5L2WB

The x-ray co-crystal structure of human cdk2/cycline and dinaciclib.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
270
structure length
270
Chain Sequence
SPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle/inhibitor
molecule keywords Cyclin-dependent kinase 2
publication title Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5l2wB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5l2wB01
1AD6A 2WPAB 4EOMB 2UZLB 2I40B 5LQFB 2W9FA 1H1SB 1H26B 1W98B 3MY5B 5IDNB 4BCHB 1UNLD 4CFWB 1H24B 2PHGA 2PMIB 4KRCB 4YOSA 1AISB 4BCNB 1G3NC 1JOWA 2CCIB 1PKDB 3F5XB 3BLRB 5ACBA 5HQ0B 2WEVB 4EOQB 4BCOB 2CJMB 1FINB 3MIAB 5CEIB 3TNHB 4CFXB 1H1QB 4EC8B 2G9XB 1H28B 4F7LB 1JKWA 1H1PB 1H27B 2F2CA 4KRDB 3DOGB 4BCKB 2I53A 2PK9B 2C5VB 5EFQB 2WHBB 2QDJA 4F6UB 1N4MA 5FGKB 1F5QB 3BHVB 4CFNB 3BLQB 2UUEB 4BCMB 4RODA 4EOSB 1H1RB 1E9HB 4BCIB 4F6WB 1D3UB 2UZBB 5HBHB 3QHRB 2C5XB 5HNBB 2CCHB 3H4CA 4F70B 1H25B 1OIUB 3POMA 1UNGD 4EOIB 2UZEB 1VYWB 2V22B 5I5ZB 2UZDB 2BKZB 3TN8B 4YOOA 4OR5B 2B9RA 3DDQB 3MY1B 4CRLB 5HVYB 4ROEA 2W2HA 3BHTB 1O9KA 2C5NB 2W99A 1OKWB 2WXVB 2W9ZA 5IDPB 1OL1B 3G33B 3BHUB 1JSUB 1OI9B 1GY3B 1XO2A 1GUXA 4CFUD 1GH6B 2C4GB 3EJ1B 1UNHD 2X1NB 3BLHB 3O0GD 1OKVB 4BCGB 4YOZA 1FVVB 4UN0A 4F7NB 4OGRB 4NSTB 2C5OB 3QHWB 3LQ5B 2WMAB 4EOJB 4CFUB 2W96A 4F6SB 2WIHB 1VOLA 2IVXA 1QMZB 2IW8B 4CFMB 4ELJA 3MI9B 4TTHA 1OGUB 2R7GA 1OIYB 4BCQD 5L2WB 4EOPB 4EOOB 4YC3B 4ELLA 1KXUA 4Y72B 3TNIB 2BPMB 4BCND 2IW9B 1TFBA 2C6TB 1O9KB 1P5EB 4BCQB 4F7JB 5IF1B 4EORB 3EIDB 4G6LB 1VINA 4II5B 4ROCA 4CXAB 2WMBB 4BCFB 2EUFA 3TNWB 1C9BA 4EC9B 4EOLB 4EOKB 1GUXB 1H4LD 3DDPB 2PK2A 5CYIB 5LMKB 1OL2B 4EONB 3K7AM 1JSTB 4IMYB 1ZP2A 4CFVB 4I3ZB 1BU2A 4BCPB 4F7SB 5HBEB 4FX3B 2WFYB 4BCMD 3M03A 3EOCB 5HBJB 5BNJB 1URCB 2IW6B 2WIPB 4BCJB 5ICPB 3RGFB 2JGZB
chains in the Genus database with same CATH superfamily
