2ZPGB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpgB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpgB02
1QP2A 2ZPBB 2WSFE 2ZCFB 3WVEB 3VYGA 2DD4A 2ZPGB 1JB0E 1UGRB 1QP3A 1DJ7B 3X25B 4ZGDB 3X28B 2CYZB 2CZ7B 2ZPEB 2CZ6B 1AHJB 2ZPHB 3HHTB 2ZZDB 3X24B 2PVOB 3LW5E 2DXBB 2CZ1B 4XK8E 4OB1B 1GXIE 2D0QB 2QDYB 1UGPB 3A8LB 2PVDB 1UGSB 3QYGB 2ZZDA 3QXEB 4OB0B 3X20B 2PUOB 1PSFA 4ZGEB 1IREB 3QYHB 1V29B 2DXBA 1UGQB 2DXCB 4Y28E 5L8RE 2AHJB 2DPPB 2CZ0B 2ZPIB 2WSCE 3A8MB 3VYHB 2PU9B 3WVDB 3VYGB 4ZGJB 1PSEA 3QZ5B 4KT0E 3A8GB 2ZPFB 4OB2B 3QZ9B 2O01E 2DD5B 3A8OB 2PUKB 2WSEE 4L6V5 2DXCA 4OB3B 2DD4B 4RKUE 3A8HB 4FM4B 2PVGB 2DD5A 3X26B
chains in the Genus database with same CATH superfamily
2BKZB 2BTTA 3OYGA 3VS4A 4C92A 1F1BB 1N4MA 2L5QA 4PFZA 4E7KA 4HCBA 1N5ZA 2ZPGB 4E47A 1SPKA 3P8DA 1EX4A 1DJ7B 2QEXT 4XU0A 4BCMB 2QTXA 2YUPA 5LL6S 4YOZA 3OYHA 2CYZB 2RHYA 4Q5WA 1VQPT 1S72A 2ZZDB 2EQKA 3CPWP 1M4ZA 4HCZA 3G71Q 2CSIA 4N4IA 2KGTA 2NUTB 4M7AF 1UJYA 4DEXA 1W70A 3BDUA 4EMKB 2K9GA 4YOOA 1IO6A 4E6RA 3I5SA 1I8FA 4CRIA 4EOMB 3CD6Q 2EUFA 3BY7A 1QW1A 1D1AA 1YHQT 3QYGB 1GBRA 5I5ZB 1OV3A 1VQMQ 1LPLA 1VYTA 1M90U 1OL2B 4BCQB 2XDDA 2KE9A 3C95A 2WACA 5IHYA 1D1BA 3M0RA 5IAYA 1NE8A 3PO3S 1H1PB 2K2MA 5CVIA 4RUGA 1K73C 3G6EQ 1UG1A 2V1QA 4F16A 2X51A 2KSSA 2CUDA 2PNIA 2PU9B 3JCMQ 1BBZA 3EGDA 2K2VA 3MEUA 4RTWA 1RI0A 2J6KA 1YWOA 2K79A 4BCOB 2AKKA 1Q82R 2NUTA 3L42A 2QEXA 5GMKi 1S1NA 3QIIA 1X2KA 2DO3A 2QXFA 4XU3A 2XMFA 3TQ7P 3CCVT 1VQPA 4AG2C 1QVGS 2RHXA 4QVZA 2JS0A 5LJ5h 4F7LB 4KBMB 1NPPA 1B34B 2OTJQ 2C5OB 1PD0A 4JJNK 2PHGA 1HYOA 2IW8B 1YHQA 4MZPA 1KQ1A 4EPCA 4JPBW 3ZL7C 3EAEA 1D0ZA 2WSFE 2C0OA 2HCKA 3BE3A 4CC4B 2JTEA 2XIDA 1MMNA 5KYYB 1T3LA 1KD1C 1W1FA 4FT2A 2NUPB 2EQJA 3I35A 4PJOD 2KXDA 2L0AA 4II5B 1YHQQ 4C92C 3MP1A 3CC4T 2X1NB 4BD3A 3QWXX 1UNLD 2CCIB 5FRNA 4LUDA 4F7UF 5CKFA 3DKMA 2HSPA 3EHRA 2QQSA 1VIFA 2EGAA 3CCMA 3A8LB 3HKSA 1UHCA 2EVRA 4M77C 2F2WA 3D7SB 4OB0B 4EIKA 1KD1R 3MEVA 4EORB 2SRCA 3EFRA 1G3SA 5D6XA 1GBQA 3CBOA 1I07A 2DEUA 3TSZA 1XO2A 2ZPIB 4J9CA 2XK0A 5FROA 1OU9A 4KUDK 1Y71A 1QKWA 5IDNB 3CCVQ 1WA7A 2VWFA 3RKWA 4AKGA 2LX9A 1UGVA 3M03A 3HBLA 1YJNQ 1VQ5T 1YITQ 2DZ9A 4FYYB 2FRWA 1KHIA 4QQDA 4DEYA 3CC2T 2XDPA 3REAB 4JS5A 5GMKm 2HKNA 1D3BB 2XG8D 1VYVA 4KT0E 1JJ2A 3HTRA 3JB9G 4C0FA 1X6OA 1WDXA 4ROCA 3S3MA 3CC4A 4M77E 2WEVB 2GQIA 2HEQA 2DD5B 4JJDA 4PJOF 3OYFA 2KQWA 2W99A 2QI2A 5HNBB 2P0KA 2I40B 5KCOA 1M27C 2PQWA 4EMKC 2RK2A 1AZEA 1AD6A 1YI2Q 1E6HA 1GCQC 1AWJA 4C92G 2Y4XA 3VS2A 3DTOA 2RHIA 3FB9A 3EJ1B 4FU6A 2CH4W 1Q81R 3JCMV 2NUZA 4J9DA 2KT8A 5DLQE 2F2CA 1WLPB 3NTIA 2D1XA 2ATCB 4L59A 3PTAA 2EAYA 1UGRB 1HK9A 4K11A 1Q7YU 3CC7Q 5J3BA 4M7DA 1ZBXA 2CT3A 1D3BA 2LX7A 2LQWA 1UUEA 2CZ7B 1RI9A 1SRMA 4JLIA 4ESRA 1MMAA 1OL1B 4QT7A 1VQ5A 5LJ5j 4X9CA 4J9EA 3CMAQ 1M9SA 1WXTA 3CC2A 4DOVA 4E7JA 2BS2A 4BY1X 3UT1A 1O75A 4LD9K 5KYNA 2HNIA 1GXIE 5GAN8 2DJZA 2IW6B 4C8QC 4RTZA 3KXTA 2KXCA 3EGUA 5IXFA 1M90C 3OYCA 1JSTB 3LLRA 3GPLA 3QJYA 3OSSC 3M9QA 3TCJA 2Z0WA 1GRIA 5HCKA 4BI8B 3RUXA 2E65A 5KYXB 5GAMd 3M0SA 4CFXB 1WQ7A 1YCSB 5I2MA 2WSCE 2P84A 1QVGA 3OBYA 4RODA 1V1CA 4BCHB 5IN1A 4B9XA 1C0MA 1JRIA 4NS5A 2E64A 3JV3A 3META 2DMOA 1QWEA 1M90R 2KROA 2DAQA 3BHTB 1WFWA 2LQNA 1K9AA 2I2LA 2BS4A 2E70A 1ZUYA 1X75C 5M9OA 2HKQB 4C8QE 2O9SA 2YRVA 4EOLB 2C5VB 2COZA 4C5EA 3QHWB 5HBEB 2VGMA 1UDLA 3HSBA 1HD3A 4BDYA 5CQYA 5KE3A 2QG9B 3BLRB 2R57A 1MHNA 2RNAA 2CP6A 2COWA 3UPUA 4IKFA 2IG0A 2BZYA 4PKCC 1PKTA 5GAOn 1I5OB 1OI9B 5GMKj 5CIUA 4LUEA 4XTZA 3PFSA 1KC8C 4IIMA 4EOOB 2PTKA 1VINA 3I9QA 2GFAA 2K3YA 2PMIB 1G3WA 2ABLA 3O5ZA 1WXBA 1H1SB 2A28A 3SHWA 1Z9QA 4A4FA 1AHJB 2E6ZA 1UJ0A 1TTHB 3FLGA 4M75B 3OS2A 4ZTFA 3FJPA 3SWNA 3JCMJ 1EZZB 1GUXA 2B86A 3I56T 2BPMB 5LJ3e 1KC8R 1F5QB 1UHFA 2FVUA 4LDVA 2H3JA 2LMJA 3M0PA 2GF7A 3FDRA 5GAMh 2GNCA 2QQBA 4Z8AA 3BHVB 1TU0B 4XQ3A 2JVVA 2X4YA 1WX6A 3QWYA 4J7IA 3VS1A 1E7PA 2D0NA 4HCKA 2DL3A 3VV0A 1AZGB 4Y28E 3M57A 5GAN5 2AHJB 5GANd 4JX4A 1YIJQ 1OIYB 1M5Q1 1M2OA 4AMCA 2IVWA 1K8AU 4QVDA 1OULA 4Z89A 4FIBA 3I55Q 3WVDB 1NZ9A 2GFUA 2O4XB 3MPUB 5CKEA 4OR5B 5L2WB 3PE0A 4M75A 2H3EB 3LGFA 3TW6A 2V26A 2DRMA 3L2ZA 2E5KA 5FRMA 3SDZA 3LWIA 1YJ9T 3TVTA 4L5GA 2WIHB 2G3RA 4RCBA 4ELLA 2JUFA 1JKWA 1H25B 1VQ9T 1VYWB 3CCLT 1BYMA 5I22A 1K73U 4BE1A 1YJWT 1IB8A 3I56A 2LT1A 4J5YA 2M16A 4HVWA 1MV0B 1BB9A 5KYUA 2F1LA 5GAN3 1FXXA 4OGRB 2MIOA 3TSWA 3OYAA 3PIPA 3QJ6A 4F6WB 5FW9A 3M5AA 4AKIA 4Y72B 2WJ9A 4M7AB 2LRQA 4OMNA 3MEAA 1YNZA 2O4XA 2ED1A 4BCND 4M7DG 4TTHA 5DQVA 2DD4A 1WYXA 5KH6A 3CMEQ 4R55A 1GFCA 2DL7A 5GAOm 2ZPEB 2LZ6B 4M78C 3CQTA 2RJCA 4JX6A 1HXDA 2RI5A 2AK5A 2RQUA 4J8OA 3MP6A 2EJ9A 2VGNA 4MDXA 1YJ9A 4PNOA 2WFYB 4A4KA 1H26B 1VQ9A 1Y0MA 1X2QA 1K9MC 1ZUUA 3QHSA 5HK0A 3G33B 3CCLA 1U3OA 5GANh 1GFDA 1H28B 1V29B 1K76A 1U5SA 3QYEA 2D9TA 1UFFA 2QQ9A 3A5ZB 1PHTA 3BG9A 2MOXA 2WPAB 5KYWB 3RBBB 1YJWQ 4M78E 4EOSB 2CKKA 3BG5A 2CUBA 4BE2A 1ZSZB 5HBHB 5CEIB 4DBRA 4VUBA 5LJ5f 2RI3A 5KE2A 3G71T 2WXVB 4J6YA 1P92A 5GAMj 1ZQ1A 3H4CA 1OKVB 1MNEA 3G1JA 2CSQA 4M75C 4ZN1A 2DL5A 3CD6T 3OQ5A 2GGRA 4B6MA 1VQMT 1M3BA 1WHJA 2LCSA 4KRCB 2L3QA 5A0LA 4R0KA 4UN0A 1LVKA 3UF4A 1C6VX 1AWOA 3HP9A 1XTDA 1RACB 4DBFA 4V2SA 1MNDA 1JSUB 3G6ET 2DVJA 3M4YA 4F7UB 1ZUKA 1YBYA 3MEWA 4C5HA 4JRIA 5CKHA 4PJLA 2YT6A 3S3OA 1BI3A 3Q1JA 3JCMg 2BS3A 1YN8A 1ZA1B 2P0QA 5D7UA 5LJ3d 1E7OA 5A2QE 3MY5B 2A37A 3O8VA 3BHUB 4PJMA 3G71A 1Y7XA 2I0NA 1N27A 2KAFA 1HJDA 2IVXA 2HD0A 1FMWA 3FJ5A 4PFPA 3WXMB 2OTJT 1Z9ZA 2CP3A 3CD6A 1VQNQ 4AFUC 3DB4A 5C6SA 3RDVA 3EGDB 4F7UA 4C0ZA 2DFUA 2DXBA 4XTXA 1VQMA 2ECZA 4OMOA 4Z88A 4BBRM 3CCUQ 5ICPB 4AFSC 3M54A 1OZ2A 5A0DA 2EYWA 2V1RA 1K8AC 4M75G 4KGZB 2JNGA 5IH2A 3G6EA 4DQ2A 1QVPA 2RJFA 1JJ2P 4M7AC 3BLQB 2BE9B 2YRDA 2HMAA 3GIBA 4FYXB 3JB9D 2JT4A 2B9RA 1M1GA 2K3BA 3GOXA 2MF2A 1UTIA 1BI0A 4FYVB 1OIUB 4E7ZA 4IUPA 5GANj 2ZAEA 3QZ9B 1K8AR 3MO8A 4M6VA 4MFEA 4L6V5 2DNUA 5I11A 5CKBA 1OX8A 4C92D 1VQ7Q 2NWMA 2OTJA 3JCMf 4AKHA 4OP0A 4RG2A 4ATOA 3HZJA 2KRSA 3X26B 4C5IA 2KRNA 3P8BB 4PJOA 3EG0A 1OEBA 4OMFB 1SG5A 4A54A 1K73R 4EOJB 2QGFB 1WHHA 4AG1C 2C6TB 2Y90A 1YJNT 3EOCB 4M77D 5LJ3h 1YITT 1VQ6Q 2YHTA 1BCMA 5L23A 2J6FA 2PK2A 3SEMA 3F70A 3J80E 4PJOE 4C0DB 3GBQA 4HCCA 1WGSA 2QYZA 5IHNA 2YWWA 2LTOA 2C0TA 3UWNA 3KBGA 4JJCA 2XD0A 1ZSZC 3INZA 1KC8U 2WHBB 2JW4A 2P4RA 3CCSQ 1FMKA 2JN0A 2M51A 3J81E 2DYIA 1C1AA 2PVDB 3UDCA 2C06A 2HBWA 3GF5A 4M7AG 4A4HA 1G3TA 1H92A 2EGCA 3V8LA 1YI2T 4F14A 4ZNXA 5GAMg 2GCXA 3V8JA 3VKIA 3N5BB 1QVGP 4GLKA 2OTLQ 4BCMD 1W98B 3PIOA 2KK4A 1KJWA 4MMLA 5KCHA 3C12A 3JCMc 2HQEA 1Y96B 1W2BS 3E1SA 3RKYA 4GY5A 2O31A 2IW9B 1X27A 2LCLA 3CC7T 3CCVA 3QDRB 4PK4A 1X43A 4CC7A 5FLXE 4N4GA 3OYKA 1KIKA 1PC0A 2MMPA 1YJNA 2RQWA 4F7JB 3QUIA 4JZ3A 3OYBA 1YITA 5J39A 3CMAT 5GAOq 2WIPB 4KRTA 4XU2A 2EBPA 4D6WA 3PGGA 1Y07A 2XHCA 4M77F 3EG3A 1YWPA 1WHLA 2C5NB 1H1RB 2B8AA 1OYXA 3T9NA 4EOKB 2LJ1A 3L1AA 4A53A 3M4GA 2PUKB 3KUFA 2F2VA 1X6BA 2EGEA 4C92E 3ME9A 3R6OA 5LQFB 4A63B 2CGHA 2XDBA 1M2VA 1W2BP 5CKDA 4M7DB 