2ZPGB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpgB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpgB02
3X24B 4OB3B 3X25B 1QP2A 4RKUE 3QXEB 3VYGB 3X28B 2CZ1B 2CZ0B 3VYGA 3QYGB 3VYHB 2CZ6B 4ZGJB 2CZ7B 3HHTB 1AHJB 2WSEE 1GXIE 2AHJB 1PSEA 2PVDB 3A8LB 2ZCFB 2PVOB 1UGSB 3A8OB 2PUKB 3A8HB 2ZPHB 2DXCB 3LW5E 2DXBB 3X26B 3A8GB 4ZGEB 1QP3A 2DD4B 3X20B 2DXCA 2DD5B 2DXBA 1UGPB 2WSFE 1JB0E 2ZPIB 4OB0B 4XK8E 2DD4A 2DD5A 1IREB 4ZGDB 2ZPEB 3WVEB 2ZPBB 4OB2B 2WSCE 1DJ7B 4OB1B 2O01E 2ZZDB 2PUOB 2QDYB 2PU9B 2ZPGB 2ZZDA 2DPPB 2PVGB 3A8MB 1V29B 2CYZB 1UGRB 3QYHB 2ZPFB 4KT0E 4FM4B 2D0QB 1PSFA 4Y28E 5L8RE 1UGQB 3QZ5B 3QZ9B 4L6V5 3WVDB
chains in the Genus database with same CATH superfamily
4EDUA 1AVZC 1C6VX 3QWYA 3QPHA 4AFSC 1KC8U 3M4GA 3CCLA 3L1AA 2QEXQ 1M27C 1TOVA 4BCFB 1M30A 3VU3C 4PFPA 2A37A 4Z02A 5LJ3g 2B86A 4LDUA 3BLRB 2CP2A 1TS9A 2FB7A 1PRLC 3VS7A 2FYKA 4EC9B 3RNJA 5FROA 3TNWB 2FL7A 1JSTB 3Q1JA 5J3BA 2LJ0A 2KMTA 1VA7A 4F7JB 2P4TA 5GAOq 1QVPA 2DETA 3MEAA 3VKGA 1LJOA 1VQNQ 2O31A 4AI6A 4C92A 2GNCA 1BU2A 2RQVA 1VQLT 1YITQ 4C0FA 2BTTA 4CRLB 3OB9A 1H26B 3GLXA 1QCOA 4A4KA 1N6AA 4FYXB 4M78E 4MDWA 4F16A 2IW9B 2W9ZA 1IZ6A 4A4FA 5DQWA 3X26B 2GFUA 3HTRA 4ZGEB 2EAYA 1RI9A 2O4XB 4RG8A 4A4GA 5GANe 3G71T 5CKEA 2AIRB 4BCMB 3DTOA 3VUZA 5DQVA 1T0HA 3NPFA 2DM1A 1U8RA 1UG1A 4M77D 3OYAA 3PIPA 1VQ7Q 1IREB 4ESRA 1W1FA 1OKWB 4RCBA 4E7IA 1DJ7B 1MV3A 4ATOA 4M7AA 1VQ6T 2JS2A 5IHKA 1NPRA 4BY6C 1EX4A 2JMCA 4FT4A 1KG1A 1W2BA 7AT1B 4YTLA 4EMKA 3M0RA 4OVAA 1UGRB 2NLUA 4DEYA 3SB2A 1KFZA 3GBQA 4JDSA 1QWFA 2ED0A 1BI0A 5LJ5j 2BE9B 3SWNC 4DBRA 3S3OA 5HY6A 1YNZA 1QCNA 3C94A 4KRCB 5A0GA 4C92F 4ZTJA 2K2MA 2XDDA 4EOKB 3H9NA 1G8XA 2RQUA 4GLMA 3CCLQ 5GMKe 4BCMD 2E6NA 1NJIU 2KYMA 2MI6A 2C5XB 3QUIA 4HCBA 2DIQA 3FIFA 1YIJT 3OW2S 1Z9QA 1YWOA 4JLIA 4NL2A 2C06A 4NS5A 5LJ3d 2KAFA 5C6SA 1RADB 3G4SA 1TUDA 4HVWA 2E5QA 1PRMC 2CUDA 4F04B 3M58A 3CMEA 1F1BB 5GAOp 1XOVA 2W0ZA 1Z9ZA 3QKJA 2DMOA 2LTOA 4MFEA 2CP0A 5CQXA 1EIFA 1WJRA 2LC4A 4M7AF 2LQ8A 3PMTA 3BLHB 3A8LB 3JCMb 2PVOB 4F17A 4QQGA 1NG2A 2W96A 2EQIA 4QW2A 3QHSA 5DY9A 5EFQB 4E2FB 2VGNA 3URGA 1NLOC 1GY3B 3JB9G 4J9HA 2KR6A 1C1AA 4BCKB 1NEGA 3BW1A 4EOJB 1UUEA 5FU6B 1WHGA 4C0DB 2CGHA 3LWHA 2V1QA 5GMKl 2UZDB 2P4RA 4EMGA 1Y07A 3KFVA 3M0UA 2SRCA 2O4XA 2O88A 4IMYB 3G6ET 1MGQA 3REAB 3MKDA 4GY5A 1RAHB 4C0GA 1YFNA 2KGTA 4M78D 2X4YA 1G3SA 2GF7A 4BCND 2J6OA 2RQTA 4RTWA 2ROLA 4FCYA 1G3TA 2KROA 1S72T 3OQ5A 1JJ2A 3OYHA 2QQRA 2A7YA 2DVEA 2K5IA 1VOMA 1ZUUA 1QVGA 2K3YA 5CKBA 3U23A 5GMKm 4RCCA 1VQLA 4J6XA 2XK0A 2L8DA 2E12A 3JCMJ 2FPDA 3PNWC 4MFDA 5CIUA 3CD6T 4JJDA 4BD3A 3JRZA 1MNDA 2AK5A 2DZCA 1V1CA 3VKIA 3EH1A 2W2HA 1PKDB 4IUPA 3JAME 3C12A 3G71A 1K73C 4BCJB 5GAN4 1NYGA 2WJ9A 3OYEA 2J6FA 3CPWP 1GCQA 2DXTA 5J26A 2X1NB 3PE0A 2J05A 4EORB 2RK1A 1QKXA 1A0NB 2MOXA 3JB9I 4E7LA 3OYIA 1BYMA 1VQ6A 2VGMA 3G4SQ 4KGZB 1K8AR 2BE7D 3E2UA 4JPBW 1YJNQ 2EYWA 3M53A 4BCPB 2QGSA 1QCFA 1YHQQ 4HL4A 4E7SA 3UPUA 4MZMA 4A53A 4JLGA 1U5SA 2RPNA 2EFIA 1KQSP 4CRIA 2JT4A 4J9GA 4RG2A 1W70A 1SEMA 3NFCA 1FXXA 1HD3A 2FEIA 1VQPA 2LNVA 5IF1B 4M7DC 3AHUA 3HB9A 1ZQ1A 1ABOA 1IO6A 2HKQB 2KT1A 2LVMA 3D7SB 4OGCA 1Q7YC 3JB9D 1YIJA 2CT4A 2OX7A 5ACBA 4CI0C 2DD5B 4XTYA 1QW1A 2FHDA 2B9RA 1JXMA 3BHVB 3E9FA 1WGSA 4RMOA 4KBMB 2GQIA 1GBQA 1M9SA 4AFZC 4FSSA 1KXUA 4CFWB 2C5NB 5FWCA 5IHIA 3S3NA 1VQKT 1UECA 2FZKB 2NUPB 4RTZA 1VQOT 3ME9A 3TW7A 2DTHA 2KRSA 4M75E 3CPWS 1YJWQ 1U1SA 3A5ZB 1PC0A 2MK5A 2DEUA 2RD1A 5LJ5h 4NC6A 1GBRA 2IG0A 4AFUC 5LJ3e 1RAIB 3JCMW 1OQKA 2JMAA 2QTXA 1H3HA 2P0QA 2QEXT 2BZYA 1WPYA 3V7SA 3G71Q 2QAZA 1D3BB 4M75G 3MPUB 4XTXA 1JRIA 4R56A 1U06A 1H8KA 1WJQA 1JBMA 1PG5B 2I53A 1UHFA 3G6EA 1B7TA 1KQSS 1BKBA 3BDUA 5LJ3f 5D6XA 2D9TA 4D8DA 3HPWA 2I40B 3QWLA 1S72A 2RNAA 4M77C 1VQNT 1WXTA 5GAN2 1AISB 2MPXC 2DRKA 4ZGJB 1YITT 1M90C 1QQJA 2EKOA 2K6DA 3MP1A 3CBMA 3QYEA 1Q86C 4RTVA 1Q82R 1UDLA 3CD6A 2DL5A 3HFNA 5L23A 4HT8A 4PK4A 1RAGB 3HRTA 1VQPQ 3OS2A 2CH4W 1M3CA 2RA2A 1SHFA 1TU0B 2C5OB 1SSFA 3IQLA 4JX6A 3THKA 4C8QE 1VQ7T 1OKVB 3NHNA 2PJQA 1E6HA 4OMMA 1BCMA 2DD4B 4O5VA 3OYCA 3CXCA 3BHTB 2EYXA 4ZN1A 2QG9B 1T3SA 1H25B 5GAMj 1GL5A 2XDBA 5CO7A 3LGLA 1ZBXA 1T3LA 2DD5A 1WHJA 5LJ5g 2E6ZA 1C9BA 2DF6A 2M51A 4E7ZA 2DILA 3JB9F 2Z0WA 3L2WA 4QT7A 4ZNXA 3O0GD 3GIBA 3RKXA 2KNBB 2QDYB 1VUBA 2D8HA 3HZJA 2E41A 2H3EB 4A4HA 1XNIA 1Y71A 2R5MA 2F5KA 1BB9A 4PJJA 4B9WA 4KT0E 2YHTA 5GJWB 2KRMA 4FIBA 4EOIB 2YDLA 2PK2A 3RKWA 2ROTA 4M75D 1WHLA 1K76A 2XDPA 2MMPA 4IUUA 4LE9A 1D3BA 3CXCP 1IB8A 3CBOA 1H641 3TSWA 3DDQB 1VQKA 2DJZA 2F2CA 5GAOl 1PM3A 2Y4YA 1S72Q 1OX8A 1KD1C 1VQOA 1P5EB 2V22B 2RH2A 1JKWA 3ULRB 2XICA 3O5ZA 4DBQA 4M78C 2NUTB 2XU8A 1H3ZA 3EFRA 3QO3A 2G6FX 3C0CA 4HVUA 5DLOA 3HHTB 1K4US 2XI9A 4LUDA 4XU2A 2WIHB 3UA6A 2CJMB 5GAOm 2LX9A 2QEXA 3H8ZA 1HSQA 4XTVA 2RHXA 5ECAA 5CKHA 2BIVA 4HKEA 3L42A 1TWBA 1K9MC 2DK3A 3HP9A 3INZA 2AZVA 3FJ5A 4IUQA 4R55A 2KYBA 4D8KA 2RO0A 2VKNA 4KGVB 5FU6C 4J9FA 4C0DC 2HQEA 1NEBA 1VQNA 4ELJA 1R77A 2L3QA 2MYSA 3RUXA 4C5EA 1OIYB 1B34B 2DD4A 5HNBB 2KMGA 4M7DB 2GBQA 2ED1A 1OGUB 4HCKA 5EC7A 5LJ5d 1IGUA 3NTHA 4C8QD 1OOTA 4J6WA 2X3XD 3VRYA 1M8VA 1SG5A 1KQ1A 2RMOA 2PU9B 5HCKA 2VASA 2UZEB 3LX7A 3OY9A 4HVVA 3A8MB 3RKYA 3VS1A 4XAXB 4ELZC 1Y0MA 3PFSA 4ROCA 2HL3A 1KIKA 4X9DA 4M77G 2LP5A 5A0DA 5DLQE 2J6KA 3UF4A 1RUWA 2QQ8A 2BPMB 4I3ZB 4FW2A 2L0AA 2QA4Q 3BFMA 3MEWA 3L2QA 3G4ST 1SRLA 2BS4A 1YJNT 2M1HA 3E19A 2VV5A 2IIMA 1YHQT 3OS1A 3BG5A 2V1RA 1FMVA 3GP8A 2COYA 4FW1A 2DIGA 2LCCA 1K1ZA 1UJYA 1NLPC 2E4HA 2G3RA 1PCXA 5CYIB 2X4WA 4CC2A 1SF9A 5IH2A 2EQKA 2KE9A 2DLPA 2K2VA 2UUEB 4X34A 2L3SA 2XIDA 2WFYB 2KR3A 2CT3A 3V7CA 2NUTA 3JCMQ 3M55A 3V8JA 3LGFA 3E9GA 4L5GA 4BCQD 2YLCA 1D1AA 1WHHA 4IUTA 4RTTA 3OS0A 2DFUA 1UGVA 4M77B 1F5QB 4F7LB 3I5RA 2X4XA 4Z88A 4QQ6A 3A8HB 1H27B 2LMJA 2A0FB 3JSCA 1BI2A 4OMLA 4BI8B 5HVYB 1RLPC 3VS4A 5GAMh 3M54A 1M3AA 2KK4A 2EQJA 2VUBA 2BS2A 1K73U 4X9CA 5FLXE 1D0ZA 2QXFA 1BBZA 2ZPIB 1YJWT 3BE3A 3H6ZA 1Q7YR 3POMA 3I9QA 2JJ9A 3OSVA 2EGAA 1B34A 4YC3B 2X51A 4QKUA 5GANj 4M7DA 1LOJA 3TU4K 2DBKA 2NYSA 3HRSA 4LDXA 1SKUB 3RMQA 1D09B 3TCJA 2W9FA 1V29B 3QYHB 5FGKB 2ZPFB 3GOXA 1SPKA 3JB9J 3L2RA 2DKGA 1NJIR 2L3PA 4Y28E 5L8RE 1UGQB 1G3WA 3OYYA 3KBGA 1CKBA 3QYBA 4M78G 1XJWB 1QWEA 3GPLA 5IDNB 2RI3A 5HKCA 5GAN3 3VRZA 1FINB 1E9HB 2JTFA 3CCUT 3NMZC 3QJ6A 2NWMA 4OP0A 1FYNA 1Q81C 3GNGA 1N4MA 4RTXA 3R6OA 2ATCB 1Q7YU 2ECZA 1YJ9Q 2AT1B 2IVXA 4CC7A 1VYVA 1MMAA 3J81E 2WACA 1S1NA 1I07A 2K5FA 1N8RR 1TH7A 3J7AF 4JJCA 2M16A 1HJDA 2WMBB 2R58A 1UTIA 4HNUA 1VQPT 5GMKj 1PHTA 2MWPA 1RI0A 1UEBA 1R0BG 1FWZA 3FEOA 3FRNA 4EC8B 4EOSB 4YOZA 2FPEA 3CBPA 5GAMg 4JX4A 3OYDA 4PFOA 4M7DF 5A2QE 1OI9B 4J9CA 4Y72B 3FDRA 2ZGWA 2L89A 1M90R 3GTMS 2RJDA 4M78B 5HK0A 5I22A 4BCNB 