5HBEB

Cdk8-cycc in complex with 8-[3-chloro-5-(1-methyl-2,2-dioxo-2, 3-dihydro-1h-2l6-benzo[c]isothiazol-5-yl)-pyridin- 4-yl]-1-oxa-3,8-diaza-spiro[4.5]decan-2-one
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hbeB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hbeB01
2X1NB 3BLRB 4ELLA 4EORB 4EOSB 5HBEB 3EOCB 4BCHB 1FINB 4EOLB 4YOZA 5HBHB 4BCQD 4EOKB 1P5EB 1H27B 1OKVB 2PHGA 3RGFB 4BCJB 1UNGD 5IF1B 4FX3B 4EC8B 1OIUB 3MIAB 1URCB 2I53A 4TTHA 3MI9B 1AISB 1GH6B 5HNBB 5IDNB 4F7JB 3TNWB 3TNIB 3BLQB 1OKWB 1PKDB 4CFNB 4CFWB 2G9XB 4YOSA 4BCIB 2WIPB 2BKZB 1GY3B 1UNHD 3BLHB 2EUFA 4BCND 4F7SB 2IVXA 1H26B 1FVVB 4EOIB 4EOQB 2IW8B 3BHTB 3MY1B 4RODA 2UZBB 2JGZB 3G33B 2C6TB 4OGRB 3MY5B 4CFXB 2UZDB 3BHVB 1E9HB 1F5QB 4Y72B 1H4LD 2CCIB 1KXUA 4KRCB 4CXAB 2R7GA 4KRDB 3TNHB 1H24B 1VYWB 1H1SB 1QMZB 1OI9B 5IDPB 1H1QB 1GUXA 2C5NB 1JSUB 2IW9B 1UNLD 4CFUB 2CJMB 1O9KA 4F6WB 3BHUB 5HVYB 4BCMB 4II5B 1GUXB 1VOLA 4YOOA 3EJ1B 1OL1B 1H1RB 4F7LB 2PMIB 2BPMB 4UN0A 1O9KB 1H28B 4BCOB 5EFQB 4EOOB 3DOGB 2WPAB 4BCKB 2C4GB 5LMKB 1D3UB 4BCPB 1TFBA 2V22B 2W96A 1VINA 2I40B 1H1PB 2W9FA 2WHBB 4EC9B 2F2CA 3DDPB 4EOMB 3H4CA 2W2HA 4I3ZB 1OL2B 2WIHB 1H25B 5HBJB 2CCHB 4ROEA 3M03A 2B9RA 3QHRB 1BU2A 3LQ5B 2WFYB 5L2WB 3DDQB 2WXVB 3O0GD 3POMA 1G3NC 5LQFB 4BCFB 2PK9B 4CFVB 4CRLB 4ELJA 2WMBB 5CYIB 2WMAB 4EONB 3EIDB 1OIYB 2C5VB 1JSTB 2UZLB 4F70B 1C9BA 3K7AM 3F5XB 4F7NB 2UUEB 5ACBA 5CEIB 4IMYB 4BCQB 5ICPB 1W98B 5FGKB 4F6UB 2PK2A 2W99A 1JOWA 4BCGB 4CFMB 4EOJB 5BNJB 4G6LB 5HQ0B 2C5XB 2QDJA 1OGUB 3TN8B 4CFUD 1ZP2A 4ROCA 3QHWB 2C5OB 4OR5B 4NSTB 4YC3B 4F6SB 1XO2A 5I5ZB 1JKWA 1N4MA 4BCMD 2IW6B 2W9ZA 1AD6A 2UZEB 4BCNB 2WEVB 4EOPB
chains in the Genus database with same CATH superfamily
2QFZA 1FINB 4YOZA 3QZ9B 4BCQD 1H27B 1OKVB 3RGFB 3X25B 3MI9B 1AISB 2CYZB 4F7JB 4CFNB 4CFWB 4YOSA 4BCIB 2LW4A 3BG9A 2IW8B 3BHTB 4RODA 2CZ6B 3MY5B 2UZDB 3A8LB 1F5QB 3QYGB 3QWLA 1KXUA 4KRCB 2DD5B 3TNHB 4BY7X 4ZGJB 1H1SB 1QMZB 3WVEB 2C5NB 1JSUB 2IW9B 4CFUB 4JX5A 4BY1X 3B57A 5HVYB 4BCMB 1VOLA 1AHJB 4BBSM 4BCKB 4AI6A 1VINA 2I40B 1H1PB 4HL4A 4EC9B 2F2CA 2QDYB 3QHRB 3TW6A 3DDQB 3POMA 1G3NC 4BCFB 2PK9B 4CRLB 1FKMA 