2WFYB

Truncation and optimisation of peptide inhibitors of cdk2, cyclin a through structure guided design
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Truncation and Optimisation of Peptide Inhibitors of Cyclin-Dependent Kinase 2-Cyclin a Through Structure-Guided Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wfyB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wfyB02
2QDJA 3RGFB 5LMKB 2C4GB 2W2HA 4CXAB 1ZP2A 4CFVB 4BCOB 4OGRB 1JSTB 1FINB 4EOOB 4BCIB 1H24B 1AISB 2C5VB 5HQ0B 2WEVB 5HBJB 4BCGB 4BCHB 4BCFB 2CJMB 2G9XB 1GUXA 3BHVB 1OKVB 1OIYB 2PK2A 2W9ZA 3MY5B 4EC9B 4CRLB 5EFQB 2W96A 2WIHB 4Y72B 4F7NB 3DDPB 1W98B 5ACBA 4BCJB 3DOGB 1G3NC 4F7JB 1H1SB 1UNGD 2BPMB 2W9FA 4CFUD 2WPAB 4CFUB 5HVYB 4BCPB 3EIDB 5BNJB 1VOLA 4YOOA 4I3ZB 2F2CA 2R7GA 1OIUB 4KRDB 1H25B 1P5EB 4UN0A 3BLHB 3POMA 4F70B 1OKWB 2WIPB 3G33B 5HBHB 5HNBB 1GUXB 2BKZB 4EOIB 1UNHD 3F5XB 2C6TB 4TTHA 2V22B 5IDNB 4EOKB 4F7LB 2PHGA 4CFXB 3TNWB 1PKDB 4YC3B 2X1NB 1OL1B 1H26B 2JGZB 2WXVB 4FX3B 2C5XB 5CYIB 3BLRB 5I5ZB 4NSTB 5IF1B 1JKWA 3O0GD 4IMYB 2IW6B 3BHTB 3QHWB 3TNHB 1QMZB 2IW9B 4G6LB 5ICPB 1C9BA 2IW8B 1OL2B 2WFYB 4F6WB 2PMIB 1H28B 1O9KA 1OI9B 2C5OB 4YOZA 3MY1B 4ELLA 2C5NB 4ROEA 1JOWA 1KXUA 3MIAB 2CCIB 4YOSA 4EOJB 1JSUB 5L2WB 1OGUB 2EUFA 1F5QB 1H27B 4BCMD 4OR5B 3K7AM 4F6UB 3MI9B 4BCMB 1N4MA 4CFNB 4CFWB 2WMAB 4ROCA 2UZDB 1URCB 3LQ5B 4BCQD 4EC8B 2PK9B 4BCQB 4EOQB 5CEIB 5HBEB 1XO2A 1O9KB 2UZLB 1H4LD 1BU2A 2UZEB 2B9RA 1VYWB 3EOCB 4EOMB 4BCKB 2I40B 3QHRB 4RODA 5FGKB 5LQFB 4EONB 1FVVB 2UUEB 3EJ1B 4F7SB 3H4CA 4CFMB 4KRCB 4EOSB 3DDQB 4EOPB 1VINA 4II5B 1H1RB 1E9HB 1AD6A 2WMBB 4EORB 1GH6B 5IDPB 1H1PB 1GY3B 3BHUB 3M03A 3TN8B 4BCNB 4BCND 4ELJA 1UNLD 2UZBB 3TNIB 2W99A 2I53A 2CCHB 2WHBB 1D3UB 1H1QB 1TFBA 3BLQB 4F6SB 2IVXA 4EOLB
chains in the Genus database with same CATH superfamily
3DJBA 4OB0B 3RGFB 5LMKB 1ZP2A 1JSTB 4NC6A 1AISB 3TW7A 4BCFB 1OIYB 2W9ZA 4EC9B 2ZPGB 3DDPB 3HHTB 5ACBA 1ENWA 2BS3A 1UNGD 2DD4B 3EIDB 4UN0A 2CZ1B 2WJ9A 3BLHB 1OKWB 2WIPB 3G33B 2BKZB 2PHGA 2QGSA 3HZJA 2X1NB 5I5ZB 4NSTB 4IMYB 3B57A 1QMZB 1C9BA 1H28B 4YOZA 4QSHA 3MY1B 2C5NB 4HNTA 1JOWA 2CCIB 4HNUA 3PO3S 4BCMB 1N4MA 4JX6A 