2WXVB

Structure of cdk2-cyclin a with a pyrazolo(4,3-h) quinazoline-3- carboxamide inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Identification of Potent Pyrazolo[4,3-H]Quinazoline-3-Carboxamides as Multi-Cyclin-Dependent Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wxvB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wxvB02
2IW8B 4CRLB 4BCPB 3QHRB 3MIAB 4EC8B 5IF1B 1UNGD 4YOSA 2C5NB 2G9XB 2W96A 4CFWB 2IW6B 4EOQB 1C9BA 3POMA 2C4GB 2V22B 3H4CA 2B9RA 4G6LB 4KRDB 1N4MA 5HBEB 4F6SB 4BCIB 2R7GA 1JSTB 2UZLB 4BCND 3BLRB 3EOCB 5FGKB 4F70B 4BCFB 4CFUD 5HNBB 4EORB 3EIDB 3TNIB 2WFYB 2WMBB 5HBHB 4YC3B 4F7LB 5IDNB 4CFUB 3G33B 4YOOA 1OKVB 4BCJB 4Y72B 3RGFB 4CFXB 4BCGB 2UZBB 2WIHB 2UZDB 3DDQB 1AD6A 5HQ0B 5CEIB 1H1RB 4KRCB 4EONB 3EJ1B 4EOJB 4EOPB 4EOKB 4F6WB 2BKZB 5LQFB 4I3ZB 2WMAB 1GUXB 4EOMB 3K7AM 3MI9B 3BHUB 1H4LD 4BCHB 1OKWB 2WHBB 2CCIB 5HBJB 4CXAB 1H25B 5ACBA 4BCOB 4ROCA 5ICPB 1JOWA 4ROEA 1H27B 4BCNB 5L2WB 2CJMB 1AISB 1JSUB 4NSTB 1PKDB 1OL2B 1UNHD 1F5QB 2WXVB 1OGUB 4CFMB 1H1PB 1H24B 2QDJA 2UZEB 2W2HA 2CCHB 2C5VB 1ZP2A 3LQ5B 1H1QB 1BU2A 1GY3B 1H28B 2X1NB 5IDPB 2F2CA 3M03A 4BCKB 5CYIB 2IW9B 4BCQD 2C5XB 1UNLD 1O9KA 3BLQB 1XO2A 4CFNB 1H1SB 3QHWB 2WEVB 1W98B 4BCQB 2WIPB 2W9ZA 5LMKB 1D3UB 1QMZB 3DOGB 3TN8B 5I5ZB 1FINB 1P5EB 2PK9B 5HVYB 5BNJB 3MY5B 2JGZB 3O0GD 2PHGA 2IVXA 2PK2A 1GH6B 3DDPB 4IMYB 4EC9B 1VOLA 1TFBA 2UUEB 1JKWA 3BHTB 4FX3B 5EFQB 4F7NB 1OIYB 2C6TB 4EOLB 4F7SB 1O9KB 2BPMB 4OR5B 1FVVB 1OL1B 1H26B 1VINA 4OGRB 4RODA 1E9HB 2W9FA 2I40B 1VYWB 2EUFA 2I53A 3BLHB 4EOSB 2W99A 3MY1B 4YOZA 3F5XB 4CFVB 1OI9B 3TNWB 4EOIB 4BCMD 2C5OB 4ELJA 4F7JB 4EOOB 4II5B 2PMIB 3BHVB 1KXUA 1URCB 1GUXA 1OIUB 4UN0A 2WPAB 3TNHB 4TTHA 4BCMB 4ELLA 4F6UB 1G3NC
chains in the Genus database with same CATH superfamily
2DXCB 4HNTA 2CYZB 2W96A 2KR6A 2IW6B 1C9BA 2V22B 3H4CA 1QLBA 4OB2B 2UZLB 3BLRB 3EOCB 4F70B 4FM4B 4CFUD 5HNBB 4QSHA 3EIDB 2WFYB 2AHJB 4F7LB 4LOCA 1OKVB 4Y72B 3RGFB 2ZPHB 3DDQB 3QZ5B 5IHYA 2BKZB 5EJCA 3K7AM 1H4LD 4BCHB 5ACBA 3TW6A 1UGPB 4ROEA 4BCNB 4ZGDB 4BBSM 1JSUB 1F5QB 2W2HA 3X25B 1BU2A 2X1NB 4JX6A 5IDPB 4BCQD 2CZ1B 1O9KA 3BLQB 1E7PA 3DOGB 2ZPGB 3TN8B 