2D0QB

Complex of fe-type nhase with cyclohexyl isocyanide, photo-activated for 1hr at 277k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title X-ray snap shots of Inhibitor Binding Process in Photo-reactive Nitrile Hydratase
rcsb
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2d0qB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2d0qB02
4OB0B 3WVEB 4ZGEB 2DD5A 2PVOB 3X26B 2PUOB 2QDYB 4XK8E 1IREB 2WSCE 2CZ6B 4FM4B 4KT0E 3A8MB 4Y28E 4ZGDB 2ZZDA 2WSEE 4RKUE 2CYZB 1GXIE 3HHTB 1QP2A 2PVGB 2DXCB 2DXCA 3X28B 2DD5B 3VYHB 3VYGA 3X24B 2CZ7B 1PSFA 2ZPGB 3A8OB 1QP3A 1UGRB 2ZPBB 1V29B 2ZZDB 3QYGB 3QZ5B 2PU9B 3QZ9B 3A8GB 1UGPB 3VYGB 1DJ7B 2ZPHB 1PSEA 1UGSB 3LW5E 2AHJB 2D0QB 2ZPIB 2DD4A 2ZCFB 3WVDB 1JB0E 2DXBA 4OB1B 2CZ1B 2PVDB 4ZGJB 3X25B 2ZPFB 2PUKB 3A8HB 5L8RE 2O01E 3X20B 2CZ0B 1AHJB 3QYHB 2WSFE 4OB2B 4L6V5 2DD4B 2DPPB 3A8LB 2DXBB 2ZPEB 4OB3B 1UGQB 3QXEB
chains in the Genus database with same CATH superfamily
1AOJA 2ATCB 2P0KA 5CVIA 1K76A 2CS7A 3OA6A 2HDAA 4PJOE 1FMWA 1D3BA 3QKJA 3JB9J 4AKGA 4HVWA 1Y57A 3VJPA 2NYSA 2QG9B 2R5AA 1BK2A 1X75C 2JTFA 4ELJA 3CXCS 1S72Q 2HQHA 3C94A 2B9RA 2J6OA 3C95A 2LJ0A 1UTIA 5IXBA 2DXCA 3RDVA 2KMGA 4LUDA 2QXFA 4M78G 2XG8D 3VYGA 2XKOC 3HKSA 3OYCA 4N4HA 2EBPA 4OF1A 1H26B 1BCOA 3CMAT 2DNUA 1WQWA 2CUDA 4PKCC 1PKSA 3GNFB 5CQYA 1Z9QA 2CT4A 2ZPBB 3UDCA 3BG9A 2HCKA 1U1SA 5D7UA 1WYXA 4CFUD 1C0MA 3G71Q 2NUPB 1QVFA 1OI9B 3NTIA 2LQKA 3MI9B 3EG1A 1FWZA 1GCQA 2EJ9A 5FU6B 2MMPA 1UNLD 4RTVA 3PIOA 1IHVA 2CSQA 1D3UB 4KH1B 4OR5B 3ER0A 3MJXA 3D7SB 1M1KR 5DQVA 1TUDA 4ELYC 4YOZA 2KBTA 1AZGB 2DXBA 3QDFA 1RAEB 3EOCB 4F6UB 3X25B 1HXDA 4C92B 5FW9A 2PUKB 1UGVA 2HEQA 1NJIR 2VV5A 2YRCA 1M1KC 1H3HA 3VS3A 1IXDA 3QHRB 2F2XA 2DK3A 5FRMA 2BZ8A 4E7IA 1E7OA 1QKXA 2P4RA 1R0CB 1QVPA 2VVKA 1I5OB 4UN0A 3I5SA 1KK7A 2PQWA 3GOXA 3UF4A 1WHMA 4R0KA 2PK2A 2FZGB 1LJOA 2JOYA 3M53A 3QYBA 1NJIC 1UECA 2E10A 3CQTA 1TG0A 1FVVB 2PVOB 3FB9A 2DMEA 1VIEA 4PJOF 3H4CA 2BS4A 1V76A 2GBQA 4AT1B 1VQOQ 4RG2A 1H1PB 1GUXB 4F7JB 4Y92A 2GF7A 3CCQA 1AWXA 3RKYA 3P8HA 1K0SA 2QGSA 1KHCA 4M77C 2RM4A 1UEBA 3EGDA 1U1TA 3RNJA 4CFVB 2QAZA 3PGGA 1HSQA 1PSFA 2FEIA 1G8XA 5HKCA 2HBWA 1T0JA 4M75F 3V8KA 3QWXX 5DQWA 4QVCA 1WFWA 1CKBA 3QZ9B 4X1VA 2WPAB 3B57A 4QQDA 2M02A 3I56Q 1G3SA 1G3NC 1O9KB 2P0PA 2EYWA 5CAIA 4FX3B 2YHTA 5I2MA 2KE9A 4RTZA 2EKHA 2R57A 2V22B 3CCJA 3UWNA 3LX7A 4A4GA 1KG1A 1M2OA 5BNJB 4NC6A 2O88A 4CFXB 2CZ1B 4WCIA 1H3ZA 3HFOA 4C0DC 3CXCA 2DVEA 3M54A 1X6BA 2I2LA 2LDMA 3GTMS 3CBMA 4J9IA 1C6VX 1BIBA 5GMKl 2DIQA 3RIRA 3NHNA 2QASA 2KMTA 3HRUA 3EGXA 3CCUT 1VQ4A 5IHNA 4C8QB 3FJ5A 2C5OB 2YSQA 1VQ7A 1VYWB 3CCRA 4XU0A 3M0TA 5AT1B 3RUXA 2DM1A 1X6OA 2RK1A 4EC9B 4LDXA 1JOWA 4OGRB 4C5GA 5GMKm 1QMZB 4BE0A 1AZEA 3BHUB 2OTJQ 5LJ5g 4CC3A 1T0HA 3DL1A 2CKKA 2ECZA 2KYMA 1N4MA 2JXBA 1OULA 1WDXA 1OOTA 1Y07A 5HQ0B 1OYXA 2DL4A 2KR6A 1Y7XA 2K5IA 3QJYA 3CC2A 3JB9D 3G6ET 2M9UA 2QK0A 2K3XA 1GXIE 3DB3A 2QA4A 1Q7YU 3OYGA 1VQNA 2L3PA 3UPUA 1N8RU 2DRMA 2CJMB 4M6VA 1D3BB 2HQEA 4QQGA 1URCB 1VQKQ 2MK5A 2HSPA 2L8DA 4RUGA 1OU9A 3CPFA 1GFCA 1FX7A 1WXTA 2HBPA 3L2VA 2FL7A 1X01A 3SEMA 3FLGA 4M78C 3QWYA 1NYGA 4HCKA 1OX8A 4TTHA 4CFUB 2MIOA 2K4YA 3EIDB 1AD6A 3CPWS 3JCMP 3VYGB 2QGFB 3EFOA 1UGSB 4JS5A 3GF5A 3JV3A 1VQLQ 2EYXA 2DL8A 1ZBXA 4E2FB 1UE9A 3OYMA 1M8VA 4PJMA 2M16A 1VQPA 1Q95G 4F7LB 2YUNA 2E3HA 4JZ3A 1UNHD 3PTAA 4Y72B 1JSTB 3SD4A 2RNAA 3OYHA 2GCXA 1G3WA 2LQWA 5LJ3h 2OTLA 2X3XD 2EYQA 4PL6A 1QVFP 2RHZA 2L2PA 5LJ3g 3L2RA 3TREA 3CMAA 5D6XA 3H0HA 2DXBB 1IGQA 1JJ2P 1G83A 4EOLB 2HL3A 1H1RB 5HBEB 1MMGA 4M7DE 4IMYB 1UJYA 2CDTA 1WGSA 4M4ZA 5KCOA 2X51A 2A36A 4BCJB 2LVMA 4M7AA 4F7UA 2D9TA 2W2HA 4XU2A 4HT8A 2C0IA 3CCSA 2UZBB 3M57A 2VGNA 1XOVA 1OL2B 1PG5B 3HHTB 2LC4A 4OVAA 4C0ZA 1T3SA 4N4IA 4MIMA 4M7AD 2EJFA 3G4ST 2JTMA 2KRMA 2LNVA 2QYZA 1VYVA 2MAMA 5A2QE 5HY6A 2K6DA 2DERA 2G77A 5GAOr 2K9GA 2RB6A 2CGHA 5M9OA 1X27A 3MY5B 4FIBA 1AWJA 2DL7A 2DILA 5GAN7 1UGPB 2V8IA 1W2BP 1BU1A 1N9RA 2VXEA 3JCMX 2KT8A 5DY9A 3KFVA 4CFNB 1OEBA 4J6YA 1M30A 3Q1JA 4EOSB 3CCEQ 2CCHB 4O5VA 2E5QA 3NFCA 3M03A 1VQMQ 5GANh 3CC7Q 2DTOA 1U06A 3F70A 1TXQA 2QQAA 5J39A 2PTKA 1WQ7A 1WX6A 5IH2A 5GJVB 3I55T 2H3EB 1U8RA 1KD1R 3OYLA 4OMFB 3OYDA 1OIYB 1PKDB 4L6V5 2RJCA 2VB6A 3M5AA 4DQ2A 4KGXB 3VKIA 4C92E 4KBMB 4AG1C 1M90U 3QXEB 4E47A 2LNHB 4M7DF 3PNWC 4A54A 5I21A 3EGXB 1KD1C 2O2OA 2DO3A 4KT0E 2KNBB 2BZYA 2FRWA 4F70B 4LN2A 4OMNA 4MMLA 2EFIA 3DLMA 1NG2A 3SHWA 5DLOA 1NE8A 4XTVA 2ZZDA 2PMIB 1G5VA 2X35A 1I5LA 2CYZB 2RI5A 4J6XA 4AFQC 5KE3A 3CCLT 2FHDA 2C5VB 1LNXA 2XDBA 4KRDB 1YHQQ 3MP1A 3CC4T 5GAN3 1ZUYA 3JCMd 5A0DA 1ZSGA 1YJNT 4YC3B 3OSSC 1UUEA 2DXUA 2KDSA 3DLLA 1VQ9T 4M77G 3CCUA 3BG5A 4BBSM 1GL5A 2RQVA 4FL6A 4KGZB 3NMZC 3MP6A 3OYBA 2HL5C 4AFZC 1IB8A 1ZSZC 2IG0A 1YJWA 1H4LD 2QEXT 1QLBA 1YITT 2MYSA 3FC3A 4M78A 1S72T 4XTUA 2I40B 1D1BA 2YUQA 5KYWB 2FB7A 3E9FA 1PWTA 2AT1B 2IIMA 3EH2A 3ZBDA 4A4HA 2DX1A 4XQ3A 2CP2A 3I55Q 2GTOA 1PRLC 4KGVB 3CD6T 1D0ZA 4RG8A 1RACB 2F2VA 2AKKA 4V2SA 1HK9A 4ZN1A 3QSUA 3VS2A 2D8JA 3G6EA 4M78D 2K2VA 1EFNA 5L8RE 1XQHA 3EFOB 3L2WA 4AFUC 3JB9H 1K1ZA 3EHRA 4OMPA 2FO0A 4CRLB 4BCHB 1R8OB 1X69A 2K5FA 3A1PA 3PMIA 5KYUA 2E4HA 2F2CA 4C92F 3M0PA 3SWNC 2G9XB 4C8QE 1W2BS 3CCLQ 2X4JA 1I0CA 3M56A 1YWOA 3G7ZA 2JS2A 2K3YA 4JRQA 4FYWB 1BKBA 1Y96A 4HKEA 4A4KA 2KEAA 1RAIB 1M3AA 2QFZA 2PK9B 5C6SA 2CP0A 2V8JA 1KQ2A 4PFZA 2NUTA 4Z88A 2ENMA 2LX7A 2IVWA 2KR3A 4OMQA 2L5QA 1SSFA 2G3RA 3ASKA 3PVLA 4ATOA 1PNJA 5D6YA 3QHWB 3BFMA 3CCMQ 3VYHB 4WTOB 1OQKA 1F5QB 4M7AB 2VYTA 2EYZA 1ZUUA 4F7UB 1AD5A 4JLGA 3JCMb 1GBRA 4MDWA 3V7CA 1KQSA 2K5LA 3HRTA 2QEXQ 1SRLA 1YITQ 1K73R 1PRMC 3PIPA 2X9HA 3VS0A 1V29B 3OY9A 3OW2P 2PU9B 3IQLA 2AZVA 1TWBA 2EQMA 2R58A 1I1JA 4A4EA 2E12A 2KXDA 4J7FA 1Q86U 2VASA 5LJ3f 1D0YA 5GAOp 1VQOT 3CD6Q 1BBZA 1P5EB 4RTXA 5IHKA 4CC7A 1K73C 4M75E 4KH0B 1ABQA 3J7AF 2HKQB 4CC2A 1NM7A 2LX9A 4K11A 2DYBA 1QW1A 3U23A 2D6FA 2W0ZA 2PVDB 3EGUA 1VINA 4L5GA 3VRYA 3T9NA 2FPEA 2GNCA 4PLLA 4EOQB 4DOWA 2MF2A 4OMOA 4JRKA 4AI6A 1U5SA 4PK4A 5IXFA 2IVXA 2GTJA 3QDRB 1TUCA 4XU3A 3G4SA 1AHJB 1YJ9T 3DJBA 3BDLA 2OI3A 3EG9A 4YOSA 4RODA 7AT1B 3CC2Q 1NPRA 1MV3A 1JXOA 3I56T 2BKDN 1Q82U 4E7JA 4FYXB 1YIJT 4NOYA 1R77A 3HL8A 2JMAA 1I81A 1KC8U 1QCOA 1WLPB 2RI3A 3TW6A 2EJGA 3JCMc 5LJ5j 1TS9A 3CBOA 5AYFA 4C8QF 1VQ6Q 1JBMA 3L2QA 2WMAB 1KQ1A 2Z0WA 2AK5A 2GFUA 3GP8A 2H3JA 3LWIA 3TU4K 1VQ8A 4ZGDB 3AT1B 3HRSA 3V7RA 5IAYA 4XTYA 3DB4A 2JMCA 4XTZA 4ME7A 3JCMf 2WIPB 2WMBB 1XO2A 4EOKB 4EOOB 2J6FA 3MKDA 1V1CA 2D1XA 2LT4A 3VS4A 3POMA 3VU3C 3FEOA 2VWFA 4PJOG 4JPBW 4BBRM 3MO8A 3JAME 2XHCA 2JM8A 1M1FA 2YDLA 1JSUB 1T3LA 3J80E 4IUPA 2RQRA 5GAMf 3UA7A 2ZZDB 4BXXX 2JW4A 5GANf 3QYGB 3QZ5B 2GQVA 2OTJT 1J3TA 1FMVA 2PZ1A 4DEYA 4EMHA 1QVGA 1K8AU 4JX6A 1PSEA 2KAFA 2BZXA 5FROA 4HA8A 4E7LA 2D0QB 3TEEA 4OGCA 1VYTA 3WVDB 1GBQA 1ZSZA 2OAWA 2V1RA 3TNHB 1H641 1YJ9Q 1D1AA 2COZA 1BB9A 1E6HA 1PCXA 1VQKT 4J9HA 1VUBA 1AEYA 4N0AC 4F6SB 3K7AM 1MHNA 1YIJQ 3H0IA 1QQJA 1M4ZA 4FW1A 4BD3A 1O9SA 4M78B 5IN1A 3CC4A 3EG3A 1M1GA 