4HL4A 4EC8B 5CEIB 2G77A 2UZLB 1O9KB 1H4LD 1BU2A 2B9RA 3EOCB 3X26B 1UGSB 4HLQA 2UUEB 4F7SB 3TW6A 3QYHB 2WMBB 2QDYB 4EORB 4BBRM 3QYBA 3M03A 3TN8B 1UNLD 2UZBB 3A8MB 1H1QB 3BLQB 4F6SB 2DXBB 3X20B 2C4GB 4MFDA 2W2HA 4CFVB 3DTOA 1FINB 2WEVB 5HBJB 2DD5B 3A8HB 2G9XB 3KHIA 3X28B 2DXCB 1W98B 3DOGB 3A8OB 4CFUD 4LOCA 2QF7A 1VOLA 4YOOA 3HB9A 1OIUB 1P5EB 4F70B 1GUXB 4EOIB 2C6TB 4AKIA 4EOKB 4F7LB 2LW4A 3HO8A 3TNWB 4YC3B 3QYGB 5EJCA 2C5XB 2QFZA 4BY7X 1JKWA 3BHTB 3TNHB 5DQWA 3QZ9B 2WFYB 4F6WB 2PMIB 4BXXX 1OI9B 2C5OB 1KXUA 4OR5B 4F6UB 3MI9B 4CFNB 4CFWB 3WVEB 1QLBA 1URCB 4ZGDB 2PK9B 4BCQB 4EOQB 3VKHA 1XO2A 4BCKB 3X24B 4AKGA 3EJ1B 2ZPIB 3H4CA 4AKHA 4EOSB 3DDQB 4II5B 3A8LB 4ZGJB 1H1PB 3BHUB 5BNJB 4BCNB 1TD6A 4OB2B 1TFBA 2IVXA 4EOLB 2ZCFB 2QDJA 2CYZB 4CXAB 2ZPBB 4BCIB 1H24B 5HQ0B 3BG5A 2DMEA 5DQVA 4BCHB 3QWLA 2CJMB 3BG9A 3BHVB 2PK2A 3MY5B 4BY1X 2ZPEB 4Y72B 4HNVA 4BCJB 1G3NC 4F7JB 1H1SB 2BPMB 4BCPB 3DL1A 1FKMA 3HBLA 2F2CA 3VYHB 2R7GA 3POMA 2CZ6B 5HBHB 1UNHD 3WVDB 5IDNB 1IREB 2CZ0B 2ZZDB 2JGZB 2WXVB 3BLRB 3O0GD 4FM4B 2IW6B 3QHWB 4Z6YA 5ICPB 2IW8B 1OL2B 1O9KA 1UGRB 4MFEA 3MIAB 4YOSA 1JSUB 1OGUB 2EUFA 2PJQA 1H27B 4BCMD 3K7AM 3X25B 3LQ5B 2QQ8A 4ZGEB 4AI6A 2UZEB 1VYWB 3VYGB 4EOMB 4OB3B 4RODA 2AHJB 1H1RB 1E9HB 5IDPB 1GY3B 3TNIB 4JX4A 2W99A 1D3UB 2DPPB 1V29B 2IN3A 2BS4A 3BG3A 4BCOB 4OGRB 4EOOB 3QZ5B 2C5VB 3NDQA 4BCGB 4OB1B 1GUXA 2ZPHB 1OKVB 4CRLB 5EFQB 2W96A 2WIHB 4F7NB 1UGPB 3QXEB 2W9FA 2WPAB 2ZPFB 3QYEA 4CFUB 5HVYB 4I3ZB 4KRDB 1H25B 4JX5A 5HNBB 4TTHA 3F5XB 2V22B 4CFXB 1PKDB 5CYIB 1OL1B 1H26B 4BBSM 4FX3B 2D0QB 3VKGA 5IF1B 2IW9B 4G6LB 2CZ7B 4MIMA 4ELLA 4ROEA 4EOJB 1F5QB 2BS2A 4ROCA 2WMAB 2UZDB 2KMGA 4BCQD 2KR6A 5HBEB 1UGQB 2I40B 3QHRB 5FGKB 5LQFB 4EONB 1FVVB 4M6VA 4CFMB 4KRCB 1E7PA 4EOPB 1VINA 1AD6A 1AHJB 1GH6B 5IHYA 4BCND 4ELJA 3A8GB 2I53A 2CCHB 2WHBB 3GTMS 5L2WB
chains in the Genus database with same CATH topology