1FINB 5BNJB 3MY5B 2JGZB 1ENWA 3VKGA 2CZ7B 2PK2A 3DDPB 1VOLA 3BHTB 3X26B 3A8LB 4F7NB 3B57A 4OGRB 1OL1B 1H26B 1VINA 1E9HB 2I40B 4ZGJB 3MY1B 4Z6YA 4JX5A 4UN0A 2QGSA 3TNHB 1D3UB 4F6UB 2QF7A 2IW8B 4CRLB 2QDYB 2WJ9A 3QHRB 4NC6A 4EC8B 5IF1B 4YOSA 2C5NB 3HO8A 4OB0B 3NDQA 3POMA 2B9RA 2R7GA 1JSTB 4HLQA 5FGKB 4BCFB 4EORB 3TNIB 2ZZDB 4CFUB 4BCGB 2UZBB 2WIHB 2DMEA 5DQWA 4EOKB 3VYHB 1AHJB 2WMAB 4EOMB 3MI9B 4CXAB 1H25B 5ICPB 4BY1X 4JX4A 1AISB 2IN3A 3A8OB 4ZGEB 4NSTB 4BBRM 3QYEA 1H28B 1GY3B 3M03A 3DTOA 2C5XB 1UNLD 3BG3A 4CFNB 4MFDA 2WEVB 1W98B 4BCQB 2WIPB 3X24B 2W9ZA 3BG9A 2PK9B 1FKMA 4M6VA 2IVXA 4OB1B 2D0QB 1OIYB 2C6TB 4EOLB 4F7SB 4OR5B 3VYGB 4RODA 2W9FA 4YOZA 3F5XB 4CFVB 3TNWB 4BCMD 4F7JB 4EOOB 3BHVB 1URCB 1GUXA 2WPAB 1UGRB 1G3NC 4BCPB 2CZ6B 3MIAB 3DJBA 2ZPEB 4CFWB 4EOQB 4G6LB 1IREB 3DL1A 4BCND 3A8MB 4HNUA 2WMBB 4YC3B 4YOOA 4BCJB 1AD6A 1H1RB 4KRCB 3HBLA 1TD6A 4EOPB 4F6WB 1GUXB 3BHUB 3A8GB 4BCOB 4ROCA 1JOWA 3VKHA 1PKDB 1OL2B 1UNHD 2WXVB 1OGUB 4CFMB 1H1PB 2C5VB 1ZP2A 3LQ5B 4MFEA 1H1SB 3QHWB 2BS3A 3QXEB 5I5ZB 3O0GD 4IMYB 4EC9B 1JKWA 4FX3B 4HL4A 4AKGA 2BS2A 2ZPBB 2QQ8A 1VYWB 2I53A 4EOSB 3WVEB 4EOIB 4ELJA 3KHIA 4II5B 1OIUB 4BCMB 4ELLA 3HHTB 3QYGB 4MIMA 4BY7X 4OB3B 1UNGD 2DXBB 1V29B 2G9XB 3GTMS 2C4GB 2G77A 4KRDB 1N4MA 5HBEB 4F6SB 4BCIB 5DQVA 3QWLA 5HBHB 5IDNB 1UGSB 2ZPFB 3G33B 4CFXB 5HQ0B 2UZDB 5CEIB 4EONB 3EJ1B 4EOJB 5LQFB 4I3ZB 3X28B 3A8HB 1OKWB 2WHBB 2CCIB 5HBJB 2DD4B 3HZJA 4AKHA 2ZCFB 3WVDB 1H27B 3QYBA 5L2WB 2CJMB 2ZPIB 4AKIA 1H24B 2QDJA 4BXXX 2UZEB 2CCHB 1H1QB 2PJQA 2F2CA 4BCKB 5CYIB 2KMGA 2IW9B 2QFZA 1XO2A 3QYHB 5LMKB 1QMZB 1P5EB 5HVYB 2PHGA 2CZ0B 4AI6A 1GH6B 1TFBA 2UUEB 4HNVA 3TW7A 5EFQB 3HB9A 1O9KB 2BPMB 1FVVB 2LW4A 2EUFA 3BG5A 3BLHB 2W99A 2DPPB 2BS4A 3X20B 1OI9B 2C5OB 3QZ9B 2PMIB 1KXUA 1UGQB 3PO3S 4TTHA 2DD5B
chains in the Genus database with same CATH topology
