3QHRB

Structure of a pcdk2/cyclina transition-state mimic
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
261
Chain Sequence
b'SNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Briefly Bound to Activate: Transient Binding of a Second Catalytic Magnesium Activates the Structure and Dynamics of CDK2 Kinase for Catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding
total genus 96
structure length 261
sequence length 261
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3qhrB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3qhrB02
1O9KB 4EOQB 5HQ0B 3MIAB 4Y72B 3DDPB 1JKWA 4TTHA 4F6WB 5CYIB 4EONB 1GY3B 4YC3B 5HBHB 2IW6B 4KRDB 1VOLA 5L2WB 3M03A 3O0GD 4G6LB 3MI9B 4YOZA 1OKWB 4BCKB 1VYWB 4I3ZB 1OL2B 5ACBA 2JGZB 1H27B 2W9ZA 5LMKB 5LQFB 3QHWB 2I53A 4EC9B 3EOCB 1P5EB 4EOPB 3TN8B 3MY1B 3BHVB 2W2HA 2WFYB 1G3NC 4F6SB 3F5XB 1GUXB 2PK2A 2W99A 5EFQB 4ROEA 3BHTB 1UNHD 4FX3B 3POMA 2BKZB 1F5QB 1E9HB 5IDNB 4F7SB 3EJ1B 3BLHB 3BLRB 2IVXA 1H1RB 2V22B 5FGKB 1UNGD 1UNLD 1JOWA 4YOOA 4BCJB 3DDQB 4CRLB 1D3UB 2WMBB 5HNBB 4BCHB 2PK9B 4ELJA 1N4MA 4BCFB 2C5XB 2WIPB 4NSTB 2IW8B 1JSTB 1QMZB 5HVYB 1VINA 2WHBB 4CFNB 4CXAB 5HBJB 2IW9B 5CEIB 1H4LD 1URCB 2PMIB 2UZDB 4OR5B 1OKVB 2QDJA 4CFWB 5ICPB 3H4CA 2UUEB 2CCHB 4OGRB 4EOSB 3BLQB 4BCIB 2UZBB 2X1NB 1FINB 4EOIB 3DOGB 1O9KA 3RGFB 2WEVB 1AISB 2C5NB 5BNJB 2UZEB 5IF1B 1FVVB 1TFBA 1H26B 4BCOB 2WIHB 4KRCB 4CFUD 5I5ZB 1OGUB 2W9FA 2PHGA 1H24B 2BPMB 3EIDB 1H25B 3QHRB 2C6TB 4F6UB 3LQ5B 1OIYB 2I40B 4BCND 1XO2A 1KXUA 4F7NB 4CFMB 5HBEB 1ZP2A 2UZLB 4EC8B 4CFUB 1H1PB 4ELLA 4CFVB 2G9XB 3G33B 2CJMB 2W96A 4BCMD 1OI9B 4EOLB 2F2CA 1GUXA 1AD6A 3K7AM 4BCGB 4RODA 4BCNB 1BU2A 2WMAB 1OIUB 4YOSA 2CCIB 1OL1B 2C5VB 3TNHB 4EOKB 1PKDB 1GH6B 2B9RA 2C4GB 4BCMB 1H1QB 2EUFA 1H1SB 1JSUB 3MY5B 5IDPB 4EORB 4F70B 4BCQD 3BHUB 1H28B 2C5OB 2WXVB 4IMYB 1C9BA 4ROCA 4EOJB 2WPAB 4UN0A 3TNIB 4BCPB 2R7GA 4F7LB 4CFXB 4EOMB 3TNWB 4II5B 1W98B 4EOOB 4BCQB 4F7JB
chains in the Genus database with same CATH superfamily
