5HBEB

Cdk8-cycc in complex with 8-[3-chloro-5-(1-methyl-2,2-dioxo-2, 3-dihydro-1h-2l6-benzo[c]isothiazol-5-yl)-pyridin- 4-yl]-1-oxa-3,8-diaza-spiro[4.5]decan-2-one
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclin-dependent kinase 8
publication title Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hbeB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hbeB01
2UUEB 3DOGB 3POMA 4F7JB 4F70B 5I5ZB 4EOQB 4BCHB 1H4LD 4I3ZB 4G6LB 2W99A 4CFUB 1D3UB 1JKWA 2WMBB 3LQ5B 5HNBB 1VINA 4CFXB 5IDNB 1N4MA 4BCFB 1GUXA 4CFMB 1P5EB 4CFUD 3M03A 5ICPB 1UNHD 2W96A 5IDPB 2JGZB 4F6SB 2WXVB 4F7LB 4YOSA 1OIYB 3O0GD 5CYIB 4ELJA 4EORB 4EOKB 4CXAB 1H26B 2C5OB 1W98B 5HBJB 2PHGA 1KXUA 1VYWB 2WPAB 4Y72B 1OL2B 4II5B 1URCB 4OGRB 5HBEB 4BCNB 5HQ0B 2W9FA 1F5QB 1AISB 4F6UB 4BCMB 2PK9B 3MI9B 1JSTB 3BHUB 2CJMB 5HBHB 2UZDB 1UNGD 4ROCA 1FINB 4EOJB 4BCND 1H28B 3QHRB 4UN0A 2WIHB 4BCOB 1OL1B 2I53A 2QDJA 4BCMD 4F6WB 1H25B 2EUFA 2IW6B 1OIUB 5FGKB 2UZBB 1G3NC 4BCKB 1TFBA 2BKZB 5EFQB 3DDQB 4RODA 1C9BA 2C5XB 1JSUB 5IF1B 2R7GA 1H1PB 4CRLB 1VOLA 2V22B 4CFVB 4KRCB 1OKWB 5LQFB 3H4CA 1FVVB 1PKDB 2C5NB 3BLHB 4EC9B 4EOMB 4CFNB 2W2HA 2CCIB 3BLRB 1QMZB 5CEIB 3RGFB 2IVXA 2IW9B 5HVYB 2UZLB 4BCIB 1H1QB 1H1SB 2WMAB 4IMYB 4BCGB 3TNWB 3QHWB 4EONB 2W9ZA 1E9HB 4FX3B 1O9KB 3F5XB 4F7NB 4BCQB 4EOLB 3BHVB 2I40B 1XO2A 3EIDB 1OI9B 3BLQB 4F7SB 1AD6A 3TN8B 3TNHB 1H24B 2C4GB 2C6TB 4BCQD 2BPMB 1H1RB 1GH6B 2PK2A 4YOOA 4EC8B 2G9XB 2WIPB 4EOOB 4CFWB 4TTHA 1BU2A 1GUXB 1JOWA 4KRDB 4OR5B 2CCHB 4ROEA 2WEVB 3EOCB 2PMIB 2C5VB 1ZP2A 4BCJB 4ELLA 5L2WB 3MY5B 3MY1B 2WHBB 2B9RA 2WFYB 2F2CA 2X1NB 3G33B 4EOSB 3BHTB 3DDPB 1H27B 1GY3B 1OGUB 1UNLD 3EJ1B 4YC3B 4EOPB 3TNIB 1OKVB 5ACBA 2IW8B 3K7AM 4EOIB 5LMKB 2UZEB 1O9KA 3MIAB 4NSTB 5BNJB 4YOZA 4BCPB
chains in the Genus database with same CATH superfamily
2UUEB 5I5ZB 3GTMS 1H4LD 2CZ1B 2ZPFB 1D3UB 1JKWA 2WMBB 4HNUA 5IDNB 4BCFB 1GUXA 4ZGDB 3M03A 1UNHD 3HZJA 4AI6A 4F7LB 1OIYB 5CYIB 1V29B 4CXAB 4OB0B 4Y72B 5HQ0B 4M6VA 4BCMB 2PK9B 1UNGD 4EOJB 1H28B 3QHRB 4UN0A 1OL1B 2QDJA 4F6WB 1H25B 2EUFA 3QXEB 2UZBB 2BKZB 5EFQB 5IF1B 3X20B 1H1PB 2QQ8A 1VOLA 3H4CA 2C5NB 2BS3A 1IREB 3BLRB 5HVYB 2G77A 