2D0QB

Complex of fe-type nhase with cyclohexyl isocyanide, photo-activated for 1hr at 277k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title X-ray snap shots of Inhibitor Binding Process in Photo-reactive Nitrile Hydratase
rcsb
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2d0qB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d0qB02
2ZPIB 1V29B 2ZPGB 4KT0E 3QYGB 2PUOB 1DJ7B 1AHJB 3A8HB 2WSCE 3LW5E 2DD5B 3X24B 2CZ1B 1GXIE 2O01E 2DXBA 2PUKB 3VYGB 4OB0B 2CZ6B 3A8GB 1UGRB 4ZGEB 1PSFA 4RKUE 3QZ9B 4L6V5 2DXCA 2ZPFB 3X25B 4XK8E 2DD4A 1JB0E 3VYGA 5L8RE 3QXEB 1UGSB 2AHJB 2CZ7B 2ZPBB 2PU9B 2WSEE 2ZZDB 4OB1B 2ZPEB 2PVGB 3A8OB 2DD5A 3QYHB 2CZ0B 3HHTB 2PVDB 1IREB 4OB2B 2CYZB 2ZZDA 3VYHB 1UGPB 4ZGDB 3A8LB 2QDYB 1UGQB 4ZGJB 4FM4B 1QP2A 3WVDB 4OB3B 2DPPB 2PVOB 1QP3A 3QZ5B 3X26B 4Y28E 2D0QB 2DXCB 3X20B 2ZCFB 3WVEB 3X28B 2DD4B 2WSFE 3A8MB 1PSEA 2ZPHB 2DXBB
chains in the Genus database with same CATH superfamily
4D6WA 1WYXA 3HFNA 3FDRA 3QYGB 4DQ2A 1K73C 4EPCA 4M78G 4BDYA 1QCFA 3V7CA 2C5VB 4IUPA 1BB9A 4HCCA 1M2OA 2UUEB 4OMFB 4F7UF 3BDUA 3CCUQ 1ENWA 1QWEA 2AZSA 4C92A 4LE9A 3J7AF 1WHKA 5KYYB 4LUDA 2WIHB 3EJ1B 4ORZA 3UPUA 1TUDA 4JPBW 1VQLQ 2P84A 2RF0A 3QKJA 1JSTB 1B34A 4M78A 3ULRB 2L3RA 3AT1B 3EHQA 1YI2T 3CPWP 3CCQQ 1M2VA 4FU6A 1VIEA 4M7DF 2E3IA 2BIVA 3OYNA 1VINA 1B3QA 2C0TA 2CT4A 2F5TX 2FZKB 1SRMA 4XU1A 3CC2T 4HLQA 4OP0A 4IUUA 2DNUA 4ELZC 3GNGA 1G83A 4J6WA 2K2VA 3MJXA 1JJ2P 4M75E 2W9ZA 3VS0A 1K1ZA 2CYZB 3CCJA 1VQMT 4HVWA 1QLYA 4ZN1A 2NUPB 4BCPB 3BFMA 3G6EQ 1YJNQ 1H1QB 4LN2A 1ZUKA 1D0XA 2E65A 1QP2A 3CCLT 1ZA1B 1MGQA 1GCQA 1TU0B 1QQJA 4RTUA 1JSUB 4A4FA 1ZBXA 2VUBA 1RLQC 5FROA 4CXAB 2DYBA 4OMNA 2P0PA 5GANj 3TNIB 2RD1A 3JB9G 5FU6C 4RTXA 1U1TA 3G6ET 4CFNB 2DEUA 5IAYA 3VS7A 1GCPA 1OPLA 4J5YA 3J81E 1Q81C 3MHXA 4E47A 5GMKe 3HTRA 2QG9B 4QVDA 1M3BA 2EQKA 4Q5WA 2IN3A 4BY1X 4J9HA 2PUKB 1M8VA 1E7PA 3I5RA 2JM8A 3TEEA 3QIIA 2E3HA 1IXDA 1M1FA 4J7FA 4KH0B 1H4LD 4E7JA 3EFOB 3JB9H 1YJ9T 4C92E 5FLXE 1VQNA 2YSQA 1IHWA 1BIAA 1QCNA 1M3AA 1GFDA 5LJ3d 3OW2A 4RTWA 2QA4Q 2LNVA 1PD1A 3GP8A 3LQ5B 4M77B 4XAXB 4V2SA 1VQ5Q 1HYOA 3EGDA 1N27A 3OSVA 1YFNA 2VV5A 1PHTA 4ELJA 4TTHA 5CYIB 1TS9A 3A1PA 3S3OA 4EC8B 2ENMA 4HCKA 2X51A 1R0BG 2LX9A 4Z89A 1D3BB 4LD9K 4CFMB 1SEMA 2KY9A 4NSTB 2QGGA 2O9SA 3HP9A 1IREB 3M57A 4C5GA 3CCMT 2COWA 2Y4YA 4OF1A 4EOOB 1O75A 1X6BA 4EIKA 2V8KA 1VYUA 4I3ZB 3M0TA 5CK9A 4CI0C 3JCMQ 3V7SA 4BD3A 2QDYB 4DBFA 3P8BB 1JXOA 2VB6A 2CH4A 1VQ5T 3EOCB 1SF9A 1RAEB 1VYVA 2V1QA 4PK4A 1QWFA 4RTTA 1VQ9A 4F04B 4QVCA 3JCMV 2EQJA 2H3EB 5GAMe 2DX1A 4F16A 1TXQA 1MNEA 2BZ8A 2FZCB 1YJWA 2EIFA 3C12A 4DOVA 1FVVB 1OX9A 1EX4A 2AZVA 3OYJA 1TH7A 2EUFA 4JRKA 1D3UB 3O8VA 4PFOA 3BLHB 3ZBDA 3K7AM 2DEQA 4G6LB 2L8DA 4YTLA 2C5OB 3DL1A 2HKQB 2OTLA 5HK0A 3SD4A 4AT1B 1XQHA 4E6RA 3JCMc 2XK0A 2R57A 2LJ0A 2JJ9A 3QWXX 4BCND 1I1JA 2DK3A 4KUDK 1HJDA 3RNJA 1UDLA 3IQLA 1K8AR 2DD5B 1IGUA 1VQ6A 5HBHB 1GXIE 2VGNA 1VQ4Q 1TSFA 1G8XA 3PFSA 2ED0A 3QDRB 2Z0WA 2CKKA 2KXDA 4C5HA 2FB7A 4ZGEB 3EHRA 5KYXA 3M54A 1PSFA 3BY7A 3JCMh 4EMHA 4JZ3A 3PNWC 4ELYC 3JV3A 3KFVA 3FLGA 1GH6B 1NYFA 4HCBA 1M4ZA 2ROLA 2JUFA 3URGA 5IN1A 4YOOA 2QQ9A 2W0ZA 1W98B 4GLMA 4M75F 1AT1B 2KR3A 4F7UG 1UGVA 2WJ9A 3PO3S 2QQRA 2KXCA 2B9RA 1YIJA 2DL4A 5LJ3f 1H641 3HRTA 3HBLA 2DO3A 4HA8A 1H28B 3BHUB 2PMIB 2AHJB 5KH6A 2J6OA 4FW1A 3MPUB 4M7AF 2CP6A 2RH2A 1H27B 1WFWA 3LGFA 1R0CB 4BI4A 4RODA 4A4EA 4A4GA 3H0FA 5CKFA 2KMGA 4EOLB 3C95A 4B9WA 2AT1B 2X35A 2E6ZA 2QGSA 3OS5A 4BUGA 4DBQA 2MWPA 4F7UA 3BDLA 2GFAA 1XO2A 2ZZDA 3QHWB 3S3MA 3A8LB 1PG5B 5D6YA 1QVFP 1O9KA 1T0JA 1JKWA 1M5Q1 2BKZB 2BE7D 4OB3B 4ATOA 4HT8A 1QMZB 4M77C 2DTOA 3CPWS 3QHRB 1FINB 1Y7XA 4JJDA 2FRYA 3CCJT 4IUVA 3HKSA 1E7OA 3NMZC 4NL2A 2IPOB 3HB9A 3OSSC 4EMKB 1X75C 4M7AD 5IHYA 4GY5A 1TG0A 1ACMB 3OYLA 2ZPHB 3G71A 1GRIA 2FPEA 4ESRA 2V1RA 1I0CA 4PLIA 3JCMP 2DXTA 2QTVA 1H26B 2WSCE 3UA6A 2J6KA 3EG9B 4XTVA 4XTYA 2DZCA 3VS4A 1YITQ 2LC4A 4QW2A 3I55T 3TVTA 4JRQA 4PNOA 3NTKA 4EDUA 1VQNQ 1NYGA 2CZ6B 5LJ5d 2EGEA 2A08A 3BW1A 2ATCB 4HCZA 1HSQA 1Y07A 1WHHA 2ZAEA 4FSSA 5DM7R 1SPKA 4JS4A 4PL6A 2BPMB 2DYIA 5FWCA 2FEIA 1R8OB 4AFZC 2WEVB 3QYEA 3VYGA 1M8MA 3B57A 2QYZA 5GANe 3C0CA 4LUEA 4JS5A 2DVJA 1VQ8Q 4F6UB 3M4YA 3TSWA 1VQ7Q 2OAWA 1AWOA 1ARKA 1YI2A 3JRZA 5GAOq 1X2KA 5ACBA 3S3NA 1D1AA 1UJYA 5M9OA 2VASA 1VQNT 5FGKB 2KNBB 3PVQA 4RTYA 3QYHB 4FYYB 2LJ1A 4EORB 2GF7A 2DBMA 3GF5A 1ZSZB 1JBMA 2RHUA 4CFUD 1H3ZA 3GLXA 2JTFA 3DKMA 1VQMA 3HFOA 2RHZA 1AISB 1YJWQ 2VVKA 4HL4A 3H6ZA 3EGXB 2GQIA 4J6XA 3MO8A 3MIAB 3CCLA 2DF6A 1Y71A 1M90R 2O2OA 4Y28E 5KYUA 1HD3A 1M1KC 4M4ZA 2O4XB 5GAN8 1MMGA 4BCGB 1KFZA 5GMKj 4XU0A 5GAOn 1MMDA 5LQFB 2DA9A 4EOSB 4WF2A 5L2WB 5GAN5 3CCST 4DOWA 1VQ9T 3RBBB 2G6FX 1M2VB 3VS3A 1M90U 4KRCB 5GAN7 4AFQC 1AHJB 4F6WB 3RKWA 1YJWT 4LOCA 4OMMA 2MYSA 2ROTA 1X2QA 1WZOA 4J9EA 3RDVA 2PZ1A 3VUZA 2UZBB 2QK0A 3PIPA 2AKKA 2OTLT 4II5B 3PE0A 2QEXQ 1OV3A 3TW6A 1CSKA 2OTJA 3TREA 3TQ7P 1NEBA 2KYMA 5LJ5f 2JNGA 1ZP2A 4EMKC 2QFZA 3VUBA 2I0NA 1ZUUA 5CQXA 3M56A 1VQ6T 4AKHA 4M77E 2JVVA 4N4IA 1RAIB 2DERA 1S72A 2XI9A 4Y72B 2BKDN 2EGAA 4BI8B 4MDXA 2JTMA 2JTEA 2X4WA 1H24B 1VYWB 3QXEB 2WXVB 3NGPA 3MP1A 2RMOA 3QJYA 4TVRA 2MI6A 1OL2B 4J9BA 2L2PA 1GUXB 1K9MR 1A0NB 5A0LA 4CC4B 2CP3A 4X34A 2EYXA 2P0QA 2XIDA 1FMVA 2HZYA 4BY7X 1YIJT 3INZA 5FWBA 2V26A 2HAXA 3CCMA 2WFYB 2L3PA 2R5AA 4RG8A 1PD0A 5EC7A 3SFMA 3CC4A 2DL8A 3PGGA 4M7AG 5EJCA 3RGFB 4ELLA 3WVDB 4QVZA 4R56A 1AEYA 2G9XB 4C5IA 4CC2A 3H0HA 3QZ5B 2UZEB 4XU2A 2RA2A 1N5ZA 3TNWB 3MP8A 2EQMA 3G71Q 4FYWB 3G7ZA 4KRDB 3QG1A 1RAGB 1N8RR 2KSSA 1BCMA 4JX4A 1H8KA 2DBKA 5GMKl 4M7AA 2CREA 4F14A 3L2VA 4LXCA 1SHFA 2ZPIB 1V29B 2GFUA 1ZSZC 5KE3A 5FRNA 3UATA 4FSXA 5DLOA 1DJ7B 2XMFA 3LW5E 2V8IA 1N8RU 2C0OA 2QQ8A 3GNFB 2EKHA 1P92A 4X1VA 2A28A 1W2BA 3A8GB 1UGRB 1MMNA 1H1SB 2F2CA 4IUQA 4F70B 2H8HA 3CXCA 1LPLA 2HSPA 5CVIA 2L5QA 2XDBA 4FYVB 4AKGA 5J26A 1YI2Q 3JB9I 3R6OA 4RTZA 1NEGA 1W2BS 1O9SA 3JCMg 1PKSA 2YRCA 5IF1B 3DB3A 3CXCS 1V76A 1OKWB 3CC2Q 3MI9B 2EYZA 2KAFA 3VRZA 3L2WA 2MWOA 2PVGB 3GPLA 1D1CA 3HRUA 2FPFA 4BY6B 3QDFA 3FRNA 2FYKA 2BS3A 2YLBA 4FIBA 1VQMQ 1LNXA 4JJNK 4XTXA 1VA7A 4AI6A 2E64A 1IB8A 2CSIA 1Q82R 3JCMJ 4KGXB 2LTOA 1T3LA 3T9NA 3CCLQ 3G4SA 3H9NA 1RAFB 2M16A 1T3SA 4RMOA 1QVGP 3RKYA 2W99A 2WMBB 1K76A 2M02A 4D8KA 1BK2A 4OVAA 3M0QA 1KG1A 1Q82U 1W1FA 1NPPA 2J06A 2D0QB 3EG0A 2ECZA 5EFQB 2R7GA 4HXJA 4IURA 4EOIB 5D6WA 2K5FA 2EWNA 3A8MB 3C94A 2RJCA 4F7JB 2F1LA 4L5GA 2KT8A 2P4TA 4QKUA 3VJPA 2AK5A 2RI5A 2DETA 1KQ2A 2K3XA 2VXEA 1KQSA 4M7AE 1OPKA 2X4XA 2COZA 1CKAA 4M77F 5GAOr 1JU5C 1RAAB 1ABOA 1IHVA 1V1CA 2LT1A 1WNLA 5I5ZB 5KE2A 2A0FB 2CJMB 4F7UB 1YJ9Q 2LQWA 3MP6A 1KQSS 2GCXA 3I55A 5ECAA 4FL6A 3PMIA 2W9FA 1KD1R 4P5NA 3NHNA 2R5MA 4VUBA 2ZPFB 2JN0A 3I9QA 4XTUA 2IW6B 1BI3A 2HL5C 2PK9B 5DQWA 4ME7A 1UNHD 1WXBA 1SKUB 5KYWB 3RMQA 2NUZA 5ICPB 4DEYA 3EGUA 2OTJT 7AT1B 3UWNA 2LNHB 3FIFA 4M7DB 3L1AA 1YCSB 3CCMQ 4UN0A 2KI7A 3CBPA 4M77D 8ATCB 2E70A 4PJOC 5HKCA 4BCMB 2KROA 5EG2A 1OZ3A 1S72T 3RERA 4B6MA 