5L2WB

The x-ray co-crystal structure of human cdk2/cycline and dinaciclib.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
270
structure length
270
Chain Sequence
SPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title Spectrum and Degree of CDK Drug Interactions Predicts Clinical Performance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle/inhibitor
total genus 90
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5l2wB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5l2wB01
2IVXA 2IW6B 2CCHB 4YOOA 4EOKB 4EC9B 4F7JB 1H1QB 2C5XB 4CFWB 4EOIB 4EOLB 3BLHB 5FGKB 4EC8B 2WFYB 5CEIB 4F6UB 3EJ1B 4ELLA 3EIDB 4BCOB 1UNHD 3BLRB 4EONB 4YC3B 1E9HB 2I40B 1D3UB 2PMIB 2WMAB 3DDQB 4IMYB 5HBHB 4EOMB 1TFBA 3G33B 1XO2A 2WXVB 2PHGA 3MY5B 4CFUD 4BCFB 1O9KB 1H1SB 2W96A 5EFQB 5HBEB 1BU2A 2V22B 1OL1B 2UZDB 3K7AM 1G3NC 1VINA 3RGFB 1JKWA 4BCPB 5IDPB 4KRDB 2PK9B 5HBJB 4BCMD 3DOGB 4NSTB 5BNJB 4CXAB 1N4MA 2WIPB 2IW8B 1URCB 4EOSB 1JOWA 4EOPB 5ICPB 1H1RB 2C6TB 2UZBB 1H25B 2QDJA 3M03A 2BPMB 4ELJA 2UZLB 5HVYB 4BCQB 4F7SB 2WHBB 2UZEB 4ROEA 2F2CA 4CFMB 3F5XB 4BCKB 2JGZB 1OIUB 2UUEB 4F6WB 2IW9B 3TNHB 2C5VB 3POMA 4UN0A 4BCHB 1F5QB 1GH6B 1UNLD 4CFVB 3TN8B 1JSTB 3EOCB 1H4LD 4EOOB 3QHWB 4FX3B 1GUXA 1UNGD 2W2HA 1H1PB 2W99A 4BCGB 1H28B 1AISB 2C4GB 1VOLA 2I53A 2WIHB 4YOSA 4BCNB 3BLQB 1H24B 4EOQB 2CCIB 2WEVB 2W9FA 4EORB 4YOZA 4F6SB 2EUFA 3O0GD 1OIYB 2B9RA 5HNBB 4RODA 3BHUB 3MIAB 3BHVB 3TNWB 4CFNB 4I3ZB 4EOJB 1OKWB 2CJMB 4II5B 4OGRB 1O9KA 3TNIB 2WMBB 3MY1B 2G9XB 1P5EB 1FINB 2C5OB 4F7LB 4BCQD 5HQ0B 3DDPB 3H4CA 1OGUB 2R7GA 2W9ZA 1GY3B 4Y72B 5IDNB 5ACBA 4ROCA 4F7NB 4BCJB 4CFUB 1C9BA 5CYIB 1OL2B 3QHRB 1OI9B 4KRCB 2PK2A 2BKZB 3LQ5B 1JSUB 2WPAB 4OR5B 3MI9B 4BCMB 4F70B 1H27B 1KXUA 4BCND 4BCIB 5LMKB 2C5NB 5I5ZB 1FVVB 1PKDB 1VYWB 2X1NB 5L2WB 1ZP2A 1H26B 1AD6A 4TTHA 1W98B 4CFXB 1GUXB 1OKVB 5IF1B 1QMZB 3BHTB 5LQFB 4CRLB 4G6LB
chains in the Genus database with same CATH superfamily