1UFFA 4BXXX 3OMGA 1AWJA 5KYWB 1YJNA 3I55Q 1PNJA 4B6MA 4M77A 1YHQA 1D3UB 2BS3A 2R7GA 4M75C 1EFNA 4PJOE 5GMKi 1H1PB 1VQ9A 4QVDA 2P0KA 1W2BP 4F6UB 1QVFA 2E65A 3N5BB 2RB6A 3LWIA 4HCCA 1WHKA 3A98A 4N4GA 1U3OA 2XKOC 5LJ5f 5IT9E 2CSQA 1N8RU 3A1PA 2DVJA 3BLQB 4CFMB 2K57A 2A36A 4OB1B 3RDVA 3LH0A 4M6VA 2RJEA 2P0PA 4PJOG 1RAFB 1NPPA 4MMKA 1MNEA 2BKZB 1WDXA 4PLIA 1M90U 2QF7A 3HKSA 3VS3A 4FM4B 5GAN7 2D0NA 3SFMA 3EH2A 1Q86U 1M4ZA 3V8KA 2PHGA 2L2PA 1HXDA 1WLPB 2EW3A 2EJ9A 1IRXA 3ZFJA 2DX1A 1SHGA 2O9VA 4LOCA 1OZ3A 1YJWA 3H0HA 4HXJA 1UNGD 2VYTA 3P8DA 4BY7X 4DBFA 4X1VA 2CREA 4M77F 3CC2T 1G83A 3LYIA 1VQ4A 4CXAB 1NYFA 2MCNA 4A4EA 4PNOA 2W10A 2JW4A 3SEMA 2EKHA 1CKAA 4J9EA 1D1CA 2WSEE 4AKHA 4UC4A 1WQ7A 2SEMA 2OAWA 4WCIA 1KD1R 1X27A 1TFBA 2X9HA 2KY9A 1VOLA 4KRDB 5KE3A 5GAMd 2D8JA 5AT1B 2DXUA 2DE0X 2DERA 1VINA 3CCUA 2B8AA 3EG3A 1UE9A 4OMNA 2LCLA 1MHNA 2RI5A 1JJ2P 3EFSA 1ZUYA 2C0TA 1OL2B 1VQ9Q 4M78A 4DQ2A 3FLGA 1QVGP 5KYWA 2DL8A 5I21A 4BE1A 3CC4Q 4EOOB 1K9MR 3M0SA 1YI2A 1LNXA 4DOVA 4OB2B 2I0NA 3LH5A 5KCHA 2ZZDB 2IVWA 1QKWA 2J06A 4HT9A 1VYUA 3MI9B 1AWXA 1KD1U 4AMCA 4PJOD 5AYFA 2JGZB 2DEQA 1M5Q1 3H4CA 1JXOA 5FWBA 2QA4T 4EOPB 2RQRA 1WA7A 3LQ5B 4ELLA 2MF2A 2PNIA 4EMHA 1BIAA 2BUDA 3BDLA 4DBHA 1KQ2A 3EHQA 3EG0A 1ZSGA 3QZ5B 4P5NA 3WVDB 4BACA 1OZ2A 1ZHIA 1VQMQ 2HL5C 3CCET 4RTUA 1RL2A 1URCB 2EYZA 1GH6B 2JZ2A 1K9MU 2GTOA 4HCZA 1VQ4Q 4F7SB 2CKKA 4M78F 2EGCA 1XQHA 3QYGB 4J5YA 2EUFA 5GMKh 3S6WA 2BZXA 1OYXA 2V8JA 3NDQA 5L2WB 4EOQB 2E5KA 1QVGS 1G3NC 1UGSB 2EIFA 5IXFA 2LW4A 3CCUQ 3TVTA 3DJBA 1LPLA 2GCXA 3MY1B 4Z8AA 2D1XA 2OJ2A 3CCRT 2IW6B 4FL6A 3DLLA 5GANg 2FRWA 2JOYA 3CC2A 4BDZA 4E7KA 2WSFE 1JB0E 2C4GB 1B07A 1YI2Q 5IN1A 3UA7A 5CCAA 3EG2A 1YCYA 3L2ZA 4FSXA 2KSSA 4Z89A 2DYBA 2RQWA 2YUQA 2PMIB 4Q5WA 2VC8A 2O01E 5C0MA 4OF1A 4J83A 4II1A 5EG2A 3VS0A 2K5LA 1WX6A 3EG9B 2QK0A 4M75B 3QJYA 5A0LA 1TTHB 3VKHA 4AT1B 4KUIA 2ZZDA 2GFAA 2RHYA 4G6LB 3OYFA 2A28A 1PSFA 4A54A 4BCHB 4HLQA 2YRCA 2GQVA 1C0MA 1YJ9T 4ME7A 3TNHB 4C8QG 2EVRA 2KRNA 2E3IA 4OB3B 4LUEA 1M8MA 3X25B 1PWTA 1X69A 4KH1B 2E1HA 3PIOA 2YRVA 1TSFA 5GAMe 4ELYC 1MMDA 4Y91A 4VUBA 4ORZA 3MCAB 3NTKA 3X28B 1WXUA 1O75A 4D6WA 2RJCA 1Q81R 4BI4A 2QASA 1AWOA 1W98B 2L5QA 1M1FA 2G9XB 2CP5A 4C92E 2QA4A 1N27A 3FC3A 5CVIA 2EJFA 4FYWB 2FRYA 4BI3A 1VQ8T 3CCJQ 2HMAA 5GAMf 1P92A 3RERA 3CC7Q 3I55T 3PGGA 5KE2A 4OMPA 5KCOA 5HQ0B 5BNJB 3M59A 4JZ4A 3JCMh 4XTUA 1I81A 3A8OB 2PUKB 5CK9A 3KUFA 3CMAQ 2M0YA 3HFOA 3CCEA 1R0CB 1YCSB 2LZ6B 5FU7C 2QFZA 3RGFB 1Y7XA 1KJWA 3I56Q 4C92G 1D1BA 4L59A 3T9NA 4C8QB 3A8GB 2ABLA 4BE2A 3LLRA 4PJNA 3CC2Q 1ARKA 1QMZB 1V76A 2QQSA 5GANd 3EFOB 1RAAB 2L3RA 5CKDA 5M9OA 1NZ9A 1GFCA 1X6GA 4M7AE 1Q81U 1RABB 2YUOA 3WVEB 4BBSM 4CC4B 4CFVB 1YP5A 3M57A 4KGXB 4MZPA 4O6JA 2FO0A 1K8AC 2DJQA 3JCMV 4J7IA 3TQ7P 3DL1A 3SD4A 4JS5A 2LDMA 3JCMX 4LD6A 2OTLQ 3HBLA 4JRQA 1SSHA 2PVGB 4M7AG 2JXBA 3CCSA 2K79A 3EG9A 1X2KA 2IN3A 4M75A 3EG1A 1OPLA 4BUGA 5GAN5 1BK2A 4XU0A 2KI7A 3CCRA 4JS4A 2CP7A 4GLKA 3CCVT 1TUCA 3QSUA 3EIDB 4EOLB 3OSSC 2H3JA 1AWWA 2KBTA 4JRKA 5CR2A 5CKFA 3S3MA 2C5VB 4J9BA 1KHCA 1ZSZB 2F5TX 4XU3A 3BG9A 2F2VA 3DOGB 4BY1X 3CXCS 2H8HA 3JCMP 1BIBA 3TN8B 4GBQA 2CH4A 4BCQB 2M0OA 1OU8A 1OX9A 4OMQA 2DL4A 2CZ1B 1X6OA 1UB4A 1ZP2A 3OYMA 3JCMg 2EYYA 1T0JA 2R5AA 3H0IA 2CZ7B 4F7UE 1K0XA 1MV0B 4J9DA 4MMLA 2NUZA 2A3LA 3UT1A 1BI3A 3J80E 3DDPB 3EGDB 2IPOB 1PSEA 5IHNA 4PJOC 1PD1A 1ZX6A 3ZEHA 4CFUB 1YJ9A 2R57A 1VQ9T 2VWFA 3CCEQ 1K73R 4BCIB 1VIFA 4F70B 3CC4T 5EJCA 4F7UG 4M75F 5HBEB 4N0AC 1O9KB 4KRTA 4C92D 4QSHA 3RBBB 5IAYA 2XD0A 3EHRA 2Y90A 3V7RA 1AD6A 3EOCB 3UATA 3EGUA 3OW2A 2JN0A 4C8QA 5LQFB 3CCMQ 5DM7R 1M1KC 1BI1A 2FG0A 3NGPA 2QQ9A 3EFOA 1ZUKA 2QQBA 1H28B 1Q95G 3ZL7C 2V26A 2RHIA 4R0KA 5KYYB 1VQ8A 2AZSA 4XTWA 2LNHB 4RODA 4LNPA 2DRMA 2PUOB 1WIEA 3I55A 2F2XA 1OV3A 2VB6A 1VQMT 1JOWA 1FMKA 2KXDA 3REBB 3CCSQ 2OTJQ 1Y57A 4M7AD 3P8BB 4CFUD 4PJMA 5J39A 4BCGB 4AKIA 3CCRQ 1Q82C 2HD0A 2WIPB 1TD6A 2HBPA 4JX5A 4L6V5 2C0OA 2HDAA 1KHIA 2X3WD 1VQ4T 2F69A 3M0TA 4F7UB 3X24B 2RN8A 4LD9K 1GFDA 4C0ZA 2ESWA 4OMOA 1E7OA 3VUBA 3OW2P 2M02A 1ZSZA 2A08A 2CCIB 3PMIA 4CFXB 2FZCB 3I5SA 4C8QF 1ZLMA 2HSEB 4JZ3A 3JCMd 1EZZB 3CQTA 2VVKA 4E7JA 1GXIE 4E6RA 1D0XA 2Y4XA 3CCVA 2KVQG 2LQWA 2ZCFB 2HCKA 1G2BA 3H41A 1WYXA 3EGDA 1WFWA 1RAEB 2HZYA 3L2VA 1MUZA 2RHUA 2DXCB 2DTIA 4WTOB 5GANf 1ZBJA 4AG2C 1YI2T 3G7ZA 1K0SA 1W4SA 5I2SA 1QP3A 2KEAA 3M5AA 2HNIA 3QWXX 2HBWA 4J6YA 4BE0A 2K3XA 5GJVB 1O9KA 4XTZA 2JUFA 1M3BA 4XK8E 4OB0B 2K7AA 5GAOn 3I35A 4PFZA 5FU7B 4J7FA 5LJ5e 1G5VA 1VQ8Q 4HNTA 8AT1B 3MP8A 1UNHD 1Q86R 2MAMA 4M4ZA 3PO3S 5KYYA 3G1JA 2C6TB 2KDSA 2CS7A 4AFQC 2CYZB 4KULA 1RACB 2DZ9A 2WPAB 4J8OA 3CC4A 2HSPA 2D0QB 1CSKA 2LT1A 4J9IA 4NOYA 3WXMB 1J3TA 1AZGB 5LMKB 3QHWB 2PQWA 4EONB 1VIEA 2K3BA 2DA9A 1ZA1B 1K9AA 4F6WB 2QDLA 3CEYA 1XTDA 1OU9A 2AKKA 3TREA 2KT8A 1WZOA 2G77A 3OMCA 4F7UA 4B9XA 5CAIA 3VYGB 1B3QA 3ASKA 5GAOr 4F7NB 4BB7A 1YBYA 2IW8B 1ENWA 1N9SA 3CCJT 1QMCA 1XO2A 2CZ0B 3OA6A 3CC7T 1NM7A 3CPFA 3META 2JVVA 1H92A 3QDRB 1I4K1 4A63B 1SRMA 3PVLA 1I5OB 3VS2A 3CPWA 1VQMA 3OS5A 2DBMA 5IDPB 2XG8D 3PVQA 3CMAT 1WNLA 4JRPA 1LVKA 2LRQA 2E70A 5KYUB 4FYYB 4N4HA 3CCVQ 3OYKA 3I56T 3C95A 2EJGA 1VQ5T 2LX7A 1I5LA 4LDWA 1QVFP 3G33B 3CCQT 3MP6A 4LN2A 4CC3A 1KC8C 5KYXB 1OULA 2LJ3A 1QLYA 2GGRA 1FMWA 3OYLA 4IIMA 1MMNA 2W99A 2MIOA 2PTKA 3JB9H 1X01A 2XHCA 1KQSA 4C8QC 3X20B 1X75C 1WXBA 4PJOB 2DXCA 1JEGA 1R8OB 2CUBA 3QDFA 2K9GA 1W2BS 1WI7A 1OPKA 2FVUA 4MZTA 2OTLT 2HQXA 2ZPEB 1UNLD 3MIAB 4F7UF 3EJ1B 2EGEA 3M03A 2WSCE 1PKTA 1TUGB 4LXCA 2AKLA 3M56A 1H1QB 4AKGA 5D7UA 3F70A 1E6GA 1N9RA 1WQWA 4IUVA 4HA8A 2E64A 3M4YA 4Y92A 4ZTFA 1KK7A 5HK3A 1TXQA 1IHWA 1QLBA 2PK9B 2RI2A 2JM8A 2ZAEA 1AD5A 5GANh 4E7HA 1FKMA 3CMEQ 3JCMe 1AEYA 3TEEA 3ER0A 3OBYA 2CDTA 3PT9A 2ENMA 2DYIA 5D6WA 4PLLA 4C92C 4DEXA 4RKUE 3HO8A 1ZSZC 3BY7A 3TSZA 3O8VA 4II5B 1QVFS 2QGFB 2YUNA 2YRDA 1E7PA 3JCMf 1WJSA 2DL3A 3VYGA 2CZ6B 1Y96B 3RESA 3FB9A 1HYOA 5GAN8 3MJXA 1YN8A 1RLQC 3TNIB 2YLBA 3QG1A 1K8AU 5KH6A 5LJ3j 1U1TA 2OAUA 4AG1C 5CEIB 1GCPA 4M7AC 5KYUA 1M1GA 3DKMA 4XQ3A 2QTVA 1PKSA 1BU1A 1NJIC 2ZPHB 3OYBA 3CCMT 2EQMA 2CP6A 4YOOA 3C4SA 4EMKC 1H1SB 2LQNA 4BDYA 1JJ2S 5KYXA 4JRIA 1VQLQ 3KXTA 3PTAA 3JV3A 3M0PA 2WEVB 2RM4A 3CCJA 2LQKA 3HRUA 3VS5A 1M2OA 3BHUB 3CC7A 4OGRB 3HSBA 4PJOA 4DA4A 4CFNB 1I0CA 2DMEA 4BCOB 2FZGB 5I2MA 3CCST 2V8IA 2OTJT 3CMAA 3MY5B 3R6NA 2J7IA 4BY6B 2OI3A 1IGQA 2DL7A 3HL8A 3I56A 1N8RC 1VQ5A 3SHWA 1M1KR 3NTIA 4N0AA 8ATCB 2LT4A 3CCQA 2YWWA 4V2SA 2QYZA 1H4LD 2EWNA 1VQ6Q 2RK2A 3SWNB 4MDXA 1AOJA 2E3HA 2V8KA 3RMSA 2DAQA 4C5GA 2QDJA 1OL1B 1ABQA 4HNVA 1N5ZA 2JTEA 2RF0A 2F2WA 4IURA 4XU1A 1GUXB 1QP2A 3QXEB 5I5ZB 2OTLA 4LDVA 2F1LA 1D0YA 4EOMB 4QVZA 3B57A 2M9UA 2RJFA 4F6SB 3OBWA 4TTHA 4PJLA 