2RJEA 2XDDA 3RESA 3BLQB 5LL6S 1W4SA 5CEIB 3FB9A 2HL3A 1X27A 1F5QB 4MDWA 2VWFA 5CKEA 1I5OB 4HVVA 1NJIC 2RQUA 2KRMA 1KSWA 1I81A 4OMLA 1S1NA 4C8QB 1QCOA 2QTXA 3VRYA 2RO0A 1WA7A 3OYBA 2UZLB 4AFSC 3M55A 3CC4T 1TUCA 4QQ6A 5GAMd 4BY6C 2WSFE 2DJQA 1BU1A 3CBOA 1TWBA 4JDSA 1SHGA 4N0AC 3AHUA 2DILA 5BNJB 1VQPT 1RLPC 4MZTA 3CCSA 5J3BA 1BCOA 5DY9A 3BE3A 3F5XB 2GGRA 4EONB 4AKIA 2QQSA 3M0PA 2O9VA 2YUQA 2FPDA 2DXBA 2M0OA 1WJSA 4ZNXA 4BE1A 5LJ5h 4BXXX 4Z8AA 2OX7A 3QUIA 4JJCA 4XU3A 4L6V5 4Z6YA 5AT1B 3HRSA 2IIMA 4Z02A 3BHTB 4CFWB 2FRWA 1ZSGA 4LDXA 3GBQA 5KYYA 2E6NA 5GAOm 4E7LA 3VS1A 2K5LA 1URCB 1Q81R 2CUBA 3HZJA 1PWTA 1KC8R 1FWZA 2MMPA 3A8OB 4BI3A 3VS5A 2PTKA 2YHTA 1TD6A 1K8AU 1PNJA 1OOTA 3MCAB 2GTJA 1AD6A 2E4HA 3HHTB 3G4SQ 2UZDB 4OB2B 4OR5B 2D6FA 1U1SA 5CAIA 3JCMb 4F7SB 2E5QA 3FJPA 1D0ZA 2KVQG 4ZGDB 1E9HB 1Q81U 1UTIA 9ATCB 1KC8U 4FT2A 1FMKA 1Z9QA 2CCIB 3CCJQ 2LW4A 3V8JA 2LJ3A 3J80E 3X26B 2K9GA 2ZGWA 3CCVA 2NUPA 2E1HA 2LDMA 2JS2A 3CPWA 3JCMW 2RNAA 2VYTA 4M7DC 4NS5A 2RM4A 3G4ST 2CDTA 1YNZA 3LWIA 5IH2A 3MEVA 4BCQD 1YP5A 3LLRA 3MEWA 4O6JA 4Z88A 3DTOA 2CGHA 4QQGA 5GAMf 2F2WA 2ESWA 4LDUA 3CCET 2PNIA 2RHIA 2HCKA 2JW4A 1OGUB 3G1JA 2EBPA 1LVKA 2R58A 1KK7A 4YOZA 3I55Q 1JJ2A 3SEMA 2DE0X 3LH0A 5CO7A 3X24B 1QVGS 1RL2A 2EQUA 2KMTA 1ZX6A 2SRCA 5CIUA 1M90C 4PJOE 1WIEA 3EH1A 1H1RB 4QQDA 3M5AA 4C8QC 2FL7A 1X6OA 2D9TA 4J9IA 1JJ2S 3SWNB 1B7TA 1OU9A 2DLPA 1D0YA 1HK9A 4M77G 2KYBA 2XDPA 1JB0E 2RJFA 4BCHB 2D0NA 2D8JA 4QSHA 2E41A 4M75B 1P5EB 1TTHB 3MKDA 3OBWA 2J7IA 3EFOA 3BG9A 1Q86C 4NC6A 4FYXB 3QWLA 2YXYA 5GANd 4DBRA 2BUDA 1UJ0A 2EJFA 1SG5A 4PJNA 1AD5A 3RIRA 3LGLA 4M77A 2DMOA 1UHCA 1UE9A 3VKHA 1R77A 4LDWA 2EAYA 4Y91A 3OS0A 2K6DA 1NLOC 3JSCA 2BS4A 5L23A 1D3BA 4F7LB 4EMGA 3V8LA 1RACB 5A0DA 4RG2A 2I53A 3M0SA 2EYQA 1ZBJA 3QSUA 2IVWA 1X69A 5HK3A 2LP5A 2GQVA 4JLGA 1M3CA 3VS2A 3OYAA 1JO8A 3THKA 1IZ6A 3CCSQ 4F6SB 1FXXA 5GAN6 2M0YA 1VQ9Q 2NUTA 3SDZA 1E6HA 2C6TB 1UNLD 1PSEA 2VKNA 4NOYA 8AT1B 2K2MA 3KHIA 4C92B 2I40B 3CCUA 2LCSA 2PUOB 1QW1A 2DL3A 2K3BA 2XG8D 3H8ZA 3JCMe 1UNGD 4JZ4A 2QDJA 2OTLQ 3I56T 2M9UA 1VQLA 4BBSM 2HBPA 1YHQT 1B34B 4M78B 3TCJA 1N4MA 1SSHA 3CPFA 5IHNA 3OA6A 1N8RC 3CCQA 1GBRA 4KH1B 1I8FA 1VQ6Q 1RI9A 2OI3A 2DM1A 4C5EA 4JRPA 1RABB 2YUNA 2HMAA 5DQVA 3LH5A 2O88A 2IW8B 2LCLA 4FW2A 1MV3A 2C5NB 4OGRB 4EOMB 3OYMA 4F7NB 1N9RA 2LZ6B 1SRLA 2RN8A 3CBMA 1YWOA 3V7RA 1X01A 1LCKA 2XU8A 3U23A 1KIKA 3G33B 4MIMA 5LMKB 1BKBA 1MV0B 1YJNA 3ASKA 1ZUYA 1YIJQ 5CR2A 5GANf 2PQWA 4JLIA 4BCKB 2HNIA 2I2LA 2P0KA 3CMET 1M30A 4HT9A 4QT7A 4A4HA 2DTIA 2YDLA 4JRIA 1KHIA 2MPXC 5GAN4 2JMAA 3SWNC 1VQOT 4ZTJA 4ZGJB 4PKCC 1G3NC 3NTHA 4GLKA 4MZMA 2XKOC 4M75C 3M9QA 4HKEA 5I2SA 4M6VA 2F2XA 4C8QE 1M1GA 1JRIA 1MMAA 1WQWA 3OW2P 2LX7A 2ZCFB 3OMCA 4PJOF 3A5ZB 4OMQA 3X28B 1Y96A 1WDXA 1PM3A 3VKGA 2DXUA 4IIMA 1Q82C 4PFZA 1K9MU 3TSZA 2HD0A 4MFDA 3GTMS 1VQPA 3CCVT 4HNUA 3A8HB 5GJWB 1Q95G 2EJGA 2D1XA 4LNPA 4Y92A 1QVFA 2X3XD 3KUFA 3VV0A 4RTVA 5I22A 3OYGA 4IKFA 4J9GA 3EGDB 3EG9A 1ZHIA 2MOXA 1C1AA 2O31A 1QKXA 5CKBA 1M1KR 3A98A 1U06A 3DB4A 3OYIA 3M0RA 5FU6B 4B9XA 1QVFS 4PJOD 2EPDA 3OYCA 5LJ5g 2XICA 4C92C 3L2QA 4ROCA 1QLBA 4MFEA 3SB2A 2MCNA 3UA7A 4OB1B 1M1KU 5GAOp 3ER0A 4C0GA 2HEQA 4J6YA 2NLUA 2X1NB 2IVXA 3OYKA 4M78C 2JZ2A 2M51A 1SSFA 1U3OA 3EFRA 5IT9E 5LJ3h 1KJWA 4YOSA 2NWMA 2G3RA 3PT9A 3DLMA 5CQYA 2K5IA 1NM7A 1WXTA 4A63B 3M59A 1UEBA 2RQRA 1VQKT 4AG2C 2MK5A 2MF2A 2QDLA 4OMOA 1ZSZA 3FJ5A 2COYA 2DIQA 3TN8B 2OJ2A 2FHDA 4C0FA 4ANJA 2VGMA 2A36A 2LRQA 2GNCA 3M4GA 2BE9B 5GAMh 3EGXA 1K0SA 2PHGA 2QXFA 1GCQC 2C0IA 5HQ0B 1WJQA 4RCBA 1VQ4A 2A7YA 3PVLA 1QMCA 1LJOA 5KYXB 2O4XA 4WCIA 1VOMA 2XHCA 3CCEA 2CSQA 2ED1A 1PCXA 2CT3A 4ZN3A 5FRMA 3Q1JA 1G3WA 2JOYA 2WPAB 3OS2A 5IXFA 4OB0B 1IRXA 2RI3A 5HBEB 1PRLC 4HNVA 3I5SA 5I2MA 1WGSA 2QAZA 3I35A 4RKUE 3CCUT 2F2VA 1EIFA 4E7IA 1G2BA 4E7KA 4DA4A 3E9GA 2L3QA 2EYWA 3CCRA 3QWYA 2J6FA 2MAMA 3EG3A 6AT1B 1VQLT 1M27C 4EOQB 2OTJQ 4MMKA 3ZL7C 3CMAA 3O0GD 3REBB 1OIYB 1NBEB 4CC3A 1UGSB 5CKDA 1H92A 1FKMA 2LQ8A 3QYBA 1PC0A 3CCQT 2ZZDB 3DDPB 2QGFB 4EOPB 4PLLA 1KQ1A 2ZPEB 5GAOl 3BLRB 1S72Q 2G77A 4C8QF 1O9KB 2NYSA 2P4RA 1BI0A 2B8AA 3M0UA 5GMKm 1TFBA 3QBYA 1MNDA 4CRLB 4CRIA 4JJBA 3GIBA 1GFCA 2JGZB 2YLCA 1GUXA 3NDQA 1Q7YR 1K8AC 1H3HA 4M7DD 4YC3B 5LJ5j 4C0ZA 2DMEA 4F17A 1KD1U 2KDSA 1QVPA 1I07A 2DVEA 1K73R 1YJNT 1ZA2B 2LT4A 4BCMD 1J3TA 2KT1A 1WPYA 4OMPA 3V8KA 2DPPB 2FVUA 4BACA 1JOWA 1D09B 3E19A 1KC8C 2X4YA 3P8HA 3QHSA 3CC4Q 5D7UA 2E5KA 1Q7YU 2KRNA 1C9BA 4N4GA 4UC4A 4II1A 2CP7A 1VQPQ 1K73U 3META 2AIRB 1Y0MA 2MIOA 1YITA 4C8QD 4KT0E 1BBZA 3E9FA 2HSEB 3OYHA 2FO0A 1UUEA 2JS0A 4IIOA 3UT1A 4RCCA 1VOLA 2HDAA 2RQVA 3OYFA 3MEAA 3ME9A 4PJOG 3JCMX 2HQXA 4LD6A 1IGQA 2ABLA 2WIPB 4M78E 1BI1A 2Y90A 3VYGB 3I56A 3KXTA 1YHQA 3VKIA 5LJ3e 3VS6A 1VQ8A 4WTOB 3OW2S 2DKGA 2YT6A 2KEAA 3QZ9B 1F1BB 1VQ7A 1UB4A 4KBMB 4FX3B 2DXCA 1OX8A 1NLPC 1AOJA 3CC7A 1LOJA 3JB9J 2DD4A 2EYYA 1K0XA 5GAN3 2CUDA 1K4US 4PJOA 4BCOB 2B86A 3FC3A 4R55A 3REAB 4AG1C 2QA4T 3EIDB 4OGCA 4C0DB 1XNIA 3BG5A 1UECA 5GANh 1C6VX 3LX7A 5HNBB 1UHFA 2NUTB 3H0IA 4E7HA 2BZYA 2CZ0B 2RQWA 1ABQA 3L42A 3L2RA 3DDQB 3D7SB 2BS2A 3VU3C 2VC8A 2C5XB 2DL7A 3CMEA 2DAQA 3E2UA 2JXBA 4IMYB 5KYUB 1UGQB 5KCHA 3UF4A 5IXBA 2RI2A 1VQOA 2HBWA 2KE9A 4N0AA 4A54A 4KULA 3EH2A 4R0KA 1VYTA 1IO6A 3CEYA 1QP3A 4NL3A 2RHYA 3O5ZA 1QKWA 1NG2A 3OYEA 3CD6A 3PMTA 1EZZB 4BCNB 4X9CA 4DBHA 4BE0A 3DLLA 2K4YA 5A0GA 1KXUA 3CCEQ 3MY5B 3OMGA 1W6XA 2WACA 5GMKi 2C06A 1ZQ1A 4J9DA 5FU7B 1OI1A 2RPNA 3FEOA 3NFCA 2ZPGB 2L89A 4KRTA 5HBJB 5I11A 1NZ9A 3PTAA 2QEXA 4JX5A 2RK2A 2KK4A 5D6XA 2O01E 1NJIR 1G3SA 1TOVA 2YWWA 5IHIA 1H1PB 3CCRQ 1VQ4T 1QVGA 1YCYA 3GOXA 2KRSA 1I5LA 3TW7A 2L3SA 4FT4A 1RUWA 4BCJB 2E10A 3X25B 4XK8E 3CMAQ 2RK1A 1PKTA 2GBQA 5I21A 1JEGA 2EW3A 1NJIU 2L0AA 2KQWA 2A37A 3RUXA 4A53A 2RQTA 1HXDA 4BDZA 4M7DG 4HVUA 2W10A 1AVZC 2CZ7B 2PU9B 2WHBB 2A3LA 4E2FB 1Y96B 2DRMA 5C6SA 1I4K1 4MMLA 4BCQB 4M75D 1VUBA 4PJMA 4E7ZA 5KYWA 5FW9A 1WX6A 3CCRT 3H4CA 3NTIA 2EVRA 3R6NA 2X4JA 3E1SA 1E6GA 3CMAT 2KGTA 2X9HA 2JT4A 1OU8A 1UGPB 4M7DA 2FZGB 2D8HA 2DFUA 2JMCA 1G3YA 4ZTFA 1W2BP 4C92F 1TUGB 1GY3B 3EG2A 4E7SA 4C8QG 4AMCA 5LJ3g 1JXMA 2V22B 4M7AB 1FMWA 1VQKA 4D8DA 3CXCP 1BIBA 4GBQA 2V8JA 3HO8A 1N6AA 2OAUA 4C0DC 2YUOA 2DTHA 1RI0A 2HQHA 4M78F 3OYYA 3WVEB 3EG1A 2DRKA 1OULA 1Z9ZA 4J7IA 2W96A 1WHLA 2JM9A 4JUVA 1C0MA 1EFNA 4EOJB 3LYIA 5CCAA 1XJWB 2YRDA 4AFUC 4C8QA 1YWPA 1WHJA 1JQQA 1RAHB 4PFPA 3I56Q 5KCOA 2K79A 1K9MC 1YHQQ 1WI7A 5GAMg 2F5KA 5LJ5e 2EGCA 1T0HA 2EFIA 3NPFA 3OS1A 4CFVB 4RUGA 2LMJA 1G5VA 3MEUA 4IUTA 2F69A 4C92D 1AZEA 4J83A 3N5BB 1WXUA 3JCMd 1YITT 3CC7Q 4EC9B 1WHGA 4HNTA 3EAEA 3QPHA 3CQTA 4J9FA 2C4GB 2FG0A 3RMSA 4OGEA 3ZFJA 3CC2A 5J39A 4M78D 3LWHA 4K11A 2LQKA 4CC7A 1D1BA 1OEBA 5FU7C 2CCHB 3UDCA 4JX6A 2IG0A 5L8RE 2KBTA 2BZXA 4F7UE 1VQ8T 2PK2A 2SEMA 2M1HA 3F70A 4BE2A 2WSEE 2QQAA 1VQ7T 1FX7A 5CKHA 1OL1B 1X6GA 4CFUB 3MY1B 3OQ5A 3M03A 2AKLA 3DJBA 1AWWA 2DD5A 3CMEQ 2DL5A 2Y4XA 3CC7T 1KQSP 4BCFB 2PVDB 5AYFA 4PJJA 1VQOQ 1MHNA 3OB9A 2K7AA 