5CYIB 2WMAB 2C5VB 4IMYB 4BCQB 5ICPB 4EOJB 4OB0B 4AKHA 3QYEA 5HQ0B 1IREB 4CFUD 4F6SB 2C5OB 2KR6A 1XO2A 4BCMD 2IW6B 4EOPB 4EOSB 5HBEB 4EOLB 4EOKB 2PHGA 1UGPB 1UNGD 1OIUB 3MIAB 1GH6B 5IDNB 2QGSA 2G9XB 2BKZB 1GY3B 3BLHB 1UGRB 1H26B 4HNVA 4EOIB 4EOQB 4ZGEB 3QZ5B 2ZCFB 1H4LD 2CCIB 4LOCA 2R7GA 4KRDB 1H24B 3BG5A 1GUXA 2BS3A 4NC6A 4AKIA 1GUXB 3PO3S 2G77A 2PMIB 1H28B 4EOOB 2WPAB 4BXXX 3A8OB 4BCPB 2V22B 2WHBB 3X28B 2DMEA 3HZJA 3H4CA 2DXBB 5DQVA 5HBJB 3M03A 2QF7A 2DPPB 1BU2A 2WJ9A 3DJBA 3LQ5B 5LQFB 4CFVB 4EONB 2DD4B 4F70B 1C9BA 4MFDA 3HHTB 3K7AM 2BS2A 2UUEB 2CZ0B 4F6UB 2W99A 2ZPBB 5BNJB 3TN8B 4OB1B 3QXEB 4ROCA 4OR5B 4YC3B 1N4MA 4I3ZB 2X1NB 2AHJB 3GTMS 4EORB 3EOCB 1UGSB 3A8GB 5HBHB 1QLBA 1E7PA 4FX3B 4EC8B 1URCB 2I53A 4OB3B 4M6VA 4MFEA 3TNIB 3BLQB 1PKDB 2WIPB 2ZZDB 4F7SB 4MIMA 2JGZB 4CFXB 1E9HB 3HBLA 4CXAB 1VYWB 1OI9B 3DTOA 5IDPB 1H1QB 3A8HB 2D0QB 5IHYA 2CZ7B 4F6WB 2PJQA 4II5B 4YOOA 2ZPFB 1OL1B 1H1RB 4F7LB 3KHIA 4ZGDB 4UN0A 4BCOB 5EFQB 3DOGB 3X24B 5LMKB 1D3UB 2KMGA 3HB9A 3TW7A 2W9FA 4OB2B 4EOMB 3VKGA 1OL2B 2WIHB 1H25B 2ZPHB 2CCHB 2B9RA 2WFYB 2ZPGB 2WXVB 1UGQB 2WMBB 1OIYB 2DXCB 4FM4B 4F7NB 4JX4A 5ACBA 1W98B 3HO8A 4BCGB 4G6LB 1OGUB 3NDQA 2BS4A 4NSTB 5I5ZB 1JKWA 2UZEB 4QSHA 3BLRB 4ELLA 3VKHA 4AKGA 4BCHB 2QQ8A 3VYHB 4BBRM 1P5EB 4BCJB 4HNTA 5IF1B 4TTHA 5HNBB 3TNWB 1OKWB 1UNHD 2EUFA 5DQWA 4BCND 2IVXA 1FVVB 3MY1B 2UZBB 3G33B 2C6TB 4OGRB 3A8MB 3BHVB 4Y72B 1V29B 3WVDB 1TD6A 1UNLD 2CJMB 1O9KA 2ZPEB 4HNUA 3QYHB 3BHUB 3VYGB 3EJ1B 2BPMB 1O9KB 2C4GB 1TFBA 2W96A 2ZPIB 1ENWA 3X26B 3X20B 3DDPB 2W2HA 4ROEA 5L2WB 3O0GD 3QYBA 4Z6YA 4JX6A 4ELJA 3EIDB 2CZ1B 1JSTB 5EJCA 2UZLB 3BG3A 3DL1A 3F5XB 5CEIB 5FGKB 2PK2A 1JOWA 2IN3A 4CFMB 2C5XB 2QDJA 1ZP2A 4HLQA 3QHWB 2W9ZA 1AD6A 4BCNB 2WEVB
chains in the Genus database with same CATH topology
2X1NB 3BLRB 4ELLA 4EORB 4EOSB 5HBEB 3EOCB 4BCHB 1FINB 4EOLB 4YOZA 5HBHB 4BCQD 4EOKB 1P5EB 1H27B 1OKVB 2PHGA 3RGFB 4BCJB 1UNGD 5IF1B 4FX3B 4EC8B 1OIUB 3MIAB 1URCB 2I53A 4TTHA 3MI9B 1AISB 1GH6B 5HNBB 5IDNB 4F7JB 3TNWB 3TNIB 3BLQB 1OKWB 1PKDB 4CFNB 4CFWB 2G9XB 4YOSA 4BCIB 2WIPB 2BKZB 1GY3B 1UNHD 3BLHB 2EUFA 4BCND 4F7SB 2IVXA 1H26B 1FVVB 4EOIB 