4F6WB 5FU6C 5IT9E 1YJNA 3PO3S 2C5XB 3VKHA 4LDWA 2D0NA 4IUQA 2DLPA 2A7YA 5LJ3j 2DVJA 1WHKA 3EAEA 4XTXA 1VQ9A 5IDNB 1N6AA 3OYFA 2DF6A 4VUBA 1VQLT 2QTVA 3VV0A 4DA4A 1ZHIA 1IREB 2JN0A 3SWNA 5GMKh 4PNOA 1VOLA 4KUDK 4AKHA 2E65A 3CMEQ 4XU1A 3RMQA 2YRVA 4JLIA 1S72A 1ZX6A 1GFDA 3MHXA 2PJQA 1MNDA 2EW3A 5KYUB 5LJ5e 3E1SA 2PVGB 4EOJB 3QIIA 3BLRB 4HL4A 1K9MU 3MPUB 4HCBA 1HJDA 4I3ZB 1Y96B 2RMOA 1WPYA 2BUDA 2YWWA 2ZPGB 3TW7A 4NSTB 5DM7R 2NUTB 2RN8A 2BE7D 1M8MA 1VQ5Q 3G71A 4F7NB 2DRKA 3H41A 1TOVA 1BIAA 1SSHA 1LVKA 2B8AA 2XICA 2GFAA 1DJ7B 2X4WA 3PMTA 1WJQA 3OS2A 2WEVB 2CP5A 4IURA 4R56A 4IUVA 4R55A 2A37A 1OU8A 1YI2T 2C0OA 5L23A 4L59A 1W4SA 2BKZB 5KYWA 4C5IA 3LWHA 1SPKA 1UFFA 1RLQC 4FSSA 2VUBA 1FINB 1W6XA 1ZQ1A 3KHIA 4PFPA 2DIGA 2A08A 4JJCA 3LLRA 3I9QA 3CEYA 4JZ4A 1OGUB 1KQSP 4HVVA 4RTWA 4EORB 1U3OA 5EFQB 5GANj 5KYXA 1SG5A 8AT1B 2HKNA 2FVUA 2KK4A 4FW2A 1WHJA 1NEGA 2RD1A 3O0GD 1OL1B 5FLXE 2W96A 4J8OA 2J05A 3M0SA 4QT7A 1PC0A 5CKEA 3JCMV 4C0GA 1IHWA 2OAUA 2KY9A 3LGFA 2ED0A 4IUTA 4EIKA 3G33B 1Q7YR 1Q81U 1ZA1B 1N8RR 1YNZA 2DD5A 2C5NB 4BCND 3FJPA 4J9CA 3CBPA 2YLCA 2DJQA 4FM4B 3EG9B 5LJ3e 3CCET 2PHGA 1WXUA 3CCVQ 1VQMT 2P0QA 1Z9ZA 3CC7T 1UG1A 4J9EA 5LJ5d 4BCMD 5GAOq 2WJ9A 2MPXC 1Q7YC 4J9FA 2EGEA 3QUIA 4ANJA 1N8RC 4OGEA 1H92A 2DMOA 2C4GB 1VIFA 1X2QA 2VKNA 2WIHB 1A0NB 2R5MA 4AFSC 3A8OB 2Y4XA 3JRZA 1YI2Q 4BI4A 5GAN6 2IW8B 5HCKA 1I8FA 3JB9F 4QW2A 4BCQD 3A8GB 3I56A 1JU5C 4M7AE 3EJ1B 3E2UA 2O4XA 4PJOC 5CKDA 4F7UE 2NLUA 2K7AA 3OYNA 3NDQA 2EGCA 2FRYA 2KT1A 4A4FA 2DBMA 2LTOA 4RCCA 3OYAA 2EKOA 2RPNA 2V1QA 4J9GA 4C5HA 2R7GA 1PD1A 2DD4A 2MWOA 2QDLA 4J5YA 2NWMA 5CCAA 4M77A 1YHQT 3TN8B 4HNTA 3OMCA 4QVZA 2RQTA 4JX4A 2RA2A 1MNEA 2AIRB 2JGZB 2KRNA 3M0UA 4LOCA 2QQ8A 4FYVB 2ZPFB 1QKWA 2O31A 3JCMh 5J26A 3LGLA 4M75C 4BACA 2O01E 4AG2C 4QQ6A 4BE2A 3QPHA 3JCMg 4Z8AA 2LJ1A 3OS1A 4M77D 1QVGP 4ELZC 3JCMJ 1ZSZB 3OS5A 4J9DA 4C5EA 3VKGA 3BLQB 4OB3B 3OBWA 1B07A 5GAMh 2RI2A 3TVTA 4BCIB 2P84A 1E7PA 2F69A 1CKAA 2OTJA 5GAMg 2M0OA 1OKVB 1I4K1 5GANg 2DEUA 2C6TB 2K3BA 1M3BA 3FIFA 1TTHB 3JCMQ 4MDXA 4CFWB 2DL3A 2WSEE 1YCSB 4BY6C 5FU7C 4BCKB 4X9CA 3LYIA 1X6GA 4BE1A 1RLPC 1MMAA 2E6ZA 3GNGA 4M7DG 2QQBA 4BCFB 1KJWA 1VQKA 1LOJA 2JTEA 3A98A 2JT4A 4BI3A 2NUZA 3CPWA 3SWNB 4JUVA 3S6WA 4OP0A 4E7SA 1UB4A 2UZLB 4GY5A 2WXVB 3HPWA 3CXCP 4A63B 2MCNA 2KSSA 2O9VA 1M9SA 3URGA 4DBFA 2F2WA 4MZMA 3EHQA 4AKIA 2DFUA 2RQWA 1WHLA 3ZEHA 4M7AF 2RHIA 4F7UF 2RHUA 2COWA 1QVFS 2CP7A 4ZTFA 4RTUA 5A0LA 2EVRA 4JX5A 2QQ9A 5CIUA 2DTHA 1JJ2S 1C1AA 1BCMA 4DBHA 3OSVA 3CCMT 4LDVA 5I11A 3S3NA 1PHTA 2ROLA 4JJDA 5KE2A 1NYFA 3CCJT 1IO6A 1I07A 2O9SA 2QGGA 3OYYA 4RCBA 3X20B 5HBJB 1UNGD 2LQNA 2J6KA 5CKBA 1VOMA 4ROCA 2DTIA 3M55A 2E41A 4GLKA 3KBGA 3PE0A 2E5KA 1VQ4T 4M78E 4OB0B 3WVEB 2GGRA 3CCRT 3RR6A 2DBKA 3X26B 5KYXB 3S3MA 3AHUA 4PJJA 2CZ6B 4RMOA 1M5Q1 1SHGA 4BCNB 1B7TA 5GJWB 3A8MB 3KUFA 4UC4A 1KFZA 1PKTA 1KIKA 2RJEA 1GCPA 1MGQA 1AWOA 3CCQQ 2HD0A 1YWPA 2VC8A 4C92G 2LW4A 1AT1B 3DOGB 1M3CA 3RBBB 1GY3B 2DD5B 1JO8A 1M27C 1QWFA 4PJLA 5DLQE 3P8DA 3P8BB 1ACMB 1GH6B 3EFSA 5IHYA 4BCPB 2E1HA 1ENWA 2DEQA 3CC2T 4YTLA 3QBYA 4QKUA 4BB7A 4PJNA 2FPDA 2CZ7B 2JNGA 1TSFA 3NTKA 3RKXA 1SF9A 3HTRA 1QP3A 2MI6A 5KCHA 4XAXB 1JQQA 1H1QB 3MEWA 5FGKB 1VQ6T 4E6RA 1BI0A 5C0MA 3EG0A 5IDPB 5HBHB 5L2WB 1WIEA 2YLBA 3OMGA 4BY1X 1LCKA 2OJ2A 4PJOA 3CCJQ 1YP5A 3REBB 2COYA 4OMLA 3CCEA 4ROEA 4ZGJB 1VQMA 2JS0A 3L42A 3CC7A 1ABOA 2O4XB 4J7IA 4G6LB 3OBYA 3TSWA 4PJOD 1YN8A 1VQ4Q 1RABB 4P5NA 2CZ0B 2HNIA 3JSCA 4LD6A 1EX4A 2WSFE 1M1KU 2E64A 1E9HB 4JDSA 1VQ7Q 3CCRQ 4MFDA 1OI1A 4C0FA 3GPLA 2DD4B 1VQPT 4EOPB 4M77B 3O8VA 4M75A 2V26A 1UJ0A 2XIDA 2DXTA 1NEBA 2CREA 2GQIA 3VS5A 2OTLT 4JRPA 2F5TX 4ZGEB 1WZOA 3M0QA 3RKWA 1NJIU 4M78F 4F7SB 1TFBA 1P92A 2PUOB 4XK8E 1RAFB 2WSCE 2ESWA 1FKMA 1ARKA 1MV0B 2KXCA 4M75D 3JCMW 1UDLA 4HLQA 5I5ZB 1QLYA 1K0XA 1OV3A 4RKUE 5GMKj 2KRSA 2QA4Q 1YHQA 1VQNQ 2QDJA 1Q86R 1JJ2A 1B34A 2QQRA 2RHXA 1HD3A 4C8QG 2EIFA 4FT4A 3TQ7P 3CCST 1WHGA 3OYEA 2CSIA 4C0DB 1NBEB 3VS7A 5FWBA 1ZLMA 4LE9A 4KRCB 4M7DC 1BYMA 2CT3A 4DOVA 1XTDA 1Q86C 4IKFA 1OX9A 1IZ6A 3GLXA 3META 4CFMB 1C9BA 3EFRA 2V8KA 4EMKC 3BW1A 2C0TA 1UHFA 3NTHA 4KUIA 3CMET 1M2VA 2DA9A 2HMAA 2DZCA 2ZPIB 3C4SA 1G2BA 2EQUA 5FWCA 4BI8B 2CH4A 3H0FA 3I55A 4M7AC 2LP5A 1Q82R 1VQPQ 1H27B 1LPLA 1JXMA 2VXFA 1R0BG 4ELLA 2FYKA 4CI0C 4FCYA 2DL5A 3HP9A 2FPFA 3CPWP 5CK9A 1KC8R 1D0XA 2MOXA 3A8HB 3DTOA 2XDPA 4EPCA 4J6WA 1WXBA 2DAQA 5GAN8 3C0CA 2OTLQ 3QYHB 1W2BA 1VQ5T 4RTYA 2VGMA 4B9WA 5ICPB 3OS0A 3CMAQ 4M75G 1Q82C 3NGPA 1RAHB 2CCIB 3M0RA 1QMCA 2HSEB 2CH4W 2CP6A 2BIVA 2RJFA 1KC8C 4D8DA 2I53A 3R6NA 3MY1B 5HK0A 3CCLA 3SB2A 1B3QA 3LH0A 5KYNA 4HNUA 4MZPA 4X34A 1XNIA 1H25B 2QI2A 3MEUA 2YUPA 3BG3A 4F17A 2DYIA 2QTXA 4IIMA 4QVDA 3CCSQ 4HXJA 5EC7A 3OW2S 4DEXA 5A0GA 1QP2A 1JRIA 4BDYA 1RI0A 2FG0A 1K8AR 1BI3A 2IN3A 3DDQB 3H6ZA 3VUBA 3CCMA 1ZA2B 1K9AA 3HSBA 3H8ZA 1D1CA 3BY7A 9ATCB 4C92C 5GMKe 2QEXA 3RERA 1YITA 1UGRB 1F1BB 2UUEB 4ZTJA 1Y71A 1SRMA 4EDUA 4HCZA 1K8AC 1PM3A 4EC8B 1E6GA 3QG1A 1QWEA 2DKGA 5D6WA 1RAGB 2E70A 3OQ5A 5GMKi 3CD6A 4Z89A 5GAN5 3CCVT 2G6FX 1KHIA 3I5RA 1N5ZA 4II5B 4HVUA 4Z02A 5ACBA 4LXCA 1WI7A 2QQSA 6AT1B 4NL3A 1RADB 5HVYB 1JB0E 3HZJA 2XU8A 2LZ6B 2MWPA 2KI7A 2K57A 2UZDB 1G3TA 5LJ5h 1ZBJA 1YJWT 3BHTB 5GAOl 2A3LA 2F1LA 2KVQG 2KYBA 2EQKA 2Y90A 3L2ZA 1NLOC 1KSWA 3INZA 3ZL7C 4JJNK 1MUZA 3KXTA 2KGTA 3EG2A 2W9ZA 1BI2A 4PJOB 3PT9A 5CKFA 1VA7A 3WXMB 2AZSA 5GAOm 1BI1A 1W1FA 4XTWA 1GRIA 2RK2A 2LCLA 3L2UA 1VYUA 2M0YA 1EZZB 5GAN4 2PNIA 5CQXA 1JEGA 2L3SA 5FRNA 2WFYB 4JS4A 1K9MR 4BCGB 2YXYA 5GAMj 1VQ6A 3E19A 3M59A 1X43A 2QDYB 2RH2A 3EH1A 2LJ3A 2HZYA 3LQ5B 4BY7X 1ZUKA 3H9NA 4Y28E 3DDPB 4MMKA 2A28A 4FYYB 3A5ZB 4M75B 5LQFB 1AISB 1WA7A 4EONB 3PFSA 2EYYA 4RTTA 1TUGB 1K9MC 2SEMA 2D8HA 2DXCB 1SEMA 2DETA 1QCNA 3DKMA 2CP3A 5ECAA 4BDZA 1RL2A 4WF2A 2KROA 3HB9A 1OKWB 3BHVB 4GLMA 4LDUA 3ULRB 2X1NB 3S3OA 1VQOA 3OYKA 3CCUQ 3FDRA 1NLPC 2LMJA 2HAXA 4BCOB 2E6NA 3PVQA 4B6MA 2CUBA 2L3QA 2F5KA 4MFEA 4C8QC 2OX7A 2I0NA 2YRDA 1B34B 1X2KA 4MZTA 4BY6B 1YJWQ 2ZPHB 4M7DA 5FU7B 5LMKB 2ED1A 3OB9A 2WHBB 3LW5E 1EIFA 2JJ9A 2W99A 3E9GA 4J83A 3R6OA 5KYYA 3MEAA 4LNPA 4EOIB 5I22A 4EMKA 1YJ9A 4QSHA 4OB1B 2XMFA 3MP8A 4LDYA 1OPLA 4KULA 4FSXA 3JB9G 1PD0A 4ZNXA 3TNIB 4AMCA 1WJRA 5I2SA 4M7DD 5GAN2 3C12A 4YOOA 1OZ2A 3OW2A 3G6EQ 1Q81R 4B9XA 1YIJA 5J3BA 3HBLA 2LT1A 1M2VB 2ROTA 2DZ9A 4Q5WA 2BS3A 2DE0X 4E7ZA 4OB2B 2AKLA 2RJDA 1O75A 2FZCB 3A8LB 1FMKA 3GBQA 5KH6A 3QJ6A 3V8JA 3LH5A 1H28B 1Q81C 3ZFJA 1WNLA 3L1AA 2K2MA 1W70A 1JKWA 1AVZC 5GAOn 1WHHA 3JCMe 4A53A 3RMSA 2X4YA 2RO0A 4M77E 4PFOA 4TVRA 2J7IA 3V7SA 1KD1U 1N27A 4LUEA 3CMEA 4N0AA 3NPFA 5EG2A 2B86A 2NUPA 1YCYA 5GAMe 4F14A 5GANe 4X9DA 4JRIA 3X28B 3EGDB 4JJBA 5CKHA 2W10A 4Y91A 1AWWA 3QWLA 5CO7A 3TCJA 1VQ8T 4DBRA 5LJ3d 3VS1A 2EUFA 2ZAEA 1GCQC 1UHCA 2BE9B 5IHIA 3HO8A 1OIUB 3THKA 1D09B 1K4US 3J81E 1VQ5A 2XDDA 2Y4YA 3TSZA 2ZGWA 3BLHB 1TH7A 3M58A 3JB9I 1TU0B 5LL6S 4EOMB 3UT1A 2SRCA 2X3WD 3GIBA 4C92A 1QCFA 1HYOA 1KQSS 2DJZA 1H24B 5CYIB 