A 2FL7A 3I55T 3V7SA 2OTLA 4ZN1A 3M55A 3VU3C 3I55A 3CCMA 4HT8A 1V29B 1FKMA 2QQBA 3CCQA 4M77C 2RJFA 4A4HA 4BY6B 3FB9A 3TEEA 3OYEA 2P0KA 4CRIA 3S3MA 1VQOA 4ELJA 4JLGA 3BG5A 5GAN2 1NJIU 2YLCA 2C06A 2OTJA 2HNIA 2XG8D 2DTOA 2RD1A 4M78G 4M78D 4M75A 5C6SA 3CCJA 1KQSS 1VQKT 3CC7T 2VV5A 1BIBA 1YJNA 2D0QB 4P5NA 4WF2A 3JCMd 4EMKB 3CCMT 1BI1A 2RHIA 4NL2A 4C5EA 4J6YA 3CMAA 3CMEA 2XDBA 3QO3A 3ZBDA 4M78A 1K9MU 1B34B 2RI5A 4BI4A 4M7AD 3P8BB 4RG8A 3WVDB 4IUVA 2ZCFB 4L59A 3OYNA 2GQVA 2JTFA 2PVDB 3P8HA 4UC4A 3JCMh 4C8QG 2QEXT 4E47A 3OYKA 5CQYA 2QQ9A 2P4TA 1KQ1A 3A8LB 1M4ZA 1LOJA 3QHSA 5C0MA 2QA4T 3RKYA 2ZZDA 2JTMA 3QJ6A 2LQ8A 4J83A 3L2WA 4MFDA 2R58A 4MZPA 4QVZA 4A4KA 3GP8A 1JJ2A 3QYEA 1WJSA 2JNGA 2PVOB 2V8KA 4C8QB 3HB9A 4X34A 1M9SA 2CYZB 4X9CA 2DJZA 1LJOA 2X4WA 2E1HA 2KSSA 1VQNT 4M75F 4HNVA 3OYMA 2CKKA 3VKGA 1KD1U 5GAMg 5GAN6 4M6VA 3M5AA 3BFMA 5I2SA 2WSEE 2KMTA 3A8HB 2RA2A 2RJEA 2BS2A 4MZTA 4MZMA 4J7FA 4BY6C 2QTXA 3CD6T 2CZ6B 4LD6A 4M78B 4PLLA 1W2BA 4QSHA 2M1HA 3A8GB 4B9XA 2BIVA 2L3RA 3NTIA 4LDVA 2MF2A 5IAYA 3OYHA 4RCBA 4PJOB 5CKHA 4XTWA 1VQLT 1WQ7A 4R56A 1O9SA 1I5LA 2O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X24 B;  3LW5 E;  3X20 B;  1IRE B;  2DD5 A;  2PUK B;  3HHT B;  4L6V 5;  2WSF E;  2DXC A;  3X28 B;  4KT0 E;  1UGP B;  2ZPG B;  2PUO B;  1QP3 A;  2QDY B;  3VYG A;  3VYH B;  2DXB A;  3A8M B;  1UGR B;  1PSF A;  2CZ7 B;  3QZ5 B;  1QP2 A;  4ZGD B;  2DD4 B;  1GXI E;  2ZPB B;  2CZ0 B;  4ZGJ B;  5L8R E;  3QXE B;  3QZ9 B;  1V29 B;  2O01 E;  4OB0 B;  2DXB B;  2DPP B;  4Y28 E;  2AHJ B;  2CZ1 B;  2DD5 B;  2WSC E;  4OB1 B;  2D0Q B;  1UGS B;  2DXC B;  3WVE B;  4RKU E;  3WVD B;  3X26 B;  2ZCF B;  2PVG B;  2PVD B;  1JB0 E;  4XK8 E;  1PSE A;  4FM4 B;  3A8L B;  2ZPH B;  3VYG B;  3QYG B;  2ZZD A;  1UGQ B;  2PVO B;  2CYZ B;  4ZGE B;  2PU9 B;  2ZPF B;  2ZPI B;  3A8O B;  4OB2 B;  2DD4 A;  3QYH B;  2WSE E;  3X25 B;  3A8H B;  1AHJ B;  2CZ6 B;  2ZPE B;  3A8G B;  4OB3 B;  1DJ7 B;  2ZZD B; 
#chains in the Genus database with same CATH topology
 2QDL A;  3LLR A;  3E19 A;  3PT9 A;  1A0N B;  2X4Y A;  4QKU A;  3GNG A;  3CXC A;  4N4I A;  5KYU B;  2EQK A;  1ACM B;  3SD4 A;  3CCV A;  2OTJ T;  2EYZ A;  4OP0 A;  4M75 C;  1ZUK A;  4E2F B;  2XI9 A;  2PUO B;  4JRQ A;  4GBQ A;  1K1Z A;  2JVV A;  3UF4 A;  5J39 A;  2PHG A;  1UTI A;  1OIY B;  1YI2 T;  1N27 A;  3TU4 K;  3JRZ A;  5GAO n;  5GAN f;  1P5E B;  4OML A;  1PC0 A;  3CQT A;  2W2H A;  2AKL A;  1WDX A;  2FRY A;  4FW1 A;  2DD4 B;  5FRM A;  4KUD K;  2W0Z A;  4ZGJ B;  2L3P A;  2EIF A;  3TSW A;  1X6O A;  5LJ3 e;  1M2O A;  4EDU A;  3RMQ A;  4PNO A;  5GAN 7;  3OBW A;  1N5Z A;  4IIM A;  1H27 B;  4CFW B;  2M51 A;  3B57 A;  1MMA A;  3DTO A;  2O4X B;  5J26 A;  4A4F A;  4F7U G;  4M7D E;  2QAZ A;  3IQL A;  2DAQ A;  5CQX A;  5CCA A;  3P8D A;  2DVJ A;  1PRM C;  2WIP B;  1VQM Q;  2LQK A;  4CFU B;  3OBY A;  1M90 U;  3BDU A;  4JRP A;  4M78 F;  2PVG B;  2G77 A;  1HSQ A;  4D8D A;  3HKS A;  4Z89 A;  1UNG D;  1M3A A;  4Z02 A;  1T0J A;  2K3B A;  3I9Q A;  5GAO p;  1QMZ B;  4Y72 B;  4KBM B;  4R55 A;  4NST B;  4C8Q E;  4BY7 X;  4MML A;  4RMO A;  1N4M A;  4EC9 B;  3UDC A;  3H6Z A;  3L2Q A;  2F2C A;  3JSC A;  2IVW A;  4M4Z A;  5IXF A;  2CP2 A;  3GPL A;  2F2X A;  2LTO A;  1LVK A;  1QKX A;  3EFO A;  2QYZ A;  3OS0 A;  2RHY A;  1I0C A;  4N0A C;  3TNI B;  4DEY A;  2MK5 A;  3C94 A;  5CKD A;  1HJD A;  5LJ3 j;  2F5K A;  4DBH A;  1BCM A;  2WSF E;  1FIN B;  1O75 A;  2COW A;  4KT0 E;  5I21 A;  1YCS B;  2CCH B;  4F17 A;  1W70 A;  1VIE A;  2F69 A;  4JUV A;  1PD1 A;  3DDP B;  5GAM d;  1WLP B;  3EFO B;  5KE2 A;  2V8J A;  2E3I A;  4C0D C;  3E9G A;  5IHN A;  2QDJ A;  1K0X A;  1Q86 U;  1YJ9 A;  4I3Z B;  2KRM A;  2CP3 A;  4AFQ C;  1BI3 A;  3BDL A;  1UNL D;  4N0A A;  5KYY B;  3H8Z A;  1RI0 A;  4F7U B;  2B9R A;  3L2V A;  3NGP A;  4NL3 A;  4M77 D;  2LJ0 A;  3QHR B;  2LCL A;  3RDV A;  1M1K R;  4QT7 A;  2KDS A;  3LYI A;  4J9F A;  2DXB B;  2RB6 A;  5GAN 8;  4LDU A;  2EUF A;  4BCM D;  2PK2 A;  2A28 A;  1F1B B;  1Y96 A;  3MEV A;  4Z8A A;  1D1A A;  1OV3 A;  2QGS A;  2C5N B;  1QLY A;  5LJ5 h;  3OS5 A;  4DOW A;  2FVU A;  1I07 A;  3MY5 B;  3I56 T;  2DIQ A;  1OUL A;  2YHT A;  2A0F B;  2Y4Y A;  1JJ2 S;  4M7D A;  1RAA B;  3MKD A;  2LJ1 A;  2RI2 A;  1I81 A;  1UE9 A;  