4EOQB 2IW8B 3BHTB 3MY1B 4RODA 2UZBB 2JGZB 3G33B 2C6TB 4OGRB 3MY5B 4CFXB 2UZDB 3BHVB 1E9HB 1F5QB 4Y72B 1H4LD 2CCIB 1KXUA 4KRCB 4CXAB 2R7GA 4KRDB 3TNHB 1H24B 1VYWB 1H1SB 1QMZB 1OI9B 5IDPB 1H1QB 1GUXA 2C5NB 1JSUB 2IW9B 1UNLD 4CFUB 2CJMB 1O9KA 4F6WB 3BHUB 5HVYB 4BCMB 4II5B 1GUXB 1VOLA 4YOOA 3EJ1B 1OL1B 1H1RB 4F7LB 2PMIB 2BPMB 4UN0A 1O9KB 1H28B 4BCOB 5EFQB 4EOOB 3DOGB 2WPAB 4BCKB 2C4GB 5LMKB 1D3UB 4BCPB 1TFBA 2V22B 2W96A 1VINA 2I40B 1H1PB 2W9FA 2WHBB 4EC9B 2F2CA 3DDPB 4EOMB 3H4CA 2W2HA 4I3ZB 1OL2B 2WIHB 1H25B 5HBJB 2CCHB 4ROEA 3M03A 2B9RA 3QHRB 1BU2A 3LQ5B 2WFYB 5L2WB 3DDQB 2WXVB 3O0GD 3POMA 1G3NC 5LQFB 4BCFB 2PK9B 4CFVB 4CRLB 4ELJA 2WMBB 5CYIB 2WMAB 4EONB 3EIDB 1OIYB 2C5VB 1JSTB 2UZLB 4F70B 1C9BA 3K7AM 3F5XB 4F7NB 2UUEB 5ACBA 5CEIB 4IMYB 4BCQB 5ICPB 1W98B 5FGKB 4F6UB 2PK2A 2W99A 1JOWA 4BCGB 4CFMB 4EOJB 5BNJB 4G6LB 5HQ0B 2C5XB 2QDJA 1OGUB 3TN8B 4CFUD 1ZP2A 4ROCA 3QHWB 2C5OB 4OR5B 4NSTB 4YC3B 4F6SB 1XO2A 5I5ZB 1JKWA 1N4MA 4BCMD 2IW6B 2W9ZA 1AD6A 2UZEB 4BCNB 2WEVB 4EOPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X1N B;  3BLR B;  4ELL A;  4EOR B;  4EOS B;  5HBE B;  3EOC B;  4BCH B;  1FIN B;  4EOL B;  4YOZ A;  5HBH B;  4BCQ D;  4EOK B;  1P5E B;  1H27 B;  1OKV B;  2PHG A;  3RGF B;  4BCJ B;  1UNG D;  5IF1 B;  4FX3 B;  4EC8 B;  1OIU B;  3MIA B;  1URC B;  2I53 A;  4TTH A;  3MI9 B;  1AIS B;  1GH6 B;  5HNB B;  5IDN B;  4F7J B;  3TNW B;  3TNI B;  3BLQ B;  1OKW B;  1PKD B;  4CFN B;  4CFW B;  2G9X B;  4YOS A;  4BCI B;  2WIP B;  2BKZ B;  1GY3 B;  1UNH D;  3BLH B;  2EUF A;  4BCN D;  4F7S B;  2IVX A;  1H26 B;  1FVV B;  4EOI B;  4EOQ B;  2IW8 B;  3BHT B;  3MY1 B;  4ROD A;  2UZB B;  2JGZ B;  3G33 B;  2C6T B;  4OGR B;  3MY5 B;  4CFX B;  2UZD B;  3BHV B;  1E9H B;  1F5Q B;  4Y72 B;  1H4L D;  2CCI B;  1KXU A;  4KRC B;  4CXA B;  2R7G A;  4KRD B;  3TNH B;  1H24 B;  1VYW B;  1H1S B;  1QMZ B;  1OI9 B;  5IDP B;  1H1Q B;  1GUX A;  2C5N B;  1JSU B;  2IW9 B;  1UNL D;  4CFU B;  2CJM B;  1O9K A;  4F6W B;  3BHU B;  5HVY B;  4BCM B;  4II5 B;  1GUX B;  1VOL A;  4YOO A;  3EJ1 B;  1OL1 B;  1H1R B;  4F7L B;  2PMI B;  2BPM B;  4UN0 A;  1O9K B;  1H28 B;  4BCO B;  5EFQ B;  4EOO B;  3DOG B;  2WPA B;  4BCK B;  2C4G B;  5LMK B;  1D3U B;  4BCP B;  1TFB A;  2V22 B;  2W96 A;  1VIN A;  2I40 B;  1H1P B;  2W9F A;  2WHB B;  4EC9 B;  2F2C A;  3DDP B;  4EOM B;  3H4C A;  2W2H A;  4I3Z B;  1OL2 B;  2WIH B;  1H25 B;  5HBJ B;  2CCH B;  4ROE A;  3M03 A;  2B9R A;  3QHR B;  1BU2 A;  3LQ5 B;  2WFY B;  5L2W B;  3DDQ B;  2WXV B;  3O0G D;  3POM A;  1G3N C;  5LQF B;  4BCF B;  2PK9 B;  4CFV B;  4CRL B;  4ELJ A;  2WMB B;  5CYI B;  2WMA B;  4EON B;  3EID B;  1OIY B;  2C5V B;  1JST B;  2UZL B;  4F70 B;  1C9B A;  3K7A M;  3F5X B;  4F7N B;  2UUE B;  5ACB A;  5CEI B;  4IMY B;  4BCQ B;  5ICP B;  1W98 B;  5FGK B;  4F6U B;  2PK2 A;  2W99 A;  1JOW A;  4BCG B;  4CFM B;  4EOJ B;  5BNJ B;  4G6L B;  5HQ0 B;  2C5X B;  2QDJ A;  1OGU B;  3TN8 B;  4CFU D;  1ZP2 A;  4ROC A;  3QHW B;  2C5O B;  4OR5 B;  4NST B;  4YC3 B;  4F6S B;  1XO2 A;  5I5Z B;  1JKW A;  1N4M A;  4BCM D;  2IW6 B;  2W9Z A;  1AD6 A;  2UZE B;  4BCN B;  2WEV B;  4EOP B; 
#chains in the Genus database with same CATH topology
 2QFZ A;  1FIN B;  4YOZ A;  3QZ9 B;  4BCQ D;  1H27 B;  1OKV B;  3RGF B;  3X25 B;  3MI9 B;  1AIS B;  2CYZ B;  4F7J B;  4CFN B;  4CFW B;  4YOS A;  4BCI B;  2LW4 A;  3BG9 A;  2IW8 B;  3BHT B;  4ROD A;  2CZ6 B;  3MY5 B;  2UZD B;  3A8L B;  1F5Q B;  3QYG B;  3QWL A;  1KXU A;  4KRC B;  2DD5 B;  3TNH B;  4BY7 X;  4ZGJ B;  1H1S B;  1QMZ B;  3WVE B;  2C5N B;  1JSU B;  2IW9 B;  4CFU B;  4JX5 A;  4BY1 X;  3B57 A;  5HVY B;  4BCM B;  1VOL A;  1AHJ B;  4BBS M;  4BCK B;  4AI6 A;  1VIN A;  2I40 B;  1H1P B;  4HL4 A;  4EC9 B;  2F2C A;  2QDY B;  3QHR B;  3TW6 A;  3DDQ B;  3POM A;  1G3N C;  4BCF B;  2PK9 B;  4CRL B;  1FKM A;  5CYI B;  2WMA B;  2C5V B;  4IMY B;  4BCQ B;  5ICP B;  4EOJ B;  4OB0 B;  4AKH A;  3QYE A;  5HQ0 B;  1IRE B;  4CFU D;  4F6S B;  2C5O B;  2KR6 A;  1XO2 A;  4BCM D;  2IW6 B;  4EOP B;  4EOS B;  5HBE B;  4EOL B;  4EOK B;  2PHG A;  1UGP B;  1UNG D;  1OIU B;  3MIA B;  1GH6 B;  5IDN B;  2QGS A;  2G9X B;  2BKZ B;  1GY3 B;  3BLH B;  1UGR B;  1H26 B;  4HNV A;  4EOI B;  4EOQ B;  4ZGE B;  3QZ5 B;  2ZCF B;  1H4L D;  2CCI B;  4LOC A;  2R7G A;  4KRD B;  1H24 B;  3BG5 A;  