3VYHB 4KGZB 4BBRM 1GL5A 4A4KA 2YUPA 5HY6A 3SHWA 1Y57A 1VIFA 2J05A 4FM4B 1NPRA 4J8OA 3CD6Q 1WLPB 2LQNA 3JB9F 4M7DE 4ROEA 1AZGB 4BB7A 2DJZA 1XOVA 3G6EA 1BU2A 1U5SA 3QJ6A 4XTWA 2RJDA 5A2QE 2EKOA 2VXFA 2H3JA 1Q86R 3X20B 3QO3A 1BYMA 1BI2A 2EJ9A 1OIUB 2LVMA 3CCVQ 1OI9B 4LDYA 3OY9A 1M9SA 2RHXA 3ZEHA 1YJ9A 3CD6T 1U8RA 5LJ3j 5GAN2 1Q86U 3C4SA 5HCKA 2CH4W 1H25B 3M53A 1NE8A 5GJVB 2CZ1B 1W70A 4LDVA 4M7AC 1UG1A 1OKVB 3S6WA 3HPWA 4PJLA 3JB9D 2IW9B 2W2HA 5IHKA 2DIGA 2DZ9A 2K3YA 4L59A 4J9CA 3JCMf 2QEXT 4M75G 4CFXB 2WMAB 2E12A 2CP5A 4KGVB 2CP2A 2CP0A 4KUIA 1YBYA 4EMKA 3WXMB 5GAMj 5IDNB 3HL8A 2RB6A 4BCIB 5C0MA 4X9DA 2GTOA 3RR6A 3SWNA 2ZPBB 5GMKh 2QA4A 2HKNA 4XQ3A 1OYXA 2PJQA 1PRMC 1VQ5A 1N9SA 4M75A 5IDPB 2QI2A 3P8DA 1WJRA 3H41A 3EFSA 1GBQA 1X43A 2QF7A 1FYNA 1G3TA 2BTTA 3PIOA 3HSBA 1KHCA 2QASA 5GANg 1PKDB 5DLQE 1OQKA 3JAME 4N4HA 1VQKQ 3L2UA 1OZ2A 3POMA 5HVYB 3BG3A 1AWXA 5KYNA 3BHVB 1WHMA 1ZLMA 1XTDA 1YN8A 3RKXA 1WQ7A 2EQIA 2PVOB 3TU4K 2KR6A 1RADB 1KD1C 1MUZA 2CS7A 4O5VA 3L2ZA 4DEXA 1AWJA 2DXCB 2LCCA 3OBYA 2XD0A 1CKBA 1UFFA 2DD4B 3DOGB 4XTZA 4EOKB 4C92G 3G71T 1B07A 4FCYA 4PJOB 2X3WD 2HQEA 3TNHB 1K9AA 3KBGA 3OYDA 2QQBA 4MZPA 1Q7YC 2K57A 3M58A 2DXBB 2YRVA
chains in the Genus database with same CATH topology
4KT0E 4D6WA 4LDUA 3HFNA 3CCET 2RHIA 3FDRA 3QYGB 4DQ2A 1K73C 3E9FA 3OYHA 1M90U 5GAN7 1AHJB 3RKWA 3UT1A 4LOCA 2R58A 4EPCA 1YJWT 4M78G 4RCCA 1JJ2A 3OYFA 3MEAA 3ME9A 3LH0A 5CO7A 2HQXA 4PJOG 3V7CA 3JCMX 4BDYA 3X24B 1QVGS 4IUPA 3VUZA 4HCCA 4LD6A 4OMFB 4F7UF 1RL2A 2EQUA 1BI1A 2KMTA 4M78E 5CIUA 1M90C 3PIPA 2Y90A 3BDUA 3VYGB 4PJOE 3I56A 2OTLT 4C92A 3J7AF 3KXTA 1YHQA 3VKIA 4QQDA 3M5AA 4C8QC 5LJ3e 1VQ8A 2FL7A 3OW2S 3TW6A 2DKGA 2OTJA 3TREA 1X6OA 3QZ9B 2D9TA 1JJ2S 3UPUA 1UB4A 1VQ7A 4KBMB 5LJ5f 3SWNB 2DXCA 2JNGA 3QKJA 1HK9A 4M77G 4EMKC 2QFZA 3CC7A 1LOJA 3VUBA 2DD4A 2XDPA 1B34A 1JB0E 2RJFA 4M78A 3JB9J 2L3RA 5CQXA 3M56A 5GAN3 1VQ6T 1YJNA 4PJOA 4AKHA 4QSHA 2E41A 4M75B 2JVVA 4M77E 4N4IA 4R55A 3FC3A 1S72A 1YI2T 2XI9A 3OBWA 2BKDN 4BI8B 4MDXA 2JTMA 2X4WA 3QXEB 3BG9A 2QA4T 3MP1A 1Q86C 4NC6A 3QWLA 4OGCA 3QJYA 4FU6A 4TVRA 1VIEA 1XNIA 2MI6A 4C0DB 2BUDA 3BG5A 5GANh 4M7DF 2BIVA 2EJFA 3OYNA 3LX7A 5A0LA 4X34A 4E7HA 2F5TX 2P0QA 4XU1A 3LGLA 2XIDA 3RIRA 3CC2T 2CZ0B 4HLQA 3L42A 4M77A 4IUUA 4OP0A 4ELZC 3GNGA 1YIJT 3VKHA 4J6WA 2K2VA 3INZA 4LDWA 2EAYA 4M75E 4Y91A 3OS0A 3L2RA 2BS2A 3VU3C 2VC8A 2HAXA 2CYZB 3CCJA 3CCMA 1VQMT 3CMEA 4ZN1A 2R5AA 3JSCA 4RG8A 3BFMA 2DAQA 2BS4A 1D3BA 3SFMA 3CC4A 1UGQB 3PGGA 5KCHA 5EJCA 4M7AG 2RI2A 2E65A 3V8LA 4EMGA 1QP2A 5A0DA 4RG2A 3WVDB 4QVZA 4R56A 1VQOA 4N0AA 4A54A 2EYQA 4KULA 4C5IA 1MGQA 3CCLT 3QSUA 3CEYA 1QP3A 4NL3A 2IVWA 2RHYA 5HK3A 3QZ5B 3OYEA 2GQVA 3CD6A 4JLGA 4XU2A 2RA2A 3MP8A 4A4FA 1ZBXA 2EQMA 3OYAA 3PMTA 1IZ6A 2VUBA 5FROA 4X9CA 3G7ZA 1FXXA 4BE0A 5GAN6 3QG1A 2P0PA 5GANj 3DLLA 3SDZA 2KSSA 1PSEA 4JX4A 2K4YA 2RD1A 5A0GA 5GMKl 3OMGA 3JB9G 4M7AA 2WACA 5GMKi 2C06A 5FU6C 1ZQ1A 4NOYA 1U1TA 5FU7B 3L2VA 3G6ET 1OI1A 3KHIA 3FEOA 3NFCA 2ZPIB 1V29B 2ZPGB 2GFUA 2L89A 4C92B 5KE3A 5FRNA 3CCUA 5IAYA 4FSXA 2PUOB 1NZ9A 1DJ7B 5DLOA 4J5YA 3J81E 3PTAA 1Q81C 2QEXA 1QW1A 3MHXA 4E47A 3LW5E 4JX5A 5GMKe 2V8IA 2XG8D 2RK2A 3H8ZA 4QVDA 3JCMe 4LD9K 2QDJA 2EQKA 4Q5WA 2KK4A 3I56T 2M9UA 1VQLA 1N8RU 5D6XA 4BBSM 2QQ8A 2HBPA 2O01E 1YHQT 2PUKB 1M8VA 3GNFB 1E7PA 1B34B 1P92A 4M78B 3TEEA 3TCJA 3QIIA 1G3SA 1W2BA 3A8GB 1UGRB 1M1FA 3CPFA 4J7FA 1QVGA 1VQ4T 3OA6A 1YCYA 3GOXA 4E7JA 3JB9H 1I5LA 1N8RC 3TW7A 3CCQA 1YJ9T 4FT4A 4C92E 5FLXE 4IUQA 1I8FA 3CXCA 1VQNA 2E10A 1BIAA 3X25B 4XK8E 2L5QA 5CVIA 2XDBA 4AKGA 5J26A 4C5EA 2RK1A 5LJ3d 3JB9I 4JRPA 3R6OA 3OW2A 5I21A 2LCLA 1W2BS 1O9SA 1NJIU 2LNVA 2KQWA 3GP8A 3JCMg 4M77B 4XAXB 4V2SA 3OYMA 3RUXA 4A53A 1HXDA 4BDZA 4M7DG 1N27A 3OSVA 1N9RA 2VV5A 3DB3A 2CZ7B 3CBMA 3CXCS 2PU9B 3V7RA 4ELJA 1X01A 2A3LA 3S3OA 1Y96B 2XU8A 2KAFA 2LX9A 4MIMA 1D3BB 1BKBA 2MWOA 1I4K1 2PVGB 3ASKA 5C6SA 4MMLA 3L2WA 5CR2A 5GANf 4M75D 1VUBA 3GPLA 3HRUA 4BY6B 2PQWA 3FRNA 2FYKA 4JLIA 3H4CA 3CCRT 2HNIA 2KY9A 2BS3A 2I2LA 2P0KA 2YLBA 3NTIA 3HP9A 4FIBA 1IREB 1LNXA 2X4JA 3E1SA 3M57A 4C5GA 3CCMT 2Y4YA 3CMET 4XTXA 4OF1A 4AI6A 4JJNK 1O75A 4HT9A 2E64A 4A4HA 2DTIA 4JRIA 3CMAT 1KHIA 3JCMJ 2V8KA 5CK9A 2LTOA 5GAN4 4CI0C 3SWNC 3JCMQ 1UGPB 1VQOT 4M7DA 4ZTJA 3T9NA 3V7SA 2QDYB 4BD3A 3G4SA 4ZGJB 3P8BB 4PKCC 1G3YA 4ZTFA 2M16A 4C92F 4RMOA 3NTHA 4GLKA 4MZMA 1VQ5T 3RKYA 4C8QG 2XKOC 4M75C 3M9QA 1VQ9A 4HKEA 5LJ3g 5I2SA 4M7AB 4QVCA 4M6VA 3JCMV 1VQKA 2EQJA 4OVAA 5GAMe 1BIBA 4C8QE 1M1GA 1KG1A 1JRIA 2V8JA 1Q82U 3HO8A 1N6AA 2OAUA 1WQWA 4C0DC 1YJWA 1NPPA 2EIFA 2D0QB 2DTHA 1RI0A 3C12A 4DOVA 4M78F 2ZCFB 3OMCA 3OYYA 3WVEB 3OYJA 1TH7A 4PJOF 3A5ZB 4JRKA 4IURA 3X28B 1Y96A 3O8VA 2K5FA 5D6WA 2EWNA 3VKGA 2DXUA 4J7IA 3ZBDA 3A8MB 2DEQA 2L8DA 3C94A 2RJCA 4YTLA 1Q82C 4JUVA 1K9MU 3DL1A 2HD0A 3LYIA 4L5GA 5CCAA 2OTLA 5HK0A 2P4TA 3SD4A 3VJPA 1XQHA 4MFDA 2RI5A 3JCMc 4C8QA 1KQ2A 2K3XA 2VXEA 2XK0A 1KQSA 4M7AE 1VQPA 2X4XA 2R57A 3CCVT 4HNUA 2DK3A 5KCOA 1K9MC 4KUDK 3A8HB 4M77F 5GAOr 5GAMg 2DD5B 2F5KA 5LJ5e 2EJGA 2EFIA 2LT1A 1WNLA 5KE2A 1VQ6A 1GXIE 3OS1A 2VGNA 1G5VA 3PFSA 3MEUA 4IUTA 2F69A 4C92D 4F7UB 1QVFA 3QDRB 3MP6A 2CKKA 3N5BB 2GCXA 4J83A 4C5HA 2FB7A 4ZGEB 3JCMd 3I55A 1YITT 3M54A 4FL6A 3KUFA 1PSFA 3BY7A 3PMIA 4HNTA 3EAEA 3QPHA 4P5NA 3JCMh 3VV0A 4EMHA 3OYGA 3PNWC 4ELYC 4IKFA 3FLGA 3RMSA 2R5MA 4OGEA 4HCBA 1M4ZA 1ZHIA 4VUBA 2JUFA 5CKBA 3URGA 3ZFJA 2ZPFB 3DB4A 2JN0A 4XTUA 3OYIA 5IN1A 1BI3A 3CC2A 2QQ9A 5J39A 4M75F 4M78D 4ME7A 5FU6B 3LWHA 4F7UG 4B9XA 2LQKA 2WJ9A 2QQRA 1QVFS 4PJOD 5FU7C 1YIJA 3UDCA 3OYCA 5LJ5g 2XICA 5LJ3f 4JX6A 1H641 2IG0A 3HRTA 5L8RE 3HBLA 2DO3A 3RMQA 4C92C 4HA8A 3L2QA 4F7UE 1VQ8T 2AHJB 5KH6A 1QLBA 2M1HA 2OTJT 3F70A 4BE2A 4MFEA 3SB2A 2WSEE 2QQAA 3UWNA 4OB1B 1VQ7T 1FX7A 5CKHA 1M1KU 4M7AF 2RH2A 5GAOp 3ER0A 3FIFA 3OQ5A 3LGFA 4M7DB 4BI4A 3L1AA 4C0GA 2DD5A 4A4EA 4A4GA 2Y4XA 3CC7T 3OYKA 4J6YA 2NLUA 5CKFA 2KMGA 3CBPA 3C95A 4M78C 2JZ2A 4M77D 2X35A 4B9WA 2E6ZA 2E70A 1SSFA 3OS5A 4BUGA 5HKCA 2PVDB 4PJOC 3EFRA 2MWPA 5EG2A 1OZ3A 5AYFA 1S72T 3RERA 5IT9E 2RJEA 5LJ3h 3BDLA 1MHNA 4F7UA 2XDDA 3RESA 2GFAA 3OB9A 5LL6S 2G3RA 2ZZDA 1W4SA 3PT9A 3VYHB 3DLMA 5CQYA 3S3MA 4BBRM 3A8LB 4A4KA 3FB9A 5D6YA 5HY6A 2K5IA 1VIFA 4FM4B 1NPRA 4J8OA 3M59A 1UEBA 4MDWA 1M5Q1 5CKEA 4ATOA 4OB3B 1VQKT 1NJIC 3JB9F 4M7DE 4HT8A 2MF2A 4BB7A 2DJZA 4M77C 1XOVA 2DTOA 3G6EA 3CPWS 3QJ6A 4XTWA 2RJDA 1I81A 5A2QE 2DIQA 2EKOA 1Y7XA 4C8QB 2QTXA 2VXFA 2RO0A 3CCJT 3OYBA 2H3JA 4IUVA 3HKSA 3X20B 2FHDA 3QO3A 4C0FA 1BYMA 4NL2A 2VGMA 2LRQA 3M55A 3CC4T 1BI2A 3M4GA 3HB9A 2EJ9A 4QQ6A 3M58A 3OSSC 5GAMd 4BY6C 2WSFE 4EMKB 5GAMh 1X75C 3CBOA 2LVMA 4JDSA 4M7AD 4GY5A 4N0AC 3AHUA 4LDYA 3OYLA 2ZPHB 3G71A 1VQPT 2QXFA 3OY9A 1WJQA 1M9SA 4MZTA 4RCBA 1VQ4A 3CCSA 2A7YA 2RHXA 4PLIA 5J3BA 3ZEHA 1YJ9A 1LJOA 5DY9A 3JCMP 3CD6T 2DXTA 2O4XA 1U8RA 5LJ3j 5GAN2 1Q86U 3C4SA 2XHCA 3CCEA 2WSCE 4AKIA 3M53A 4ZN3A 4XTVA 4XTYA 5FRMA 3Q1JA 1G3WA 2JOYA 2QQSA 2DZCA 3OS2A 1NE8A 2CZ1B 2LC4A 4QW2A 3I55T 4JRQA 