5L2WB

The x-ray co-crystal structure of human cdk2/cycline and dinaciclib.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
270
structure length
270
Chain Sequence
SPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle/inhibitor
molecule keywords Cyclin-dependent kinase 2
total genus 90
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5l2wB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5l2wB01
3RGFB 4EOIB 1URCB 5ICPB 5I5ZB 4G6LB 5ACBA 2UUEB 1FVVB 4KRCB 4YOSA 1GUXA 3MI9B 1O9KA 2G9XB 2WMBB 3TN8B 4CFMB 1H25B 4EC8B 4EOQB 4CXAB 1W98B 1TFBA 4BCJB 4F6WB 4ELLA 2W9ZA 4F7SB 5HBEB 5IDNB 1G3NC 5L2WB 2I40B 1H26B 2IW8B 1H28B 3TNIB 4I3ZB 2WMAB 3H4CA 1KXUA 4ROEA 5CYIB 2CJMB 2C6TB 1UNGD 2IVXA 2UZDB 1JOWA 1UNHD 1O9KB 1ZP2A 2C5VB 4YOOA 3TNHB 5BNJB 1H27B 1PKDB 4TTHA 3BLQB 5HBJB 3POMA 1OL2B 4BCHB 4RODA 2C5OB 5LQFB 4BCQD 1QMZB 5IDPB 3QHRB 4CRLB 4NSTB 4EOOB 3BHVB 1JKWA 3EJ1B 4BCFB 2W9FA 4EOMB 1N4MA 1GY3B 3MY5B 2IW6B 1VYWB 2C5XB 3F5XB 4F7JB 3DDPB 1P5EB 1FINB 1OIUB 1H24B 1AD6A 1AISB 4CFNB 4KRDB 4EORB 1OIYB 2UZLB 1H1QB 5HBHB 4EOLB 2WIPB 2WHBB 2W96A 4EOJB 3BLRB 4II5B 4BCND 3MY1B 4BCMD 2R7GA 2PK9B 3LQ5B 2C5NB 5HVYB 4F70B 4EOSB 1OL1B 3QHWB 2BKZB 5EFQB 5LMKB 3EIDB 2W99A 2I53A 2WEVB 1BU2A 4FX3B 4F7LB 4ROCA 1GUXB 1UNLD 1OKWB 4EOPB 1JSUB 1F5QB 4F6SB 2PMIB 1D3UB 2BPMB 1H1SB 2WXVB 1E9HB 1JSTB 4ELJA 2JGZB 2X1NB 2WPAB 4Y72B 1OGUB 2PHGA 3G33B 4YOZA 4BCIB 4EC9B 4UN0A 3BLHB 1C9BA 3BHTB 4BCNB 1VOLA 4OR5B 2WFYB 1H1RB 1H4LD 2C4GB 4BCMB 2IW9B 1OI9B 1VINA 4BCOB 3BHUB 4CFUD 2UZBB 4EONB 4CFWB 5CEIB 5IF1B 3M03A 4BCPB 2W2HA 1XO2A 5HQ0B 5FGKB 2WIHB 3DOGB 4CFVB 2EUFA 2CCIB 2F2CA 3K7AM 1GH6B 2PK2A 2QDJA 4BCKB 4CFXB 3O0GD 3TNWB 4YC3B 5HNBB 2V22B 1OKVB 4BCQB 2UZEB 3EOCB 4IMYB 4CFUB 4BCGB 4F7NB 3MIAB 4OGRB 1H1PB 2CCHB 3DDQB 4EOKB 2B9RA 4F6UB
chains in the Genus database with same CATH superfamily