1GUX A;  2BS3 A;  4NC6 A;  4AKI A;  1GUX B;  3PO3 S;  2G77 A;  2PMI B;  1H28 B;  4EOO B;  2WPA B;  4BXX X;  3A8O B;  4BCP B;  2V22 B;  2WHB B;  3X28 B;  2DME A;  3HZJ A;  3H4C A;  2DXB B;  5DQV A;  5HBJ B;  3M03 A;  2QF7 A;  2DPP B;  1BU2 A;  2WJ9 A;  3DJB A;  3LQ5 B;  5LQF B;  4CFV B;  4EON B;  2DD4 B;  4F70 B;  1C9B A;  4MFD A;  3HHT B;  3K7A M;  2BS2 A;  2UUE B;  2CZ0 B;  4F6U B;  2W99 A;  2ZPB B;  5BNJ B;  3TN8 B;  4OB1 B;  3QXE B;  4ROC A;  4OR5 B;  4YC3 B;  1N4M A;  4I3Z B;  2X1N B;  2AHJ B;  3GTM S;  4EOR B;  3EOC B;  1UGS B;  3A8G B;  5HBH B;  1QLB A;  1E7P A;  4FX3 B;  4EC8 B;  1URC B;  2I53 A;  4OB3 B;  4M6V A;  4MFE A;  3TNI B;  3BLQ B;  1PKD B;  2WIP B;  2ZZD B;  4F7S B;  4MIM A;  2JGZ B;  4CFX B;  1E9H B;  3HBL A;  4CXA B;  1VYW B;  1OI9 B;  3DTO A;  5IDP B;  1H1Q B;  3A8H B;  2D0Q B;  5IHY A;  2CZ7 B;  4F6W B;  2PJQ A;  4II5 B;  4YOO A;  2ZPF B;  1OL1 B;  1H1R B;  4F7L B;  3KHI A;  4ZGD B;  4UN0 A;  4BCO B;  5EFQ B;  3DOG B;  3X24 B;  5LMK B;  1D3U B;  2KMG A;  3HB9 A;  3TW7 A;  2W9F A;  4OB2 B;  4EOM B;  3VKG A;  1OL2 B;  2WIH B;  1H25 B;  2ZPH B;  2CCH B;  2B9R A;  2WFY B;  2ZPG B;  2WXV B;  1UGQ B;  2WMB B;  1OIY B;  2DXC B;  4FM4 B;  4F7N B;  4JX4 A;  5ACB A;  1W98 B;  3HO8 A;  4BCG B;  4G6L B;  1OGU B;  3NDQ A;  2BS4 A;  4NST B;  5I5Z B;  1JKW A;  2UZE B;  4QSH A;  3BLR B;  4ELL A;  3VKH A;  4AKG A;  4BCH B;  2QQ8 A;  3VYH B;  4BBR M;  1P5E B;  4BCJ B;  4HNT A;  5IF1 B;  4TTH A;  5HNB B;  3TNW B;  1OKW B;  1UNH D;  2EUF A;  5DQW A;  4BCN D;  2IVX A;  1FVV B;  3MY1 B;  2UZB B;  3G33 B;  2C6T B;  4OGR B;  3A8M B;  3BHV B;  4Y72 B;  1V29 B;  3WVD B;  1TD6 A;  1UNL D;  2CJM B;  1O9K A;  2ZPE B;  4HNU A;  3QYH B;  3BHU B;  3VYG B;  3EJ1 B;  2BPM B;  1O9K B;  2C4G B;  1TFB A;  2W96 A;  2ZPI B;  1ENW A;  3X26 B;  3X20 B;  3DDP B;  2W2H A;  4ROE A;  5L2W B;  3O0G D;  3QYB A;  4Z6Y A;  4JX6 A;  4ELJ A;  3EID B;  2CZ1 B;  1JST B;  5EJC A;  2UZL B;  3BG3 A;  3DL1 A;  3F5X B;  5CEI B;  5FGK B;  2PK2 A;  1JOW A;  2IN3 A;  4CFM B;  2C5X B;  2QDJ A;  1ZP2 A;  4HLQ A;  3QHW B;  2W9Z A;  1AD6 A;  4BCN B;  2WEV B; 