1AD6A 4EOMB 5DQVA 4OB1B 3MY5B 4BCHB 4CFWB 1UGQB 2PHGA 3F5XB 2QGSA 4JX4A 5DQWA 1FINB 4CFXB 1H1QB 4ZGEB 1H28B 3QZ9B 1H27B 4AI6A 1E7PA 3DOGB 2I53A 4NC6A 4LOCA 5EFQB 2WHBB 1N4MA 5FGKB 1F5QB 4CFNB 2ZPFB 4F6WB 2UZBB 5HNBB 3NDQA 3QWLA 3HB9A 3POMA 2CZ7B 4OB2B 4M6VA 2UZDB 4OR5B 2B9RA 3VYGB 3MY1B 4ROEA 1O9KA 2C5NB 2W99A 3QYGB 2WXVB 1GY3B 2ZPIB 4YOZA 2CZ6B 4OGRB 4NSTB 3LQ5B 4F6SB 2DPPB 2WIHB 3X26B 4ELJA 4FM4B 2R7GA 1OIYB 4ZGDB 4YC3B 4AKHA 2IW9B 4F7JB 1O9KB 4MIMA 1C9BA 4EC9B 4EOLB 5LMKB 1UGSB 1OL2B 4EONB 2QFZA 1JSTB 1ZP2A 2ZPGB 1BU2A 2KMGA 5HBEB 1URCB 2ZCFB 3RGFB 2DMEA 4MFDA 2PJQA 5LQFB 2UZLB 2W9FA 1H26B 3KHIA 1H24B 2PMIB 4KRCB 1AISB 2CYZB 5ACBA 3DTOA 2WEVB 1ENWA 4HNTA 2G9XB 3A8MB 4F7LB 1H1PB 2ZZDB 2PK9B 4JX5A 3HHTB 3BLQB 2ZPBB 2UUEB 2QF7A 3WVEB 1H1RB 4EOSB 4RODA 1D3UB 3QHRB 2CCHB 3H4CA 4F70B 1OIUB 1UNGD 2UZEB 5I5ZB 2WJ9A 1TD6A 3TN8B 1FKMA 4YOOA 3DDQB 4CRLB 1OKWB 5IDPB 1JSUB 1OI9B 3A8LB 4QSHA 1GUXA 2CZ0B 4BCGB 3O0GD 4UN0A 4CFUB 4EOJB 2W96A 2IVXA 1QMZB 2IW8B 3DJBA 4BCQD 5L2WB 4EOPB 4EOOB 2BS4A 4ELLA 2BS2A 1KXUA 3EIDB 1VINA 2WMBB 3X25B 3HBLA 3TNWB 2KR6A 1GUXB 1H4LD 3X28B 2PK2A 3K7AM 4HNUA 3VYHB 4I3ZB 3WVDB 4BCPB 4F7SB 3EOCB 4ZGJB 5HBJB 4BCJB 2WPAB 2I40B 1H1SB 1W98B 3VKGA 5IDNB 3QZ5B 2BS3A 1UNLD 2AHJB 4YOSA 4BCNB 1G3NC 2CCIB 1PKDB 4BCOB 2CJMB 3VKHA 2CZ1B 5EJCA 2F2CA 4KRDB 3BG5A 2C5VB 2QDJA 4F6UB 4Z6YA 3BHVB 2QQ8A 5HBHB 3BG3A 4BBSM 4BY1X 1VYWB 3QYEA 2DD4B 2W2HA 3BHTB 4BXXX 2W9ZA 1OL1B 3G33B 3BHUB 1AHJB 1GH6B 1OKVB 1FVVB 3A8OB 3QXEB 2WMAB 1VOLA 3B57A 4CFMB 4AKIA 4HNVA 4TTHA 2DXCB 2G77A 3TNIB 4BCND 1TFBA 2C6TB 1P5EB 3GTMS 4EORB 4OB3B 4ROCA 1V29B 4CXAB 4BCFB 4EOKB 1IREB 4JX6A 4OB0B 5CYIB 4IMYB 4CFVB 2ZPEB 4MFEA 4FX3B 2WFYB 3A8GB 2IW6B 5ICPB 3A8HB 3BG9A 1JOWA 3BLRB 5HQ0B 4EOQB 3MIAB 5CEIB 3TNHB 4EC8B 4BBRM 1JKWA 3PO3S 4BCKB 2ZPHB 4BCMB 1E9HB 4BCIB 2C5XB 1UGPB 1H25B 4EOIB 2V22B 2BKZB 5HVYB 3TW7A 4AKGA 4BY7X 4HL4A 2D0QB 2LW4A 1XO2A 4CFUD 2C4GB 3EJ1B 1UNHD 2X1NB 3BLHB 3HO8A 4F7NB 2C5OB 3X20B 3QHWB 2DD5B 2DXBB 3X24B 3MI9B 3TW6A 1OGUB 3HZJA 1UGRB 4Y72B 2BPMB 4HLQA 4BCQB 5IF1B 4II5B 4G6LB 5IHYA 2EUFA 1QLBA 2QDYB 3DDPB 3QYHB 3DL1A 2IN3A 4BCMD 3M03A 5BNJB 2WIPB 3QYBA 2JGZB
chains in the Genus database with same CATH topology