1AD6 A;  2C6T B;  2FEI A;  5GAO l;  1MHN A;  3HPW A;  3REB B;  2X51 A;  2NUT B;  1Q82 R;  4GLK A;  2ZPE B;  3I56 Q;  3DB3 A;  4EC8 B;  1XTD A;  2H8H A;  3OYY A;  4Y92 A;  4PJO G;  1H26 B;  4FYW B;  1DJ7 B;  1TFB A;  3G4S A;  1O9K B;  1UEB A;  4ATO A;  4BCJ B;  3JCM e;  1H4L D;  2EVR A;  2JT4 A;  3LW5 E;  4C8Q C;  1H1S B;  1NLP C;  2PUK B;  2XHC A;  1OX9 A;  2FPE A;  2JS0 A;  2OAU A;  2OTL T;  3FRN A;  3TRE A;  4LXC A;  2E6N A;  2EGC A;  1OX8 A;  1ZBJ A;  2GNC A;  3LWH A;  4ZTJ A;  5KYX B;  1VQ9 T;  4QW2 A;  4E7Z A;  1ENW A;  3JCM f;  4AKG A;  4JZ4 A;  2L5Q A;  1YHQ Q;  1W2B P;  2OTJ Q;  1MV0 B;  2A08 A;  4IUQ A;  2K4Y A;  2J06 A;  3A8M B;  3OYB A;  4C92 A;  2DTI A;  5GMK h;  4C0G A;  4ZGD B;  1VQ7 T;  2HSE B;  4CFN B;  3CPF A;  4RTW A;  5GAN 5;  3M57 A;  1RAH B;  5M9O A;  4ROD A;  5DY9 A;  2HCK A;  2GFU A;  4QQ6 A;  4ELL A;  1OZ3 A;  4KUI A;  4E7S A;  2DM1 A;  4K11 A;  2HD0 A;  3LGL A;  1FWZ A;  1NG2 A;  4YC3 B;  1WIE A;  2AHJ B;  2VWF A;  1KG1 A;  2ATC B;  2WSC E;  1G5V A;  4BCK B;  5FU6 C;  1Y7X A;  2D8J A;  4F7S B;  1OI1 A;  2IW6 B;  3WVE B;  4C8Q F;  4F16 A;  4BE1 A;  1QWE A;  2Y4X A;  1X2Q A;  2JGZ B;  2MPX C;  3WXM B;  3DLL A;  2QFZ A;  2CGH A;  2MIO A;  1WYX A;  1HXD A;  3LH0 A;  3HSB A;  4BCF B;  1OYX A;  1C6V X;  4WCI A;  1RLP C;  3SWN A;  2M02 A;  1RAC B;  4JRI A;  2BZY A;  1M90 C;  4HL4 A;  4OB2 B;  3ZEH A;  2LVM A;  4VUB A;  1RAB B;  3C4S A;  3EGD B;  3X25 B;  1AD5 A;  3BLR B;  1Z9Z A;  1M1K U;  3VRZ A;  3EGU A;  1FYN A;  1WHL A;  2KBT A;  1ZP2 A;  1E7O A;  4CC4 B;  4CC2 A;  3SEM A;  1WHJ A;  2QGG A;  3NHN A;  1D0Z A;  2HEQ A;  5GMK i;  2RNA A;  5IDN B;  1OOT A;  3CBM A;  3OA6 A;  1Q82 C;  5HBE B;  1TSF A;  1JSU B;  4PJO F;  4JJB A;  1IHV A;  3ASK A;  2K9G A;  2DIG A;  1UGV A;  5L2W B;  2MI6 A;  2YT6 A;  3SFM A;  4NS5 A;  2FPD A;  2QDY B;  3KUF A;  2OI3 A;  1AZG B;  2R5M A;  1BI2 A;  4MDW A;  3THK A;  4AT1 B;  3M0P A;  2JXB A;  2UZE B;  1S1N A;  2YLB A;  5IN1 A;  4RUG A;  3UT1 A;  4JDS A;  2FZG B;  2BUD A;  5KH6 A;  4V2S A;  2E5Q A;  1QVF P;  3H4C A;  2DKG A;  1G83 A;  3M0T A;  5KYU A;  1FMW A;  3OS1 A;  3M59 A;  3Q1J A;  3EFR A;  4HCZ A;  4MDX A;  3I55 T;  2RF0 A;  1V29 B;  3H41 A;  2LNH B;  1H28 B;  3TEE A;  1M2V A;  4CRI A;  2NUP A;  4ELJ A;  5GAN 2;  1RLQ C;  2JS2 A;  2YLC A;  2DTO A;  2RD1 A;  4M78 D;  4M75 A;  1VQK T;  3CC7 T;  1V1C A;  2VV5 A;  4JJC A;  5HVY B;  2FZK B;  3CCM T;  4CFV B;  4J6Y A;  1YJN Q;  1PKT A;  3QO3 A;  3FJ5 A;  3GTM S;  3P8B B;  2ENM A;  2WEV B;  2JTF A;  3I5S A;  2WMB B;  2CUB A;  2QEX T;  3OYK A;  3CC7 Q;  5CQY A;  3QHS A;  3MI9 B;  1M4Z A;  3RKY A;  4J83 A;  3QJ6 A;  3PO3 S;  2LQ8 A;  2BPM B;  1X6B A;  2ROL A;  2E1H A;  2MOX A;  2ROT A;  1VQN T;  4J9I A;  2CKK A;  2QA4 Q;  2YUO A;  2RA2 A;  1FMK A;  3CD6 T;  5ACB A;  2I53 A;  3VRY A;  3NPF A;  1W1F A;  2M1H A;  4B9X A;  4PJO B;  5CKH A;  2NWM A;  1HD3 A;  1WQ7 A;  1O9S A;  2P84 A;  3VUB A;  4M7A E;  4ESR A;  1RAG B;  5DLO A;  1Q81 R;  2XDP A;  2K6D A;  4KH0 B;  2HL3 A;  1VQP A;  3TSZ A;  4MMK A;  3BLH B;  3DKM A;  1YI2 Q;  1U1T A;  5EJC A;  3OSS C;  4FU6 A;  3V8K A;  1NPR A;  1UJY A;  2DXT A;  1PG5 B;  2RM4 A;  1K73 R;  4EMH A;  4EOS B;  1IZ6 A;  2MWO A;  3CME Q;  2AIR B;  1Y71 A;  4EOP B;  2XDD A;  1KD1 R;  4YOO A;  3CCU A;  4F70 B;  2YWW A;  4C8Q D;  4C5H A;  3MPU B;  4C92 E;  4CFM B;  2RJD A;  5KCO A;  1FVV B;  3OSV A;  2KT8 A;  3QDF A;  4A4G A;  1TD6 A;  2IIM A;  5EC7 A;  2XKO C;  2BTT A;  1K0S A;  3G6E A;  2DD5 B;  4L5G A;  3PGG A;  3MCA B;  1EFN A;  3HRT A;  4MFE A;  3BHT B;  2HBW A;  3CC4 A;  2K2M A;  4OMP A;  3OMG A;  3I5R A;  1K76 A;  1N8R C;  2P0Q A;  2EJ9 A;  1W2B S;  1VQ7 A;  1JQQ A;  4LUD A;  4D6W A;  5A2Q E;  4BE2 A;  4RTZ A;  4BXX X;  2CDT A;  4C0Z A;  3LQ5 B;  3M0R A;  3G71 T;  1KC8 C;  3QYH B;  2E65 A;  1WJR A;  4M75 G;  3OB9 A;  1QVG A;  1JU5 C;  1RUW A;  4PLI A;  5KYY A;  4QQG A;  1OQK A;  3DJB A;  3QSU A;  2OTL Q;  2WIH B;  1YJW T;  2EQM A;  1ZSZ C;  3UPU A;  4HVU A;  2LW4 A;  4PFZ A;  4BY1 X;  1UHF A;  1YIJ T;  1EX4 A;  4OGC A;  4Z88 A;  5J3B A;  2KXD A;  3VKH A;  3QII A;  3KHI A;  3JCM V;  3EHR A;  2RK1 A;  3EAE A;  5GAN j;  1AWO A;  2KR3 A;  2X9H A;  1U06 A;  5GMK j;  2PTK A;  1O9K A;  1T0H A;  5GAN