2QDJA 3RGFB 5LMKB 2C4GB 2W2HA 4CXAB 1ZP2A 4CFVB 4BCOB 4OGRB 1JSTB 1FINB 4EOOB 4BCIB 1H24B 1AISB 2C5VB 5HQ0B 2WEVB 5HBJB 4BCGB 4BCHB 4BCFB 2CJMB 2G9XB 1GUXA 3BHVB 1OKVB 1OIYB 2PK2A 2W9ZA 3MY5B 4EC9B 4CRLB 5EFQB 2W96A 2WIHB 4Y72B 4F7NB 3DDPB 1W98B 5ACBA 4BCJB 3DOGB 1G3NC 4F7JB 1H1SB 1UNGD 2BPMB 2W9FA 4CFUD 2WPAB 4CFUB 5HVYB 4BCPB 3EIDB 5BNJB 1VOLA 4YOOA 4I3ZB 2F2CA 2R7GA 1OIUB 4KRDB 1H25B 1P5EB 4UN0A 3BLHB 3POMA 4F70B 1OKWB 2WIPB 3G33B 5HBHB 5HNBB 1GUXB 2BKZB 4EOIB 1UNHD 3F5XB 2C6TB 4TTHA 2V22B 5IDNB 4EOKB 4F7LB 2PHGA 4CFXB 3TNWB 1PKDB 4YC3B 2X1NB 1OL1B 1H26B 2JGZB 2WXVB 4FX3B 2C5XB 5CYIB 3BLRB 5I5ZB 4NSTB 5IF1B 1JKWA 3O0GD 4IMYB 2IW6B 3BHTB 3QHWB 3TNHB 1QMZB 2IW9B 4G6LB 5ICPB 1C9BA 2IW8B 1OL2B 2WFYB 4F6WB 2PMIB 1H28B 1O9KA 1OI9B 2C5OB 4YOZA 3MY1B 4ELLA 2C5NB 4ROEA 1JOWA 1KXUA 3MIAB 2CCIB 4YOSA 4EOJB 1JSUB 5L2WB 1OGUB 2EUFA 1F5QB 1H27B 4BCMD 4OR5B 3K7AM 4F6UB 3MI9B 4BCMB 1N4MA 4CFNB 4CFWB 2WMAB 4ROCA 2UZDB 1URCB 3LQ5B 4BCQD 4EC8B 2PK9B 4BCQB 4EOQB 5CEIB 5HBEB 1XO2A 1O9KB 2UZLB 1H4LD 1BU2A 2UZEB 2B9RA 1VYWB 3EOCB 4EOMB 4BCKB 2I40B 3QHRB 4RODA 5FGKB 5LQFB 4EONB 1FVVB 2UUEB 3EJ1B 4F7SB 3H4CA 4CFMB 4KRCB 4EOSB 3DDQB 4EOPB 1VINA 4II5B 1H1RB 1E9HB 1AD6A 2WMBB 4EORB 1GH6B 5IDPB 1H1PB 1GY3B 3BHUB 3M03A 3TN8B 4BCNB 4BCND 4ELJA 1UNLD 2UZBB 3TNIB 2W99A 2I53A 2CCHB 2WHBB 1D3UB 1H1QB 1TFBA 3BLQB 4F6SB 2IVXA 4EOLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDJ A;  3RGF B;  5LMK B;  2C4G B;  2W2H A;  4CXA B;  1ZP2 A;  4CFV B;  4BCO B;  4OGR B;  1JST B;  1FIN B;  4EOO B;  4BCI B;  1H24 B;  1AIS B;  2C5V B;  5HQ0 B;  2WEV B;  5HBJ B;  4BCG B;  4BCH B;  4BCF B;  2CJM B;  2G9X B;  1GUX A;  3BHV B;  1OKV B;  1OIY B;  2PK2 A;  2W9Z A;  3MY5 B;  4EC9 B;  4CRL B;  5EFQ B;  2W96 A;  2WIH B;  4Y72 B;  4F7N B;  3DDP B;  1W98 B;  5ACB A;  4BCJ B;  3DOG B;  1G3N C;  4F7J B;  1H1S B;  1UNG D;  2BPM B;  2W9F A;  4CFU D;  2WPA B;  4CFU B;  5HVY B;  4BCP B;  3EID B;  5BNJ B;  1VOL A;  4YOO A;  4I3Z B;  2F2C A;  2R7G A;  1OIU B;  4KRD B;  1H25 B;  1P5E B;  4UN0 A;  3BLH B;  3POM A;  4F70 B;  1OKW B;  2WIP B;  3G33 B;  5HBH B;  5HNB B;  1GUX B;  2BKZ B;  4EOI B;  1UNH D;  3F5X B;  2C6T B;  4TTH A;  2V22 B;  5IDN B;  4EOK B;  4F7L B;  2PHG A;  4CFX B;  3TNW B;  1PKD B;  4YC3 B;  2X1N B;  1OL1 B;  1H26 B;  2JGZ B;  2WXV B;  4FX3 B;  2C5X B;  5CYI B;  3BLR B;  5I5Z B;  4NST B;  5IF1 B;  1JKW A;  3O0G D;  4IMY B;  2IW6 B;  3BHT B;  3QHW B;  3TNH