2WXVB

Structure of cdk2-cyclin a with a pyrazolo(4,3-h) quinazoline-3- carboxamide inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Identification of Potent Pyrazolo[4,3-H]Quinazoline-3-Carboxamides as Multi-Cyclin-Dependent Kinase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wxvB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wxvB02
1AD6A 4F7SB 5CYIB 1H28B 1BU2A 3DDPB 4BCQB 2W9ZA 1JOWA 2W9FA 3DDQB 4KRDB 2BKZB 4CFMB 1H24B 1PKDB 4CRLB 1C9BA 4EOSB 5IF1B 2WIPB 5HQ0B 4F70B 4EONB 4F6UB 2I40B 1H25B 4UN0A 1VOLA 3RGFB 4F6SB 1GH6B 1G3NC 1F5QB 1H1RB 4FX3B 2I53A 1OIYB 4CFVB 3BHVB 4CFUD 1XO2A 3BHUB 2WHBB 4RODA 4NSTB 3MI9B 3TNHB 3TNIB 5L2WB 2WPAB 2C5VB 2IVXA 4ROCA 5IDNB 4BCND 3EIDB 1O9KB 3MY5B 3QHRB 5LMKB 1FINB 2W96A 4OR5B 4I3ZB 3BLHB 1P5EB 3K7AM 2C5OB 2G9XB 1H1PB 4EOPB 2JGZB 1JSUB 4EORB 2C5XB 3BHTB 1OI9B 2CJMB 2W99A 5EFQB 4BCQD 2PK2A 4ROEA 3O0GD 3F5XB 4EOQB 1D3UB 4ELJA 5HNBB 4EOMB 4EC8B 5FGKB 4EOKB 4II5B 2IW6B 4BCHB 1URCB 2UZEB 1GUXA 4KRCB 4YOSA 4BCGB 4BCFB 4BCMB 4CFNB 4BCKB 3BLQB 3G33B 2QDJA 1OIUB 4CFWB 4BCPB 4BCIB 1O9KA 4F6WB 2B9RA 2WXVB 2W2HA 2UZBB 1ZP2A 5BNJB 4YOOA 1OKVB 5ICPB 3MIAB 2CCHB 3LQ5B 1TFBA 5LQFB 4IMYB 4G6LB 4CFUB 4BCOB 2EUFA 3M03A 4F7LB 3POMA 4TTHA 3EJ1B 1JSTB 2UUEB 3EOCB 5I5ZB 4CFXB 1H27B 2WMAB 4CXAB 2C5NB 5HBEB 2F2CA 4BCNB 2X1NB 1UNLD 4EOIB 2PHGA 1OL2B 4F7JB 2IW9B 2PK9B 2PMIB 1W98B 2WFYB 3DOGB 1JKWA 5HVYB 1H26B 4EOJB 5ACBA 1VINA 3BLRB 3H4CA 5IDPB 1H1SB 1QMZB 2R7GA 2C6TB 5HBJB 1VYWB 2CCIB 1OGUB 2UZDB 2C4GB 5CEIB 1GY3B 2WIHB 1OKWB 2IW8B 3TNWB 4Y72B 1N4MA 2UZLB 1GUXB 1KXUA 2BPMB 1UNGD 1H1QB 2V22B 4YC3B 1E9HB 1AISB 5HBHB 3QHWB 4ELLA 4YOZA 4EOOB 2WMBB 4EOLB 1OL1B 3TN8B 3MY1B 4BCJB 4OGRB 1FVVB 1H4LD 1UNHD 2WEVB 4BCMD 4EC9B 4F7NB
chains in the Genus database with same CATH superfamily
4F7SB 4Z6YA 4CFMB 3DDQB 4KRDB 2BKZB 4CRLB 4F70B 4F6UB 3QXEB 3RGFB 1H1RB 3VYGB 2D0QB 3BHVB 4CFVB 1XO2A 4BBSM 2DXCB 2KMGA 3BG5A 4BCND 3EIDB 3QHRB 4I3ZB 3VKHA 1P5EB 3K7AM 4BXXX 2G9XB 4JX5A 4EOPB 4EORB 1OI9B 1D3UB 4ELJA 2ZPFB 2BS4A 5FGKB 2WJ9A 2IW6B 4BCHB 2DPPB 4BCMB 2QFZA 1AHJB 3BLQB 3G33B 1UGQB 1OIUB 4BCPB 3WVDB 2UZBB 3HZJA 1ZP2A 4OB1B 4YOOA 2CCHB 