h;  2DL7 A;  3SB2 A;  1VQ8 A;  4CC3 A;  3C0C A;  4F7J B;  5GMK e;  2VUB A;  3FLG A;  1M27 C;  3RNJ A;  4HT9 A;  1VA7 A;  3CCV T;  4WTO B;  1G3Y A;  2EQJ A;  1E9H B;  4PL6 A;  2CSQ A;  5LJ5 e;  5GAN g;  1VQ4 Q;  2PK9 B;  3JCM Q;  2HDA A;  3CBP A;  2B8A A;  4F6S B;  4M77 E;  4XTY A;  2EQI A;  2XIC A;  1YHQ T;  1TWB A;  1GCQ C;  2H3J A;  3SDZ A;  4KGZ B;  3OW2 A;  1TUG B;  2OAW A;  4FSS A;  2IVX A;  4IUR A;  5FLX E;  2EYY A;  3MY1 B;  2K57 A;  4M7D G;  5BNJ B;  1OU8 A;  2OX7 A;  2MMP A;  1FX7 A;  2RN8 A;  1KC8 U;  2RQV A;  2RHU A;  3QDR B;  4XK8 E;  2CP6 A;  2QEX A;  3EID B;  2IPO B;  1PSE A;  3OY9 A;  2CUD A;  4IUT A;  2K2V A;  5D6W A;  5HY6 A;  3QPH A;  4RTT A;  1W4S A;  3CD6 A;  3UA6 A;  1NE8 A;  3CMA T;  2W9F A;  1OPK A;  2KQW A;  2VC8 A;  1P92 A;  1SSF A;  3CC7 A;  1RL2 A;  3CCJ T;  1ZSG A;  2LDM A;  3DL1 A;  2DL5 A;  5KE3 A;  3L1A A;  4II5 B;  4IIO A;  1BYM A;  3M03 A;  2DVE A;  5GAM j;  3G1J A;  2W10 A;  1WZO A;  4OB3 B;  4E6R A;  2I2L A;  4BCN D;  4JJN K;  5GMK l;  1QLB A;  5GAM e;  4NC6 A;  1J3T A;  2B86 A;  2O2O A;  1NLO C;  1KIK A;  2V1Q A;  4RG2 A;  2EGA A;  3J7A F;  1WXU A;  3V8J A;  3N5B B;  1KSW A;  1K8A C;  1VQK A;  2DL3 A;  1IGU A;  3S3N A;  3RBB B;  4BCP B;  2FB7 A;  2QK0 A;  3X28 B;  5FU7 B;  2ZAE A;  4E7H A;  2RH2 A;  2HMA A;  1D3U B;  2XK0 A;  5GAO q;  2KE9 A;  3CCS A;  1VQ4 T;  5IT9 E;  3JAM E;  2QXF A;  2E41 A;  4BI8 B;  2EKH A;  1FXX A;  1WJQ A;  1M1G A;  1B7T A;  1UGR B;  1VIF A;  1H3H A;  2CZ7 B;  2J6K A;  3OYF A;  3HFN A;  1EIF A;  2LCS A;  3OW2 S;  3H9N A;  2IG0 A;  2CP7 A;  1WGS A;  3FJP A;  5FRO A;  1Q81 C;  1CKB A;  1NM7 A;  2CZ0 B;  4ANJ A;  1VQ6 Q;  4KGV B;  1EZZ B;  2BE7 D;  1I5O B;  4M7D D;  3G7Z A;  3CCL A;  2KMG A;  4HNT A;  1S72 A;  4DBQ A;  5IDP B;  3MP1 A;  4JRK A;  4XTZ A;  4G6L B;  4IUP A;  3EGX A;  4M7A A;  1WPY A;  1YFN A;  3EG0 A;  2I0N A;  4LOC A;  1QCF A;  1YJN T;  4ZNX A;  1UGS B;  1VQ5 T;  4OVA A;  2DXC B;  1VQ6 T;  1SHF A;  1AVZ C;  3OW2 P;  1ZBX A;  5CVI A;  2BS4 A;  1PHT A;  3RMS A;  1YJ9 T;  2DME A;  1Y57 A;  3EHQ A;  3S3O A;  1UGQ B;  2EGE A;  1OL1 B;  3T9N A;  1VQO T;  1ZQ1 A;  4EMK C;  2V26 A;  5LJ3 d;  2VB6 A;  1YIT T;  3RGF B;  1D1B A;  4ZGE B;  4BB7 A;  1X27 A;  3CCR A;  4BCG B;  3A8O B;  1NZ9 A;  2R5A A;  2I40 B;  2VGM A;  3PVQ A;  5HK3 A;  3BY7 A;  3VS7 A;  4FCY A;  1C0M A;  4UN0 A;  3CMA Q;  1GUX B;  1JOW A;  2ABL A;  3CCL T;  3GF5 A;  3INZ A;  1N8R U;  2DEQ A;  2KNB B;  1GFD A;  2GGR A;  3UAT A;  4OMM A;  3EH1 A;  5HQ0 B;  2DF6 A;  3JB9 F;  1JO8 A;  2R57 A;  1M2V B;  2ESW A;  1WA7 A;  2COZ A;  3M56 A;  4PJO E;  4A63 B;  3M54 A;  1N6A A;  3CC4 T;  1VQ8 Q;  1AWJ A;  1TU0 B;  1XO2 A;  1W98 B;  1VQ7 Q;  4XTV A;  1PKS A;  1UGP B;  1OL2 B;  3V7C A;  1LNX A;  3J80 E;  2RPN A;  2BZ8 A;  3HRS A;  1NPP A;  2EWN A;  3JB9 G;  3MP8 A;  3MEA A;  4M77 B;  3GIB A;  2A3L A;  1G8X A;  2JMC A;  5CKB A;  3EG1 A;  3NTK A;  2LT1 A;  3QWY A;  2IW9 B;  3HP9 A;  2AT1 B;  2QA4 A;  3CCM Q;  2EAY A;  2ZPB B;  1BB9 A;  1M8M A;  4F14 A;  5DQW A;  2L89 A;  3BE3 A;  5CK9 A;  1G3W A;  3VS6 A;  2OTL A;  4BCH B;  4ZN1 A;  2QEX Q;  2J05 A;  5CYI B;  2VVK A;  3I55 A;  1ZUU A;  4M77 C;  2WPA B;  3OYE A;  3S3M A;  1VQO A;  3BG5 A;  1NYG A;  2D1X A;  4AMC A;  5I11 A;  4M78 G;  4EON B;  1ABQ A;  3CCJ A;  5IHY A;  1YJN A;  1M90 R;  4P5N A;  1QKW A;  2RHI A;  4C5E A;  3CMA A;  3CME A;  3ZBD A;  4M78 A;  4HVW A;  1B34 B;  2RI5 A;  4BI4 A;  2VKN A;  3WVD B;  2ZCF B;  1Q86 R;  2C0T A;  1Z9Q A;  3D7S B;  2QQ9 A;  1KQ1 A;  5C0M A;  1LOJ A;  1BU2 A;  3L2W A;  1JJ2 A;  2JNG A;  4X1V A;  4X9C A;  5ICP B;  4AFU C;  2JW4 A;  2X4W A;  2W9Z A;  1MMN A;  2DRM A;  1MND A;  2LMJ A;  4M6V A;  3EG9 A;  2ED1 A;  4J7F A;  2QTX A;  1KFZ A;  4M78 B;  1LCK A;  1KK7 A;  1MV3 A;  2BIV A;  4LDV A;  2CCI B;  4KRT A;  1RI9 A;  1Q7Y C;  2O4X A;  2BS3 A;  4FIB A;  1BK2 A;  2X35 A;  4FYX B;  4J5Y A;  1TTH B;  4Y91 A;  2EFI A;  1WHM A;  1OU9 A;  2D0N A;  2JTE A;  1B07 A;  4AKI A;  3PIP A;  4LDW A;  4L6V 5;  3FEO A;  3CC2 T;  1VQM A;  3CCS T;  5LQF B;  2AKK A;  2RHX A;  2CSI A;  1ZLM A;  1VQN A;  4OMF B;  4LE9 A;  1QW1 A;  3VS4 A;  5KYW B;  3PE0 A;  5EG2 A;  1RAE B;  1BCO A;  3VYG A;  1SG5 A;  4M7D B;  2DA9 A;  1PCX A;  1VYW