#chains in the Genus database with same CATH homology
 2X1N B;  3BLR B;  4ELL A;  4EOR B;  4EOS B;  5HBE B;  3EOC B;  4BCH B;  1FIN B;  4EOL B;  4YOZ A;  5HBH B;  4BCQ D;  4EOK B;  1P5E B;  1H27 B;  1OKV B;  2PHG A;  3RGF B;  4BCJ B;  1UNG D;  5IF1 B;  4FX3 B;  4EC8 B;  1OIU B;  3MIA B;  1URC B;  2I53 A;  4TTH A;  3MI9 B;  1AIS B;  1GH6 B;  5HNB B;  5IDN B;  4F7J B;  3TNW B;  3TNI B;  3BLQ B;  1OKW B;  1PKD B;  4CFN B;  4CFW B;  2G9X B;  4YOS A;  4BCI B;  2WIP B;  2BKZ B;  1GY3 B;  1UNH D;  3BLH B;  2EUF A;  4BCN D;  4F7S B;  2IVX A;  1H26 B;  1FVV B;  4EOI B;  4EOQ B;  2IW8 B;  3BHT B;  3MY1 B;  4ROD A;  2UZB B;  2JGZ B;  3G33 B;  2C6T B;  4OGR B;  3MY5 B;  4CFX B;  2UZD B;  3BHV B;  1E9H B;  1F5Q B;  4Y72 B;  1H4L D;  2CCI B;  1KXU A;  4KRC B;  4CXA B;  2R7G A;  4KRD B;  3TNH B;  1H24 B;  1VYW B;  1H1S B;  1QMZ B;  1OI9 B;  5IDP B;  1H1Q B;  1GUX A;  2C5N B;  1JSU B;  2IW9 B;  1UNL D;  4CFU B;  2CJM B;  1O9K A;  4F6W B;  3BHU B;  5HVY B;  4BCM B;  4II5 B;  1GUX B;  1VOL A;  4YOO A;  3EJ1 B;  1OL1 B;  1H1R B;  4F7L B;  2PMI B;  2BPM B;  4UN0 A;  1O9K B;  1H28 B;  4BCO B;  5EFQ B;  4EOO B;  3DOG B;  2WPA B;  4BCK B;  2C4G B;  5LMK B;  1D3U B;  4BCP B;  1TFB A;  2V22 B;  2W96 A;  1VIN A;  2I40 B;  1H1P B;  2W9F A;  2WHB B;  4EC9 B;  2F2C A;  3DDP B;  4EOM B;  3H4C A;  2W2H A;  4I3Z B;  1OL2 B;  2WIH B;  1H25 B;  5HBJ B;  2CCH B;  4ROE A;  3M03 A;  2B9R A;  3QHR B;  1BU2 A;  3LQ5 B;  2WFY B;  5L2W B;  3DDQ B;  2WXV B;  3O0G D;  3POM A;  1G3N C;  5LQF B;  4BCF B;  2PK9 B;  4CFV B;  4CRL B;  4ELJ A;  2WMB B;  5CYI B;  2WMA B;  4EON B;  3EID B;  1OIY B;  2C5V B;  1JST B;  2UZL B;  4F70 B;  1C9B A;  3K7A M;  3F5X B;  4F7N B;  2UUE B;  5ACB A;  5CEI B;  4IMY B;  4BCQ B;  5ICP B;  1W98 B;  5FGK B;  4F6U B;  2PK2 A;  2W99 A;  1JOW A;  4BCG B;  4CFM B;  4EOJ B;  5BNJ B;  4G6L B;  5HQ0 B;  2C5X B;  2QDJ A;  1OGU B;  3TN8 B;  4CFU D;  1ZP2 A;  4ROC A;  3QHW B;  2C5O B;  4OR5 B;  4NST B;  4YC3 B;  4F6S B;  1XO2 A;  5I5Z B;  1JKW A;  1N4M A;  4BCM D;  2IW6 B;  2W9Z A;  1AD6 A;  2UZE B;  4BCN B;  2WEV B;  4EOP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...