3QZ9B 2WFYB 5CEIB 4HNUA 1AHJB 4BCOB 2KMGA 2DXBB 4EONB 4YC3B 1E9HB 3WVDB 3DDQB 2ZPGB 2DD5B 4HLQA 3QYGB 1O9KB 1H1SB 2W96A 5EFQB 3PO3S 2V22B 2ZPIB 4MFEA 2CYZB 3HZJA 4NSTB 4CXAB 1H25B 2BPMB 4ELJA 2UZLB 3KHIA 5HVYB 4FM4B 4ROEA 4CFMB 3F5XB 4BCKB 2IW9B 1GH6B 3A8LB 3QYBA 1H4LD 3A8HB 3GTMS 2CZ7B 1H1PB 2WEVB 1UGRB 2B9RA 3BHUB 2CZ6B 1OKWB 2QF7A 3QYEA 1FINB 3X20B 2BS3A 3H4CA 2R7GA 2G77A 4AKIA 2DMEA 5CYIB 1OL2B 4JX5A 4OB1B 2PK2A 4BCMB 4F70B 4ZGJB 2KR6A 1KXUA 1PKDB 4OB2B 4TTHA 1GUXB 5HBJB 2IVXA 4BY7X 4EC9B 4F7JB 1ENWA 2IN3A 2C5XB 3BLHB 4EC8B 4F6UB 4ELLA 5IHYA 1UNHD 3BLRB 1D3UB 3HB9A 3B57A 2LW4A 3G33B 4HL4A 1XO2A 3DTOA 2WXVB 2PHGA 3MY5B 4CFUD 1BU2A 3QZ5B 3K7AM 2ZCFB 1JKWA 4BCPB 5BNJB 4AI6A 3A8OB 4EOSB 4EOPB 2C6TB 4OB3B 2QDJA 3X24B 3M03A 4BCQB 4F7SB 2F2CA 3HBLA 1OIUB 2C5VB 3POMA 3HHTB 4NC6A 1AISB 2C4GB 4BCNB 4OB0B 2CZ0B 2CCIB 4ZGEB 1IREB 4QSHA 4EORB 4F6SB 3TW7A 3O0GD 5HNBB 3DJBA 4BY1X 1V29B 4EOJB 5DQVA 4II5B 4LOCA 3TNIB 3MY1B 2C5OB 1OGUB 5DQWA 4BBSM 2W9ZA 1GY3B 1QLBA 5ACBA 2QGSA 1C9BA 1OI9B 2BKZB 3LQ5B 3VKHA 1H27B 4HNVA 1UGSB 1ZP2A 4CFXB 2DXCB 5IF1B 1QMZB 3BHTB 4ZGDB 3X28B 4CFWB 4EOIB 5FGKB 3A8GB 2ZPEB 1UGQB 2ZPFB 2ZPBB 4IMYB 4EOMB 5HBEB 2UZDB 4KRDB 4AKGA 2PJQA 3BG9A 1N4MA 1JOWA 2UZBB 2ZPHB 2WHBB 3DL1A 2JGZB 2UUEB 4F6WB 2BS2A 4UN0A 4BCHB 1F5QB 3TN8B 1JSTB 4JX6A 1UNGD 2W2HA 2W99A 1TD6A 4BCGB 2AHJB 1H28B 4MFDA 4JX4A 4YOSA 1H24B 2W9FA 4AKHA 4YOZA 2EUFA 2DD4B 4RODA 3MIAB 4CFNB 4I3ZB 2CJMB 4OGRB 1O9KA 3QYHB 2WMBB 3X25B 3VYGB 5HQ0B 3X26B 4Y72B 5IDNB 4Z6YA 4CFUB 4KRCB 3QWLA 2BS4A 3BG5A 4OR5B 3MI9B 2QFZA 5LMKB 2C5NB 1FVVB 5L2WB 1AD6A 1W98B 1OKVB 3NDQA 5LQFB 4CRLB 2IW6B 2CCHB 4YOOA 4EOKB 1H1QB 4EOLB 3EJ1B 3TW6A 3EIDB 4MIMA 2QQ8A 2I40B 4HNTA 2PMIB 2WMAB 5HBHB 1TFBA 4BCFB 2CZ1B 1OL1B 1G3NC 1VINA 3RGFB 4M6VA 2QDYB 5IDPB 2PK9B 4BCMD 3DOGB 1UGPB 2WIPB 2IW8B 4BBRM 1URCB 5ICPB 1H1RB 2UZEB 3A8MB 3TNHB 4CFVB 1UNLD 2D0QB 3EOCB 4EOOB 3QHWB 4FX3B 1GUXA 1VOLA 2I53A 2WIHB 3BLQB 3QXEB 4EOQB 2DPPB 2WJ9A 2ZZDB 1OIYB 3HO8A 3BHVB 3TNWB 1E7PA 2G9XB 1P5EB 4F7LB 5EJCA 4BCQD 3DDPB 3WVEB 3VKGA 4ROCA 4F7NB 4BCJB 3QHRB 3BG3A 3VYHB 1JSUB 2WPAB 4BCND 4BCIB 5I5ZB 1VYWB 2X1NB 1FKMA 1H26B 4BXXX 4G6LB
chains in the Genus database with same CATH topology