B;  1QMZ B;  2IW9 B;  4G6L B;  5ICP B;  1C9B A;  2IW8 B;  1OL2 B;  2WFY B;  4F6W B;  2PMI B;  1H28 B;  1O9K A;  1OI9 B;  2C5O B;  4YOZ A;  3MY1 B;  4ELL A;  2C5N B;  4ROE A;  1JOW A;  1KXU A;  3MIA B;  2CCI B;  4YOS A;  4EOJ B;  1JSU B;  5L2W B;  1OGU B;  2EUF A;  1F5Q B;  1H27 B;  4BCM D;  4OR5 B;  3K7A M;  4F6U B;  3MI9 B;  4BCM B;  1N4M A;  4CFN B;  4CFW B;  2WMA B;  4ROC A;  2UZD B;  1URC B;  3LQ5 B;  4BCQ D;  4EC8 B;  2PK9 B;  4BCQ B;  4EOQ B;  5CEI B;  5HBE B;  1XO2 A;  1O9K B;  2UZL B;  1H4L D;  1BU2 A;  2UZE B;  2B9R A;  1VYW B;  3EOC B;  4EOM B;  4BCK B;  2I40 B;  3QHR B;  4ROD A;  5FGK B;  5LQF B;  4EON B;  1FVV B;  2UUE B;  3EJ1 B;  4F7S B;  3H4C A;  4CFM B;  4KRC B;  4EOS B;  3DDQ B;  4EOP B;  1VIN A;  4II5 B;  1H1R B;  1E9H B;  1AD6 A;  2WMB B;  4EOR B;  1GH6 B;  5IDP B;  1H1P B;  1GY3 B;  3BHU B;  3M03 A;  3TN8 B;  4BCN B;  4BCN D;  4ELJ A;  1UNL D;  2UZB B;  3TNI B;  2W99 A;  2I53 A;  2CCH B;  2WHB B;  1D3U B;  1H1Q B;  1TFB A;  3BLQ B;  4F6S B;  2IVX A;  4EOL B; 
#chains in the Genus database with same CATH topology
 3DJB A;  4OB0 B;  3RGF B;  5LMK B;  1ZP2 A;  1JST B;  4NC6 A;  1AIS B;  3TW7 A;  4BCF B;  1OIY B;  2W9Z A;  4EC9 B;  2ZPG B;  3DDP B;  3HHT B;  5ACB A;  1ENW A;  2BS3 A;  1UNG D;  2DD4 B;  3EID B;  4UN0 A;  2CZ1 B;  2WJ9 A;  3BLH B;  1OKW B;  2WIP B;  3G33 B;  2BKZ B;  2PHG A;  2QGS A;  3HZJ A;  2X1N B;  5I5Z B;  4NST B;  4IMY B;  3B57 A;  1QMZ B;  1C9B A;  1H28 B;  4YOZ A;  4QSH A;  3MY1 B;  2C5N B;  4HNT A;  1JOW A;  2CCI B;  4HNU A;  3PO3 S;  4BCM B;  1N4M A;  4JX6 A;  4HL4 A;  4EC8 B;  5CEI B;  2G77 A;  2UZL B;  1O9K B;  1H4L D;  1BU2 A;  2B9R A;  3EOC B;  3X26 B;  1UGS B;  4HLQ A;  2UUE B;  4F7S B;  3TW6 A;  3QYH B;  2WMB B;  2QDY B;  4EOR B;  4BBR M;  3QYB A;  3M03 A;  3TN8 B;  1UNL D;  2UZB B;  3A8M B;  1H1Q B;  3BLQ B;  4F6S B;  2DXB B;  3X20 B;  2C4G B;  4MFD A;  2W2H A;  4CFV B;  3DTO A;  1FIN B;  2WEV B;  5HBJ B;  2DD5 B;  3A8H B;  2G9X B;  3KHI A;  3X28 B;  2DXC B;  1W98 B;  3DOG B;  3A8O B;  4CFU D;  4LOC A;  2QF7 A;  1VOL A;  4YOO A;  3HB9 A;  1OIU B;  1P5E B;  4F70 B;  1GUX B;  4EOI B;  2C6T B;  4AKI A;  4EOK