3A8OB 3RGFB 4LOCA 1O9KA 2G9XB 4CXAB 2DXBB 4BCJB 1UGRB 3QZ5B 5HBEB 5IDNB 1G3NC 2I40B 2BS4A 1KXUA 5BNJB 3BLQB 2C5OB 5LQFB 1QMZB 1UGPB 4EOOB 1JKWA 3X24B 3HHTB 5DQVA 4EOMB 3MY5B 2IW6B 3WVDB 1VYWB 2C5XB 3QYGB 4CFNB 2CZ6B 1OIYB 2UZLB 4M6VA 1TD6A 2W96A 4FM4B 2R7GA 3PO3S 5LMKB 2W99A 2I53A 4BY1X 4F7LB 1UNLD 4EOPB 1JSUB 4F6SB 4AKIA 2WXVB 1JSTB 2QDYB 4QSHA 4YOZA 4Y72B 1OGUB 4BCIB 4EC9B 3BLHB 1VOLA 1FKMA 1ENWA 3BHUB 5CEIB 3M03A 4BCPB 1XO2A 3QWLA 3QYHB 3K7AM 2D0QB 4BBSM 3TNWB 3A8MB 5HNBB 4AI6A 1OKVB 4F7NB 3DDQB 4EOKB 4F6UB 5I5ZB 4YOSA 3MI9B 4CFMB 4ELLA 5L2WB 2IW8B 3TNIB 4I3ZB 4YOOA 2UZDB 1UNHD 1ZP2A 1O9KB 1PKDB 4JX6A 5HBJB 3POMA 1OL2B 3HBLA 2QFZA 4BCQD 4NSTB 5IHYA 3BHVB 3EJ1B 2CZ7B 3DJBA 3BG9A 4AKHA 1AHJB 3KHIA 4OB3B 1H1QB 5HBHB 4EOLB 4EOJB 3A8HB 3VYHB 2QQ8A 2CZ1B 2PK9B 3LQ5B 2C5NB 1QLBA 1OL1B 3QHWB 5EFQB 3EIDB 4FX3B 2ZPBB 4MFDA 1F5QB 2BPMB 3BG3A 3TW6A 2ZPHB 4MIMA 4ELJA 2JGZB 3GTMS 3BHTB 4OR5B 3X25B 4BCMB 3QZ9B 2IW9B 1OI9B 3B57A 3DL1A 3X26B 2DD4B 4HNVA 4BXXX 2W2HA 5HQ0B 1IREB 2EUFA 2AHJB 2QDJA 4HNTA 4BCKB 4CFXB 4ZGJB 2ZPFB 4ZGDB 4OB2B 2PJQA 4CFUB 1H1PB 2B9RA 3NDQA 4EOIB 1URCB 4ZGEB 5ICPB 4G6LB 1FVVB 4KRCB 4EC8B 1H25B 4EOQB 1W98B 1UGSB 2W9ZA 5DQWA 4NC6A 1H28B 2WMAB 3H4CA 4ROEA 5CYIB 2CJMB 2C6TB 3X20B 3TNHB 4AKGA 2C5VB 2ZCFB 1H27B 1V29B 4BCHB 4RODA 3QHRB 3QYBA 3HZJA 4BCFB 2W9FA 1GY3B 4JX5A 3F5XB 4F7JB 1FINB 1UGQB 4MFEA 1AISB 4II5B 2KMGA 3MY1B 2DD5B 4BCMD 4JX4A 5HVYB 4F70B 4HL4A 5EJCA 2CZ0B 1GUXB 1OKWB 2PMIB 1D3UB 4UN0A 1C9BA 4BCNB 2WFYB 1H4LD 3HB9A 2C4GB 4HLQA 1VINA 4CFUD 2UZBB 4EONB 3BG5A 2ZPEB 5IF1B 2WIHB 3DOGB 4CFVB 2CCIB 2PK2A 3TW7A 3O0GD 4BCQB 3EOCB 3VYGB 3MIAB 5ACBA 2UUEB 1GUXA 2WMBB 3TN8B 1TFBA 4F6WB 4OB0B 4F7SB 2DXCB 1H26B 3QYEA 2LW4A 3X28B 1UNGD 2IVXA 3A8GB 1JOWA 4TTHA 2DPPB 2QGSA 5IDPB 4CRLB 1N4MA 3DDPB 1P5EB 1OIUB 1H24B 4Z6YA 1AD6A 4KRDB 4EORB 2WIPB 4BY7X 2WHBB 3VKGA 3BLRB 3WVEB 4BCND 4OB1B 2ZPIB 2KR6A 4EOSB 2BKZB 2ZPGB 2WEVB 1BU2A 2QF7A 4ROCA 2BS2A 1H1SB 2CYZB 1E9HB 2X1NB 2WPAB 2PHGA 3G33B 2BS3A 3VKHA 1H1RB 2ZZDB 3QXEB 2WJ9A 4BCOB 4BBRM 4CFWB 3DTOA 1E7PA 5FGKB 3A8LB 2F2CA 1GH6B 4YC3B 2V22B 2UZEB 4IMYB 4BCGB 2IN3A 2DMEA 4OGRB 4HNUA 3HO8A 2CCHB 2G77A
chains in the Genus database with same CATH topology