5DQVA 3VKGA 1QLBA 4LOCA 2QQ8A 5LQFB 4AKHA 3QYGB 3EOCB 3TW7A 4CFXB 1H27B 2WMAB 2X1NB 2DD5B 3HB9A 2ZPHB 2CZ0B 3HBLA 5HVYB 4EOJB 4MFDA 1QMZB 2UZDB 5EJCA 2IW8B 4Y72B 3DJBA 1N4MA 2BPMB 1E9HB 1AISB 2WEVB 4BCMD 4EC9B 5CYIB 1H28B 1E7PA 4ZGEB 2W9FA 1H24B 1C9BA 2WIPB 5HQ0B 4UN0A 1VOLA 2CZ6B 4BY7X 4RODA 4NSTB 4MFEA 3TNIB 3MY5B 3VYHB 4HLQA 4OR5B 4MIMA 2C5XB 1ENWA 2W99A 4BCQD 2PK2A 4ROEA 3F5XB 4EC8B 4EOKB 4II5B 1URCB 2UZEB 1FKMA 4KRCB 4BCFB 4CFNB 1UGRB 4BCKB 4AI6A 4CFWB 4BCIB 2WXVB 4ZGJB 5ICPB 1UGPB 4QSHA 4OB3B 4CFUB 2EUFA 4HL4A 3TW6A 2C5NB 2F2CA 2PHGA 4OB2B 4F7JB 4FM4B 2PMIB 2WFYB 3DOGB 1JKWA 2CZ7B 3BG3A 1H26B 5ACBA 1H1SB 2R7GA 4AKIA 2CCIB 3A8LB 2WIHB 3TNWB 1GUXB 1UNGD 1TD6A 4YOZA 1OL1B 2ZPIB 3QYHB 4OGRB 1UNHD 4HNTA 4OB0B 1AD6A 2ZZDB 3DDPB 4BCQB 3QZ9B 2W9ZA 1JOWA 3GTMS 2QDYB 4M6VA 1GH6B 4FX3B 2DD4B 2KR6A 4CFUD 3BHUB 2WHBB 3MI9B 4HNUA 5L2WB 2WPAB 2IVXA 3QWLA 1UGSB 5LMKB 1FINB 5IHYA 2C5OB 1JSUB 2CJMB 3KHIA 3O0GD 3QYBA 3QZ5B 5HNBB 4EOMB 3X26B 3QYEA 1GUXA 3A8MB 4YOSA 4BCGB 4NC6A 2IN3A 3DL1A 2QDJA 1O9KA 1V29B 5DQWA 4F6WB 2AHJB 2CZ1B 3A8HB 2BS2A 1TFBA 2ZPEB 4IMYB 3POMA 4TTHA 1JSTB 3X20B 1UNLD 4EOIB 1OL2B 2PK9B 1W98B 3H4CA 2G77A 2C6TB 5HBJB 4HNVA 1GY3B 1IREB 3WVEB 3BG9A 3NDQA 2V22B 4EOOB 3HO8A 3TN8B 3MY1B 4BCJB 1FVVB 1H4LD 2BS3A 1BU2A 1PKDB 3X24B 4EOSB 5IF1B 4AKGA 4EONB 2I40B 1H25B 4JX4A 3X25B 4F6SB 1G3NC 1F5QB 2I53A 1OIYB 2ZPGB 3A8GB 3A8OB 3TNHB 2C5VB 4BBRM 2PJQA 4ROCA 5IDNB 1O9KB 3PO3S 2W96A 3BLHB 2ZPBB 1H1PB 2JGZB 3BHTB 5EFQB 2CYZB 4EOQB 4BY1X 3X28B 2DMEA 4ZGDB 2B9RA 2W2HA 5BNJB 1OKVB 3B57A 3MIAB 3LQ5B 2ZCFB 4G6LB 4BCOB 4F7LB 3M03A 3EJ1B 2UUEB 5I5ZB 4CXAB 2QGSA 5HBEB 4BCNB 2DXBB 2IW9B 2LW4A 1VINA 3BLRB 4JX6A 5IDPB 2QF7A 1VYWB 1OGUB 2C4GB 5CEIB 1OKWB 3DTOA 2UZLB 1KXUA 3HHTB 1H1QB 4YC3B 5HBHB 3QHWB 4ELLA 2WMBB 4EOLB 4F7NB
chains in the Genus database with same CATH topology