B;  4F7L B;  2LW4 A;  3HO8 A;  3TNW B;  4YC3 B;  3QYG B;  5EJC A;  2C5X B;  2QFZ A;  4BY7 X;  1JKW A;  3BHT B;  3TNH B;  5DQW A;  3QZ9 B;  2WFY B;  4F6W B;  2PMI B;  4BXX X;  1OI9 B;  2C5O B;  1KXU A;  4OR5 B;  4F6U B;  3MI9 B;  4CFN B;  4CFW B;  3WVE B;  1QLB A;  1URC B;  4ZGD B;  2PK9 B;  4BCQ B;  4EOQ B;  3VKH A;  1XO2 A;  4BCK B;  3X24 B;  4AKG A;  3EJ1 B;  2ZPI B;  3H4C A;  4AKH A;  4EOS B;  3DDQ B;  4II5 B;  3A8L B;  4ZGJ B;  1H1P B;  3BHU B;  5BNJ B;  4BCN B;  1TD6 A;  4OB2 B;  1TFB A;  2IVX A;  4EOL B;  2ZCF B;  2QDJ A;  2CYZ B;  4CXA B;  2ZPB B;  4BCI B;  1H24 B;  5HQ0 B;  3BG5 A;  2DME A;  5DQV A;  4BCH B;  3QWL A;  2CJM B;  3BG9 A;  3BHV B;  2PK2 A;  3MY5 B;  4BY1 X;  2ZPE B;  4Y72 B;  4HNV A;  4BCJ B;  1G3N C;  4F7J B;  1H1S B;  2BPM B;  4BCP B;  3DL1 A;  1FKM A;  3HBL A;  2F2C A;  3VYH B;  2R7G A;  3POM A;  2CZ6 B;  5HBH B;  1UNH D;  3WVD B;  5IDN B;  1IRE B;  2CZ0 B;  2ZZD B;  2JGZ B;  2WXV B;  3BLR B;  3O0G D;  4FM4 B;  2IW6 B;  3QHW B;  4Z6Y A;  5ICP B;  2IW8 B;  1OL2 B;  1O9K A;  1UGR B;  4MFE A;  3MIA B;  4YOS A;  1JSU B;  1OGU B;  2EUF A;  2PJQ A;  1H27 B;  4BCM D;  3K7A M;  3X25 B;  3LQ5 B;  2QQ8 A;  4ZGE B;  4AI6 A;  2UZE B;  1VYW B;  3VYG B;  4EOM B;  4OB3 B;  4ROD A;  2AHJ B;  1H1R B;  1E9H B;  5IDP B;  1GY3 B;  3TNI B;  4JX4 A;  2W99 A;  1D3U B;  2DPP B;  1V29 B;  2IN3 A;  2BS4 A;  3BG3 A;  4BCO B;  4OGR B;  4EOO B;  3QZ5 B;  2C5V B;  3NDQ A;  4BCG B;  4OB1 B;  1GUX A;  2ZPH B;  1OKV B;  4CRL B;  5EFQ B;  2W96 A;  2WIH B;  4F7N B;  1UGP B;  3QXE B;  2W9F A;  2WPA B;  2ZPF B;  3QYE A;  4CFU B;  5HVY B;  4I3Z B;  4KRD B;  1H25 B;  4JX5 A;  5HNB B;  4TTH A;  3F5X B;  2V22 B;  4CFX B;  1PKD B;  5CYI B;  1OL1 B;  1H26 B;  4BBS M;  4FX3 B;  2D0Q B;  3VKG A;  5IF1 B;  2IW9 B;  4G6L B;  2CZ7 B;  4MIM A;  4ELL A;  4ROE A;  4EOJ B;  1F5Q B;  2BS2 A;  4ROC A;  2WMA B;  2UZD B;  2KMG A;  4BCQ D;  2KR6 A;  5HBE B;  1UGQ B;  2I40 B;  3QHR B;  5FGK B;  5LQF B;  4EON B;  1FVV B;  4M6V A;  4CFM B;  4KRC B;  1E7P A;  4EOP B;  1VIN A;  1AD6 A;  1AHJ B;  1GH6 B;  5IHY A;  4BCN D;  4ELJ A;  3A8G B;  2I53 A;  2CCH B;  2WHB B;  3GTM S;  5L2W B; 