2WACA 4DBQA 5CR2A 4N4GA 4LD9K 2LRQA 2UZEB 2YT6A 2AHJB 3N5BB 3V8LA 1IGUA 3VUZA 3CCQT 4CRIA 2JZ2A 2FZKB 1SKUB 3MCAB 1SHFA 2A0FB 4D6WA 2XK0A 4CXAB 4C92D 3REAB 4ORZA 2KQWA 1YBYA 1H8KA 2HQXA 3FRNA 4CC4B 1N9SA 2BTTA 3UA6A 4M7AG 2EWNA 4F7UG 1RAAB 3SDZA 1S1NA 3VS6A 3G4SQ 3BDUA 2DPPB 3QO3A 1VQLA 1GUXA 4KRTA 2EGAA 2RQUA 4NL2A 3RESA 2W9FA 1RUWA 4IUUA 4F16A 3I35A 5HK3A 3HFNA 1UGQB 2L0AA 2P4TA 2LCCA 1M90R 4O6JA 3OYJA 2LCSA 8ATCB 2JM9A 4ZN3A 2M1HA 1IRXA 3TNWB 4Z6YA 2EPDA 3ME9A 3M9QA 4M77F 3CCVA 1VQ8Q 1RI9A 4HNVA 2M51A 5GAMd 2JVVA 4NS5A 1M90C 2H8HA 5GANd 4FU6A 3M4GA 4GBQA 2LQ8A 1VQ7T 1O9KA 3F5XB 3X24B 1WJSA 1H1SB 1FXXA 2IW6B 2BS2A 4F04B 1W98B 2K79A 1Y0MA 2XD0A 3QYEA 5LJ5f 2IPOB 3O5ZA 3UATA 1YI2A 5EJCA 3VRZA 1NPPA 4OMMA 4BUGA 4EMGA 2J06A 1TD6A 4IIOA 2EQIA 3M4YA 2IW9B 4BCMB 2YUOA 2JUFA 2RF0A 2E3IA 2QF7A 1KXUA 1OZ3A 1CSKA 4HCCA 4C8QA 3G1JA 2BPMB 3G71T 4E7HA 1QVGS 1K73U 4HT9A 2ZCFB 2EAYA 5IF1B 2QA4T 4E7KA 3BE3A 1OPKA 2ABLA 1VQNT 1ZP2A 2C06A 1NZ9A 2L3RA 2EQJA 5CEIB 4D8KA 3QHSA 4ESRA 4C8QD 5HNBB 2X4XA 4BCQB 4PLIA 4FT2A 3SFMA 4M7DB 2XI9A 3CC4Q 1YFNA 1XJWB 1FYNA 1MMDA 1G3YA 1BU2A 2RHYA 1YJNQ 5KYYB 4EMKB 2ZPEB 4J9BA 4II1A 3MEVA 2L89A 3RGFB 3MIAB 1MMNA 3OYIA 1VQ9Q
chains in the Genus database with same CATH topology
2P0KA 5CVIA 3LGFA 4IUTA 1Q81U 4E47A 2CS7A 3OA6A 2DD5A 5HK0A 3CCLA 4M7DF 3PNWC 1D3BA 3QKJA 3SB2A 3JB9J 3LH0A 4A54A 4AKGA 5I21A 4HNUA 3FJPA 4MZPA 3VJPA 1KD1C 3CBPA 4X34A 1XNIA 2QI2A 2DO3A 2YLCA 3MEUA 4FM4B 4KT0E 5LJ3e 3BG3A 3CCET 2R5AA 2QTXA 2JTFA 1X75C 4ELJA 4MMLA 2EFIA 3DLMA 5DLOA 3CXCS 1VQMT 2P0QA 4QVDA 1NE8A 4XTVA 2ZZDA 3CC7T 1G5VA 3OW2S 2X35A 5LJ5d 1I5LA 5GAOq 2WJ9A 2CYZB 2RI5A 3C94A 4J6XA 3C95A 5A0GA 1QP2A 2FHDA 1JRIA 3QUIA 5KE3A 4BDYA 1Q7YC 1LNXA 1N8RC 1RI0A 2XDBA 4OGEA 1BI3A 3MP1A 2DXCA 3CC4T 5GAN3 2KMGA 3H6ZA 3VUBA 3CCMA 3JCMd 2QXFA 4M78G 2XG8D 3VYGA 3HSBA 5A0DA 2XKOC 3H8ZA 3HKSA 3OYCA 1YJNT 3OSSC 4N4HA 4OF1A 1VIFA 3CMAT 1WQWA 3BY7A 4PKCC 2DXUA 2KDSA 3GNFB 5CQYA 2R5MA 4M77G 4C92C 3A8OB 3BG5A 2Y4XA 1UGRB 5GMKe 2ZPBB 2QEXA 3JRZA 3CCUA 3UDCA 1YITA 3BG9A 4BBSM 4ZTJA 1Y71A 1U1SA 4EDUA 4BI4A 4HCZA 5GAN6 1K8AC 1QVFA 1I8FA 3JB9F 3NTIA 2LQKA 4FL6A 4QW2A 3A8GB 3I56A 1VQ8A 3QG1A 3MP6A 1FWZA 2O4XA 2DKGA 2EJ9A 5FU6B 3OYBA 5CKDA 4F7UE 2MMPA 5D6WA 2NLUA 2E70A 3OQ5A 4A4FA 5GMKi 3OYNA 2IG0A 3PIOA 1YJWA 3CD6A 2QEXT 1QLBA 1YITT 2LTOA 4RCCA 3OYAA 3FC3A 2EKOA 5GAN5 3CCVT 4M78A 1KHIA 1S72T 3ER0A 4XTUA 4Z02A 4C5HA 2QQSA 2FB7A 3E9FA 2DD4A 2MWOA 4ELYC 4NL3A 1JB0E 3ZBDA 2DXBA 4A4HA 3HZJA 4J5YA 2XU8A 4M77A 5CCAA 1YHQT 4XQ3A 2MWPA 2K57A 4HNTA 1G3TA 3OMCA 4QVZA 5LJ5h 3CD6T 1YJWT 4JX4A 2RA2A 4RG8A 5GAOl 2A3LA 3X25B 1HXDA 2KVQG 4V2SA 1HK9A 2EQKA 2Y90A 4C92B 3L2ZA 4ZN1A 4LOCA 3QSUA 2QQ8A 3G6EA 2ZPFB 2PUKB 3INZA 2K2VA 4M78D 4M7AE 4JJNK 3JCMh 5J26A 3LGLA 4M75C 2VV5A 5L8RE 1XQHA 4BACA 2O01E 3KXTA 1M1KC 4QQ6A 4BE2A 3L2WA 3QPHA 3JCMg 3JB9H 1BI2A 2DK3A 3PT9A 5FRMA 4E7IA 3OS1A 4PJOB 4M77D 5CKFA 4ELZC 3WXMB 3JCMJ 1QVPA 3OS5A 4C5EA 5GAOm 1BI1A 1R8OB 4XTWA 3VKGA 2RK2A 2LCLA 3L2UA 2K5FA 4OB3B 3OBWA 2PQWA 5GAMh 3PMIA 3GOXA 5GAN4 4C92F 2RI2A 3SWNC 1E7PA 5CQXA 1LJOA 1W2BS 2F69A 2JOYA 4C8QE 3M53A 3QYBA 1NJIC 5FRNA 5GAMg 2M0OA 4JS4A 2E10A 2OTJA 2X4JA 3M56A 2PVOB 3FB9A 1I4K1 3G7ZA 5GAMj 5GANg 3E19A 1VQ6A 3M59A 1VIEA 2K3YA 4JRQA 2QDYB 2RH2A 4PJOF 1BKBA 1Y96A 3H4CA 3FIFA 2BS4A 4HKEA 4A4KA 2QFZA 4RG2A 3JCMQ 5C6SA 2V8JA 1KQ2A 4MDXA 4Y28E 4MMKA 2IVWA 2WSEE 3A5ZB 4M75B 4BY6C 5FU7C 2GF7A 4X9CA 3CCQA 3PFSA 2L5QA 3LYIA 3CCLT 4BE1A 1SSFA 1K9MC 3RKYA 2G3RA 3ASKA 3P8HA 4ATOA 2DXCB 5D6YA 2E6ZA 3GNGA 4M7DG 1KHCA 2QQBA 3BFMA 3DKMA 4M77C 3VYHB 2RM4A 1UEBA 1U1TA 1VQKA 4BDZA 4M7AB 1RL2A 2VYTA 4WF2A 1LOJA 3HB9A 4BI3A 4F7UB 3PGGA 3CPWA 1PSFA 4JLGA 4LDUA 3SWNB 4JUVA 3JCMb 3S6WA 4OP0A 4MDWA 3V7CA 3S3OA 1VQOA 1KQSA 2K5LA 1UB4A 3HRTA 4GY5A 3FDRA 3HPWA 3PIPA 5HKCA 4M75F 3OYKA 1V29B 3V8KA 2HAXA 2E6NA 2KSSA 3OY9A 4QVCA 2PU9B 2EQMA 3QZ9B 1M9SA 4MFEA 2F5KA 2R58A 3URGA 4C8QC 4A4EA 4QQDA 1G3SA 2E12A 4MZMA 4AKIA 4J7FA 1Q86U 1B34B 3ZEHA 5LJ3f 5GAOp 1VQOT 2P0PA 4MZTA 4BY6B 2ZPHB 4M7AF 4M7DA 5FU7B 2RHIA 5CAIA 4F7UF 2YHTA 2RHUA 3OB9A 3LW5E 5I2MA 1EIFA 1K73C 1QVFS 3E9GA 4M75E 4J83A 2R57A 4ZTFA 5A0LA 3CCJA 3R6OA 3UWNA 3LX7A 3J7AF 4JX5A 2QQ9A 5CIUA 4A4GA 3MEAA 2DTHA 1KG1A 4EMKA 2LX9A 4NC6A 1YJ9A 4QSHA 1QW1A 1JJ2S 4OB1B 3MP8A 4LDYA 2D6FA 4KULA 4FSXA 2CZ1B 2PVDB 3JB9G 3OSVA 4L5GA 3CCMT 1H3ZA 3HFOA 3T9NA 4C0DC 4PJOE 3CXCA 4LDVA 2DVEA 3M54A 1WJRA 4PLLA 5I2SA 4M7DD 5GAN2 2I2LA 3C12A 1OZ2A 2LDMA 3CBMA 4DOWA 3OW2A 2MF2A 4B9XA 4JRKA 4AI6A 3S3NA 1BIBA 5J3BA 5GMKl 2DIQA 1YIJA 3RIRA 5KE2A 3CCJT 3HBLA 3QDRB 2KMTA 2LT1A 3HRUA 3OYYA 4RCBA 3CCUT 1VQ4A 3X20B 4C8QB 4XU3A 3G4SA 1AHJB 2DZ9A 4Q5WA 2BS3A 1YJ9T 3BDLA 4OB2B 3CCRA 1VQ7A 2RJDA 1O75A 4XU0A 1NPRA 3RERA 5CKBA 3A8LB 3RUXA 1X6OA 2RK1A 5KH6A 3I56T 2DTIA 2BKDN 3QJ6A 3V8JA 1Q82U 4E7JA 4LDXA 1YIJT 3M55A 4NOYA 2E41A 4GLKA 1Q81C 3HL8A 3KBGA 4C5GA 5GMKm 3ZFJA 4BE0A 1WNLA 3L1AA 1VQ4T 1I81A 4M78E 4OB0B 1KC8U 2RI3A 3WVEB 3TW6A 5LJ5g 2EJGA 3DL1A 2CKKA 3JCMc 3CCRT 5GAOn 5LJ5j 3CBOA 5AYFA 4C8QF 3X26B 1JBMA 3JCMe 3L2QA 4A53A 3S3MA 1KQ1A 3RMSA 2X4YA 3AHUA 2RO0A 4M77E 2CZ6B 4TVRA 4RMOA 1M5Q1 2GFUA 3V7SA 1VQ9T 1KD1U 3GP8A 3A8MB 1Y07A 1N27A 3KUFA 4UC4A 2H3JA 3LWIA 3CMEA 3TU4K 4N0AA 4ZGDB 1OYXA 2KR6A 1Y7XA 2K5IA 3HRSA 3QJYA 5EG2A 3V7RA 3CC2A 2RJEA 5IAYA 4XTYA 3DB4A 1MGQA 3JB9D 4XTZA 3G6ET 2HD0A 2VC8A 2M9UA 4ME7A 2K3XA 4C92G 1GXIE 3DB3A 1YCYA 5GAMe 2QA4A 3JCMf 1Q7YU 3OYGA 1VQNA 3UPUA 5GANe 4X9DA 4JRIA 3X28B 1N8RU 1KC8C 2DD5B 5DLQE 2HQEA 4M6VA 1D3BB 4QQGA 5CKHA 3P8DA 4Y91A 3QWLA 3P8BB 4PJOC 5CO7A 2LT4A 3EFSA 3TCJA 3VU3C 1VQ8T 3FEOA 2E1HA 4PJOG 2DEQA 5LJ3d 2L8DA 3CC2T 3CPFA 4YTLA 3QBYA 4BB7A 4BBRM 2CZ7B 1FX7A 2JNGA 3MO8A 3NTKA 2XHCA 3RKXA 1M1FA 3JAME 2HBPA 1QP3A 4IUPA 3J80E 5GAMf 3HO8A 3L2VA 2ZZDB 2MI6A 2FL7A 1X01A 5KCHA 3J81E 5GANf 4XAXB 2XDDA 3QYGB 2Y4YA 3QZ5B 2GQVA 1VQ5A 2OTJT 2ZGWA 3FLGA 3MEWA 4M78C 4EMHA 1TH7A 3M58A 3JB9I 1QVGA 5LL6S 1VQ6T 1K8AU 3UT1A 2K4YA 3CPWS 3GIBA 4C92A 1BI0A 5C0MA 3JCMP 1KQSS 3VYGB 2DJZA 5CR2A 2WACA 4JX6A 4N4GA 3OMGA 2YLBA 1PSEA 4LD9K 1UGSB 2LRQA 4JS5A 2KAFA 3GF5A 5FROA 4HA8A 4E7LA 2AHJB 3DLLA 2D0QB 3N5BB 3V8LA 4PJOA 3TEEA 3VUZA 3CCQT 4OGCA 4CRIA 2JZ2A 3WVDB 3MCAB 1ZBXA 3CCEA 4D6WA 1H641 3OYMA 1M8VA 2XK0A 2M16A 4C92D 4ZGJB 1VQPA 1VQMA 2KQWA 1YBYA 2HQXA 3L42A 3CC7A 1VQKT 2O4XB 1VUBA 3PTAA 3FRNA 4N0AC 1MHNA 4J7IA 3SD4A 1N9SA 3OBYA 4M7AG 2EWNA 1M4ZA 4F7UG 3OYHA 2GCXA 1VQPT 4BD3A 4PJOD 1G3WA 1O9SA 4M78B 5IN1A 4P5NA 3SDZA 2CZ0B 2HNIA 5LJ3h 2OTLA 3CC4A 3JSCA 3BDUA 4LD6A 2WSFE 2EYQA 2E64A 4PL6A 1M1KU 1M1GA 4JDSA 5FU6C 4MFDA 1OI1A 2RHZA 4C0FA 3GPLA 2DD4B 2DPPB 3QO3A 3VKHA 4LDWA 5IT9E 1YJNA 5LJ3g 3L2RA 3TREA 3CMAA 1VQLA 5D6XA 4IUQA 4NL2A 2DXBB 3RESA 2A7YA 4M77B 5LJ3j 4IUUA 3O8VA 4M75A 3EAEA 1VQ9A 4XTXA 5HK3A 2XIDA 3HFNA 1N6AA 1UGQB 4M7DE 2DXTA 2P4TA 3OYFA 2LCCA 4VUBA 4O6JA 2OTLT 3OYJA 4JRPA 2F5TX 1WGSA 4ZGEB 5KCOA 3RKWA 1NJIU 4M78F 1VQLT 3VV0A 1P92A 2LVMA 2PUOB 4XK8E 