B;  1VQ4 A;  2EYX A;  1MMD A;  3HBL A;  1D09 B;  2DTH A;  5CR2 A;  4HXJ A;  1VYU A;  2M0Y A;  1WI7 A;  3KBG A;  2ED0 A;  3BW1 A;  3MET A;  4BUG A;  3CCS Q;  1H25 B;  2VYT A;  1B34 A;  1KJW A;  2NUT A;  5IXB A;  3PVL A;  2BZX A;  1Q7Y R;  3HFO A;  4OMN A;  1PRL C;  4Q5W A;  4OR5 B;  5KYW A;  3QBY A;  1YNZ A;  4CI0 C;  3E2U A;  4M7D C;  2LP5 A;  9ATC B;  3CCQ T;  2DPP B;  3G33 B;  3TNW B;  4ROC A;  3RUX A;  1ZHI A;  2FO0 A;  2KT1 A;  1KC8 R;  3OYG A;  2W96 A;  4JX5 A;  1JEG A;  4BD3 A;  4JPB W;  4IMY B;  5LJ5 f;  1KHC A;  3CEY A;  6AT1 B;  4CFU D;  5LJ5 d;  1OEB A;  4AG2 C;  4M75 D;  1IXD A;  2JZ2 A;  1ZSZ A;  4AI6 A;  5I22 A;  1QCN A;  2DZC A;  3NTH A;  3KFV A;  2GF7 A;  4A54 A;  2PU9 B;  5IHK A;  2YXY A;  3RES A;  4XQ3 A;  2LZ6 B;  2DRK A;  2E70 A;  3RKX A;  2FRW A;  1G3N C;  1UG1 A;  3RKW A;  3NMZ C;  4M78 C;  4RTV A;  1WXT A;  3OYC A;  4J9D A;  2BE9 B;  5DQV A;  1UFF A;  5GAO m;  2LQW A;  3FC3 A;  2NUP B;  1BI0 A;  2HSP A;  1TXQ A;  1VQ9 Q;  1KD1 C;  3X20 B;  4JX6 A;  2RK2 A;  3NDQ A;  2X4J A;  5A0L A;  4KUL A;  5GAN 3;  1SEM A;  1YBY A;  4F6W B;  1Q81 U;  1WHK A;  3GOX A;  2LQN A;  1X01 A;  1Y07 A;  3CC4 Q;  1VQ8 T;  2HKQ B;  2WHB B;  3ER0 A;  2K79 A;  2E12 A;  2JM8 A;  4FYY B;  1YJW A;  4ZN3 A;  3G6E Q;  1SSH A;  2KXC A;  5LJ3 h;  1N8R R;  4A53 A;  2O88 A;  4J7I A;  1PKD B;  2PQW A;  2F5T X;  4OMQ A;  3TQ7 P;  4JX4 A;  2NUZ A;  3PFS A;  1NJI C;  2K3Y A;  2RI3 A;  4HCK A;  1YWO A;  3HTR A;  3QWL A;  1UDL A;  2DJQ A;  5I2M A;  5GAN 4;  4LDY A;  4CXA B;  3EJ1 B;  2DYB A;  3PNW C;  3S6W A;  1BU1 A;  5EFQ B;  1H92 A;  2KRN A;  3H0H A;  1JXM A;  3I55 Q;  2YUP A;  1VOL A;  5CKE A;  4ORZ A;  5IF1 B;  5AT1 B;  4DQ2 A;  1GL5 A;  5GMK m;  2RQR A;  3EFS A;  3ULR B;  1MMG A;  1XNI A;  1UB4 A;  4II1 A;  1X75 C;  5KYX A;  1E6G A;  1G3T A;  2EJG A;  1VQP Q;  3CPW A;  2KAF A;  2ZPH B;  1OZ2 A;  3U23 A;  2EPD A;  5HBJ B;  2EW3 A;  4BCI B;  3CCU T;  1S72 Q;  1GBR A;  2WMA B;  3M0S A;  2CJM B;  4PJO D;  2K5F A;  2ZPF B;  1D3B B;  4RTY A;  5I5Z B;  1CKA A;  2DD4 A;  4J8O A;  5CAI A;  3QWX X;  4M7A F;  1TOV A;  3PMI A;  4J6W A;  4F7U A;  3G6E T;  2DL8 A;  1GCQ A;  4EMG A;  4EOJ B;  3PIO A;  2YDL A;  1KQS A;  1VQL Q;  2G6F X;  3CCJ Q;  3MJX A;  4FSX A;  2J7I A;  4M75 E;  3GBQ A;  2JMA A;  2CH4 A;  3TCJ A;  1YCY A;  1Y96 B;  3A98 A;  4HNU A;  1WQW A;  4IUU A;  3JCM X;  4PJN A;  3SWN C;  3M4G A;  1NJI U;  2WAC A;  5D7U A;  1V76 A;  4EOK B;  2DMO A;  4F7U F;  2HKN A;  1YHQ A;  2VXF A;  2L8D A;  3MEU A;  2KYB A;  2MCN A;  1GY3 B;  1KXU A;  1KHI A;  1KQS P;  1K9M R;  1JBM A;  2C5X B;  2IW8 B;  4E7L A;  1UJ0 A;  2KK4 A;  3QJY A;  1U3O A;  3OYA A;  3BHU B;  4F7L B;  2VAS A;  2X3X D;  4J9B A;  4AG1 C;  1K8A R;  3JCM g;  1VQ5 Q;  4PFP A;  1W6X A;  2YRD A;  3O8V A;  3OMC A;  1H24 B;  2RQW A;  2LX7 A;  4LN2 A;  2CT4 A;  4ME7 A;  4J9G A;  2YRC A;  4OF1 A;  3CCU Q;  1S72 T;  3QZ9 B;  4LD9 K;  1VQL A;  2HBP A;  4JJD A;  3OS2 A;  1UNH D;  1LPL A;  1YWP A;  4NOY A;  1MNE A;  2PJQ A;  2JOY A;  2G3R A;  2GTJ A;  2HQX A;  4LNP A;  2W99 A;  1H3Z A;  1F5Q B;  3CCR Q;  4EOR B;  2L3S A;  1PD0 A;  5CEI B;  1YJW Q;  1QVG S;  2QQ8 A;  4M77 G;  4BI3 A;  1I8F A;  3H0I A;  2E5K A;  4C92 C;  1YIJ A;  1JB0 E;  3LGF A;  2CP5 A;  4PJJ A;  3OYD A;  3KXT A;  1NYF A;  4CRL B;  1H1P B;  1N9S A;  2QQR A;  2O31 A;  2DER A;  3JB9 J;  1BBZ A;  4O6J A;  1R8O B;  3C95 A;  1R0C B;  5DLQ E;  4R0K A;  2M0O A;  4OGE A;  3CBO A;  2M16 A;  2QF7 A;  4JS5 A;  2IN3 A;  2LNV A;  2D9T A;  2DFU A;  1OGU B;  5L23 A;  1NEG A;  4HKE A;  3MO8 A;  2VXE A;  5HNB B;  3G71 A;  5AYF A;  3HL8 A;  1ZA2 B;  1AWW A;  2DK3 A;  3JV3 A;  3BG3 A;  4J9E A;  2PNI A;  1QVF S;  1GBQ A;  3LX7 A;  5CO7 A;  2FYK A;  3LWI A;  1OKV B;  2F2V A;  1I4K 1;  3JCM b;  3L2U A;  1KQ2 A;  2P0P A;  4A4E A;  3CXC P;  5FRN A;  1WFW A;  2A7Y A;  4FX3 B;  2M9U A;  2O9S A;  4XU1 A;  4N4H A;  3CCE Q;  2LJ3 A;  3GNF B;  3CD6 Q;  4XU3 A;  2FPF A;  5FU7 C;  2K5L A;  1MGQ A;  4EOI B;  3HO8 A;  3TNH B;  2A37 A;  1GXI E;  5FWB A;  4EOQ B;  1M5Q 1;  1ZA1 B;  4F7U E;  3M53 A;  1NEB A;  1IB8 A;  3EH2 A;  3UWN A;  2FL7 A;  2DBK A;  3M55 A;  2J6O A;  4HT8 A;  1FKM A;  1H1Q B;  2QQB A;  4BY6 B;  4JLG A;  2AK5 A;  2C06 A;  2OTJ A;  2HNI A;  