3RGFB 4EOIB 1URCB 5ICPB 5I5ZB 4G6LB 5ACBA 2UUEB 1FVVB 4KRCB 4YOSA 1GUXA 3MI9B 1O9KA 2G9XB 2WMBB 3TN8B 4CFMB 1H25B 4EC8B 4EOQB 4CXAB 1W98B 1TFBA 4BCJB 4F6WB 4ELLA 2W9ZA 4F7SB 5HBEB 5IDNB 1G3NC 5L2WB 2I40B 1H26B 2IW8B 1H28B 3TNIB 4I3ZB 2WMAB 3H4CA 1KXUA 4ROEA 5CYIB 2CJMB 2C6TB 1UNGD 2IVXA 2UZDB 1JOWA 1UNHD 1O9KB 1ZP2A 2C5VB 4YOOA 3TNHB 5BNJB 1H27B 1PKDB 4TTHA 3BLQB 5HBJB 3POMA 1OL2B 4BCHB 4RODA 2C5OB 5LQFB 4BCQD 1QMZB 5IDPB 3QHRB 4CRLB 4NSTB 4EOOB 3BHVB 1JKWA 3EJ1B 4BCFB 2W9FA 4EOMB 1N4MA 1GY3B 3MY5B 2IW6B 1VYWB 2C5XB 3F5XB 4F7JB 3DDPB 1P5EB 1FINB 1OIUB 1H24B 1AD6A 1AISB 4CFNB 4KRDB 4EORB 1OIYB 2UZLB 1H1QB 5HBHB 4EOLB 2WIPB 2WHBB 2W96A 4EOJB 3BLRB 4II5B 4BCND 3MY1B 4BCMD 2R7GA 2PK9B 3LQ5B 2C5NB 5HVYB 4F70B 4EOSB 1OL1B 3QHWB 2BKZB 5EFQB 5LMKB 3EIDB 2W99A 2I53A 2WEVB 1BU2A 4FX3B 4F7LB 4ROCA 1GUXB 1UNLD 1OKWB 4EOPB 1JSUB 1F5QB 4F6SB 2PMIB 1D3UB 2BPMB 1H1SB 2WXVB 1E9HB 1JSTB 4ELJA 2JGZB 2X1NB 2WPAB 4Y72B 1OGUB 2PHGA 3G33B 4YOZA 4BCIB 4EC9B 4UN0A 3BLHB 1C9BA 3BHTB 4BCNB 1VOLA 4OR5B 2WFYB 1H1RB 1H4LD 2C4GB 4BCMB 2IW9B 1OI9B 1VINA 4BCOB 3BHUB 4CFUD 2UZBB 4EONB 4CFWB 5CEIB 5IF1B 3M03A 4BCPB 2W2HA 1XO2A 5HQ0B 5FGKB 2WIHB 3DOGB 4CFVB 2EUFA 2CCIB 2F2CA 3K7AM 1GH6B 2PK2A 2QDJA 4BCKB 4CFXB 3O0GD 3TNWB 4YC3B 5HNBB 2V22B 1OKVB 4BCQB 2UZEB 3EOCB 4IMYB 4CFUB 4BCGB 4F7NB 3MIAB 4OGRB 1H1PB 2CCHB 3DDQB 4EOKB 2B9RA 4F6UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGF B;  4EOI B;  1URC B;  5ICP B;  5I5Z B;  4G6L B;  5ACB A;  2UUE B;  1FVV B;  4KRC B;  4YOS A;  1GUX A;  3MI9 B;  1O9K A;  2G9X B;  2WMB B;  3TN8 B;  4CFM B;  1H25 B;  4EC8 B;  4EOQ B;  4CXA B;  1W98 B;  1TFB A;  4BCJ B;  4F6W B;  4ELL A;  2W9Z A;  4F7S B;  5HBE B;  5IDN B;  1G3N C;  5L2W B;  2I40 B;  1H26 B;  2IW8 B;  1H28 B;  3TNI B;  4I3Z B;  2WMA B;  3H4C A;  1KXU A;  4ROE A;  5CYI B;  2CJM B;  2C6T B;  1UNG D;  2IVX A;  2UZD B;  1JOW A;  1UNH D;  1O9K B;  1ZP2 A;  2C5V B;  4YOO A;  3TNH B;  5BNJ B;  1H27 B;  1PKD B;  4TTH A;  3BLQ B;  5HBJ B;  3POM A;  1OL2 B;  4BCH B;  4ROD A;  2C5O B;  5LQF B;  4BCQ D;  1QMZ B;  5IDP B;  3QHR B;  4CRL B;  4NST B;  4EOO B;  3BHV B;  1JKW A;  3EJ1 B;  4BCF B;  2W9F A;  4EOM B;  1N4M A;  1GY3 B;  3MY5 B;  2IW6 B;  1VYW B;  2C5X B;  3F5X B;  4F7J B;  3DDP B;  1P5E B;  1FIN B;  1OIU B;  1H24 B;  1AD6 A;  1AIS B;  4CFN B;  4KRD B;  4EOR B;  1OIY B;  2UZL B;  1H1Q B;  5HBH B;  4EOL B;  2WIP B;  2WHB B;  2W96 A;  4EOJ B;  