3DDPB 3DTOA 3VYHB 5CYIB 1GY3B 4OB0B 2IW6B 3QYBA 3O0GD 4NC6A 4AKHA 3QHWB 2D0QB 4EOPB 1GUXB 2PK2A 2W99A 1UNHD 2CZ0B 1E9HB 5IDNB 4F7SB 3EJ1B 3X24B 5FGKB 4HLQA 4CRLB 1D3UB 2BS3A 5DQVA 5HNBB 4ELJA 2LW4A 1N4MA 4BCFB 2WIPB 2IW8B 4ZGDB 4MFEA 4CXAB 2DD5B 2BS2A 1URCB 2PMIB 4AKGA 1OKVB 1V29B 4OB1B 5DQWA 2ZCFB 3TW7A 4HNTA 2X1NB 1FINB 4BY7X 3RGFB 4KRCB 2QFZA 2ZPGB 2W9FA 2ZPIB 3QHRB 2C6TB 4BY1X 1XO2A 4CFMB 2ZZDB 4CFUB 4BCMD 1TD6A 3K7AM 4BCGB 4BCNB 1QLBA 1OIUB 4YOSA 3A8GB 4EOKB 1H1SB 3MY5B 4JX4A 4EORB 4BCQD 1H28B 2C5OB 2R7GA 4AI6A 4CFXB 2QF7A 4EOQB 4F7JB 3X25B 1O9KB 3MIAB 4TTHA 4F6WB 4MFDA 3MI9B 4YOZA 3QXEB 3TW6A 4I3ZB 1OL2B 2JGZB 3HO8A 4OB2B 4EC9B 4AKIA 4OB3B 3A8LB 3BG5A 4FX3B 3QYEA 2ZPFB 3BLHB 4BBRM 3WVEB 2IN3A 3HB9A 3BLRB 2QQ8A 3GTMS 1UNLD 1AHJB 3VKHA 3DDQB 1E7PA 4NSTB 1QMZB 3BG9A 1FKMA 5HBJB 3QWLA 2IW9B 5CEIB 2UZDB 4OR5B 4OGRB 4BCIB 3DOGB 2WEVB 2C5NB 2CZ6B 4BBSM 1FVVB 1TFBA 3QZ5B 2WIHB 1H24B 2BPMB 3EIDB 1OIYB 2I40B 5HBEB 4CFVB 2G9XB 3KHIA 2CYZB 2F2CA 1AD6A 4RODA 2C5VB 3TNHB 2B9RA 1GH6B 2C4GB 4JX6A 2EUFA 4F70B 2WXVB 4IMYB 2WPAB 3TNWB 4II5B 1W98B 3X26B 1JKWA 1VOLA 5L2WB 2DXBB 4BCKB 1VYWB 5LMKB 3EOCB 3TN8B 3A8OB 3BHVB 4HL4A 1G3NC 4JX5A 3NDQA 3A8MB 5EFQB 3BHTB 3POMA 1F5QB 2V22B 1UNGD 1JOWA 4YOOA 3B57A 2WMBB 2PK9B 2C5XB 1ENWA 1JSTB 1UGPB 1VINA 4CFNB 2QGSA 2ZPHB 4CFWB 3H4CA 1UGSB 2CCHB 2UZBB 4BXXX 4EOIB 1AISB 2BS4A 5BNJB 5IF1B 1H26B 4BCOB 4CFUD 2DPPB 2PHGA 1H25B 2DD4B 4F6UB 3LQ5B 4BCND 2ZPBB 4QSHA 1ZP2A 3X20B 2CJMB 4EOLB 1OI9B 1GUXA 2WMAB 3WVDB 2CCIB 1PKDB 4BCMB 4M6VA 2DXCB 3BHUB 1C9BA 1UGRB 4EOJB 3HHTB 4UN0A 3TNIB 2KMGA 4FM4B 4EOMB 2QDYB 4BCQB 5HQ0B 4Y72B 4EONB 4ZGJB 4YC3B 5HBHB 4KRDB 3M03A 4G6LB 3VKGA 3QYGB 1OKWB 5ACBA 1H27B 2W9ZA 5LQFB 2I53A 2KR6A 1P5EB 2G77A 3MY1B 2W2HA 2WFYB 4F6SB 3F5XB 4ROEA 3X28B 2BKZB 2CZ7B 4Z6YA 2IVXA 1H1RB 4BCJB 2ZPEB 5EJCA 4HNUA 3QZ9B 4BCHB 3VYGB 4HNVA 2PJQA 3BG3A 5HVYB 2WHBB 1H4LD 2QDJA 5ICPB 3A8HB 4MIMA 2UUEB 3QYHB 4EOSB 3BLQB 1O9KA 2UZEB 2AHJB 5I5ZB 1OGUB 1UGQB 1IREB 4F7NB 1KXUA 4EC8B 2UZLB 1H1PB 3DL1A 2DMEA 4ELLA 3G33B 2W96A 5IHYA 3HBLA 1BU2A 3HZJA 3PO3S 2CZ1B 1OL1B 4ZGEB 2WJ9A 1H1QB 1JSUB 5IDPB 4LOCA 4ROCA 4BCPB 4F7LB 4EOOB 3DJBA
chains in the Genus database with same CATH topology