1XJWB 3DB3A 1Y96A 2CREA 2PVGB 3KFVA 3UA6A 1YI2A 4XTVA 3JRZA 3MY1B 3VUBA 4FYWB 2JS2A 3JAME 3BLHB 8ATCB 1TS9A 4XTWA 4C8QD 1EIFA 2GQVA 3VJPA 3QG1A 2L3SA 1BU2A 3MP8A 3V8KA 2ZPHB 4PJNA 1IZ6A 5I21A 3CC7A 2JZ2A 1I4K1 2EYXA 2HQXA 4DBQA 1NJIC 1R0CB 2MWPA 5GAMf 4RTVA 3CMAA 5EG2A 4EMHA 4XK8E 2E4HA 4ZN3A 4KRDB 1TXQA 2QF7A 4Y92A 3TU4K 2VV5A 4F7UG 3VRZA 5GJVB 1TD6A 2M0OA 2LCCA 2C5XB 2E1HA 3EGXA 4UC4A 3H8ZA 4BCFB 1AWWA 5GANg 2MAMA 2KVQG 4ROEA 3EG9B 2EYQA 4F17A 5LJ3j 5GAN4 4BCGB 3L2QA 5IHKA 4HL4A 4C5GA 2RB6A 4LD6A 2EFIA 4OMLA 4XAXB 2KYMA 3RIRA 2EKOA 3VYHB 4ORZA 1M1KU 2RK1A 3FIFA 2QGSA 4FL6A 1X01A 1K9MU 3OYIA 1JXMA 3OA6A 1KSWA 3QZ5B 2FRYA 3M0UA 1RLPC 4C8QF 4CFUB 4X9DA 4FCYA 2JMCA 4BBSM 2MCNA 4ELZC 3CCRQ 2X4JA 2YRCA 3M58A 4IMYB 2DF6A 1OPKA 4C0DC 1Q86U 2HAXA 3V7CA 5HQ0B 3AT1B 1GH6B 5CCAA 1TFBA 2EWNA 4JRQA 2A36A 2VYTA 5IT9E 4OMQA 3L2RA 2DIGA 1CKBA 4NL3A 4CFNB 5CR2A 3G4SQ 3EG9A 3LYIA 3L2VA 3M0QA 1VQOQ 4PJOG 3REBB 3CCJQ 6AT1B 2KT1A 1D0XA 3BFMA 4HT8A 2RA2A 1YIJT 4RTUA 4BY7X 1WJQA 2FPEA 3SWNB 1GUXB 3H0FA 1U8RA 3I55T 2HL5C 3R6NA 5D6YA 2DIQA 3HRUA 4I3ZB 1JOWA 3JB9J 2L3RA 5ECAA 1VUBA 3HFOA 3X28B 2OJ2A 1KQ2A 2DKGA 1XNIA 4F7SB 4FSSA 3TNWB 1KHCA 2OI3A 2CDTA 2QQRA 3PMTA 2QA4Q 4MFDA 4QKUA 4DBHA 2DE0X 2DTHA 5GANf 1WHGA 2K4YA 4MMKA 1W2BA 2O2OA 3C4SA 5CK9A 4R56A 2DETA 4BCIB 2OAWA 3MHXA 1TOVA 1SSHA 2WMBB 4ELYC 5CAIA 2RH2A 1PNJA 4J7FA 1SRLA 1AEYA 2JOYA 1R0BG 2VXFA 4XTUA 2EQMA 2V8IA 4J9HA 5DLOA 1IGUA 1RAAB 2J05A 1FWZA 1VQ4Q 1IXDA 1TWBA 2BE7D 1KK7A 1LCKA 4M7DC 2RD1A 1NG2A 4IUUA 1VQLQ 2X3XD 3CMET 3JCMW 1YIJA 1TSFA 3NHNA 3I55A 3P8HA 2SEMA 4HNUA 5BNJB 2CT4A 2FEIA 4RMOA 2X35A 5KYUB 2ROLA 1T3SA 7AT1B 5LJ5e 4NC6A 2O88A 2DL4A 1ZHIA 1KFZA 4KUIA 1T0HA 2E6NA 2FL7A 1GL5A 2DM1A 1NYGA 2X4WA 4EC9B 3O0GD 4BI4A 1G8XA 1ZBJA 3CBPA 5LMKB 2DD4B 4OB3B 4M78D 4X1VA 2JXBA 4KGXB 2LQKA 5D6WA 2MK5A 2LDMA 2KYBA 4M7DE 1NLPC 2Y4YA 4JJBA 1PM3A 4BE0A 1N8RC 3WVEB 3BW1A 4BY6B 1MV3A 3OMCA 2FZCB 4XTYA 3BDLA 4EOPB 2VUBA 2F2XA 3DDPB 2RHUA 4FX3B 4YOSA 5LJ5g 1B7TA 1FINB 3MI9B 2F69A 3CMEA 2BUDA 2ENMA 1U1SA 5GMKl 1H1QB 4B9WA 3VRYA 2VVKA 4RCCA 4QW2A 5FGKB 3RKXA 3OYMA 4AI6A 3CCQQ 1PG5B 2BKDN 4ELJA 5HBJB 3E2UA 4LE9A 4QVCA 3K7AM 2E12A 2FB7A 5HVYB 3EFOA 2W9FA 3QYHB 1T0JA 3OW2S 2A08A 5GMKe 4F6UB 2FZKB 1NLOC 2LVMA 2M0YA 4LN2A 3JCMP 3QWLA 2JM8A 2YUOA 2L3PA 3A98A 1M1KC 4M78F 2X4XA 3EG2A 2AIRB 2A3LA 2BZXA 3A1PA 4AFQC 1OOTA 3SWNC 2M9UA 1YJWA 4A4EA 3CEYA 4YC3B 2AKLA 2KY9A 2IIMA 4FW2A 4AFZC 3V7RA 3KHIA 1ZLMA 1Q86C 3OSVA 2RI2A 3LH5A 4HVVA 1M1KR 1PD1A 1QCOA 2LJ0A 1QKXA 4D8DA 1JEGA 3QHRB 1VQ8Q 5FU7B 4M4ZA 1K9MR 1ZSGA 1VQNT 1YFNA 1VYUA 2KMTA 3SFMA 5GAOp 5LJ3f 1BIBA 3QDFA 3JCMe 3CCUT 2KR6A 1E6GA 2ZPBB 1O9SA 4BXXX 1Q86R 1U06A 3VS3A 1BK2A 3OS1A 3AHUA 1H3HA 3S3NA 2QQAA 2I53A 1QP3A 5HKCA 4OGEA 1A0NB 3X25B 1Y57A 1K1ZA 5J26A 1LJOA 1RAGB 3VS6A 1RLQC 1TUDA 3HHTB 1QWFA 1TUGB 1SHGA 1JO8A 5GAN7 2A0FB 4BACA 4E7SA 2PVOB 2DXBB 2E5QA 2FPDA 1G83A 3M59A 4OB1B 3ZFJA 2EKHA 1WQWA 2DXUA 1VQKQ 2QDYB 1WXUA 4IIOA 4M7AD 1FX7A 1PWTA 4HT9A 2D8HA 4KGVB 1H24B 1NYFA 3OYNA 2DTOA 1I0CA 1VQ7T 1ACMB 2K3XA 2EQUA 3NPFA 3LGLA 2QQ8A 1VQNA 2DERA 4M75E 4KH1B 4MZMA 2R5AA 1C9BA 1NJIU 2DYBA 3CCUA 3TW7A 2E41A 1YCYA 2EJGA 1G5VA 1URCB 1VQ6T 2YXYA 4CI0C 3CCEQ 3C94A 1XOVA 2NLUA 3CXCA 2LT4A 3EG1A 2G77A 2W96A 1QMCA 4BY6C 2M1HA 2VASA 3VS7A 4JZ4A 3E9GA 1O9KA 1D1CA 5DQWA 3RMSA 3EH2A 2ZPFB 2DA9A 1B07A 3CCST 5IF1B 2RQTA 4PLLA 3U23A 1GCPA 4IUQA 4PJOB 3MCAB 4PLIA 2V22B 2WSEE 2KNBB 3M0TA 4O6JA 1KG1A 4G6LB 4PL6A 4J6XA 1NEGA 2OTLT 4M77A 1H8KA 2R7GA 1P5EB 1WI7A 3ER0A 1KXUA 2QGGA 1VQ7A 2QDJA 2ZCFB 4II1A 2PZ1A 5DM7R 2EYZA 3OB9A 5EC7A 3M55A 2FZGB 4J9IA 4FW1A 5DY9A 1W4SA 1OI1A 2AT1B 5FU6B 1WJSA 4ANJA 1FKMA 1WIEA 3LH0A 1VA7A 1S72Q 1VQ6A 1Q82C 2K7AA 4JS4A 3QSUA 4A4GA 1JBMA 2A7YA 1LOJA 1IRXA 3MJXA 3I5RA 1E9HB 3HFNA 1I5LA 2K5LA 3OW2A 3IQLA 2YDLA 3ULRB 5GAMe 2EIFA 4M7AE 1SEMA 2KI7A 4EC8B 1WHMA 2QK0A 3CCSA 1RABB 2H8HA 3HL8A 2ZZDA 4BCPB 2PUOB 3NMZC 1PSFA 4IURA 3V7SA 2JJ9A 4HKEA 4NL2A 1VIEA 2RO0A 5FU7C 4EMKA 2LJ3A 4C8QB 3CCMT 4CC3A 5L8RE 5CO7A 2OTLA 1GCQA 2P4TA 4HLQA 1IGQA 4JRPA 3NDQA 3E19A 1JXOA 3EIDB 2CS7A 3RESA 3JB9F 3NGPA 2UZBB 2QEXQ 2DLPA 5I2SA 3TREA 2FPFA 3URGA 4EONB 2JTMA 5GAOl 2DVEA 1N6AA 1VQPQ 4F7NB 4Z02A 4EOIB 4FSXA 1M2VB 1R77A 1RAIB 2KMGA 1AWXA 1ZA2B 2VKNA 1TH7A 2RF0A 1IHVA 1M3CA 1H4LD 4LOCA 4C92F 4J6WA 1G3NC 3JB9H 3HO8A 4MIMA 4BDZA 1X6GA 2J7IA 4F70B 1UNHD 2WMAB 4C8QA 3JCMd 4FM4B 3ASKA 5C0MA 2DXTA 1QVFA 4ME7A 4BCQD 1PRMC 4HNTA 1B34A 3H41A 4WTOB 2D6FA 1VOLA 3HRSA 3QKJA 1JB0E 1CSKA 2QFZA 4JRKA 5AT1B 3RR6A 1BCOA 3QPHA 3MKDA 2NYSA 4E7LA 3H6ZA 5AYFA 4CFMB 4NSTB 3CCRT 3EGXB 2BZ8A 1QMZB 4J9FA 3CCMQ 4OMMA 2XU8A 4F7UE 4QQ6A 2UUEB 5GANe 5KYYA 4CRLB 2F5KA 2GTOA 2NUPA 4X34A 3CPWA 5GMKh 1N8RU 2DRKA 4LXCA 3G4ST 3QXEB 1RL2A 4LNPA 5EFQB 1VQOT 1MGQA 3CCJT 3LX7A 4GLMA 4PJOC 3VU3C 4DA4A 4LDXA 3GLXA 1M8MA 1Q81C 4HA8A 3F5XB 5GAN6 2FG0A 2DJQA 1MUZA 1AVZC 1BI1A 2GBQA 8AT1B 4Y91A 2G6FX 1KQSS 4RTYA 3B57A 3RMQA 2RMOA 3J7AF 1OGUB 4QSHA 3HRTA 4BI3A 3OS5A 5GAOr 3FEOA 1QQJA 1FVVB 5FWBA 5FU6C 3CC4Q 2QA4T 3RERA 2CJMB 4KH0B 1NJIR 1M3AA 3THKA 3M56A 3JCMh 3CCRA 3A8OB 2G9XB 1ZP2A 1UECA 2CP0A 2EW3A 3FRNA 2R5MA 4M77G 1WNLA 2DBKA 4MZTA 4AT1B 1NM7A 2CP5A 2KEAA 2HL3A 2IN3A 3A8HB 1I1JA 3G4SA 1VQ4T 2HBPA 2DD5A 1VQOA 1KQSP 1QP2A 3CCJA 3S6WA 3VKHA 4LDYA 2K5FA 2VXEA 4O5VA 1VQLT 4N0AA 4E2FB 4CFWB 2RN8A 2YLBA 4BB7A 1JU5C 1Q95G 1I81A 2V8KA 2W10A 2DZCA 2HZYA 2FO0A 1TUCA 1VQ5Q 2QTVA 4C0GA 2RJDA 1MMDA 3CC2Q 2UZDB 4RTTA 1XQHA 2QDLA 3PVLA 2AZSA 5ACBA 2E10A 1H3ZA 2JTFA 4JLGA 3X24B 1D3UB 3HPWA 4FT4A 3LW5E 4M7DD 3H0HA 1RAFB 4TVRA 2QA4A 2D0QB 2ED0A 2MWOA 4M78B 3DDQB 1UGSB 3CBMA 3TNHB 3DOGB 1J3TA 2FYKA 2YLCA 2K5IA 3OYEA 3X20B 2HQHA 4XU1A 3JCMb 2DBMA 1VOMA 2RQRA 2L8DA 2DXCB 2LP5A 2QAZA 3SD4A 2QASA 4J83A 2CZ0B 3VS5A 4BCKB 4EDUA 1VQ4A 3GTMS 1OPLA 4EMGA 3GNFB 4OGCA 2LC4A 3TN8B 1AT1B 2L2PA 1VQLA 3VYGB 3L2WA 4YTLA 1OU8A 5KYXA 4BCJB 2J06A 4ZGJB 1UE9A 2LNHB 1SF9A 4HNVA 4BCNB 2F5TX 4M78A 4OB2B 4EOQB 2EPDA 1K0SA 3NTKA 4PJJA 4OF1A 3CCQT 2CP2A 4C8QG 2PJQA 3MIAB 3RNJA 3OMGA 2DXCA 1SSFA 1TG0A 4QQGA 4IUTA 4M7DF 1UEBA 1FYNA 2DILA 1PRLC 2JM9A 1SHFA 2JGZB 1X69A 4CFUD 4RTXA 2E3HA 3VYGA 3VUZA 1QLBA 1RADB 2O9VA 2RQVA 2HDAA 2K57A 3CXCS 4WF2A 2EJFA 4ZGDB 2XICA 5HK3A 2UZLB 2CZ6B 1BI2A 3PNWC 3ZBDA 1R8OB 3NTHA 4LDWA 1V76A 3LWHA 2V8JA 4N0AC 3EFSA 2AZVA 3QYBA 3EFOB 3DL1A 4IUVA 2CZ1B 3NFCA 5IHIA 2YUNA 3G7ZA 2DX1A 1UB4A 2CCHB 4MDWA 3OYLA 3EH1A 1UGPB 1VQ8T 2X9HA 3VKGA 1KQSA 1OX9A 3H9NA 3CCQA 5LJ3g 4ZGEB 2YUQA 2LNVA 4BUGA 3EHQA 1BIAA 2GTJA 1BKBA 3VS0A 1Q82U 3PMIA 2LQ8A 4J9BA 2DPPB 4CFVB 4Z6YA 5GAN2 3CXCP 2OAUA 1UNGD 3DLMA 1N8RR 1IHWA 3A8MB 2DTIA 1D09B 3GP8A 1GY3B 2EYYA 3TEEA 1G2BA 1M30A 3RGFB 5IDPB 2MI6A 1ABOA 1RAEB 1NPRA 2J6OA 1WJRA 1CKAA 1LNXA 1PSEA 5CQXA 1ZX6A 9ATCB 3A8GB 2M02A 1QCFA 1AOJA 2YSQA 4D8KA 1K0XA 2FHDA 3I56Q 1WHKA 2OX7A 2C4GB 4M75D 1VQKT 2O01E 1FMVA 1Q7YC 1ABQA 3DLLA 4DOWA 1U1TA 1M8VA 4J9GA 2DEQA 2JMAA 2KR3A 3L2UA 4E7HA 1VQ8A 1NEBA 1RAHB 1G3YA 3E9FA 4JDSA 4HVUA 3BG3A 4OMPA 2RM4A 3JCMX 1WZOA 4JX5A 1MMGA 3JSCA 2W9ZA 2XI9A 2KDSA 2RPNA 2L89A 2CH4A 4PFOA 3CCET 3OYYA 1SKUB 1Q7YR 2C0IA 4GBQA 3PVQA 1H641 1ENWA 2KBTA 2W0ZA 4NOYA 3OW2P 2UZEB 3HB9A 1AD5A 5CYIB 4M7AA 1KD1U 1OZ3A 3FC3A 3SB2A 3OBWA 5GJWB 1PKSA 2X3WD 2ROTA 5HY6A 1YJ9Q 2COYA 3OS0A 3POMA 4CXAB 2EQIA 1ARKA 2KRMA 1VQ9Q 2HSEB 2R58A 1D0YA 3CCLQ 3C0CA 3JB9I 1VQKA 3PT9A 2ESWA 3UA7A 3TNIB 1IREB 2BIVA 1RUWA 1H27B 4LDUA 4WCIA 4M75F 1BU1A 3ZEHA 1UGQB 2MYSA 1AISB 2P0PA 3OY9A 1QVFS 2W2HA 5FWCA 1NBEB 1O9KB 5IXBA 1PCXA 4CC2A 3UATA 3OYJA 2D8JA 5EJCA 4C92B 1M1FA 2E3IA 2VC8A 1OKWB 4ZTJA 2K6DA 2XKOC 1S72T 1WPYA 4E7IA 2CP7A 3CCEA 3M53A 3H0IA 1OQKA 1N9RA 4M78G 1N9SA 4RG8A 1YP5A 4F6SB 2DL8A 4F04B 2PK9B 1W6XA 3OYDA 4M77B 2MPXC 5KYWA 3CPFA 4HXJA 1Q81U 2ZGWA 1QCNA 1K4US 1HSQA 2RJEA 2VB6A 4N4HA 3DJBA 3CPWS 5A0GA 2LW4A 1QLYA 1ZSZA 4JUVA 1JQQA 3LQ5B 2IPOB 1B3QA 1QVFP 2DK3A 3GNGA 1PKDB 4P5NA 2DMEA 2RHZA 4RKUE 4OVAA 3QO3A 1EFNA 5LJ5d 3QBYA 1JJ2S 4KULA