4IMYB 3PO3S 4BCGB 3HO8A 3F5XB 3HBLA 3BHVB 3HHTB 1OI9B 3QYBA 2C4GB 3A8GB 3A8OB 2BPMB 4TTHA 1GUXB 4KRDB 4JX5A 4BBRM 1ZP2A 4BCJB 4HLQA 1UGQB 3MY1B 2WHBB 3QZ5B 2WFYB 3G33B 4EOSB 3BHTB 2IW8B 4EOIB 3MIAB 4BCPB 4F70B 4G6LB 4QSHA 4AKIA 3LQ5B 2ZCFB 4CFMB 2ZPHB 1P5EB 5ICPB 5IDPB 2W96A 3X26B 2JGZB 4F6SB 4YOSA 4Z6YA 4MFDA 3QWLA 1W98B 2PHGA 1VYWB 1OL2B 3X25B 1URCB 5HBEB 2W9FA 1F5QB 4ROCA 2CJMB 4BCOB 4BCMD 2I53A 1OIUB 4BCKB 4OB1B 4RODA 2C5XB 1JSUB 2ZPGB 2ZPIB 2V22B 4CFVB 1OKWB 5LQFB 5EJCA 4EC9B 2W2HA 2DMEA 4CFNB 2CCIB 2KR6A 3KHIA 2IN3A 3QYEA 3B57A 2WMAB 4MIMA 4FX3B 1E9HB 4F7NB 1XO2A 3BLQB 3TN8B 3NDQA 3TNHB 2ZPEB 5IHYA 3A8MB 1GH6B 2PK2A 2AHJB 3DJBA 4OR5B 2WEVB 3BG3A 3DTOA 2ZPBB 2F2CA 2X1NB 4YC3B 1OKVB 5LMKB 2UZEB 1O9KA 4AKHA 4YOZA 3VYHB 2D0QB 3DOGB 3POMA 4F7JB 4EOQB 4BCHB 2DD5B 2DXBB 2KMGA 4I3ZB 1ENWA 1TD6A 4NC6A 3QZ9B 4CFUB 1VINA 1N4MA 2CYZB 2CZ6B 4HNVA 2WXVB 3O0GD 2C5OB 5HBJB 1UGSB 4II5B 4BBSM 4OGRB 4BCNB 4F6UB 3MI9B 1JSTB 3BHUB 5HBHB 2UZDB 2BS4A 1FINB 4ZGEB 2WIHB 3TW7A 1UGRB 1E7PA 4FM4B 5FGKB 2DXCB 1G3NC 1TFBA 3VYGB 3DDQB 2CZ0B 3TW6A 2R7GA 4ZGJB 4JX4A 4EOMB 1PKDB 3BLHB 1QMZB 5CEIB 3RGFB 4AKGA 2QFZA 2UZLB 4BCIB 3TNWB 3QHWB 4LOCA 2W9ZA 1O9KB 3X28B 4BCQB 1AHJB 2I40B 4BXXX 1AD6A 5DQWA 3WVDB 4YOOA 4EC8B 4OB3B 2WIPB 4EOOB 4CFWB 3BG9A 1JOWA 3A8HB 5L2WB 3DL1A 3DDPB 2PJQA 1GY3B 1OGUB 1UNLD 3K7AM 4NSTB 3X24B 4HNTA 2W99A 5DQVA 5HNBB 4CFXB 3QYHB 4JX6A 4CFUD 2DPPB 4ELJA 4EORB 4EOKB 1H26B 1KXUA 2WPAB 2QDYB 3BG5A 4OB2B 1AISB 3A8LB 4BCND 1UGPB 3QYGB 2IW6B 3VKHA 1FKMA 1C9BA 4CRLB 2DD4B 4KRCB 1FVVB 2IVXA 3HB9A 2IW9B 1H1QB 2WJ9A 1H1SB 4EONB 4EOLB 3EIDB 4F7SB 2QF7A 1H24B 2C6TB 4BCQD 1H1RB 3WVEB 2G9XB 2BS2A 3VKGA 1QLBA 1BU2A 4BY1X 2CCHB 4ROEA 3EOCB 2LW4A 2PMIB 4HL4A 2C5VB 4ELLA 4MFEA 3MY5B 2B9RA 4BY7X 1H27B 2QGSA 3EJ1B 4EOPB 3TNIB 5ACBA 2CZ7B 5BNJB 2ZZDB
chains in the Genus database with same CATH topology