3BLR B;  4II5 B;  4BCN D;  3MY1 B;  4BCM D;  2R7G A;  2PK9 B;  3LQ5 B;  2C5N B;  5HVY B;  4F70 B;  4EOS B;  1OL1 B;  3QHW B;  2BKZ B;  5EFQ B;  5LMK B;  3EID B;  2W99 A;  2I53 A;  2WEV B;  1BU2 A;  4FX3 B;  4F7L B;  4ROC A;  1GUX B;  1UNL D;  1OKW B;  4EOP B;  1JSU B;  1F5Q B;  4F6S B;  2PMI B;  1D3U B;  2BPM B;  1H1S B;  2WXV B;  1E9H B;  1JST B;  4ELJ A;  2JGZ B;  2X1N B;  2WPA B;  4Y72 B;  1OGU B;  2PHG A;  3G33 B;  4YOZ A;  4BCI B;  4EC9 B;  4UN0 A;  3BLH B;  1C9B A;  3BHT B;  4BCN B;  1VOL A;  4OR5 B;  2WFY B;  1H1R B;  1H4L D;  2C4G B;  4BCM B;  2IW9 B;  1OI9 B;  1VIN A;  4BCO B;  3BHU B;  4CFU D;  2UZB B;  4EON B;  4CFW B;  5CEI B;  5IF1 B;  3M03 A;  4BCP B;  2W2H A;  1XO2 A;  5HQ0 B;  5FGK B;  2WIH B;  3DOG B;  4CFV B;  2EUF A;  2CCI B;  2F2C A;  3K7A M;  1GH6 B;  2PK2 A;  2QDJ A;  4BCK B;  4CFX B;  3O0G D;  3TNW B;  4YC3 B;  5HNB B;  2V22 B;  1OKV B;  4BCQ B;  2UZE B;  3EOC B;  4IMY B;  4CFU B;  4BCG B;  4F7N B;  3MIA B;  4OGR B;  1H1P B;  2CCH B;  3DDQ B;  4EOK B;  2B9R A;  4F6U B; 
#chains in the Genus database with same CATH topology
 3A8O B;  3RGF B;  4LOC A;  1O9K A;  2G9X B;  4CXA B;  2DXB B;  4BCJ B;  1UGR B;  3QZ5 B;  5HBE B;  5IDN B;  1G3N C;  2I40 B;  2BS4 A;  1KXU A;  5BNJ B;  3BLQ B;  2C5O B;  5LQF B;  1QMZ B;  1UGP B;  4EOO B;  1JKW A;  3X24 B;  3HHT B;  5DQV A;  4EOM B;  3MY5 B;  2IW6 B;  3WVD B;  1VYW B;  2C5X B;  3QYG B;  4CFN B;  2CZ6 B;  1OIY B;  2UZL B;  4M6V A;  1TD6 A;  2W96 A;  4FM4 B;  2R7G A;  3PO3 S;  5LMK B;  2W99 A;  2I53 A;  4BY1 X;  4F7L B;  1UNL D;  4EOP B;  1JSU B;  4F6S B;  4AKI A;  2WXV B;  1JST B;  2QDY B;  4QSH A;  4YOZ A;  4Y72 B;  1OGU B;  4BCI B;  4EC9 B;  3BLH B;  1VOL A;  1FKM A;  1ENW A;  3BHU B;  5CEI B;  3M03 A;  4BCP B;  1XO2 A;  3QWL A;  3QYH B;  3K7A M;  2D0Q B;  4BBS M;  3TNW B;  3A8M B;  5HNB B;  4AI6 A;  1OKV B;  4F7N B;  3DDQ B;  4EOK B;  4F6U B;  5I5Z B;  4YOS A;  3MI9 B;  4CFM B;  4ELL A;  5L2W B;  2IW8 B;  3TNI B;  4I3Z B;  4YOO A;  2UZD B;  1UNH D;  1ZP2 A;  1O9K B;  1PKD B;  4JX6 A;  5HBJ B;  3POM A;  1OL2 B;  3HBL A;  2QFZ A;  4BCQ D;  4NST B;  5IHY A;  3BHV B;  3EJ1 B;  2CZ7 B;  3DJB A;  3BG9 