4ZN3A 4DA4A 4M7AA 2M1HA 1ZHIA 1IREB 2WSCE 2JN0A 2D9TA 4F7UA 3JCMW 1FKMA 3SWNA 4Z6YA 5GMKh 4PNOA 4KUDK 4M75D 4AKHA 3ME9A 2E65A 4XU2A 4HLQA 3M9QA 4M77F 4XU1A 3RMQA 3CCSA 2YRVA 3CCVA 4JLIA 1S72A 4HNVA 3M57A 2VGNA 3MHXA 4RKUE 5GAMd 1XOVA 2JVVA 4NS5A 5GMKj 1M90C 3HHTB 2LC4A 4OVAA 5GANd 5LJ5e 3E1SA 2PVGB 4C0ZA 3QIIA 4FU6A 1YHQA 4HL4A 3M4GA 1K9MU 4N4IA 2QDJA 4MIMA 1JJ2A 4M7AD 1B34A 2EJFA 3G4ST 2JTMA 2LQ8A 2QQRA 2LNVA 2RHXA 4HCBA 4C8QG 1VQ7T 2EIFA 3X24B 1WJSA 2MAMA 4FT4A 5A2QE 3CCST 5HY6A 1Y96B 3OYEA 1FXXA 4HT8A 2BS2A 1WPYA 2G77A 2BUDA 5GAOr 4C0DB 2ZPGB 3TW7A 5DM7R 2XD0A 3QYEA 5LJ5f 2RB6A 2CGHA 1YI2A 4M7DC 3G71A 1BYMA 5EJCA 5M9OA 1NPPA 4DOVA 4BUGA 4EMGA 1XTDA 4FIBA 1Q86C 4IKFA 1IZ6A 3M4YA 1BIAA 3GLXA 3META 5GAN7 1UGPB 2V8IA 3EFRA 2B8AA 2V8KA 1N9RA 2VXEA 2XICA 4EMKC 2GFAA 3BW1A 3JCMX 1DJ7B 5DY9A 2JUFA 2X4WA 3PMTA 1WJQA 3NTHA 3OS2A 4KUIA 2QF7A 4J6YA 1OZ3A 3CMET 4IURA 4R56A 4IUVA 4C8QA 3Q1JA 4R55A 4HCCA 1YI2T 2DZCA 3G71T 4E7HA 2ZPIB 4L59A 1W4SA 1QVGS 1K73U 4HT9A 2ZCFB 2EAYA 3C4SA 4C5IA 2EQUA 3LWHA 4BI8B 2QA4T 4E7KA 3I55A 1VQNT 4M7AC 4O5VA 2E5QA 2C06A 3NFCA 2VUBA 1NZ9A 1ZQ1A 3KHIA 2VXFA 2DIGA 5GANh 2L3RA 2FYKA 2EQJA 4CI0C 2DTOA 3HP9A 3LLRA 5CK9A 3F70A 3QHSA 3CEYA 3A8HB 4C8QD 2X4XA 2QQAA 5J39A 2XDPA 4FT2A 4J6WA 1WQ7A 4PLIA 3SFMA 4EPCA 2XI9A 2DAQA 4M7DB 5GANj 5GAN8 3QYHB 3I55T 1W2BA 1G3YA 2RHYA 1U8RA 1VQ5T 3OYLA 2VGMA 4OMFB 2FVUA 2KK4A 4L6V5 2RJCA 3M5AA 4B9WA 3OS0A 3OYDA 2RD1A 4EMKB 4M75G 1Q82C 4DQ2A 2ZPEB 3VKIA 4II1A 3MEVA 2L89A 4C92E 5FLXE 4J8OA 4KBMB 2BIVA 3OYIA 2RJFA 5CKEA 3JCMV 4C0GA 2OAUA 1M90U 3QXEB 2KY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB0 B;  3WVE B;  4ZGE B;  2DD5 A;  2PVO B;  3X26 B;  2PUO B;  2QDY B;  4XK8 E;  1IRE B;  2WSC E;  2CZ6 B;  4FM4 B;  4KT0 E;  3A8M B;  4Y28 E;  4ZGD B;  2ZZD A;  2WSE E;  4RKU E;  2CYZ B;  1GXI E;  3HHT B;  1QP2 A;  2PVG B;  2DXC B;  2DXC A;  3X28 B;  2DD5 B;  3VYH B;  3VYG A;  3X24 B;  2CZ7 B;  1PSF A;  2ZPG B;  3A8O B;  1QP3 A;  1UGR B;  2ZPB B;  1V29 B;  2ZZD B;  3QYG B;  3QZ5 B;  2PU9 B;  3QZ9 B;  3A8G B;  1UGP B;  3VYG B;  1DJ7 B;  2ZPH B;  1PSE A;  1UGS B;  3LW5 E;  2AHJ B;  2D0Q B;  2ZPI B;  2DD4 A;  2ZCF B;  3WVD B;  1JB0 E;  2DXB A;  4OB1 B;  2CZ1 B;  2PVD B;  4ZGJ B;  3X25 B;  2ZPF B;  2PUK B;  3A8H B;  5L8R E;  2O01 E;  3X20 B;  2CZ0 B;  1AHJ B;  3QYH B;  2WSF E;  4OB2 B;  4L6V 5;  2DD4 B;  2DPP B;  3A8L B;  2DXB B;  2ZPE B;  4OB3 B;  1UGQ B;  3QXE B; 
#chains in the Genus database with same CATH topology
 1AOJ A;  2ATC B;  2P0K A;  5CVI A;  1K76 A;  2CS7 A;  3OA6 A;  2HDA A;  4PJO E;  1FMW A;  1D3B A;  3QKJ A;  3JB9 J;  4AKG A;  4HVW A;  1Y57 A;  3VJP A;  2NYS A;  2QG9 B;  2R5A A;  1BK2 A;  1X75 C;  2JTF A;  4ELJ A;  3CXC S;  1S72 Q;  2HQH A;  3C94 A;  2B9R A;  2J6O A;  3C95 A;  2LJ0 A;  1UTI A;  5IXB A;  2DXC A;  3RDV A;  2KMG A;  4LUD A;  2QXF A;  4M78 G;  2XG8 D;  3VYG A;  2XKO C;  3HKS A;  3OYC A;  4N4H A;  2EBP A;  4OF1 A;  1H26 B;  1BCO A;  3CMA T;  2DNU A;  1WQW A;  2CUD A;  4PKC C;  1PKS A;  3GNF B;  5CQY A;  1Z9Q A;  2CT4 A;  2ZPB B;  3UDC A;  3BG9 A;  2HCK A;  1U1S A;  5D7U A;  1WYX A;  4CFU D;  1C0M A;  3G71 Q;  2NUP B;  1QVF A;  1OI9 B;  3NTI A;  2LQK A;  3MI9 B;  3EG1 A;  1FWZ A;  1GCQ A;  2EJ9 A;  5FU6 B;  2MMP A;  1UNL D;  4RTV A;  3PIO A;  1IHV A;  2CSQ A;  1D3U B;  4KH1 B;  4OR5 B;  3ER0 A;  3MJX A;  3D7S B;  1M1K R;  5DQV A;  1TUD A;  4ELY C;  4YOZ A;  2KBT A;  1AZG B;  2DXB A;  3QDF A;  1RAE B;  3EOC B;  4F6U B;  3X25 B;  1HXD A;  4C92 B;  5FW9 A;  2PUK B;  1UGV A;  2HEQ A;  1NJI R;  2VV5 A;  2YRC A;  1M1K C;  1H3H A;  3VS3 A;  1IXD A;  3QHR B;  2F2X A;  2DK3 A;  5FRM A;  2BZ8 A;  4E7I A;  1E7O A;  1QKX A;  2P4R A;  1R0C B;  1QVP A;  2VVK A;  1I5O B;  4UN0 A;  3I5S A;  1KK7 A;  2PQW A;  3GOX A;  3UF4 A;  1WHM A;  4R0K A;  2PK2 A;  2FZG B;  1LJO A;  2JOY A;  3M53 A;  3QYB A;  1NJI C;  1UEC A;  2E10 A;  3CQT A;  1TG0 A;  1FVV B;  2PVO B;  3FB9 A;  2DME A;  1VIE A;  4PJO F;  3H4C A;  2BS4 A;  1V76 A;  2GBQ A;  4AT1 B;  1VQO Q;  4RG2 A;  1H1P B;  1GUX B;  4F7J B;  4Y92 A;  2GF7 A;  3CCQ A;  1AWX A;  3RKY A;  3P8H A;  1K0S A;  2QGS A;  1KHC A;  4M77 C;  2RM4 A;  1UEB A;  3EGD A;  1U1T A;  3RNJ A;  4CFV B;  2QAZ A;  3PGG A;  1HSQ A;  1PSF A;  2FEI A;  1G8X A;  5HKC A;  2HBW A;  1T0J A;  4M75 F;  3V8K A;  3QWX X;  5DQW A;  4QVC A;  1WFW A;  1CKB A;  3QZ9 B;  4X1V A;  2WPA B;  3B57 A;  4QQD A;  2M02 A;  3I56 Q;  1G3S A;  1G3N C;  1O9K B;  2P0P A;  2EYW A;  5CAI A;  4FX3 B;  2YHT A;  5I2M A;  2KE9 A;  4RTZ A;  2EKH A;  2R57 A;  2V22 B;  3CCJ A;  3UWN A;  3LX7 A;  4A4G A;  1KG1 A;  1M2O A;  5BNJ B;  4NC6 A;  2O88 A;  4CFX B;  2CZ1 B;  4WCI A;  1H3Z A;  3HFO A;  4C0D C;  3CXC A;  2DVE A;  3M54 A;  1X6B A;  2I2L A;  2LDM A;  3GTM S;  3CBM A;  4J9I A;  1C6V X;  1BIB A;  5GMK l;  2DIQ A;  3RIR A;  3NHN A;  2QAS A;  2KMT A;  3HRU A;  3EGX A;  3CCU T;  1VQ4 A;  5IHN A;  4C8Q B;  3FJ5 A;  2C5O B;  2YSQ A;  1VQ7 A;  1VYW B;  3CCR A;  4XU0 A;  3M0T A;  5AT1 B;  3RUX A;  2DM1 A;  1X6O A;  2RK1 A;  4EC9 B;  4LDX A;  1JOW A;  4OGR B;  4C5G A;  5GMK m;  1QMZ B;  4BE0 A;  1AZE A;  3BHU B;  2OTJ Q;  5LJ5 g;  4CC3 A;  1T0H A;  3DL1 A;  2CKK A;  2ECZ A;  2KYM A;  1N4M A;  2JXB A;  1OUL A;  1WDX A;  1OOT A;  1Y07 A;  5HQ0 B;  1OYX A;  2DL4 A;  2KR6 A;  1Y7X A;  2K5I A;  3QJY A;  3CC2 A;  3JB9 D;  3G6E T;  2M9U A;  2QK0 A;  2K3X A;  1GXI E;  3DB3 A;  2QA4 A;  1Q7Y U;  3OYG A;  1VQN A;  2L3P A;  3UPU A;  1N8R U;  2DRM A;  2CJM B;  4M6V A;  1D3B B;  2HQE A;  4QQG A;  1URC B;  1VQK Q;  2MK5 A;  2HSP A;  2L8D A;  4RUG A;  1OU9 A;  3CPF A;  1GFC A;  1FX7 A;  1WXT A;  2HBP A;  3L2V A;  2FL7 A;  1X01 A;  3SEM A;  3FLG A;  4M78 C;  3QWY A;  1NYG A;  4HCK A;  1OX8 A;  4TTH A;  4CFU B;  2MIO A;  2K4Y A;  3EID B;  1AD6 A;  3CPW S;  3JCM P;  3VYG B;  2QGF B;  3EFO A;  1UGS B;  4JS5 A;  3GF5 A;  3JV3 A;  1VQL Q;  2EYX A;  2DL8 A;  1ZBX A;  4E2F B;  1UE9 A;  3OYM A;  1M8V A;  4PJM A;  2M16 A;  1VQP A;  1Q95 G;  4F7L B;  2YUN A;  2E3H A;  4JZ3 A;  1UNH D;  3PTA A;  4Y72 B;  1JST B;  3SD4 A;  2RNA A;  3OYH A;  2GCX A;  1G3W A;  2LQW A;  5LJ3 h;  2OTL A;  2X3X D;  2EYQ A;  4PL6 A;  1QVF P;  2RHZ A;  2L2P A;  5LJ3 g;  3L2R A;  3TRE A;  3CMA A;  5D6X A;  3H0H A;  2DXB B;  1IGQ A;  1JJ2 P;  1G83 A;  4EOL B;  2HL3 A;  1H1R B;  5HBE B;  1MMG A;  4M7D E;  4IMY B;  1UJY A;  2CDT A;  1WGS A;  4M4Z A;  5KCO A;  2X51 A;  2A36 A;  4BCJ B;  2LVM A;  4M7A A;  4F7U A;  2D9T A;  2W2H A;  4XU2 A;  4HT8 A;  2C0I A;  3CCS A;  2UZB B;  3M57 A;  2VGN A;  1XOV A;  1OL2 B;  1PG5 B;  3HHT B;  2LC4 A;  4OVA A;  4C0Z A;  1T3S A;  4N4I A;  4MIM A;  4M7A D;  2EJF A;  3G4S T;  2JTM A;  2KRM A;  2LNV A;  2QYZ A;  1VYV A;  2MAM A;  5A2Q E;  5HY6 A;  2K6D A;  2DER A;  2G77 A;  5GAO r;  2K9G A;  2RB6 A;  2CGH A;  5M9O A;  1X27 A;  3MY5 B;  4FIB A;  1AWJ A;  2DL7 A;  2DIL A;  5GAN 7;  1UGP B;  2V8I A;  1W2B P;  1BU1 