2DXBA 4LDVA 4PNOA 3NTKA 4EDUA 5GAMf 4M7AC 2M0OA 4OB0B 3S6WA 1WJSA 3HPWA 2CZ6B 2RI3A 3JB9D 5LJ5d 4HNVA 4BE1A 5I2MA 1WGSA 5LJ5h 4RKUE 3QUIA 2DIGA 2DZ9A 3BW1A 3CCUT 4XU3A 4L6V5 2K3YA 4HCZA 4L59A 1Y07A 3JCMf 2QEXT 4M75G 4Z6YA 1EIFA 5DM7R 4E7IA 4E7KA 3HRSA 3E9GA 4DA4A 4JS4A 2E12A 4PL6A 4Z02A 1R8OB 3CCRA 3VYGA 3QYEA 2MAMA 1VQLT 5GANe 4JS5A 4KUIA 1YBYA 4EMKA 3WXMB 5GAMj 4LDXA 3HL8A 3M4YA 2RB6A 2E6NA 5GAOm 5C0MA 4MMKA 3CMAA 4E7LA 4X9DA 1YI2A 1UGSB 3JRZA 5CKDA 5GAOq 1FKMA 2LQ8A 3SWNA 2ZPBB 3QYBA 2K5LA 3CCQT 3S3NA 2ZZDB 5GMKh 2QA4A 4XQ3A 4PLLA 1OYXA 5M9OA 3HZJA 1KQ1A 2ZPEB 1VQNT 5GAOl 1VQ5A 1FWZA 1N9SA 3A8OB 2MMPA 4BI3A 2G77A 4M75A 4C8QF 3QYHB 2YHTA 5GANd 1K8AU 1BI0A 3MCAB 2GF7A 2B8AA 2QI2A 1WJRA 3HHTB 3P8DA 5GMKm 3EFSA 3QBYA 4OB2B 4CRIA 2QF7A 2D6FA 1G3TA 1U1SA 3GF5A 3PIOA 3GIBA 1KHCA 5CAIA 3HSBA 5GANg 3JCMb 5DLQE 2E5QA 1JBMA 2RHUA 2YLCA 3FJPA 3JAME 3GLXA 1H3ZA 1K8AC 1KQSS 2KVQG 4M7DD 4ZGDB 2JTFA 4N4HA 5LJ5j 3L2UA 1OZ2A 1Q81U 3DKMA 4C0ZA 1KD1U 1VQMA 2KDSA 3HFOA 1KC8U 1QVPA 2DVEA 2RHZA 4FT2A 3BG3A 1YJNT 2LT4A 4HL4A 1XTDA 3H6ZA 1WPYA 3V8KA 2DPPB 2FVUA 1WQ7A 3RKXA 4J6XA 2PVOB 4BACA 3E19A 3TU4K 2KR6A 3V8JA 3MO8A 3J80E 1KD1C 3CCLA 1KC8C 2X4YA 3X26B 1Y71A 2ZGWA 3CCVA 3P8HA 2CS7A 3QHSA 4O5VA 4Y28E 2E1HA 3L2ZA 1Q7YU 1M1KC 2DXCB 2LCCA 3OBYA 2LDMA 4N4GA 3CPWA 3JCMW 2XD0A 2O4XB 2VYTA 4UC4A 4M7DC 5GAN8 4II1A 4NS5A 2DD4B 2RM4A 3G4ST 4XTZA 5GMKj 4XU0A 4C92G 5GAOn 3G71T 3LWIA 1K73U 4PJOB 3META 2HQEA 3MEVA 3LLRA 3MEWA 3KBGA 4O6JA 4WF2A 5GAN5 3OYDA 2QQBA 4MZPA 3CCST 1Q7YC 2K57A 4DOWA 1VQ9T 2CGHA 4QQGA 1YITA 2DXBB 4C8QD 2YRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPI B;  1V29 B;  2ZPG B;  4KT0 E;  3QYG B;  2PUO B;  1DJ7 B;  1AHJ B;  3A8H B;  2WSC E;  3LW5 E;  2DD5 B;  3X24 B;  2CZ1 B;  1GXI E;  2O01 E;  2DXB A;  2PUK B;  3VYG B;  4OB0 B;  2CZ6 B;  3A8G B;  1UGR B;  4ZGE B;  1PSF A;  4RKU E;  3QZ9 B;  4L6V 5;  2DXC A;  2ZPF B;  3X25 B;  4XK8 E;  2DD4 A;  1JB0 E;  3VYG A;  5L8R E;  3QXE B;  1UGS B;  2AHJ B;  2CZ7 B;  2ZPB B;  2PU9 B;  2WSE E;  2ZZD B;  4OB1 B;  2ZPE B;  2PVG B;  3A8O B;  2DD5 A;  3QYH B;  2CZ0 B;  3HHT B;  2PVD B;  1IRE B;  4OB2 B;  2CYZ B;  2ZZD A;  3VYH B;  1UGP B;  4ZGD B;  3A8L B;  2QDY B;  1UGQ B;  4ZGJ B;  4FM4 B;  1QP2 A;  3WVD B;  4OB3 B;  2DPP B;  2PVO B;  1QP3 A;  3QZ5 B;  3X26 B;  4Y28 E;  2D0Q B;  2DXC B;  3X20 B;  2ZCF B;  3WVE B;  3X28 B;  2DD4 B;  2WSF E;  3A8M B;  1PSE A;  2ZPH B;  2DXB B; 
#chains in the Genus database with same CATH topology
 4D6W A;  1WYX A;  3HFN A;  3FDR A;  3QYG B;  4DQ2 A;  1K73 C;  4EPC A;  4M78 G;  4BDY A;  1QCF A;  3V7C A;  2C5V B;  4IUP A;  1BB9 A;  4HCC A;  1M2O A;  2UUE B;  4OMF B;  4F7U F;  3BDU A;  3CCU Q;  1ENW A;  1QWE A;  2AZS A;  4C92 A;  4LE9 A;  3J7A F;  1WHK A;  5KYY B;  4LUD A;  2WIH B;  3EJ1 B;  4ORZ A;  3UPU A;  1TUD A;  4JPB W;  1VQL Q;  2P84 A;  2RF0 A;  3QKJ A;  1JST B;  1B34 A;  4M78 A;  3ULR B;  2L3R A;  3AT1 B;  3EHQ A;  1YI2 T;  3CPW P;  3CCQ Q;  1M2V A;  4FU6 A;  1VIE A;  4M7D F;  2E3I A;  2BIV A;  3OYN A;  1VIN A;  1B3Q A;  2C0T A;  2CT4 A;  2F5T X;  2FZK B;  1SRM A;  4XU1 A;  3CC2 T;  4HLQ A;  4OP0 A;  4IUU A;  2DNU A;  4ELZ C;  3GNG A;  1G83 A;  4J6W A;  2K2V A;  3MJX A;  1JJ2 P;  4M75 E;  2W9Z A;  3VS0 A;  1K1Z A;  2CYZ B;  3CCJ A;  1VQM T;  4HVW A;  1QLY A;  4ZN1 A;  2NUP B;  4BCP B;  3BFM A;  3G6E Q;  1YJN Q;  1H1Q B;  4LN2 A;  1ZUK A;  1D0X A;  2E65 A;  1QP2 A;  3CCL T;  1ZA1 B;  1MGQ A;  1GCQ A;  1TU0 B;  1QQJ A;  4RTU A;  1JSU B;  4A4F A;  1ZBX A;  2VUB A;  1RLQ C;  5FRO A;  4CXA B;  2DYB A;  4OMN A;  2P0P A;  5GAN j;  3TNI B;  2RD1 A;  3JB9 G;  5FU6 C;  4RTX A;  1U1T A;  3G6E T;  4CFN B;  2DEU A;  5IAY A;  3VS7 A;  1GCP A;  1OPL A;  4J5Y A;  3J81 E;  1Q81 C;  3MHX A;  4E47 A;  5GMK e;  3HTR A;  2QG9 B;  4QVD A;  1M3B A;  2EQK A;  4Q5W A;  2IN3 A;  4BY1 X;  4J9H A;  2PUK B;  1M8V A;  1E7P A;  3I5R A;  2JM8 A;  3TEE A;  3QII A;  2E3H A;  1IXD A;  1M1F A;  4J7F A;  4KH0 B;  1H4L D;  4E7J A;  3EFO B;  3JB9 H;  1YJ9 T;  4C92 E;  5FLX E;  1VQN A;  2YSQ A;  1IHW A;  1BIA A;  1QCN A;  1M3A A;  1GFD A;  5LJ3 d;  3OW2 A;  4RTW A;  2QA4 Q;  2LNV A;  1PD1 A;  3GP8 A;  3LQ5 B;  4M77 B;  4XAX B;  4V2S A;  1VQ5 Q;  1HYO A;  3EGD A;  1N27 A;  3OSV A;  1YFN A;  2VV5 A;  1PHT A;  4ELJ A;  4TTH A;  5CYI B;  1TS9 A;  3A1P A;  3S3O A;  4EC8 B;  2ENM A;  4HCK A;  2X51 A;  1R0B G;  2LX9 A;  4Z89 A;  1D3B B;  4LD9 K;  4CFM B;  1SEM A;  2KY9 A;  4NST B;  2QGG A;  2O9S A;  3HP9 A;  1IRE B;  3M57 A;  4C5G A;  3CCM T;  2COW A;  2Y4Y A;  4OF1 A;  4EOO B;  1O75 A;  1X6B A;  4EIK A;  2V8K A;  1VYU A;  4I3Z B;  3M0T A;  5CK9 A;  4CI0 C;  3JCM Q;  3V7S A;  4BD3 A;  2QDY B;  4DBF A;  3P8B B;  1JXO A;  2VB6 A;  2CH4 A;  1VQ5 T;  3EOC B;  1SF9 A;  1RAE B;  1VYV A;  2V1Q A;  4PK4 A;  1QWF A;  4RTT A;  1VQ9 A;  4F04 B;  4QVC A;  3JCM V;  2EQJ A;  2H3E B;  5GAM e;  2DX1 A;  4F16 A;  1TXQ A;  1MNE A;  2BZ8 A;  2FZC B;  1YJW A;  2EIF A;  3C12 A;  4DOV A;  1FVV B;  1OX9 A;  1EX4 A;  2AZV A;  3OYJ A;  1TH7 A;  2EUF A;  4JRK A;  1D3U B;  3O8V A;  4PFO A;  3BLH B;  3ZBD A;  3K7A M;  2DEQ A;  4G6L B;  2L8D A;  4YTL A;  2C5O B;  3DL1 A;  2HKQ B;  2OTL A;  5HK0 A;  3SD4 A;  4AT1 B;  1XQH A;  4E6R A;  3JCM c;  2XK0 A;  2R57 A;  2LJ0 A;  2JJ9 A;  3QWX X;  4BCN D;  1I1J A;  2DK3 A;  4KUD K;  1HJD A;  3RNJ A;  1UDL A;  3IQL A;  1K8A R;  2DD5 B;  1IGU A;  1VQ6 A;  5HBH B;  1GXI E;  2VGN A;  1VQ4 Q;  1TSF A;  1G8X A;  3PFS A;  2ED0 A;  3QDR B;  2Z0W A;  2CKK A;  2KXD A;  4C5H A;  2FB7 A;  4ZGE B;  3EHR A;  5KYX A;  3M54 A;  1PSF A;  3BY7 A;  3JCM h;  4EMH A;  4JZ3 A;  3PNW C;  4ELY C;  3JV3 A;  3KFV A;  3FLG A;  1GH6 B;  1NYF A;  4HCB A;  1M4Z A;  2ROL A;  2JUF A;  3URG A;  5IN1 A;  4YOO A;  2QQ9 A;  2W0Z A;  1W98 B;  4GLM A;  4M75 F;  1AT1 B;  2KR3 A;  4F7U G;  1UGV A;  2WJ9 A;  3PO3 S;  2QQR A;  2KXC A;  2B9R A;  1YIJ A;  2DL4 A;  5LJ3 f;  1H64 1;  3HRT A;  3HBL A;  2DO3 A;  4HA8 A;  1H28 B;  3BHU B;  2PMI B;  2AHJ B;  5KH6 A;  2J6O A;  4FW1 A;  3MPU B;  4M7A F;  2CP6 A;  2RH2 A;  1H27 B;  1WFW A;  3LGF A;  1R0C B;  4BI4 A;  4ROD A;  4A4E A;  4A4G A;  3H0F A;  5CKF A;  2KMG A;  4EOL B;  3C95 A;  4B9W A;  2AT1 B;  2X35 A;  2E6Z A;  2QGS A;  3OS5 A;  4BUG A;  4DBQ A;  2MWP A;  4F7U A;  3BDL A;  2GFA A;  1XO2 A;  2ZZD A;  3QHW B;  3S3M A;  3A8L B;  1PG5 B;  5D6Y A;  1QVF P;  1O9K A;  1T0J A;  1JKW A;  1M5Q 1;  2BKZ B;  2BE7 D;  4OB3 B;  4ATO A;  4HT8 A;  1QMZ B;  4M77 C;  2DTO A;  3CPW S;  3QHR B;  1FIN B;  1Y7X A;  4JJD A;  2FRY A;  3CCJ T;  4IUV A;  3HKS A;  1E7O A;  3NMZ C;  4NL2 A;  2IPO B;  3HB9 A;  3OSS C;  4EMK B;  1X75 C;  4M7A D;  5IHY A;  4GY5 A;  1TG0 A;  1ACM B;  3OYL A;  2ZPH B;  3G71 A;  1GRI A;  2FPE A;  4ESR A;  2V1R A;  1I0C A;  4PLI A;  3JCM P;  2DXT A;  2QTV A;  1H26 B;  2WSC E;  3UA6 A;  2J6K A;  3EG9 B;  4XTV A;  4XTY A;  2DZC A;  3VS4 A;  1YIT Q;  2LC4 A;  4QW2 A;  3I55 