2E3H A;  4DBR A;  5C6S A;  2DET A;  3MIA B;  4AFS C;  2EBP A;  1BIB A;  3VS2 A;  2DBM A;  2D0Q B;  4BAC A;  3JCM d;  4EMK B;  1BI1 A;  4NL2 A;  2C5O B;  2KGT A;  2XDB A;  2DNU A;  1K9M U;  2WXV B;  4M7A D;  1HYO A;  2EYW A;  4IUV A;  4RG8 A;  1VQN Q;  2GQV A;  4UC4 A;  3JCM h;  4C8Q G;  1RAF B;  4E47 A;  2PZ1 A;  3CCL Q;  1TUD A;  2P4T A;  3A8L B;  2QA4 T;  4BCQ D;  2ZZD A;  2JTM A;  4OGR B;  4MFD A;  4QVZ A;  3GP8 A;  3LH5 A;  2PVO B;  2V8K A;  4C8Q B;  1M9S A;  2CYZ B;  1LJO A;  4M75 F;  4HNV A;  1KD1 U;  3VKG A;  1RAD B;  3M5A A;  1RAI B;  2WSE E;  2UZD B;  2KMT A;  2Z0W A;  3A8H B;  2RJE A;  4MZT A;  2BS2 A;  1ZX6 A;  1IRX A;  1YIT Q;  3A8G B;  3NTI A;  5IAY A;  3VS0 A;  1VOM A;  2FG0 A;  1OI9 B;  4XTW A;  3REA B;  4R56 A;  2O9V A;  2ZZD B;  1I5L A;  3X24 B;  3CPW P;  1U5S A;  2V8I A;  1R77 A;  2L2P A;  3E9F A;  4PKC C;  3O0G D;  2YUN A;  1HK9 A;  4J6X A;  2QI2 A;  3L2Z A;  2DEU A;  2DXC A;  2DIL A;  2CS7 A;  1K73 C;  1OIU B;  1VQ9 A;  2GBQ A;  2KRS A;  2LC4 A;  4PK4 A;  1AWX A;  4KRD B;  4TTH A;  1SPK A;  2ZPG B;  2LCC A;  4KH1 B;  1UHC A;  4HVV A;  1X69 A;  4HA8 A;  4HCB A;  3RER A;  3VYH B;  4YOS A;  3CCV Q;  4N4G A;  2COY A;  3VS3 A;  4ZTF A;  3QZ5 B;  4QVD A;  1SRL A;  1JRI A;  2GTO A;  2LT4 A;  1YIT A;  3V7R A;  5CKF A;  5HKC A;  2ECZ A;  4XU2 A;  2EQU A;  1CSK A;  3VKI A;  3CCQ Q;  3CC2 A;  4EPC A;  4E7K A;  2RQT A;  1PWT A;  3NFC A;  3CCE A;  2J6F A;  2F1L A;  5ECA A;  3QUI A;  4C92 F;  5HBH B;  1T3L A;  1ZSZ B;  4FT2 A;  5GAO r;  2UUE B;  4BBS M;  3DLM A;  1SF9 A;  1Q82 U;  1VQ5 A;  2O01 E;  3M58 A;  1VQM T;  4BCM B;  4Z6Y A;  2CZ1 B;  1VQP T;  2DYI A;  4QVC A;  3VS1 A;  3JCM P;  3AHU A;  4DOV A;  3G71 Q;  2LRQ A;  3ME9 A;  2KVQ G;  1AOJ A;  4RKU E;  4C5I A;  1GCP A;  1U8R A;  4M78 E;  2FHD A;  1AT1 B;  1JJ2 P;  1ARK A;  1T3S A;  3QYB A;  2MWP A;  3H0F A;  1YP5 A;  2F2W A;  4M77 A;  3VJP A;  4DEX A;  1AIS B;  2EJF A;  3V8L A;  1M3C A;  2ZPI B;  5LL6 S;  5LJ5 j;  3E1S A;  2E10 A;  4LUE A;  1U1S A;  2HL5 C;  2D6F A;  3HZJ A;  4BBR M;  3L2R A;  2MYS A;  1AHJ B;  5CIU A;  3EOC B;  2YSQ A;  1IGQ A;  2EKO A;  4HLQ A;  3VUZ A;  1PNJ A;  2ZGW A;  1GRI A;  1GH6 B;  4C5G A;  3TN8 B;  4M75 B;  1E7P A;  2EYQ A;  3VV0 A;  2XMF A;  3CME T;  4M7D F;  2XD0 A;  1B3Q A;  1X43 A;  4QQD A;  5DM7 R;  5A0G A;  1YN8 A;  3MP6 A;  2UZB B;  3HRU A;  4OMO A;  1XQH A;  4AFZ C;  1QP3 A;  3R6N A;  1QCO A;  2DZ9 A;  4M7A C;  2HZY A;  3TW7 A;  3I35 A;  3SWN B;  1D3B A;  1OPL A;  1E6H A;  1JST B;  1TG0 A;  1AZE A;  2OJ2 A;  3M9Q A;  4PFO A;  2GCX A;  5FU6 B;  1WX6 A;  1M3B A;  5FW9 A;  2YRV A;  4C0F A;  2E64 A;  2G9X B;  1SRM A;  3QG1 A;  1M8V A;  4BCQ B;  4TVR A;  4OB1 B;  2QG9 B;  2C0O A;  4XTX A;  2RQU A;  3MHX A;  3QKJ A;  3G4S Q;  2E6Z A;  1VQO Q;  2K5I A;  2VGN A;  5GAM f;  1IO6 A;  4F7N B;  4KGX B;  1QVF A;  1VIN A;  2SEM A;  3JB9 D;  1K9M C;  2DO3 A;  1R0B G;  2RMO A;  1QMC A;  4O5V A;  3VYG B;  1QVP A;  1XOV A;  1TS9 A;  1C9B A;  5HK0 A;  2BKZ B;  3CC2 Q;  3OYI A;  4GLM A;  2XID A;  2V1R A;  5GAN e;  5LJ5 g;  4ROE A;  4CFX B;  3CCR T;  1G2B A;  3G4S T;  1QQJ A;  4PJL A;  1K8A U;  2RJC A;  1VQK Q;  1H64 1;  2KRO A;  4BDZ A;  4D8K A;  2C0I A;  2A36 A;  4FL6 A;  1JKW A;  1IHW A;  4FW2 A;  4YTL A;  2D8H A;  4XAX B;  3VS5 A;  1VQ6 A;  3OYJ A;  2QTV A;  3BHV B;  1YI2 A;  2JN0 A;  1OKW B;  4JS4 A;  1IRE B;  2L0A A;  2P4R A;  3OQ5 A;  4PJM A;  4RCC A;  5GAM h;  3HHT B;  3J81 E;  3SHW A;  1YIJ Q;  1NJI R;  2CH4 W;  4C0D B;  4LDX A;  2DX1 A;  4M77 F;  3A5Z B;  2E4H A;  4YOZ A;  3PMT A;  2HQE A;  2X3W D;  4E7J A;  4XTU A;  1M1F A;  1MUZ A;  2X1N B;  4MIM A;  4C92 D;  2DXB A;  2WJ9 A;  1G3S A;  3C12 A;  2C5V B;  5LJ3 g;  2KR6 A;  1QP2 A;  2PMI B;  3DDQ B;  1X6G A;  2FZC B;  1BKB A;  3PTA A;  2DLP A;  1K9A A;  4ELZ C;  2GFA A;  5L8R E;  3R6O A;  3K7A M;  1SKU B;  1GUX A;  1WNL A;  2CT3 A;  3QXE B;  2AZS A;  4B9W A;  4IKF A;  4PJO A;  1PM3 A;  8ATC B;  1URC B;  7AT1 B;  4OB0 B;  4Y28 E;  2QAS A;  2X4X A;  3CCE T;  4BE0 A;  5KYN A;  3CPW S;  3DOG B;  4X9D A;  3O5Z A;  4C92 B;  1VUB A;  2NLU A;  3BLQ B;  2L3Q A;  1BIA A;  1D0X A;  2GQI A;  2KI7 A;  3X26 B;  3ZL7 C;  2CRE A;  4F6U B;  1Q95 G;  5GJW B;  4FM4 B;  2RHZ A;  1ABO A;  3QYG B;  3JB9 