#chains in the Genus database with same CATH homology
 2QDJ A;  3RGF B;  5LMK B;  2C4G B;  2W2H A;  4CXA B;  1ZP2 A;  4CFV B;  4BCO B;  4OGR B;  1JST B;  1FIN B;  4EOO B;  4BCI B;  1H24 B;  1AIS B;  2C5V B;  5HQ0 B;  2WEV B;  5HBJ B;  4BCG B;  4BCH B;  4BCF B;  2CJM B;  2G9X B;  1GUX A;  3BHV B;  1OKV B;  1OIY B;  2PK2 A;  2W9Z A;  3MY5 B;  4EC9 B;  4CRL B;  5EFQ B;  2W96 A;  2WIH B;  4Y72 B;  4F7N B;  3DDP B;  1W98 B;  5ACB A;  4BCJ B;  3DOG B;  1G3N C;  4F7J B;  1H1S B;  1UNG D;  2BPM B;  2W9F A;  4CFU D;  2WPA B;  4CFU B;  5HVY B;  4BCP B;  3EID B;  5BNJ B;  1VOL A;  4YOO A;  4I3Z B;  2F2C A;  2R7G A;  1OIU B;  4KRD B;  1H25 B;  1P5E B;  4UN0 A;  3BLH B;  3POM A;  4F70 B;  1OKW B;  2WIP B;  3G33 B;  5HBH B;  5HNB B;  1GUX B;  2BKZ B;  4EOI B;  1UNH D;  3F5X B;  2C6T B;  4TTH A;  2V22 B;  5IDN B;  4EOK B;  4F7L B;  2PHG A;  4CFX B;  3TNW B;  1PKD B;  4YC3 B;  2X1N B;  1OL1 B;  1H26 B;  2JGZ B;  2WXV B;  4FX3 B;  2C5X B;  5CYI B;  3BLR B;  5I5Z B;  4NST B;  5IF1 B;  1JKW A;  3O0G D;  4IMY B;  2IW6 B;  3BHT B;  3QHW B;  3TNH B;  1QMZ B;  2IW9 B;  4G6L B;  5ICP B;  1C9B A;  2IW8 B;  1OL2 B;  2WFY B;  4F6W B;  2PMI B;  1H28 B;  1O9K A;  1OI9 B;  2C5O B;  4YOZ A;  3MY1 B;  4ELL A;  2C5N B;  4ROE A;  1JOW A;  1KXU A;  3MIA B;  2CCI B;  4YOS A;  4EOJ B;  1JSU B;  5L2W B;  1OGU B;  2EUF A;  1F5Q B;  1H27 B;  4BCM D;  4OR5 B;  3K7A M;  4F6U B;  3MI9 B;  4BCM B;  1N4M A;  4CFN B;  4CFW B;  2WMA B;  4ROC A;  2UZD B;  1URC B;  3LQ5 B;  4BCQ D;  4EC8 B;  2PK9 B;  4BCQ B;  4EOQ B;  5CEI B;  5HBE B;  1XO2 A;  1O9K B;  2UZL B;  1H4L D;  1BU2 A;  2UZE B;  2B9R A;  1VYW B;  3EOC B;  4EOM B;  4BCK B;  2I40 B;  3QHR B;  4ROD A;  5FGK B;  5LQF B;  4EON B;  1FVV B;  2UUE B;  3EJ1 B;  4F7S B;  3H4C A;  4CFM B;  4KRC B;  4EOS B;  3DDQ B;  4EOP B;  1VIN A;  4II5 B;  1H1R B;  1E9H B;  1AD6 A;  2WMB B;  4EOR B;  1GH6 B;  5IDP B;  1H1P B;  1GY3 B;  3BHU B;  3M03 A;  3TN8 B;  4BCN B;  4BCN D;  4ELJ A;  1UNL D;  2UZB B;  3TNI B;  2W99 A;  2I53 A;  2CCH B;  2WHB B;  1D3U B;  1H1Q B;  1TFB A;  3BLQ B;  4F6S B;  2IVX A;  4EOL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...