chains in the Genus database with same CATH topology
4M7AB 4ME7A 3OYGA 2LRQA 2RA2A 4C92A 3MEAA 1YIJT 2L5QA 2O4XA 1WJQA 3SWNB 4HNTA 1B34A 4E7KA 4M7DG 4HCBA 2D6FA 1U8RA 3I55T 3HRSA 2DD4A 3QKJA 2ZPGB 4E47A 1JB0E 5D6YA 2QFZA 3P8DA 5KH6A 1DJ7B 2DIQA 4R55A 3HRUA 4JRKA 2QEXT 3JB9J 2L3RA 4XU0A 1VUBA 2QTXA 3HFOA 5GAOm 3X28B 5LL6S 3QPHA 3OYHA 2CYZB 2ZPEB 2RHYA 1KQ2A 2DKGA 1XNIA 4Q5WA 4M78C 4E7LA 3H6ZA 5AYFA 2RJCA 2EQKA 2ZZDB 4JX6A 1HXDA 1VQPT 1M4ZA 1S72A 3CCRT 1KHCA 2QQRA 4HCZA 2RI5A 3PMTA 4N4IA 4MFDA 4M7AF 4J8OA 2DTHA 3MP6A 2EJ9A 3BDUA 2VGNA 5GANf 2XU8A 4F7UE 4QQ6A 2K4YA 4EMKB 4PNOA 1YJ9A 4MMKA 5GANe 4MDXA 1W2BA 2F5KA 4A4KA 3C4SA 1I8FA 4X34A 4CRIA 5CK9A 5GMKh 4R56A 3CPWA 1N8RU 1VQ9A 1K9MC 3QHSA 3BY7A 5HK0A 1QW1A 3CCLA 1YHQT 3G4ST 3QYGB 3QXEB 1RL2A 5GANh 3MHXA 1VQOT 1M90U 1MGQA 4ELYC 2RH2A 5CAIA 3LX7A 3CCJT 2XDDA 3VU3C 4PJOC 4J7FA 1V29B 3C95A 2WACA 4DA4A 2JOYA 2VXFA 3QYEA 4XTUA 4LDXA 2EQMA 2V8IA 3GLXA 5DLOA 5IAYA 1NE8A 1Q81C 5CVIA 1FWZA 4HA8A 1K73C 2D9TA 5GAN6 2QQ9A 3A5ZB 3BG9A 2KSSA 4M7DC 2RD1A 1BI1A 4IUUA 2PU9B 3JCMQ 4Y91A 2WJ9A 3CMET 3JCMW 1YIJA 1KQSS 2K2VA 4M78E 3RMQA 2CKKA 3MEUA 3BG5A 4BE2A 3J7AF 4QSHA 3I55A 3HRTA 1RI0A 4BI3A 3OS5A 3P8HA 5GAOr 4HNUA 3FEOA 4RMOA 2X35A 4VUBA 5LJ5f 2RI3A 3L42A 5KE2A 5FU6C 3G71T 2QEXA 4HT8A 5GMKi 2QA4T 4J6YA 4NC6A 5LJ5e 3QIIA 1P92A 2DO3A 2QXFA 3RERA 4XU3A 5GAMj 1ZQ1A 3H4CA 1ZHIA 3CCVT 1VQPA 4KUIA 1QVGS 4M75C 2E6NA 3M56A 2RHXA 4QVZA 3JCMh 3CCRA 3A8OB 2FL7A 5LJ5h 4ZN1A 3CD6T 3OQ5A 4KBMB 2X4WA 4PJOE 3FRNA 4MZTA 1NPPA 2R5MA 4M77G 1WNLA 4BI4A 1VQMT 4M7AA 1B34B 3CBPA 4M78D 2DD4B 4OB3B 5A0LA 3A8HB 2LQKA 4JJNK 3HP9A 1XTDA 3G4SA 1YHQA 5D6WA 4V2SA 2LDMA 1KQ1A 4MZPA 2HBPA 2DD5A 1VQ4T 1VQOA 4EPCA 4M7DE 3G6ET 1QP2A 3EAEA 3M4YA 4F7UB 3CCJA 2Y4YA 2WSFE 1YBYA 3VKHA 3S6WA 4LDYA 2K5FA 4BE0A 2VXEA 3WVEB 3BW1A 4O5VA 4BY6B 1N8RC 3OMCA 1VQLT 4N0AA 3MEWA 4XTYA 4C5HA 3BDLA 2YLBA 4BB7A 4JRIA 5CKHA 2VUBA 1I81A 2V8KA 2DZCA 3S3OA 1BI3A 2XIDA 3Q1JA 3JCMg 2RHUA 2BS3A 5LJ5g 1KD1C 4FT2A 4PJOD 2EQJA 4C0GA 2F69A 2RJDA 3CMEA 2P0QA 2BUDA 4C92C 3MP1A 3CC4T 1XQHA 4BD3A 5LJ3d 5A2QE 1U1SA 5GMKl 2E10A 5FRNA 2JTFA 3O8VA 4JLGA 1H3ZA 3X24B 3HPWA 4FT4A 4F7UF 4B9WA 3LW5E 5CKFA 4M7DD 3DKMA 1Y7XA 4RCCA 4TVRA 3G71A 1N27A 2KAFA 4QW2A 2HD0A 2QA4A 3RKXA 2D0QB 3OYMA 4AI6A 2MWOA 2QQSA 4M78B 1VIFA 2BKDN 3CCMA 3A8LB 4ELJA 3WXMB 3HKSA 1UGSB 3CBMA 2OTJT 4M77C 2FYKA 2YLCA 2K5IA 4QVCA 2E12A 3OYEA 4OB0B 3X20B 2FB7A 3MEVA 3CD6A 3EFRA 4XU1A 1G3SA 3JCMb 3DB4A 5C6SA 3QYHB 4F7UA 4C0ZA 2DXBA 4XTXA 5D6XA 1VQMA 3CBOA 2L8DA 2DXCB 3SD4A 3OW2S 4BBRM 4J83A 2CZ0B 5GMKe 2ZPIB 2LVMA 1OZ2A 3M54A 5A0DA 3QWLA 3JCMP 4EDUA 2XK0A 5FROA 4KUDK 1Y71A 1K8AC 1VQ4A 4M75G 2JNGA 1M1KC 4EMGA 3G6EA 3GNFB 4DQ2A 4M78F 3RKWA 4OGCA 4AKGA 2X4XA 2LC4A 2LX9A 1QVPA 3HBLA 2RJFA 1VQ5T 4M7AC 2DZ9A 2A3LA 1VQLA 3VYGB 1KHIA 3GIBA 4QQDA 3CC2T 3SWNC 2XDPA 2M9UA 4YTLA 3L2WA 4A4EA 4JS5A 5GMKm 1YJWA 3CEYA 4ZGJB 3JB9D 2KY9A 1M1GA 4HNVA 1D3BB 3GOXA 2XG8D 4KT0E 1JJ2A 2MF2A 3JB9G 3V7RA 4C0FA 1X6OA 2F5TX 3KHIA 1BI0A 4M78A 1Q86C 4OB2B 3S3MA 3CC4A 3OSVA 4IUPA 5GANj 2RI2A 3NTKA 3QZ9B 4M77E 4OF1A 2DD5B 3CCQT 3MO8A 4PJOF 3OYFA 2KQWA 4C8QG 4M6VA 4MFEA 2QI2A 5FU7B 2P0KA 4L6V5 5KCOA 1VQNT 5CKBA 2PQWA 4EMKC 2RK2A 3OMGA 4C92D 2DXCA 1SSFA 4QQGA 2KMTA 4IUTA 2OTJA 3JCMf 4C92G 4AKHA 4M7DF 2Y4XA 3SFMA 4OP0A 4RG2A 1UEBA 3HZJA 1BIBA 5LJ3f 3JCMe 5GAOp 3CCUT 4ATOA 3X26B 2RHIA 2KR6A 3FB9A 4C5IA 4PJOA 2ZPBB 3P8BB 1O9SA 4FU6A 3JCMV 4OMFB 4A54A 3OS1A 5DLQE 3AHUA 3S3NA 3NTIA 2Y90A 3VYGA 2QQAA 3VUZA 4M77D 5LJ3h 4L59A 1QLBA 3PTAA 1YITT 1YJNT 2EAYA 2YHTA 1UGRB 1HK9A 1QP3A 2K57A 5HKCA 4OGEA 4WF2A 3X25B 5J3BA 3CXCS 1Q7YU 1ZBXA 4ZGDB 2EJFA 5J26A 1LJOA 4M7DA 1D3BA 2XICA 5HK3A 2CZ7B 4JLIA 2CZ6B 1BI2A 3F70A 3PNWC 3J80E 3ZBDA 1R8OB 3NTHA 4LDWA 1VQ5A 4C0DB 3HHTB 3LWHA 5LJ5j 4X9CA 1WGSA 4HCCA 2V8JA 1M9SA 3EFSA 4N0AC 2LTOA 3CC2A 3UWNA 3QYBA 3KBGA 4DOVA 5GAN7 2XD0A 4E7JA 4BACA 3DL1A 2BS2A 2PVOB 4IUVA 2DXBB 2E5QA 3UT1A 2CZ1B 3NFCA 3QSUA 1O75A 3M59A 4OB1B 4LD9K 3INZA 3ZFJA 2HNIA 3G7ZA 1KC8U 1WQWA 1UB4A 2DXUA 1GXIE 3OYLA 4MDWA 5GAN8 2QDYB 2DJZA 2JN0A 3J81E 4M7AD 1UGPB 1FX7A 4C8QC 1VQ8T 2PVDB 3UDCA 3KXTA 2C06A 4HT9A 3GF5A 3OYNA 4M7AG 3VKGA 1KQSA 4A4HA 2DTOA 1G3TA 1KD1U 3OYCA 3V8LA 3CCQA 1M90C 1VQ7T 3LLRA 2K3XA 1YI2T 5LJ3g 4ZGEB 2EQUA 5GAMg 2LNVA 3GPLA 3QJYA 4BUGA 2GCXA 1BIAA 3OSSC 3LGLA 2QQ8A 3M9QA 3N5BB 4GLKA 3TCJA 3V8JA 3VKIA 1BKBA 1Q82U 3PMIA 3PIOA 1VQNA 2KK4A 2LQ8A 4BI8B 4M75E 3RUXA 2DPPB 2E65A 4MMLA 5GAMd 5KCHA 4MZMA 4Z6YA 3C12A 5GAN2 3JCMc 1WQ7A 2OAUA 2HQEA 2R5AA 5I2MA 1NJIU 1Y96B 3DLMA 1W2BS 3E1SA 3CCUA 3TW7A 2WSCE 2E41A 4GY5A 3RKYA 1YCYA 2EJGA 3OBYA 4B9XA 5IN1A 1QVGA 1VQ6T 1G5VA 3A8MB 2DTIA 1JRIA 2LCLA 4CI0C 4NS5A 3CC7T 2E64A 3C94A 3GP8A 1XOVA 2NLUA 3META 3TEEA 3QDRB 3CXCA 3CCVA 2LT4A 2MI6A 2G77A 4N4GA 4BY6C 5FLXE 3OYKA 2M1HA 1NPRA 2MMPA 1YJNA 1WJRA 3OYBA 3QUIA 1YITA 3E9GA 1LNXA 2DAQA 1PSEA 5J39A 3CMAT 5GAOq 5CQXA 4XU2A 3RMSA 4D6WA 3A8GB 3PGGA 2I2LA 2ZPFB 2BS4A 1Y07A 2E70A 2XHCA 1X75C 4M77F 5M9OA 4C8QE 2FHDA 2YRVA 4M75D 3CCST 1VQKT 2O01E 4PLLA 2B8AA 1OYXA 3T9NA 4C5EA 1Q7YC 4IUQA 4PJOB 3L1AA 4A53A 2VGMA 3MCAB 4PLIA 3M4GA 4DOWA 2PUKB 3KUFA 1U1TA 3DLLA 3HSBA 4BDYA 5CQYA 2DEQA 2WSEE 5KE3A 4C92E 3ME9A 1M8VA 2R57A 1MHNA 4O6JA 3R6OA 1KG1A 3L2UA 4PL6A 4J6XA 4E7HA 1VQ8A 2CGHA 3UPUA 2OTLT 4IKFA 2IG0A 2XDBA 1G3YA 3E9FA 4JDSA 4M77A 5CKDA 4PKCC 3ER0A 1VQ7A 4M7DB 3DB3A 5GAOn 1Y96A 3BG3A 2PVGB 1YI2A 5GMKj 5CIUA 2RM4A 4XTZA 4XTVA 3JRZA 3PFSA 3JCMX 1KC8C 4JX5A 3JSCA 3VUBA 2XI9A 2QDJA 2ZCFB 2KDSA 4II1A 3JAME 5DM7R 2L89A 3OB9A 4XTWA 3M55A 4C8QD 2GFAA 2K3YA 1EIFA 2GQVA 3VJPA 3CCET 5DY9A 1G3WA 1W4SA 3OYYA 3QG1A 1OI1A 1H641 5FU6B 1WJSA 3MP8A 1FKMA 4NOYA 3LH0A 1VQ6A 4A4FA 1Q82C 3V8KA 2ZPHB 1AHJB 3HB9A 4JS4A 1IZ6A 2E6ZA 1OZ3A 5I21A 2JZ2A 3FC3A 3CC7A 3SB2A 3OBWA 3FLGA 1I4K1 4M75B 4A4GA 3OS2A 2HQXA 1JBMA 4ZTFA 2A7YA 3FJPA 1LOJA 3SWNA 3JCMJ 1NJIC 5HY6A 2MWPA 3OS0A 3I56T 