1X2QA 4ZN3A 1KSWA 1JQQA 3M9QA 1I1JA 3VYHB 3JCMc 1M1KU 2EQUA 3OYGA 1YIJQ 4WF2A 1YWPA 4PJOF 2DTOA 1IHVA 2UZBB 3DB3A 4KUDK 1NE8A 1UHCA 4C5HA 1AZEA 1Y96A 3V8LA 2EBPA 3TW6A 3RR6A 4E47A 3UWNA 2EYQA 3OYNA 1VYWB 1IXDA 3MEUA 5HBJB 4PKCC 4JJNK 1I8FA 1MMGA 1X43A 3VV0A 3LW5E 3OYJA 2DXBB 5FRNA 1UJ0A 1Q82U 4ROEA 3AT1B 2BKDN 2NUPA 4FX3B 3GF5A 4KH0B 2KXCA 4F14A 3EGXB 5LL6S 3CCLT 2O9SA 4M7DE 4ZGDB 4EPCA 5I11A 4OGEA 4NSTB 3E1SA 2HEQA 2ZPBB 4UN0A 5FRMA 1GCQC 2PZ1A 1H1RB 2JM9A 3QIIA 4RTYA 2D6FA 4MIMA 2HAXA 1VQ5Q 1GRIA 3KHIA 1ACMB 3G6EQ 1H24B 2JS0A 2VXEA 4BBRM 3QBYA 2COWA 5D6YA 3CCQQ 3M0QA 2LJ1A 1JU5C 2DO3A 1W6XA 4DOWA 1ZA2B 5FW9A 4M7DG 3CCMA 2DNUA 1M2VB 2BZ8A 2KQWA 2EPDA 2HKNA 4QQDA 2QI2A 3QZ9B 3BG3A 2C0IA 3EAEA 1AT1B 5KYNA 3H0FA 4LDYA 3SWNA 3UDCA 4RUGA 5GAN6 1JO8A 1WHMA 4YOSA 2JTMA 2WMAB 3RIRA 4EIKA 1X6BA 3DLMA 3CD6Q 4FT2A 4Z6YA 3MHXA 4C5IA 2X4JA 9ATCB 4FYVB 2OTJA 1GUXA 2XMFA 3F5XB 2K4YA 3K7AM 1OEBA 4QVCA 2UZLB 4OR5B 5ICPB 1VYTA 4C92B 2HQHA 4ANJA 1AHJB 5LJ3h 3VS6A 3QHRB 2AHJB 2O2OA 4IKFA 2PVDB 3MEVA 3SDZA 2JNGA 2FPFA 2YUPA 1YITA 3FJPA 4M77E 1FVVB 2YSQA 2X35A 4TVRA 2WHBB 1HK9A 2QGGA 3L2UA 2YXYA 2VXFA 2RHZA 2P84A 3DB4A 4PL6A 3P8HA 4NL3A 2DXBA 1UGPB 1FX7A 2YT6A 1KC8R 4M7AB 4JUVA 2QQAA 5HBHB 4FU6A 1VQ7A 1PD0A 1O9SA 2MWOA 3EGXA 1LCKA 4N4IA 3GNFB 3ZBDA 1NBEB 4EMKB 3VJPA 2WXVB 6AT1B 2LCSA 2GTJA 1G3YA 5IHYA 1BCOA 3CMET 4K11A 2ZPGB 2I2LA 1VQKQ 2DPPB 4OMFB 2COZA 2CSIA 2E10A 4M7DD 1OIUB 1VQOQ 2CCHB 1TG0A 4IIOA 3MO8A 5CQYA 1JSUB 5IXBA 1OI1A 2CP3A 1M2VA 4JJBA
chains in the Genus database with same CATH topology
4M75D 4EDUA 3CEYA 1XTDA 3QPHA 2XDPA 2MMPA 1KC8U 4IUUA 3M4GA 3TREA 3CCLA 1D3BA 3L1AA 2G77A 2JZ2A 3OMCA 1K9MU 4F7UA 3CBOA 4B9XA 5CAIA 3VYGB 4HCZA 1H641 3VU3C 3ASKA 1VQKA 2DJZA 5GAOl 4Z02A 5LJ3g 5GAOr 4BB7A 1YBYA 4LDUA 2Y4YA 1N9SA 3CCJT 2FB7A 2CKKA 4M78F 1KD1C 1XQHA 1VQOA 2CZ0B 2FYKA 2RH2A 3OA6A 3CC7T 3QYGB 2XICA 2FL7A 4J5YA 3CPFA 3Q1JA 5J3BA 3S6WA 3META 5FROA 2JVVA 3QDRB 1I4K1 2KMTA 4M78C 2XU8A 1OYXA 1H3ZA 2P4TA 2V8JA 3EFRA 5GAOq 3CPWA 3QO3A 3OS5A 1VQMA 5DLOA 1QVPA 2XG8D 3CMAT 1WNLA 3HHTB 2XI9A 4JRPA 3MEAA 4XU2A 2LRQA 2E70A 1QVGS 4N4HA 5GAOm 2LX9A 3VKGA 1LJOA 3OYKA 3I56T 3C95A 2EJGA 2QEXA 3H8ZA 4AI6A 1VQ5T 4C92A 1I5LA 4LDWA 4XTVA 1VQLT 1UGSB 4C0FA 2EIFA 3OB9A 2RHXA 3GLXA 4A4KA 3CCQT 3MP6A 5CKHA 1N6AA 2BIVA 4HKEA 1KC8C 2GCXA 4M78E 4MDWA 3L42A 1IZ6A 1K9MC 4A4FA 2DK3A 4FL6A 3CCRT 3OYLA 3X26B 2GFUA 3DLLA 3HP9A 5GANg 3INZA 3JB9H 1X01A 2XHCA 4ZGEB 2EAYA 4A4GA 2O4XB 4RG8A 5GANe 3G71T 1KQSA 4C8QC 5CKEA 3X20B 1X75C 2JOYA 4PJOB 2DXCA 4IUQA 4R55A 1R8OB 3CC2A 4BDZA 3VUZA 2RO0A 3CD6T 4E7KA 5FU6C 2WSFE 4C0DC 2HQEA 1JB0E 1W2BS 1VQNA 4ELJA 1U8RA 4C5EA 3RUXA 1B34B 2DD4A 2FVUA 4M77D 5IN1A 3PIPA 4MZTA 5CCAA 1IREB 2HQXA 2KMGA 1YCYA 2ZPEB 3L2ZA 4FSXA 2OTLT 2KSSA 4M7DB 4RCBA 4F7UF 4Q5WA 2VC8A 2WSCE 4E7IA 1DJ7B 2O01E 4OF1A 3M56A 5C0MA 4J83A 3NTHA 5LJ5d 1VQ6T 4C8QD 1NPRA 5GMKh 4II1A 4AKGA 4J6WA 3F70A 5EG2A 1N9RA 2K5LA 1WQWA 4IUVA 4BY6C 1M8VA 1KQ1A 4M75B 3QJYA 2PU9B 4FT4A 5A0LA 4HA8A 1KG1A 3VKHA 2E64A 3M4YA 3LX7A 4KUIA 3OY9A 1W2BA 2ZZDA 4ZTFA 3QSUA 4YTLA 4EMKA 2GFAA 3A8MB 4OVAA 2RHYA 3RKYA 5HK3A 1UGRB 2NLUA 4XAXB 3SB2A 3PFSA 4ELZC 1QLBA 4JDSA 3OYFA 1PSFA 1BI0A 2RI2A 4X9DA 4A54A 4M77G 4HLQA 5LJ5j 5A0DA 5DLQE 3SWNC 2GQVA 3S3OA 5HY6A 1YJ9T 3C94A 5GANh 4E7HA 1FKMA 3JCMe 2QQ8A 5A0GA 4ME7A 4C92F 3ER0A 4ZTJA 3OBYA 3PT9A 4C8QG 3BFMA 3MEWA 3L2QA 5D6WA 4OB3B 2XDDA 3G4ST 4PLLA 3X25B 4C92C 5GMKe 2E6NA 1NJIU 2BS4A 1YJNT 2M1HA 2MI6A 3QUIA 4RKUE 4HCBA 3HO8A 2VV5A 3E19A 2DIQA 2E1HA 3BY7A 3FIFA 3PIOA 2YRVA 1YHQT 3O8VA 3OS1A 3OW2S 1YIJT 4LDXA 5GAMe 3BG5A 4ELYC 1QVFS 3GP8A 4JLIA 4Y91A 4NL2A 2DIGA 4VUBA 3MCAB 2C06A 3NTKA 3X28B 2LCCA 4NS5A 5LJ3d 1E7PA 2KAFA 3JCMf 1WJSA 5C6SA 3VYGA 3G4SA 1O75A 2G3RA 4D6WA 2RJCA 2E5QA 2CZ6B 2X4WA 4BI4A 1Y96B 3RESA 3M58A 5LJ3j 3FB9A 3CMEA 2L5QA 1M1FA 5GAN8 2EQKA 4C92E 5GAOp 1XOVA 2QA4A 1N27A 2K2VA 3QKJA 5CVIA 3FC3A 2EJFA 4X34A 2LTOA 1VQ5A 4BI3A 4MFEA 5CQXA 1VQ8T 1EIFA 2XIDA 5GAN5 1WJRA 3V7CA 5GAMf 1P92A 2LC4A 3JCMQ 4M7AF 2LQ8A 3RERA 2YLBA 3PMTA 3M55A 3V8JA 3A8LB 3LGFA 3QG1A 3JCMb 1K8AU 3I55T 3E9GA 5KH6A 3PGGA 4L5GA 5KE2A 2PVOB 1U1TA 2YLCA 2OAUA 5KCOA 3M59A 3JCMh 4XTUA 1I81A 4QQGA 4M7AC 3A8OB 2PUKB 5CK9A 1M1GA 3DKMA 3KUFA 4IUTA 3OS0A 4M77B 3HFOA 4XQ3A 3CCEA 4QW2A 5FU7C 2QFZA 3QHSA 5DY9A 2X4XA 2VGNA 4QQ6A 1NJIC 3URGA 3A8HB 2ZPHB 1Y7XA 3OYBA 3CCMT 3JSCA 1BI2A 2EQMA 3JB9G 3C4SA 4C92G 4L59A 3T9NA 4BI8B 2KR6A 4C8QB 3A8GB 4EMKC 4BE2A 4BDYA 1JJ2S 4JRIA 3BW1A 5GAMh 3KXTA 3M54A 3LLRA 3PTAA 5GANd 2QQSA 5FU6B 2KK4A 2RM4A 4C0DB 2CGHA 2EQJA 2VUBA 2BS2A 3LWHA 3CCJA 1K73U 2L3RA 2LQKA 4X9CA 5FLXE 5CKDA 1NZ9A 5M9OA 3HRUA 2QXFA 4EMGA 4ATOA 1Y07A 2ZPIB 4M7AE 3CC7A 2O4XA 3G6ET 1YJWT 3H6ZA 1Q81U 3HSBA 1MGQA 4PJOA 4DA4A 4GY5A 4C0GA 5I2MA 4M78D 2X4YA 3WVEB 4BBSM 1G3SA 2GF7A 2V8IA 3OSVA 3CMAA 2OTJT 3M57A 1G3TA 4MZPA 1S72T 1B34A 3OQ5A 4BY6B 4O6JA 3OYAA 3OYHA 1JJ2A 2QQRA 5GANj 1K8AC 4M7DA 3JCMV 1N8RC 4J7IA 3HL8A 3I56A 3DL1A 1LOJA 2A7YA 2DVEA 3HRSA 3SD4A 4JS5A 2K5IA 2LDMA 3JCMX 3TU4K 1QVGA 2K3YA 4LD6A 3NTIA 5CKBA 4BUGA 3RMQA 4RCCA 5GMKm 1VQLA 4N0AA 4J6XA 3HBLA 4JRQA 3TCJA 2LT4A 2PVGB 2XK0A 2L8DA 3CCQA 4M7AG 3CCSA 2E12A 1V29B 3QYHB 3JCMJ 4V2SA 2EWNA 2ZPFB 3GOXA 3JB9J 4M75A 2RK2A 3PNWC 3SWNB 2DKGA 3L2RA 4MDXA 4C5GA 2V8KA 3RMSA 4MFDA 2DAQA 4XU0A 4Y28E 5CIUA 5L8RE 4BD3A 2QDJA 3JRZA 4GLKA 1UGQB 1G3WA 3CCRA 3CCVT 2DZCA 3OYYA 3KBGA 3QYBA 4M78G 4HNVA 3VKIA 3OSSC 4IUPA 3JAME 3G71A 3C12A 2H3JA 1K73C 5GAN4 4JRKA 3GPLA 5CR2A 2RI3A 5CKFA 5HKCA 2WJ9A 5GAN3 3OYEA 3S3MA 4IURA 2JTFA 3CCUT 4XU1A 3QJ6A 2DXTA 4OP0A 1KHCA 1QP2A 5J26A 2F5TX 4XU3A 1Q81C 3GNGA 3BG9A 3R6OA 1Q7YU 3QXEB 2OTLA 2RK1A 4LDVA 3CXCS 4QVZA 3JCMP 3JB9I 2M9UA 1BIBA 4E7LA 2RJFA 3OBWA 3OYIA 1BYMA 2M0OA 1VQ6A 2VGMA 2CZ1B 1X6OA 3J81E 4ZN3A 1UB4A 2WACA 3OYMA 2K5FA 3M9QA 3JCMg 1TH7A 3M53A 3VYHB 3JCMc 2R5AA 1M1KU 2M16A 3J7AF 2CZ7B 2EQUA 3OYGA 2R58A 4HL4A 4WF2A 4F7UE 3UPUA 4HNUA 4PJOF 1VQPT 2DTOA 5GMKj 3DB3A 4MZMA 4A53A 4KUDK 2MWPA 4MMLA 2A3LA 3UT1A 1NE8A 1RI0A 1BI3A 4JLGA 3J80E 1UEBA 4C5HA 1FWZA 3FEOA 3FRNA 1Y96A 2EFIA 3V8LA 4CRIA 1PSEA 3TW6A 4PJOC 4E47A 3UWNA 2EYQA 3CBPA 3ZEHA 5GAMg 4JX4A 3OYNA 3OYDA 4M7DF 5A2QE 1YJ9A 3MEUA 4RG2A 2R57A 3NFCA 1FXXA 1VQ9T 4PKCC 3FDRA 4JJNK 2ZGWA 2L89A 1VQPA 2LNVA 1I8FA 1VIFA 4M7DC 2RJDA 3VV0A 3AHUA 3HB9A 4M78B 1ZQ1A 2LVMA 5HK0A 3CC4T 5EJCA 4OGCA 3LW5E 3OMGA 1Q7YC 4F7UG 1YJNA 4M75F 3OYJA 2DXBB 3JB9D 4N0AC 4C92D 5FRNA 1Q82U 4QSHA 4M77A 5IAYA 1YIJA 1YHQA 2XD0A 2BKDN 2BS3A 4M75C 4PJOE 4CI0C 2Y90A 3V7RA 5GMKi 2DD5B 4XTYA 1VQ9A 4QVDA 3OW2A 1QW1A 2FHDA 3GF5A 2JN0A 2P0KA 3E9FA 1WGSA 4C8QA 2E65A 1QVFA 3N5BB 2RB6A 4KBMB 4RMOA 3LWIA 4HCCA 4M7AA 4N4GA 5DM7R 