2IW8B 4CRLB 4BCPB 3QHRB 3MIAB 4EC8B 5IF1B 1UNGD 4YOSA 2C5NB 2G9XB 2W96A 4CFWB 2IW6B 4EOQB 1C9BA 3POMA 2C4GB 2V22B 3H4CA 2B9RA 4G6LB 4KRDB 1N4MA 5HBEB 4F6SB 4BCIB 2R7GA 1JSTB 2UZLB 4BCND 3BLRB 3EOCB 5FGKB 4F70B 4BCFB 4CFUD 5HNBB 4EORB 3EIDB 3TNIB 2WFYB 2WMBB 5HBHB 4YC3B 4F7LB 5IDNB 4CFUB 3G33B 4YOOA 1OKVB 4BCJB 4Y72B 3RGFB 4CFXB 4BCGB 2UZBB 2WIHB 2UZDB 3DDQB 1AD6A 5HQ0B 5CEIB 1H1RB 4KRCB 4EONB 3EJ1B 4EOJB 4EOPB 4EOKB 4F6WB 2BKZB 5LQFB 4I3ZB 2WMAB 1GUXB 4EOMB 3K7AM 3MI9B 3BHUB 1H4LD 4BCHB 1OKWB 2WHBB 2CCIB 5HBJB 4CXAB 1H25B 5ACBA 4BCOB 4ROCA 5ICPB 1JOWA 4ROEA 1H27B 4BCNB 5L2WB 2CJMB 1AISB 1JSUB 4NSTB 1PKDB 1OL2B 1UNHD 1F5QB 2WXVB 1OGUB 4CFMB 1H1PB 1H24B 2QDJA 2UZEB 2W2HA 2CCHB 2C5VB 1ZP2A 3LQ5B 1H1QB 1BU2A 1GY3B 1H28B 2X1NB 5IDPB 2F2CA 3M03A 4BCKB 5CYIB 2IW9B 4BCQD 2C5XB 1UNLD 1O9KA 3BLQB 1XO2A 4CFNB 1H1SB 3QHWB 2WEVB 1W98B 4BCQB 2WIPB 2W9ZA 5LMKB 1D3UB 1QMZB 3DOGB 3TN8B 5I5ZB 1FINB 1P5EB 2PK9B 5HVYB 5BNJB 3MY5B 2JGZB 3O0GD 2PHGA 2IVXA 2PK2A 1GH6B 3DDPB 4IMYB 4EC9B 1VOLA 1TFBA 2UUEB 1JKWA 3BHTB 4FX3B 5EFQB 4F7NB 1OIYB 2C6TB 4EOLB 4F7SB 1O9KB 2BPMB 4OR5B 1FVVB 1OL1B 1H26B 1VINA 4OGRB 4RODA 1E9HB 2W9FA 2I40B 1VYWB 2EUFA 2I53A 3BLHB 4EOSB 2W99A 3MY1B 4YOZA 3F5XB 4CFVB 1OI9B 3TNWB 4EOIB 4BCMD 2C5OB 4ELJA 4F7JB 4EOOB 4II5B 2PMIB 3BHVB 1KXUA 1URCB 1GUXA 1OIUB 4UN0A 2WPAB 3TNHB 4TTHA 4BCMB 4ELLA 4F6UB 1G3NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW8 B;  4CRL B;  4BCP B;  3QHR B;  3MIA B;  4EC8 B;  5IF1 B;  1UNG D;  4YOS A;  2C5N B;  2G9X B;  2W96 A;  4CFW B;  2IW6 B;  4EOQ B;  1C9B A;  3POM A;  2C4G B;  2V22 B;  3H4C A;  2B9R A;  4G6L B;  4KRD B;  1N4M A;  5HBE B;  4F6S B;  4BCI B;  2R7G A;  1JST B;  2UZL B;  4BCN D;  3BLR B;  3EOC B;  5FGK B;  4F70 B;  4BCF B;  4CFU D;  5HNB B;  4EOR B;  3EID B;  3TNI B;  2WFY B;  2WMB B;  5HBH B;  4YC3 B;  4F7L B;  5IDN B;  4CFU B;  3G33 B;  4YOO A;  1OKV B;  4BCJ B;  4Y72 B;  3RGF B;  4CFX B;  4BCG B;  2UZB B;  2WIH B;  2UZD B;  3DDQ B;  1AD6 A;  5HQ0 B;  5CEI B;  1H1R B;  4KRC B;  4EON B;  3EJ1 B;  4EOJ B;  4EOP B;  4EOK B;  4F6W B;  2BKZ B;  5LQF B;  4I3Z B;  2WMA B;  1GUX B;  4EOM B;  3K7A M;  3MI9 B;  3BHU B;  1H4L D;  4BCH B;  1OKW B;  2WHB B;  2CCI B;  5HBJ B;  4CXA B;  1H25 B;  5ACB A;  4BCO B;  4ROC A;  5ICP B;  1JOW A;  4ROE A;  1H27 B;  4BCN B;  5L2W B;  2CJM B;  1AIS B;  1JSU B;  4NST B;  1PKD B;  1OL2 B;  1UNH D;  1F5Q B;  2WXV B;  1OGU B;  4CFM B;  1H1P B;  1H24 B;  2QDJ A;  2UZE B;  