2WXVB

Structure of cdk2-cyclin a with a pyrazolo(4,3-h) quinazoline-3- carboxamide inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Identification of Potent Pyrazolo[4,3-H]Quinazoline-3-Carboxamides as Multi-Cyclin-Dependent Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wxvB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wxvB02
5HQ0B 2CCHB 3DOGB 2PMIB 2WXVB 1AISB 3BHTB 4RODA 5EFQB 4EC9B 4EC8B 4UN0A 4BCKB 4YOZA 1JSUB 2WFYB 3MY1B 1P5EB 2C5VB 1BU2A 2WIPB 4YOSA 4F70B 3DDQB 2UZEB 3MIAB 4F6UB 2BKZB 1H1PB 3RGFB 2I40B 4F7SB 5LQFB 2WMAB 2G9XB 4EOKB 4OGRB 3EIDB 3EJ1B 4OR5B 2WHBB 4ELLA 4BCJB 4EOJB 3BHVB 1GY3B 2PK2A 1O9KB 1AD6A 1OIUB 5ICPB 3F5XB 1OI9B 4F7LB 5IF1B 4EOOB 4BCFB 4EOQB 4ROEA 3QHRB 4BCGB 1D3UB 1OKWB 2PHGA 4F7NB 2W9FA 2PK9B 5HVYB 4IMYB 1GH6B 5HBEB 4Y72B 1H1RB 3TNHB 1TFBA 4CXAB 2C6TB 2CJMB 2QDJA 5CYIB 1G3NC 2C5XB 5HNBB 1E9HB 1OGUB 1FVVB 2W99A 4BCNB 1JOWA 2V22B 5FGKB 2JGZB 5HBJB 4EOSB 1UNLD 4BCPB 2CCIB 3TN8B 2EUFA 4EOMB 2UZDB 1QMZB 4NSTB 4BCND 1H26B 2C5NB 2IW9B 2UZLB 2W96A 1URCB 4YOOA 4BCMD 4CFUD 4CFMB 4TTHA 4BCQB 2WMBB 3QHWB 4BCHB 3BLRB 4CRLB 5HBHB 1ZP2A 3M03A 4YC3B 1FINB 4ELJA 4EOLB 3MY5B 4CFVB 3POMA 2WEVB 5BNJB 1UNHD 5ACBA 3EOCB 2IW6B 4EOPB 3H4CA 1OIYB 4BCQD 1H28B 3O0GD 1H27B 2B9RA 4BCMB 1H25B 4BCOB 1O9KA 2IW8B 3MI9B 1JKWA 2W9ZA 4CFUB 4CFWB 5LMKB 1H24B 4F6WB 4CFNB 2I53A 5IDPB 4CFXB 4EORB 1C9BA 2UZBB 4F6SB 1H4LD 1W98B 1VINA 3DDPB 4EONB 4I3ZB 1OL1B 4EOIB 1N4MA 1OKVB 2R7GA 4G6LB 1GUXB 3K7AM 3TNWB 2W2HA 1VOLA 5IDNB 3TNIB 1H1QB 2BPMB 1XO2A 4FX3B 2F2CA 2WPAB 1JSTB 1PKDB 2X1NB 3BHUB 2IVXA 4F7JB 4ROCA 2UUEB 5CEIB 5I5ZB 5L2WB 4KRDB 1KXUA 2C5OB 3BLQB 1H1SB 1F5QB 1VYWB 3G33B 4BCIB 3LQ5B 2WIHB 1UNGD 1OL2B 4II5B 2C4GB 4KRCB 1GUXA 3BLHB
chains in the Genus database with same CATH superfamily
2CCHB 3DOGB 2PMIB 4LOCA 2AHJB 2CYZB 4HL4A 2C5VB 4YOSA 3DDQB 2UZEB 5DQWA 3RGFB 1H1PB 2G9XB 3EIDB 2LW4A 4ELLA 4EOJB 4BY1X 4ZGJB 1AD6A 1OIUB 4F7LB 2DD4B 3DJBA 5IF1B 3QXEB 4EOOB 2PHGA 5HBEB 2C6TB 2CJMB 2C5XB 3QYHB 2W99A 4BCNB 1JOWA 4BCPB 3TN8B 3X20B 1ENWA 3VYGB 4BCND 1H26B 2C5NB 2W96A 4YOOA 2DPPB 2WMBB 4AKIA 3X26B 4CRLB 3DTOA 4YC3B 4ELJA 2WEVB 5ACBA 2ZZDB 