I;  4F04 B;  5D6X A;  3ZFJ A;  2KY9 A;  3EG3 A;  5FGK B;  5IHI A;  1NBE B;  1C1A A;  1ZUY A;  3TVT A;  2JM9 A;  2LX9 A;  2QGF B;  4AKH A;  5LJ3 f;  3JCM W;  5GAN d;  4HCC A;  2HAX A;  3BG9 A;  1FMV A;  2QQS A;  3JB9 H;  3FDR A;  2Y90 A;  1TH7 A;  3FIF A;  4M7A G;  3M0U A;  2RO0 A;  1YJ9 Q;  1D1C A;  2AZV A;  2HQH A;  2K7A A;  3OYL A;  1N9R A;  3GLX A;  3TW6 A;  1M1K C;  2DE0 X;  4XU0 A;  2KYM A;  3EGX B;  4JLI A;  3M4Y A;  4M7A B;  4DBF A;  5KCH A;  1WXB A;  1K4U S;  5LMK B;  1Q7Y U;  3I56 A;  2DD5 A;  3DB4 A;  4J9C A;  4GY5 A;  1M30 A;  2BKD N;  2V22 B;  3F5X B;  3URG A;  4ELY C;  1H8K A;  2DXU A;  4FT4 A;  4PJO C;  4RTU A;  2QQA A;  4EMK A;  3JCM J;  2JUF A;  1UEC A;  3L42 A;  3RIR A;  3F70 A;  2MAM A;  1WHH A;  3MEW A;  5FWC A;  1GFC A;  2DL4 A;  2UZL B;  2K3X A;  1PSF A;  5D6Y A;  4BDY A;  4C8Q A;  3EG2 A;  1TUC A;  1D0Y A;  1I1J A;  5A0D A;  3JCM c;  4C92 G;  3RR6 A;  1UUE A;  4DA4 A;  3EGD A;  3EG9 B;  2XU8 A;  2WFY B;  4E7I A;  1Y0M A;  3M0Q A;  1AEY A;  4FYV B;  3CXC S;  1QWF A;  1VYT A;  3V7S A;  3VU3 C;  3CCM A;  2KEA A;  5HCK A;  3CCQ A;  2RJF A;  4BCN B;  4A4H A;  3FB9 A;  2P0K A;  2SRC A;  2XG8 D;  1KQS S;  1VYV A;  4EOO B;  2CP0 A;  2R7G A;  4KRC B;  4WF2 A;  1K73 U;  4EIK A;  3POM A;  4RTX A;  2YUQ A;  3AT1 B;  5GJV B;  3OYN A;  2H3E B;  4L59 A;  2PVD B;  1H1R B;  3P8H A;  3QHW B;  1XJW B;  1Q86 C;  3UA7 A;  4BCO B;  2R58 A;  4MZP A;  4A4K A;  4J9H A;  3QYE A;  1WJS A;  1JXO A;  3HB9 A;  4X34 A;  2DJZ A;  8AT1 B;  2KSS A;  3A1P A;  5IH2 A;  4EOM B;  3OYM A;  2JJ9 A;  5GAM g;  5GAN 6;  4JZ3 A;  3BFM A;  5I2S A;  4B6M A;  1SHG A;  4MZM A;  4BY6 C;  1X2K A;  2CZ6 B;  4LD6 A;  4PLL A;  1W2B A;  4QSH A;  1WHG A;  1QVG P;  2NYS A;  2L3R A;  3OYH A;  2MF2 A;  4RCB A;  2C4G B;  4CC7 A;  1VQL T;  4EOL B; 
#chains in the Genus database with same CATH homology
 3X24 B;  2BS3 A;  3LLR A;  2X35 A;  2V8I A;  4FIB A;  4J5Y A;  4Y91 A;  3E19 A;  3PT9 A;  3VUB A;  3E9F A;  4PKC C;  2EFI A;  4M7A E;  5DLO A;  2X4Y A;  2XDP A;  3GNG A;  1VQP A;  4AKI A;  3PIP A;  3CXC A;  1HK9 A;  4LDW A;  4MMK A;  4L6V 5;  4J6X A;  2QI2 A;  3FEO A;  3L2Z A;  4N4I A;  2DXC A;  3DKM A;  3CC2 T;  2CS7 A;  1K73 C;  1VQM A;  3CCS T;  2EQK A;  1VQ9 A;  3SD4 A;  3CCV A;  2RHX A;  2LC4 A;  1Q7Y C;  1VQN A;  2ZPG B;  2OTJ T;  1U1T A;  5EJC A;  3OSS C;  4FU6 A;  4OMF B;  3V8K A;  1QW1 A;  4OP0 A;  4M75 C;  2LCC A;  2XI9 A;  2PUO B;  5EG2 A;  4JRQ A;  4HCB A;  1NPR A;  4HA8 A;  2JVV A;  3RER A;  3VYH B;  3VYG A;  5J39 A;  4N4G A;  1YI2 T;  4M7D B;  2DXT A;  1N27 A;  3TU4 K;  3JRZ A;  5GAO n;  3QZ5 B;  4QVD A;  5GAN f;  4ZTF A;  2LT4 A;  1JRI A;  2RM4 A;  1VQ4 A;  1YIT A;  3HBL A;  3V7R A;  2DTH A;  5CKF A;  4EMH A;  5HKC A;  5CR2 A;  1IZ6 A;  2MWO A;  4XU2 A;  3KBG A;  2EQU A;  2DD4 B;  3VKI A;  3CC2 A;  3BW1 A;  3MET A;  4BUG A;  4EPC A;  1Y71 A;  4KUD K;  4E7K A;  5FRM A;  2XDD A;  2VYT A;  4ZGJ B;  1B34 A;  3NFC A;  3CCE A;  2EIF A;  3CCU A;  1X6O A;  3HFO A;  3QUI A;  4C8Q D;  4EDU A;  3RMQ A;  4PNO A;  4C92 F;  4C5H A;  3OBW A;  5LJ3 e;  5GAN 7;  4FT2 A;  4Q5W A;  4C92 E;  5GAO r;  4BBS M;  2RJD A;  3DLM A;  5KCO A;  3QBY A;  1Q82 U;  3OSV A;  4CI0 C;  1VQ5 A;  2O01 E;  3M58 A;  2O4X B;  4A4G A;  4M7D C;  5J26 A;  4A4F A;  3CCQ T;  1VQM T;  4F7U G;  2DPP B;  2XKO C;  4Z6Y A;  3RUX A;  1ZHI A;  4M7D E;  2CZ1 B;  2DD5 B;  3G6E A;  4L5G A;  1VQP T;  3PGG A;  4QVC A;  2DAQ A;  3OYG A;  3MCA B;  5CQX A;  3HRT A;  3JCM P;  4JX5 A;  3AHU A;  4MFE A;  4DOV A;  4BD3 A;  5CCA A;  2LRQ A;  3CC4 A;  3P8D A;  3ME9 A;  2KVQ G;  5LJ5 f;  1KHC A;  4RKU E;  3CEY A;  2LQK A;  4C5I A;  3OBY A;  1M90 U;  3BDU A;  4JRP A;  3OMG A;  4M78 F;  2PVG B;  2G77 A;  4M78 E;  2FHD A;  1U8R A;  5LJ5 d;  1N8R C;  2P0Q A;  4M75 D;  2JZ2 A;  3HKS A;  2EJ9 A;  1W2B S;  3QYB A;  1VQ7 A;  2MWP A;  4Z02 A;  4AI6 A;  4D6W A;  4M77 A;  5A2Q E;  5GAO p;  3VJP A;  2DZC A;  2EJF A;  3NTH A;  4BE2 A;  3V8L A;  2GF7 A;  4A54 A;  2PU9 B;  4KBM B;  4R55 A;  2ZPI B;  3RES A;  4C8Q E;  4MDX A;  4C0Z A;  5LL6 S;  5LJ5 j;  4MML A;  4XQ3 A;  3E1S A;  2E10 A;  4RMO A;  3UDC A;  2E70 A;  1U1S A;  3H6Z A;  3QYH B;  2E65 A;  3RKX A;  3G71 T;  3L2Q A;  1KC8 C;  1WJR A;  3JSC A;  3OB9 A;  2IVW