A;  4AKH A;  1AHJ B;  3KHI A;  4OB3 B;  1H1Q B;  5HBH B;  4EOL B;  4EOJ B;  3A8H B;  3VYH B;  2QQ8 A;  2CZ1 B;  2PK9 B;  3LQ5 B;  2C5N B;  1QLB A;  1OL1 B;  3QHW B;  5EFQ B;  3EID B;  4FX3 B;  2ZPB B;  4MFD A;  1F5Q B;  2BPM B;  3BG3 A;  3TW6 A;  2ZPH B;  4MIM A;  4ELJ A;  2JGZ B;  3GTM S;  3BHT B;  4OR5 B;  3X25 B;  4BCM B;  3QZ9 B;  2IW9 B;  1OI9 B;  3B57 A;  3DL1 A;  3X26 B;  2DD4 B;  4HNV A;  4BXX X;  2W2H A;  5HQ0 B;  1IRE B;  2EUF A;  2AHJ B;  2QDJ A;  4HNT A;  4BCK B;  4CFX B;  4ZGJ B;  2ZPF B;  4ZGD B;  4OB2 B;  2PJQ A;  4CFU B;  1H1P B;  2B9R A;  3NDQ A;  4EOI B;  1URC B;  4ZGE B;  5ICP B;  4G6L B;  1FVV B;  4KRC B;  4EC8 B;  1H25 B;  4EOQ B;  1W98 B;  1UGS B;  2W9Z A;  5DQW A;  4NC6 A;  1H28 B;  2WMA B;  3H4C A;  4ROE A;  5CYI B;  2CJM B;  2C6T B;  3X20 B;  3TNH B;  4AKG A;  2C5V B;  2ZCF B;  1H27 B;  1V29 B;  4BCH B;  4ROD A;  3QHR B;  3QYB A;  3HZJ A;  4BCF B;  2W9F A;  1GY3 B;  4JX5 A;  3F5X B;  4F7J B;  1FIN B;  1UGQ B;  4MFE A;  1AIS B;  4II5 B;  2KMG A;  3MY1 B;  2DD5 B;  4BCM D;  4JX4 A;  5HVY B;  4F70 B;  4HL4 A;  5EJC A;  2CZ0 B;  1GUX B;  1OKW B;  2PMI B;  1D3U B;  4UN0 A;  1C9B A;  4BCN B;  2WFY B;  1H4L D;  3HB9 A;  2C4G B;  4HLQ A;  1VIN A;  4CFU D;  2UZB B;  4EON B;  3BG5 A;  2ZPE B;  5IF1 B;  2WIH B;  3DOG B;  4CFV B;  2CCI B;  2PK2 A;  3TW7 A;  3O0G D;  4BCQ B;  3EOC B;  3VYG B;  3MIA B;  5ACB A;  2UUE B;  1GUX A;  2WMB B;  3TN8 B;  1TFB A;  4F6W B;  4OB0 B;  4F7S B;  2DXC B;  1H26 B;  3QYE A;  2LW4 A;  3X28 B;  1UNG D;  2IVX A;  3A8G B;  1JOW A;  4TTH A;  2DPP B;  2QGS A;  5IDP B;  4CRL B;  1N4M A;  3DDP B;  1P5E B;  1OIU B;  1H24 B;  4Z6Y A;  1AD6 A;  4KRD B;  4EOR B;  2WIP B;  4BY7 X;  2WHB B;  3VKG A;  3BLR B;  3WVE B;  4BCN D;  4OB1 B;  2ZPI B;  2KR6 A;  4EOS B;  2BKZ B;  2ZPG B;  2WEV B;  1BU2 A;  2QF7 A;  4ROC A;  2BS2 A;  1H1S B;  2CYZ B;  1E9H B;  2X1N B;  2WPA B;  2PHG A;  3G33 B;  2BS3 A;  3VKH A;  1H1R B;  2ZZD B;  3QXE B;  2WJ9 A;  4BCO B;  4BBR M;  4CFW B;  3DTO A;  1E7P A;  5FGK B;  3A8L B;  2F2C A;  1GH6 B;  4YC3 B;  2V22 B;  2UZE B;  4IMY B;  4BCG B;  2IN3 A;  2DME A;  4OGR B;  4HNU A;  3HO8 A;  2CCH B;  2G77 A; 