2IVXA 2IW6B 2CCHB 4YOOA 4EOKB 4EC9B 4F7JB 1H1QB 2C5XB 4CFWB 4EOIB 4EOLB 3BLHB 5FGKB 4EC8B 2WFYB 5CEIB 4F6UB 3EJ1B 4ELLA 3EIDB 4BCOB 1UNHD 3BLRB 4EONB 4YC3B 1E9HB 2I40B 1D3UB 2PMIB 2WMAB 3DDQB 4IMYB 5HBHB 4EOMB 1TFBA 3G33B 1XO2A 2WXVB 2PHGA 3MY5B 4CFUD 4BCFB 1O9KB 1H1SB 2W96A 5EFQB 5HBEB 1BU2A 2V22B 1OL1B 2UZDB 3K7AM 1G3NC 1VINA 3RGFB 1JKWA 4BCPB 5IDPB 4KRDB 2PK9B 5HBJB 4BCMD 3DOGB 4NSTB 5BNJB 4CXAB 1N4MA 2WIPB 2IW8B 1URCB 4EOSB 1JOWA 4EOPB 5ICPB 1H1RB 2C6TB 2UZBB 1H25B 2QDJA 3M03A 2BPMB 4ELJA 2UZLB 5HVYB 4BCQB 4F7SB 2WHBB 2UZEB 4ROEA 2F2CA 4CFMB 3F5XB 4BCKB 2JGZB 1OIUB 2UUEB 4F6WB 2IW9B 3TNHB 2C5VB 3POMA 4UN0A 4BCHB 1F5QB 1GH6B 1UNLD 4CFVB 3TN8B 1JSTB 3EOCB 1H4LD 4EOOB 3QHWB 4FX3B 1GUXA 1UNGD 2W2HA 1H1PB 2W99A 4BCGB 1H28B 1AISB 2C4GB 1VOLA 2I53A 2WIHB 4YOSA 4BCNB 3BLQB 1H24B 4EOQB 2CCIB 2WEVB 2W9FA 4EORB 4YOZA 4F6SB 2EUFA 3O0GD 1OIYB 2B9RA 5HNBB 4RODA 3BHUB 3MIAB 3BHVB 3TNWB 4CFNB 4I3ZB 4EOJB 1OKWB 2CJMB 4II5B 4OGRB 1O9KA 3TNIB 2WMBB 3MY1B 2G9XB 1P5EB 1FINB 2C5OB 4F7LB 4BCQD 5HQ0B 3DDPB 3H4CA 1OGUB 2R7GA 2W9ZA 1GY3B 4Y72B 5IDNB 5ACBA 4ROCA 4F7NB 4BCJB 4CFUB 1C9BA 5CYIB 1OL2B 3QHRB 1OI9B 4KRCB 2PK2A 2BKZB 3LQ5B 1JSUB 2WPAB 4OR5B 3MI9B 4BCMB 4F70B 1H27B 1KXUA 4BCND 4BCIB 5LMKB 2C5NB 5I5ZB 1FVVB 1PKDB 1VYWB 2X1NB 5L2WB 1ZP2A 1H26B 1AD6A 4TTHA 1W98B 4CFXB 1GUXB 1OKVB 5IF1B 1QMZB 3BHTB 5LQFB 4CRLB 4G6LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVX A;  2IW6 B;  2CCH B;  4YOO A;  4EOK B;  4EC9 B;  4F7J B;  1H1Q B;  2C5X B;  4CFW B;  4EOI B;  4EOL B;  3BLH B;  5FGK B;  4EC8 B;  2WFY B;  5CEI B;  4F6U B;  3EJ1 B;  4ELL A;  3EID B;  4BCO B;  1UNH D;  3BLR B;  4EON B;  4YC3 B;  1E9H B;  2I40 B;  1D3U B;  2PMI B;  2WMA B;  3DDQ B;  4IMY B;  5HBH B;  4EOM B;  1TFB A;  3G33 B;  1XO2 A;  2WXV B;  2PHG A;  3MY5 B;  4CFU D;  4BCF B;  1O9K B;  1H1S B;  2W96 A;  5EFQ B;  5HBE B;  1BU2 A;  2V22 B;  1OL1 B;  2UZD B;  3K7A M;  1G3N C;  1VIN A;  3RGF B;  1JKW A;  4BCP B;  5IDP B;  4KRD B;  2PK9 B;  5HBJ B;  4BCM D;  3DOG B;  4NST B;  5BNJ B;  4CXA B;  1N4M A;  2WIP B;  2IW8 B;  1URC B;  4EOS B;  1JOW A;  4EOP B;  5ICP B;  1H1R B;  2C6T B;  2UZB B;  1H25 B;  2QDJ A;  3M03 A;  2BPM B;  4ELJ A;  2UZL B;  5HVY B;  4BCQ B;  4F7S B;  2WHB B;  2UZE B;  4ROE A;  2F2C A;  4CFM B;  3F5X B;  4BCK B;  2JGZ B;  1OIU B;  2UUE B;  4F6W B;  2IW9 B;  3TNH B;  2C5V B;  3POM A;  4UN0 A;  4BCH