3H4CA 2QDYB 3QZ5B 2DMEA 1H25B 2BS4A 3MI9B 2W9ZA 4CFWB 1H24B 4F6WB 4CFNB 4NC6A 5EJCA 1C9BA 2UZBB 5IHYA 4HNUA 2W2HA 1VOLA 1UGPB 2D0QB 1PKDB 3B57A 3X24B 2IVXA 3HZJA 2UUEB 3A8MB 1IREB 1KXUA 2QGSA 1VYWB 2ZPHB 3HB9A 1OL2B 5HQ0B 2ZPIB 3BHTB 4RODA 4EC8B 3HO8A 4UN0A 4BBRM 4YOZA 1JSUB 2QF7A 2WFYB 1P5EB 2WIPB 4F70B 4F6UB 4F7SB 3BG5A 4EOKB 4OGRB 3EJ1B 2CZ0B 1UGRB 3BHVB 2PK2A 5ICPB 3QYGB 1TD6A 3BG3A 4ROEA 2KMGA 4BCGB 3QYBA 2PJQA 4Y72B 1H1RB 4OB2B 4CXAB 5CYIB 1G3NC 1FVVB 2ZPEB 2V22B 2JGZB 2CCIB 2EUFA 3HBLA 2UZDB 2IW9B 4BCMD 1URCB 4CFUD 3A8LB 3M03A 3POMA 5BNJB 1UNHD 3A8GB 1V29B 3HHTB 2IW6B 3A8OB 2WJ9A 3O0GD 1H27B 2DXBB 3X28B 4BCOB 5LMKB 3KHIA 4HNTA 4CFXB 4BY7X 1W98B 1VINA 3DDPB 4I3ZB 1OL1B 2R7GA 4G6LB 3K7AM 2BPMB 1XO2A 2F2CA 5DQVA 3BHUB 4F7JB 5L2WB 3A8HB 4BXXX 1F5QB 4BCIB 1AHJB 2WIHB 4BBSM 4II5B 3QZ9B 1GUXA 3BLHB 4EC9B 2CZ6B 1BU2A 3MIAB 2BKZB 2I40B 3GTMS 5LQFB 4OR5B 2WHBB 4BCJB 1GY3B 3F5XB 4BCFB 1D3UB 3QHRB 3TW6A 4HLQA 4IMYB 1GH6B 3TNHB 1TFBA 2DD5B 3BG9A 3DL1A 4QSHA 2BS3A 5FGKB 5HBJB 4EOSB 4OB0B 4JX4A 4JX5A 2ZCFB 1QMZB 4NSTB 4OB1B 2ZPGB 4EOLB 3MY5B 4CFVB 4AKGA 4AKHA 1OIYB 2QFZA 2ZPBB 4BCMB 2CZ1B 1O9KA 2IW8B 4CFUB 4Z6YA 2I53A 4AI6A 5IDPB 2KR6A 1H4LD 4ZGEB 4EONB 1N4MA 1OKVB 3TNWB 3TNIB 4FM4B 4OB3B 2WPAB 1JSTB 2X1NB 4KRDB 2ZPFB 2C5OB 3BLQB 2DXCB 1UNGD 4TTHA 4MFDA 2WXVB 1AISB 3PO3S 5EFQB 4BCKB 3MY1B 1UGQB 3TW7A 2CZ7B 2WMAB 1UGSB 1O9KB 1OI9B 4JX6A 4EOQB 1OKWB 3VKGA 4F7NB 2W9FA 2PK9B 5HVYB 2QDJA 2BS2A 5HNBB 1E9HB 1OGUB 4M6VA 1UNLD 4EOMB 4HNVA 3WVDB 2UZLB 4CFMB 4BCQB 3QHWB 4BCHB 1E7PA 3BLRB 3QWLA 5HBHB 1ZP2A 1FINB 1FKMA 3EOCB 3NDQA 4EOPB 3QYEA 4MIMA 4BCQD 1H28B 2B9RA 3VYHB 1JKWA 4ZGDB 4EORB 1QLBA 4F6SB 2QQ8A 4EOIB 1GUXB 5IDNB 1H1QB 3X25B 3VKHA 4FX3B 4ROCA 5CEIB 5I5ZB 3WVEB 2IN3A 4MFEA 2G77A 1H1SB 3G33B 3LQ5B 2C4GB 4KRCB
chains in the Genus database with same CATH topology