3HFNA 5GAMf 1I5LA 2K5LA 3OW2A 5LJ3e 3CMAA 5EG2A 5GAMe 2FVUA 4EMHA 4XK8E 2EIFA 2R58A 4LDVA 4M7AE 2H3JA 4ZN3A 3JB9I 2QF7A 3TU4K 2VV5A 2GF7A 3FDRA 4F7UG 5GAMh 3CCSA 1VQKA 3HL8A 2QQBA 2ZZDA 2M0OA 2LCCA 3PT9A 2PUOB 2E1HA 1PSFA 4XQ3A 4IURA 1IREB 4UC4A 3V7SA 3H8ZA 4HKEA 2BIVA 4NL2A 2JVVA 2X4YA 4J7IA 4LDUA 4M75F 1VIEA 5GANg 2MAMA 1E7PA 1UGQB 2KVQG 2RO0A 3ZEHA 5FU7C 3VV0A 4EMKA 2EYQA 2P0PA 4C8QB 4Y28E 5LJ3j 5GAN4 3M57A 3OY9A 5GAN5 3CCMT 5L8RE 2AHJB 3L2QA 5CO7A 1QVFS 2OTLA 4HL4A 4C5GA 2RB6A 5GANd 2P4TA 4HLQA 4JX4A 4LD6A 2EFIA 1M5Q1 3OYJA 2IVWA 4JRPA 4XAXB 5EJCA 3RIRA 2EKOA 3E19A 4C92B 3VYHB 4QVDA 1M1FA 1K8AU 4FIBA 2VC8A 3WVDB 1NZ9A 2GFUA 2O4XB 5CKEA 2RK1A 2XKOC 4ZTJA 1M1KU 2CS7A 1S72T 3RESA 1WPYA 3FIFA 4M75A 4E7IA 4FL6A 3JB9F 3LGFA 1X01A 3CCEA 3TW6A 3OYIA 1K9MU 3M53A 5I2SA 3OA6A 3L2ZA 3TREA 3URGA 3QZ5B 1N9RA 4M78G 5FRMA 1N9SA 2JTMA 3SDZA 4RG8A 5GAOl 3LWIA 2DVEA 1YJ9T 1N6AA 4L5GA 4C8QF 4X9DA 4Z02A 4BBSM 4ELZC 2G3RA 4RCBA 2JUFA 4FSXA 3OYDA 2X4JA 1VQ9T 4M77B 3M58A 3CPFA 1Q81U 2KMGA 2ZGWA 3CCLT 1TH7A 4C0DC 1Q86U 3V7CA 2HAXA 1BYMA 1K73U 2RJEA 4BE1A 4N4HA 3CPWS 3I56A 4LOCA 2LT1A 5A0GA 4J5YA 5CCAA 4C92F 1YJWT 2EWNA 4J6WA 2M16A 4JUVA 4JRQA 2VYTA 5IT9E 3L2RA 3JB9H 3HO8A 4MIMA 2DIGA 4BDZA 5GAN3 4NL3A 2DK3A 3GNGA 5CR2A 4P5NA 1FXXA 4C8QA 2RHZA 3LYIA 3L2VA 4RKUE 4OVAA 4FM4B 3QO3A 4PJOG 3JCMd 3PIPA 3OYAA 3ASKA 5C0MA 5LJ5d 3QBYA 3QJ6A 1JJ2S 3BFMA 3M5AA 4AKIA 4KULA 2DXTA 1QVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QP2 A;  2ZPB B;  2WSF E;  2ZCF B;  3WVE B;  3VYG A;  2DD4 A;  2ZPG B;  1JB0 E;  1UGR B;  1QP3 A;  1DJ7 B;  3X25 B;  4ZGD B;  3X28 B;  2CYZ B;  2CZ7 B;  2ZPE B;  2CZ6 B;  1AHJ B;  2ZPH B;  3HHT B;  2ZZD B;  3X24 B;  2PVO B;  3LW5 E;  2DXB B;  2CZ1 B;  4XK8 E;  4OB1 B;  1GXI E;  2D0Q B;  2QDY B;  1UGP B;  3A8L B;  2PVD B;  1UGS B;  3QYG B;  2ZZD A;  3QXE B;  4OB0 B;  3X20 B;  2PUO B;  1PSF A;  4ZGE B;  1IRE B;  3QYH B;  1V29 B;  2DXB A;  1UGQ B;  2DXC B;  4Y28 E;  5L8R E;  2AHJ B;  2DPP B;  2CZ0 B;  2ZPI B;  2WSC E;  3A8M B;  3VYH B;  2PU9 B;  3WVD B;  3VYG B;  4ZGJ B;  1PSE A;  3QZ5 B;  4KT0 E;  3A8G B;  2ZPF B;  4OB2 B;  3QZ9 B;  2O01 E;  2DD5 B;  3A8O B;  2PUK B;  2WSE E;  4L6V 5;  2DXC A;  4OB3 B;  2DD4 B;  4RKU E;  3A8H B;  4FM4 B;  2PVG B;  2DD5 A;  3X26 B; 
#chains in the Genus database with same CATH topology
 2BKZ B;  2BTT A;  3OYG A;  3VS4 A;  4C92 A;  1F1B B;  1N4M A;  2L5Q A;  4PFZ A;  4E7K A;  4HCB A;  1N5Z A;  2ZPG B;  4E47 A;  1SPK A;  3P8D A;  1EX4 A;  1DJ7 B;  2QEX T;  4XU0 A;  4BCM B;  2QTX A;  2YUP A;  5LL6 S;  4YOZ A;  3OYH A;  2CYZ B;  2RHY A;  4Q5W A;  1VQP T;  1S72 A;  2ZZD B;  2EQK A;  3CPW P;  1M4Z A;  4HCZ A;  3G71 Q;  2CSI A;  4N4I A;  2KGT A;  2NUT B;  4M7A F;  1UJY A;  4DEX A;  1W70 A;  3BDU A;  4EMK B;  2K9G A;  4YOO A;  1IO6 A;  4E6R A;  3I5S A;  1I8F A;  4CRI A;  4EOM B;  3CD6 Q;  2EUF A;  3BY7 A;  1QW1 A;  1D1A A;  1YHQ T;  3QYG B;  1GBR A;  5I5Z B;  1OV3 A;  1VQM Q;  1LPL A;  1VYT A;  1M90 U;  1OL2 B;  4BCQ B;  2XDD A;  2KE9 A;  3C95 A;  2WAC A;  5IHY A;  1D1B A;  3M0R A;  5IAY A;  1NE8 A;  3PO3 S;  1H1P B;  2K2M A;  5CVI A;  4RUG A;  1K73 C;  3G6E Q;  1UG1 A;  2V1Q A;  4F16 A;  2X51 A;  2KSS A;  2CUD A;  2PNI A;  2PU9 B;  3JCM Q;  1BBZ A;  3EGD A;  2K2V A;  3MEU A;  4RTW A;  1RI0 A;  2J6K A;  1YWO A;  2K79 A;  4BCO B;  2AKK A;  1Q82 R;  2NUT A;  3L42 A;  2QEX A;  5GMK i;  1S1N A;  3QII A;  1X2K A;  2DO3 A;  2QXF A;  4XU3 A;  2XMF A;  3TQ7 P;  3CCV T;  1VQP A;  4AG2 C;  1QVG S;  2RHX A;  4QVZ A;  2JS0 A;  5LJ5 h;  4F7L B;  4KBM B;  1NPP A;  1B34 B;  2OTJ Q;  2C5O B;  1PD0 A;  4JJN K;  2PHG A;  1HYO A;  2IW8 B;  1YHQ A;  4MZP A;  1KQ1 A;  4EPC A;  4JPB W;  3ZL7 C;  3EAE A;  1D0Z A;  2WSF E;  2C0O A;  2HCK A;  3BE3 A;  4CC4 B;  2JTE A;  2XID A;  1MMN A;  5KYY B;  1T3L A;  1KD1 C;  1W1F A;  4FT2 A;  2NUP B;  2EQJ A;  3I35 A;  4PJO D;  2KXD A;  2L0A A;  4II5 B;  1YHQ Q;  4C92 C;  3MP1 A;  3CC4 T;  2X1N B;  4BD3 A;  3QWX X;  1UNL D;  2CCI B;  5FRN A;  4LUD A;  4F7U F;  5CKF A;  3DKM A;  2HSP A;  3EHR A;  2QQS A;  1VIF A;  2EGA A;  3CCM A;  3A8L B;  3HKS A;  1UHC A;  2EVR A;  4M77 C;  2F2W A;  3D7S B;  4OB0 B;  4EIK A;  1KD1 R;  3MEV A;  4EOR B;  2SRC A;  3EFR A;  1G3S A;  5D6X A;  1GBQ A;  3CBO A;  1I07 A;  2DEU A;  3TSZ A;  1XO2 A;  2ZPI B;  4J9C A;  2XK0 A;  5FRO A;  1OU9 A;  4KUD K;  1Y71 A;  1QKW A;  5IDN B;  3CCV Q;  1WA7 A;  2VWF A;  3RKW A;  4AKG A;  2LX9 A;  1UGV A;  3M03 A;  3HBL A;  1YJN Q;  1VQ5 T;  1YIT Q;  2DZ9 A;  4FYY B;  2FRW A;  1KHI A;  4QQD A;  4DEY A;  3CC2 T;  2XDP A;  3REA B;  4JS5 A;  5GMK m;  2HKN A;  1D3B B;  2XG8 D;  1VYV A;  4KT0 E;  1JJ2 A;  3HTR A;  3JB9 G;  4C0F A;  1X6O A;  1WDX A;  4ROC A;  3S3M A;  3CC4 A;  4M77 E;  2WEV B;  2GQI A;  2HEQ A;  2DD5 B;  4JJD A;  4PJO F;  3OYF A;  2KQW A;  2W99 A;  2QI2 A;  5HNB B;  2P0K A;  2I40 B;  5KCO A;  1M27 C;  2PQW A;  4EMK C;  2RK2 A;  1AZE A;  1AD6 A;  1YI2 Q;  1E6H A;  1GCQ C;  1AWJ A;  4C92 G;  2Y4X A;  3VS2 A;  3DTO A;  2RHI A;  3FB9 A;  3EJ1 B;  4FU6 A;  2CH4 W;  1Q81 R;  3JCM V;  2NUZ A;  4J9D A;  2KT8 A;  5DLQ E;  2F2C A;  1WLP B;  3NTI A;  2D1X A;  2ATC B;  4L59 A;  3PTA A;  2EAY A;  1UGR B;  1HK9 A;  4K11 A;  1Q7Y U;  3CC7 Q;  5J3B A;  4M7D A;  1ZBX A;  2CT3 A;  1D3B A;  2LX7 A;  2LQW A;  1UUE A;  2CZ7 B;  1RI9 A;  1SRM A;  4JLI A;  4ESR A;  1MMA A;  1OL1 B;  4QT7 A;  1VQ5 A;  5LJ5 j;  4X9C A;  4J9E A;  3CMA Q;  1M9S A;  1WXT A;  3CC2 A;  4DOV A;  4E7J A;  2BS2 A;  4BY1 X;  3UT1 A;  1O75 A;  4LD9 K;  5KYN A;  2HNI A;  1GXI E;  5GAN 8;  2DJZ A;  2IW6 B;  4C8Q C;  4RTZ A;  3KXT A;  2KXC A;  3EGU A;  5IXF A;  1M90 C;  3OYC A;  1JST B;  3LLR A;  3GPL A;  3QJY A;  3OSS C;  3M9Q A;  3TCJ A;  2Z0W A;  1GRI A;  5HCK A;  4BI8 B;  3RUX A;  2E65 A;  5KYX B;  5GAM d;  3M0S A;  4CFX B;  1WQ7 A;  1YCS B;  5I2M A;  2WSC E;  2P84 A;  1QVG A;  3OBY A;  4ROD A;  1V1C A;  4BCH B;  5IN1 A;  4B9X A;  1C0M A;  1JRI A;  4NS5 A;  2E64 A;  3JV3 A;  3MET A;  2DMO A;  1QWE A;  1M90 R;  2KRO A;  2DAQ A;  3BHT B;  1WFW A;  2LQN A;  1K9A A;  2I2L A;  2BS4 A;  2E70 A;  1ZUY A;  1X75 C;  5M9O A;  2HKQ B;  4C8Q E;  2O9S A;  2YRV A;  4EOL B;  2C5V B;  2COZ A;  4C5E A;  3QHW B;  5HBE B;  2VGM A;  1UDL A;  3HSB A;  1HD3 A;  4BDY A;  5CQY A;  5KE3 A;  2QG9 B;  3BLR B;  2R57 A;  1MHN A;  2RNA A;  2CP6 A;  2COW A;  3UPU A;  4IKF A;  2IG0 A;  2BZY A;  4PKC C;  1PKT A;  5GAO n;  1I5O B;  1OI9 B;  5GMK j;  5CIU A;  4LUE A;  4XTZ A;  3PFS A;  1KC8 C;  4IIM A;  4EOO B;  2PTK A;  1VIN A;  3I9Q A;  2GFA A;  2K3Y A;  2PMI B;  1G3W A;  2ABL A;  3O5Z A;  1WXB A;  1H1S B;  2A28 A;  3SHW A;  1Z9Q A;  4A4F A;  1AHJ B;  2E6Z A;  1UJ0 A;  1TTH B;  3FLG A;  4M75 B;  3OS2 A;  4ZTF A;  3FJP A;  3SWN A;  3JCM J;  1EZZ B;  1GUX A;  2B86 A;  3I56 T;  2BPM B;  5LJ3 e;  1KC8 R;  1F5Q B;  1UHF A;  2FVU A;  4LDV A;  2H3J A;  2LMJ A;  3M0P