B;  1F5Q B;  1GH6 B;  1UNL D;  4CFV B;  3TN8 B;  1JST B;  3EOC B;  1H4L D;  4EOO B;  3QHW B;  4FX3 B;  1GUX A;  1UNG D;  2W2H A;  1H1P B;  2W99 A;  4BCG B;  1H28 B;  1AIS B;  2C4G B;  1VOL A;  2I53 A;  2WIH B;  4YOS A;  4BCN B;  3BLQ B;  1H24 B;  4EOQ B;  2CCI B;  2WEV B;  2W9F A;  4EOR B;  4YOZ A;  4F6S B;  2EUF A;  3O0G D;  1OIY B;  2B9R A;  5HNB B;  4ROD A;  3BHU B;  3MIA B;  3BHV B;  3TNW B;  4CFN B;  4I3Z B;  4EOJ B;  1OKW B;  2CJM B;  4II5 B;  4OGR B;  1O9K A;  3TNI B;  2WMB B;  3MY1 B;  2G9X B;  1P5E B;  1FIN B;  2C5O B;  4F7L B;  4BCQ D;  5HQ0 B;  3DDP B;  3H4C A;  1OGU B;  2R7G A;  2W9Z A;  1GY3 B;  4Y72 B;  5IDN B;  5ACB A;  4ROC A;  4F7N B;  4BCJ B;  4CFU B;  1C9B A;  5CYI B;  1OL2 B;  3QHR B;  1OI9 B;  4KRC B;  2PK2 A;  2BKZ B;  3LQ5 B;  1JSU B;  2WPA B;  4OR5 B;  3MI9 B;  4BCM B;  4F70 B;  1H27 B;  1KXU A;  4BCN D;  4BCI B;  5LMK B;  2C5N B;  5I5Z B;  1FVV B;  1PKD B;  1VYW B;  2X1N B;  5L2W B;  1ZP2 A;  1H26 B;  1AD6 A;  4TTH A;  1W98 B;  4CFX B;  1GUX B;  1OKV B;  5IF1 B;  1QMZ B;  3BHT B;  5LQF B;  4CRL B;  4G6L B; 
#chains in the Genus database with same CATH topology
 3QZ9 B;  2WFY B;  5CEI B;  4HNU A;  1AHJ B;  4BCO B;  2KMG A;  2DXB B;  4EON B;  4YC3 B;  1E9H B;  3WVD B;  3DDQ B;  2ZPG B;  2DD5 B;  4HLQ A;  3QYG B;  1O9K B;  1H1S B;  2W96 A;  5EFQ B;  3PO3 S;  2V22 B;  2ZPI B;  4MFE A;  2CYZ B;  3HZJ A;  4NST B;  4CXA B;  1H25 B;  2BPM B;  4ELJ A;  2UZL B;  3KHI A;  5HVY B;  4FM4 B;  4ROE A;  4CFM B;  3F5X B;  4BCK B;  2IW9 B;  1GH6 B;  3A8L B;  3QYB A;  1H4L D;  3A8H B;  3GTM S;  2CZ7 B;  1H1P B;  2WEV B;  1UGR B;  2B9R A;  3BHU B;  2CZ6 B;  1OKW B;  2QF7 A;  3QYE A;  1FIN B;  3X20 B;  2BS3 A;  3H4C A;  2R7G A;  2G77 A;  4AKI A;  2DME A;  5CYI B;  1OL2 B;  4JX5 A;  4OB1 B;  2PK2 A;  4BCM B;  4F70 B;  4ZGJ B;  2KR6 A;  1KXU A;  1PKD B;  4OB2 B;  4TTH A;  1GUX B;  5HBJ B;  2IVX A;  4BY7 X;  4EC9 B;  4F7J B;  1ENW A;  2IN3 A;  2C5X B;  3BLH B;  4EC8 B;  4F6U B;  4ELL A;  5IHY A;  1UNH D;  3BLR B;  1D3U B;  3HB9 A;  3B57 A;  2LW4 A;  3G33 B;  4HL4 A;  1XO2 A;  3DTO A;  2WXV B;  2PHG A;  3MY5 B;  4CFU D;  1BU2 A;  3QZ5 B;  3K7A M;  2ZCF B;  1JKW A;  