2UUEB 3DOGB 3POMA 4F7JB 4F70B 5I5ZB 4EOQB 4BCHB 1H4LD 4I3ZB 4G6LB 2W99A 4CFUB 1D3UB 1JKWA 2WMBB 3LQ5B 5HNBB 1VINA 4CFXB 5IDNB 1N4MA 4BCFB 1GUXA 4CFMB 1P5EB 4CFUD 3M03A 5ICPB 1UNHD 2W96A 5IDPB 2JGZB 4F6SB 2WXVB 4F7LB 4YOSA 1OIYB 3O0GD 5CYIB 4ELJA 4EORB 4EOKB 4CXAB 1H26B 2C5OB 1W98B 5HBJB 2PHGA 1KXUA 1VYWB 2WPAB 4Y72B 1OL2B 4II5B 1URCB 4OGRB 5HBEB 4BCNB 5HQ0B 2W9FA 1F5QB 1AISB 4F6UB 4BCMB 2PK9B 3MI9B 1JSTB 3BHUB 2CJMB 5HBHB 2UZDB 1UNGD 4ROCA 1FINB 4EOJB 4BCND 1H28B 3QHRB 4UN0A 2WIHB 4BCOB 1OL1B 2I53A 2QDJA 4BCMD 4F6WB 1H25B 2EUFA 2IW6B 1OIUB 5FGKB 2UZBB 1G3NC 4BCKB 1TFBA 2BKZB 5EFQB 3DDQB 4RODA 1C9BA 2C5XB 1JSUB 5IF1B 2R7GA 1H1PB 4CRLB 1VOLA 2V22B 4CFVB 4KRCB 1OKWB 5LQFB 3H4CA 1FVVB 1PKDB 2C5NB 3BLHB 4EC9B 4EOMB 4CFNB 2W2HA 2CCIB 3BLRB 1QMZB 5CEIB 3RGFB 2IVXA 2IW9B 5HVYB 2UZLB 4BCIB 1H1QB 1H1SB 2WMAB 4IMYB 4BCGB 3TNWB 3QHWB 4EONB 2W9ZA 1E9HB 4FX3B 1O9KB 3F5XB 4F7NB 4BCQB 4EOLB 3BHVB 2I40B 1XO2A 3EIDB 1OI9B 3BLQB 4F7SB 1AD6A 3TN8B 3TNHB 1H24B 2C4GB 2C6TB 4BCQD 2BPMB 1H1RB 1GH6B 2PK2A 4YOOA 4EC8B 2G9XB 2WIPB 4EOOB 4CFWB 4TTHA 1BU2A 1GUXB 1JOWA 4KRDB 4OR5B 2CCHB 4ROEA 2WEVB 3EOCB 2PMIB 2C5VB 1ZP2A 4BCJB 4ELLA 5L2WB 3MY5B 3MY1B 2WHBB 2B9RA 2WFYB 2F2CA 2X1NB 3G33B 4EOSB 3BHTB 3DDPB 1H27B 1GY3B 1OGUB 1UNLD 3EJ1B 4YC3B 4EOPB 3TNIB 1OKVB 5ACBA 2IW8B 3K7AM 4EOIB 5LMKB 2UZEB 1O9KA 3MIAB 4NSTB 5BNJB 4YOZA 4BCPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUE B;  3DOG B;  3POM A;  4F7J B;  4F70 B;  5I5Z B;  4EOQ B;  4BCH B;  1H4L D;  4I3Z B;  4G6L B;  2W99 A;  4CFU B;  1D3U B;  1JKW A;  2WMB B;  3LQ5 B;  5HNB B;  1VIN A;  4CFX B;  5IDN B;  1N4M A;  4BCF B;  1GUX A;  4CFM B;  1P5E B;  4CFU D;  3M03 A;  5ICP B;  1UNH D;  2W96 A;  5IDP B;  2JGZ B;  4F6S B;  2WXV B;  4F7L B;  4YOS A;  1OIY B;  3O0G D;  5CYI B;  4ELJ A;  4EOR B;  4EOK B;  4CXA B;  1H26 B;  2C5O B;  1W98 B;  5HBJ B;  2PHG A;  1KXU A;  1VYW B;  2WPA B;  4Y72 B;  1OL2 B;  4II5 B;  1URC B;  4OGR B;  5HBE B;  4BCN B;  5HQ0 B;  2W9F A;  1F5Q B;  1AIS B;  4F6U B;  4BCM B;  2PK9 B;  3MI9 B;  1JST B;  3BHU B;  2CJM B;  5HBH B;  2UZD B;  1UNG D;  4ROC A;  1FIN B;  4EOJ B;  4BCN D;  1H28 B;  3QHR B;  4UN0 A;  2WIH B;  4BCO B;  1OL1 B;  2I53 A;  2QDJ A;  4BCM D;  4F6W B;  1H25 B;  2EUF A;  2IW6 B;  1OIU B;  5FGK B;  2UZB B;  1G3N C;  4BCK B;  1TFB A;  2BKZ B;  5EFQ B;  3DDQ B;  4ROD A;  1C9B A;  2C5X B;  1JSU B;  5IF1 B;  2R7G A;  1H1P B;  4CRL B;  1VOL A;  2V22 B;  4CFV B;  4KRC