1AD6A 4F7SB 5CYIB 1H28B 1BU2A 3DDPB 4BCQB 2W9ZA 1JOWA 2W9FA 3DDQB 4KRDB 2BKZB 4CFMB 1H24B 1PKDB 4CRLB 1C9BA 4EOSB 5IF1B 2WIPB 5HQ0B 4F70B 4EONB 4F6UB 2I40B 1H25B 4UN0A 1VOLA 3RGFB 4F6SB 1GH6B 1G3NC 1F5QB 1H1RB 4FX3B 2I53A 1OIYB 4CFVB 3BHVB 4CFUD 1XO2A 3BHUB 2WHBB 4RODA 4NSTB 3MI9B 3TNHB 3TNIB 5L2WB 2WPAB 2C5VB 2IVXA 4ROCA 5IDNB 4BCND 3EIDB 1O9KB 3MY5B 3QHRB 5LMKB 1FINB 2W96A 4OR5B 4I3ZB 3BLHB 1P5EB 3K7AM 2C5OB 2G9XB 1H1PB 4EOPB 2JGZB 1JSUB 4EORB 2C5XB 3BHTB 1OI9B 2CJMB 2W99A 5EFQB 4BCQD 2PK2A 4ROEA 3O0GD 3F5XB 4EOQB 1D3UB 4ELJA 5HNBB 4EOMB 4EC8B 5FGKB 4EOKB 4II5B 2IW6B 4BCHB 1URCB 2UZEB 1GUXA 4KRCB 4YOSA 4BCGB 4BCFB 4BCMB 4CFNB 4BCKB 3BLQB 3G33B 2QDJA 1OIUB 4CFWB 4BCPB 4BCIB 1O9KA 4F6WB 2B9RA 2WXVB 2W2HA 2UZBB 1ZP2A 5BNJB 4YOOA 1OKVB 5ICPB 3MIAB 2CCHB 3LQ5B 1TFBA 5LQFB 4IMYB 4G6LB 4CFUB 4BCOB 2EUFA 3M03A 4F7LB 3POMA 4TTHA 3EJ1B 1JSTB 2UUEB 3EOCB 5I5ZB 4CFXB 1H27B 2WMAB 4CXAB 2C5NB 5HBEB 2F2CA 4BCNB 2X1NB 1UNLD 4EOIB 2PHGA 1OL2B 4F7JB 2IW9B 2PK9B 2PMIB 1W98B 2WFYB 3DOGB 1JKWA 5HVYB 1H26B 4EOJB 5ACBA 1VINA 3BLRB 3H4CA 5IDPB 1H1SB 1QMZB 2R7GA 2C6TB 5HBJB 1VYWB 2CCIB 1OGUB 2UZDB 2C4GB 5CEIB 1GY3B 2WIHB 1OKWB 2IW8B 3TNWB 4Y72B 1N4MA 2UZLB 1GUXB 1KXUA 2BPMB 1UNGD 1H1QB 2V22B 4YC3B 1E9HB 1AISB 5HBHB 3QHWB 4ELLA 4YOZA 4EOOB 2WMBB 4EOLB 1OL1B 3TN8B 3MY1B 4BCJB 4OGRB 1FVVB 1H4LD 1UNHD 2WEVB 4BCMD 4EC9B 4F7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD6 A;  4F7S B;  5CYI B;  1H28 B;  1BU2 A;  3DDP B;  4BCQ B;  2W9Z A;  1JOW A;  2W9F A;  3DDQ B;  4KRD B;  2BKZ B;  4CFM B;  1H24 B;  1PKD B;  4CRL B;  1C9B A;  4EOS B;  5IF1 B;  2WIP B;  5HQ0 B;  4F70 B;  4EON B;  4F6U B;  2I40 B;  1H25 B;  4UN0 A;  1VOL A;  3RGF B;  4F6S B;  1GH6 B;  1G3N C;  1F5Q B;  1H1R B;  4FX3 B;  2I53 A;  1OIY B;  4CFV B;  3BHV B;  4CFU D;  1XO2 A;  3BHU B;  2WHB B;  4ROD A;  4NST B;  3MI9 B;  3TNH B;  3TNI B;  5L2W B;  2WPA B;  2C5V B;  2IVX A;  4ROC A;  5IDN B;  4BCN D;  3EID B;  1O9K B;  3MY5 B;  3QHR B;  5LMK B;  1FIN B;  2W96 A;  4OR5 B;  4I3Z B;  3BLH B;  1P5E B;  3K7A M;  2C5O B;  2G9X B;  1H1P B;  4EOP B;  2JGZ B;  1JSU B;  4EOR B;  2C5X B;  3BHT B;  1OI9 B;  2CJM B;  2W99 A;  5EFQ B;  4BCQ D;  2PK2 A;  4ROE A;  3O0G D;  3F5X B;  4EOQ B;  1D3U B;  4ELJ A;  5HNB B;  4EOM B;  4EC8 B;  5FGK B;  4EOK B;  4II5 B;  2IW6 B;  4BCH B;  1URC B;  2UZE B;  1GUX A;  4KRC B;  4YOS A;  4BCG B;  4BCF B;  4BCM B;  4CFN B;  4BCK B;  3BLQ B;  3G33 B;  2QDJ A;  1OIU B;  4CFW