A;  1N9R A;  2VXE A;  3JCM X;  2KT8 A;  5DY9 A;  3KFV A;  4CFN B;  1OEB A;  4J6Y A;  1M30 A;  3Q1J A;  4EOS B;  3CCE Q;  2CCH B;  4O5V A;  2E5Q A;  3NFC A;  3M03 A;  1VQM Q;  5GAN h;  3CC7 Q;  2DTO A;  1U06 A;  3F70 A;  1TXQ A;  2QQA A;  5J39 A;  2PTK A;  1WQ7 A;  1WX6 A;  5IH2 A;  5GJV B;  3I55 T;  2H3E B;  1U8R A;  1KD1 R;  3OYL A;  4OMF B;  3OYD A;  1OIY B;  1PKD B;  4L6V 5;  2RJC A;  2VB6 A;  3M5A A;  4DQ2 A;  4KGX B;  3VKI A;  4C92 E;  4KBM B;  4AG1 C;  1M90 U;  3QXE B;  4E47 A;  2LNH B;  4M7D F;  3PNW C;  4A54 A;  5I21 A;  3EGX B;  1KD1 C;  2O2O A;  2DO3 A;  4KT0 E;  2KNB B;  2BZY A;  2FRW A;  4F70 B;  4LN2 A;  4OMN A;  4MML A;  2EFI A;  3DLM A;  1NG2 A;  3SHW A;  5DLO A;  1NE8 A;  4XTV A;  2ZZD A;  2PMI B;  1G5V A;  2X35 A;  1I5L A;  2CYZ B;  2RI5 A;  4J6X A;  4AFQ C;  5KE3 A;  3CCL T;  2FHD A;  2C5V B;  1LNX A;  2XDB A;  4KRD B;  1YHQ Q;  3MP1 A;  3CC4 T;  5GAN 3;  1ZUY A;  3JCM d;  5A0D A;  1ZSG A;  1YJN T;  4YC3 B;  3OSS C;  1UUE A;  2DXU A;  2KDS A;  3DLL A;  1VQ9 T;  4M77 G;  3CCU A;  3BG5 A;  4BBS M;  1GL5 A;  2RQV A;  4FL6 A;  4KGZ B;  3NMZ C;  3MP6 A;  3OYB A;  2HL5 C;  4AFZ C;  1IB8 A;  1ZSZ C;  2IG0 A;  1YJW A;  1H4L D;  2QEX T;  1QLB A;  1YIT T;  2MYS A;  3FC3 A;  4M78 A;  1S72 T;  4XTU A;  2I40 B;  1D1B A;  2YUQ A;  5KYW B;  2FB7 A;  3E9F A;  1PWT A;  2AT1 B;  2IIM A;  3EH2 A;  3ZBD A;  4A4H A;  2DX1 A;  4XQ3 A;  2CP2 A;  3I55 Q;  2GTO A;  1PRL C;  4KGV B;  3CD6 T;  1D0Z A;  4RG8 A;  1RAC B;  2F2V A;  2AKK A;  4V2S A;  1HK9 A;  4ZN1 A;  3QSU A;  3VS2 A;  2D8J A;  3G6E A;  4M78 D;  2K2V A;  1EFN A;  5L8R E;  1XQH A;  3EFO B;  3L2W A;  4AFU C;  3JB9 H;  1K1Z A;  3EHR A;  4OMP A;  2FO0 A;  4CRL B;  4BCH B;  1R8O B;  1X69 A;  2K5F A;  3A1P A;  3PMI A;  5KYU A;  2E4H A;  2F2C A;  4C92 F;  3M0P A;  3SWN C;  2G9X B;  4C8Q E;  1W2B S;  3CCL Q;  2X4J A;  1I0C A;  3M56 A;  1YWO A;  3G7Z A;  2JS2 A;  2K3Y A;  4JRQ A;  4FYW B;  1BKB A;  1Y96 A;  4HKE A;  4A4K A;  2KEA A;  1RAI B;  1M3A A;  2QFZ A;  2PK9 B;  5C6S A;  2CP0 A;  2V8J A;  1KQ2 A;  4PFZ A;  2NUT A;  4Z88 A;  2ENM A;  2LX7 A;  2IVW A;  2KR3 A;  4OMQ A;  2L5Q A;  1SSF A;  2G3R A;  3ASK A;  3PVL A;  4ATO A;  1PNJ A;  5D6Y A;  3QHW B;  3BFM A;  3CCM Q;  3VYH B;  4WTO B;  1OQK A;  1F5Q B;  4M7A B;  2VYT A;  2EYZ A;  1ZUU A;  4F7U B;  1AD5 A;  4JLG A;  3JCM b;  1GBR A;  4MDW A;  3V7C A;  1KQS A;  2K5L A;  3HRT A;  2QEX Q;  1SRL A;  1YIT Q;  1K73 R;  1PRM C;  3PIP A;  2X9H A;  3VS0 A;  1V29 B;  3OY9 A;  3OW2 P;  2PU9 B;  3IQL A;  2AZV A;  1TWB A;  2EQM A;  2R58 A;  1I1J A;  4A4E A;  2E12 A;  2KXD A;  4J7F A;  1Q86 U;  2VAS A;  5LJ3 f;  1D0Y A;  5GAO p;  1VQO T;  3CD6 Q;  1BBZ A;  1P5E B;  4RTX A;  5IHK A;  4CC7 A;  1K73 C;  4M75 E;  4KH0 B;  1ABQ A;  3J7A F;  2HKQ B;  4CC2 A;  1NM7 A;  2LX9 A;  4K11 A;  2DYB A;  1QW1 A;  3U23 A;  2D6F A;  2W0Z A;  2PVD B;  3EGU A;  1VIN A;  4L5G A;  3VRY A;  3T9N A;  2FPE A;  2GNC A;  4PLL A;  4EOQ B;  4DOW A;  2MF2 A;  4OMO A;  4JRK A;  4AI6 A;  1U5S A;  4PK4 A;  5IXF A;  2IVX A;  2GTJ A;  3QDR B;  1TUC A;  4XU3 A;  3G4S A;  1AHJ B;  1YJ9 T;  3DJB A;  3BDL A;  2OI3 A;  3EG9 A;  4YOS A;  4ROD A;  7AT1 B;  3CC2 Q;  1NPR A;  1MV3 A;  1JXO A;  3I56 T;  2BKD N;  1Q82 U;  4E7J A;  4FYX B;  1YIJ T;  4NOY A;  1R77 A;  3HL8 A;  2JMA A;  1I81 A;  1KC8 U;  1QCO A;  1WLP B;  2RI3 A;  3TW6 A;  2EJG A;  3JCM c;  5LJ5 j;  1TS9 A;  3CBO A;  5AYF A;  4C8Q F;  1VQ6 Q;  1JBM A;  3L2Q A;  2WMA B;  1KQ1 A;  2Z0W A;  2AK5 A;  2GFU A;  3GP8 A;  2H3J A;  3LWI A;  3TU4 K;  1VQ8 A;  4ZGD B;  3AT1 B;  3HRS A;  3V7R A;  5IAY A;  4XTY A;  3DB4 A;  2JMC A;  4XTZ A;  4ME7 A;  3JCM f;  2WIP B;  2WMB B;  1XO2 A;  4EOK B;  4EOO B;  2J6F A;  3MKD A;  1V1C A;  2D1X A;  2LT4 A;  3VS4 A;  3POM A;  3VU3 C;  3FEO A;  2VWF A;  4PJO G;  4JPB W;  4BBR M;  3MO8 A;  3JAM E;  2XHC A;  2JM8 A;  1M1F A;  2YDL A;  1JSU B;  1T3L A;  3J80 E;  4IUP A;  2RQR A;  5GAM f;  3UA7 A;  2ZZD B;  4BXX X;  2JW4 A;  5GAN f;  3QYG B;  3QZ5 B;  2GQV A;  2OTJ T;  1J3T A;  1FMV A;  2PZ1 A;  4DEY A;  4EMH A;  1QVG A;  1K8A U;  4JX6 A;  1PSE A;  2KAF A;  2BZX A;  5FRO A;  4HA8 A;  4E7L A;  2D0Q B;  3TEE A;  4OGC A;  1VYT A;  3WVD B;  1GBQ A;  1ZSZ A;  2OAW A;  2V1R A;  3TNH B;  1H64 1;  1YJ9 Q;  1D1A A;  2COZ A;  1BB9 A;  1E6H A;  1PCX A;  1VQK T;  4J9H A;  1VUB A;  1AEY A;  4N0A C;  4F6S B;  3K7A M;  1MHN A;  1YIJ Q;  3H0I A;  1QQJ A;  1M4Z A;  4FW1 A;  4BD3 A;  1O9S A;  4M78 B;  5IN1 A;  3CC4 A;  3EG3 A;  1M1G A;  4F6W B;  5FU6 C;  5IT9 E;  1YJN A;  3PO3 S;  2C5X B;  3VKH A;  4LDW A;  2D0N A;  4IUQ A;  2DLP A;  2A7Y A;  5LJ3 j;  2DVJ A;  1WHK A;  3EAE A;  4XTX A;  1VQ9 A;  5IDN B;  1N6A A;  3OYF A;  2DF6 A;  4VUB A;  1VQL T;  2QTV A;  3VV0 A;  4DA4 A;  1ZHI A;  1IRE B;  2JN0 A;  3SWN A;  5GMK h;  4PNO A;  1VOL A;  4KUD K;  4AKH A;  2E65 A;  3CME Q;  4XU1 A;  3RMQ A;  2YRV A;  4JLI A;  1S72 A;  1ZX6 A;  1GFD A;  3MHX A;  2PJQ A;  1MND A;  2EW3 A;  5KYU B;  5LJ5 e;  3E1S A;  2PVG B;  4EOJ B;  3QII A;  3BLR B;  4HL4 A;  1K9M U;  3MPU B;  4HCB A;  1HJD A;  4I3Z B;  1Y96 B;  2RMO A;  1WPY A;  2BUD A;  2YWW A;  2ZPG B;  3TW7 A;  4NST B;  5DM7 R;  2NUT B;  2RN8 A;  2BE7 D;  1M8M A;  1VQ5 Q;  3G71 A;  4F7N B;  2DRK A;  3H41 A;  1TOV A;  1BIA A;  1SSH A;  1LVK A;  2B8A A;  2XIC A;  2GFA A;  1DJ7 B;  2X4W A;  3PMT A;  1WJQ A;  3OS2 A;  2WEV B;  2CP5 A;  4IUR A;  4R56 A;  4IUV A;  4R55 A;  2A37 A;  1OU8 A;  1YI2 T;  2C0O A;  5L23 A;  4L59 A;  1W4S A;  2BKZ B;  5KYW A;  4C5I A;  3LWH A;  1SPK A;  1UFF A;  1RLQ C;  4FSS A;  2VUB A;  1FIN B;  1W6X A;  1ZQ1 A;  3KHI A;  4PFP A;  2DIG A;  2A08 A;  4JJC A;  3LLR A;  3I9Q A;  3CEY A;  4JZ4 A;  1OGU B;  1KQS P;  4HVV A;  4RTW A;  4EOR B;  1U3O A;  5EFQ B;  5GAN j;  5KYX A;  1SG5 A;  8AT1 B;  2HKN A;  2FVU A;  2KK4 A;  4FW2 A;  1WHJ A;  1NEG A;  2RD1 A;  3O0G D;  1OL1 B;  5FLX E;  2W96 A;  4J8O A;  2J05 A;  3M0S A;  4QT7 A;  1PC0 A;  5CKE A;  3JCM V;  4C0G A;  1IHW A;  2OAU A;  2KY9 A;  3LGF A;  2ED0 A;  4IUT A;  4EIK A;  3G33 B;  1Q7Y R;  1Q81 U;  1ZA1 B;  1N8R R;  1YNZ A;  2DD5 A;  2C5N B;  4BCN D;  3FJP A;  4J9C A;  3CBP A;  2YLC A;  2DJQ A;  4FM4 B;  3EG9 B;  5LJ3 e;  3CCE T;  2PHG A;  1WXU A;  3CCV Q;  1VQM T;  2P0Q A;  1Z9Z A;  3CC7 T;  1UG1 A;  4J9E A;  5LJ5 d;  4BCM D;  5GAO q;  2WJ9 A;  2MPX C;  1Q7Y C;  4J9F A;  2EGE A;  3QUI A;  4ANJ A;  1N8R C;  4OGE A;  1H92 A;  2DMO A;  2C4G B;  1VIF A;  1X2Q A;  2VKN A;  2WIH B;  1A0N B;  2R5M A;  4AFS C;  3A8O B;  2Y4X A;  3JRZ A;  1YI2 Q;  4BI4 A;  5GAN 6;  2IW8 B;  5HCK A;  1I8F A;  3JB9 F;  4QW2 A;  4BCQ D;  3A8G B;  3I56 A;  1JU5 C;  4M7A E;  3EJ1 B;  3E2U A;  2O4X A;  4PJO C;  5CKD A;  4F7U E;  2NLU A;  2K7A A;  3OYN A;  3NDQ A;  2EGC A;  2FRY A;  2KT1 A;  4A4F A;  2DBM A;  2LTO A;  4RCC A;  3OYA A;  2EKO A;  2RPN A;  2V1Q A;  4J9G A;  4C5H A;  2R7G A;  1PD1 A;  2DD4 A;  2MWO A;  2QDL A;  4J5Y