1O9KB 4EOQB 5HQ0B 3MIAB 4Y72B 3DDPB 1JKWA 4TTHA 4F6WB 5CYIB 4EONB 1GY3B 4YC3B 5HBHB 2IW6B 4KRDB 1VOLA 5L2WB 3M03A 3O0GD 4G6LB 3MI9B 4YOZA 1OKWB 4BCKB 1VYWB 4I3ZB 1OL2B 5ACBA 2JGZB 1H27B 2W9ZA 5LMKB 5LQFB 3QHWB 2I53A 4EC9B 3EOCB 1P5EB 4EOPB 3TN8B 3MY1B 3BHVB 2W2HA 2WFYB 1G3NC 4F6SB 3F5XB 1GUXB 2PK2A 2W99A 5EFQB 4ROEA 3BHTB 1UNHD 4FX3B 3POMA 2BKZB 1F5QB 1E9HB 5IDNB 4F7SB 3EJ1B 3BLHB 3BLRB 2IVXA 1H1RB 2V22B 5FGKB 1UNGD 1UNLD 1JOWA 4YOOA 4BCJB 3DDQB 4CRLB 1D3UB 2WMBB 5HNBB 4BCHB 2PK9B 4ELJA 1N4MA 4BCFB 2C5XB 2WIPB 4NSTB 2IW8B 1JSTB 1QMZB 5HVYB 1VINA 2WHBB 4CFNB 4CXAB 5HBJB 2IW9B 5CEIB 1H4LD 1URCB 2PMIB 2UZDB 4OR5B 1OKVB 2QDJA 4CFWB 5ICPB 3H4CA 2UUEB 2CCHB 4OGRB 4EOSB 3BLQB 4BCIB 2UZBB 2X1NB 1FINB 4EOIB 3DOGB 1O9KA 3RGFB 2WEVB 1AISB 2C5NB 5BNJB 2UZEB 5IF1B 1FVVB 1TFBA 1H26B 4BCOB 2WIHB 4KRCB 4CFUD 5I5ZB 1OGUB 2W9FA 2PHGA 1H24B 2BPMB 3EIDB 1H25B 3QHRB 2C6TB 4F6UB 3LQ5B 1OIYB 2I40B 4BCND 1XO2A 1KXUA 4F7NB 4CFMB 5HBEB 1ZP2A 2UZLB 4EC8B 4CFUB 1H1PB 4ELLA 4CFVB 2G9XB 3G33B 2CJMB 2W96A 4BCMD 1OI9B 4EOLB 2F2CA 1GUXA 1AD6A 3K7AM 4BCGB 4RODA 4BCNB 1BU2A 2WMAB 1OIUB 4YOSA 2CCIB 1OL1B 2C5VB 3TNHB 4EOKB 1PKDB 1GH6B 2B9RA 2C4GB 4BCMB 1H1QB 2EUFA 1H1SB 1JSUB 3MY5B 5IDPB 4EORB 4F70B 4BCQD 3BHUB 1H28B 2C5OB 2WXVB 4IMYB 1C9BA 4ROCA 4EOJB 2WPAB 4UN0A 3TNIB 4BCPB 2R7GA 4F7LB 4CFXB 4EOMB 3TNWB 4II5B 1W98B 4EOOB 4BCQB 4F7JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9K B;  4EOQ B;  5HQ0 B;  3MIA B;  4Y72 B;  3DDP B;  1JKW A;  4TTH A;  4F6W B;  5CYI B;  4EON B;  1GY3 B;  4YC3 B;  5HBH B;  2IW6 B;  4KRD B;  1VOL A;  5L2W B;  3M03 A;  3O0G D;  4G6L B;  3MI9 B;  4YOZ A;  1OKW B;  4BCK B;  1VYW B;  4I3Z B;  1OL2 B;  5ACB A;  2JGZ B;  1H27 B;  2W9Z A;  5LMK B;  5LQF B;  3QHW B;  2I53 A;  4EC9 B;  3EOC B;  1P5E B;  4EOP B;  3TN8 B;  3MY1 B;  3BHV B;  2W2H A;  2WFY B;  1G3N C;  4F6S B;  3F5X B;  1GUX B;  2PK2 A;  2W99 A;  5EFQ B;  4ROE A;  3BHT B;  1UNH D;  4FX3 B;  3POM A;  2BKZ B;  1F5Q B;  1E9H B;  5IDN B;  4F7S B;  3EJ1 B;  3BLH B;  3BLR B;  2IVX A;  1H1R B;  2V22 B;  5FGK B;  1UNG D;  1UNL D;  1JOW A;  4YOO A;  4BCJ B;  3DDQ B;  4CRL B;  1D3U B;  2WMB B;  5HNB B;  4BCH B;  2PK9 B;  4ELJ A;  1N4M A;  4BCF B;  2C5X B;  2WIP B;  4NST B;  2IW8 B;  1JST B;  1QMZ B;  5HVY B;  1VIN A;  2WHB B;  4CFN B;  4CXA B;  5HBJ B;  2IW9 B;  5CEI B;  1H4L D;  1URC B;  2PMI