B;  4BCP B;  4BCI B;  1O9K A;  4F6W B;  2B9R A;  2WXV B;  2W2H A;  2UZB B;  1ZP2 A;  5BNJ B;  4YOO A;  1OKV B;  5ICP B;  3MIA B;  2CCH B;  3LQ5 B;  1TFB A;  5LQF B;  4IMY B;  4G6L B;  4CFU B;  4BCO B;  2EUF A;  3M03 A;  4F7L B;  3POM A;  4TTH A;  3EJ1 B;  1JST B;  2UUE B;  3EOC B;  5I5Z B;  4CFX B;  1H27 B;  2WMA B;  4CXA B;  2C5N B;  5HBE B;  2F2C A;  4BCN B;  2X1N B;  1UNL D;  4EOI B;  2PHG A;  1OL2 B;  4F7J B;  2IW9 B;  2PK9 B;  2PMI B;  1W98 B;  2WFY B;  3DOG B;  1JKW A;  5HVY B;  1H26 B;  4EOJ B;  5ACB A;  1VIN A;  3BLR B;  3H4C A;  5IDP B;  1H1S B;  1QMZ B;  2R7G A;  2C6T B;  5HBJ B;  1VYW B;  2CCI B;  1OGU B;  2UZD B;  2C4G B;  5CEI B;  1GY3 B;  2WIH B;  1OKW B;  2IW8 B;  3TNW B;  4Y72 B;  1N4M A;  2UZL B;  1GUX B;  1KXU A;  2BPM B;  1UNG D;  1H1Q B;  2V22 B;  4YC3 B;  1E9H B;  1AIS B;  5HBH B;  3QHW B;  4ELL A;  4YOZ A;  4EOO B;  2WMB B;  4EOL B;  1OL1 B;  3TN8 B;  3MY1 B;  4BCJ B;  4OGR B;  1FVV B;  1H4L D;  1UNH D;  2WEV B;  4BCM D;  4EC9 B;  4F7N B; 
#chains in the Genus database with same CATH topology
 4F7S B;  4Z6Y A;  4CFM B;  3DDQ B;  4KRD B;  2BKZ B;  4CRL B;  4F70 B;  4F6U B;  3QXE B;  3RGF B;  1H1R B;  3VYG B;  2D0Q B;  3BHV B;  4CFV B;  1XO2 A;  4BBS M;  2DXC B;  2KMG A;  3BG5 A;  4BCN D;  3EID B;  3QHR B;  4I3Z B;  3VKH A;  1P5E B;  3K7A M;  4BXX X;  2G9X B;  4JX5 A;  4EOP B;  4EOR B;  1OI9 B;  1D3U B;  4ELJ A;  2ZPF B;  2BS4 A;  5FGK B;  2WJ9 A;  2IW6 B;  4BCH B;  2DPP B;  4BCM B;  2QFZ A;  1AHJ B;  3BLQ B;  3G33 B;  1UGQ B;  1OIU B;  4BCP B;  3WVD B;  2UZB B;  3HZJ A;  1ZP2 A;  4OB1 B;  4YOO A;  2CCH B;  5DQV A;  3VKG A;  1QLB A;  4LOC A;  2QQ8 A;  5LQF B;  4AKH A;  3QYG B;  3EOC B;  3TW7 A;  4CFX B;  1H27 B;  2WMA B;  2X1N B;  2DD5 B;  3HB9 A;  2ZPH B;  2CZ0 B;  3HBL A;  5HVY B;  4EOJ B;  4MFD A;  1QMZ B;  2UZD B;  5EJC A;  2IW8 B;  4Y72 B;  3DJB A;  1N4M A;  2BPM B;  1E9H B;  1AIS B;  2WEV B;  4BCM D;  4EC9 B;  5CYI B;  1H28 B;  1E7P A;  4ZGE B;  2W9F A;  1H24 B;  1C9B A;  2WIP B;  5HQ0 B;  4UN0 A;  1VOL A;  2CZ6 B;  4BY7 X;  4ROD A;  4NST B;  4MFE A;  3TNI B;  3MY5 B;  3VYH B;  4HLQ A;  4OR5 B;  4MIM A;  2C5X B;  1ENW