1AD6A 2WPAB 4EOMB 2UZLB 2I40B 5LQFB 2W9FA 1H1SB 1H26B 1W98B 3MY5B 5IDNB 4BCHB 1UNLD 4CFWB 1H24B 2PHGA 2PMIB 4KRCB 4YOSA 1AISB 4BCNB 1G3NC 1JOWA 2CCIB 1PKDB 3F5XB 3BLRB 5ACBA 5HQ0B 2WEVB 4EOQB 4BCOB 2CJMB 1FINB 3MIAB 5CEIB 3TNHB 4CFXB 1H1QB 4EC8B 2G9XB 1H28B 4F7LB 1JKWA 1H1PB 1H27B 2F2CA 4KRDB 3DOGB 4BCKB 2I53A 2PK9B 2C5VB 5EFQB 2WHBB 2QDJA 4F6UB 1N4MA 5FGKB 1F5QB 3BHVB 4CFNB 3BLQB 2UUEB 4BCMB 4RODA 4EOSB 1H1RB 1E9HB 4BCIB 4F6WB 1D3UB 2UZBB 5HBHB 3QHRB 2C5XB 5HNBB 2CCHB 3H4CA 4F70B 1H25B 1OIUB 3POMA 1UNGD 4EOIB 2UZEB 1VYWB 2V22B 5I5ZB 2UZDB 2BKZB 3TN8B 4YOOA 4OR5B 2B9RA 3DDQB 3MY1B 4CRLB 5HVYB 4ROEA 2W2HA 3BHTB 1O9KA 2C5NB 2W99A 1OKWB 2WXVB 2W9ZA 5IDPB 1OL1B 3G33B 3BHUB 1JSUB 1OI9B 1GY3B 1XO2A 1GUXA 4CFUD 1GH6B 2C4GB 3EJ1B 1UNHD 2X1NB 3BLHB 3O0GD 1OKVB 4BCGB 4YOZA 1FVVB 4UN0A 4F7NB 4OGRB 4NSTB 2C5OB 3QHWB 3LQ5B 2WMAB 4EOJB 4CFUB 2W96A 4F6SB 2WIHB 1VOLA 2IVXA 1QMZB 2IW8B 4CFMB 4ELJA 3MI9B 4TTHA 1OGUB 2R7GA 1OIYB 4BCQD 5L2WB 4EOPB 4EOOB 4YC3B 4ELLA 1KXUA 4Y72B 3TNIB 2BPMB 4BCND 2IW9B 1TFBA 2C6TB 1O9KB 1P5EB 4BCQB 4F7JB 5IF1B 4EORB 3EIDB 4G6LB 1VINA 4II5B 4ROCA 4CXAB 2WMBB 4BCFB 2EUFA 3TNWB 1C9BA 4EC9B 4EOLB 4EOKB 1GUXB 1H4LD 3DDPB 2PK2A 5CYIB 5LMKB 1OL2B 4EONB 3K7AM 1JSTB 4IMYB 1ZP2A 4CFVB 4I3ZB 1BU2A 4BCPB 4F7SB 5HBEB 4FX3B 2WFYB 4BCMD 3M03A 3EOCB 5HBJB 5BNJB 1URCB 2IW6B 2WIPB 4BCJB 5ICPB 3RGFB 2JGZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD6 A;  2WPA B;  4EOM B;  2UZL B;  2I40 B;  5LQF B;  2W9F A;  1H1S B;  1H26 B;  1W98 B;  3MY5 B;  5IDN B;  4BCH B;  1UNL D;  4CFW B;  1H24 B;  2PHG A;  2PMI B;  4KRC B;  4YOS A;  1AIS B;  4BCN B;  1G3N C;  1JOW A;  2CCI B;  1PKD B;  3F5X B;  3BLR B;  5ACB A;  5HQ0 B;  2WEV B;  4EOQ B;  4BCO B;  2CJM B;  1FIN B;  3MIA B;  5CEI B;  3TNH B;  4CFX B;  1H1Q B;  4EC8 B;  2G9X B;  1H28 B;  4F7L B;  1JKW A;  1H1P B;  1H27 B;  2F2C A;  4KRD B;  3DOG B;  4BCK B;  2I53 A;  2PK9 B;  2C5V B;  5EFQ B;  2WHB B;  2QDJ A;  4F6U B;  1N4M A;  5FGK B;  1F5Q B;  3BHV B;  4CFN B;  3BLQ B;  2UUE B;  4BCM B;  4ROD A;  4EOS B;  1H1R B;  1E9H B;  4BCI B;  4F6W B;  1D3U B;  2UZB B;  5HBH B;  3QHR B;  2C5X B;  5HNB B;  2CCH B;  3H4C A;  4F70 B;  1H25 B;  1OIU B;  3POM A;  1UNG D;  4EOI B;  2UZE B;  1VYW B;  2V22 B;  5I5Z B;  2UZD B;  2BKZ B;  3TN8 B;  4YOO A;  4OR5 B;  2B9R A;  3DDQ B;  3MY1 B;  4CRL B;  5HVY B;  4ROE A;  2W2H A;  3BHT B;  1O9K A;  2C5N B;  2W99 A;  1OKW B;  2WXV B;  