A;  4M75 G;  1QVG A;  2D6F A;  3HZJ A;  4PLI A;  3RKW A;  4BBR M;  3L2R A;  1AHJ B;  4M78 C;  4QQG A;  5CIU A;  2LTO A;  3GPL A;  3QSU A;  3OYC A;  1YJW T;  2EKO A;  2EQM A;  4HLQ A;  3VUZ A;  5GAO m;  3UPU A;  3OS0 A;  3FC3 A;  2RHY A;  1BI0 A;  2ZGW A;  4N0A C;  4C5G A;  1KD1 C;  3X20 B;  4JX6 A;  2RK2 A;  1YIJ T;  4M75 B;  4OGC A;  3C94 A;  5CKD A;  2X4J A;  5J3B A;  5A0L A;  4KUL A;  5GAN 3;  1E7P A;  2F5K A;  5LJ3 j;  3VKH A;  1YBY A;  3QII A;  2EYQ A;  3KHI A;  2WSF E;  1Q81 U;  1Q86 C;  3JCM V;  3VV0 A;  3CME T;  1O75 A;  4M7D F;  2XD0 A;  4KT0 E;  3GOX A;  2RK1 A;  1X01 A;  1Y07 A;  3EAE A;  4QQD A;  1VQ8 T;  5I21 A;  5DM7 R;  5A0G A;  5GAN j;  3MP6 A;  3ER0 A;  1VIE A;  3HRU A;  2F69 A;  2E12 A;  4JUV A;  1XQH A;  5GAM d;  1YJW A;  1QP3 A;  4ZN3 A;  4HCC A;  5KE2 A;  2DZ9 A;  2V8J A;  5GMK j;  5GAN h;  4M7A C;  5LJ3 h;  4A53 A;  3TW7 A;  4C0D C;  4J7I A;  2PQW A;  3E9G A;  3SB2 A;  2QDJ A;  2F5T X;  3SWN B;  1VQ8 A;  4JX4 A;  1Q86 U;  1YJ9 A;  3PFS A;  1NJI C;  2K3Y A;  2RI3 A;  1D3B A;  3QWL A;  5GMK e;  2VUB A;  1BI3 A;  5I2M A;  3BDL A;  3FLG A;  4LDY A;  4N0A A;  5GAN 4;  4HT9 A;  3H8Z A;  3PNW C;  3S6W A;  3CCV T;  1RI0 A;  1G3Y A;  2EQJ A;  4F7U B;  3L2V A;  4NL3 A;  4M77 D;  3M9Q A;  2LCL A;  2KDS A;  2GCX A;  3LYI A;  4PL6 A;  5FU6 B;  5LJ5 e;  5GAN g;  3JCM Q;  3CBP A;  2B8A A;  2DXB B;  2RB6 A;  2YRV A;  4C0F A;  5GAN 8;  5CKE A;  4LDU A;  2E64 A;  4M77 E;  4XTY A;  2XIC A;  1YHQ T;  4DQ2 A;  3MEV A;  1Y96 A;  5GMK m;  3QG1 A;  2H3J A;  1M8V A;  4TVR A;  3SDZ A;  4OB1 B;  4XTX A;  3OW2 A;  3EFS A;  5LJ5 h;  3OS5 A;  3MHX A;  2FVU A;  3QKJ A;  4DOW A;  2E6Z A;  4IUR A;  2K5I A;  2VGN A;  5FLX E;  1XNI A;  1UB4 A;  2K57 A;  4II1 A;  4M7D G;  5GAM f;  1X75 C;  2MMP A;  1FX7 A;  1KC8 U;  1QVF A;  1G3T A;  2RHU A;  2EJG A;  3QDR B;  4XK8 E;  3I56 T;  2QEX A;  3CPW A;  1PSE A;  2DIQ A;  2DO3 A;  4IUT A;  3OY9 A;  2YHT A;  3JB9 D;  2K2V A;  2KAF A;  4O5V A;  2ZPH B;  1OZ2 A;  2Y4Y A;  3VYG B;  5D6W A;  1QVP A;  3QPH A;  1JJ2 S;  1XOV A;  5HY6 A;  1W4S A;  5HK0 A;  3CD6 A;  4M7D A;  3CMA T;  1NE8 A;  3CCU T;  2RI2 A;  2KQW A;  2VC8 A;  1P92 A;  3OYI A;  1I81 A;  2XID A;  1SSF A;  2K5F A;  2ZPF B;  4PJO D;  5GAN e;  1D3B B;  1RL2 A;  5LJ5 g;  3CC7 A;  3CCJ T;  3CCR T;  2LDM A;  3DL1 A;  2DD4 A;  3G4S T;  4J8O A;  5CAI A;  5KE3 A;  5GAO l;  4M7A F;  1MHN A;  3L1A A;  3HPW A;  1BYM A;  3PMI A;  4J6W A;  2DVE A;  1K8A U;  2RJC A;  4F7U A;  1H64 1;  5GAM j;  3G6E T;  4GLK A;  4EMG A;  2ZPE B;  3DB3 A;  4OB3 B;  3PIO A;  1KQS A;  4BDZ A;  1XTD A;  3OYY A;  2I2L A;  4PJO G;  4FL6 A;  4JJN K;  4FSX A;  1DJ7 B;  4YTL A;  5GMK l;  1QLB A;  4M75 E;  3G4S A;  5GAM e;  1UEB A;  4XAX B;  4ATO A;  1VQ6 A;  4NC6 A;  3JCM e;  3OYJ A;  3LW5 E;  1YI2 A;  2JN0 A;  4C8Q C;  3TCJ A;  1YCY A;  4JS4 A;  1IRE B;  1Y96 B;  4RG2 A;  3OQ5 A;  3J7A F;  2PUK B;  2XHC A;  4HNU A;  1WQW A;  4IUU A;  4RCC A;  3V8J A;  5GAM h;  3HHT B;  3N5B B;  3J81 E;  2OAU A;  1K8A C;  1VQK A;  2OTL T;  3FRN A;  3TRE A;  4C0D B;  3S3N A;  2E6N A;  2FB7 A;  4LDX A;  3X28 B;  4M77 F;  3A5Z B;  5FU7 B;  3JCM X;  4E7H A;  2RH2 A;  3SWN C;  3LWH A;  2XK0 A;  3M4G A;  5GAO q;  4ZTJ A;  2WAC A;  3PMT A;  3CCS A;  4QW2 A;  5IT9 E;  3JAM E;  1VQ4 T;  1VQ9 T;  2HQE A;  3JCM f;  4F7U F;  1YHQ A;  2VXF A;  4E7J A;  2L8D A;  4AKG A;  3MEU A;  4XTU A;  2L5Q A;  2QXF A;  2E41 A;  1M1F A;  4BI8 B;  4MIM A;  1FXX A;  4IUQ A;  1WJQ A;  2DXB A;  1KHI A;  1M1G A;  4C92 D;  2K4Y A;  3A8M B;  1UGR B;  2WJ9 A;  1JBM A;  1G3S A;  1VIF A;  2CZ7 B;  3C12 A;  5LJ3 g;  4E7L A;  2KK4 A;  2KR6 A;  3OYF A;  1QP2 A;  3HFN A;  1EIF A;  3QJY A;  3OW2 S;  2IG0 A;  1WGS A;  3OYB A;  3OYA A;  4C92 A;  1BKB A;  3FJP A;  3PTA A;  2DTI A;  2ZZD B;  5FRO A;  5GMK h;  4C0G A;  4ZGD B;  3JCM g;  1VQ7 T;  1Q81 C;  4ELZ C;  2GFA A;  3O8V A;  2CZ0 B;  3CPF A;  3OMC A;  5L8R E;  4ME7 A;  3R6O A;  5GAN 5;  3M57 A;  1WNL A;  4M7D D;  3QXE B;  5M9O A;  4B9W A;  3G7Z A;  4OF1 A;  3CCL A;  5DY9 A;  1S72 T;  2KMG A;  3QZ9 B;  2GFU A;  4HNT A;  4QQ6 A;  1S72 A;  1VQL A;  4IKF A;  4LD9 K;  4PJO A;  2HBP A;  1OZ3 A;  4KUI A;  3OS2 A;  2HD0 A;  3MP1 A;  1K73 U;  4OB0 B;  4JRK A;  4NOY A;  3LGL A;  4XTZ A;  