B;  1OKW B;  5LQF B;  3H4C A;  1FVV B;  1PKD B;  2C5N B;  3BLH B;  4EC9 B;  4EOM B;  4CFN B;  2W2H A;  2CCI B;  3BLR B;  1QMZ B;  5CEI B;  3RGF B;  2IVX A;  2IW9 B;  5HVY B;  2UZL B;  4BCI B;  1H1Q B;  1H1S B;  2WMA B;  4IMY B;  4BCG B;  3TNW B;  3QHW B;  4EON B;  2W9Z A;  1E9H B;  4FX3 B;  1O9K B;  3F5X B;  4F7N B;  4BCQ B;  4EOL B;  3BHV B;  2I40 B;  1XO2 A;  3EID B;  1OI9 B;  3BLQ B;  4F7S B;  1AD6 A;  3TN8 B;  3TNH B;  1H24 B;  2C4G B;  2C6T B;  4BCQ D;  2BPM B;  1H1R B;  1GH6 B;  2PK2 A;  4YOO A;  4EC8 B;  2G9X B;  2WIP B;  4EOO B;  4CFW B;  4TTH A;  1BU2 A;  1GUX B;  1JOW A;  4KRD B;  4OR5 B;  2CCH B;  4ROE A;  2WEV B;  3EOC B;  2PMI B;  2C5V B;  1ZP2 A;  4BCJ B;  4ELL A;  5L2W B;  3MY5 B;  3MY1 B;  2WHB B;  2B9R A;  2WFY B;  2F2C A;  2X1N B;  3G33 B;  4EOS B;  3BHT B;  3DDP B;  1H27 B;  1GY3 B;  1OGU B;  1UNL D;  3EJ1 B;  4YC3 B;  4EOP B;  3TNI B;  1OKV B;  5ACB A;  2IW8 B;  3K7A M;  4EOI B;  5LMK B;  2UZE B;  1O9K A;  3MIA B;  4NST B;  5BNJ B;  4YOZ A;  4BCP B; 
#chains in the Genus database with same CATH topology
 2UUE B;  5I5Z B;  3GTM S;  1H4L D;  2CZ1 B;  2ZPF B;  1D3U B;  1JKW A;  2WMB B;  4HNU A;  5IDN B;  4BCF B;  1GUX A;  4ZGD B;  3M03 A;  1UNH D;  3HZJ A;  4AI6 A;  4F7L B;  1OIY B;  5CYI B;  1V29 B;  4CXA B;  4OB0 B;  4Y72 B;  5HQ0 B;  4M6V A;  4BCM B;  2PK9 B;  1UNG D;  4EOJ B;  1H28 B;  3QHR B;  4UN0 A;  1OL1 B;  2QDJ A;  4F6W B;  1H25 B;  2EUF A;  3QXE B;  2UZB B;  2BKZ B;  5EFQ B;  5IF1 B;  3X20 B;  1H1P B;  2QQ8 A;  1VOL A;  3H4C A;  2C5N B;  2BS3 A;  1IRE B;  3BLR B;  5HVY B;  2G77 A;  4IMY B;  3PO3 S;  4BCG B;  3HO8 A;  3F5X B;  3HBL A;  3BHV B;  3HHT B;  1OI9 B;  3QYB A;  2C4G B;  3A8G B;  3A8O B;  2BPM B;  4TTH A;  1GUX B;  4KRD B;  4JX5 A;  4BBR M;  1ZP2 A;  4BCJ B;  4HLQ A;  1UGQ B;  3MY1 B;  2WHB B;  3QZ5 B;  2WFY B;  3G33 B;  4EOS B;  3BHT B;  2IW8 B;  4EOI B;  3MIA B;  4BCP B;  4F70 B;  4G6L B;  4QSH A;  4AKI A;  3LQ5 B;  2ZCF B;  4CFM B;  2ZPH B;  1P5E B;  5ICP B;  5IDP B;  2W96 A;  3X26 B;  2JGZ B;  4F6S B;  4YOS A;  4Z6Y A;  4MFD A;  3QWL A;  1W98 B;  2PHG A;  1VYW B;  1OL2 B;  3X25 B;  1URC B;  5HBE B;  2W9F A;  