A;  2W99 A;  4BCQ D;  2PK2 A;  4ROE A;  3F5X B;  4EC8 B;  4EOK B;  4II5 B;  1URC B;  2UZE B;  1FKM A;  4KRC B;  4BCF B;  4CFN B;  1UGR B;  4BCK B;  4AI6 A;  4CFW B;  4BCI B;  2WXV B;  4ZGJ B;  5ICP B;  1UGP B;  4QSH A;  4OB3 B;  4CFU B;  2EUF A;  4HL4 A;  3TW6 A;  2C5N B;  2F2C A;  2PHG A;  4OB2 B;  4F7J B;  4FM4 B;  2PMI B;  2WFY B;  3DOG B;  1JKW A;  2CZ7 B;  3BG3 A;  1H26 B;  5ACB A;  1H1S B;  2R7G A;  4AKI A;  2CCI B;  3A8L B;  2WIH B;  3TNW B;  1GUX B;  1UNG D;  1TD6 A;  4YOZ A;  1OL1 B;  2ZPI B;  3QYH B;  4OGR B;  1UNH D;  4HNT A;  4OB0 B;  1AD6 A;  2ZZD B;  3DDP B;  4BCQ B;  3QZ9 B;  2W9Z A;  1JOW A;  3GTM S;  2QDY B;  4M6V A;  1GH6 B;  4FX3 B;  2DD4 B;  2KR6 A;  4CFU D;  3BHU B;  2WHB B;  3MI9 B;  4HNU A;  5L2W B;  2WPA B;  2IVX A;  3QWL A;  1UGS B;  5LMK B;  1FIN B;  5IHY A;  2C5O B;  1JSU B;  2CJM B;  3KHI A;  3O0G D;  3QYB A;  3QZ5 B;  5HNB B;  4EOM B;  3X26 B;  3QYE A;  1GUX A;  3A8M B;  4YOS A;  4BCG B;  4NC6 A;  2IN3 A;  3DL1 A;  2QDJ A;  1O9K A;  1V29 B;  5DQW A;  4F6W B;  2AHJ B;  2CZ1 B;  3A8H B;  2BS2 A;  1TFB A;  2ZPE B;  4IMY B;  3POM A;  4TTH A;  1JST B;  3X20 B;  1UNL D;  4EOI B;  1OL2 B;  2PK9 B;  1W98 B;  3H4C A;  2G77 A;  2C6T B;  5HBJ B;  4HNV A;  1GY3 B;  1IRE B;  3WVE B;  3BG9 A;  3NDQ A;  2V22 B;  4EOO B;  3HO8 A;  3TN8 B;  3MY1 B;  4BCJ B;  1FVV B;  1H4L D;  2BS3 A;  1BU2 A;  1PKD B;  3X24 B;  4EOS B;  5IF1 B;  4AKG A;  4EON B;  2I40 B;  1H25 B;  4JX4 A;  3X25 B;  4F6S B;  1G3N C;  1F5Q B;  2I53 A;  1OIY B;  2ZPG B;  3A8G B;  3A8O B;  3TNH B;  2C5V B;  4BBR M;  2PJQ A;  4ROC A;  5IDN B;  1O9K B;  3PO3 S;  2W96 A;  3BLH B;  2ZPB B;  1H1P B;  2JGZ B;  3BHT B;  5EFQ B;  2CYZ B;  4EOQ B;  4BY1 X;  3X28 B;  2DME A;  4ZGD B;  2B9R A;  2W2H A;  5BNJ B;  1OKV B;  3B57 A;  3MIA B;  3LQ5 B;  2ZCF B;  4G6L B;  4BCO B;  4F7L B;  3M03 A;  3EJ1 B;  2UUE B;  5I5Z B;  4CXA B;  2QGS A;  5HBE B;  4BCN B;  2DXB B;  2IW9 B;  2LW4 A;  1VIN A;  3BLR B;  4JX6 A;  5IDP B;  2QF7 A;  1VYW B;  1OGU B;  2C4G B;  5CEI B;  1OKW B;  3DTO A;  2UZL B;  1KXU A;  3HHT B;  1H1Q B;  4YC3 B;  5HBH B;  3QHW B;  4ELL A;  2WMB B;  4EOL B;  4F7N B; 