T;  3TVT A;  4JRQ A;  4PNO A;  3NTK A;  4EDU A;  1VQN Q;  1NYG A;  2CZ6 B;  5LJ5 d;  2EGE A;  2A08 A;  3BW1 A;  2ATC B;  4HCZ A;  1HSQ A;  1Y07 A;  1WHH A;  2ZAE A;  4FSS A;  5DM7 R;  1SPK A;  4JS4 A;  4PL6 A;  2BPM B;  2DYI A;  5FWC A;  2FEI A;  1R8O B;  4AFZ C;  2WEV B;  3QYE A;  3VYG A;  1M8M A;  3B57 A;  2QYZ A;  5GAN e;  3C0C A;  4LUE A;  4JS5 A;  2DVJ A;  1VQ8 Q;  4F6U B;  3M4Y A;  3TSW A;  1VQ7 Q;  2OAW A;  1AWO A;  1ARK A;  1YI2 A;  3JRZ A;  5GAO q;  1X2K A;  5ACB A;  3S3N A;  1D1A A;  1UJY A;  5M9O A;  2VAS A;  1VQN T;  5FGK B;  2KNB B;  3PVQ A;  4RTY A;  3QYH B;  4FYY B;  2LJ1 A;  4EOR B;  2GF7 A;  2DBM A;  3GF5 A;  1ZSZ B;  1JBM A;  2RHU A;  4CFU D;  1H3Z A;  3GLX A;  2JTF A;  3DKM A;  1VQM A;  3HFO A;  2RHZ A;  1AIS B;  1YJW Q;  2VVK A;  4HL4 A;  3H6Z A;  3EGX B;  2GQI A;  4J6X A;  3MO8 A;  3MIA B;  3CCL A;  2DF6 A;  1Y71 A;  1M90 R;  2O2O A;  4Y28 E;  5KYU A;  1HD3 A;  1M1K C;  4M4Z A;  2O4X B;  5GAN 8;  1MMG A;  4BCG B;  1KFZ A;  5GMK j;  4XU0 A;  5GAO n;  1MMD A;  5LQF B;  2DA9 A;  4EOS B;  4WF2 A;  5L2W B;  5GAN 5;  3CCS T;  4DOW A;  1VQ9 T;  3RBB B;  2G6F X;  1M2V B;  3VS3 A;  1M90 U;  4KRC B;  5GAN 7;  4AFQ C;  1AHJ B;  4F6W B;  3RKW A;  1YJW T;  4LOC A;  4OMM A;  2MYS A;  2ROT A;  1X2Q A;  1WZO A;  4J9E A;  3RDV A;  2PZ1 A;  3VUZ A;  2UZB B;  2QK0 A;  3PIP A;  2AKK A;  2OTL T;  4II5 B;  3PE0 A;  2QEX Q;  1OV3 A;  3TW6 A;  1CSK A;  2OTJ A;  3TRE A;  3TQ7 P;  1NEB A;  2KYM A;  5LJ5 f;  2JNG A;  1ZP2 A;  4EMK C;  2QFZ A;  3VUB A;  2I0N A;  1ZUU A;  5CQX A;  3M56 A;  1VQ6 T;  4AKH A;  4M77 E;  2JVV A;  4N4I A;  1RAI B;  2DER A;  1S72 A;  2XI9 A;  4Y72 B;  2BKD N;  2EGA A;  4BI8 B;  4MDX A;  2JTM A;  2JTE A;  2X4W A;  1H24 B;  1VYW B;  3QXE B;  2WXV B;  3NGP A;  3MP1 A;  2RMO A;  3QJY A;  4TVR A;  2MI6 A;  1OL2 B;  4J9B A;  2L2P A;  1GUX B;  1K9M R;  1A0N B;  5A0L A;  4CC4 B;  2CP3 A;  4X34 A;  2EYX A;  2P0Q A;  2XID A;  1FMV A;  2HZY A;  4BY7 X;  1YIJ T;  3INZ A;  5FWB A;  2V26 A;  2HAX A;  3CCM A;  2WFY B;  2L3P A;  2R5A A;  4RG8 A;  1PD0 A;  5EC7 A;  3SFM A;  3CC4 A;  2DL8 A;  3PGG A;  4M7A G;  5EJC A;  3RGF B;  4ELL A;  3WVD B;  4QVZ A;  4R56 A;  1AEY A;  2G9X B;  4C5I A;  4CC2 A;  3H0H A;  3QZ5 B;  2UZE B;  4XU2 A;  2RA2 A;  1N5Z A;  3TNW B;  3MP8 A;  2EQM A;  3G71 Q;  4FYW B;  3G7Z A;  4KRD B;  3QG1 A;  1RAG B;  1N8R R;  2KSS A;  1BCM A;  4JX4 A;  1H8K A;  2DBK A;  5GMK l;  4M7A A;  2CRE A;  4F14 A;  3L2V A;  4LXC A;  1SHF A;  2ZPI B;  1V29 B;  2GFU A;  1ZSZ C;  5KE3 A;  5FRN A;  3UAT A;  4FSX A;  5DLO A;  1DJ7 B;  2XMF A;  3LW5 E;  2V8I A;  1N8R U;  2C0O A;  2QQ8 A;  3GNF B;  2EKH A;  1P92 A;  4X1V A;  2A28 A;  1W2B A;  3A8G B;  1UGR B;  1MMN A;  1H1S B;  2F2C A;  4IUQ A;  4F70 B;  2H8H A;  3CXC A;  1LPL A;  2HSP A;  5CVI A;  2L5Q A;  2XDB A;  4FYV B;  4AKG A;  5J26 A;  1YI2 Q;  3JB9 I;  3R6O A;  4RTZ A;  1NEG A;  1W2B S;  1O9S A;  3JCM g;  1PKS A;  2YRC A;  5IF1 B;  3DB3 A;  3CXC S;  1V76 A;  1OKW B;  3CC2 Q;  3MI9 B;  2EYZ A;  2KAF A;  3VRZ A;  3L2W A;  2MWO A;  2PVG B;  3GPL A;  1D1C A;  3HRU A;  2FPF A;  4BY6 B;  3QDF A;  3FRN A;  2FYK A;  2BS3 A;  2YLB A;  4FIB A;  1VQM Q;  1LNX A;  4JJN K;  4XTX A;  1VA7 A;  4AI6 A;  2E64 A;  1IB8 A;  2CSI A;  1Q82 R;  3JCM J;  4KGX B;  2LTO A;  1T3L A;  3T9N A;  3CCL Q;  3G4S A;  3H9N A;  1RAF B;  2M16 A;  1T3S A;  4RMO A;  1QVG P;  3RKY A;  2W99 A;  2WMB B;  1K76 A;  2M02 A;  4D8K A;  1BK2 A;  4OVA A;  3M0Q A;  1KG1 A;  1Q82 U;  1W1F A;  1NPP A;  2J06 A;  2D0Q B;  3EG0 A;  2ECZ A;  5EFQ B;  2R7G A;  4HXJ A;  4IUR A;  4EOI B;  5D6W A;  2K5F A;  2EWN A;  3A8M B;  3C94 A;  2RJC A;  4F7J B;  2F1L A;  4L5G A;  2KT8 A;  2P4T A;  4QKU A;  3VJP A;  2AK5 A;  2RI5 A;  2DET A;  1KQ2 A;  2K3X A;  2VXE A;  1KQS A;  4M7A E;  1OPK A;  2X4X A;  2COZ A;  1CKA A;  4M77 F;  5GAO r;  1JU5 C;  1RAA B;  1ABO A;  1IHV A;  1V1C A;  2LT1 A;  1WNL A;  5I5Z B;  5KE2 A;  2A0F B;  2CJM B;  4F7U B;  1YJ9 Q;  2LQW A;  3MP6 A;  1KQS S;  2GCX A;  3I55 A;  5ECA A;  4FL6 A;  3PMI A;  2W9F A;  1KD1 R;  4P5N A;  3NHN A;  2R5M A;  4VUB A;  2ZPF B;  2JN0 A;  3I9Q A;  4XTU A;  2IW6 B;  1BI3 A;  2HL5 C;  2PK9 B;  5DQW A;  4ME7 A;  1UNH D;  1WXB A;  1SKU B;  5KYW B;  3RMQ A;  2NUZ A;  5ICP B;  4DEY A;  3EGU A;  2OTJ T;  7AT1 B;  3UWN A;  2LNH B;  3FIF A;  4M7D B;  3L1A A;  1YCS B;  3CCM Q;  4UN0 A;  2KI7 A;  3CBP A;  4M77 D;  8ATC B;  2E70 A;  4PJO C;  5HKC A;  4BCM B;  2KRO A;  5EG2 A;  1OZ3 A;  1S72 T;  3RER A;  4B6M A;  2RJE A;  2XDD A;  3RES A;  3BLQ B;  5LL6 S;  1W4S A;  5CEI B;  3FB9 A;  2HL3 A;  1X27 A;  1F5Q B;  4MDW A;  2VWF A;  5CKE A;  1I5O B;  4HVV A;  1NJI C;  2RQU A;  2KRM A;  1KSW A;  1I81 A;  4OML A;  1S1N A;  4C8Q B;  1QCO A;  2QTX A;  3VRY A;  2RO0 A;  1WA7 A;  3OYB A;  2UZL B;  4AFS C;  3M55 A;  3CC4 T;  1TUC A;  4QQ6 A;  5GAM d;  4BY6 C;  2WSF E;  2DJQ A;  1BU1 A;  3CBO A;  1TWB A;  4JDS A;  1SHG A;  4N0A C;  3AHU A;  2DIL A;  5BNJ B;  1VQP T;  1RLP C;  4MZT A;  3CCS A;  5J3B A;  1BCO A;  5DY9 A;  3BE3 A;  3F5X B;  2GGR A;  4EON B;  4AKI A;  2QQS A;  3M0P A;  2O9V A;  2YUQ A;  2FPD A;  2DXB A;  2M0O A;  1WJS A;  4ZNX A;  4BE1 A;  5LJ5 h;  4BXX X;  4Z8A A;  2OX7 A;  3QUI A;  4JJC A;  4XU3 A;  4L6V 5;  4Z6Y A;  5AT1 B;  3HRS A;  2IIM A;  4Z02 A;  3BHT B;  4CFW B;  2FRW A;  1ZSG A;  4LDX A;  3GBQ A;  5KYY A;  2E6N A;  5GAO m;  4E7L A;  3VS1 A;  2K5L A;  1URC B;  1Q81 R;  2CUB A;  3HZJ A;  1PWT A;  1KC8 R;  1FWZ A;  2MMP A;  3A8O B;  4BI3 A;  3VS5 A;  2PTK A;  2YHT A;  1TD6 A;  1K8A U;  1PNJ A;  1OOT A;  3MCA B;  2GTJ A;  1AD6 A;  2E4H A;  3HHT B;  3G4S Q;  2UZD B;  4OB2 B;  4OR5 B;  2D6F A;  1U1S A;  5CAI A;  3JCM b;  4F7S B;  2E5Q A;  3FJP A;  1D0Z A;  2KVQ G;  4ZGD B;  1E9H B;  1Q81 U;  1UTI A;  9ATC B;  1KC8 U;  4FT2 A;  1FMK A;  1Z9Q A;  2CCI B;  3CCJ Q;  2LW4 A;  3V8J A;  2LJ3 A;  3J80 E;  3X26 B;  2K9G A;  2ZGW A;  3CCV A;  2NUP A;  2E1H A;  2LDM A;  2JS2 A;  3CPW A;  3JCM W;  2RNA A;  2VYT A;  4M7D C;  4NS5 A;  2RM4 A;  3G4S T;  2CDT A;  1YNZ A;  3LWI A;  5IH2 A;  3MEV A;  4BCQ D;  1YP5 A;  3LLR A;  3MEW A;  4O6J A;  4Z88 A;  3DTO A;  2CGH A;  4QQG A;  5GAM f;  2F2W A;  2ESW A;  4LDU A;  3CCE T;  2PNI A;  2RHI A;  2HCK A;  2JW4 A;  1OGU B;  3G1J A;  2EBP A;  1LVK A;  2R58 A;  1KK7 A;  4YOZ A;  3I55 Q;  1JJ2 A;  3SEM A;  2DE0 X;  3LH0 A;  5CO7 A;  3X24 B;  1QVG S;  1RL2 A;  2EQU A;  2KMT A;  1ZX6 A;  2SRC A;  5CIU A;  1M90 C;  4PJO E;  1WIE A;  3EH1 A;  1H1R B;  4QQD A;  3M5A A;  4C8Q C;  2FL7 A;  1X6O A;  2D9T A;  4J9I A;  1JJ2 S;  3SWN B;  1B7T A;  1OU9 A;  2DLP A;  1D0Y A;  1HK9 A;  4M77 G;  2KYB A;  2XDP A;  1JB0 E;  2RJF A;  4BCH B;  2D0N A;  2D8J A;  4QSH A;  2E41 A;  4M75 B;  1P5E B;  1TTH B;  3MKD A;  3OBW A;  2J7I A;  3EFO A;  3BG9 A;  1Q86 C;  4NC6 A;  4FYX B;  3QWL A;  2YXY A;  5GAN d;  4DBR A;  2BUD A;  1UJ0 A;  2EJF A;  1SG5 A;  4PJN A;  1AD5 A;  3RIR