1M1KC 1M9SA 5LL6S 2XKOC 5LJ5f 3CCLT 1BI1A 5IT9E 1N8RU 2QQ9A 4M7DE 4ZGDB 4EPCA 3S3NA 1VQKT 4OGEA 3E1SA 2ZPBB 2K57A 2QQBA 5FRMA 2RHIA 4OB1B 1VQ8A 3QIIA 2D6FA 3LH0A 4M6VA 4MIMA 2RJEA 4XTWA 1VQOT 2HAXA 2P0PA 3KHIA 3ME9A 3TW7A 2DTHA 4M75E 3CPWS 2PUOB 4PJOG 1U1SA 3A5ZB 3I55A 1NPPA 2VXEA 4BBRM 4MMKA 3QBYA 5D6YA 1VQMT 4JS4A 2RD1A 5LJ5h 4PLIA 4M7AD 4NC6A 3P8BB 1M90U 2DO3A 2IG0A 2QF7A 3HKSA 4DOWA 5LJ3e 5J39A 3JCMW 4AKIA 4M7DG 4FM4B 5GAN7 3CCMA 2QTXA 1Q82C 3SFMA 2HD0A 2KQWA 1Q86U 1M4ZA 2P0QA 3V8KA 2QEXT 4QQDA 1WPYA 3QZ9B 1HXDA 3BG3A 2QI2A 2HBPA 4JX5A 3EAEA 4L6V5 3V7SA 1KHIA 1D3BB 2EJ9A 4LDYA 3SWNA 3UDCA 5GAN6 1VQ4T 2F69A 4F7UB 4M75G 3ZFJA 2JTMA 3RIRA 4XTXA 3X24B 4LD9K 1JRIA 3DLMA 4R56A 4LOCA 1OZ3A 1WJQA 4C0ZA 1JBMA 3G6EA 4FT2A 4Z6YA 3MHXA 1YJWA 4C5IA 1KQSS 1BKBA 3BDUA 5LJ3f 3VUBA 2VYTA 3P8DA 5D6XA 2X4JA 2D9TA 2OTJA 4M77F 3CC2T 3HPWA 3LYIA 1VQ4A 3QWLA 2K4YA 1S72A 4A4EA 3PMIA 4PNOA 4M77C 1VQNT 5GAN2 4QVCA 4C8QF 4ZGJB 1YITT 3JCMd 1M90C 4C92B 2EKOA 3MP1A 1AHJB 2WSEE 3CBMA 3QYEA 4AKHA 5LJ3h 4UC4A 4E7JA 1GXIE 2AHJB 1Q86C 1WQ7A 4IKFA 2PVDB 2Y4XA 3CD6A 3MEVA 3HFNA 3CCVA 4HT8A 2KVQG 2ZCFB 2KY9A 3SDZA 2JNGA 5KE3A 5GAMd 1YITA 3FJPA 3HRTA 4M77E 3OS2A 2DXUA 3L2VA 2RA2A 2X35A 4TVRA 2RHUA 1HK9A 1SSFA 3CCUA 2B8AA 2DXCB 2DTIA 5GANf 4JX6A 5GMKl 1YI2T 3G7ZA 1W4SA 1MHNA 2LCLA 2RI5A 4C8QE 3L2UA 2VXFA 2RHZA 1VQ7T 3EFSA 5I2SA 3DB4A 1QP3A 3P8HA 4PL6A 3M5AA 2DD4B 4M78A 2HNIA 4O5VA 3FLGA 4J6YA 4DQ2A 4NL3A 2K3XA 3OYCA 3CXCA 4BE0A 2DXBA 1UGPB 1FX7A 4ZN1A 5I21A 4XTZA 2JUFA 4BE1A 5GAMj 4XK8E 2XDBA 4OB0B 5CO7A 3LGLA 4M7AB 1ZBXA 5GAOn 4JUVA 2QQAA 2DD5A 1YI2A 5FU7B 4FU6A 1LNXA 5LJ5g 2E6ZA 4DOVA 1VQ7A 4J7FA 5LJ5e 1O9SA 2MWOA 1G5VA 4OB2B 4HNTA 3JB9F 3MP8A 5KCHA 2ZZDB 3L2WA 2IVWA 4N4IA 3GNFB 3ZBDA 4EMKB 4HT9A 3GIBA 3VJPA 3RKXA 1KD1U 2MAMA 4PJOD 2QDYB 1VUBA 1G3YA 2DEQA 5AYFA 3HZJA 2E41A 3CMET 2ZPGB 1M5Q1 3H4CA 2I2LA 2DPPB 4A4HA 2KDSA 2QA4T 3CCST 1XNIA 1Y71A 2CS7A 2R5MA 4OMFB 2CYZB 4KULA 2DZ9A 2F5KA 2E10A 2MF2A 4J8OA 4EMHA 4B9WA 4M7DD 1BIAA 2BUDA 2LT1A 2D0QB 2YHTA 3BDLA 4KT0E 4NOYA 3WXMB 3CC4A 1KQ2A 4FIBA 3QZ5B 4P5NA 3WVDB 4BACA 3MO8A 1OZ2A 2PQWA 1ZHIA 5CQYA 1VIEA 3RKWA 1OI1A 3CCET 3TEEA 1RL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X24 B;  4OB3 B;  3X25 B;  1QP2 A;  4RKU E;  3QXE B;  3VYG B;  3X28 B;  2CZ1 B;  2CZ0 B;  3VYG A;  3QYG B;  3VYH B;  2CZ6 B;  4ZGJ B;  2CZ7 B;  3HHT B;  1AHJ B;  2WSE E;  1GXI E;  2AHJ B;  1PSE A;  2PVD B;  3A8L B;  2ZCF B;  2PVO B;  1UGS B;  3A8O B;  2PUK B;  3A8H B;  2ZPH B;  2DXC B;  3LW5 E;  2DXB B;  3X26 B;  3A8G B;  4ZGE B;  1QP3 A;  2DD4 B;  3X20 B;  2DXC A;  2DD5 B;  2DXB A;  1UGP B;  2WSF E;  1JB0 E;  2ZPI B;  4OB0 B;  4XK8 E;  2DD4 A;  2DD5 A;  1IRE B;  4ZGD B;  2ZPE B;  3WVE B;  2ZPB B;  4OB2 B;  2WSC E;  1DJ7 B;  4OB1 B;  2O01 E;  2ZZD B;  2PUO B;  2QDY B;  2PU9 B;  2ZPG B;  2ZZD A;  2DPP B;  2PVG B;  3A8M B;  1V29 B;  2CYZ B;  1UGR B;  3QYH B;  2ZPF B;  4KT0 E;  4FM4 B;  2D0Q B;  1PSF A;  4Y28 E;  5L8R E;  1UGQ B;  3QZ5 B;  3QZ9 B;  4L6V 5;  3WVD B; 
#chains in the Genus database with same CATH topology
 4EDU A;  1AVZ C;  1C6V X;  3QWY A;  3QPH A;  4AFS C;  1KC8 U;  3M4G A;  3CCL A;  3L1A A;  2QEX Q;  1M27 C;  1TOV A;  4BCF B;  1M30 A;  3VU3 C;  4PFP A;  2A37 A;  4Z02 A;  5LJ3 g;  2B86 A;  4LDU A;  3BLR B;  2CP2 A;  1TS9 A;  2FB7 A;  1PRL C;  3VS7 A;  2FYK A;  4EC9 B;  3RNJ A;  5FRO A;  3TNW B;  2FL7 A;  1JST B;  3Q1J A;  5J3B A;  2LJ0 A;  2KMT A;  1VA7 A;  4F7J B;  2P4T A;  5GAO q;  1QVP A;  2DET A;  3MEA A;  3VKG A;  1LJO A;  1VQN Q;  2O31 A;  4AI6 A;  4C92 A;  2GNC A;  1BU2 A;  2RQV A;  1VQL T;  1YIT Q;  4C0F A;  2BTT A;  4CRL B;  3OB9 A;  1H26 B;  3GLX A;  1QCO A;  4A4K A;  1N6A A;  4FYX B;  4M78 E;  4MDW A;  4F16 A;  2IW9 B;  2W9Z A;  1IZ6 A;  4A4F A;  5DQW A;  3X26 B;  2GFU A;  3HTR A;  4ZGE B;  2EAY A;  1RI9 A;  2O4X B;  4RG8 A;  4A4G A;  5GAN e;  3G71 T;  5CKE A;  2AIR B;  4BCM B;  3DTO A;  3VUZ A;  5DQV A;  1T0H A;  3NPF A;  2DM1 A;  1U8R A;  1UG1 A;  4M77 D;  3OYA A;  3PIP A;  1VQ7 Q;  1IRE B;  4ESR A;  1W1F A;  1OKW B;  4RCB A;  4E7I A;  1DJ7 B;  1MV3 A;  4ATO A;  4M7A A;  1VQ6 T;  2JS2 A;  5IHK A;  1NPR A;  4BY6 C;  1EX4 A;  2JMC A;  4FT4 A;  1KG1 A;  1W2B A;  7AT1 B;  4YTL A;  4EMK A;  3M0R A;  4OVA A;  1UGR B;  2NLU A;  4DEY A;  3SB2 A;  1KFZ A;  3GBQ A;  4JDS A;  1QWF A;  2ED0 A;  1BI0 A;  5LJ5 j;  2BE9 B;  3SWN C;  4DBR A;  3S3O A;  5HY6 A;  1YNZ A;  1QCN A;  3C94 A;  4KRC B;  5A0G A;  4C92 F;  4ZTJ A;  2K2M A;  2XDD A;  4EOK B;  3H9N A;  1G8X A;  2RQU A;  4GLM A;  3CCL Q;  5GMK e;  4BCM D;  2E6N A;  1NJI U;  2KYM A;  2MI6 A;  2C5X B;  3QUI A;  4HCB A;  2DIQ A;  3FIF A;  1YIJ T;  3OW2 S;  1Z9Q A;  1YWO A;  4JLI A;  4NL2 A;  2C06 A;  4NS5 A;  5LJ3 d;  2KAF A;  5C6S A;  1RAD B;  3G4S A;  1TUD A;  4HVW A;  2E5Q A;  1PRM C;  2CUD A;  4F04 B;  3M58 A;  3CME A;  1F1B B;  5GAO p;  1XOV A;  2W0Z A;  1Z9Z A;  3QKJ A;  2DMO A;  2LTO A;  4MFE A;  2CP0 A;  5CQX A;  1EIF A;  1WJR A;  2LC4 A;  4M7A F;  2LQ8 A;  3PMT A;  3BLH B;  3A8L B;  3JCM b;  2PVO B;  4F17 A;  4QQG A;  1NG2 A;  2W96 A;  2EQI A;  4QW2 A;  3QHS A;  5DY9 A;  5EFQ B;  4E2F B;  2VGN A;  3URG A;  1NLO C;  1GY3 B;  3JB9 G;  4J9H A;  2KR6 A;  1C1A A;  4BCK B;  1NEG A;  3BW1 A;  4EOJ B;  1UUE A;  5FU6 B;  1WHG A;  4C0D B;  2CGH A;  3LWH A;  2V1Q A;  5GMK l;  2UZD B;  2P4R A;  4EMG A;  1Y07 A;  3KFV A;  3M0U A;  2SRC A;  2O4X A;  2O88 A;  4IMY B;  3G6E T;  1MGQ A;  3REA B;  3MKD A;  4GY5 A;  1RAH B;  4C0G A;  1YFN A;  2KGT A;  4M78 D;  2X4Y A;  1G3S A;  2GF7 A;  4BCN D;  2J6O A;  2RQT A;  4RTW A;  2ROL A;  4FCY A;  1G3T A;  2KRO A;  1S72 T;  3OQ5 A;  1JJ2 A;  3OYH A;  2QQR A;  2A7Y A;  2DVE A;  2K5I A;  1VOM A;  1ZUU A;  1QVG A;  2K3Y A;  5CKB A;  3U23 A;  5GMK m;  4RCC A;  1VQL A;  4J6X A;  2XK0 A;  2L8D A;  2E12 A;  3JCM J;  2FPD A;  3PNW C;  4MFD A;  5CIU A;  3CD6 T;  4JJD A;  4BD3 A;  3JRZ A;  1MND A;  2AK5 A;  2DZC A;  1V1C A;  3VKI A;  3EH1 A;  2W2H A;  1PKD B;  4IUP A;  3JAM E;  3C12 A;  3G71 A;  1K73 C;  4BCJ B;  5GAN 4;  1NYG A;  2WJ9 A;  3OYE A;  2J6F A;  3CPW P;  1GCQ A;  2DXT A;  5J26 A;  2X1N B;  3PE0 A;  2J05 A;  4EOR B;  2RK1 A;  1QKX A;  1A0N B;  2MOX A;  3JB9 I;  4E7L A;  3OYI A;  1BYM A;  1VQ6 A;  2VGM A;  3G4S Q;  4KGZ B;  1K8A R;  2BE7 D;  3E2U A;  4JPB W;  1YJN Q;  2EYW A;  3M53 A;  4BCP B;  2QGS A;  1QCF A;  1YHQ Q;  4HL4 A;  4E7S A;  3UPU A;  4MZM A;  4A53 A;  4JLG A;  1U5S A;  2RPN A;  2EFI A;  1KQS P;  4CRI A;  2JT4 A;  4J9G A;  4RG2 A;  1W70 A;  1SEM A;  3NFC A;  1FXX A;  1HD3 A;  2FEI A;  1VQP A;  2LNV A;  5IF1 B;  4M7D C;  3AHU A;  3HB9 A;  1ZQ1 A;  1ABO