A;  2GF7 A;  3FDR A;  5GAM h;  2GNC A;  2QQB A;  4Z8A A;  3BHV B;  1TU0 B;  4XQ3 A;  2JVV A;  2X4Y A;  1WX6 A;  3QWY A;  4J7I A;  3VS1 A;  1E7P A;  2D0N A;  4HCK A;  2DL3 A;  3VV0 A;  1AZG B;  4Y28 E;  3M57 A;  5GAN 5;  2AHJ B;  5GAN d;  4JX4 A;  1YIJ Q;  1OIY B;  1M5Q 1;  1M2O A;  4AMC A;  2IVW A;  1K8A U;  4QVD A;  1OUL A;  4Z89 A;  4FIB A;  3I55 Q;  3WVD B;  1NZ9 A;  2GFU A;  2O4X B;  3MPU B;  5CKE A;  4OR5 B;  5L2W B;  3PE0 A;  4M75 A;  2H3E B;  3LGF A;  3TW6 A;  2V26 A;  2DRM A;  3L2Z A;  2E5K A;  5FRM A;  3SDZ A;  3LWI A;  1YJ9 T;  3TVT A;  4L5G A;  2WIH B;  2G3R A;  4RCB A;  4ELL A;  2JUF A;  1JKW A;  1H25 B;  1VQ9 T;  1VYW B;  3CCL T;  1BYM A;  5I22 A;  1K73 U;  4BE1 A;  1YJW T;  1IB8 A;  3I56 A;  2LT1 A;  4J5Y A;  2M16 A;  4HVW A;  1MV0 B;  1BB9 A;  5KYU A;  2F1L A;  5GAN 3;  1FXX A;  4OGR B;  2MIO A;  3TSW A;  3OYA A;  3PIP A;  3QJ6 A;  4F6W B;  5FW9 A;  3M5A A;  4AKI A;  4Y72 B;  2WJ9 A;  4M7A B;  2LRQ A;  4OMN A;  3MEA A;  1YNZ A;  2O4X A;  2ED1 A;  4BCN D;  4M7D G;  4TTH A;  5DQV A;  2DD4 A;  1WYX A;  5KH6 A;  3CME Q;  4R55 A;  1GFC A;  2DL7 A;  5GAO m;  2ZPE B;  2LZ6 B;  4M78 C;  3CQT A;  2RJC A;  4JX6 A;  1HXD A;  2RI5 A;  2AK5 A;  2RQU A;  4J8O A;  3MP6 A;  2EJ9 A;  2VGN A;  4MDX A;  1YJ9 A;  4PNO A;  2WFY B;  4A4K A;  1H26 B;  1VQ9 A;  1Y0M A;  1X2Q A;  1K9M C;  1ZUU A;  3QHS A;  5HK0 A;  3G33 B;  3CCL A;  1U3O A;  5GAN h;  1GFD A;  1H28 B;  1V29 B;  1K76 A;  1U5S A;  3QYE A;  2D9T A;  1UFF A;  2QQ9 A;  3A5Z B;  1PHT A;  3BG9 A;  2MOX A;  2WPA B;  5KYW B;  3RBB B;  1YJW Q;  4M78 E;  4EOS B;  2CKK A;  3BG5 A;  2CUB A;  4BE2 A;  1ZSZ B;  5HBH B;  5CEI B;  4DBR A;  4VUB A;  5LJ5 f;  2RI3 A;  5KE2 A;  3G71 T;  2WXV B;  4J6Y A;  1P92 A;  5GAM j;  1ZQ1 A;  3H4C A;  1OKV B;  1MNE A;  3G1J A;  2CSQ A;  4M75 C;  4ZN1 A;  2DL5 A;  3CD6 T;  3OQ5 A;  2GGR A;  4B6M A;  1VQM T;  1M3B A;  1WHJ A;  2LCS A;  4KRC B;  2L3Q A;  5A0L A;  4R0K A;  4UN0 A;  1LVK A;  3UF4 A;  1C6V X;  1AWO A;  3HP9 A;  1XTD A;  1RAC B;  4DBF A;  4V2S A;  1MND A;  1JSU B;  3G6E T;  2DVJ A;  3M4Y A;  4F7U B;  1ZUK A;  1YBY A;  3MEW A;  4C5H A;  4JRI A;  5CKH A;  4PJL A;  2YT6 A;  3S3O A;  1BI3 A;  3Q1J A;  3JCM g;  2BS3 A;  1YN8 A;  1ZA1 B;  2P0Q A;  5D7U A;  5LJ3 d;  1E7O A;  5A2Q E;  3MY5 B;  2A37 A;  3O8V A;  3BHU B;  4PJM A;  3G71 A;  1Y7X A;  2I0N A;  1N27 A;  2KAF A;  1HJD A;  2IVX A;  2HD0 A;  1FMW A;  3FJ5 A;  4PFP A;  3WXM B;  2OTJ T;  1Z9Z A;  2CP3 A;  3CD6 A;  1VQN Q;  4AFU C;  3DB4 A;  5C6S A;  3RDV A;  3EGD B;  4F7U A;  4C0Z A;  2DFU A;  2DXB A;  4XTX A;  1VQM A;  2ECZ A;  4OMO A;  4Z88 A;  4BBR M;  3CCU Q;  5ICP B;  4AFS C;  3M54 A;  1OZ2 A;  5A0D A;  2EYW A;  2V1R A;  1K8A C;  4M75 G;  4KGZ B;  2JNG A;  5IH2 A;  3G6E A;  4DQ2 A;  1QVP A;  2RJF A;  1JJ2 P;  4M7A C;  3BLQ B;  2BE9 B;  2YRD A;  2HMA A;  3GIB A;  4FYX B;  3JB9 D;  2JT4 A;  2B9R A;  1M1G A;  2K3B A;  3GOX A;  2MF2 A;  1UTI A;  1BI0 A;  4FYV B;  1OIU B;  4E7Z A;  4IUP A;  5GAN j;  2ZAE A;  3QZ9 B;  1K8A R;  3MO8 A;  4M6V A;  4MFE A;  4L6V 5;  2DNU A;  5I11 A;  5CKB A;  1OX8 A;  4C92 D;  1VQ7 Q;  2NWM A;  2OTJ A;  3JCM f;  4AKH A;  4OP0 A;  4RG2 A;  4ATO A;  3HZJ A;  2KRS A;  3X26 B;  4C5I A;  2KRN A;  3P8B B;  4PJO A;  3EG0 A;  1OEB A;  4OMF B;  1SG5 A;  4A54 A;  1K73 R;  4EOJ B;  2QGF B;  1WHH A;  4AG1 C;  2C6T B;  2Y90 A;  1YJN T;  3EOC B;  4M77 D;  5LJ3 h;  1YIT T;  1VQ6 Q;  2YHT A;  1BCM A;  5L23 A;  2J6F A;  2PK2 A;  3SEM A;  3F70 A;  3J80 E;  4PJO E;  4C0D B;  3GBQ A;  4HCC A;  1WGS A;  2QYZ A;  5IHN A;  2YWW A;  2LTO A;  2C0T A;  3UWN A;  3KBG A;  4JJC A;  2XD0 A;  1ZSZ C;  3INZ A;  1KC8 U;  2WHB B;  2JW4 A;  2P4R A;  3CCS Q;  1FMK A;  2JN0 A;  2M51 A;  3J81 E;  2DYI A;  1C1A A;  2PVD B;  3UDC A;  2C06 A;  2HBW A;  3GF5 A;  4M7A G;  4A4H A;  1G3T A;  1H92 A;  2EGC A;  3V8L A;  1YI2 T;  4F14 A;  4ZNX A;  5GAM g;  2GCX A;  3V8J A;  3VKI A;  3N5B B;  1QVG P;  4GLK A;  2OTL Q;  4BCM D;  1W98 B;  3PIO A;  2KK4 A;  1KJW A;  4MML A;  5KCH A;  3C12 A;  3JCM c;  2HQE A;  1Y96 B;  1W2B S;  3E1S A;  3RKY A;  4GY5 A;  2O31 A;  2IW9 B;  1X27 A;  2LCL A;  3CC7 T;  3CCV A;  3QDR B;  4PK4 A;  1X43 A;  4CC7 A;  5FLX E;  4N4G A;  3OYK A;  1KIK A;  1PC0 A;  2MMP A;  1YJN A;  2RQW A;  4F7J B;  3QUI A;  4JZ3 A;  3OYB A;  1YIT A;  5J39 A;  3CMA T;  5GAO q;  2WIP B;  4KRT A;  4XU2 A;  2EBP A;  4D6W A;  3PGG A;  1Y07 A;  2XHC A;  4M77 F;  3EG3 A;  1YWP A;  1WHL A;  2C5N B;  1H1R B;  2B8A A;  1OYX A;  3T9N A;  4EOK B;  2LJ1 A;  3L1A A;  4A53 A;  3M4G A;  2PUK B;  3KUF A;  2F2V A;  1X6B A;  2EGE A;  4C92 E;  3ME9 A;  3R6O A;  5LQF B;  4A63 B;  2CGH A;  2XDB A;  1M2V A;  1W2B P;  5CKD A;  4M7D B;  1XJW B;  3DB3 A;  1Y96 A;  2CRE A;  2PVG B;  3KFV A;  3UA6 A;  1YI2 A;  4XTV A;  3JRZ A;  3MY1 B;  3VUB A;  4FYW B;  2JS2 A;  3JAM E;  3BLH B;  8ATC B;  1TS9 A;  4XTW A;  4C8Q D;  1EIF A;  2GQV A;  3VJP A;  3QG1 A;  2L3S A;  1BU2 A;  3MP8 A;  3V8K A;  2ZPH B;  4PJN A;  1IZ6 A;  5I21 A;  3CC7 A;  2JZ2 A;  1I4K 1;  2EYX A;  2HQX A;  4DBQ A;  1NJI C;  1R0C B;  2MWP A;  5GAM f;  4RTV A;  3CMA A;  5EG2 A;  4EMH A;  4XK8 E;  2E4H A;  4ZN3 A;  4KRD B;  1TXQ A;  2QF7 A;  4Y92 A;  3TU4 K;  2VV5 A;  4F7U G;  3VRZ A;  5GJV B;  1TD6 A;  2M0O A;  2LCC A;  2C5X B;  2E1H A;  3EGX A;  4UC4 A;  3H8Z A;  4BCF B;  1AWW A;  5GAN g;  2MAM A;  2KVQ G;  4ROE A;  3EG9 B;  2EYQ A;  4F17 A;  5LJ3 j;  5GAN 4;  4BCG B;  3L2Q A;  5IHK A;  4HL4 A;  4C5G A;  2RB6 A;  4LD6 A;  2EFI A;  4OML A;  4XAX B;  2KYM A;  3RIR A;  2EKO A;  3VYH B;  4ORZ A;  1M1K U;  2RK1 A;  3FIF A;  2QGS A;  4FL6 A;  1X01 A;  1K9M U;  3OYI A;  1JXM A;  3OA6 A;  1KSW A;  3QZ5 B;  2FRY A;  3M0U A;  1RLP C;  4C8Q F;  4CFU B;  4X9D A;  4FCY A;  2JMC A;  4BBS M;  2MCN A;  4ELZ C;  3CCR Q;  2X4J A;  2YRC A;  3M58 A;  4IMY B;  2DF6 A;  1OPK A;  4C0D C;  1Q86 U;  2HAX A;  3V7C A;  5HQ0 B;  3AT1 B;  1GH6 B;  5CCA A;  1TFB A;  2EWN A;  4JRQ A;  2A36 A;  2VYT A;  5IT9 E;  4OMQ A;  3L2R A;  2DIG A;  1CKB A;  4NL3 A;  4CFN B;  5CR2 A;  3G4S Q;  3EG9 A;  3LYI A;  3L2V A;  3M0Q A;  1VQO Q;  4PJO G;  3REB B;  3CCJ Q;  6AT1 B;  2KT1 A;  1D0X A;  3BFM A;  4HT8 A;  2RA2 A;  1YIJ T;  4RTU A;  4BY7 X;  1WJQ A;  2FPE A;  3SWN B;  1GUX B;  3H0F A;  1U8R A;  3I55 T;  2HL5 C;  3R6N A;  5D6Y A;  2DIQ A;  3HRU A;  4I3Z B;  1JOW A;  3JB9 J;  2L3R A;  5ECA A;  1VUB A;  3HFO A;  3X28 B;  2OJ2 A;  1KQ2 A;  2DKG A;  1XNI A;  4F7S B;  4FSS A;  3TNW B;  1KHC A;  2OI3 A;  2CDT A;  2QQR A;  3PMT A;  2QA4 Q;  4MFD A;  4QKU A;  4DBH A;  2DE0 X;  2DTH A;  5GAN f;  1WHG A;  2K4Y A;  4MMK A;  1W2B A;  2O2O A;  3C4S A;  5CK9 A;  4R56 A;  2DET A;  4BCI B;  2OAW A;  3MHX A;  1TOV A;  1SSH A;  2WMB B;  4ELY C;  5CAI A;  2RH2 A;  1PNJ A;  4J7F A;  1SRL A;  1AEY A;  2JOY A;  1R0B G;  2VXF A;  4XTU A;  2EQM A;  2V8I A;  4J9H A;  5DLO A;  1IGU A;  1RAA B;  2J05 