5HQ0B 2CCHB 3DOGB 2PMIB 2WXVB 1AISB 3BHTB 4RODA 5EFQB 4EC9B 4EC8B 4UN0A 4BCKB 4YOZA 1JSUB 2WFYB 3MY1B 1P5EB 2C5VB 1BU2A 2WIPB 4YOSA 4F70B 3DDQB 2UZEB 3MIAB 4F6UB 2BKZB 1H1PB 3RGFB 2I40B 4F7SB 5LQFB 2WMAB 2G9XB 4EOKB 4OGRB 3EIDB 3EJ1B 4OR5B 2WHBB 4ELLA 4BCJB 4EOJB 3BHVB 1GY3B 2PK2A 1O9KB 1AD6A 1OIUB 5ICPB 3F5XB 1OI9B 4F7LB 5IF1B 4EOOB 4BCFB 4EOQB 4ROEA 3QHRB 4BCGB 1D3UB 1OKWB 2PHGA 4F7NB 2W9FA 2PK9B 5HVYB 4IMYB 1GH6B 5HBEB 4Y72B 1H1RB 3TNHB 1TFBA 4CXAB 2C6TB 2CJMB 2QDJA 5CYIB 1G3NC 2C5XB 5HNBB 1E9HB 1OGUB 1FVVB 2W99A 4BCNB 1JOWA 2V22B 5FGKB 2JGZB 5HBJB 4EOSB 1UNLD 4BCPB 2CCIB 3TN8B 2EUFA 4EOMB 2UZDB 1QMZB 4NSTB 4BCND 1H26B 2C5NB 2IW9B 2UZLB 2W96A 1URCB 4YOOA 4BCMD 4CFUD 4CFMB 4TTHA 4BCQB 2WMBB 3QHWB 4BCHB 3BLRB 4CRLB 5HBHB 1ZP2A 3M03A 4YC3B 1FINB 4ELJA 4EOLB 3MY5B 4CFVB 3POMA 2WEVB 5BNJB 1UNHD 5ACBA 3EOCB 2IW6B 4EOPB 3H4CA 1OIYB 4BCQD 1H28B 3O0GD 1H27B 2B9RA 4BCMB 1H25B 4BCOB 1O9KA 2IW8B 3MI9B 1JKWA 2W9ZA 4CFUB 4CFWB 5LMKB 1H24B 4F6WB 4CFNB 2I53A 5IDPB 4CFXB 4EORB 1C9BA 2UZBB 4F6SB 1H4LD 1W98B 1VINA 3DDPB 4EONB 4I3ZB 1OL1B 4EOIB 1N4MA 1OKVB 2R7GA 4G6LB 1GUXB 3K7AM 3TNWB 2W2HA 1VOLA 5IDNB 3TNIB 1H1QB 2BPMB 1XO2A 4FX3B 2F2CA 2WPAB 1JSTB 1PKDB 2X1NB 3BHUB 2IVXA 4F7JB 4ROCA 2UUEB 5CEIB 5I5ZB 5L2WB 4KRDB 1KXUA 2C5OB 3BLQB 1H1SB 1F5QB 1VYWB 3G33B 4BCIB 3LQ5B 2WIHB 1UNGD 1OL2B 4II5B 2C4GB 4KRCB 1GUXA 3BLHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQ0 B;  2CCH B;  3DOG B;  2PMI B;  2WXV B;  1AIS B;  3BHT B;  4ROD A;  5EFQ B;  4EC9 B;  4EC8 B;  4UN0 A;  4BCK B;  4YOZ A;  1JSU B;  2WFY B;  3MY1 B;  1P5E B;  2C5V B;  1BU2 A;  2WIP B;  4YOS A;  4F70 B;  3DDQ B;  2UZE B;  3MIA B;  4F6U B;  2BKZ B;  1H1P B;  3RGF B;  2I40 B;  4F7S B;  5LQF B;  2WMA B;  2G9X B;  4EOK B;  4OGR B;  3EID B;  3EJ1 B;  4OR5 B;  2WHB B;  4ELL A;  4BCJ B;  4EOJ B;  3BHV B;  1GY3 B;  2PK2 A;  1O9K B;  1AD6 A;  1OIU B;  5ICP B;  3F5X B;  1OI9 B;  4F7L B;  5IF1 B;  4EOO B;  4BCF B;  4EOQ B;  4ROE A;  3QHR B;  4BCG B;  1D3U B;  1OKW B;  2PHG A;  4F7N B;  2W9F A;  2PK9 B;  5HVY B;  4IMY B;  1GH6 B;  5HBE B;  4Y72 B;  1H1R B;  3TNH B;  1TFB A;  4CXA B;  2C6T B;  2CJM B;  2QDJ A;  5CYI B;  1G3N C;  2C5X B;  5HNB B;  1E9H B;  1OGU B;  1FVV B;  2W99 A;  4BCN B;  1JOW A;  2V22 B;  5FGK B;  2JGZ B;  5HBJ B;  4EOS B;  1UNL D;  4BCP B;  2CCI B;  3TN8 B;  2EUF A;  4EOM B;  2UZD B;  1QMZ B;  4NST B;  4BCN D;  1H26 B;  2C5N B;  2IW9 B;  2UZL B;  2W96 A;  1URC B;  4YOO A;  4BCM D;  