A;  2NWM A;  5CCA A;  4M77 A;  1YHQ T;  3TN8 B;  4HNT A;  3OMC A;  4QVZ A;  2RQT A;  4JX4 A;  2RA2 A;  1MNE A;  2AIR B;  2JGZ B;  2KRN A;  3M0U A;  4LOC A;  2QQ8 A;  4FYV B;  2ZPF B;  1QKW A;  2O31 A;  3JCM h;  5J26 A;  3LGL A;  4M75 C;  4BAC A;  2O01 E;  4AG2 C;  4QQ6 A;  4BE2 A;  3QPH A;  3JCM g;  4Z8A A;  2LJ1 A;  3OS1 A;  4M77 D;  1QVG P;  4ELZ C;  3JCM J;  1ZSZ B;  3OS5 A;  4J9D A;  4C5E A;  3VKG A;  3BLQ B;  4OB3 B;  3OBW A;  1B07 A;  5GAM h;  2RI2 A;  3TVT A;  4BCI B;  2P84 A;  1E7P A;  2F69 A;  1CKA A;  2OTJ A;  5GAM g;  2M0O A;  1OKV B;  1I4K 1;  5GAN g;  2DEU A;  2C6T B;  2K3B A;  1M3B A;  3FIF A;  1TTH B;  3JCM Q;  4MDX A;  4CFW B;  2DL3 A;  2WSE E;  1YCS B;  4BY6 C;  5FU7 C;  4BCK B;  4X9C A;  3LYI A;  1X6G A;  4BE1 A;  1RLP C;  1MMA A;  2E6Z A;  3GNG A;  4M7D G;  2QQB A;  4BCF B;  1KJW A;  1VQK A;  1LOJ A;  2JTE A;  3A98 A;  2JT4 A;  4BI3 A;  2NUZ A;  3CPW A;  3SWN B;  4JUV A;  3S6W A;  4OP0 A;  4E7S A;  1UB4 A;  2UZL B;  4GY5 A;  2WXV B;  3HPW A;  3CXC P;  4A63 B;  2MCN A;  2KSS A;  2O9V A;  1M9S A;  3URG A;  4DBF A;  2F2W A;  4MZM A;  3EHQ A;  4AKI A;  2DFU A;  2RQW A;  1WHL A;  3ZEH A;  4M7A F;  2RHI A;  4F7U F;  2RHU A;  2COW A;  1QVF S;  2CP7 A;  4ZTF A;  4RTU A;  5A0L A;  2EVR A;  4JX5 A;  2QQ9 A;  5CIU A;  2DTH A;  1JJ2 S;  1C1A A;  1BCM A;  4DBH A;  3OSV A;  3CCM T;  4LDV A;  5I11 A;  3S3N A;  1PHT A;  2ROL A;  4JJD A;  5KE2 A;  1NYF A;  3CCJ T;  1IO6 A;  1I07 A;  2O9S A;  2QGG A;  3OYY A;  4RCB A;  3X20 B;  5HBJ B;  1UNG D;  2LQN A;  2J6K A;  5CKB A;  1VOM A;  4ROC A;  2DTI A;  3M55 A;  2E41 A;  4GLK A;  3KBG A;  3PE0 A;  2E5K A;  1VQ4 T;  4M78 E;  4OB0 B;  3WVE B;  2GGR A;  3CCR T;  3RR6 A;  2DBK A;  3X26 B;  5KYX B;  3S3M A;  3AHU A;  4PJJ A;  2CZ6 B;  4RMO A;  1M5Q 1;  1SHG A;  4BCN B;  1B7T A;  5GJW B;  3A8M B;  3KUF A;  4UC4 A;  1KFZ A;  1PKT A;  1KIK A;  2RJE A;  1GCP A;  1MGQ A;  1AWO A;  3CCQ Q;  2HD0 A;  1YWP A;  2VC8 A;  4C92 G;  2LW4 A;  1AT1 B;  3DOG B;  1M3C A;  3RBB B;  1GY3 B;  2DD5 B;  1JO8 A;  1M27 C;  1QWF A;  4PJL A;  5DLQ E;  3P8D A;  3P8B B;  1ACM B;  1GH6 B;  3EFS A;  5IHY A;  4BCP B;  2E1H A;  1ENW A;  2DEQ A;  3CC2 T;  4YTL A;  3QBY A;  4QKU A;  4BB7 A;  4PJN A;  2FPD A;  2CZ7 B;  2JNG A;  1TSF A;  3NTK A;  3RKX A;  1SF9 A;  3HTR A;  1QP3 A;  2MI6 A;  5KCH A;  4XAX B;  1JQQ A;  1H1Q B;  3MEW A;  5FGK B;  1VQ6 T;  4E6R A;  1BI0 A;  5C0M A;  3EG0 A;  5IDP B;  5HBH B;  5L2W B;  1WIE A;  2YLB A;  3OMG A;  4BY1 X;  1LCK A;  2OJ2 A;  4PJO A;  3CCJ Q;  1YP5 A;  3REB B;  2COY A;  4OML A;  3CCE A;  4ROE A;  4ZGJ B;  1VQM A;  2JS0 A;  3L42 A;  3CC7 A;  1ABO A;  2O4X B;  4J7I A;  4G6L B;  3OBY A;  3TSW A;  4PJO D;  1YN8 A;  1VQ4 Q;  1RAB B;  4P5N A;  2CZ0 B;  2HNI A;  3JSC A;  4LD6 A;  1EX4 A;  2WSF E;  1M1K U;  2E64 A;  1E9H B;  4JDS A;  1VQ7 Q;  3CCR Q;  4MFD A;  1OI1 A;  4C0F A;  3GPL A;  2DD4 B;  1VQP T;  4EOP B;  4M77 B;  3O8V A;  4M75 A;  2V26 A;  1UJ0 A;  2XID A;  2DXT A;  1NEB A;  2CRE A;  2GQI A;  3VS5 A;  2OTL T;  4JRP A;  2F5T X;  4ZGE B;  1WZO A;  3M0Q A;  3RKW A;  1NJI U;  4M78 F;  4F7S B;  1TFB A;  1P92 A;  2PUO B;  4XK8 E;  1RAF B;  2WSC E;  2ESW A;  1FKM A;  1ARK A;  1MV0 B;  2KXC A;  4M75 D;  3JCM W;  1UDL A;  4HLQ A;  5I5Z B;  1QLY A;  1K0X A;  1OV3 A;  4RKU E;  5GMK j;  2KRS A;  2QA4 Q;  1YHQ A;  1VQN Q;  2QDJ A;  1Q86 R;  1JJ2 A;  1B34 A;  2QQR A;  2RHX A;  1HD3 A;  4C8Q G;  2EIF A;  4FT4 A;  3TQ7 P;  3CCS T;  1WHG A;  3OYE A;  2CSI A;  4C0D B;  1NBE B;  3VS7 A;  5FWB A;  1ZLM A;  4LE9 A;  4KRC B;  4M7D C;  1BYM A;  2CT3 A;  4DOV A;  1XTD A;  1Q86 C;  4IKF A;  1OX9 A;  1IZ6 A;  3GLX A;  3MET A;  4CFM B;  1C9B A;  3EFR A;  2V8K A;  4EMK C;  3BW1 A;  2C0T A;  1UHF A;  3NTH A;  4KUI A;  3CME T;  1M2V A;  2DA9 A;  2HMA A;  2DZC A;  2ZPI B;  3C4S A;  1G2B A;  2EQU A;  5FWC A;  4BI8 B;  2CH4 A;  3H0F A;  3I55 A;  4M7A C;  2LP5 A;  1Q82 R;  1VQP Q;  1H27 B;  1LPL A;  1JXM A;  2VXF A;  1R0B G;  4ELL A;  2FYK A;  4CI0 C;  4FCY A;  2DL5 A;  3HP9 A;  2FPF A;  3CPW P;  5CK9 A;  1KC8 R;  1D0X A;  2MOX A;  3A8H B;  3DTO A;  2XDP A;  4EPC A;  4J6W A;  1WXB A;  2DAQ A;  5GAN 8;  3C0C A;  2OTL Q;  3QYH B;  1W2B A;  1VQ5 T;  4RTY A;  2VGM A;  4B9W A;  5ICP B;  3OS0 A;  3CMA Q;  4M75 G;  1Q82 C;  3NGP A;  1RAH B;  2CCI B;  3M0R A;  1QMC A;  2HSE B;  2CH4 W;  2CP6 A;  2BIV A;  2RJF A;  1KC8 C;  4D8D A;  2I53 A;  3R6N A;  3MY1 B;  5HK0 A;  3CCL A;  3SB2 A;  1B3Q A;  3LH0 A;  5KYN A;  4HNU A;  4MZP A;  4X34 A;  1XNI A;  1H25 B;  2QI2 A;  3MEU A;  2YUP A;  3BG3 A;  4F17 A;  2DYI A;  2QTX A;  4IIM A;  4QVD A;  3CCS Q;  4HXJ A;  5EC7 A;  3OW2 S;  4DEX A;  5A0G A;  1QP2 A;  1JRI A;  4BDY A;  1RI0 A;  2FG0 A;  1K8A R;  1BI3 A;  2IN3 A;  3DDQ B;  3H6Z A;  3VUB A;  3CCM A;  1ZA2 B;  1K9A A;  3HSB A;  3H8Z A;  1D1C A;  3BY7 A;  9ATC B;  4C92 C;  5GMK e;  2QEX A;  3RER A;  1YIT A;  1UGR B;  1F1B B;  2UUE B;  4ZTJ A;  1Y71 A;  1SRM A;  4EDU A;  4HCZ A;  1K8A C;  1PM3 A;  4EC8 B;  1E6G A;  3QG1 A;  1QWE A;  2DKG A;  5D6W A;  1RAG B;  2E70 A;  3OQ5 A;  5GMK i;  3CD6 A;  4Z89 A;  5GAN 5;  3CCV T;  2G6F X;  1KHI A;  3I5R A;  1N5Z A;  4II5 B;  4HVU A;  4Z02 A;  5ACB A;  4LXC A;  1WI7 A;  2QQS A;  6AT1 B;  4NL3 A;  1RAD B;  5HVY B;  1JB0 E;  3HZJ A;  2XU8 A;  2LZ6 B;  2MWP A;  2KI7 A;  2K57 A;  2UZD B;  1G3T A;  5LJ5 h;  1ZBJ A;  1YJW T;  3BHT B;  5GAO l;  2A3L A;  2F1L A;  2KVQ G;  2KYB A;  2EQK A;  2Y90 A;  3L2Z A;  1NLO C;  1KSW A;  3INZ A;  3ZL7 C;  4JJN K;  1MUZ A;  3KXT A;  2KGT A;  3EG2 A;  2W9Z A;  1BI2 A;  4PJO B;  3PT9 A;  5CKF A;  1VA7 A;  3WXM B;  2AZS A;  5GAO m;  1BI1 A;  1W1F A;  4XTW A;  1GRI A;  2RK2 A;  2LCL A;  3L2U A;  1VYU A;  2M0Y A;  1EZZ B;  5GAN 4;  2PNI A;  5CQX A;  1JEG A;  2L3S A;  5FRN A;  2WFY B;  4JS4 A;  1K9M R;  4BCG B;  2YXY A;  5GAM j;  1VQ6 A;  3E19 A;  3M59 A;  1X43 A;  2QDY B;  2RH2 A;  3EH1 A;  2LJ3 A;  2HZY A;  3LQ5 B;  4BY7 X;  1ZUK A;  3H9N A;  4Y28 E;  3DDP B;  4MMK A;  2A28 A;  4FYY B;  3A5Z B;  4M75 B;  5LQF B;  1AIS B;  1WA7 A;  4EON B;  3PFS A;  2EYY A;  4RTT A;  1TUG B;  1K9M C;  2SEM A;  2D8H A;  2DXC B;  1SEM A;  2DET A;  1QCN A;  3DKM A;  2CP3 A;  5ECA A;  4BDZ A;  1RL2 A;  4WF2 A;  2KRO A;  3HB9 A;  1OKW B;  3BHV B;  4GLM A;  4LDU A;  3ULR B;  2X1N B;  3S3O A;  1VQO A;  3OYK A;  3CCU Q;  3FDR A;  1NLP C;  2LMJ A;  2HAX A;  4BCO B;  2E6N A;  3PVQ A;  4B6M A;  2CUB A;  2L3Q A;  2F5K A;  4MFE A;  4C8Q C;  2OX7 A;  2I0N A;  2YRD A;  1B34 B;  1X2K A;  4MZT A;  4BY6 B;  1YJW Q;  2ZPH B;  4M7D A;  5FU7 B;  5LMK B;  2ED1 A;  3OB9 A;  2WHB B;  3LW5 E;  1EIF A;  2JJ9 A;  2W99 A;  3E9G A;  4J83 A;  3R6O A;  5KYY A;  3MEA A;  4LNP A;  4EOI B;  5I22 A;  4EMK A;  1YJ9 A;  4QSH A;  4OB1 B;  2XMF A;  3MP8 A;  4LDY A;  1OPL A;  4KUL A;  4FSX A;  3JB9 G;  1PD0 A;  4ZNX A;  3TNI B;  4AMC A;  1WJR A;  5I2S A;  4M7D D;  5GAN 2;  3C12 A;  4YOO A;  1OZ2 A;  3OW2 