A;  1IO6 A;  2HKQ B;  2KT1 A;  2LVM A;  3D7S B;  4OGC A;  1Q7Y C;  3JB9 D;  1YIJ A;  2CT4 A;  2OX7 A;  5ACB A;  4CI0 C;  2DD5 B;  4XTY A;  1QW1 A;  2FHD A;  2B9R A;  1JXM A;  3BHV B;  3E9F A;  1WGS A;  4RMO A;  4KBM B;  2GQI A;  1GBQ A;  1M9S A;  4AFZ C;  4FSS A;  1KXU A;  4CFW B;  2C5N B;  5FWC A;  5IHI A;  3S3N A;  1VQK T;  1UEC A;  2FZK B;  2NUP B;  4RTZ A;  1VQO T;  3ME9 A;  3TW7 A;  2DTH A;  2KRS A;  4M75 E;  3CPW S;  1YJW Q;  1U1S A;  3A5Z B;  1PC0 A;  2MK5 A;  2DEU A;  2RD1 A;  5LJ5 h;  4NC6 A;  1GBR A;  2IG0 A;  4AFU C;  5LJ3 e;  1RAI B;  3JCM W;  1OQK A;  2JMA A;  2QTX A;  1H3H A;  2P0Q A;  2QEX T;  2BZY A;  1WPY A;  3V7S A;  3G71 Q;  2QAZ A;  1D3B B;  4M75 G;  3MPU B;  4XTX A;  1JRI A;  4R56 A;  1U06 A;  1H8K A;  1WJQ A;  1JBM A;  1PG5 B;  2I53 A;  1UHF A;  3G6E A;  1B7T A;  1KQS S;  1BKB A;  3BDU A;  5LJ3 f;  5D6X A;  2D9T A;  4D8D A;  3HPW A;  2I40 B;  3QWL A;  1S72 A;  2RNA A;  4M77 C;  1VQN T;  1WXT A;  5GAN 2;  1AIS B;  2MPX C;  2DRK A;  4ZGJ B;  1YIT T;  1M90 C;  1QQJ A;  2EKO A;  2K6D A;  3MP1 A;  3CBM A;  3QYE A;  1Q86 C;  4RTV A;  1Q82 R;  1UDL A;  3CD6 A;  2DL5 A;  3HFN A;  5L23 A;  4HT8 A;  4PK4 A;  1RAG B;  3HRT A;  1VQP Q;  3OS2 A;  2CH4 W;  1M3C A;  2RA2 A;  1SHF A;  1TU0 B;  2C5O B;  1SSF A;  3IQL A;  4JX6 A;  3THK A;  4C8Q E;  1VQ7 T;  1OKV B;  3NHN A;  2PJQ A;  1E6H A;  4OMM A;  1BCM A;  2DD4 B;  4O5V A;  3OYC A;  3CXC A;  3BHT B;  2EYX A;  4ZN1 A;  2QG9 B;  1T3S A;  1H25 B;  5GAM j;  1GL5 A;  2XDB A;  5CO7 A;  3LGL A;  1ZBX A;  1T3L A;  2DD5 A;  1WHJ A;  5LJ5 g;  2E6Z A;  1C9B A;  2DF6 A;  2M51 A;  4E7Z A;  2DIL A;  3JB9 F;  2Z0W A;  3L2W A;  4QT7 A;  4ZNX A;  3O0G D;  3GIB A;  3RKX A;  2KNB B;  2QDY B;  1VUB A;  2D8H A;  3HZJ A;  2E41 A;  2H3E B;  4A4H A;  1XNI A;  1Y71 A;  2R5M A;  2F5K A;  1BB9 A;  4PJJ A;  4B9W A;  4KT0 E;  2YHT A;  5GJW B;  2KRM A;  4FIB A;  4EOI B;  2YDL A;  2PK2 A;  3RKW A;  2ROT A;  4M75 D;  1WHL A;  1K76 A;  2XDP A;  2MMP A;  4IUU A;  4LE9 A;  1D3B A;  3CXC P;  1IB8 A;  3CBO A;  1H64 1;  3TSW A;  3DDQ B;  1VQK A;  2DJZ A;  2F2C A;  5GAO l;  1PM3 A;  2Y4Y A;  1S72 Q;  1OX8 A;  1KD1 C;  1VQO A;  1P5E B;  2V22 B;  2RH2 A;  1JKW A;  3ULR B;  2XIC A;  3O5Z A;  4DBQ A;  4M78 C;  2NUT B;  2XU8 A;  1H3Z A;  3EFR A;  3QO3 A;  2G6F X;  3C0C A;  4HVU A;  5DLO A;  3HHT B;  1K4U S;  2XI9 A;  4LUD A;  4XU2 A;  2WIH B;  3UA6 A;  2CJM B;  5GAO m;  2LX9 A;  2QEX A;  3H8Z A;  1HSQ A;  4XTV A;  2RHX A;  5ECA A;  5CKH A;  2BIV A;  4HKE A;  3L42 A;  1TWB A;  1K9M C;  2DK3 A;  3HP9 A;  3INZ A;  2AZV A;  3FJ5 A;  4IUQ A;  4R55 A;  2KYB A;  4D8K A;  2RO0 A;  2VKN A;  4KGV B;  5FU6 C;  4J9F A;  4C0D C;  2HQE A;  1NEB A;  1VQN A;  4ELJ A;  1R77 A;  2L3Q A;  2MYS A;  3RUX A;  4C5E A;  1OIY B;  1B34 B;  2DD4 A;  5HNB B;  2KMG A;  4M7D B;  2GBQ A;  2ED1 A;  1OGU B;  4HCK A;  5EC7 A;  5LJ5 d;  1IGU A;  3NTH A;  4C8Q D;  1OOT A;  4J6W A;  2X3X D;  3VRY A;  1M8V A;  1SG5 A;  1KQ1 A;  2RMO A;  2PU9 B;  5HCK A;  2VAS A;  2UZE B;  3LX7 A;  3OY9 A;  4HVV A;  3A8M B;  3RKY A;  3VS1 A;  4XAX B;  4ELZ C;  1Y0M A;  3PFS A;  4ROC A;  2HL3 A;  1KIK A;  4X9D A;  4M77 G;  2LP5 A;  5A0D A;  5DLQ E;  2J6K A;  3UF4 A;  1RUW A;  2QQ8 A;  2BPM B;  4I3Z B;  4FW2 A;  2L0A A;  2QA4 Q;  3BFM A;  3MEW A;  3L2Q A;  3G4S T;  1SRL A;  2BS4 A;  1YJN T;  2M1H A;  3E19 A;  2VV5 A;  2IIM A;  1YHQ T;  3OS1 A;  3BG5 A;  2V1R A;  1FMV A;  3GP8 A;  2COY A;  4FW1 A;  2DIG A;  2LCC A;  1K1Z A;  1UJY A;  1NLP C;  2E4H A;  2G3R A;  1PCX A;  5CYI B;  2X4W A;  4CC2 A;  1SF9 A;  5IH2 A;  2EQK A;  2KE9 A;  2DLP A;  2K2V A;  2UUE B;  4X34 A;  2L3S A;  2XID A;  2WFY B;  2KR3 A;  2CT3 A;  3V7C A;  2NUT A;  3JCM Q;  3M55 A;  3V8J A;  3LGF A;  3E9G A;  4L5G A;  4BCQ D;  2YLC A;  1D1A A;  1WHH A;  4IUT A;  4RTT A;  3OS0 A;  2DFU A;  1UGV A;  4M77 B;  1F5Q B;  4F7L B;  3I5R A;  2X4X A;  4Z88 A;  4QQ6 A;  3A8H B;  1H27 B;  2LMJ A;  2A0F B;  3JSC A;  1BI2 A;  4OML A;  4BI8 B;  5HVY B;  1RLP C;  3VS4 A;  5GAM h;  3M54 A;  1M3A A;  2KK4 A;  2EQJ A;  2VUB A;  2BS2 A;  1K73 U;  4X9C A;  5FLX E;  1D0Z A;  2QXF A;  1BBZ A;  2ZPI B;  1YJW T;  3BE3 A;  3H6Z A;  1Q7Y R;  3POM A;  3I9Q A;  2JJ9 A;  3OSV A;  2EGA A;  1B34 A;  4YC3 B;  2X51 A;  4QKU A;  5GAN j;  4M7D A;  1LOJ A;  3TU4 K;  2DBK A;  2NYS A;  3HRS A;  4LDX A;  1SKU B;  3RMQ A;  1D09 B;  3TCJ A;  2W9F A;  1V29 B;  3QYH B;  5FGK B;  2ZPF B;  3GOX A;  1SPK A;  3JB9 J;  3L2R A;  2DKG A;  1NJI R;  2L3P A;  4Y28 E;  5L8R E;  1UGQ B;  1G3W A;  3OYY A;  3KBG A;  1CKB A;  3QYB A;  4M78 G;  1XJW B;  1QWE A;  3GPL A;  5IDN B;  2RI3 A;  5HKC A;  5GAN 3;  3VRZ A;  1FIN B;  1E9H B;  2JTF A;  3CCU T;  3NMZ C;  3QJ6 A;  2NWM A;  4OP0 A;  1FYN A;  1Q81 C;  3GNG A;  1N4M A;  4RTX A;  3R6O A;  2ATC B;  1Q7Y U;  2ECZ A;  1YJ9 Q;  2AT1 B;  2IVX A;  4CC7 A;  1VYV A;  1MMA A;  3J81 E;  2WAC A;  1S1N A;  1I07 A;  2K5F A;  1N8R R;  1TH7 A;  3J7A F;  4JJC A;  2M16 A;  1HJD A;  2WMB B;  2R58 A;  1UTI A;  4HNU A;  1VQP T;  5GMK j;  1PHT A;  2MWP A;  1RI0 A;  1UEB A;  1R0B G;  1FWZ A;  3FEO A;  3FRN A;  4EC8 B;  4EOS B;  4YOZ A;  2FPE A;  3CBP A;  5GAM g;  4JX4 A;  3OYD A;  4PFO A;  4M7D F;  5A2Q E;  1OI9 B;  4J9C A;  4Y72 B;  3FDR A;  2ZGW A;  2L89 A;  1M90 R;  3GTM S;  2RJD A;  4M78 B;  5HK0 A;  5I22 A;  4BCN B;  1UFF A;  4BXX X;  3OMG A;  1AWJ A;  5KYW B;  1YJN A;  3I55 Q;  1PNJ A;  4B6M A;  4M77 A;  1YHQ A;  1D3U B;  2BS3 A;  2R7G A;  4M75 C;  1EFN A;  4PJO E;  5GMK i;  1H1P B;  1VQ9 A;  4QVD A;  2P0K A;  1W2B P;  4F6U B;  1QVF A;  2E65 A;  3N5B B;  2RB6 A;  3LWI A;  4HCC A;  1WHK A;  3A98 A;  4N4G A;  1U3O A;  2XKO C;  5LJ5 f;  5IT9 E;  2CSQ A;  1N8R U;  3A1P A;  2DVJ A;  3BLQ B;  4CFM B;  2K57 A;  2A36 A;  4OB1 B;  3RDV A;  3LH0 A;  4M6V A;  2RJE A;  2P0P A;  4PJO G;  1RAF B;  1NPP A;  4MMK A;  1MNE A;  2BKZ B;  1WDX A;  4PLI A;  1M90 U;  2QF7 A;  3HKS A;  3VS3 A;  4FM4 B;  5GAN 7;  2D0N A;  3SFM A;  3EH2 A;  1Q86 U;  1M4Z A;  3V8K A;  2PHG A;  2L2P A;  1HXD A;  1WLP B;  2EW3 A;  2EJ9 A;  1IRX A;  3ZFJ A;  2DX1 A;  1SHG A;  2O9V A;  4LOC A;  1OZ3 A;  1YJW A;  3H0H A;  4HXJ A;  1UNG D;  2VYT A;  3P8D A;  4BY7 X;  4DBF A;  4X1V A;  2CRE A;  4M77 F;  3CC2 T;  1G83 A;  3LYI A;  1VQ4 A;  4CXA B;  1NYF A;  2MCN A;  4A4E A;  4PNO A;  2W10 A;  2JW4 A;  3SEM A;  2EKH A;  1CKA A;  4J9E A;  1D1C A;  2WSE E;  4AKH A;  4UC4 A;  1WQ7 A;  2SEM A;  2OAW A;  4WCI A;  1KD1 R;  1X27 A;  1TFB A;  2X9H A;  2KY9 A;  1VOL A;  4KRD B;  5KE3 A;  5GAM d;  2D8J A;  5AT1 B;  2DXU A;  2DE0 X;  2DER A;  1VIN A;  3CCU A;  2B8A A;  3EG3 A;  1UE9 A;  4OMN A;  2LCL A;  1MHN A;  