4CFU D;  4CFM B;  4TTH A;  4BCQ B;  2WMB B;  3QHW B;  4BCH B;  3BLR B;  4CRL B;  5HBH B;  1ZP2 A;  3M03 A;  4YC3 B;  1FIN B;  4ELJ A;  4EOL B;  3MY5 B;  4CFV B;  3POM A;  2WEV B;  5BNJ B;  1UNH D;  5ACB A;  3EOC B;  2IW6 B;  4EOP B;  3H4C A;  1OIY B;  4BCQ D;  1H28 B;  3O0G D;  1H27 B;  2B9R A;  4BCM B;  1H25 B;  4BCO B;  1O9K A;  2IW8 B;  3MI9 B;  1JKW A;  2W9Z A;  4CFU B;  4CFW B;  5LMK B;  1H24 B;  4F6W B;  4CFN B;  2I53 A;  5IDP B;  4CFX B;  4EOR B;  1C9B A;  2UZB B;  4F6S B;  1H4L D;  1W98 B;  1VIN A;  3DDP B;  4EON B;  4I3Z B;  1OL1 B;  4EOI B;  1N4M A;  1OKV B;  2R7G A;  4G6L B;  1GUX B;  3K7A M;  3TNW B;  2W2H A;  1VOL A;  5IDN B;  3TNI B;  1H1Q B;  2BPM B;  1XO2 A;  4FX3 B;  2F2C A;  2WPA B;  1JST B;  1PKD B;  2X1N B;  3BHU B;  2IVX A;  4F7J B;  4ROC A;  2UUE B;  5CEI B;  5I5Z B;  5L2W B;  4KRD B;  1KXU A;  2C5O B;  3BLQ B;  1H1S B;  1F5Q B;  1VYW B;  3G33 B;  4BCI B;  3LQ5 B;  2WIH B;  1UNG D;  1OL2 B;  4II5 B;  2C4G B;  4KRC B;  1GUX A;  3BLH B; 
#chains in the Genus database with same CATH topology
 2CCH B;  3DOG B;  2PMI B;  4LOC A;  2AHJ B;  2CYZ B;  4HL4 A;  2C5V B;  4YOS A;  3DDQ B;  2UZE B;  5DQW A;  3RGF B;  1H1P B;  2G9X B;  3EID B;  2LW4 A;  4ELL A;  4EOJ B;  4BY1 X;  4ZGJ B;  1AD6 A;  1OIU B;  4F7L B;  2DD4 B;  3DJB A;  5IF1 B;  3QXE B;  4EOO B;  2PHG A;  5HBE B;  2C6T B;  2CJM B;  2C5X B;  3QYH B;  2W99 A;  4BCN B;  1JOW A;  4BCP B;  3TN8 B;  3X20 B;  1ENW A;  3VYG B;  4BCN D;  1H26 B;  2C5N B;  2W96 A;  4YOO A;  2DPP B;  2WMB B;  4AKI A;  3X26 B;  4CRL B;  3DTO A;  4YC3 B;  4ELJ A;  2WEV B;  5ACB A;  2ZZD B;  3H4C A;  2QDY B;  3QZ5 B;  2DME A;  1H25 B;  2BS4 A;  3MI9 B;  2W9Z A;  4CFW B;  1H24 B;  4F6W B;  4CFN B;  4NC6 A;  5EJC A;  1C9B A;  2UZB B;  5IHY A;  4HNU A;  2W2H A;  1VOL A;  1UGP B;  2D0Q B;  1PKD B;  3B57 A;  3X24 B;  2IVX A;  3HZJ A;  2UUE B;  3A8M B;  1IRE B;  1KXU A;  2QGS A;  1VYW B;  2ZPH B;  3HB9 A;  1OL2 B;  5HQ0 B;  2ZPI B;  3BHT B;  4ROD A;  4EC8 B;  3HO8 A;  4UN0 A;  4BBR M;  4YOZ A;  1JSU B;  2QF7 A;  2WFY B;  1P5E B;  2WIP B;  4F70 B;  4F6U B;  4F7S B;  3BG5 A;  4EOK B;  4OGR B;  3EJ1 B;  2CZ0 B;  