1F5Q B;  4ROC A;  2CJM B;  4BCO B;  4BCM D;  2I53 A;  1OIU B;  4BCK B;  4OB1 B;  4ROD A;  2C5X B;  1JSU B;  2ZPG B;  2ZPI B;  2V22 B;  4CFV B;  1OKW B;  5LQF B;  5EJC A;  4EC9 B;  2W2H A;  2DME A;  4CFN B;  2CCI B;  2KR6 A;  3KHI A;  2IN3 A;  3QYE A;  3B57 A;  2WMA B;  4MIM A;  4FX3 B;  1E9H B;  4F7N B;  1XO2 A;  3BLQ B;  3TN8 B;  3NDQ A;  3TNH B;  2ZPE B;  5IHY A;  3A8M B;  1GH6 B;  2PK2 A;  2AHJ B;  3DJB A;  4OR5 B;  2WEV B;  3BG3 A;  3DTO A;  2ZPB B;  2F2C A;  2X1N B;  4YC3 B;  1OKV B;  5LMK B;  2UZE B;  1O9K A;  4AKH A;  4YOZ A;  3VYH B;  2D0Q B;  3DOG B;  3POM A;  4F7J B;  4EOQ B;  4BCH B;  2DD5 B;  2DXB B;  2KMG A;  4I3Z B;  1ENW A;  1TD6 A;  4NC6 A;  3QZ9 B;  4CFU B;  1VIN A;  1N4M A;  2CYZ B;  2CZ6 B;  4HNV A;  2WXV B;  3O0G D;  2C5O B;  5HBJ B;  1UGS B;  4II5 B;  4BBS M;  4OGR B;  4BCN B;  4F6U B;  3MI9 B;  1JST B;  3BHU B;  5HBH B;  2UZD B;  2BS4 A;  1FIN B;  4ZGE B;  2WIH B;  3TW7 A;  1UGR B;  1E7P A;  4FM4 B;  5FGK B;  2DXC B;  1G3N C;  1TFB A;  3VYG B;  3DDQ B;  2CZ0 B;  3TW6 A;  2R7G A;  4ZGJ B;  4JX4 A;  4EOM B;  1PKD B;  3BLH B;  1QMZ B;  5CEI B;  3RGF B;  4AKG A;  2QFZ A;  2UZL B;  4BCI B;  3TNW B;  3QHW B;  4LOC A;  2W9Z A;  1O9K B;  3X28 B;  4BCQ B;  1AHJ B;  2I40 B;  4BXX X;  1AD6 A;  5DQW A;  3WVD B;  4YOO A;  4EC8 B;  4OB3 B;  2WIP B;  4EOO B;  4CFW B;  3BG9 A;  1JOW A;  3A8H B;  5L2W B;  3DL1 A;  3DDP B;  2PJQ A;  1GY3 B;  1OGU B;  1UNL D;  3K7A M;  4NST B;  3X24 B;  4HNT A;  2W99 A;  5DQV A;  5HNB B;  4CFX B;  3QYH B;  4JX6 A;  4CFU D;  2DPP B;  4ELJ A;  4EOR B;  4EOK B;  1H26 B;  1KXU A;  2WPA B;  2QDY B;  3BG5 A;  4OB2 B;  1AIS B;  3A8L B;  4BCN D;  1UGP B;  3QYG B;  2IW6 B;  3VKH A;  1FKM A;  1C9B A;  4CRL B;  2DD4 B;  4KRC B;  1FVV B;  2IVX A;  3HB9 A;  2IW9 B;  1H1Q B;  2WJ9 A;  1H1S B;  4EON B;  4EOL B;  3EID B;  4F7S B;  2QF7 A;  1H24 B;  2C6T B;  4BCQ D;  1H1R B;  3WVE B;  2G9X B;  2BS2 A;  3VKG A;  1QLB A;  1BU2 A;  4BY1 X;  2CCH B;  4ROE A;  3EOC B;  2LW4 A;  2PMI B;  4HL4 A;  2C5V B;  4ELL A;  4MFE A;  3MY5 B;  2B9R A;  4BY7 X;  1H27 B;  2QGS A;  3EJ1 B;  4EOP B;  3TNI B;  5ACB A;  2CZ7 B;  5BNJ B;  2ZZD B; 