2W9Z A;  5IDP B;  1OL1 B;  3G33 B;  3BHU B;  1JSU B;  1OI9 B;  1GY3 B;  1XO2 A;  1GUX A;  4CFU D;  1GH6 B;  2C4G B;  3EJ1 B;  1UNH D;  2X1N B;  3BLH B;  3O0G D;  1OKV B;  4BCG B;  4YOZ A;  1FVV B;  4UN0 A;  4F7N B;  4OGR B;  4NST B;  2C5O B;  3QHW B;  3LQ5 B;  2WMA B;  4EOJ B;  4CFU B;  2W96 A;  4F6S B;  2WIH B;  1VOL A;  2IVX A;  1QMZ B;  2IW8 B;  4CFM B;  4ELJ A;  3MI9 B;  4TTH A;  1OGU B;  2R7G A;  1OIY B;  4BCQ D;  5L2W B;  4EOP B;  4EOO B;  4YC3 B;  4ELL A;  1KXU A;  4Y72 B;  3TNI B;  2BPM B;  4BCN D;  2IW9 B;  1TFB A;  2C6T B;  1O9K B;  1P5E B;  4BCQ B;  4F7J B;  5IF1 B;  4EOR B;  3EID B;  4G6L B;  1VIN A;  4II5 B;  4ROC A;  4CXA B;  2WMB B;  4BCF B;  2EUF A;  3TNW B;  1C9B A;  4EC9 B;  4EOL B;  4EOK B;  1GUX B;  1H4L D;  3DDP B;  2PK2 A;  5CYI B;  5LMK B;  1OL2 B;  4EON B;  3K7A M;  1JST B;  4IMY B;  1ZP2 A;  4CFV B;  4I3Z B;  1BU2 A;  4BCP B;  4F7S B;  5HBE B;  4FX3 B;  2WFY B;  4BCM D;  3M03 A;  3EOC B;  5HBJ B;  5BNJ B;  1URC B;  2IW6 B;  2WIP B;  4BCJ B;  5ICP B;  3RGF B;  2JGZ B; 
#chains in the Genus database with same CATH topology
 1AD6 A;  4EOM B;  5DQV A;  4OB1 B;  3MY5 B;  4BCH B;  4CFW B;  1UGQ B;  2PHG A;  3F5X B;  2QGS A;  4JX4 A;  5DQW A;  1FIN B;  4CFX B;  1H1Q B;  4ZGE B;  1H28 B;  3QZ9 B;  1H27 B;  4AI6 A;  1E7P A;  3DOG B;  2I53 A;  4NC6 A;  4LOC A;  5EFQ B;  2WHB B;  1N4M A;  5FGK B;  1F5Q B;  4CFN B;  2ZPF B;  4F6W B;  2UZB B;  5HNB B;  3NDQ A;  3QWL A;  3HB9 A;  3POM A;  2CZ7 B;  4OB2 B;  4M6V A;  2UZD B;  4OR5 B;  2B9R A;  3VYG B;  3MY1 B;  4ROE A;  1O9K A;  2C5N B;  2W99 A;  3QYG B;  2WXV B;  1GY3 B;  2ZPI B;  4YOZ A;  2CZ6 B;  4OGR B;  4NST B;  3LQ5 B;  4F6S B;  2DPP B;  2WIH B;  3X26 B;  4ELJ A;  4FM4 B;  2R7G A;  1OIY B;  4ZGD B;  4YC3 B;  4AKH A;  2IW9 B;  4F7J B;  1O9K B;  4MIM A;  1C9B A;  4EC9 B;  4EOL B;  5LMK B;  1UGS B;  1OL2 B;  4EON B;  2QFZ A;  1JST B;  1ZP2 A;  2ZPG B;  1BU2 A;  2KMG A;  5HBE B;  1URC B;  2ZCF B;  3RGF B;  2DME A;  4MFD A;  2PJQ A;  5LQF B;  2UZL B;  2W9F A;  1H26 B;  3KHI A;  1H24 B;  2PMI B;  4KRC B;  1AIS B;  2CYZ B;  5ACB A;  3DTO A;  2WEV B;  1ENW A;  4HNT A;  2G9X B;  3A8M B;  4F7L B;  1H1P