A;  3LGL A;  4M77 A;  2DMO A;  1UHC A;  1UE9 A;  3VKH A;  1R77 A;  4LDW A;  2EAY A;  4Y91 A;  3OS0 A;  2K6D A;  1NLO C;  3JSC A;  2BS4 A;  5L23 A;  1D3B A;  4F7L B;  4EMG A;  3V8L A;  1RAC B;  5A0D A;  4RG2 A;  2I53 A;  3M0S A;  2EYQ A;  1ZBJ A;  3QSU A;  2IVW A;  1X69 A;  5HK3 A;  2LP5 A;  2GQV A;  4JLG A;  1M3C A;  3VS2 A;  3OYA A;  1JO8 A;  3THK A;  1IZ6 A;  3CCS Q;  4F6S B;  1FXX A;  5GAN 6;  2M0Y A;  1VQ9 Q;  2NUT A;  3SDZ A;  1E6H A;  2C6T B;  1UNL D;  1PSE A;  2VKN A;  4NOY A;  8AT1 B;  2K2M A;  3KHI A;  4C92 B;  2I40 B;  3CCU A;  2LCS A;  2PUO B;  1QW1 A;  2DL3 A;  2K3B A;  2XG8 D;  3H8Z A;  3JCM e;  1UNG D;  4JZ4 A;  2QDJ A;  2OTL Q;  3I56 T;  2M9U A;  1VQL A;  4BBS M;  2HBP A;  1YHQ T;  1B34 B;  4M78 B;  3TCJ A;  1N4M A;  1SSH A;  3CPF A;  5IHN A;  3OA6 A;  1N8R C;  3CCQ A;  1GBR A;  4KH1 B;  1I8F A;  1VQ6 Q;  1RI9 A;  2OI3 A;  2DM1 A;  4C5E A;  4JRP A;  1RAB B;  2YUN A;  2HMA A;  5DQV A;  3LH5 A;  2O88 A;  2IW8 B;  2LCL A;  4FW2 A;  1MV3 A;  2C5N B;  4OGR B;  4EOM B;  3OYM A;  4F7N B;  1N9R A;  2LZ6 B;  1SRL A;  2RN8 A;  3CBM A;  1YWO A;  3V7R A;  1X01 A;  1LCK A;  2XU8 A;  3U23 A;  1KIK A;  3G33 B;  4MIM A;  5LMK B;  1BKB A;  1MV0 B;  1YJN A;  3ASK A;  1ZUY A;  1YIJ Q;  5CR2 A;  5GAN f;  2PQW A;  4JLI A;  4BCK B;  2HNI A;  2I2L A;  2P0K A;  3CME T;  1M30 A;  4HT9 A;  4QT7 A;  4A4H A;  2DTI A;  2YDL A;  4JRI A;  1KHI A;  2MPX C;  5GAN 4;  2JMA A;  3SWN C;  1VQO T;  4ZTJ A;  4ZGJ B;  4PKC C;  1G3N C;  3NTH A;  4GLK A;  4MZM A;  2XKO C;  4M75 C;  3M9Q A;  4HKE A;  5I2S A;  4M6V A;  2F2X A;  4C8Q E;  1M1G A;  1JRI A;  1MMA A;  1WQW A;  3OW2 P;  2LX7 A;  2ZCF B;  3OMC A;  4PJO F;  3A5Z B;  4OMQ A;  3X28 B;  1Y96 A;  1WDX A;  1PM3 A;  3VKG A;  2DXU A;  4IIM A;  1Q82 C;  4PFZ A;  1K9M U;  3TSZ A;  2HD0 A;  4MFD A;  3GTM S;  1VQP A;  3CCV T;  4HNU A;  3A8H B;  5GJW B;  1Q95 G;  2EJG A;  2D1X A;  4LNP A;  4Y92 A;  1QVF A;  2X3X D;  3KUF A;  3VV0 A;  4RTV A;  5I22 A;  3OYG A;  4IKF A;  4J9G A;  3EGD B;  3EG9 A;  1ZHI A;  2MOX A;  1C1A A;  2O31 A;  1QKX A;  5CKB A;  1M1K R;  3A98 A;  1U06 A;  3DB4 A;  3OYI A;  3M0R A;  5FU6 B;  4B9X A;  1QVF S;  4PJO D;  2EPD A;  3OYC A;  5LJ5 g;  2XIC A;  4C92 C;  3L2Q A;  4ROC A;  1QLB A;  4MFE A;  3SB2 A;  2MCN A;  3UA7 A;  4OB1 B;  1M1K U;  5GAO p;  3ER0 A;  4C0G A;  2HEQ A;  4J6Y A;  2NLU A;  2X1N B;  2IVX A;  3OYK A;  4M78 C;  2JZ2 A;  2M51 A;  1SSF A;  1U3O A;  3EFR A;  5IT9 E;  5LJ3 h;  1KJW A;  4YOS A;  2NWM A;  2G3R A;  3PT9 A;  3DLM A;  5CQY A;  2K5I A;  1NM7 A;  1WXT A;  4A63 B;  3M59 A;  1UEB A;  2RQR A;  1VQK T;  4AG2 C;  2MK5 A;  2MF2 A;  2QDL A;  4OMO A;  1ZSZ A;  3FJ5 A;  2COY A;  2DIQ A;  3TN8 B;  2OJ2 A;  2FHD A;  4C0F A;  4ANJ A;  2VGM A;  2A36 A;  2LRQ A;  2GNC A;  3M4G A;  2BE9 B;  5GAM h;  3EGX A;  1K0S A;  2PHG A;  2QXF A;  1GCQ C;  2C0I A;  5HQ0 B;  1WJQ A;  4RCB A;  1VQ4 A;  2A7Y A;  3PVL A;  1QMC A;  1LJO A;  5KYX B;  2O4X A;  4WCI A;  1VOM A;  2XHC A;  3CCE A;  2CSQ A;  2ED1 A;  1PCX A;  2CT3 A;  4ZN3 A;  5FRM A;  3Q1J A;  1G3W A;  2JOY A;  2WPA B;  3OS2 A;  5IXF A;  4OB0 B;  1IRX A;  2RI3 A;  5HBE B;  1PRL C;  4HNV A;  3I5S A;  5I2M A;  1WGS A;  2QAZ A;  3I35 A;  4RKU E;  3CCU T;  2F2V A;  1EIF A;  4E7I A;  1G2B A;  4E7K A;  4DA4 A;  3E9G A;  2L3Q A;  2EYW A;  3CCR A;  3QWY A;  2J6F A;  2MAM A;  3EG3 A;  6AT1 B;  1VQL T;  1M27 C;  4EOQ B;  2OTJ Q;  4MMK A;  3ZL7 C;  3CMA A;  3O0G D;  3REB B;  1OIY B;  1NBE B;  4CC3 A;  1UGS B;  5CKD A;  1H92 A;  1FKM A;  2LQ8 A;  3QYB A;  1PC0 A;  3CCQ T;  2ZZD B;  3DDP B;  2QGF B;  4EOP B;  4PLL A;  1KQ1 A;  2ZPE B;  5GAO l;  3BLR B;  1S72 Q;  2G77 A;  4C8Q F;  1O9K B;  2NYS A;  2P4R A;  1BI0 A;  2B8A A;  3M0U A;  5GMK m;  1TFB A;  3QBY A;  1MND A;  4CRL B;  4CRI A;  4JJB A;  3GIB A;  1GFC A;  2JGZ B;  2YLC A;  1GUX A;  3NDQ A;  1Q7Y R;  1K8A C;  1H3H A;  4M7D D;  4YC3 B;  5LJ5 j;  4C0Z A;  2DME A;  4F17 A;  1KD1 U;  2KDS A;  1QVP A;  1I07 A;  2DVE A;  1K73 R;  1YJN T;  1ZA2 B;  2LT4 A;  4BCM D;  1J3T A;  2KT1 A;  1WPY A;  4OMP A;  3V8K A;  2DPP B;  2FVU A;  4BAC A;  1JOW A;  1D09 B;  3E19 A;  1KC8 C;  2X4Y A;  3P8H A;  3QHS A;  3CC4 Q;  5D7U A;  2E5K A;  1Q7Y U;  2KRN A;  1C9B A;  4N4G A;  4UC4 A;  4II1 A;  2CP7 A;  1VQP Q;  1K73 U;  3MET A;  2AIR B;  1Y0M A;  2MIO A;  1YIT A;  4C8Q D;  4KT0 E;  1BBZ A;  3E9F A;  2HSE B;  3OYH A;  2FO0 A;  1UUE A;  2JS0 A;  4IIO A;  3UT1 A;  4RCC A;  1VOL A;  2HDA A;  2RQV A;  3OYF A;  3MEA A;  3ME9 A;  4PJO G;  3JCM X;  2HQX A;  4LD6 A;  1IGQ A;  2ABL A;  2WIP B;  4M78 E;  1BI1 A;  2Y90 A;  3VYG B;  3I56 A;  3KXT A;  1YHQ A;  3VKI A;  5LJ3 e;  3VS6 A;  1VQ8 A;  4WTO B;  3OW2 S;  2DKG A;  2YT6 A;  2KEA A;  3QZ9 B;  1F1B B;  1VQ7 A;  1UB4 A;  4KBM B;  4FX3 B;  2DXC A;  1OX8 A;  1NLP C;  1AOJ A;  3CC7 A;  1LOJ A;  3JB9 J;  2DD4 A;  2EYY A;  1K0X A;  5GAN 3;  2CUD A;  1K4U S;  4PJO A;  4BCO B;  2B86 A;  3FC3 A;  4R55 A;  3REA B;  4AG1 C;  2QA4 T;  3EID B;  4OGC A;  4C0D B;  1XNI A;  3BG5 A;  1UEC A;  5GAN h;  1C6V X;  3LX7 A;  5HNB B;  1UHF A;  2NUT B;  3H0I A;  4E7H A;  2BZY A;  2CZ0 B;  2RQW A;  1ABQ A;  3L42 A;  3L2R A;  3DDQ B;  3D7S B;  2BS2 A;  3VU3 C;  2VC8 A;  2C5X B;  2DL7 A;  3CME A;  2DAQ A;  3E2U A;  2JXB A;  4IMY B;  5KYU B;  1UGQ B;  5KCH A;  3UF4 A;  5IXB A;  2RI2 A;  1VQO A;  2HBW A;  2KE9 A;  4N0A A;  4A54 A;  4KUL A;  3EH2 A;  4R0K A;  1VYT A;  1IO6 A;  3CEY A;  1QP3 A;  4NL3 A;  2RHY A;  3O5Z A;  1QKW A;  1NG2 A;  3OYE A;  3CD6 A;  3PMT A;  1EZZ B;  4BCN B;  4X9C A;  4DBH A;  4BE0 A;  3DLL A;  2K4Y A;  5A0G A;  1KXU A;  3CCE Q;  3MY5 B;  3OMG A;  1W6X A;  2WAC A;  5GMK i;  2C06 A;  1ZQ1 A;  4J9D A;  5FU7 B;  1OI1 A;  2RPN A;  3FEO A;  3NFC A;  2ZPG B;  2L89 A;  4KRT A;  5HBJ B;  5I11 A;  1NZ9 A;  3PTA A;  2QEX A;  4JX5 A;  2RK2 A;  2KK4 A;  5D6X A;  2O01 E;  1NJI R;  1G3S A;  1TOV A;  2YWW A;  5IHI A;  1H1P B;  3CCR Q;  1VQ4 T;  1QVG A;  1YCY A;  3GOX A;  2KRS A;  1I5L A;  3TW7 A;  2L3S A;  4FT4 A;  1RUW A;  4BCJ B;  2E10 A;  3X25 B;  4XK8 E;  3CMA Q;  2RK1 A;  1PKT A;  2GBQ A;  5I21 A;  1JEG A;  2EW3 A;  1NJI U;  2L0A A;  2KQW A;  2A37 A;  3RUX A;  4A53 A;  2RQT A;  1HXD A;  4BDZ A;  4M7D G;  4HVU A;  2W10 A;  1AVZ C;  2CZ7 B;  2PU9 B;  2WHB B;  2A3L A;  4E2F B;  1Y96 B;  2DRM A;  5C6S A;  1I4K 1;  4MML A;  4BCQ B;  4M75 D;  1VUB A;  4PJM A;  4E7Z A;  5KYW A;  5FW9 A;  1WX6 A;  3CCR T;  3H4C A;  3NTI A;  2EVR A;  3R6N A;  2X4J A;  3E1S A;  1E6G A;  3CMA T;  2KGT A;  2X9H A;  2JT4 A;  1OU8 A;  1UGP B;  4M7D A;  2FZG B;  2D8H A;  2DFU A;  2JMC A;  1G3Y A;  4ZTF A;  1W2B P;  4C92 F;  1TUG B;  1GY3 B;  3EG2 A;  4E7S A;  4C8Q G;  4AMC A;  5LJ3 g;  1JXM A;  2V22 B;  4M7A B;  1FMW A;  1VQK A;  4D8D A;  3CXC P;  1BIB A;  4GBQ A;  2V8J A;  3HO8 A;  1N6A A;  2OAU A;  4C0D C;  2YUO A;  2DTH A;  1RI0 A;  2HQH A;  4M78 F;  3OYY A;  3WVE B;  3EG1 A;  2DRK A;  1OUL A;  1Z9Z