A;  1FWZ A;  1VQ4 Q;  1IXD A;  1TWB A;  2BE7 D;  1KK7 A;  1LCK A;  4M7D C;  2RD1 A;  1NG2 A;  4IUU A;  1VQL Q;  2X3X D;  3CME T;  3JCM W;  1YIJ A;  1TSF A;  3NHN A;  3I55 A;  3P8H A;  2SEM A;  4HNU A;  5BNJ B;  2CT4 A;  2FEI A;  4RMO A;  2X35 A;  5KYU B;  2ROL A;  1T3S A;  7AT1 B;  5LJ5 e;  4NC6 A;  2O88 A;  2DL4 A;  1ZHI A;  1KFZ A;  4KUI A;  1T0H A;  2E6N A;  2FL7 A;  1GL5 A;  2DM1 A;  1NYG A;  2X4W A;  4EC9 B;  3O0G D;  4BI4 A;  1G8X A;  1ZBJ A;  3CBP A;  5LMK B;  2DD4 B;  4OB3 B;  4M78 D;  4X1V A;  2JXB A;  4KGX B;  2LQK A;  5D6W A;  2MK5 A;  2LDM A;  2KYB A;  4M7D E;  1NLP C;  2Y4Y A;  4JJB A;  1PM3 A;  4BE0 A;  1N8R C;  3WVE B;  3BW1 A;  4BY6 B;  1MV3 A;  3OMC A;  2FZC B;  4XTY A;  3BDL A;  4EOP B;  2VUB A;  2F2X A;  3DDP B;  2RHU A;  4FX3 B;  4YOS A;  5LJ5 g;  1B7T A;  1FIN B;  3MI9 B;  2F69 A;  3CME A;  2BUD A;  2ENM A;  1U1S A;  5GMK l;  1H1Q B;  4B9W A;  3VRY A;  2VVK A;  4RCC A;  4QW2 A;  5FGK B;  3RKX A;  3OYM A;  4AI6 A;  3CCQ Q;  1PG5 B;  2BKD N;  4ELJ A;  5HBJ B;  3E2U A;  4LE9 A;  4QVC A;  3K7A M;  2E12 A;  2FB7 A;  5HVY B;  3EFO A;  2W9F A;  3QYH B;  1T0J A;  3OW2 S;  2A08 A;  5GMK e;  4F6U B;  2FZK B;  1NLO C;  2LVM A;  2M0Y A;  4LN2 A;  3JCM P;  3QWL A;  2JM8 A;  2YUO A;  2L3P A;  3A98 A;  1M1K C;  4M78 F;  2X4X A;  3EG2 A;  2AIR B;  2A3L A;  2BZX A;  3A1P A;  4AFQ C;  1OOT A;  3SWN C;  2M9U A;  1YJW A;  4A4E A;  3CEY A;  4YC3 B;  2AKL A;  2KY9 A;  2IIM A;  4FW2 A;  4AFZ C;  3V7R A;  3KHI A;  1ZLM A;  1Q86 C;  3OSV A;  2RI2 A;  3LH5 A;  4HVV A;  1M1K R;  1PD1 A;  1QCO A;  2LJ0 A;  1QKX A;  4D8D A;  1JEG A;  3QHR B;  1VQ8 Q;  5FU7 B;  4M4Z A;  1K9M R;  1ZSG A;  1VQN T;  1YFN A;  1VYU A;  2KMT A;  3SFM A;  5GAO p;  5LJ3 f;  1BIB A;  3QDF A;  3JCM e;  3CCU T;  2KR6 A;  1E6G A;  2ZPB B;  1O9S A;  4BXX X;  1Q86 R;  1U06 A;  3VS3 A;  1BK2 A;  3OS1 A;  3AHU A;  1H3H A;  3S3N A;  2QQA A;  2I53 A;  1QP3 A;  5HKC A;  4OGE A;  1A0N B;  3X25 B;  1Y57 A;  1K1Z A;  5J26 A;  1LJO A;  1RAG B;  3VS6 A;  1RLQ C;  1TUD A;  3HHT B;  1QWF A;  1TUG B;  1SHG A;  1JO8 A;  5GAN 7;  2A0F B;  4BAC A;  4E7S A;  2PVO B;  2DXB B;  2E5Q A;  2FPD A;  1G83 A;  3M59 A;  4OB1 B;  3ZFJ A;  2EKH A;  1WQW A;  2DXU A;  1VQK Q;  2QDY B;  1WXU A;  4IIO A;  4M7A D;  1FX7 A;  1PWT A;  4HT9 A;  2D8H A;  4KGV B;  1H24 B;  1NYF A;  3OYN A;  2DTO A;  1I0C A;  1VQ7 T;  1ACM B;  2K3X A;  2EQU A;  3NPF A;  3LGL A;  2QQ8 A;  1VQN A;  2DER A;  4M75 E;  4KH1 B;  4MZM A;  2R5A A;  1C9B A;  1NJI U;  2DYB A;  3CCU A;  3TW7 A;  2E41 A;  1YCY A;  2EJG A;  1G5V A;  1URC B;  1VQ6 T;  2YXY A;  4CI0 C;  3CCE Q;  3C94 A;  1XOV A;  2NLU A;  3CXC A;  2LT4 A;  3EG1 A;  2G77 A;  2W96 A;  1QMC A;  4BY6 C;  2M1H A;  2VAS A;  3VS7 A;  4JZ4 A;  3E9G A;  1O9K A;  1D1C A;  5DQW A;  3RMS A;  3EH2 A;  2ZPF B;  2DA9 A;  1B07 A;  3CCS T;  5IF1 B;  2RQT A;  4PLL A;  3U23 A;  1GCP A;  4IUQ A;  4PJO B;  3MCA B;  4PLI A;  2V22 B;  2WSE E;  2KNB B;  3M0T A;  4O6J A;  1KG1 A;  4G6L B;  4PL6 A;  4J6X A;  1NEG A;  2OTL T;  4M77 A;  1H8K A;  2R7G A;  1P5E B;  1WI7 A;  3ER0 A;  1KXU A;  2QGG A;  1VQ7 A;  2QDJ A;  2ZCF B;  4II1 A;  2PZ1 A;  5DM7 R;  2EYZ A;  3OB9 A;  5EC7 A;  3M55 A;  2FZG B;  4J9I A;  4FW1 A;  5DY9 A;  1W4S A;  1OI1 A;  2AT1 B;  5FU6 B;  1WJS A;  4ANJ A;  1FKM A;  1WIE A;  3LH0 A;  1VA7 A;  1S72 Q;  1VQ6 A;  1Q82 C;  2K7A A;  4JS4 A;  3QSU A;  4A4G A;  1JBM A;  2A7Y A;  1LOJ A;  1IRX A;  3MJX A;  3I5R A;  1E9H B;  3HFN A;  1I5L A;  2K5L A;  3OW2 A;  3IQL A;  2YDL A;  3ULR B;  5GAM e;  2EIF A;  4M7A E;  1SEM A;  2KI7 A;  4EC8 B;  1WHM A;  2QK0 A;  3CCS A;  1RAB B;  2H8H A;  3HL8 A;  2ZZD A;  4BCP B;  2PUO B;  3NMZ C;  1PSF A;  4IUR A;  3V7S A;  2JJ9 A;  4HKE A;  4NL2 A;  1VIE A;  2RO0 A;  5FU7 C;  4EMK A;  2LJ3 A;  4C8Q B;  3CCM T;  4CC3 A;  5L8R E;  5CO7 A;  2OTL A;  1GCQ A;  2P4T A;  4HLQ A;  1IGQ A;  4JRP A;  3NDQ A;  3E19 A;  1JXO A;  3EID B;  2CS7 A;  3RES A;  3JB9 F;  3NGP A;  2UZB B;  2QEX Q;  2DLP A;  5I2S A;  3TRE A;  2FPF A;  3URG A;  4EON B;  2JTM A;  5GAO l;  2DVE A;  1N6A A;  1VQP Q;  4F7N B;  4Z02 A;  4EOI B;  4FSX A;  1M2V B;  1R77 A;  1RAI B;  2KMG A;  1AWX A;  1ZA2 B;  2VKN A;  1TH7 A;  2RF0 A;  1IHV A;  1M3C A;  1H4L D;  4LOC A;  4C92 F;  4J6W A;  1G3N C;  3JB9 H;  3HO8 A;  4MIM A;  4BDZ A;  1X6G A;  2J7I A;  4F70 B;  1UNH D;  2WMA B;  4C8Q A;  3JCM d;  4FM4 B;  3ASK A;  5C0M A;  2DXT A;  1QVF A;  4ME7 A;  4BCQ D;  1PRM C;  4HNT A;  1B34 A;  3H41 A;  4WTO B;  2D6F A;  1VOL A;  3HRS A;  3QKJ A;  1JB0 E;  1CSK A;  2QFZ A;  4JRK A;  5AT1 B;  3RR6 A;  1BCO A;  3QPH A;  3MKD A;  2NYS A;  4E7L A;  3H6Z A;  5AYF A;  4CFM B;  4NST B;  3CCR T;  3EGX B;  2BZ8 A;  1QMZ B;  4J9F A;  3CCM Q;  4OMM A;  2XU8 A;  4F7U E;  4QQ6 A;  2UUE B;  5GAN e;  5KYY A;  4CRL B;  2F5K A;  2GTO A;  2NUP A;  4X34 A;  3CPW A;  5GMK h;  1N8R U;  2DRK A;  4LXC A;  3G4S T;  3QXE B;  1RL2 A;  4LNP A;  5EFQ B;  1VQO T;  1MGQ A;  3CCJ T;  3LX7 A;  4GLM A;  4PJO C;  3VU3 C;  4DA4 A;  4LDX A;  3GLX A;  1M8M A;  1Q81 C;  4HA8 A;  3F5X B;  5GAN 6;  2FG0 A;  2DJQ A;  1MUZ A;  1AVZ C;  1BI1 A;  2GBQ A;  8AT1 B;  4Y91 A;  2G6F X;  1KQS S;  4RTY A;  3B57 A;  3RMQ A;  2RMO A;  3J7A F;  1OGU B;  4QSH A;  3HRT A;  4BI3 A;  3OS5 A;  5GAO r;  3FEO A;  1QQJ A;  1FVV B;  5FWB A;  5FU6 C;  3CC4 Q;  2QA4 T;  3RER A;  2CJM B;  4KH0 B;  1NJI R;  1M3A A;  3THK A;  3M56 A;  3JCM h;  3CCR A;  3A8O B;  2G9X B;  1ZP2 A;  1UEC A;  2CP0 A;  2EW3 A;  3FRN A;  2R5M A;  4M77 G;  1WNL A;  2DBK A;  4MZT A;  4AT1 B;  1NM7 A;  2CP5 A;  2KEA A;  2HL3 A;  2IN3 A;  3A8H B;  1I1J A;  3G4S A;  1VQ4 T;  2HBP A;  2DD5 A;  1VQO A;  1KQS P;  1QP2 A;  3CCJ A;  3S6W A;  3VKH A;  4LDY A;  2K5F A;  2VXE A;  4O5V A;  1VQL T;  4N0A A;  4E2F B;  4CFW B;  2RN8 A;  2YLB A;  4BB7 A;  1JU5 C;  1Q95 G;  1I81 A;  2V8K A;  2W10 A;  2DZC A;  2HZY A;  2FO0 A;  1TUC A;  1VQ5 Q;  2QTV A;  4C0G A;  2RJD A;  1MMD A;  3CC2 Q;  2UZD B;  4RTT A;  1XQH A;  2QDL A;  3PVL A;  2AZS A;  5ACB A;  2E10 A;  1H3Z A;  2JTF A;  4JLG A;  3X24 B;  1D3U B;  3HPW A;  4FT4 A;  3LW5 E;  4M7D D;  3H0H A;  1RAF B;  4TVR A;  2QA4 A;  2D0Q B;  2ED0 A;  2MWO A;  4M78 B;  3DDQ B;  1UGS B;  3CBM A;  3TNH B;  3DOG B;  1J3T A;  2FYK A;  2YLC A;  2K5I A;  3OYE A;  3X20 B;  2HQH A;  4XU1 A;  3JCM b;  2DBM A;  1VOM A;  2RQR A;  2L8D A;  2DXC B;  2LP5 A;  2QAZ A;  3SD4 A;  2QAS A;  4J83 A;  2CZ0 B;  3VS5 A;  4BCK B;  4EDU A;  1VQ4 A;  3GTM S;  1OPL A;  4EMG A;  3GNF B;  4OGC A;  2LC4 A;  3TN8 B;  1AT1 B;  2L2P A;  1VQL A;  3VYG B;  3L2W A;  4YTL A;  1OU8 A;  5KYX A;  4BCJ B;  2J06 A;  4ZGJ B;  1UE9 A;  2LNH B;  1SF9 A;  4HNV A;  4BCN B;  2F5T X;  4M78 A;  4OB2 B;  4EOQ B;  2EPD A;  1K0S A;  3NTK A;  4PJJ A;  4OF1 A;  3CCQ T;  2CP2 A;  4C8Q G;  2PJQ A;  3MIA B;  3RNJ A;  3OMG A;  2DXC A;  1SSF A;  1TG0 A;  4QQG A;  4IUT A;  4M7D F;  1UEB A;  