2W2H A;  2CCH B;  2C5V B;  1ZP2 A;  3LQ5 B;  1H1Q B;  1BU2 A;  1GY3 B;  1H28 B;  2X1N B;  5IDP B;  2F2C A;  3M03 A;  4BCK B;  5CYI B;  2IW9 B;  4BCQ D;  2C5X B;  1UNL D;  1O9K A;  3BLQ B;  1XO2 A;  4CFN B;  1H1S B;  3QHW B;  2WEV B;  1W98 B;  4BCQ B;  2WIP B;  2W9Z A;  5LMK B;  1D3U B;  1QMZ B;  3DOG B;  3TN8 B;  5I5Z B;  1FIN B;  1P5E B;  2PK9 B;  5HVY B;  5BNJ B;  3MY5 B;  2JGZ B;  3O0G D;  2PHG A;  2IVX A;  2PK2 A;  1GH6 B;  3DDP B;  4IMY B;  4EC9 B;  1VOL A;  1TFB A;  2UUE B;  1JKW A;  3BHT B;  4FX3 B;  5EFQ B;  4F7N B;  1OIY B;  2C6T B;  4EOL B;  4F7S B;  1O9K B;  2BPM B;  4OR5 B;  1FVV B;  1OL1 B;  1H26 B;  1VIN A;  4OGR B;  4ROD A;  1E9H B;  2W9F A;  2I40 B;  1VYW B;  2EUF A;  2I53 A;  3BLH B;  4EOS B;  2W99 A;  3MY1 B;  4YOZ A;  3F5X B;  4CFV B;  1OI9 B;  3TNW B;  4EOI B;  4BCM D;  2C5O B;  4ELJ A;  4F7J B;  4EOO B;  4II5 B;  2PMI B;  3BHV B;  1KXU A;  1URC B;  1GUX A;  1OIU B;  4UN0 A;  2WPA B;  3TNH B;  4TTH A;  4BCM B;  4ELL A;  4F6U B;  1G3N C; 
#chains in the Genus database with same CATH topology
 2DXC B;  4HNT A;  2CYZ B;  2W96 A;  2KR6 A;  2IW6 B;  1C9B A;  2V22 B;  3H4C A;  1QLB A;  4OB2 B;  2UZL B;  3BLR B;  3EOC B;  4F70 B;  4FM4 B;  4CFU D;  5HNB B;  4QSH A;  3EID B;  2WFY B;  2AHJ B;  4F7L B;  4LOC A;  1OKV B;  4Y72 B;  3RGF B;  2ZPH B;  3DDQ B;  3QZ5 B;  5IHY A;  2BKZ B;  5EJC A;  3K7A M;  1H4L D;  4BCH B;  5ACB A;  3TW6 A;  1UGP B;  4ROE A;  4BCN B;  4ZGD B;  4BBS M;  1JSU B;  1F5Q B;  2W2H A;  3X25 B;  1BU2 A;  2X1N B;  4JX6 A;  5IDP B;  4BCQ D;  2CZ1 B;  1O9K A;  3BLQ B;  1E7P A;  3DOG B;  2ZPG B;  3TN8 B;  1FIN B;  5BNJ B;  3MY5 B;  2JGZ B;  1ENW A;  3VKG A;  2CZ7 B;  2PK2 A;  3DDP B;  1VOL A;  3BHT B;  3X26 B;  3A8L B;  4F7N B;  3B57 A;  4OGR B;  1OL1 B;  1H26 B;  1VIN A;  1E9H B;  2I40 B;  4ZGJ B;  3MY1 B;  4Z6Y A;  4JX5 A;  4UN0 A;  2QGS A;  3TNH B;  1D3U B;  4F6U B;  2QF7 A;  2IW8 B;  4CRL B;  2QDY B;  2WJ9 A;  3QHR B;  4NC6 A;  4EC8 B;  5IF1 B;  4YOS A;  2C5N B;  3HO8 A;  4OB0 B;  3NDQ A;  3POM A;  2B9R A;  2R7G A;  1JST B;  4HLQ A;  5FGK B;  4BCF B;  4EOR B;  3TNI B;  2ZZD B;  4CFU B;  4BCG B;  2UZB B;  2WIH B;  