#chains in the Genus database with same CATH homology
 3RGF B;  4EOI B;  1URC B;  5ICP B;  5I5Z B;  4G6L B;  5ACB A;  2UUE B;  1FVV B;  4KRC B;  4YOS A;  1GUX A;  3MI9 B;  1O9K A;  2G9X B;  2WMB B;  3TN8 B;  4CFM B;  1H25 B;  4EC8 B;  4EOQ B;  4CXA B;  1W98 B;  1TFB A;  4BCJ B;  4F6W B;  4ELL A;  2W9Z A;  4F7S B;  5HBE B;  5IDN B;  1G3N C;  5L2W B;  2I40 B;  1H26 B;  2IW8 B;  1H28 B;  3TNI B;  4I3Z B;  2WMA B;  3H4C A;  1KXU A;  4ROE A;  5CYI B;  2CJM B;  2C6T B;  1UNG D;  2IVX A;  2UZD B;  1JOW A;  1UNH D;  1O9K B;  1ZP2 A;  2C5V B;  4YOO A;  3TNH B;  5BNJ B;  1H27 B;  1PKD B;  4TTH A;  3BLQ B;  5HBJ B;  3POM A;  1OL2 B;  4BCH B;  4ROD A;  2C5O B;  5LQF B;  4BCQ D;  1QMZ B;  5IDP B;  3QHR B;  4CRL B;  4NST B;  4EOO B;  3BHV B;  1JKW A;  3EJ1 B;  4BCF B;  2W9F A;  4EOM B;  1N4M A;  1GY3 B;  3MY5 B;  2IW6 B;  1VYW B;  2C5X B;  3F5X B;  4F7J B;  3DDP B;  1P5E B;  1FIN B;  1OIU B;  1H24 B;  1AD6 A;  1AIS B;  4CFN B;  4KRD B;  4EOR B;  1OIY B;  2UZL B;  1H1Q B;  5HBH B;  4EOL B;  2WIP B;  2WHB B;  2W96 A;  4EOJ B;  3BLR B;  4II5 B;  4BCN D;  3MY1 B;  4BCM D;  2R7G A;  2PK9 B;  3LQ5 B;  2C5N B;  5HVY B;  4F70 B;  4EOS B;  1OL1 B;  3QHW B;  2BKZ B;  5EFQ B;  5LMK B;  3EID B;  2W99 A;  2I53 A;  2WEV B;  1BU2 A;  4FX3 B;  4F7L B;  4ROC A;  1GUX B;  1UNL D;  1OKW B;  4EOP B;  1JSU B;  1F5Q B;  4F6S B;  2PMI B;  1D3U B;  2BPM B;  1H1S B;  2WXV B;  1E9H B;  1JST B;  4ELJ A;  2JGZ B;  2X1N B;  2WPA B;  4Y72 B;  1OGU B;  2PHG A;  3G33 B;  4YOZ A;  4BCI B;  4EC9 B;  4UN0 A;  3BLH B;  1C9B A;  3BHT B;  4BCN B;  1VOL A;  4OR5 B;  2WFY B;  1H1R B;  1H4L D;  2C4G B;  4BCM B;  2IW9 B;  1OI9 B;  1VIN A;  4BCO B;  3BHU B;  4CFU D;  2UZB B;  4EON B;  4CFW B;  5CEI B;  5IF1 B;  3M03 A;  4BCP B;  2W2H A;  1XO2 A;  5HQ0 B;  5FGK B;  2WIH B;  3DOG B;  4CFV B;  2EUF A;  2CCI B;  2F2C A;  3K7A M;  1GH6 B;  2PK2 A;  2QDJ A;  4BCK B;  4CFX B;  3O0G D;  3TNW B;  4YC3 B;  5HNB B;  2V22 B;  1OKV B;  4BCQ B;  2UZE B;  3EOC B;  4IMY B;  4CFU B;  4BCG B;  4F7N B;  3MIA B;  4OGR B;  1H1P B;  2CCH B;  3DDQ B;  4EOK B;  2B9R A;  4F6U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...