1UGR B;  3BHV B;  2PK2 A;  5ICP B;  3QYG B;  1TD6 A;  3BG3 A;  4ROE A;  2KMG A;  4BCG B;  3QYB A;  2PJQ A;  4Y72 B;  1H1R B;  4OB2 B;  4CXA B;  5CYI B;  1G3N C;  1FVV B;  2ZPE B;  2V22 B;  2JGZ B;  2CCI B;  2EUF A;  3HBL A;  2UZD B;  2IW9 B;  4BCM D;  1URC B;  4CFU D;  3A8L B;  3M03 A;  3POM A;  5BNJ B;  1UNH D;  3A8G B;  1V29 B;  3HHT B;  2IW6 B;  3A8O B;  2WJ9 A;  3O0G D;  1H27 B;  2DXB B;  3X28 B;  4BCO B;  5LMK B;  3KHI A;  4HNT A;  4CFX B;  4BY7 X;  1W98 B;  1VIN A;  3DDP B;  4I3Z B;  1OL1 B;  2R7G A;  4G6L B;  3K7A M;  2BPM B;  1XO2 A;  2F2C A;  5DQV A;  3BHU B;  4F7J B;  5L2W B;  3A8H B;  4BXX X;  1F5Q B;  4BCI B;  1AHJ B;  2WIH B;  4BBS M;  4II5 B;  3QZ9 B;  1GUX A;  3BLH B;  4EC9 B;  2CZ6 B;  1BU2 A;  3MIA B;  2BKZ B;  2I40 B;  3GTM S;  5LQF B;  4OR5 B;  2WHB B;  4BCJ B;  1GY3 B;  3F5X B;  4BCF B;  1D3U B;  3QHR B;  3TW6 A;  4HLQ A;  4IMY B;  1GH6 B;  3TNH B;  1TFB A;  2DD5 B;  3BG9 A;  3DL1 A;  4QSH A;  2BS3 A;  5FGK B;  5HBJ B;  4EOS B;  4OB0 B;  4JX4 A;  4JX5 A;  2ZCF B;  1QMZ B;  4NST B;  4OB1 B;  2ZPG B;  4EOL B;  3MY5 B;  4CFV B;  4AKG A;  4AKH A;  1OIY B;  2QFZ A;  2ZPB B;  4BCM B;  2CZ1 B;  1O9K A;  2IW8 B;  4CFU B;  4Z6Y A;  2I53 A;  4AI6 A;  5IDP B;  2KR6 A;  1H4L D;  4ZGE B;  4EON B;  1N4M A;  1OKV B;  3TNW B;  3TNI B;  4FM4 B;  4OB3 B;  2WPA B;  1JST B;  2X1N B;  4KRD B;  2ZPF B;  2C5O B;  3BLQ B;  2DXC B;  1UNG D;  4TTH A;  4MFD A;  2WXV B;  1AIS B;  3PO3 S;  5EFQ B;  4BCK B;  3MY1 B;  1UGQ B;  3TW7 A;  2CZ7 B;  2WMA B;  1UGS B;  1O9K B;  1OI9 B;  4JX6 A;  4EOQ B;  1OKW B;  3VKG A;  4F7N B;  2W9F A;  2PK9 B;  5HVY B;  2QDJ A;  2BS2 A;  5HNB B;  1E9H B;  1OGU B;  4M6V A;  1UNL D;  4EOM B;  4HNV A;  3WVD B;  2UZL B;  4CFM B;  4BCQ B;  3QHW B;  4BCH B;  1E7P A;  3BLR B;  3QWL A;  5HBH B;  1ZP2 A;  1FIN B;  1FKM A;  3EOC B;  3NDQ A;  4EOP B;  3QYE A;  4MIM A;  4BCQ D;  1H28 B;  2B9R A;  3VYH B;  1JKW A;  4ZGD B;  4EOR B;  1QLB A;  4F6S B;  2QQ8 A;  4EOI B;  1GUX B;  5IDN B;  1H1Q B;  3X25 B;  3VKH A;  4FX3 B;  4ROC A;  5CEI B;  5I5Z B;  3WVE B;  2IN3 A;  4MFE A;  2G77 A;  1H1S B;  3G33 B;  3LQ5 B;  2C4G B;  4KRC B; 