2DME A;  5DQW A;  4EOK B;  3VYH B;  1AHJ B;  2WMA B;  4EOM B;  3MI9 B;  4CXA B;  1H25 B;  5ICP B;  4BY1 X;  4JX4 A;  1AIS B;  2IN3 A;  3A8O B;  4ZGE B;  4NST B;  4BBR M;  3QYE A;  1H28 B;  1GY3 B;  3M03 A;  3DTO A;  2C5X B;  1UNL D;  3BG3 A;  4CFN B;  4MFD A;  2WEV B;  1W98 B;  4BCQ B;  2WIP B;  3X24 B;  2W9Z A;  3BG9 A;  2PK9 B;  1FKM A;  4M6V A;  2IVX A;  4OB1 B;  2D0Q B;  1OIY B;  2C6T B;  4EOL B;  4F7S B;  4OR5 B;  3VYG B;  4ROD A;  2W9F A;  4YOZ A;  3F5X B;  4CFV B;  3TNW B;  4BCM D;  4F7J B;  4EOO B;  3BHV B;  1URC B;  1GUX A;  2WPA B;  1UGR B;  1G3N C;  4BCP B;  2CZ6 B;  3MIA B;  3DJB A;  2ZPE B;  4CFW B;  4EOQ B;  4G6L B;  1IRE B;  3DL1 A;  4BCN D;  3A8M B;  4HNU A;  2WMB B;  4YC3 B;  4YOO A;  4BCJ B;  1AD6 A;  1H1R B;  4KRC B;  3HBL A;  1TD6 A;  4EOP B;  4F6W B;  1GUX B;  3BHU B;  3A8G B;  4BCO B;  4ROC A;  1JOW A;  3VKH A;  1PKD B;  1OL2 B;  1UNH D;  2WXV B;  1OGU B;  4CFM B;  1H1P B;  2C5V B;  1ZP2 A;  3LQ5 B;  4MFE A;  1H1S B;  3QHW B;  2BS3 A;  3QXE B;  5I5Z B;  3O0G D;  4IMY B;  4EC9 B;  1JKW A;  4FX3 B;  4HL4 A;  4AKG A;  2BS2 A;  2ZPB B;  2QQ8 A;  1VYW B;  2I53 A;  4EOS B;  3WVE B;  4EOI B;  4ELJ A;  3KHI A;  4II5 B;  1OIU B;  4BCM B;  4ELL A;  3HHT B;  3QYG B;  4MIM A;  4BY7 X;  4OB3 B;  1UNG D;  2DXB B;  1V29 B;  2G9X B;  3GTM S;  2C4G B;  2G77 A;  4KRD B;  1N4M A;  5HBE B;  4F6S B;  4BCI B;  5DQV A;  3QWL A;  5HBH B;  5IDN B;  1UGS B;  2ZPF B;  3G33 B;  4CFX B;  5HQ0 B;  2UZD B;  5CEI B;  4EON B;  3EJ1 B;  4EOJ B;  5LQF B;  4I3Z B;  3X28 B;  3A8H B;  1OKW B;  2WHB B;  2CCI B;  5HBJ B;  2DD4 B;  3HZJ A;  4AKH A;  2ZCF B;  3WVD B;  1H27 B;  3QYB A;  5L2W B;  2CJM B;  2ZPI B;  4AKI A;  1H24 B;  2QDJ A;  4BXX X;  2UZE B;  2CCH B;  1H1Q B;  2PJQ A;  2F2C A;  4BCK B;  5CYI B;  2KMG A;  2IW9 B;  2QFZ A;  1XO2 A;  3QYH B;  5LMK B;  1QMZ B;  1P5E B;  5HVY B;  2PHG A;  2CZ0 B;  4AI6 A;  1GH6 B;  1TFB A;  2UUE B;  4HNV A;  3TW7 A;  5EFQ B;  3HB9 A;  1O9K B;  2BPM B;  1FVV B;  2LW4 A;  2EUF A;  3BG5 A;  3BLH B;  2W99 A;  2DPP B;  2BS4 A;  3X20 B;  1OI9 B;  2C5O B;  3QZ9 B;  2PMI B;  1KXU A;  1UGQ B;  3PO3 S;  4TTH A;  2DD5 B; 