4BCP B;  5BNJ B;  4AI6 A;  3A8O B;  4EOS B;  4EOP B;  2C6T B;  4OB3 B;  2QDJ A;  3X24 B;  3M03 A;  4BCQ B;  4F7S B;  2F2C A;  3HBL A;  1OIU B;  2C5V B;  3POM A;  3HHT B;  4NC6 A;  1AIS B;  2C4G B;  4BCN B;  4OB0 B;  2CZ0 B;  2CCI B;  4ZGE B;  1IRE B;  4QSH A;  4EOR B;  4F6S B;  3TW7 A;  3O0G D;  5HNB B;  3DJB A;  4BY1 X;  1V29 B;  4EOJ B;  5DQV A;  4II5 B;  4LOC A;  3TNI B;  3MY1 B;  2C5O B;  1OGU B;  5DQW A;  4BBS M;  2W9Z A;  1GY3 B;  1QLB A;  5ACB A;  2QGS A;  1C9B A;  1OI9 B;  2BKZ B;  3LQ5 B;  3VKH A;  1H27 B;  4HNV A;  1UGS B;  1ZP2 A;  4CFX B;  2DXC B;  5IF1 B;  1QMZ B;  3BHT B;  4ZGD B;  3X28 B;  4CFW B;  4EOI B;  5FGK B;  3A8G B;  2ZPE B;  1UGQ B;  2ZPF B;  2ZPB B;  4IMY B;  4EOM B;  5HBE B;  2UZD B;  4KRD B;  4AKG A;  2PJQ A;  3BG9 A;  1N4M A;  1JOW A;  2UZB B;  2ZPH B;  2WHB B;  3DL1 A;  2JGZ B;  2UUE B;  4F6W B;  2BS2 A;  4UN0 A;  4BCH B;  1F5Q B;  3TN8 B;  1JST B;  4JX6 A;  1UNG D;  2W2H A;  2W99 A;  1TD6 A;  4BCG B;  2AHJ B;  1H28 B;  4MFD A;  4JX4 A;  4YOS A;  1H24 B;  2W9F A;  4AKH A;  4YOZ A;  2EUF A;  2DD4 B;  4ROD A;  3MIA B;  4CFN B;  4I3Z B;  2CJM B;  4OGR B;  1O9K A;  3QYH B;  2WMB B;  3X25 B;  3VYG B;  5HQ0 B;  3X26 B;  4Y72 B;  5IDN B;  4Z6Y A;  4CFU B;  4KRC B;  3QWL A;  2BS4 A;  3BG5 A;  4OR5 B;  3MI9 B;  2QFZ A;  5LMK B;  2C5N B;  1FVV B;  5L2W B;  1AD6 A;  1W98 B;  1OKV B;  3NDQ A;  5LQF B;  4CRL B;  2IW6 B;  2CCH B;  4YOO A;  4EOK B;  1H1Q B;  4EOL B;  3EJ1 B;  3TW6 A;  3EID B;  4MIM A;  2QQ8 A;  2I40 B;  4HNT A;  2PMI B;  2WMA B;  5HBH B;  1TFB A;  4BCF B;  2CZ1 B;  1OL1 B;  1G3N C;  1VIN A;  3RGF B;  4M6V A;  2QDY B;  5IDP B;  2PK9 B;  4BCM D;  3DOG B;  1UGP B;  2WIP B;  2IW8 B;  4BBR M;  1URC B;  5ICP B;  1H1R B;  2UZE B;  3A8M B;  3TNH B;  4CFV B;  1UNL D;  2D0Q B;  3EOC B;  4EOO B;  3QHW B;  4FX3 B;  1GUX A;  1VOL A;  2I53 A;  2WIH B;  3BLQ B;  3QXE B;  4EOQ B;  2DPP B;  2WJ9 A;  2ZZD B;  1OIY B;  3HO8 A;  3BHV B;  3TNW B;  1E7P A;  2G9X B;  1P5E B;  4F7L B;  5EJC A;  4BCQ D;  3DDP B;  3WVE B;  3VKG A;  4ROC A;  4F7N B;  4BCJ B;  3QHR B;  3BG3 A;  3VYH B;  1JSU B;  2WPA B;  4BCN D;  4BCI B;  5I5Z B;  1VYW B;  2X1N B;  1FKM A;  1H26 B;  4BXX X;  4G6L B; 