#chains in the Genus database with same CATH homology
 5HQ0 B;  2CCH B;  3DOG B;  2PMI B;  2WXV B;  1AIS B;  3BHT B;  4ROD A;  5EFQ B;  4EC9 B;  4EC8 B;  4UN0 A;  4BCK B;  4YOZ A;  1JSU B;  2WFY B;  3MY1 B;  1P5E B;  2C5V B;  1BU2 A;  2WIP B;  4YOS A;  4F70 B;  3DDQ B;  2UZE B;  3MIA B;  4F6U B;  2BKZ B;  1H1P B;  3RGF B;  2I40 B;  4F7S B;  5LQF B;  2WMA B;  2G9X B;  4EOK B;  4OGR B;  3EID B;  3EJ1 B;  4OR5 B;  2WHB B;  4ELL A;  4BCJ B;  4EOJ B;  3BHV B;  1GY3 B;  2PK2 A;  1O9K B;  1AD6 A;  1OIU B;  5ICP B;  3F5X B;  1OI9 B;  4F7L B;  5IF1 B;  4EOO B;  4BCF B;  4EOQ B;  4ROE A;  3QHR B;  4BCG B;  1D3U B;  1OKW B;  2PHG A;  4F7N B;  2W9F A;  2PK9 B;  5HVY B;  4IMY B;  1GH6 B;  5HBE B;  4Y72 B;  1H1R B;  3TNH B;  1TFB A;  4CXA B;  2C6T B;  2CJM B;  2QDJ A;  5CYI B;  1G3N C;  2C5X B;  5HNB B;  1E9H B;  1OGU B;  1FVV B;  2W99 A;  4BCN B;  1JOW A;  2V22 B;  5FGK B;  2JGZ B;  5HBJ B;  4EOS B;  1UNL D;  4BCP B;  2CCI B;  3TN8 B;  2EUF A;  4EOM B;  2UZD B;  1QMZ B;  4NST B;  4BCN D;  1H26 B;  2C5N B;  2IW9 B;  2UZL B;  2W96 A;  1URC B;  4YOO A;  4BCM D;  4CFU D;  4CFM B;  4TTH A;  4BCQ B;  2WMB B;  3QHW B;  4BCH B;  3BLR B;  4CRL B;  5HBH B;  1ZP2 A;  3M03 A;  4YC3 B;  1FIN B;  4ELJ A;  4EOL B;  3MY5 B;  4CFV B;  3POM A;  2WEV B;  5BNJ B;  1UNH D;  5ACB A;  3EOC B;  2IW6 B;  4EOP B;  3H4C A;  1OIY B;  4BCQ D;  1H28 B;  3O0G D;  1H27 B;  2B9R A;  4BCM B;  1H25 B;  4BCO B;  1O9K A;  2IW8 B;  3MI9 B;  1JKW A;  2W9Z A;  4CFU B;  4CFW B;  5LMK B;  1H24 B;  4F6W B;  4CFN B;  2I53 A;  5IDP B;  4CFX B;  4EOR B;  1C9B A;  2UZB B;  4F6S B;  1H4L D;  1W98 B;  1VIN A;  3DDP B;  4EON B;  4I3Z B;  1OL1 B;  4EOI B;  1N4M A;  1OKV B;  2R7G A;  4G6L B;  1GUX B;  3K7A M;  3TNW B;  2W2H A;  1VOL A;  5IDN B;  3TNI B;  1H1Q B;  2BPM B;  1XO2 A;  4FX3 B;  2F2C A;  2WPA B;  1JST B;  1PKD B;  2X1N B;  3BHU B;  2IVX A;  4F7J B;  4ROC A;  2UUE B;  5CEI B;  5I5Z B;  5L2W B;  4KRD B;  1KXU A;  2C5O B;  3BLQ B;  1H1S B;  1F5Q B;  1VYW B;  3G33 B;  4BCI B;  3LQ5 B;  2WIH B;  1UNG D;  1OL2 B;  4II5 B;  2C4G B;  4KRC B;  1GUX A;  3BLH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...