4Y28 E;  4IUP A;  4M7A A;  1FWZ A;  1WPY A;  2X4X A;  2JOY A;  3CCE T;  2G3R A;  2AHJ B;  1KG1 A;  2HQX A;  4BE0 A;  3CPW S;  4LOC A;  2WSC E;  4X9D A;  1H3Z A;  1YJN T;  4C92 B;  1G5V A;  1VUB A;  5FU6 C;  2NLU A;  1UGS B;  1VQ5 T;  4OVA A;  1BIA A;  1Y7X A;  2DXC B;  1OI1 A;  3WVE B;  1VQ6 T;  4C8Q F;  1QVG S;  2QQ8 A;  4M77 G;  4BI3 A;  1ZBX A;  2Y4X A;  1I8F A;  5CVI A;  4BE1 A;  3X26 B;  2BS4 A;  4C92 C;  3RMS A;  3WXM B;  1YIJ A;  1YJ9 T;  1JB0 E;  3LGF A;  3DLL A;  2QFZ A;  2CGH A;  4FM4 B;  3OYD A;  1HXD A;  2RHZ A;  3QYG B;  3LH0 A;  1UGQ B;  3JB9 I;  3KXT A;  3S3O A;  3HSB A;  1N9S A;  2QQR A;  5D6X A;  1OYX A;  1ZQ1 A;  3T9N A;  4EMK C;  3JB9 J;  1VQO T;  5LJ3 d;  3SWN A;  1YIT T;  4O6J A;  4JRI A;  4ZGE B;  1R8O B;  2KY9 A;  3ZFJ A;  4BB7 A;  3CCR A;  3C95 A;  1M90 C;  3A8O B;  5DLQ E;  4HL4 A;  4OB2 B;  2LX9 A;  1NZ9 A;  2LVM A;  4AKH A;  2R5A A;  4VUB A;  5LJ3 f;  3ZEH A;  5GAN d;  3JCM W;  2M0O A;  2VGM A;  4OGE A;  5HK3 A;  4BAC A;  3BY7 A;  2HAX A;  3CBO A;  3BG9 A;  2M16 A;  3C4S A;  3X25 B;  2QQS A;  2QF7 A;  4JS5 A;  3FDR A;  2Y90 A;  3JB9 H;  2LNV A;  2D9T A;  1TH7 A;  3FIF A;  4M7A G;  2RO0 A;  1K9M C;  1M1K U;  3CCL T;  3GF5 A;  3INZ A;  4HKE A;  2DEQ A;  3MO8 A;  2VXE A;  3OYL A;  1N8R U;  1N9R A;  3GLX A;  3TW6 A;  1M1K C;  3G71 A;  4XU0 A;  4JLI A;  4M7A B;  3JB9 F;  3M4Y A;  5KCH A;  5AYF A;  3HL8 A;  2R57 A;  2DK3 A;  3BG3 A;  5GMK i;  1Q7Y U;  3I56 A;  2DD5 A;  3CBM A;  1QVF S;  3OA6 A;  1Q82 C;  3DB4 A;  3M56 A;  3LX7 A;  4PJO E;  3M54 A;  2FYK A;  4GY5 A;  5CO7 A;  1N6A A;  2BKD N;  4PJO F;  3URG A;  3LWI A;  1I4K 1;  4ELY C;  3CC4 T;  4FT4 A;  2DXU A;  4PJO C;  3JCM b;  3L2U A;  4EMK A;  2QQA A;  3ASK A;  4XTV A;  1KQ2 A;  2P0P A;  1UGP B;  3JCM J;  4A4E A;  2JUF A;  3V7C A;  1LNX A;  3J80 E;  5FRN A;  2A7Y A;  2DIG A;  2M9U A;  3L42 A;  4XU1 A;  3RIR A;  3F70 A;  4N4H A;  2MAM A;  1NPP A;  2MI6 A;  3HRS A;  3MEW A;  3SFM A;  3GNF B;  4NS5 A;  2EWN A;  3JB9 G;  4XU3 A;  2QDY B;  3KUF A;  2R5M A;  3MP8 A;  4MDW A;  1BI2 A;  2K3X A;  5FU7 C;  2K5L A;  1PSF A;  3MEA A;  4M77 B;  5D6Y A;  4BDY A;  1MGQ A;  4C8Q A;  3GIB A;  2A3L A;  2YLB A;  5CKB A;  5IN1 A;  3HO8 A;  3NTK A;  2LT1 A;  3UT1 A;  5A0D A;  3JCM c;  4C92 G;  4JDS A;  3HP9 A;  5KH6 A;  2BUD A;  4V2S A;  4DA4 A;  2QA4 A;  1GXI E;  2E5Q A;  3H4C A;  2DKG A;  1M5Q 1;  2XU8 A;  2EAY A;  2ZPB B;  4F7U E;  3M53 A;  4E7I A;  3OS1 A;  3M59 A;  2L89 A;  3UWN A;  3CXC S;  3Q1J A;  3EFR A;  1G3W A;  4HCZ A;  5CK9 A;  2FL7 A;  3I55 T;  3V7S A;  2OTL A;  4ZN1 A;  3M55 A;  3VU3 C;  3I55 A;  3CCM A;  4HT8 A;  1V29 B;  1FKM A;  2QQB A;  3CCQ A;  4M77 C;  2RJF A;  4A4H A;  4BY6 B;  3FB9 A;  3TEE A;  3OYE A;  2P0K A;  4CRI A;  3S3M A;  1VQO A;  4ELJ A;  4JLG A;  3BG5 A;  5GAN 2;  1NJI U;  2YLC A;  2C06 A;  2OTJ A;  2HNI A;  2XG8 D;  2DTO A;  2RD1 A;  4M78 G;  4M78 D;  4M75 A;  5C6S A;  3CCJ A;  1KQS S;  1VQK T;  3CC7 T;  2VV5 A;  1BIB A;  1YJN A;  2D0Q B;  4P5N A;  4WF2 A;  3JCM d;  4EMK B;  3CCM T;  1BI1 A;  2RHI A;  4NL2 A;  4C5E A;  4J6Y A;  3CMA A;  3CME A;  2XDB A;  3QO3 A;  3ZBD A;  4M78 A;  1K9M U;  1B34 B;  2RI5 A;  4BI4 A;  4M7A D;  3P8B B;  4RG8 A;  3WVD B;  4IUV A;  2ZCF B;  4L59 A;  3OYN A;  2GQV A;  2JTF A;  2PVD B;  3P8H A;  4UC4 A;  3JCM h;  4C8Q G;  2QEX T;  4E47 A;  3OYK A;  5CQY A;  2QQ9 A;  2P4T A;  1KQ1 A;  3A8L B;  1M4Z A;  1LOJ A;  3QHS A;  5C0M A;  2QA4 T;  3RKY A;  2ZZD A;  2JTM A;  3QJ6 A;  2LQ8 A;  4J83 A;  3L2W A;  4MFD A;  2R58 A;  4MZP A;  4QVZ A;  4A4K A;  3GP8 A;  1JJ2 A;  3QYE A;  1WJS A;  2JNG A;  2PVO B;  2V8K A;  4C8Q B;  3HB9 A;  4X34 A;  1M9S A;  2CYZ B;  4X9C A;  2DJZ A;  1LJO A;  2X4W A;  2E1H A;  2KSS A;  1VQN T;  4M75 F;  4HNV A;  3OYM A;  2CKK A;  3VKG A;  1KD1 U;  5GAM g;  5GAN 6;  4M6V A;  3M5A A;  3BFM A;  5I2S A;  2WSE E;  2KMT A;  3A8H B;  2RA2 A;  2RJE A;  2BS2 A;  4MZT A;  4MZM A;  4J7F A;  4BY6 C;  2QTX A;  3CD6 T;  2CZ6 B;  4LD6 A;  4M78 B;  4PLL A;  1W2B A;  4QSH A;  2M1H A;  3A8G B;  4B9X A;  2BIV A;  2L3R A;  3NTI A;  4LDV A;  2MF2 A;  5IAY A;  3OYH A;  4RCB A;  4PJO B;  5CKH A;  4XTW A;  1VQL T;  1WQ7 A;  4R56 A;  1O9S A;  1I5L A;  2O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...