B;  2UZD B;  4OR5 B;  1OKV B;  2QDJ A;  4CFW B;  5ICP B;  3H4C A;  2UUE B;  2CCH B;  4OGR B;  4EOS B;  3BLQ B;  4BCI B;  2UZB B;  2X1N B;  1FIN B;  4EOI B;  3DOG B;  1O9K A;  3RGF B;  2WEV B;  1AIS B;  2C5N B;  5BNJ B;  2UZE B;  5IF1 B;  1FVV B;  1TFB A;  1H26 B;  4BCO B;  2WIH B;  4KRC B;  4CFU D;  5I5Z B;  1OGU B;  2W9F A;  2PHG A;  1H24 B;  2BPM B;  3EID B;  1H25 B;  3QHR B;  2C6T B;  4F6U B;  3LQ5 B;  1OIY B;  2I40 B;  4BCN D;  1XO2 A;  1KXU A;  4F7N B;  4CFM B;  5HBE B;  1ZP2 A;  2UZL B;  4EC8 B;  4CFU B;  1H1P B;  4ELL A;  4CFV B;  2G9X B;  3G33 B;  2CJM B;  2W96 A;  4BCM D;  1OI9 B;  4EOL B;  2F2C A;  1GUX A;  1AD6 A;  3K7A M;  4BCG B;  4ROD A;  4BCN B;  1BU2 A;  2WMA B;  1OIU B;  4YOS A;  2CCI B;  1OL1 B;  2C5V B;  3TNH B;  4EOK B;  1PKD B;  1GH6 B;  2B9R A;  2C4G B;  4BCM B;  1H1Q B;  2EUF A;  1H1S B;  1JSU B;  3MY5 B;  5IDP B;  4EOR B;  4F70 B;  4BCQ D;  3BHU B;  1H28 B;  2C5O B;  2WXV B;  4IMY B;  1C9B A;  4ROC A;  4EOJ B;  2WPA B;  4UN0 A;  3TNI B;  4BCP B;  2R7G A;  4F7L B;  4CFX B;  4EOM B;  3TNW B;  4II5 B;  1W98 B;  4EOO B;  4BCQ B;  4F7J B; 
#chains in the Genus database with same CATH topology
 3DDP B;  3DTO A;  3VYH B;  5CYI B;  1GY3 B;  4OB0 B;  2IW6 B;  3QYB A;  3O0G D;  4NC6 A;  4AKH A;  3QHW B;  2D0Q B;  4EOP B;  1GUX B;  2PK2 A;  2W99 A;  1UNH D;  2CZ0 B;  1E9H B;  5IDN B;  4F7S B;  3EJ1 B;  3X24 B;  5FGK B;  4HLQ A;  4CRL B;  1D3U B;  2BS3 A;  5DQV A;  5HNB B;  4ELJ A;  2LW4 A;  1N4M A;  4BCF B;  2WIP B;  2IW8 B;  4ZGD B;  4MFE A;  4CXA B;  2DD5 B;  2BS2 A;  1URC B;  2PMI B;  4AKG A;  1OKV B;  1V29 B;  4OB1 B;  5DQW A;  2ZCF B;  3TW7 A;  4HNT A;  2X1N B;  1FIN B;  4BY7 X;  3RGF B;  4KRC B;  2QFZ A;  2ZPG B;  2W9F A;  2ZPI B;  3QHR B;  2C6T B;  4BY1 X;  1XO2 A;  4CFM B;  2ZZD B;  4CFU B;  4BCM D;  1TD6 A;  3K7A M;  4BCG B;  4BCN B;  1QLB A;  1OIU B;  4YOS A;  3A8G B;  4EOK B;  1H1S B;  3MY5 B;  4JX4 A;  4EOR B;  4BCQ D;  1H28 B;  2C5O B;  2R7G A;  4AI6 A;  4CFX B;  2QF7 A;  4EOQ B;  4F7J B;  3X25 B;  1O9K B;  3MIA B;  4TTH A;  4F6W B;  4MFD A;  3MI9 B;  4YOZ A;  3QXE B;  3TW6 A;  4I3Z B;  1OL2 B;  2JGZ B;  3HO8 A;  4OB2 B;  4EC9 B;  4AKI A;  4OB3 B;  