#chains in the Genus database with same CATH homology
 2IVX A;  2IW6 B;  2CCH B;  4YOO A;  4EOK B;  4EC9 B;  4F7J B;  1H1Q B;  2C5X B;  4CFW B;  4EOI B;  4EOL B;  3BLH B;  5FGK B;  4EC8 B;  2WFY B;  5CEI B;  4F6U B;  3EJ1 B;  4ELL A;  3EID B;  4BCO B;  1UNH D;  3BLR B;  4EON B;  4YC3 B;  1E9H B;  2I40 B;  1D3U B;  2PMI B;  2WMA B;  3DDQ B;  4IMY B;  5HBH B;  4EOM B;  1TFB A;  3G33 B;  1XO2 A;  2WXV B;  2PHG A;  3MY5 B;  4CFU D;  4BCF B;  1O9K B;  1H1S B;  2W96 A;  5EFQ B;  5HBE B;  1BU2 A;  2V22 B;  1OL1 B;  2UZD B;  3K7A M;  1G3N C;  1VIN A;  3RGF B;  1JKW A;  4BCP B;  5IDP B;  4KRD B;  2PK9 B;  5HBJ B;  4BCM D;  3DOG B;  4NST B;  5BNJ B;  4CXA B;  1N4M A;  2WIP B;  2IW8 B;  1URC B;  4EOS B;  1JOW A;  4EOP B;  5ICP B;  1H1R B;  2C6T B;  2UZB B;  1H25 B;  2QDJ A;  3M03 A;  2BPM B;  4ELJ A;  2UZL B;  5HVY B;  4BCQ B;  4F7S B;  2WHB B;  2UZE B;  4ROE A;  2F2C A;  4CFM B;  3F5X B;  4BCK B;  2JGZ B;  1OIU B;  2UUE B;  4F6W B;  2IW9 B;  3TNH B;  2C5V B;  3POM A;  4UN0 A;  4BCH B;  1F5Q B;  1GH6 B;  1UNL D;  4CFV B;  3TN8 B;  1JST B;  3EOC B;  1H4L D;  4EOO B;  3QHW B;  4FX3 B;  1GUX A;  1UNG D;  2W2H A;  1H1P B;  2W99 A;  4BCG B;  1H28 B;  1AIS B;  2C4G B;  1VOL A;  2I53 A;  2WIH B;  4YOS A;  4BCN B;  3BLQ B;  1H24 B;  4EOQ B;  2CCI B;  2WEV B;  2W9F A;  4EOR B;  4YOZ A;  4F6S B;  2EUF A;  3O0G D;  1OIY B;  2B9R A;  5HNB B;  4ROD A;  3BHU B;  3MIA B;  3BHV B;  3TNW B;  4CFN B;  4I3Z B;  4EOJ B;  1OKW B;  2CJM B;  4II5 B;  4OGR B;  1O9K A;  3TNI B;  2WMB B;  3MY1 B;  2G9X B;  1P5E B;  1FIN B;  2C5O B;  4F7L B;  4BCQ D;  5HQ0 B;  3DDP B;  3H4C A;  1OGU B;  2R7G A;  2W9Z A;  1GY3 B;  4Y72 B;  5IDN B;  5ACB A;  4ROC A;  4F7N B;  4BCJ B;  4CFU B;  1C9B A;  5CYI B;  1OL2 B;  3QHR B;  1OI9 B;  4KRC B;  2PK2 A;  2BKZ B;  3LQ5 B;  1JSU B;  2WPA B;  4OR5 B;  3MI9 B;  4BCM B;  4F70 B;  1H27 B;  1KXU A;  4BCN D;  4BCI B;  5LMK B;  2C5N B;  5I5Z B;  1FVV B;  1PKD B;  1VYW B;  2X1N B;  5L2W B;  1ZP2 A;  1H26 B;  1AD6 A;  4TTH A;  1W98 B;  4CFX B;  1GUX B;  1OKV B;  5IF1 B;  1QMZ B;  3BHT B;  5LQF B;  4CRL B;  4G6L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...