A;  4J7I A;  2W96 A;  1WHL A;  2JM9 A;  4JUV A;  1C0M A;  1EFN A;  4EOJ B;  3LYI A;  5CCA A;  1XJW B;  2YRD A;  4AFU C;  4C8Q A;  1YWP A;  1WHJ A;  1JQQ A;  1RAH B;  4PFP A;  3I56 Q;  5KCO A;  2K79 A;  1K9M C;  1YHQ Q;  1WI7 A;  5GAM g;  2F5K A;  5LJ5 e;  2EGC A;  1T0H A;  2EFI A;  3NPF A;  3OS1 A;  4CFV B;  4RUG A;  2LMJ A;  1G5V A;  3MEU A;  4IUT A;  2F69 A;  4C92 D;  1AZE A;  4J83 A;  3N5B B;  1WXU A;  3JCM d;  1YIT T;  3CC7 Q;  4EC9 B;  1WHG A;  4HNT A;  3EAE A;  3QPH A;  3CQT A;  4J9F A;  2C4G B;  2FG0 A;  3RMS A;  4OGE A;  3ZFJ A;  3CC2 A;  5J39 A;  4M78 D;  3LWH A;  4K11 A;  2LQK A;  4CC7 A;  1D1B A;  1OEB A;  5FU7 C;  2CCH B;  3UDC A;  4JX6 A;  2IG0 A;  5L8R E;  2KBT A;  2BZX A;  4F7U E;  1VQ8 T;  2PK2 A;  2SEM A;  2M1H A;  3F70 A;  4BE2 A;  2WSE E;  2QQA A;  1VQ7 T;  1FX7 A;  5CKH A;  1OL1 B;  1X6G A;  4CFU B;  3MY1 B;  3OQ5 A;  3M03 A;  2AKL A;  3DJB A;  1AWW A;  2DD5 A;  3CME Q;  2DL5 A;  2Y4X A;  3CC7 T;  1KQS P;  4BCF B;  2PVD B;  5AYF A;  4PJJ A;  1VQO Q;  1MHN A;  3OB9 A;  2K7A A;  3VYH B;  4KGZ B;  4BBR M;  1GL5 A;  4A4K A;  2YUP A;  5HY6 A;  3SHW A;  1Y57 A;  1VIF A;  2J05 A;  4FM4 B;  1NPR A;  4J8O A;  3CD6 Q;  1WLP B;  2LQN A;  3JB9 F;  4M7D E;  4ROE A;  1AZG B;  4BB7 A;  2DJZ A;  1XOV A;  3G6E A;  1BU2 A;  1U5S A;  3QJ6 A;  4XTW A;  2RJD A;  5A2Q E;  2EKO A;  2VXF A;  2H3J A;  1Q86 R;  3X20 B;  3QO3 A;  1BYM A;  1BI2 A;  2EJ9 A;  1OIU B;  2LVM A;  3CCV Q;  1OI9 B;  4LDY A;  3OY9 A;  1M9S A;  2RHX A;  3ZEH A;  1YJ9 A;  3CD6 T;  1U8R A;  5LJ3 j;  5GAN 2;  1Q86 U;  3C4S A;  5HCK A;  2CH4 W;  1H25 B;  3M53 A;  1NE8 A;  5GJV B;  2CZ1 B;  1W70 A;  4LDV A;  4M7A C;  1UG1 A;  1OKV B;  3S6W A;  3HPW A;  4PJL A;  3JB9 D;  2IW9 B;  2W2H A;  5IHK A;  2DIG A;  2DZ9 A;  2K3Y A;  4L59 A;  4J9C A;  3JCM f;  2QEX T;  4M75 G;  4CFX B;  2WMA B;  2E12 A;  2CP5 A;  4KGV B;  2CP2 A;  2CP0 A;  4KUI A;  1YBY A;  4EMK A;  3WXM B;  5GAM j;  5IDN B;  3HL8 A;  2RB6 A;  4BCI B;  5C0M A;  4X9D A;  2GTO A;  3RR6 A;  3SWN A;  2ZPB B;  5GMK h;  2QA4 A;  2HKN A;  4XQ3 A;  1OYX A;  2PJQ A;  1PRM C;  1VQ5 A;  1N9S A;  4M75 A;  5IDP B;  2QI2 A;  3P8D A;  1WJR A;  3H41 A;  3EFS A;  1GBQ A;  1X43 A;  2QF7 A;  1FYN A;  1G3T A;  2BTT A;  3PIO A;  3HSB A;  1KHC A;  2QAS A;  5GAN g;  1PKD B;  5DLQ E;  1OQK A;  3JAM E;  4N4H A;  1VQK Q;  3L2U A;  1OZ2 A;  3POM A;  5HVY B;  3BG3 A;  1AWX A;  5KYN A;  3BHV B;  1WHM A;  1ZLM A;  1XTD A;  1YN8 A;  3RKX A;  1WQ7 A;  2EQI A;  2PVO B;  3TU4 K;  2KR6 A;  1RAD B;  1KD1 C;  1MUZ A;  2CS7 A;  4O5V A;  3L2Z A;  4DEX A;  1AWJ A;  2DXC B;  2LCC A;  3OBY A;  2XD0 A;  1CKB A;  1UFF A;  2DD4 B;  3DOG B;  4XTZ A;  4EOK B;  4C92 G;  3G71 T;  1B07 A;  4FCY A;  4PJO B;  2X3W D;  2HQE A;  3TNH B;  1K9A A;  3KBG A;  3OYD A;  2QQB A;  4MZP A;  1Q7Y C;  2K57 A;  3M58 A;  2DXB B;  2YRV A; 
#chains in the Genus database with same CATH homology
 4KT0 E;  4D6W A;  4LDU A;  3HFN A;  3CCE T;  2RHI A;  3FDR A;  3QYG B;  4DQ2 A;  1K73 C;  3E9F A;  3OYH A;  1M90 U;  5GAN 7;  1AHJ B;  3RKW A;  3UT1 A;  4LOC A;  2R58 A;  4EPC A;  1YJW T;  4M78 G;  4RCC A;  1JJ2 A;  3OYF A;  3MEA A;  3ME9 A;  3LH0 A;  5CO7 A;  2HQX A;  4PJO G;  3V7C A;  3JCM X;  4BDY A;  3X24 B;  1QVG S;  4IUP A;  3VUZ A;  4HCC A;  4LD6 A;  4OMF B;  4F7U F;  1RL2 A;  2EQU A;  1BI1 A;  2KMT A;  4M78 E;  5CIU A;  1M90 C;  3PIP A;  2Y90 A;  3BDU A;  3VYG B;  4PJO E;  3I56 A;  2OTL T;  4C92 A;  3J7A F;  3KXT A;  1YHQ A;  3VKI A;  4QQD A;  3M5A A;  4C8Q C;  5LJ3 e;  1VQ8 A;  2FL7 A;  3OW2 S;  3TW6 A;  2DKG A;  2OTJ A;  3TRE A;  1X6O A;  3QZ9 B;  2D9T A;  1JJ2 S;  3UPU A;  1UB4 A;  1VQ7 A;  4KBM B;  5LJ5 f;  3SWN B;  2DXC A;  2JNG A;  3QKJ A;  1HK9 A;  4M77 G;  4EMK C;  2QFZ A;  3CC7 A;  1LOJ A;  3VUB A;  2DD4 A;  2XDP A;  1B34 A;  1JB0 E;  2RJF A;  4M78 A;  3JB9 J;  2L3R A;  5CQX A;  3M56 A;  5GAN 3;  1VQ6 T;  1YJN A;  4PJO A;  4AKH A;  4QSH A;  2E41 A;  4M75 B;  2JVV A;  4M77 E;  4N4I A;  4R55 A;  3FC3 A;  1S72 A;  1YI2 T;  2XI9 A;  3OBW A;  2BKD N;  4BI8 B;  4MDX A;  2JTM A;  2X4W A;  3QXE B;  3BG9 A;  2QA4 T;  3MP1 A;  1Q86 C;  4NC6 A;  3QWL A;  4OGC A;  3QJY A;  4FU6 A;  4TVR A;  1VIE A;  1XNI A;  2MI6 A;  4C0D B;  2BUD A;  3BG5 A;  5GAN h;  4M7D F;  2BIV A;  2EJF A;  3OYN A;  3LX7 A;  5A0L A;  4X34 A;  4E7H A;  2F5T X;  2P0Q A;  4XU1 A;  3LGL A;  2XID A;  3RIR A;  3CC2 T;  2CZ0 B;  4HLQ A;  3L42 A;  4M77 A;  4IUU A;  4OP0 A;  4ELZ C;  3GNG A;  1YIJ T;  3VKH A;  4J6W A;  2K2V A;  3INZ A;  4LDW A;  2EAY A;  4M75 E;  4Y91 A;  3OS0 A;  3L2R A;  2BS2 A;  3VU3 C;  2VC8 A;  2HAX A;  2CYZ B;  3CCJ A;  3CCM A;  1VQM T;  3CME A;  4ZN1 A;  2R5A A;  3JSC A;  4RG8 A;  3BFM A;  2DAQ A;  2BS4 A;  1D3B A;  3SFM A;  3CC4 A;  1UGQ B;  3PGG A;  5KCH A;  5EJC A;  4M7A G;  2RI2 A;  2E65 A;  3V8L A;  4EMG A;  1QP2 A;  5A0D A;  4RG2 A;  3WVD B;  4QVZ A;  4R56 A;  1VQO A;  4N0A A;  4A54 A;  2EYQ A;  4KUL A;  4C5I A;  1MGQ A;  3CCL T;  3QSU A;  3CEY A;  1QP3 A;  4NL3 A;  2IVW A;  2RHY A;  5HK3 A;  3QZ5 B;  3OYE A;  2GQV A;  3CD6 A;  4JLG A;  4XU2 A;  2RA2 A;  3MP8 A;  4A4F A;  1ZBX A;  2EQM A;  3OYA A;  3PMT A;  1IZ6 A;  2VUB A;  5FRO A;  4X9C A;  3G7Z A;  1FXX A;  4BE0 A;  5GAN 6;  3QG1 A;  2P0P A;  5GAN j;  3DLL A;  3SDZ A;  2KSS A;  1PSE A;  4JX4 A;  2K4Y A;  2RD1 A;  5A0G A;  5GMK l;  3OMG A;  3JB9 G;  4M7A A;  2WAC A;  5GMK i;  2C06 A;  5FU6 C;  1ZQ1 A;  4NOY A;  1U1T A;  5FU7 B;  3L2V A;  3G6E T;  1OI1 A;  3KHI A;  3FEO A;  3NFC A;  2ZPI B;  1V29 B;  2ZPG B;  2GFU A;  2L89 A;  4C92 B;  5KE3 A;  5FRN A;  3CCU A;  5IAY A;  4FSX A;  2PUO B;  1NZ9 A;  1DJ7 B;  5DLO A;  4J5Y A;  3J81 E;  3PTA A;  1Q81 C;  2QEX A;  1QW1 A;  3MHX A;  4E47 A;  3LW5 E;  4JX5 A;  5GMK e;  2V8I A;  2XG8 D;  2RK2 A;  3H8Z A;  4QVD A;  3JCM e;  4LD9 K;  2QDJ A;  2EQK A;  4Q5W A;  2KK4 A;  3I56 T;  2M9U A;  1VQL A;  1N8R U;  5D6X A;  4BBS M;  2QQ8 A;  2HBP A;  2O01 E;  1YHQ T;  2PUK B;  1M8V A;  3GNF B;  1E7P A;  1B34 B;  1P92 A;  4M78 B;  3TEE A;  3TCJ A;  3QII A;  1G3S A;  1W2B A;  3A8G B;  1UGR B;  1M1F A;  3CPF A;  4J7F A;  1QVG A;  1VQ4 T;  3OA6 A;  1YCY A;  3GOX A;  4E7J A;  3JB9 H;  1I5L A;  1N8R C;  3TW7 A;  3CCQ A;  1YJ9 T;  4FT4 A;  4C92 E;  5FLX E;  4IUQ A;  1I8F A;  3CXC A;  1VQN A;  2E10 A;  1BIA A;  3X25 B;  4XK8 E;  2L5Q A;  5CVI A;  2XDB A;  4AKG A;  5J26 A;  4C5E A;  2RK1 A;  5LJ3 d;  3JB9 I;  4JRP A;  3R6O A;  3OW2 A;  5I21 A;  2LCL A;  1W2B S;  1O9S A;  1NJI U;  2LNV A;  2KQW A;  3GP8 A;  3JCM g;  4M77 B;  4XAX B;  4V2S A;  3OYM A;  3RUX A;  4A53 A;  1HXD A;  4BDZ A;  4M7D G;  1N27 A;  3OSV A;  1N9R A;  2VV5 A;  3DB3 A;  2CZ7 B;  3CBM A;  3CXC S;  2PU9 B;  3V7R A;  4ELJ A;  1X01 A;  2A3L A;  3S3O A;  1Y96 B;  2XU8 A;  2KAF A;  2LX9 A;  4MIM A;  1D3B B;  1BKB A;  2MWO A;  1I4K 1;  2PVG B;  3ASK A;  5C6S A;  4MML A;  3L2W A;  5CR2 A;  5GAN f;  4M75 D;  1VUB A;  3GPL A;  3HRU A;  4BY6 