3A8L B;  3BG5 A;  4FX3 B;  3QYE A;  2ZPF B;  3BLH B;  4BBR M;  3WVE B;  2IN3 A;  3HB9 A;  3BLR B;  2QQ8 A;  3GTM S;  1UNL D;  1AHJ B;  3VKH A;  3DDQ B;  1E7P A;  4NST B;  1QMZ B;  3BG9 A;  1FKM A;  5HBJ B;  3QWL A;  2IW9 B;  5CEI B;  2UZD B;  4OR5 B;  4OGR B;  4BCI B;  3DOG B;  2WEV B;  2C5N B;  2CZ6 B;  4BBS M;  1FVV B;  1TFB A;  3QZ5 B;  2WIH B;  1H24 B;  2BPM B;  3EID B;  1OIY B;  2I40 B;  5HBE B;  4CFV B;  2G9X B;  3KHI A;  2CYZ B;  2F2C A;  1AD6 A;  4ROD A;  2C5V B;  3TNH B;  2B9R A;  1GH6 B;  2C4G B;  4JX6 A;  2EUF A;  4F70 B;  2WXV B;  4IMY B;  2WPA B;  3TNW B;  4II5 B;  1W98 B;  3X26 B;  1JKW A;  1VOL A;  5L2W B;  2DXB B;  4BCK B;  1VYW B;  5LMK B;  3EOC B;  3TN8 B;  3A8O B;  3BHV B;  4HL4 A;  1G3N C;  4JX5 A;  3NDQ A;  3A8M B;  5EFQ B;  3BHT B;  3POM A;  1F5Q B;  2V22 B;  1UNG D;  1JOW A;  4YOO A;  3B57 A;  2WMB B;  2PK9 B;  2C5X B;  1ENW A;  1JST B;  1UGP B;  1VIN A;  4CFN B;  2QGS A;  2ZPH B;  4CFW B;  3H4C A;  1UGS B;  2CCH B;  2UZB B;  4BXX X;  4EOI B;  1AIS B;  2BS4 A;  5BNJ B;  5IF1 B;  1H26 B;  4BCO B;  4CFU D;  2DPP B;  2PHG A;  1H25 B;  2DD4 B;  4F6U B;  3LQ5 B;  4BCN D;  2ZPB B;  4QSH A;  1ZP2 A;  3X20 B;  2CJM B;  4EOL B;  1OI9 B;  1GUX A;  2WMA B;  3WVD B;  2CCI B;  1PKD B;  4BCM B;  4M6V A;  2DXC B;  3BHU B;  1C9B A;  1UGR B;  4EOJ B;  3HHT B;  4UN0 A;  3TNI B;  2KMG A;  4FM4 B;  4EOM B;  2QDY B;  4BCQ B;  5HQ0 B;  4Y72 B;  4EON B;  4ZGJ B;  4YC3 B;  5HBH B;  4KRD B;  3M03 A;  4G6L B;  3VKG A;  3QYG B;  1OKW B;  5ACB A;  1H27 B;  2W9Z A;  5LQF B;  2I53 A;  2KR6 A;  1P5E B;  2G77 A;  3MY1 B;  2W2H A;  2WFY B;  4F6S B;  3F5X B;  4ROE A;  3X28 B;  2BKZ B;  2CZ7 B;  4Z6Y A;  2IVX A;  1H1R B;  4BCJ B;  2ZPE B;  5EJC A;  4HNU A;  3QZ9 B;  4BCH B;  3VYG B;  4HNV A;  2PJQ A;  3BG3 A;  5HVY B;  2WHB B;  1H4L D;  2QDJ A;  5ICP B;  3A8H B;  4MIM A;  2UUE B;  3QYH B;  4EOS B;  3BLQ B;  1O9K A;  2UZE B;  2AHJ B;  5I5Z B;  1OGU B;  1UGQ B;  1IRE B;  4F7N B;  1KXU A;  4EC8 B;  2UZL B;  1H1P B;  3DL1 A;  2DME A;  4ELL A;  3G33 B;  2W96 A;  5IHY A;  3HBL A;  1BU2 A;  3HZJ A;  3PO3 S;  2CZ1 B;  1OL1 B;  4ZGE B;  2WJ9 A;  1H1Q B;  1JSU B;  5IDP B;  4LOC A;  4ROC A;  4BCP B;  4F7L B;  4EOO B;  3DJB A; 