2RI5 A;  1JJ2 P;  3EFS A;  1ZUY A;  2C0T A;  1OL2 B;  1VQ9 Q;  4M78 A;  4DQ2 A;  3FLG A;  1QVG P;  5KYW A;  2DL8 A;  5I21 A;  4BE1 A;  3CC4 Q;  4EOO B;  1K9M R;  3M0S A;  1YI2 A;  1LNX A;  4DOV A;  4OB2 B;  2I0N A;  3LH5 A;  5KCH A;  2ZZD B;  2IVW A;  1QKW A;  2J06 A;  4HT9 A;  1VYU A;  3MI9 B;  1AWX A;  1KD1 U;  4AMC A;  4PJO D;  5AYF A;  2JGZ B;  2DEQ A;  1M5Q 1;  3H4C A;  1JXO A;  5FWB A;  2QA4 T;  4EOP B;  2RQR A;  1WA7 A;  3LQ5 B;  4ELL A;  2MF2 A;  2PNI A;  4EMH A;  1BIA A;  2BUD A;  3BDL A;  4DBH A;  1KQ2 A;  3EHQ A;  3EG0 A;  1ZSG A;  3QZ5 B;  4P5N A;  3WVD B;  4BAC A;  1OZ2 A;  1ZHI A;  1VQM Q;  2HL5 C;  3CCE T;  4RTU A;  1RL2 A;  1URC B;  2EYZ A;  1GH6 B;  2JZ2 A;  1K9M U;  2GTO A;  4HCZ A;  1VQ4 Q;  4F7S B;  2CKK A;  4M78 F;  2EGC A;  1XQH A;  3QYG B;  4J5Y A;  2EUF A;  5GMK h;  3S6W A;  2BZX A;  1OYX A;  2V8J A;  3NDQ A;  5L2W B;  4EOQ B;  2E5K A;  1QVG S;  1G3N C;  1UGS B;  2EIF A;  5IXF A;  2LW4 A;  3CCU Q;  3TVT A;  3DJB A;  1LPL A;  2GCX A;  3MY1 B;  4Z8A A;  2D1X A;  2OJ2 A;  3CCR T;  2IW6 B;  4FL6 A;  3DLL A;  5GAN g;  2FRW A;  2JOY A;  3CC2 A;  4BDZ A;  4E7K A;  2WSF E;  1JB0 E;  2C4G B;  1B07 A;  1YI2 Q;  5IN1 A;  3UA7 A;  5CCA A;  3EG2 A;  1YCY A;  3L2Z A;  4FSX A;  2KSS A;  4Z89 A;  2DYB A;  2RQW A;  2YUQ A;  2PMI B;  4Q5W A;  2VC8 A;  2O01 E;  5C0M A;  4OF1 A;  4J83 A;  4II1 A;  5EG2 A;  3VS0 A;  2K5L A;  1WX6 A;  3EG9 B;  2QK0 A;  4M75 B;  3QJY A;  5A0L A;  1TTH B;  3VKH A;  4AT1 B;  4KUI A;  2ZZD A;  2GFA A;  2RHY A;  4G6L B;  3OYF A;  2A28 A;  1PSF A;  4A54 A;  4BCH B;  4HLQ A;  2YRC A;  2GQV A;  1C0M A;  1YJ9 T;  4ME7 A;  3TNH B;  4C8Q G;  2EVR A;  2KRN A;  2E3I A;  4OB3 B;  4LUE A;  1M8M A;  3X25 B;  1PWT A;  1X69 A;  4KH1 B;  2E1H A;  3PIO A;  2YRV A;  1TSF A;  5GAM e;  4ELY C;  1MMD A;  4Y91 A;  4VUB A;  4ORZ A;  3MCA B;  3NTK A;  3X28 B;  1WXU A;  1O75 A;  4D6W A;  2RJC A;  1Q81 R;  4BI4 A;  2QAS A;  1AWO A;  1W98 B;  2L5Q A;  1M1F A;  2G9X B;  2CP5 A;  4C92 E;  2QA4 A;  1N27 A;  3FC3 A;  5CVI A;  2EJF A;  4FYW B;  2FRY A;  4BI3 A;  1VQ8 T;  3CCJ Q;  2HMA A;  5GAM f;  1P92 A;  3RER A;  3CC7 Q;  3I55 T;  3PGG A;  5KE2 A;  4OMP A;  5KCO A;  5HQ0 B;  5BNJ B;  3M59 A;  4JZ4 A;  3JCM h;  4XTU A;  1I81 A;  3A8O B;  2PUK B;  5CK9 A;  3KUF A;  3CMA Q;  2M0Y A;  3HFO A;  3CCE A;  1R0C B;  1YCS B;  2LZ6 B;  5FU7 C;  2QFZ A;  3RGF B;  1Y7X A;  1KJW A;  3I56 Q;  4C92 G;  1D1B A;  4L59 A;  3T9N A;  4C8Q B;  3A8G B;  2ABL A;  4BE2 A;  3LLR A;  4PJN A;  3CC2 Q;  1ARK A;  1QMZ B;  1V76 A;  2QQS A;  5GAN d;  3EFO B;  1RAA B;  2L3R A;  5CKD A;  5M9O A;  1NZ9 A;  1GFC A;  1X6G A;  4M7A E;  1Q81 U;  1RAB B;  2YUO A;  3WVE B;  4BBS M;  4CC4 B;  4CFV B;  1YP5 A;  3M57 A;  4KGX B;  4MZP A;  4O6J A;  2FO0 A;  1K8A C;  2DJQ A;  3JCM V;  4J7I A;  3TQ7 P;  3DL1 A;  3SD4 A;  4JS5 A;  2LDM A;  3JCM X;  4LD6 A;  2OTL Q;  3HBL A;  4JRQ A;  1SSH A;  2PVG B;  4M7A G;  2JXB A;  3CCS A;  2K79 A;  3EG9 A;  1X2K A;  2IN3 A;  4M75 A;  3EG1 A;  1OPL A;  4BUG A;  5GAN 5;  1BK2 A;  4XU0 A;  2KI7 A;  3CCR A;  4JS4 A;  2CP7 A;  4GLK A;  3CCV T;  1TUC A;  3QSU A;  3EID B;  4EOL B;  3OSS C;  2H3J A;  1AWW A;  2KBT A;  4JRK A;  5CR2 A;  5CKF A;  3S3M A;  2C5V B;  4J9B A;  1KHC A;  1ZSZ B;  2F5T X;  4XU3 A;  3BG9 A;  2F2V A;  3DOG B;  4BY1 X;  3CXC S;  2H8H A;  3JCM P;  1BIB A;  3TN8 B;  4GBQ A;  2CH4 A;  4BCQ B;  2M0O A;  1OU8 A;  1OX9 A;  4OMQ A;  2DL4 A;  2CZ1 B;  1X6O A;  1UB4 A;  1ZP2 A;  3OYM A;  3JCM g;  2EYY A;  1T0J A;  2R5A A;  3H0I A;  2CZ7 B;  4F7U E;  1K0X A;  1MV0 B;  4J9D A;  4MML A;  2NUZ A;  2A3L A;  3UT1 A;  1BI3 A;  3J80 E;  3DDP B;  3EGD B;  2IPO B;  1PSE A;  5IHN A;  4PJO C;  1PD1 A;  1ZX6 A;  3ZEH A;  4CFU B;  1YJ9 A;  2R57 A;  1VQ9 T;  2VWF A;  3CCE Q;  1K73 R;  4BCI B;  1VIF A;  4F70 B;  3CC4 T;  5EJC A;  4F7U G;  4M75 F;  5HBE B;  4N0A C;  1O9K B;  4KRT A;  4C92 D;  4QSH A;  3RBB B;  5IAY A;  2XD0 A;  3EHR A;  2Y90 A;  3V7R A;  1AD6 A;  3EOC B;  3UAT A;  3EGU A;  3OW2 A;  2JN0 A;  4C8Q A;  5LQF B;  3CCM Q;  5DM7 R;  1M1K C;  1BI1 A;  2FG0 A;  3NGP A;  2QQ9 A;  3EFO A;  1ZUK A;  2QQB A;  1H28 B;  1Q95 G;  3ZL7 C;  2V26 A;  2RHI A;  4R0K A;  5KYY B;  1VQ8 A;  2AZS A;  4XTW A;  2LNH B;  4ROD A;  4LNP A;  2DRM A;  2PUO B;  1WIE A;  3I55 A;  2F2X A;  1OV3 A;  2VB6 A;  1VQM T;  1JOW A;  1FMK A;  2KXD A;  3REB B;  3CCS Q;  2OTJ Q;  1Y57 A;  4M7A D;  3P8B B;  4CFU D;  4PJM A;  5J39 A;  4BCG B;  4AKI A;  3CCR Q;  1Q82 C;  2HD0 A;  2WIP B;  1TD6 A;  2HBP A;  4JX5 A;  4L6V 5;  2C0O A;  2HDA A;  1KHI A;  2X3W D;  1VQ4 T;  2F69 A;  3M0T A;  4F7U B;  3X24 B;  2RN8 A;  4LD9 K;  1GFD A;  4C0Z A;  2ESW A;  4OMO A;  1E7O A;  3VUB A;  3OW2 P;  2M02 A;  1ZSZ A;  2A08 A;  2CCI B;  3PMI A;  4CFX B;  2FZC B;  3I5S A;  4C8Q F;  1ZLM A;  2HSE B;  4JZ3 A;  3JCM d;  1EZZ B;  3CQT A;  2VVK A;  4E7J A;  1GXI E;  4E6R A;  1D0X A;  2Y4X A;  3CCV A;  2KVQ G;  2LQW A;  2ZCF B;  2HCK A;  1G2B A;  3H41 A;  1WYX A;  3EGD A;  1WFW A;  1RAE B;  2HZY A;  3L2V A;  1MUZ A;  2RHU A;  2DXC B;  2DTI A;  4WTO B;  5GAN f;  1ZBJ A;  4AG2 C;  1YI2 T;  3G7Z A;  1K0S A;  1W4S A;  5I2S A;  1QP3 A;  2KEA A;  3M5A A;  2HNI A;  3QWX X;  2HBW A;  4J6Y A;  4BE0 A;  2K3X A;  5GJV B;  1O9K A;  4XTZ A;  2JUF A;  1M3B A;  4XK8 E;  4OB0 B;  2K7A A;  5GAO n;  3I35 A;  4PFZ A;  5FU7 B;  4J7F A;  5LJ5 e;  1G5V A;  1VQ8 Q;  4HNT A;  8AT1 B;  3MP8 A;  1UNH D;  1Q86 R;  2MAM A;  4M4Z A;  3PO3 S;  5KYY A;  3G1J A;  2C6T B;  2KDS A;  2CS7 A;  4AFQ C;  2CYZ B;  4KUL A;  1RAC B;  2DZ9 A;  2WPA B;  4J8O A;  3CC4 A;  2HSP A;  2D0Q B;  1CSK A;  2LT1 A;  4J9I A;  4NOY A;  3WXM B;  1J3T A;  1AZG B;  5LMK B;  3QHW B;  2PQW A;  4EON B;  1VIE A;  2K3B A;  2DA9 A;  1ZA1 B;  1K9A A;  4F6W B;  2QDL A;  3CEY A;  1XTD A;  1OU9 A;  2AKK A;  3TRE A;  2KT8 A;  1WZO A;  2G77 A;  3OMC A;  4F7U A;  4B9X A;  5CAI A;  3VYG B;  1B3Q A;  3ASK A;  5GAO r;  4F7N B;  4BB7 A;  1YBY A;  2IW8 B;  1ENW A;  1N9S A;  3CCJ T;  1QMC A;  1XO2 A;  2CZ0 B;  3OA6 A;  3CC7 T;  1NM7 A;  3CPF A;  3MET A;  2JVV A;  1H92 A;  3QDR B;  1I4K 1;  4A63 B;  1SRM A;  3PVL A;  1I5O B;  3VS2 A;  3CPW A;  1VQM A;  3OS5 A;  2DBM A;  5IDP B;  2XG8 D;  3PVQ A;  3CMA T;  1WNL A;  4JRP A;  1LVK A;  2LRQ A;  2E70 A;  5KYU B;  4FYY B;  4N4H A;  3CCV Q;  3OYK A;  3I56 T;  3C95 A;  2EJG A;  1VQ5 T;  2LX7 A;  1I5L A;  4LDW A;  1QVF P;  3G33 B;  3CCQ T;  3MP6 A;  4LN2 A;  4CC3 A;  1KC8 C;  5KYX B;  1OUL A;  2LJ3 A;  1QLY A;  2GGR A;  1FMW A;  3OYL A;  4IIM A;  1MMN A;  2W99 A;  2MIO A;  2PTK A;  3JB9 H;  1X01 A;  2XHC A;  1KQS A;  4C8Q C;  3X20 B;  1X75 C;  1WXB A;  4PJO