B;  2PQW A;  3FRN A;  2FYK A;  4JLI A;  3H4C A;  3CCR T;  2HNI A;  2KY9 A;  2BS3 A;  2I2L A;  2P0K A;  2YLB A;  3NTI A;  3HP9 A;  4FIB A;  1IRE B;  1LNX A;  2X4J A;  3E1S A;  3M57 A;  4C5G A;  3CCM T;  2Y4Y A;  3CME T;  4XTX A;  4OF1 A;  4AI6 A;  4JJN K;  1O75 A;  4HT9 A;  2E64 A;  4A4H A;  2DTI A;  4JRI A;  3CMA T;  1KHI A;  3JCM J;  2V8K A;  5CK9 A;  2LTO A;  5GAN 4;  4CI0 C;  3SWN C;  3JCM Q;  1UGP B;  1VQO T;  4M7D A;  4ZTJ A;  3T9N A;  3V7S A;  2QDY B;  4BD3 A;  3G4S A;  4ZGJ B;  3P8B B;  4PKC C;  1G3Y A;  4ZTF A;  2M16 A;  4C92 F;  4RMO A;  3NTH A;  4GLK A;  4MZM A;  1VQ5 T;  3RKY A;  4C8Q G;  2XKO C;  4M75 C;  3M9Q A;  1VQ9 A;  4HKE A;  5LJ3 g;  5I2S A;  4M7A B;  4QVC A;  4M6V A;  3JCM V;  1VQK A;  2EQJ A;  4OVA A;  5GAM e;  1BIB A;  4C8Q E;  1M1G A;  1KG1 A;  1JRI A;  2V8J A;  1Q82 U;  3HO8 A;  1N6A A;  2OAU A;  1WQW A;  4C0D C;  1YJW A;  1NPP A;  2EIF A;  2D0Q B;  2DTH A;  1RI0 A;  3C12 A;  4DOV A;  4M78 F;  2ZCF B;  3OMC A;  3OYY A;  3WVE B;  3OYJ A;  1TH7 A;  4PJO F;  3A5Z B;  4JRK A;  4IUR A;  3X28 B;  1Y96 A;  3O8V A;  2K5F A;  5D6W A;  2EWN A;  3VKG A;  2DXU A;  4J7I A;  3ZBD A;  3A8M B;  2DEQ A;  2L8D A;  3C94 A;  2RJC A;  4YTL A;  1Q82 C;  4JUV A;  1K9M U;  3DL1 A;  2HD0 A;  3LYI A;  4L5G A;  5CCA A;  2OTL A;  5HK0 A;  2P4T A;  3SD4 A;  3VJP A;  1XQH A;  4MFD A;  2RI5 A;  3JCM c;  4C8Q A;  1KQ2 A;  2K3X A;  2VXE A;  2XK0 A;  1KQS A;  4M7A E;  1VQP A;  2X4X A;  2R57 A;  3CCV T;  4HNU A;  2DK3 A;  5KCO A;  1K9M C;  4KUD K;  3A8H B;  4M77 F;  5GAO r;  5GAM g;  2DD5 B;  2F5K A;  5LJ5 e;  2EJG A;  2EFI A;  2LT1 A;  1WNL A;  5KE2 A;  1VQ6 A;  1GXI E;  3OS1 A;  2VGN A;  1G5V A;  3PFS A;  3MEU A;  4IUT A;  2F69 A;  4C92 D;  4F7U B;  1QVF A;  3QDR B;  3MP6 A;  2CKK A;  3N5B B;  2GCX A;  4J83 A;  4C5H A;  2FB7 A;  4ZGE B;  3JCM d;  3I55 A;  1YIT T;  3M54 A;  4FL6 A;  3KUF A;  1PSF A;  3BY7 A;  3PMI A;  4HNT A;  3EAE A;  3QPH A;  4P5N A;  3JCM h;  3VV0 A;  4EMH A;  3OYG A;  3PNW C;  4ELY C;  4IKF A;  3FLG A;  3RMS A;  2R5M A;  4OGE A;  4HCB A;  1M4Z A;  1ZHI A;  4VUB A;  2JUF A;  5CKB A;  3URG A;  3ZFJ A;  2ZPF B;  3DB4 A;  2JN0 A;  4XTU A;  3OYI A;  5IN1 A;  1BI3 A;  3CC2 A;  2QQ9 A;  5J39 A;  4M75 F;  4M78 D;  4ME7 A;  5FU6 B;  3LWH A;  4F7U G;  4B9X A;  2LQK A;  2WJ9 A;  2QQR A;  1QVF S;  4PJO D;  5FU7 C;  1YIJ A;  3UDC A;  3OYC A;  5LJ5 g;  2XIC A;  5LJ3 f;  4JX6 A;  1H64 1;  2IG0 A;  3HRT A;  5L8R E;  3HBL A;  2DO3 A;  3RMQ A;  4C92 C;  4HA8 A;  3L2Q A;  4F7U E;  1VQ8 T;  2AHJ B;  5KH6 A;  1QLB A;  2M1H A;  2OTJ T;  3F70 A;  4BE2 A;  4MFE A;  3SB2 A;  2WSE E;  2QQA A;  3UWN A;  4OB1 B;  1VQ7 T;  1FX7 A;  5CKH A;  1M1K U;  4M7A F;  2RH2 A;  5GAO p;  3ER0 A;  3FIF A;  3OQ5 A;  3LGF A;  4M7D B;  4BI4 A;  3L1A A;  4C0G A;  2DD5 A;  4A4E A;  4A4G A;  2Y4X A;  3CC7 T;  3OYK A;  4J6Y A;  2NLU A;  5CKF A;  2KMG A;  3CBP A;  3C95 A;  4M78 C;  2JZ2 A;  4M77 D;  2X35 A;  4B9W A;  2E6Z A;  2E70 A;  1SSF A;  3OS5 A;  4BUG A;  5HKC A;  2PVD B;  4PJO C;  3EFR A;  2MWP A;  5EG2 A;  1OZ3 A;  5AYF A;  1S72 T;  3RER A;  5IT9 E;  2RJE A;  5LJ3 h;  3BDL A;  1MHN A;  4F7U A;  2XDD A;  3RES A;  2GFA A;  3OB9 A;  5LL6 S;  2G3R A;  2ZZD A;  1W4S A;  3PT9 A;  3VYH B;  3DLM A;  5CQY A;  3S3M A;  4BBR M;  3A8L B;  4A4K A;  3FB9 A;  5D6Y A;  5HY6 A;  2K5I A;  1VIF A;  4FM4 B;  1NPR A;  4J8O A;  3M59 A;  1UEB A;  4MDW A;  1M5Q 1;  5CKE A;  4ATO A;  4OB3 B;  1VQK T;  1NJI C;  3JB9 F;  4M7D E;  4HT8 A;  2MF2 A;  4BB7 A;  2DJZ A;  4M77 C;  1XOV A;  2DTO A;  3G6E A;  3CPW S;  3QJ6 A;  4XTW A;  2RJD A;  1I81 A;  5A2Q E;  2DIQ A;  2EKO A;  1Y7X A;  4C8Q B;  2QTX A;  2VXF A;  2RO0 A;  3CCJ T;  3OYB A;  2H3J A;  4IUV A;  3HKS A;  3X20 B;  2FHD A;  3QO3 A;  4C0F A;  1BYM A;  4NL2 A;  2VGM A;  2LRQ A;  3M55 A;  3CC4 T;  1BI2 A;  3M4G A;  3HB9 A;  2EJ9 A;  4QQ6 A;  3M58 A;  3OSS C;  5GAM d;  4BY6 C;  2WSF E;  4EMK B;  5GAM h;  1X75 C;  3CBO A;  2LVM A;  4JDS A;  4M7A D;  4GY5 A;  4N0A C;  3AHU A;  4LDY A;  3OYL A;  2ZPH B;  3G71 A;  1VQP T;  2QXF A;  3OY9 A;  1WJQ A;  1M9S A;  4MZT A;  4RCB A;  1VQ4 A;  3CCS A;  2A7Y A;  2RHX A;  4PLI A;  5J3B A;  3ZEH A;  1YJ9 A;  1LJO A;  5DY9 A;  3JCM P;  3CD6 T;  2DXT A;  2O4X A;  1U8R A;  5LJ3 j;  5GAN 2;  1Q86 U;  3C4S A;  2XHC A;  3CCE A;  2WSC E;  4AKI A;  3M53 A;  4ZN3 A;  4XTV A;  4XTY A;  5FRM A;  3Q1J A;  1G3W A;  2JOY A;  2QQS A;  2DZC A;  3OS2 A;  1NE8 A;  2CZ1 B;  2LC4 A;  4QW2 A;  3I55 T;  4JRQ A;  2DXB A;  4LDV A;  4PNO A;  3NTK A;  4EDU A;  5GAM f;  4M7A C;  2M0O A;  4OB0 B;  3S6W A;  1WJS A;  3HPW A;  2CZ6 B;  2RI3 A;  3JB9 D;  5LJ5 d;  4HNV A;  4BE1 A;  5I2M A;  1WGS A;  5LJ5 h;  4RKU E;  3QUI A;  2DIG A;  2DZ9 A;  3BW1 A;  3CCU T;  4XU3 A;  4L6V 5;  2K3Y A;  4HCZ A;  4L59 A;  1Y07 A;  3JCM f;  2QEX T;  4M75 G;  4Z6Y A;  1EIF A;  5DM7 R;  4E7I A;  4E7K A;  3HRS A;  3E9G A;  4DA4 A;  4JS4 A;  2E12 A;  4PL6 A;  4Z02 A;  1R8O B;  3CCR A;  3VYG A;  3QYE A;  2MAM A;  1VQL T;  5GAN e;  4JS5 A;  4KUI A;  1YBY A;  4EMK A;  3WXM B;  5GAM j;  4LDX A;  3HL8 A;  3M4Y A;  2RB6 A;  2E6N A;  5GAO m;  5C0M A;  4MMK A;  3CMA A;  4E7L A;  4X9D A;  1YI2 A;  1UGS B;  3JRZ A;  5CKD A;  5GAO q;  1FKM A;  2LQ8 A;  3SWN A;  2ZPB B;  3QYB A;  2K5L A;  3CCQ T;  3S3N A;  2ZZD B;  5GMK h;  2QA4 A;  4XQ3 A;  4PLL A;  1OYX A;  5M9O A;  3HZJ A;  1KQ1 A;  2ZPE B;  1VQN T;  5GAO l;  1VQ5 A;  1FWZ A;  1N9S A;  3A8O B;  2MMP A;  4BI3 A;  2G77 A;  4M75 A;  4C8Q F;  3QYH B;  2YHT A;  5GAN d;  1K8A U;  1BI0 A;  3MCA B;  2GF7 A;  2B8A A;  2QI2 A;  1WJR A;  3HHT B;  3P8D A;  5GMK m;  3EFS A;  3QBY A;  4OB2 B;  4CRI A;  2QF7 A;  2D6F A;  1G3T A;  1U1S A;  3GF5 A;  3PIO A;  3GIB A;  1KHC A;  5CAI A;  3HSB A;  5GAN g;  3JCM b;  5DLQ E;  2E5Q A;  1JBM A;  2RHU A;  2YLC A;  3FJP A;  3JAM E;  3GLX A;  1H3Z A;  1K8A C;  1KQS S;  2KVQ G;  4M7D D;  4ZGD B;  2JTF A;  4N4H A;  5LJ5 j;  3L2U A;  1OZ2 A;  1Q81 U;  3DKM A;  4C0Z A;  1KD1 U;  1VQM A;  2KDS A;  3HFO A;  1KC8 U;  1QVP A;  2DVE A;  2RHZ A;  4FT2 A;  3BG3 A;  1YJN T;  2LT4 A;  4HL4 A;  1XTD A;  3H6Z A;  1WPY A;  3V8K A;  2DPP B;  2FVU A;  1WQ7 A;  3RKX A;  4J6X A;  2PVO B;  4BAC A;  3E19 A;  3TU4 K;  2KR6 A;  3V8J A;  3MO8 A;  3J80 E;  1KD1 C;  3CCL A;  1KC8 C;  2X4Y A;  3X26 B;  1Y71 A;  2ZGW A;  3CCV A;  3P8H A;  2CS7 A;  3QHS A;  4O5V A;  4Y28 E;  2E1H A;  3L2Z A;  1Q7Y U;  1M1K C;  2DXC B;  2LCC A;  3OBY A;  2LDM A;  4N4G A;  3CPW A;  3JCM W;  2XD0 A;  2O4X B;  2VYT A;  4UC4 A;  4M7D C;  5GAN 8;  4II1 A;  4NS5 A;  2DD4 B;  2RM4 A;  3G4S T;  4XTZ A;  5GMK j;  4XU0 A;  4C92 G;  5GAO n;  3G71 T;  3LWI A;  1K73 U;  4PJO B;  3MET A;  2HQE A;  3MEV A;  3LLR A;  3MEW A;  3KBG A;  4O6J A;  4WF2 A;  5GAN 5;  3OYD A;  2QQB A;  4MZP A;  3CCS T;  1Q7Y C;  2K57 A;  4DOW A;  1VQ9 T;  2CGH A;  4QQG A;  1YIT A;  2DXB B;  4C8Q D;  2YRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...