#chains in the Genus database with same CATH homology
 1O9K B;  4EOQ B;  5HQ0 B;  3MIA B;  4Y72 B;  3DDP B;  1JKW A;  4TTH A;  4F6W B;  5CYI B;  4EON B;  1GY3 B;  4YC3 B;  5HBH B;  2IW6 B;  4KRD B;  1VOL A;  5L2W B;  3M03 A;  3O0G D;  4G6L B;  3MI9 B;  4YOZ A;  1OKW B;  4BCK B;  1VYW B;  4I3Z B;  1OL2 B;  5ACB A;  2JGZ B;  1H27 B;  2W9Z A;  5LMK B;  5LQF B;  3QHW B;  2I53 A;  4EC9 B;  3EOC B;  1P5E B;  4EOP B;  3TN8 B;  3MY1 B;  3BHV B;  2W2H A;  2WFY B;  1G3N C;  4F6S B;  3F5X B;  1GUX B;  2PK2 A;  2W99 A;  5EFQ B;  4ROE A;  3BHT B;  1UNH D;  4FX3 B;  3POM A;  2BKZ B;  1F5Q B;  1E9H B;  5IDN B;  4F7S B;  3EJ1 B;  3BLH B;  3BLR B;  2IVX A;  1H1R B;  2V22 B;  5FGK B;  1UNG D;  1UNL D;  1JOW A;  4YOO A;  4BCJ B;  3DDQ B;  4CRL B;  1D3U B;  2WMB B;  5HNB B;  4BCH B;  2PK9 B;  4ELJ A;  1N4M A;  4BCF B;  2C5X B;  2WIP B;  4NST B;  2IW8 B;  1JST B;  1QMZ B;  5HVY B;  1VIN A;  2WHB B;  4CFN B;  4CXA B;  5HBJ B;  2IW9 B;  5CEI B;  1H4L D;  1URC B;  2PMI B;  2UZD B;  4OR5 B;  1OKV B;  2QDJ A;  4CFW B;  5ICP B;  3H4C A;  2UUE B;  2CCH B;  4OGR B;  4EOS B;  3BLQ B;  4BCI B;  2UZB B;  2X1N B;  1FIN B;  4EOI B;  3DOG B;  1O9K A;  3RGF B;  2WEV B;  1AIS B;  2C5N B;  5BNJ B;  2UZE B;  5IF1 B;  1FVV B;  1TFB A;  1H26 B;  4BCO B;  2WIH B;  4KRC B;  4CFU D;  5I5Z B;  1OGU B;  2W9F A;  2PHG A;  1H24 B;  2BPM B;  3EID B;  1H25 B;  3QHR B;  2C6T B;  4F6U B;  3LQ5 B;  1OIY B;  2I40 B;  4BCN D;  1XO2 A;  1KXU A;  4F7N B;  4CFM B;  5HBE B;  1ZP2 A;  2UZL B;  4EC8 B;  4CFU B;  1H1P B;  4ELL A;  4CFV B;  2G9X B;  3G33 B;  2CJM B;  2W96 A;  4BCM D;  1OI9 B;  4EOL B;  2F2C A;  1GUX A;  1AD6 A;  3K7A M;  4BCG B;  4ROD A;  4BCN B;  1BU2 A;  2WMA B;  1OIU B;  4YOS A;  2CCI B;  1OL1 B;  2C5V B;  3TNH B;  4EOK B;  1PKD B;  1GH6 B;  2B9R A;  2C4G B;  4BCM B;  1H1Q B;  2EUF A;  1H1S B;  1JSU B;  3MY5 B;  5IDP B;  4EOR B;  4F70 B;  4BCQ D;  3BHU B;  1H28 B;  2C5O B;  2WXV B;  4IMY B;  1C9B A;  4ROC A;  4EOJ B;  2WPA B;  4UN0 A;  3TNI B;  4BCP B;  2R7G A;  4F7L B;  4CFX B;  4EOM B;  3TNW B;  4II5 B;  1W98 B;  4EOO B;  4BCQ B;  4F7J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...