A;  3G6E Q;  1Q81 R;  4B9X A;  1YIJ A;  5J3B A;  3HBL A;  2LT1 A;  1M2V B;  2ROT A;  2DZ9 A;  4Q5W A;  2BS3 A;  2DE0 X;  4E7Z A;  4OB2 B;  2AKL A;  2RJD A;  1O75 A;  2FZC B;  3A8L B;  1FMK A;  3GBQ A;  5KH6 A;  3QJ6 A;  3V8J A;  3LH5 A;  1H28 B;  1Q81 C;  3ZFJ A;  1WNL A;  3L1A A;  2K2M A;  1W70 A;  1JKW A;  1AVZ C;  5GAO n;  1WHH A;  3JCM e;  4A53 A;  3RMS A;  2X4Y A;  2RO0 A;  4M77 E;  4PFO A;  4TVR A;  2J7I A;  3V7S A;  1KD1 U;  1N27 A;  4LUE A;  3CME A;  4N0A A;  3NPF A;  5EG2 A;  2B86 A;  2NUP A;  1YCY A;  5GAM e;  4F14 A;  5GAN e;  4X9D A;  4JRI A;  3X28 B;  3EGD B;  4JJB A;  5CKH A;  2W10 A;  4Y91 A;  1AWW A;  3QWL A;  5CO7 A;  3TCJ A;  1VQ8 T;  4DBR A;  5LJ3 d;  3VS1 A;  2EUF A;  2ZAE A;  1GCQ C;  1UHC A;  2BE9 B;  5IHI A;  3HO8 A;  1OIU B;  3THK A;  1D09 B;  1K4U S;  3J81 E;  1VQ5 A;  2XDD A;  2Y4Y A;  3TSZ A;  2ZGW A;  3BLH B;  1TH7 A;  3M58 A;  3JB9 I;  1TU0 B;  5LL6 S;  4EOM B;  3UT1 A;  2SRC A;  2X3W D;  3GIB A;  4C92 A;  1QCF A;  1HYO A;  1KQS S;  2DJZ A;  1H24 B;  5CYI B;  2WAC A;  4DBQ A;  5CR2 A;  4N4G A;  4LD9 K;  2LRQ A;  2UZE B;  2YT6 A;  2AHJ B;  3N5B B;  3V8L A;  1IGU A;  3VUZ A;  3CCQ T;  4CRI A;  2JZ2 A;  2FZK B;  1SKU B;  3MCA B;  1SHF A;  2A0F B;  4D6W A;  2XK0 A;  4CXA B;  4C92 D;  3REA B;  4ORZ A;  2KQW A;  1YBY A;  1H8K A;  2HQX A;  3FRN A;  4CC4 B;  1N9S A;  2BTT A;  3UA6 A;  4M7A G;  2EWN A;  4F7U G;  1RAA B;  3SDZ A;  1S1N A;  3VS6 A;  3G4S Q;  3BDU A;  2DPP B;  3QO3 A;  1VQL A;  1GUX A;  4KRT A;  2EGA A;  2RQU A;  4NL2 A;  3RES A;  2W9F A;  1RUW A;  4IUU A;  4F16 A;  3I35 A;  5HK3 A;  3HFN A;  1UGQ B;  2L0A A;  2P4T A;  2LCC A;  1M90 R;  4O6J A;  3OYJ A;  2LCS A;  8ATC B;  2JM9 A;  4ZN3 A;  2M1H A;  1IRX A;  3TNW B;  4Z6Y A;  2EPD A;  3ME9 A;  3M9Q A;  4M77 F;  3CCV A;  1VQ8 Q;  1RI9 A;  4HNV A;  2M51 A;  5GAM d;  2JVV A;  4NS5 A;  1M90 C;  2H8H A;  5GAN d;  4FU6 A;  3M4G A;  4GBQ A;  2LQ8 A;  1VQ7 T;  1O9K A;  3F5X B;  3X24 B;  1WJS A;  1H1S B;  1FXX A;  2IW6 B;  2BS2 A;  4F04 B;  1W98 B;  2K79 A;  1Y0M A;  2XD0 A;  3QYE A;  5LJ5 f;  2IPO B;  3O5Z A;  3UAT A;  1YI2 A;  5EJC A;  3VRZ A;  1NPP A;  4OMM A;  4BUG A;  4EMG A;  2J06 A;  1TD6 A;  4IIO A;  2EQI A;  3M4Y A;  2IW9 B;  4BCM B;  2YUO A;  2JUF A;  2RF0 A;  2E3I A;  2QF7 A;  1KXU A;  1OZ3 A;  1CSK A;  4HCC A;  4C8Q A;  3G1J A;  2BPM B;  3G71 T;  4E7H A;  1QVG S;  1K73 U;  4HT9 A;  2ZCF B;  2EAY A;  5IF1 B;  2QA4 T;  4E7K A;  3BE3 A;  1OPK A;  2ABL A;  1VQN T;  1ZP2 A;  2C06 A;  1NZ9 A;  2L3R A;  2EQJ A;  5CEI B;  4D8K A;  3QHS A;  4ESR A;  4C8Q D;  5HNB B;  2X4X A;  4BCQ B;  4PLI A;  4FT2 A;  3SFM A;  4M7D B;  2XI9 A;  3CC4 Q;  1YFN A;  1XJW B;  1FYN A;  1MMD A;  1G3Y A;  1BU2 A;  2RHY A;  1YJN Q;  5KYY B;  4EMK B;  2ZPE B;  4J9B A;  4II1 A;  3MEV A;  2L89 A;  3RGF B;  3MIA B;  1MMN A;  3OYI A;  1VQ9 Q; 
#chains in the Genus database with same CATH homology
 2P0K A;  5CVI A;  3LGF A;  4IUT A;  1Q81 U;  4E47 A;  2CS7 A;  3OA6 A;  2DD5 A;  5HK0 A;  3CCL A;  4M7D F;  3PNW C;  1D3B A;  3QKJ A;  3SB2 A;  3JB9 J;  3LH0 A;  4A54 A;  4AKG A;  5I21 A;  4HNU A;  3FJP A;  4MZP A;  3VJP A;  1KD1 C;  3CBP A;  4X34 A;  1XNI A;  2QI2 A;  2DO3 A;  2YLC A;  3MEU A;  4FM4 B;  4KT0 E;  5LJ3 e;  3BG3 A;  3CCE T;  2R5A A;  2QTX A;  2JTF A;  1X75 C;  4ELJ A;  4MML A;  2EFI A;  3DLM A;  5DLO A;  3CXC S;  1VQM T;  2P0Q A;  4QVD A;  1NE8 A;  4XTV A;  2ZZD A;  3CC7 T;  1G5V A;  3OW2 S;  2X35 A;  5LJ5 d;  1I5L A;  5GAO q;  2WJ9 A;  2CYZ B;  2RI5 A;  3C94 A;  4J6X A;  3C95 A;  5A0G A;  1QP2 A;  2FHD A;  1JRI A;  3QUI A;  5KE3 A;  4BDY A;  1Q7Y C;  1LNX A;  1N8R C;  1RI0 A;  2XDB A;  4OGE A;  1BI3 A;  3MP1 A;  2DXC A;  3CC4 T;  5GAN 3;  2KMG A;  3H6Z A;  3VUB A;  3CCM A;  3JCM d;  2QXF A;  4M78 G;  2XG8 D;  3VYG A;  3HSB A;  5A0D A;  2XKO C;  3H8Z A;  3HKS A;  3OYC A;  1YJN T;  3OSS C;  4N4H A;  4OF1 A;  1VIF A;  3CMA T;  1WQW A;  3BY7 A;  4PKC C;  2DXU A;  2KDS A;  3GNF B;  5CQY A;  2R5M A;  4M77 G;  4C92 C;  3A8O B;  3BG5 A;  2Y4X A;  1UGR B;  5GMK e;  2ZPB B;  2QEX A;  3JRZ A;  3CCU A;  3UDC A;  1YIT A;  3BG9 A;  4BBS M;  4ZTJ A;  1Y71 A;  1U1S A;  4EDU A;  4BI4 A;  4HCZ A;  5GAN 6;  1K8A C;  1QVF A;  1I8F A;  3JB9 F;  3NTI A;  2LQK A;  4FL6 A;  4QW2 A;  3A8G B;  3I56 A;  1VQ8 A;  3QG1 A;  3MP6 A;  1FWZ A;  2O4X A;  2DKG A;  2EJ9 A;  5FU6 B;  3OYB A;  5CKD A;  4F7U E;  2MMP A;  5D6W A;  2NLU A;  2E70 A;  3OQ5 A;  4A4F A;  5GMK i;  3OYN A;  2IG0 A;  3PIO A;  1YJW A;  3CD6 A;  2QEX T;  1QLB A;  1YIT T;  2LTO A;  4RCC A;  3OYA A;  3FC3 A;  2EKO A;  5GAN 5;  3CCV T;  4M78 A;  1KHI A;  1S72 T;  3ER0 A;  4XTU A;  4Z02 A;  4C5H A;  2QQS A;  2FB7 A;  3E9F A;  2DD4 A;  2MWO A;  4ELY C;  4NL3 A;  1JB0 E;  3ZBD A;  2DXB A;  4A4H A;  3HZJ A;  4J5Y A;  2XU8 A;  4M77 A;  5CCA A;  1YHQ T;  4XQ3 A;  2MWP A;  2K57 A;  4HNT A;  1G3T A;  3OMC A;  4QVZ A;  5LJ5 h;  3CD6 T;  1YJW T;  4JX4 A;  2RA2 A;  4RG8 A;  5GAO l;  2A3L A;  3X25 B;  1HXD A;  2KVQ G;  4V2S A;  1HK9 A;  2EQK A;  2Y90 A;  4C92 B;  3L2Z A;  4ZN1 A;  4LOC A;  3QSU A;  2QQ8 A;  3G6E A;  2ZPF B;  2PUK B;  3INZ A;  2K2V A;  4M78 D;  4M7A E;  4JJN K;  3JCM h;  5J26 A;  3LGL A;  4M75 C;  2VV5 A;  5L8R E;  1XQH A;  4BAC A;  2O01 E;  3KXT A;  1M1K C;  4QQ6 A;  4BE2 A;  3L2W A;  3QPH A;  3JCM g;  3JB9 H;  1BI2 A;  2DK3 A;  3PT9 A;  5FRM A;  4E7I A;  3OS1 A;  4PJO B;  4M77 D;  5CKF A;  4ELZ C;  3WXM B;  3JCM J;  1QVP A;  3OS5 A;  4C5E A;  5GAO m;  1BI1 A;  1R8O B;  4XTW A;  3VKG A;  2RK2 A;  2LCL A;  3L2U A;  2K5F A;  4OB3 B;  3OBW A;  2PQW A;  5GAM h;  3PMI A;  3GOX A;  5GAN 4;  4C92 F;  2RI2 A;  3SWN C;  1E7P A;  5CQX A;  1LJO A;  1W2B S;  2F69 A;  2JOY A;  4C8Q E;  3M53 A;  3QYB A;  1NJI C;  5FRN A;  5GAM g;  2M0O A;  4JS4 A;  2E10 A;  2OTJ A;  2X4J A;  3M56 A;  2PVO B;  3FB9 A;  1I4K 1;  3G7Z A;  5GAM j;  5GAN g;  3E19 A;  1VQ6 A;  3M59 A;  1VIE A;  2K3Y A;  4JRQ A;  2QDY B;  2RH2 A;  4PJO F;  1BKB A;  1Y96 A;  3H4C A;  3FIF A;  2BS4 A;  4HKE A;  4A4K A;  2QFZ A;  4RG2 A;  3JCM Q;  5C6S A;  2V8J A;  1KQ2 A;  4MDX A;  4Y28 E;  4MMK A;  2IVW A;  2WSE E;  3A5Z B;  4M75 B;  4BY6 C;  5FU7 C;  2GF7 A;  4X9C A;  3CCQ A;  3PFS A;  2L5Q A;  3LYI A;  3CCL T;  4BE1 A;  1SSF A;  1K9M C;  3RKY A;  2G3R A;  3ASK A;  3P8H A;  4ATO A;  2DXC B;  5D6Y A;  2E6Z A;  3GNG A;  4M7D G;  1KHC A;  2QQB A;  3BFM A;  3DKM A;  4M77 C;  3VYH B;  2RM4 A;  1UEB A;  1U1T A;  1VQK A;  4BDZ A;  4M7A B;  1RL2 A;  2VYT A;  4WF2 A;  1LOJ A;  3HB9 A;  4BI3 A;  4F7U B;  3PGG A;  3CPW A;  1PSF A;  4JLG A;  4LDU A;  3SWN B;  4JUV A;  3JCM b;  3S6W A;  4OP0 A;  4MDW A;  3V7C A;  3S3O A;  1VQO A;  1KQS A;  2K5L A;  1UB4 A;  3HRT A;  4GY5 A;  3FDR A;  3HPW A;  3PIP A;  5HKC A;  4M75 F;  3OYK A;  1V29 B;  3V8K A;  2HAX A;  2E6N A;  2KSS A;  3OY9 A;  4QVC A;  2PU9 B;  2EQM A;  3QZ9 B;  1M9S A;  4MFE A;  2F5K A;  2R58 A;  3URG A;  4C8Q C;  4A4E A;  4QQD