B;  2ZZD B;  2PK9 B;  4JX5 A;  3HHT B;  3BLQ B;  2ZPB B;  2UUE B;  2QF7 A;  3WVE B;  1H1R B;  4EOS B;  4ROD A;  1D3U B;  3QHR B;  2CCH B;  3H4C A;  4F70 B;  1OIU B;  1UNG D;  2UZE B;  5I5Z B;  2WJ9 A;  1TD6 A;  3TN8 B;  1FKM A;  4YOO A;  3DDQ B;  4CRL B;  1OKW B;  5IDP B;  1JSU B;  1OI9 B;  3A8L B;  4QSH A;  1GUX A;  2CZ0 B;  4BCG B;  3O0G D;  4UN0 A;  4CFU B;  4EOJ B;  2W96 A;  2IVX A;  1QMZ B;  2IW8 B;  3DJB A;  4BCQ D;  5L2W B;  4EOP B;  4EOO B;  2BS4 A;  4ELL A;  2BS2 A;  1KXU A;  3EID B;  1VIN A;  2WMB B;  3X25 B;  3HBL A;  3TNW B;  2KR6 A;  1GUX B;  1H4L D;  3X28 B;  2PK2 A;  3K7A M;  4HNU A;  3VYH B;  4I3Z B;  3WVD B;  4BCP B;  4F7S B;  3EOC B;  4ZGJ B;  5HBJ B;  4BCJ B;  2WPA B;  2I40 B;  1H1S B;  1W98 B;  3VKG A;  5IDN B;  3QZ5 B;  2BS3 A;  1UNL D;  2AHJ B;  4YOS A;  4BCN B;  1G3N C;  2CCI B;  1PKD B;  4BCO B;  2CJM B;  3VKH A;  2CZ1 B;  5EJC A;  2F2C A;  4KRD B;  3BG5 A;  2C5V B;  2QDJ A;  4F6U B;  4Z6Y A;  3BHV B;  2QQ8 A;  5HBH B;  3BG3 A;  4BBS M;  4BY1 X;  1VYW B;  3QYE A;  2DD4 B;  2W2H A;  3BHT B;  4BXX X;  2W9Z A;  1OL1 B;  3G33 B;  3BHU B;  1AHJ B;  1GH6 B;  1OKV B;  1FVV B;  3A8O B;  3QXE B;  2WMA B;  1VOL A;  3B57 A;  4CFM B;  4AKI A;  4HNV A;  4TTH A;  2DXC B;  2G77 A;  3TNI B;  4BCN D;  1TFB A;  2C6T B;  1P5E B;  3GTM S;  4EOR B;  4OB3 B;  4ROC A;  1V29 B;  4CXA B;  4BCF B;  4EOK B;  1IRE B;  4JX6 A;  4OB0 B;  5CYI B;  4IMY B;  4CFV B;  2ZPE B;  4MFE A;  4FX3 B;  2WFY B;  3A8G B;  2IW6 B;  5ICP B;  3A8H B;  3BG9 A;  1JOW A;  3BLR B;  5HQ0 B;  4EOQ B;  3MIA B;  5CEI B;  3TNH B;  4EC8 B;  4BBR M;  1JKW A;  3PO3 S;  4BCK B;  2ZPH B;  4BCM B;  1E9H B;  4BCI B;  2C5X B;  1UGP B;  1H25 B;  4EOI B;  2V22 B;  2BKZ B;  5HVY B;  3TW7 A;  4AKG A;  4BY7 X;  4HL4 A;  2D0Q B;  2LW4 A;  1XO2 A;  4CFU D;  2C4G B;  3EJ1 B;  1UNH D;  2X1N B;  3BLH B;  3HO8 A;  4F7N B;  2C5O B;  3X20 B;  3QHW B;  2DD5 B;  2DXB B;  3X24 B;  3MI9 B;  3TW6 A;  1OGU B;  3HZJ A;  1UGR B;  4Y72 B;  2BPM B;  4HLQ A;  4BCQ B;  5IF1 B;  4II5 B;  4G6L B;  5IHY A;  2EUF A;  1QLB A;  2QDY B;  3DDP B;  3QYH B;  3DL1 A;  2IN3 A;  4BCM D;  3M03 A;  5BNJ B;  2WIP B;  3QYB A;  2JGZ B; 