B;  2DXC A;  1JEG A;  1R8O B;  2CUB A;  3QDF A;  2K9G A;  1W2B S;  1WI7 A;  1OPK A;  2FVU A;  4MZT A;  2OTL T;  2HQX A;  2ZPE B;  1UNL D;  3MIA B;  4F7U F;  3EJ1 B;  2EGE A;  3M03 A;  2WSC E;  1PKT A;  1TUG B;  4LXC A;  2AKL A;  3M56 A;  1H1Q B;  4AKG A;  5D7U A;  3F70 A;  1E6G A;  1N9R A;  1WQW A;  4IUV A;  4HA8 A;  2E64 A;  3M4Y A;  4Y92 A;  4ZTF A;  1KK7 A;  5HK3 A;  1TXQ A;  1IHW A;  1QLB A;  2PK9 B;  2RI2 A;  2JM8 A;  2ZAE A;  1AD5 A;  5GAN h;  4E7H A;  1FKM A;  3CME Q;  3JCM e;  1AEY A;  3TEE A;  3ER0 A;  3OBY A;  2CDT A;  3PT9 A;  2ENM A;  2DYI A;  5D6W A;  4PLL A;  4C92 C;  4DEX A;  4RKU E;  3HO8 A;  1ZSZ C;  3BY7 A;  3TSZ A;  3O8V A;  4II5 B;  1QVF S;  2QGF B;  2YUN A;  2YRD A;  1E7P A;  3JCM f;  1WJS A;  2DL3 A;  3VYG A;  2CZ6 B;  1Y96 B;  3RES A;  3FB9 A;  1HYO A;  5GAN 8;  3MJX A;  1YN8 A;  1RLQ C;  3TNI B;  2YLB A;  3QG1 A;  1K8A U;  5KH6 A;  5LJ3 j;  1U1T A;  2OAU A;  4AG1 C;  5CEI B;  1GCP A;  4M7A C;  5KYU A;  1M1G A;  3DKM A;  4XQ3 A;  2QTV A;  1PKS A;  1BU1 A;  1NJI C;  2ZPH B;  3OYB A;  3CCM T;  2EQM A;  2CP6 A;  4YOO A;  3C4S A;  4EMK C;  1H1S B;  2LQN A;  4BDY A;  1JJ2 S;  5KYX A;  4JRI A;  1VQL Q;  3KXT A;  3PTA A;  3JV3 A;  3M0P A;  2WEV B;  2RM4 A;  3CCJ A;  2LQK A;  3HRU A;  3VS5 A;  1M2O A;  3BHU B;  3CC7 A;  4OGR B;  3HSB A;  4PJO A;  4DA4 A;  4CFN B;  1I0C A;  2DME A;  4BCO B;  2FZG B;  5I2M A;  3CCS T;  2V8I A;  2OTJ T;  3CMA A;  3MY5 B;  3R6N A;  2J7I A;  4BY6 B;  2OI3 A;  1IGQ A;  2DL7 A;  3HL8 A;  3I56 A;  1N8R C;  1VQ5 A;  3SHW A;  1M1K R;  3NTI A;  4N0A A;  8ATC B;  2LT4 A;  3CCQ A;  2YWW A;  4V2S A;  2QYZ A;  1H4L D;  2EWN A;  1VQ6 Q;  2RK2 A;  3SWN B;  4MDX A;  1AOJ A;  2E3H A;  2V8K A;  3RMS A;  2DAQ A;  4C5G A;  2QDJ A;  1OL1 B;  1ABQ A;  4HNV A;  1N5Z A;  2JTE A;  2RF0 A;  2F2W A;  4IUR A;  4XU1 A;  1GUX B;  1QP2 A;  3QXE B;  5I5Z B;  2OTL A;  4LDV A;  2F1L A;  1D0Y A;  4EOM B;  4QVZ A;  3B57 A;  2M9U A;  2RJF A;  4F6S B;  3OBW A;  4TTH A;  4PJL A;  1X2Q A;  4ZN3 A;  1KSW A;  1JQQ A;  3M9Q A;  1I1J A;  3VYH B;  3JCM c;  1M1K U;  2EQU A;  3OYG A;  1YIJ Q;  4WF2 A;  1YWP A;  4PJO F;  2DTO A;  1IHV A;  2UZB B;  3DB3 A;  4KUD K;  1NE8 A;  1UHC A;  4C5H A;  1AZE A;  1Y96 A;  3V8L A;  2EBP A;  3TW6 A;  3RR6 A;  4E47 A;  3UWN A;  2EYQ A;  3OYN A;  1VYW B;  1IXD A;  3MEU A;  5HBJ B;  4PKC C;  4JJN K;  1I8F A;  1MMG A;  1X43 A;  3VV0 A;  3LW5 E;  3OYJ A;  2DXB B;  5FRN A;  1UJ0 A;  1Q82 U;  4ROE A;  3AT1 B;  2BKD N;  2NUP A;  4FX3 B;  3GF5 A;  4KH0 B;  2KXC A;  4F14 A;  3EGX B;  5LL6 S;  3CCL T;  2O9S A;  4M7D E;  4ZGD B;  4EPC A;  5I11 A;  4OGE A;  4NST B;  3E1S A;  2HEQ A;  2ZPB B;  4UN0 A;  5FRM A;  1GCQ C;  2PZ1 A;  1H1R B;  2JM9 A;  3QII A;  4RTY A;  2D6F A;  4MIM A;  2HAX A;  1VQ5 Q;  1GRI A;  3KHI A;  1ACM B;  3G6E Q;  1H24 B;  2JS0 A;  2VXE A;  4BBR M;  3QBY A;  2COW A;  5D6Y A;  3CCQ Q;  3M0Q A;  2LJ1 A;  1JU5 C;  2DO3 A;  1W6X A;  4DOW A;  1ZA2 B;  5FW9 A;  4M7D G;  3CCM A;  2DNU A;  1M2V B;  2BZ8 A;  2KQW A;  2EPD A;  2HKN A;  4QQD A;  2QI2 A;  3QZ9 B;  3BG3 A;  2C0I A;  3EAE A;  1AT1 B;  5KYN A;  3H0F A;  4LDY A;  3SWN A;  3UDC A;  4RUG A;  5GAN 6;  1JO8 A;  1WHM A;  4YOS A;  2JTM A;  2WMA B;  3RIR A;  4EIK A;  1X6B A;  3DLM A;  3CD6 Q;  4FT2 A;  4Z6Y A;  3MHX A;  4C5I A;  2X4J A;  9ATC B;  4FYV B;  2OTJ A;  1GUX A;  2XMF A;  3F5X B;  2K4Y A;  3K7A M;  1OEB A;  4QVC A;  2UZL B;  4OR5 B;  5ICP B;  1VYT A;  4C92 B;  2HQH A;  4ANJ A;  1AHJ B;  5LJ3 h;  3VS6 A;  3QHR B;  2AHJ B;  2O2O A;  4IKF A;  2PVD B;  3MEV A;  3SDZ A;  2JNG A;  2FPF A;  2YUP A;  1YIT A;  3FJP A;  4M77 E;  1FVV B;  2YSQ A;  2X35 A;  4TVR A;  2WHB B;  1HK9 A;  2QGG A;  3L2U A;  2YXY A;  2VXF A;  2RHZ A;  2P84 A;  3DB4 A;  4PL6 A;  3P8H A;  4NL3 A;  2DXB A;  1UGP B;  1FX7 A;  2YT6 A;  1KC8 R;  4M7A B;  4JUV A;  2QQA A;  5HBH B;  4FU6 A;  1VQ7 A;  1PD0 A;  1O9S A;  2MWO A;  3EGX A;  1LCK A;  4N4I A;  3GNF B;  3ZBD A;  1NBE B;  4EMK B;  3VJP A;  2WXV B;  6AT1 B;  2LCS A;  2GTJ A;  1G3Y A;  5IHY A;  1BCO A;  3CME T;  4K11 A;  2ZPG B;  2I2L A;  1VQK Q;  2DPP B;  4OMF B;  2COZ A;  2CSI A;  2E10 A;  4M7D D;  1OIU B;  1VQO Q;  2CCH B;  1TG0 A;  4IIO A;  3MO8 A;  5CQY A;  1JSU B;  5IXB A;  1OI1 A;  2CP3 A;  1M2V A;  4JJB A; 
#chains in the Genus database with same CATH homology
 4M75 D;  4EDU A;  3CEY A;  1XTD A;  3QPH A;  2XDP A;  2MMP A;  1KC8 U;  4IUU A;  3M4G A;  3TRE A;  3CCL A;  1D3B A;  3L1A A;  2G77 A;  2JZ2 A;  3OMC A;  1K9M U;  4F7U A;  3CBO A;  4B9X A;  5CAI A;  3VYG B;  4HCZ A;  1H64 1;  3VU3 C;  3ASK A;  1VQK A;  2DJZ A;  5GAO l;  4Z02 A;  5LJ3 g;  5GAO r;  4BB7 A;  1YBY A;  4LDU A;  2Y4Y A;  1N9S A;  3CCJ T;  2FB7 A;  2CKK A;  4M78 F;  1KD1 C;  1XQH A;  1VQO A;  2CZ0 B;  2FYK A;  2RH2 A;  3OA6 A;  3CC7 T;  3QYG B;  2XIC A;  2FL7 A;  4J5Y A;  3CPF A;  3Q1J A;  5J3B A;  3S6W A;  3MET A;  5FRO A;  2JVV A;  3QDR B;  1I4K 1;  2KMT A;  4M78 C;  2XU8 A;  1OYX A;  1H3Z A;  2P4T A;  2V8J A;  3EFR A;  5GAO q;  3CPW A;  3QO3 A;  3OS5 A;  1VQM A;  5DLO A;  1QVP A;  2XG8 D;  3CMA T;  1WNL A;  3HHT B;  2XI9 A;  4JRP A;  3MEA A;  4XU2 A;  2LRQ A;  2E70 A;  1QVG S;  4N4H A;  5GAO m;  2LX9 A;  3VKG A;  1LJO A;  3OYK A;  3I56 T;  3C95 A;  2EJG A;  2QEX A;  3H8Z A;  4AI6 A;  1VQ5 T;  4C92 A;  1I5L A;  4LDW A;  4XTV A;  1VQL T;  1UGS B;  4C0F A;  2EIF A;  3OB9 A;  2RHX A;  3GLX A;  4A4K A;  3CCQ T;  3MP6 A;  5CKH A;  1N6A A;  2BIV A;  4HKE A;  1KC8 C;  2GCX A;  4M78 E;  4MDW A;  3L42 A;  1IZ6 A;  1K9M C;  4A4F A;  2DK3 A;  4FL6 A;  3CCR T;  3OYL A;  3X26 B;  2GFU A;  3DLL A;  3HP9 A;  5GAN g;  3INZ A;  3JB9 H;  1X01 A;  2XHC A;  4ZGE B;  2EAY A;  4A4G A;  2O4X B;  4RG8 A;  5GAN e;  3G71 T;  1KQS A;  4C8Q C;  5CKE A;  3X20 B;  1X75 C;  2JOY A;  4PJO B;  2DXC A;  4IUQ A;  4R55 A;  1R8O B;  3CC2 A;  4BDZ A;  3VUZ A;  2RO0 A;  3CD6 T;  4E7K A;  5FU6 C;  2WSF E;  4C0D C;  2HQE A;  1JB0 E;  1W2B S;  1VQN A;  4ELJ A;  1U8R A;  4C5E A;  3RUX A;  1B34 B;  2DD4 A;  2FVU A;  4M77 D;  5IN1 A;  3PIP A;  4MZT A;  5CCA A;  1IRE B;  2HQX A;  2KMG A;  1YCY A;  2ZPE B;  3L2Z A;  4FSX A;  2OTL T;  2KSS A;  4M7D B;  4RCB A;  4F7U F;  4Q5W A;  2VC8 A;  2WSC E;  4E7I A;  1DJ7 B;  2O01 E;  4OF1 A;  3M56 A;  5C0M A;  4J83 A;  3NTH A;  5LJ5 d;  1VQ6 T;  4C8Q D;  1NPR A;  5GMK h;  4II1 A;  4AKG A;  4J6W A;  3F70 A;  5EG2 A;  1N9R A;  2K5L A;  1WQW A;  4IUV A;  4BY6 C;  1M8V A;  1KQ1 A;  4M75 B;  3QJY A;  2PU9 B;  4FT4 A;  5A0L A;  4HA8 A;  1KG1 A;  3VKH A;  2E64 A;  3M4Y A;  3LX7 A;  4KUI A;  3OY9 A;  1W2B A;  2ZZD A;  4ZTF A;  3QSU A;  4YTL A;  4EMK A;  2GFA A;  3A8M B;  4OVA A;  