A;  1G3S A;  2E12 A;  4MZM A;  4AKI A;  4J7F A;  1Q86 U;  1B34 B;  3ZEH A;  5LJ3 f;  5GAO p;  1VQO T;  2P0P A;  4MZT A;  4BY6 B;  2ZPH B;  4M7A F;  4M7D A;  5FU7 B;  2RHI A;  5CAI A;  4F7U F;  2YHT A;  2RHU A;  3OB9 A;  3LW5 E;  5I2M A;  1EIF A;  1K73 C;  1QVF S;  3E9G A;  4M75 E;  4J83 A;  2R57 A;  4ZTF A;  5A0L A;  3CCJ A;  3R6O A;  3UWN A;  3LX7 A;  3J7A F;  4JX5 A;  2QQ9 A;  5CIU A;  4A4G A;  3MEA A;  2DTH A;  1KG1 A;  4EMK A;  2LX9 A;  4NC6 A;  1YJ9 A;  4QSH A;  1QW1 A;  1JJ2 S;  4OB1 B;  3MP8 A;  4LDY A;  2D6F A;  4KUL A;  4FSX A;  2CZ1 B;  2PVD B;  3JB9 G;  3OSV A;  4L5G A;  3CCM T;  1H3Z A;  3HFO A;  3T9N A;  4C0D C;  4PJO E;  3CXC A;  4LDV A;  2DVE A;  3M54 A;  1WJR A;  4PLL A;  5I2S A;  4M7D D;  5GAN 2;  2I2L A;  3C12 A;  1OZ2 A;  2LDM A;  3CBM A;  4DOW A;  3OW2 A;  2MF2 A;  4B9X A;  4JRK A;  4AI6 A;  3S3N A;  1BIB A;  5J3B A;  5GMK l;  2DIQ A;  1YIJ A;  3RIR A;  5KE2 A;  3CCJ T;  3HBL A;  3QDR B;  2KMT A;  2LT1 A;  3HRU A;  3OYY A;  4RCB A;  3CCU T;  1VQ4 A;  3X20 B;  4C8Q B;  4XU3 A;  3G4S A;  1AHJ B;  2DZ9 A;  4Q5W A;  2BS3 A;  1YJ9 T;  3BDL A;  4OB2 B;  3CCR A;  1VQ7 A;  2RJD A;  1O75 A;  4XU0 A;  1NPR A;  3RER A;  5CKB A;  3A8L B;  3RUX A;  1X6O A;  2RK1 A;  5KH6 A;  3I56 T;  2DTI A;  2BKD N;  3QJ6 A;  3V8J A;  1Q82 U;  4E7J A;  4LDX A;  1YIJ T;  3M55 A;  4NOY A;  2E41 A;  4GLK A;  1Q81 C;  3HL8 A;  3KBG A;  4C5G A;  5GMK m;  3ZFJ A;  4BE0 A;  1WNL A;  3L1A A;  1VQ4 T;  1I81 A;  4M78 E;  4OB0 B;  1KC8 U;  2RI3 A;  3WVE B;  3TW6 A;  5LJ5 g;  2EJG A;  3DL1 A;  2CKK A;  3JCM c;  3CCR T;  5GAO n;  5LJ5 j;  3CBO A;  5AYF A;  4C8Q F;  3X26 B;  1JBM A;  3JCM e;  3L2Q A;  4A53 A;  3S3M A;  1KQ1 A;  3RMS A;  2X4Y A;  3AHU A;  2RO0 A;  4M77 E;  2CZ6 B;  4TVR A;  4RMO A;  1M5Q 1;  2GFU A;  3V7S A;  1VQ9 T;  1KD1 U;  3GP8 A;  3A8M B;  1Y07 A;  1N27 A;  3KUF A;  4UC4 A;  2H3J A;  3LWI A;  3CME A;  3TU4 K;  4N0A A;  4ZGD B;  1OYX A;  2KR6 A;  1Y7X A;  2K5I A;  3HRS A;  3QJY A;  5EG2 A;  3V7R A;  3CC2 A;  2RJE A;  5IAY A;  4XTY A;  3DB4 A;  1MGQ A;  3JB9 D;  4XTZ A;  3G6E T;  2HD0 A;  2VC8 A;  2M9U A;  4ME7 A;  2K3X A;  4C92 G;  1GXI E;  3DB3 A;  1YCY A;  5GAM e;  2QA4 A;  3JCM f;  1Q7Y U;  3OYG A;  1VQN A;  3UPU A;  5GAN e;  4X9D A;  4JRI A;  3X28 B;  1N8R U;  1KC8 C;  2DD5 B;  5DLQ E;  2HQE A;  4M6V A;  1D3B B;  4QQG A;  5CKH A;  3P8D A;  4Y91 A;  3QWL A;  3P8B B;  4PJO C;  5CO7 A;  2LT4 A;  3EFS A;  3TCJ A;  3VU3 C;  1VQ8 T;  3FEO A;  2E1H A;  4PJO G;  2DEQ A;  5LJ3 d;  2L8D A;  3CC2 T;  3CPF A;  4YTL A;  3QBY A;  4BB7 A;  4BBR M;  2CZ7 B;  1FX7 A;  2JNG A;  3MO8 A;  3NTK A;  2XHC A;  3RKX A;  1M1F A;  3JAM E;  2HBP A;  1QP3 A;  4IUP A;  3J80 E;  5GAM f;  3HO8 A;  3L2V A;  2ZZD B;  2MI6 A;  2FL7 A;  1X01 A;  5KCH A;  3J81 E;  5GAN f;  4XAX B;  2XDD A;  3QYG B;  2Y4Y A;  3QZ5 B;  2GQV A;  1VQ5 A;  2OTJ T;  2ZGW A;  3FLG A;  3MEW A;  4M78 C;  4EMH A;  1TH7 A;  3M58 A;  3JB9 I;  1QVG A;  5LL6 S;  1VQ6 T;  1K8A U;  3UT1 A;  2K4Y A;  3CPW S;  3GIB A;  4C92 A;  1BI0 A;  5C0M A;  3JCM P;  1KQS S;  3VYG B;  2DJZ A;  5CR2 A;  2WAC A;  4JX6 A;  4N4G A;  3OMG A;  2YLB A;  1PSE A;  4LD9 K;  1UGS B;  2LRQ A;  4JS5 A;  2KAF A;  3GF5 A;  5FRO A;  4HA8 A;  4E7L A;  2AHJ B;  3DLL A;  2D0Q B;  3N5B B;  3V8L A;  4PJO A;  3TEE A;  3VUZ A;  3CCQ T;  4OGC A;  4CRI A;  2JZ2 A;  3WVD B;  3MCA B;  1ZBX A;  3CCE A;  4D6W A;  1H64 1;  3OYM A;  1M8V A;  2XK0 A;  2M16 A;  4C92 D;  4ZGJ B;  1VQP A;  1VQM A;  2KQW A;  1YBY A;  2HQX A;  3L42 A;  3CC7 A;  1VQK T;  2O4X B;  1VUB A;  3PTA A;  3FRN A;  4N0A C;  1MHN A;  4J7I A;  3SD4 A;  1N9S A;  3OBY A;  4M7A G;  2EWN A;  1M4Z A;  4F7U G;  3OYH A;  2GCX A;  1VQP T;  4BD3 A;  4PJO D;  1G3W A;  1O9S A;  4M78 B;  5IN1 A;  4P5N A;  3SDZ A;  2CZ0 B;  2HNI A;  5LJ3 h;  2OTL A;  3CC4 A;  3JSC A;  3BDU A;  4LD6 A;  2WSF E;  2EYQ A;  2E64 A;  4PL6 A;  1M1K U;  1M1G A;  4JDS A;  5FU6 C;  4MFD A;  1OI1 A;  2RHZ A;  4C0F A;  3GPL A;  2DD4 B;  2DPP B;  3QO3 A;  3VKH A;  4LDW A;  5IT9 E;  1YJN A;  5LJ3 g;  3L2R A;  3TRE A;  3CMA A;  1VQL A;  5D6X A;  4IUQ A;  4NL2 A;  2DXB B;  3RES A;  2A7Y A;  4M77 B;  5LJ3 j;  4IUU A;  3O8V A;  4M75 A;  3EAE A;  1VQ9 A;  4XTX A;  5HK3 A;  2XID A;  3HFN A;  1N6A A;  1UGQ B;  4M7D E;  2DXT A;  2P4T A;  3OYF A;  2LCC A;  4VUB A;  4O6J A;  2OTL T;  3OYJ A;  4JRP A;  2F5T X;  1WGS A;  4ZGE B;  5KCO A;  3RKW A;  1NJI U;  4M78 F;  1VQL T;  3VV0 A;  1P92 A;  2LVM A;  2PUO B;  4XK8 E;  4ZN3 A;  4DA4 A;  4M7A A;  2M1H A;  1ZHI A;  1IRE B;  2WSC E;  2JN0 A;  2D9T A;  4F7U A;  3JCM W;  1FKM A;  3SWN A;  4Z6Y A;  5GMK h;  4PNO A;  4KUD K;  4M75 D;  4AKH A;  3ME9 A;  2E65 A;  4XU2 A;  4HLQ A;  3M9Q A;  4M77 F;  4XU1 A;  3RMQ A;  3CCS A;  2YRV A;  3CCV A;  4JLI A;  1S72 A;  4HNV A;  3M57 A;  2VGN A;  3MHX A;  4RKU E;  5GAM d;  1XOV A;  2JVV A;  4NS5 A;  5GMK j;  1M90 C;  3HHT B;  2LC4 A;  4OVA A;  5GAN d;  5LJ5 e;  3E1S A;  2PVG B;  4C0Z A;  3QII A;  4FU6 A;  1YHQ A;  4HL4 A;  3M4G A;  1K9M U;  4N4I A;  2QDJ A;  4MIM A;  1JJ2 A;  4M7A D;  1B34 A;  2EJF A;  3G4S T;  2JTM A;  2LQ8 A;  2QQR A;  2LNV A;  2RHX A;  4HCB A;  4C8Q G;  1VQ7 T;  2EIF A;  3X24 B;  1WJS A;  2MAM A;  4FT4 A;  5A2Q E;  3CCS T;  5HY6 A;  1Y96 B;  3OYE A;  1FXX A;  4HT8 A;  2BS2 A;  1WPY A;  2G77 A;  2BUD A;  5GAO r;  4C0D B;  2ZPG B;  3TW7 A;  5DM7 R;  2XD0 A;  3QYE A;  5LJ5 f;  2RB6 A;  2CGH A;  1YI2 A;  4M7D C;  3G71 A;  1BYM A;  5EJC A;  5M9O A;  1NPP A;  4DOV A;  4BUG A;  4EMG A;  1XTD A;  4FIB A;  1Q86 C;  4IKF A;  1IZ6 A;  3M4Y A;  1BIA A;  3GLX A;  3MET A;  5GAN 7;  1UGP B;  2V8I A;  3EFR A;  2B8A A;  2V8K A;  1N9R A;  2VXE A;  2XIC A;  4EMK C;  2GFA A;  3BW1 A;  3JCM X;  1DJ7 B;  5DY9 A;  2JUF A;  2X4W A;  3PMT A;  1WJQ A;  3NTH A;  3OS2 A;  4KUI A;  2QF7 A;  4J6Y A;  1OZ3 A;  3CME T;  4IUR A;  4R56 A;  4IUV A;  4C8Q A;  3Q1J A;  4R55 A;  4HCC A;  1YI2 T;  2DZC A;  3G71 T;  4E7H A;  2ZPI B;  4L59 A;  1W4S A;  1QVG S;  1K73 U;  4HT9 A;  2ZCF B;  2EAY A;  3C4S A;  4C5I A;  2EQU A;  3LWH A;  4BI8 B;  2QA4 T;  4E7K A;  3I55 A;  1VQN T;  4M7A C;  4O5V A;  2E5Q A;  2C06 A;  3NFC A;  2VUB A;  1NZ9 A;  1ZQ1 A;  3KHI A;  2VXF A;  2DIG A;  5GAN h;  2L3R A;  2FYK A;  2EQJ A;  4CI0 C;  2DTO A;  3HP9 A;  3LLR A;  5CK9 A;  3F70 A;  3QHS A;  3CEY A;  3A8H B;  4C8Q D;  2X4X A;  2QQA A;  5J39 A;  2XDP A;  4FT2 A;  4J6W A;  1WQ7 A;  4PLI A;  3SFM A;  4EPC A;  2XI9 A;  2DAQ A;  4M7D B;  5GAN j;  5GAN 8;  3QYH B;  3I55 T;  1W2B A;  1G3Y A;  2RHY A;  1U8R A;  1VQ5 T;  3OYL A;  2VGM A;  4OMF B;  2FVU A;  2KK4 A;  4L6V 5;  2RJC A;  3M5A A;  4B9W A;  3OS0 A;  3OYD A;  2RD1 A;  4EMK B;  4M75 G;  1Q82 C;  4DQ2 A;  2ZPE B;  3VKI A;  4II1 A;  3MEV A;  2L89 A;  4C92 E;  5FLX E;  4J8O A;  4KBM B;  2BIV A;  3OYI A;  2RJF A;  5CKE A;  3JCM V;  4C0G A;  2OAU A;  1M90 U;  3QXE B;  2KY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...