1FYN A;  2DIL A;  1PRL C;  2JM9 A;  1SHF A;  2JGZ B;  1X69 A;  4CFU D;  4RTX A;  2E3H A;  3VYG A;  3VUZ A;  1QLB A;  1RAD B;  2O9V A;  2RQV A;  2HDA A;  2K57 A;  3CXC S;  4WF2 A;  2EJF A;  4ZGD B;  2XIC A;  5HK3 A;  2UZL B;  2CZ6 B;  1BI2 A;  3PNW C;  3ZBD A;  1R8O B;  3NTH A;  4LDW A;  1V76 A;  3LWH A;  2V8J A;  4N0A C;  3EFS A;  2AZV A;  3QYB A;  3EFO B;  3DL1 A;  4IUV A;  2CZ1 B;  3NFC A;  5IHI A;  2YUN A;  3G7Z A;  2DX1 A;  1UB4 A;  2CCH B;  4MDW A;  3OYL A;  3EH1 A;  1UGP B;  1VQ8 T;  2X9H A;  3VKG A;  1KQS A;  1OX9 A;  3H9N A;  3CCQ A;  5LJ3 g;  4ZGE B;  2YUQ A;  2LNV A;  4BUG A;  3EHQ A;  1BIA A;  2GTJ A;  1BKB A;  3VS0 A;  1Q82 U;  3PMI A;  2LQ8 A;  4J9B A;  2DPP B;  4CFV B;  4Z6Y A;  5GAN 2;  3CXC P;  2OAU A;  1UNG D;  3DLM A;  1N8R R;  1IHW A;  3A8M B;  2DTI A;  1D09 B;  3GP8 A;  1GY3 B;  2EYY A;  3TEE A;  1G2B A;  1M30 A;  3RGF B;  5IDP B;  2MI6 A;  1ABO A;  1RAE B;  1NPR A;  2J6O A;  1WJR A;  1CKA A;  1LNX A;  1PSE A;  5CQX A;  1ZX6 A;  9ATC B;  3A8G B;  2M02 A;  1QCF A;  1AOJ A;  2YSQ A;  4D8K A;  1K0X A;  2FHD A;  3I56 Q;  1WHK A;  2OX7 A;  2C4G B;  4M75 D;  1VQK T;  2O01 E;  1FMV A;  1Q7Y C;  1ABQ A;  3DLL A;  4DOW A;  1U1T A;  1M8V A;  4J9G A;  2DEQ A;  2JMA A;  2KR3 A;  3L2U A;  4E7H A;  1VQ8 A;  1NEB A;  1RAH B;  1G3Y A;  3E9F A;  4JDS A;  4HVU A;  3BG3 A;  4OMP A;  2RM4 A;  3JCM X;  1WZO A;  4JX5 A;  1MMG A;  3JSC A;  2W9Z A;  2XI9 A;  2KDS A;  2RPN A;  2L89 A;  2CH4 A;  4PFO A;  3CCE T;  3OYY A;  1SKU B;  1Q7Y R;  2C0I A;  4GBQ A;  3PVQ A;  1H64 1;  1ENW A;  2KBT A;  2W0Z A;  4NOY A;  3OW2 P;  2UZE B;  3HB9 A;  1AD5 A;  5CYI B;  4M7A A;  1KD1 U;  1OZ3 A;  3FC3 A;  3SB2 A;  3OBW A;  5GJW B;  1PKS A;  2X3W D;  2ROT A;  5HY6 A;  1YJ9 Q;  2COY A;  3OS0 A;  3POM A;  4CXA B;  2EQI A;  1ARK A;  2KRM A;  1VQ9 Q;  2HSE B;  2R58 A;  1D0Y A;  3CCL Q;  3C0C A;  3JB9 I;  1VQK A;  3PT9 A;  2ESW A;  3UA7 A;  3TNI B;  1IRE B;  2BIV A;  1RUW A;  1H27 B;  4LDU A;  4WCI A;  4M75 F;  1BU1 A;  3ZEH A;  1UGQ B;  2MYS A;  1AIS B;  2P0P A;  3OY9 A;  1QVF S;  2W2H A;  5FWC A;  1NBE B;  1O9K B;  5IXB A;  1PCX A;  4CC2 A;  3UAT A;  3OYJ A;  2D8J A;  5EJC A;  4C92 B;  1M1F A;  2E3I A;  2VC8 A;  1OKW B;  4ZTJ A;  2K6D A;  2XKO C;  1S72 T;  1WPY A;  4E7I A;  2CP7 A;  3CCE A;  3M53 A;  3H0I A;  1OQK A;  1N9R A;  4M78 G;  1N9S A;  4RG8 A;  1YP5 A;  4F6S B;  2DL8 A;  4F04 B;  2PK9 B;  1W6X A;  3OYD A;  4M77 B;  2MPX C;  5KYW A;  3CPF A;  4HXJ A;  1Q81 U;  2ZGW A;  1QCN A;  1K4U S;  1HSQ A;  2RJE A;  2VB6 A;  4N4H A;  3DJB A;  3CPW S;  5A0G A;  2LW4 A;  1QLY A;  1ZSZ A;  4JUV A;  1JQQ A;  3LQ5 B;  2IPO B;  1B3Q A;  1QVF P;  2DK3 A;  3GNG A;  1PKD B;  4P5N A;  2DME A;  2RHZ A;  4RKU E;  4OVA A;  3QO3 A;  1EFN A;  5LJ5 d;  3QBY A;  1JJ2 S;  4KUL A; 
#chains in the Genus database with same CATH homology
 4M7A B;  4ME7 A;  3OYG A;  2LRQ A;  2RA2 A;  4C92 A;  3MEA A;  1YIJ T;  2L5Q A;  2O4X A;  1WJQ A;  3SWN B;  4HNT A;  1B34 A;  4E7K A;  4M7D G;  4HCB A;  2D6F A;  1U8R A;  3I55 T;  3HRS A;  2DD4 A;  3QKJ A;  2ZPG B;  4E47 A;  1JB0 E;  5D6Y A;  2QFZ A;  3P8D A;  5KH6 A;  1DJ7 B;  2DIQ A;  4R55 A;  3HRU A;  4JRK A;  2QEX T;  3JB9 J;  2L3R A;  4XU0 A;  1VUB A;  2QTX A;  3HFO A;  5GAO m;  3X28 B;  5LL6 S;  3QPH A;  3OYH A;  2CYZ B;  2ZPE B;  2RHY A;  1KQ2 A;  2DKG A;  1XNI A;  4Q5W A;  4M78 C;  4E7L A;  3H6Z A;  5AYF A;  2RJC A;  2EQK A;  2ZZD B;  4JX6 A;  1HXD A;  1VQP T;  1M4Z A;  1S72 A;  3CCR T;  1KHC A;  2QQR A;  4HCZ A;  2RI5 A;  3PMT A;  4N4I A;  4MFD A;  4M7A F;  4J8O A;  2DTH A;  3MP6 A;  2EJ9 A;  3BDU A;  2VGN A;  5GAN f;  2XU8 A;  4F7U E;  4QQ6 A;  2K4Y A;  4EMK B;  4PNO A;  1YJ9 A;  4MMK A;  5GAN e;  4MDX A;  1W2B A;  2F5K A;  4A4K A;  3C4S A;  1I8F A;  4X34 A;  4CRI A;  5CK9 A;  5GMK h;  4R56 A;  3CPW A;  1N8R U;  1VQ9 A;  1K9M C;  3QHS A;  3BY7 A;  5HK0 A;  1QW1 A;  3CCL A;  1YHQ T;  3G4S T;  3QYG B;  3QXE B;  1RL2 A;  5GAN h;  3MHX A;  1VQO T;  1M90 U;  1MGQ A;  4ELY C;  2RH2 A;  5CAI A;  3LX7 A;  3CCJ T;  2XDD A;  3VU3 C;  4PJO C;  4J7F A;  1V29 B;  3C95 A;  2WAC A;  4DA4 A;  2JOY A;  2VXF A;  3QYE A;  4XTU A;  4LDX A;  2EQM A;  2V8I A;  3GLX A;  5DLO A;  5IAY A;  1NE8 A;  1Q81 C;  5CVI A;  1FWZ A;  4HA8 A;  1K73 C;  2D9T A;  5GAN 6;  2QQ9 A;  3A5Z B;  3BG9 A;  2KSS A;  4M7D C;  2RD1 A;  1BI1 A;  4IUU A;  2PU9 B;  3JCM Q;  4Y91 A;  2WJ9 A;  3CME T;  3JCM W;  1YIJ A;  1KQS S;  2K2V A;  4M78 E;  3RMQ A;  2CKK A;  3MEU A;  3BG5 A;  4BE2 A;  3J7A F;  4QSH A;  3I55 A;  3HRT A;  1RI0 A;  4BI3 A;  3OS5 A;  3P8H A;  5GAO r;  4HNU A;  3FEO A;  4RMO A;  2X35 A;  4VUB A;  5LJ5 f;  2RI3 A;  3L42 A;  5KE2 A;  5FU6 C;  3G71 T;  2QEX A;  4HT8 A;  5GMK i;  2QA4 T;  4J6Y A;  4NC6 A;  5LJ5 e;  3QII A;  1P92 A;  2DO3 A;  2QXF A;  3RER A;  4XU3 A;  5GAM j;  1ZQ1 A;  3H4C A;  1ZHI A;  3CCV T;  1VQP A;  4KUI A;  1QVG S;  4M75 C;  2E6N A;  3M56 A;  2RHX A;  4QVZ A;  3JCM h;  3CCR A;  3A8O B;  2FL7 A;  5LJ5 h;  4ZN1 A;  3CD6 T;  3OQ5 A;  4KBM B;  2X4W A;  4PJO E;  3FRN A;  4MZT A;  1NPP A;  2R5M A;  4M77 G;  1WNL A;  4BI4 A;  1VQM T;  4M7A A;  1B34 B;  3CBP A;  4M78 D;  2DD4 B;  4OB3 B;  5A0L A;  3A8H B;  2LQK A;  4JJN K;  3HP9 A;  1XTD A;  3G4S A;  1YHQ A;  5D6W A;  4V2S A;  2LDM A;  1KQ1 A;  4MZP A;  2HBP A;  2DD5 A;  1VQ4 T;  1VQO A;  4EPC A;  4M7D E;  3G6E T;  1QP2 A;  3EAE A;  3M4Y A;  4F7U B;  3CCJ A;  2Y4Y A;  2WSF E;  1YBY A;  3VKH A;  3S6W A;  4LDY A;  2K5F A;  4BE0 A;  2VXE A;  3WVE B;  3BW1 A;  4O5V A;  4BY6 B;  1N8R C;  3OMC A;  1VQL T;  4N0A A;  3MEW A;  4XTY A;  4C5H A;  3BDL A;  2YLB A;  4BB7 A;  4JRI A;  5CKH A;  2VUB A;  1I81 A;  2V8K A;  2DZC A;  3S3O A;  1BI3 A;  2XID A;  3Q1J A;  3JCM g;  2RHU A;  2BS3 A;  5LJ5 g;  1KD1 C;  4FT2 A;  4PJO D;  2EQJ A;  4C0G A;  2F69 A;  2RJD A;  3CME A;  2P0Q A;  2BUD A;  4C92 C;  3MP1 A;  3CC4 T;  1XQH A;  4BD3 A;  5LJ3 d;  5A2Q E;  1U1S A;  5GMK l;  2E10 A;  5FRN A;  2JTF A;  3O8V A;  4JLG A;  1H3Z A;  3X24 B;  3HPW A;  4FT4 A;  4F7U F;  4B9W A;  3LW5 E;  5CKF A;  4M7D D;  3DKM A;  1Y7X A;  4RCC A;  4TVR A;  3G71 A;  1N27 A;  2KAF A;  4QW2 A;  2HD0 A;  2QA4 A;  3RKX A;  2D0Q B;  3OYM A;  4AI6 A;  2MWO A;  2QQS A;  4M78 B;  1VIF A;  2BKD N;  3CCM A;  3A8L B;  4ELJ A;  3WXM B;  3HKS A;  1UGS B;  3CBM A;  2OTJ T;  4M77 C;  2FYK A;  2YLC A;  2K5I A;  4QVC A;  2E12 A;  3OYE A;  4OB0 B;  3X20 B;  2FB7 A;  3MEV A;  3CD6 A;  3EFR A;  4XU1 A;  1G3S A;  3JCM b;  3DB4 A;  5C6S A;  3QYH B;  4F7U A;  4C0Z A;  2DXB A;  4XTX A;  5D6X A;  1VQM A;  3CBO A;  2L8D A;  2DXC B;  3SD4 A;  3OW2 S;  4BBR M;  4J83 A;  2CZ0 B;  5GMK e;  2ZPI B;  2LVM A;  1OZ2 A;  3M54 A;  5A0D A;  3QWL A;  3JCM P;  4EDU A;  2XK0 A;  5FRO A;  4KUD K;  1Y71 A;  1K8A C;  1VQ4 A;  4M75 G;  2JNG A;  1M1K C;  4EMG A;  3G6E A;  3GNF B;  4DQ2 A;  4M78 F;  3RKW A;  4OGC A;  4AKG A;  2X4X A;  2LC4 A;  2LX9 