#chains in the Genus database with same CATH homology
 2UUE B;  3DOG B;  3POM A;  4F7J B;  4F70 B;  5I5Z B;  4EOQ B;  4BCH B;  1H4L D;  4I3Z B;  4G6L B;  2W99 A;  4CFU B;  1D3U B;  1JKW A;  2WMB B;  3LQ5 B;  5HNB B;  1VIN A;  4CFX B;  5IDN B;  1N4M A;  4BCF B;  1GUX A;  4CFM B;  1P5E B;  4CFU D;  3M03 A;  5ICP B;  1UNH D;  2W96 A;  5IDP B;  2JGZ B;  4F6S B;  2WXV B;  4F7L B;  4YOS A;  1OIY B;  3O0G D;  5CYI B;  4ELJ A;  4EOR B;  4EOK B;  4CXA B;  1H26 B;  2C5O B;  1W98 B;  5HBJ B;  2PHG A;  1KXU A;  1VYW B;  2WPA B;  4Y72 B;  1OL2 B;  4II5 B;  1URC B;  4OGR B;  5HBE B;  4BCN B;  5HQ0 B;  2W9F A;  1F5Q B;  1AIS B;  4F6U B;  4BCM B;  2PK9 B;  3MI9 B;  1JST B;  3BHU B;  2CJM B;  5HBH B;  2UZD B;  1UNG D;  4ROC A;  1FIN B;  4EOJ B;  4BCN D;  1H28 B;  3QHR B;  4UN0 A;  2WIH B;  4BCO B;  1OL1 B;  2I53 A;  2QDJ A;  4BCM D;  4F6W B;  1H25 B;  2EUF A;  2IW6 B;  1OIU B;  5FGK B;  2UZB B;  1G3N C;  4BCK B;  1TFB A;  2BKZ B;  5EFQ B;  3DDQ B;  4ROD A;  1C9B A;  2C5X B;  1JSU B;  5IF1 B;  2R7G A;  1H1P B;  4CRL B;  1VOL A;  2V22 B;  4CFV B;  4KRC B;  1OKW B;  5LQF B;  3H4C A;  1FVV B;  1PKD B;  2C5N B;  3BLH B;  4EC9 B;  4EOM B;  4CFN B;  2W2H A;  2CCI B;  3BLR B;  1QMZ B;  5CEI B;  3RGF B;  2IVX A;  2IW9 B;  5HVY B;  2UZL B;  4BCI B;  1H1Q B;  1H1S B;  2WMA B;  4IMY B;  4BCG B;  3TNW B;  3QHW B;  4EON B;  2W9Z A;  1E9H B;  4FX3 B;  1O9K B;  3F5X B;  4F7N B;  4BCQ B;  4EOL B;  3BHV B;  2I40 B;  1XO2 A;  3EID B;  1OI9 B;  3BLQ B;  4F7S B;  1AD6 A;  3TN8 B;  3TNH B;  1H24 B;  2C4G B;  2C6T B;  4BCQ D;  2BPM B;  1H1R B;  1GH6 B;  2PK2 A;  4YOO A;  4EC8 B;  2G9X B;  2WIP B;  4EOO B;  4CFW B;  4TTH A;  1BU2 A;  1GUX B;  1JOW A;  4KRD B;  4OR5 B;  2CCH B;  4ROE A;  2WEV B;  3EOC B;  2PMI B;  2C5V B;  1ZP2 A;  4BCJ B;  4ELL A;  5L2W B;  3MY5 B;  3MY1 B;  2WHB B;  2B9R A;  2WFY B;  2F2C A;  2X1N B;  3G33 B;  4EOS B;  3BHT B;  3DDP B;  1H27 B;  1GY3 B;  1OGU B;  1UNL D;  3EJ1 B;  4YC3 B;  4EOP B;  3TNI B;  1OKV B;  5ACB A;  2IW8 B;  3K7A M;  4EOI B;  5LMK B;  2UZE B;  1O9K A;  3MIA B;  4NST B;  5BNJ B;  4YOZ A;  4BCP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...