#chains in the Genus database with same CATH homology
 1AD6 A;  4F7S B;  5CYI B;  1H28 B;  1BU2 A;  3DDP B;  4BCQ B;  2W9Z A;  1JOW A;  2W9F A;  3DDQ B;  4KRD B;  2BKZ B;  4CFM B;  1H24 B;  1PKD B;  4CRL B;  1C9B A;  4EOS B;  5IF1 B;  2WIP B;  5HQ0 B;  4F70 B;  4EON B;  4F6U B;  2I40 B;  1H25 B;  4UN0 A;  1VOL A;  3RGF B;  4F6S B;  1GH6 B;  1G3N C;  1F5Q B;  1H1R B;  4FX3 B;  2I53 A;  1OIY B;  4CFV B;  3BHV B;  4CFU D;  1XO2 A;  3BHU B;  2WHB B;  4ROD A;  4NST B;  3MI9 B;  3TNH B;  3TNI B;  5L2W B;  2WPA B;  2C5V B;  2IVX A;  4ROC A;  5IDN B;  4BCN D;  3EID B;  1O9K B;  3MY5 B;  3QHR B;  5LMK B;  1FIN B;  2W96 A;  4OR5 B;  4I3Z B;  3BLH B;  1P5E B;  3K7A M;  2C5O B;  2G9X B;  1H1P B;  4EOP B;  2JGZ B;  1JSU B;  4EOR B;  2C5X B;  3BHT B;  1OI9 B;  2CJM B;  2W99 A;  5EFQ B;  4BCQ D;  2PK2 A;  4ROE A;  3O0G D;  3F5X B;  4EOQ B;  1D3U B;  4ELJ A;  5HNB B;  4EOM B;  4EC8 B;  5FGK B;  4EOK B;  4II5 B;  2IW6 B;  4BCH B;  1URC B;  2UZE B;  1GUX A;  4KRC B;  4YOS A;  4BCG B;  4BCF B;  4BCM B;  4CFN B;  4BCK B;  3BLQ B;  3G33 B;  2QDJ A;  1OIU B;  4CFW B;  4BCP B;  4BCI B;  1O9K A;  4F6W B;  2B9R A;  2WXV B;  2W2H A;  2UZB B;  1ZP2 A;  5BNJ B;  4YOO A;  1OKV B;  5ICP B;  3MIA B;  2CCH B;  3LQ5 B;  1TFB A;  5LQF B;  4IMY B;  4G6L B;  4CFU B;  4BCO B;  2EUF A;  3M03 A;  4F7L B;  3POM A;  4TTH A;  3EJ1 B;  1JST B;  2UUE B;  3EOC B;  5I5Z B;  4CFX B;  1H27 B;  2WMA B;  4CXA B;  2C5N B;  5HBE B;  2F2C A;  4BCN B;  2X1N B;  1UNL D;  4EOI B;  2PHG A;  1OL2 B;  4F7J B;  2IW9 B;  2PK9 B;  2PMI B;  1W98 B;  2WFY B;  3DOG B;  1JKW A;  5HVY B;  1H26 B;  4EOJ B;  5ACB A;  1VIN A;  3BLR B;  3H4C A;  5IDP B;  1H1S B;  1QMZ B;  2R7G A;  2C6T B;  5HBJ B;  1VYW B;  2CCI B;  1OGU B;  2UZD B;  2C4G B;  5CEI B;  1GY3 B;  2WIH B;  1OKW B;  2IW8 B;  3TNW B;  4Y72 B;  1N4M A;  2UZL B;  1GUX B;  1KXU A;  2BPM B;  1UNG D;  1H1Q B;  2V22 B;  4YC3 B;  1E9H B;  1AIS B;  5HBH B;  3QHW B;  4ELL A;  4YOZ A;  4EOO B;  2WMB B;  4EOL B;  1OL1 B;  3TN8 B;  3MY1 B;  4BCJ B;  4OGR B;  1FVV B;  1H4L D;  1UNH D;  2WEV B;  4BCM D;  4EC9 B;  4F7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...