A;  1QVP A;  3HBL A;  2RJF A;  1VQ5 T;  4M7A C;  2DZ9 A;  2A3L A;  1VQL A;  3VYG B;  1KHI A;  3GIB A;  4QQD A;  3CC2 T;  3SWN C;  2XDP A;  2M9U A;  4YTL A;  3L2W A;  4A4E A;  4JS5 A;  5GMK m;  1YJW A;  3CEY A;  4ZGJ B;  3JB9 D;  2KY9 A;  1M1G A;  4HNV A;  1D3B B;  3GOX A;  2XG8 D;  4KT0 E;  1JJ2 A;  2MF2 A;  3JB9 G;  3V7R A;  4C0F A;  1X6O A;  2F5T X;  3KHI A;  1BI0 A;  4M78 A;  1Q86 C;  4OB2 B;  3S3M A;  3CC4 A;  3OSV A;  4IUP A;  5GAN j;  2RI2 A;  3NTK A;  3QZ9 B;  4M77 E;  4OF1 A;  2DD5 B;  3CCQ T;  3MO8 A;  4PJO F;  3OYF A;  2KQW A;  4C8Q G;  4M6V A;  4MFE A;  2QI2 A;  5FU7 B;  2P0K A;  4L6V 5;  5KCO A;  1VQN T;  5CKB A;  2PQW A;  4EMK C;  2RK2 A;  3OMG A;  4C92 D;  2DXC A;  1SSF A;  4QQG A;  2KMT A;  4IUT A;  2OTJ A;  3JCM f;  4C92 G;  4AKH A;  4M7D F;  2Y4X A;  3SFM A;  4OP0 A;  4RG2 A;  1UEB A;  3HZJ A;  1BIB A;  5LJ3 f;  3JCM e;  5GAO p;  3CCU T;  4ATO A;  3X26 B;  2RHI A;  2KR6 A;  3FB9 A;  4C5I A;  4PJO A;  2ZPB B;  3P8B B;  1O9S A;  4FU6 A;  3JCM V;  4OMF B;  4A54 A;  3OS1 A;  5DLQ E;  3AHU A;  3S3N A;  3NTI A;  2Y90 A;  3VYG A;  2QQA A;  3VUZ A;  4M77 D;  5LJ3 h;  4L59 A;  1QLB A;  3PTA A;  1YIT T;  1YJN T;  2EAY A;  2YHT A;  1UGR B;  1HK9 A;  1QP3 A;  2K57 A;  5HKC A;  4OGE A;  4WF2 A;  3X25 B;  5J3B A;  3CXC S;  1Q7Y U;  1ZBX A;  4ZGD B;  2EJF A;  5J26 A;  1LJO A;  4M7D A;  1D3B A;  2XIC A;  5HK3 A;  2CZ7 B;  4JLI A;  2CZ6 B;  1BI2 A;  3F70 A;  3PNW C;  3J80 E;  3ZBD A;  1R8O B;  3NTH A;  4LDW A;  1VQ5 A;  4C0D B;  3HHT B;  3LWH A;  5LJ5 j;  4X9C A;  1WGS A;  4HCC A;  2V8J A;  1M9S A;  3EFS A;  4N0A C;  2LTO A;  3CC2 A;  3UWN A;  3QYB A;  3KBG A;  4DOV A;  5GAN 7;  2XD0 A;  4E7J A;  4BAC A;  3DL1 A;  2BS2 A;  2PVO B;  4IUV A;  2DXB B;  2E5Q A;  3UT1 A;  2CZ1 B;  3NFC A;  3QSU A;  1O75 A;  3M59 A;  4OB1 B;  4LD9 K;  3INZ A;  3ZFJ A;  2HNI A;  3G7Z A;  1KC8 U;  1WQW A;  1UB4 A;  2DXU A;  1GXI E;  3OYL A;  4MDW A;  5GAN 8;  2QDY B;  2DJZ A;  2JN0 A;  3J81 E;  4M7A D;  1UGP B;  1FX7 A;  4C8Q C;  1VQ8 T;  2PVD B;  3UDC A;  3KXT A;  2C06 A;  4HT9 A;  3GF5 A;  3OYN A;  4M7A G;  3VKG A;  1KQS A;  4A4H A;  2DTO A;  1G3T A;  1KD1 U;  3OYC A;  3V8L A;  3CCQ A;  1M90 C;  1VQ7 T;  3LLR A;  2K3X A;  1YI2 T;  5LJ3 g;  4ZGE B;  2EQU A;  5GAM g;  2LNV A;  3GPL A;  3QJY A;  4BUG A;  2GCX A;  1BIA A;  3OSS C;  3LGL A;  2QQ8 A;  3M9Q A;  3N5B B;  4GLK A;  3TCJ A;  3V8J A;  3VKI A;  1BKB A;  1Q82 U;  3PMI A;  3PIO A;  1VQN A;  2KK4 A;  2LQ8 A;  4BI8 B;  4M75 E;  3RUX A;  2DPP B;  2E65 A;  4MML A;  5GAM d;  5KCH A;  4MZM A;  4Z6Y A;  3C12 A;  5GAN 2;  3JCM c;  1WQ7 A;  2OAU A;  2HQE A;  2R5A A;  5I2M A;  1NJI U;  1Y96 B;  3DLM A;  1W2B S;  3E1S A;  3CCU A;  3TW7 A;  2WSC E;  2E41 A;  4GY5 A;  3RKY A;  1YCY A;  2EJG A;  3OBY A;  4B9X A;  5IN1 A;  1QVG A;  1VQ6 T;  1G5V A;  3A8M B;  2DTI A;  1JRI A;  2LCL A;  4CI0 C;  4NS5 A;  3CC7 T;  2E64 A;  3C94 A;  3GP8 A;  1XOV A;  2NLU A;  3MET A;  3TEE A;  3QDR B;  3CXC A;  3CCV A;  2LT4 A;  2MI6 A;  2G77 A;  4N4G A;  4BY6 C;  5FLX E;  3OYK A;  2M1H A;  1NPR A;  2MMP A;  1YJN A;  1WJR A;  3OYB A;  3QUI A;  1YIT A;  3E9G A;  1LNX A;  2DAQ A;  1PSE A;  5J39 A;  3CMA T;  5GAO q;  5CQX A;  4XU2 A;  3RMS A;  4D6W A;  3A8G B;  3PGG A;  2I2L A;  2ZPF B;  2BS4 A;  1Y07 A;  2E70 A;  2XHC A;  1X75 C;  4M77 F;  5M9O A;  4C8Q E;  2FHD A;  2YRV A;  4M75 D;  3CCS T;  1VQK T;  2O01 E;  4PLL A;  2B8A A;  1OYX A;  3T9N A;  4C5E A;  1Q7Y C;  4IUQ A;  4PJO B;  3L1A A;  4A53 A;  2VGM A;  3MCA B;  4PLI A;  3M4G A;  4DOW A;  2PUK B;  3KUF A;  1U1T A;  3DLL A;  3HSB A;  4BDY A;  5CQY A;  2DEQ A;  2WSE E;  5KE3 A;  4C92 E;  3ME9 A;  1M8V A;  2R57 A;  1MHN A;  4O6J A;  3R6O A;  1KG1 A;  3L2U A;  4PL6 A;  4J6X A;  4E7H A;  1VQ8 A;  2CGH A;  3UPU A;  2OTL T;  4IKF A;  2IG0 A;  2XDB A;  1G3Y A;  3E9F A;  4JDS A;  4M77 A;  5CKD A;  4PKC C;  3ER0 A;  1VQ7 A;  4M7D B;  3DB3 A;  5GAO n;  1Y96 A;  3BG3 A;  2PVG B;  1YI2 A;  5GMK j;  5CIU A;  2RM4 A;  4XTZ A;  4XTV A;  3JRZ A;  3PFS A;  3JCM X;  1KC8 C;  4JX5 A;  3JSC A;  3VUB A;  2XI9 A;  2QDJ A;  2ZCF B;  2KDS A;  4II1 A;  3JAM E;  5DM7 R;  2L89 A;  3OB9 A;  4XTW A;  3M55 A;  4C8Q D;  2GFA A;  2K3Y A;  1EIF A;  2GQV A;  3VJP A;  3CCE T;  5DY9 A;  1G3W A;  1W4S A;  3OYY A;  3QG1 A;  1OI1 A;  1H64 1;  5FU6 B;  1WJS A;  3MP8 A;  1FKM A;  4NOY A;  3LH0 A;  1VQ6 A;  4A4F A;  1Q82 C;  3V8K A;  2ZPH B;  1AHJ B;  3HB9 A;  4JS4 A;  1IZ6 A;  2E6Z A;  1OZ3 A;  5I21 A;  2JZ2 A;  3FC3 A;  3CC7 A;  3SB2 A;  3OBW A;  3FLG A;  1I4K 1;  4M75 B;  4A4G A;  3OS2 A;  2HQX A;  1JBM A;  4ZTF A;  2A7Y A;  3FJP A;  1LOJ A;  3SWN A;  3JCM J;  1NJI C;  5HY6 A;  2MWP A;  3OS0 A;  3I56 T;  3HFN A;  5GAM f;  1I5L A;  2K5L A;  3OW2 A;  5LJ3 e;  3CMA A;  5EG2 A;  5GAM e;  2FVU A;  4EMH A;  4XK8 E;  2EIF A;  2R58 A;  4LDV A;  4M7A E;  2H3J A;  4ZN3 A;  3JB9 I;  2QF7 A;  3TU4 K;  2VV5 A;  2GF7 A;  3FDR A;  4F7U G;  5GAM h;  3CCS A;  1VQK A;  3HL8 A;  2QQB A;  2ZZD A;  2M0O A;  2LCC A;  3PT9 A;  2PUO B;  2E1H A;  1PSF A;  4XQ3 A;  4IUR A;  1IRE B;  4UC4 A;  3V7S A;  3H8Z A;  4HKE A;  2BIV A;  4NL2 A;  2JVV A;  2X4Y A;  4J7I A;  4LDU A;  4M75 F;  1VIE A;  5GAN g;  2MAM A;  1E7P A;  1UGQ B;  2KVQ G;  2RO0 A;  3ZEH A;  5FU7 C;  3VV0 A;  4EMK A;  2EYQ A;  2P0P A;  4C8Q B;  4Y28 E;  5LJ3 j;  5GAN 4;  3M57 A;  3OY9 A;  5GAN 5;  3CCM T;  5L8R E;  2AHJ B;  3L2Q A;  5CO7 A;  1QVF S;  2OTL A;  4HL4 A;  4C5G A;  2RB6 A;  5GAN d;  2P4T A;  4HLQ A;  4JX4 A;  4LD6 A;  2EFI A;  1M5Q 1;  3OYJ A;  2IVW A;  4JRP A;  4XAX B;  5EJC A;  3RIR A;  2EKO A;  3E19 A;  4C92 B;  3VYH B;  4QVD A;  1M1F A;  1K8A U;  4FIB A;  2VC8 A;  3WVD B;  1NZ9 A;  2GFU A;  2O4X B;  5CKE A;  2RK1 A;  2XKO C;  4ZTJ A;  1M1K U;  2CS7 A;  1S72 T;  3RES A;  1WPY A;  3FIF A;  4M75 A;  4E7I A;  4FL6 A;  3JB9 F;  3LGF A;  1X01 A;  3CCE A;  3TW6 A;  3OYI A;  1K9M U;  3M53 A;  5I2S A;  3OA6 A;  3L2Z A;  3TRE A;  3URG A;  3QZ5 B;  1N9R A;  4M78 G;  5FRM A;  1N9S A;  2JTM A;  3SDZ A;  4RG8 A;  5GAO l;  3LWI A;  2DVE A;  1YJ9 T;  1N6A A;  4L5G A;  4C8Q F;  4X9D A;  4Z02 A;  4BBS M;  4ELZ C;  2G3R A;  4RCB A;  2JUF A;  4FSX A;  3OYD A;  2X4J A;  1VQ9 T;  4M77 B;  3M58 A;  3CPF A;  1Q81 U;  2KMG A;  2ZGW A;  3CCL T;  1TH7 A;  4C0D C;  1Q86 U;  3V7C A;  2HAX A;  1BYM A;  1K73 U;  2RJE A;  4BE1 A;  4N4H A;  3CPW S;  3I56 A;  4LOC A;  2LT1 A;  5A0G A;  4J5Y A;  5CCA A;  4C92 F;  1YJW T;  2EWN A;  4J6W A;  2M16 A;  4JUV A;  4JRQ A;  2VYT A;  5IT9 E;  3L2R A;  3JB9 H;  3HO8 A;  4MIM A;  2DIG A;  4BDZ A;  5GAN 3;  4NL3 A;  2DK3 A;  3GNG A;  5CR2 A;  4P5N A;  1FXX A;  4C8Q A;  2RHZ A;  3LYI A;  3L2V A;  4RKU E;  4OVA A;  4FM4 B;  3QO3 A;  4PJO G;  3JCM d;  3PIP A;  3OYA A;  3ASK A;  5C0M A;  5LJ5 d;  3QBY A;  3QJ6 A;  1JJ2 S;  3BFM A;  3M5A A;  4AKI A;  4KUL A;  2DXT A;  1QVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...