#chains in the Genus database with same CATH homology
 2IW8 B;  4CRL B;  4BCP B;  3QHR B;  3MIA B;  4EC8 B;  5IF1 B;  1UNG D;  4YOS A;  2C5N B;  2G9X B;  2W96 A;  4CFW B;  2IW6 B;  4EOQ B;  1C9B A;  3POM A;  2C4G B;  2V22 B;  3H4C A;  2B9R A;  4G6L B;  4KRD B;  1N4M A;  5HBE B;  4F6S B;  4BCI B;  2R7G A;  1JST B;  2UZL B;  4BCN D;  3BLR B;  3EOC B;  5FGK B;  4F70 B;  4BCF B;  4CFU D;  5HNB B;  4EOR B;  3EID B;  3TNI B;  2WFY B;  2WMB B;  5HBH B;  4YC3 B;  4F7L B;  5IDN B;  4CFU B;  3G33 B;  4YOO A;  1OKV B;  4BCJ B;  4Y72 B;  3RGF B;  4CFX B;  4BCG B;  2UZB B;  2WIH B;  2UZD B;  3DDQ B;  1AD6 A;  5HQ0 B;  5CEI B;  1H1R B;  4KRC B;  4EON B;  3EJ1 B;  4EOJ B;  4EOP B;  4EOK B;  4F6W B;  2BKZ B;  5LQF B;  4I3Z B;  2WMA B;  1GUX B;  4EOM B;  3K7A M;  3MI9 B;  3BHU B;  1H4L D;  4BCH B;  1OKW B;  2WHB B;  2CCI B;  5HBJ B;  4CXA B;  1H25 B;  5ACB A;  4BCO B;  4ROC A;  5ICP B;  1JOW A;  4ROE A;  1H27 B;  4BCN B;  5L2W B;  2CJM B;  1AIS B;  1JSU B;  4NST B;  1PKD B;  1OL2 B;  1UNH D;  1F5Q B;  2WXV B;  1OGU B;  4CFM B;  1H1P B;  1H24 B;  2QDJ A;  2UZE B;  2W2H A;  2CCH B;  2C5V B;  1ZP2 A;  3LQ5 B;  1H1Q B;  1BU2 A;  1GY3 B;  1H28 B;  2X1N B;  5IDP B;  2F2C A;  3M03 A;  4BCK B;  5CYI B;  2IW9 B;  4BCQ D;  2C5X B;  1UNL D;  1O9K A;  3BLQ B;  1XO2 A;  4CFN B;  1H1S B;  3QHW B;  2WEV B;  1W98 B;  4BCQ B;  2WIP B;  2W9Z A;  5LMK B;  1D3U B;  1QMZ B;  3DOG B;  3TN8 B;  5I5Z B;  1FIN B;  1P5E B;  2PK9 B;  5HVY B;  5BNJ B;  3MY5 B;  2JGZ B;  3O0G D;  2PHG A;  2IVX A;  2PK2 A;  1GH6 B;  3DDP B;  4IMY B;  4EC9 B;  1VOL A;  1TFB A;  2UUE B;  1JKW A;  3BHT B;  4FX3 B;  5EFQ B;  4F7N B;  1OIY B;  2C6T B;  4EOL B;  4F7S B;  1O9K B;  2BPM B;  4OR5 B;  1FVV B;  1OL1 B;  1H26 B;  1VIN A;  4OGR B;  4ROD A;  1E9H B;  2W9F A;  2I40 B;  1VYW B;  2EUF A;  2I53 A;  3BLH B;  4EOS B;  2W99 A;  3MY1 B;  4YOZ A;  3F5X B;  4CFV B;  1OI9 B;  3TNW B;  4EOI B;  4BCM D;  2C5O B;  4ELJ A;  4F7J B;  4EOO B;  4II5 B;  2PMI B;  3BHV B;  1KXU A;  1URC B;  1GUX A;  1OIU B;  4UN0 A;  2WPA B;  3TNH B;  4TTH A;  4BCM B;  4ELL A;  4F6U B;  1G3N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...