#chains in the Genus database with same CATH homology
 1AD6 A;  2WPA B;  4EOM B;  2UZL B;  2I40 B;  5LQF B;  2W9F A;  1H1S B;  1H26 B;  1W98 B;  3MY5 B;  5IDN B;  4BCH B;  1UNL D;  4CFW B;  1H24 B;  2PHG A;  2PMI B;  4KRC B;  4YOS A;  1AIS B;  4BCN B;  1G3N C;  1JOW A;  2CCI B;  1PKD B;  3F5X B;  3BLR B;  5ACB A;  5HQ0 B;  2WEV B;  4EOQ B;  4BCO B;  2CJM B;  1FIN B;  3MIA B;  5CEI B;  3TNH B;  4CFX B;  1H1Q B;  4EC8 B;  2G9X B;  1H28 B;  4F7L B;  1JKW A;  1H1P B;  1H27 B;  2F2C A;  4KRD B;  3DOG B;  4BCK B;  2I53 A;  2PK9 B;  2C5V B;  5EFQ B;  2WHB B;  2QDJ A;  4F6U B;  1N4M A;  5FGK B;  1F5Q B;  3BHV B;  4CFN B;  3BLQ B;  2UUE B;  4BCM B;  4ROD A;  4EOS B;  1H1R B;  1E9H B;  4BCI B;  4F6W B;  1D3U B;  2UZB B;  5HBH B;  3QHR B;  2C5X B;  5HNB B;  2CCH B;  3H4C A;  4F70 B;  1H25 B;  1OIU B;  3POM A;  1UNG D;  4EOI B;  2UZE B;  1VYW B;  2V22 B;  5I5Z B;  2UZD B;  2BKZ B;  3TN8 B;  4YOO A;  4OR5 B;  2B9R A;  3DDQ B;  3MY1 B;  4CRL B;  5HVY B;  4ROE A;  2W2H A;  3BHT B;  1O9K A;  2C5N B;  2W99 A;  1OKW B;  2WXV B;  2W9Z A;  5IDP B;  1OL1 B;  3G33 B;  3BHU B;  1JSU B;  1OI9 B;  1GY3 B;  1XO2 A;  1GUX A;  4CFU D;  1GH6 B;  2C4G B;  3EJ1 B;  1UNH D;  2X1N B;  3BLH B;  3O0G D;  1OKV B;  4BCG B;  4YOZ A;  1FVV B;  4UN0 A;  4F7N B;  4OGR B;  4NST B;  2C5O B;  3QHW B;  3LQ5 B;  2WMA B;  4EOJ B;  4CFU B;  2W96 A;  4F6S B;  2WIH B;  1VOL A;  2IVX A;  1QMZ B;  2IW8 B;  4CFM B;  4ELJ A;  3MI9 B;  4TTH A;  1OGU B;  2R7G A;  1OIY B;  4BCQ D;  5L2W B;  4EOP B;  4EOO B;  4YC3 B;  4ELL A;  1KXU A;  4Y72 B;  3TNI B;  2BPM B;  4BCN D;  2IW9 B;  1TFB A;  2C6T B;  1O9K B;  1P5E B;  4BCQ B;  4F7J B;  5IF1 B;  4EOR B;  3EID B;  4G6L B;  1VIN A;  4II5 B;  4ROC A;  4CXA B;  2WMB B;  4BCF B;  2EUF A;  3TNW B;  1C9B A;  4EC9 B;  4EOL B;  4EOK B;  1GUX B;  1H4L D;  3DDP B;  2PK2 A;  5CYI B;  5LMK B;  1OL2 B;  4EON B;  3K7A M;  1JST B;  4IMY B;  1ZP2 A;  4CFV B;  4I3Z B;  1BU2 A;  4BCP B;  4F7S B;  5HBE B;  4FX3 B;  2WFY B;  4BCM D;  3M03 A;  3EOC B;  5HBJ B;  5BNJ B;  1URC B;  2IW6 B;  2WIP B;  4BCJ B;  5ICP B;  3RGF B;  2JGZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...