2RHY A;  3RKY A;  5HK3 A;  1UGR B;  2NLU A;  4XAX B;  3SB2 A;  3PFS A;  4ELZ C;  1QLB A;  4JDS A;  3OYF A;  1PSF A;  1BI0 A;  2RI2 A;  4X9D A;  4A54 A;  4M77 G;  4HLQ A;  5LJ5 j;  5A0D A;  5DLQ E;  3SWN C;  2GQV A;  3S3O A;  5HY6 A;  1YJ9 T;  3C94 A;  5GAN h;  4E7H A;  1FKM A;  3JCM e;  2QQ8 A;  5A0G A;  4ME7 A;  4C92 F;  3ER0 A;  4ZTJ A;  3OBY A;  3PT9 A;  4C8Q G;  3BFM A;  3MEW A;  3L2Q A;  5D6W A;  4OB3 B;  2XDD A;  3G4S T;  4PLL A;  3X25 B;  4C92 C;  5GMK e;  2E6N A;  1NJI U;  2BS4 A;  1YJN T;  2M1H A;  2MI6 A;  3QUI A;  4RKU E;  4HCB A;  3HO8 A;  2VV5 A;  3E19 A;  2DIQ A;  2E1H A;  3BY7 A;  3FIF A;  3PIO A;  2YRV A;  1YHQ T;  3O8V A;  3OS1 A;  3OW2 S;  1YIJ T;  4LDX A;  5GAM e;  3BG5 A;  4ELY C;  1QVF S;  3GP8 A;  4JLI A;  4Y91 A;  4NL2 A;  2DIG A;  4VUB A;  3MCA B;  2C06 A;  3NTK A;  3X28 B;  2LCC A;  4NS5 A;  5LJ3 d;  1E7P A;  2KAF A;  3JCM f;  1WJS A;  5C6S A;  3VYG A;  3G4S A;  1O75 A;  2G3R A;  4D6W A;  2RJC A;  2E5Q A;  2CZ6 B;  2X4W A;  4BI4 A;  1Y96 B;  3RES A;  3M58 A;  5LJ3 j;  3FB9 A;  3CME A;  2L5Q A;  1M1F A;  5GAN 8;  2EQK A;  4C92 E;  5GAO p;  1XOV A;  2QA4 A;  1N27 A;  2K2V A;  3QKJ A;  5CVI A;  3FC3 A;  2EJF A;  4X34 A;  2LTO A;  1VQ5 A;  4BI3 A;  4MFE A;  5CQX A;  1VQ8 T;  1EIF A;  2XID A;  5GAN 5;  1WJR A;  3V7C A;  5GAM f;  1P92 A;  2LC4 A;  3JCM Q;  4M7A F;  2LQ8 A;  3RER A;  2YLB A;  3PMT A;  3M55 A;  3V8J A;  3A8L B;  3LGF A;  3QG1 A;  3JCM b;  1K8A U;  3I55 T;  3E9G A;  5KH6 A;  3PGG A;  4L5G A;  5KE2 A;  2PVO B;  1U1T A;  2YLC A;  2OAU A;  5KCO A;  3M59 A;  3JCM h;  4XTU A;  1I81 A;  4QQG A;  4M7A C;  3A8O B;  2PUK B;  5CK9 A;  1M1G A;  3DKM A;  3KUF A;  4IUT A;  3OS0 A;  4M77 B;  3HFO A;  4XQ3 A;  3CCE A;  4QW2 A;  5FU7 C;  2QFZ A;  3QHS A;  5DY9 A;  2X4X A;  2VGN A;  4QQ6 A;  1NJI C;  3URG A;  3A8H B;  2ZPH B;  1Y7X A;  3OYB A;  3CCM T;  3JSC A;  1BI2 A;  2EQM A;  3JB9 G;  3C4S A;  4C92 G;  4L59 A;  3T9N A;  4BI8 B;  2KR6 A;  4C8Q B;  3A8G B;  4EMK C;  4BE2 A;  4BDY A;  1JJ2 S;  4JRI A;  3BW1 A;  5GAM h;  3KXT A;  3M54 A;  3LLR A;  3PTA A;  5GAN d;  2QQS A;  5FU6 B;  2KK4 A;  2RM4 A;  4C0D B;  2CGH A;  2EQJ A;  2VUB A;  2BS2 A;  3LWH A;  3CCJ A;  1K73 U;  2L3R A;  2LQK A;  4X9C A;  5FLX E;  5CKD A;  1NZ9 A;  5M9O A;  3HRU A;  2QXF A;  4EMG A;  4ATO A;  1Y07 A;  2ZPI B;  4M7A E;  3CC7 A;  2O4X A;  3G6E T;  1YJW T;  3H6Z A;  1Q81 U;  3HSB A;  1MGQ A;  4PJO A;  4DA4 A;  4GY5 A;  4C0G A;  5I2M A;  4M78 D;  2X4Y A;  3WVE B;  4BBS M;  1G3S A;  2GF7 A;  2V8I A;  3OSV A;  3CMA A;  2OTJ T;  3M57 A;  1G3T A;  4MZP A;  1S72 T;  1B34 A;  3OQ5 A;  4BY6 B;  4O6J A;  3OYA A;  3OYH A;  1JJ2 A;  2QQR A;  5GAN j;  1K8A C;  4M7D A;  3JCM V;  1N8R C;  4J7I A;  3HL8 A;  3I56 A;  3DL1 A;  1LOJ A;  2A7Y A;  2DVE A;  3HRS A;  3SD4 A;  4JS5 A;  2K5I A;  2LDM A;  3JCM X;  3TU4 K;  1QVG A;  2K3Y A;  4LD6 A;  3NTI A;  5CKB A;  4BUG A;  3RMQ A;  4RCC A;  5GMK m;  1VQL A;  4N0A A;  4J6X A;  3HBL A;  4JRQ A;  3TCJ A;  2LT4 A;  2PVG B;  2XK0 A;  2L8D A;  3CCQ A;  4M7A G;  3CCS A;  2E12 A;  1V29 B;  3QYH B;  3JCM J;  4V2S A;  2EWN A;  2ZPF B;  3GOX A;  3JB9 J;  4M75 A;  2RK2 A;  3PNW C;  3SWN B;  2DKG A;  3L2R A;  4MDX A;  4C5G A;  2V8K A;  3RMS A;  4MFD A;  2DAQ A;  4XU0 A;  4Y28 E;  5CIU A;  5L8R E;  4BD3 A;  2QDJ A;  3JRZ A;  4GLK A;  1UGQ B;  1G3W A;  3CCR A;  3CCV T;  2DZC A;  3OYY A;  3KBG A;  3QYB A;  4M78 G;  4HNV A;  3VKI A;  3OSS C;  4IUP A;  3JAM E;  3G71 A;  3C12 A;  2H3J A;  1K73 C;  5GAN 4;  4JRK A;  3GPL A;  5CR2 A;  2RI3 A;  5CKF A;  5HKC A;  2WJ9 A;  5GAN 3;  3OYE A;  3S3M A;  4IUR A;  2JTF A;  3CCU T;  4XU1 A;  3QJ6 A;  2DXT A;  4OP0 A;  1KHC A;  1QP2 A;  5J26 A;  2F5T X;  4XU3 A;  1Q81 C;  3GNG A;  3BG9 A;  3R6O A;  1Q7Y U;  3QXE B;  2OTL A;  2RK1 A;  4LDV A;  3CXC S;  4QVZ A;  3JCM P;  3JB9 I;  2M9U A;  1BIB A;  4E7L A;  2RJF A;  3OBW A;  3OYI A;  1BYM A;  2M0O A;  1VQ6 A;  2VGM A;  2CZ1 B;  1X6O A;  3J81 E;  4ZN3 A;  1UB4 A;  2WAC A;  3OYM A;  2K5F A;  3M9Q A;  3JCM g;  1TH7 A;  3M53 A;  3VYH B;  3JCM c;  2R5A A;  1M1K U;  2M16 A;  3J7A F;  2CZ7 B;  2EQU A;  3OYG A;  2R58 A;  4HL4 A;  4WF2 A;  4F7U E;  3UPU A;  4HNU A;  4PJO F;  1VQP T;  2DTO A;  5GMK j;  3DB3 A;  4MZM A;  4A53 A;  4KUD K;  2MWP A;  4MML A;  2A3L A;  3UT1 A;  1NE8 A;  1RI0 A;  1BI3 A;  4JLG A;  3J80 E;  1UEB A;  4C5H A;  1FWZ A;  3FEO A;  3FRN A;  1Y96 A;  2EFI A;  3V8L A;  4CRI A;  1PSE A;  3TW6 A;  4PJO C;  4E47 A;  3UWN A;  2EYQ A;  3CBP A;  3ZEH A;  5GAM g;  4JX4 A;  3OYN A;  3OYD A;  4M7D F;  5A2Q E;  1YJ9 A;  3MEU A;  4RG2 A;  2R57 A;  3NFC A;  1FXX A;  1VQ9 T;  4PKC C;  3FDR A;  4JJN K;  2ZGW A;  2L89 A;  1VQP A;  2LNV A;  1I8F A;  1VIF A;  4M7D C;  2RJD A;  3VV0 A;  3AHU A;  3HB9 A;  4M78 B;  1ZQ1 A;  2LVM A;  5HK0 A;  3CC4 T;  5EJC A;  4OGC A;  3LW5 E;  3OMG A;  1Q7Y C;  4F7U G;  1YJN A;  4M75 F;  3OYJ A;  2DXB B;  3JB9 D;  4N0A C;  4C92 D;  5FRN A;  1Q82 U;  4QSH A;  4M77 A;  5IAY A;  1YIJ A;  1YHQ A;  2XD0 A;  2BKD N;  2BS3 A;  4M75 C;  4PJO E;  4CI0 C;  2Y90 A;  3V7R A;  5GMK i;  2DD5 B;  4XTY A;  1VQ9 A;  4QVD A;  3OW2 A;  1QW1 A;  2FHD A;  3GF5 A;  2JN0 A;  2P0K A;  3E9F A;  1WGS A;  4C8Q A;  2E65 A;  1QVF A;  3N5B B;  2RB6 A;  4KBM B;  4RMO A;  3LWI A;  4HCC A;  4M7A A;  4N4G A;  5DM7 R;  1M1K C;  1M9S A;  5LL6 S;  2XKO C;  5LJ5 f;  3CCL T;  1BI1 A;  5IT9 E;  1N8R U;  2QQ9 A;  4M7D E;  4ZGD B;  4EPC A;  3S3N A;  1VQK T;  4OGE A;  3E1S A;  2ZPB B;  2K57 A;  2QQB A;  5FRM A;  2RHI A;  4OB1 B;  1VQ8 A;  3QII A;  2D6F A;  3LH0 A;  4M6V A;  4MIM A;  2RJE A;  4XTW A;  1VQO T;  2HAX A;  2P0P A;  3KHI A;  3ME9 A;  3TW7 A;  2DTH A;  4M75 E;  3CPW S;  2PUO B;  4PJO G;  1U1S A;  3A5Z B;  3I55 A;  1NPP A;  2VXE A;  4BBR M;  4MMK A;  3QBY A;  5D6Y A;  1VQM T;  4JS4 A;  2RD1 A;  5LJ5 h;  4PLI A;  4M7A D;  4NC6 A;  3P8B B;  1M90 U;  2DO3 A;  2IG0 A;  2QF7 A;  3HKS A;  4DOW A;  5LJ3 e;  5J39 A;  3JCM W;  4AKI A;  4M7D G;  4FM4 B;  5GAN 7;  3CCM A;  2QTX A;  1Q82 C;  3SFM A;  2HD0 A;  2KQW A;  1Q86 U;  1M4Z A;  2P0Q A;  3V8K A;  2QEX T;  4QQD A;  1WPY A;  3QZ9 B;  1HXD A;  3BG3 A;  2QI2 A;  2HBP A;  4JX5 A;  3EAE A;  4L6V 5;  3V7S A;  1KHI A;  1D3B B;  2EJ9 A;  4LDY A;  3SWN A;  3UDC A;  5GAN 6;  1VQ4 T;  2F69 A;  4F7U B;  4M75 G;  3ZFJ A;  2JTM A;  3RIR A;  4XTX A;  3X24 B;  4LD9 K;  1JRI A;  3DLM A;  4R56 A;  4LOC A;  1OZ3 A;  1WJQ A;  4C0Z A;  1JBM A;  3G6E A;  4FT2 A;  4Z6Y A;  3MHX A;  1YJW A;  4C5I A;  1KQS S;  1BKB A;  3BDU A;  5LJ3 f;  3VUB A;  2VYT A;  3P8D A;  5D6X A;  2X4J A;  2D9T A;  2OTJ A;  4M77 F;  3CC2 T;  3HPW A;  3LYI A;  1VQ4 A;  3QWL A;  2K4Y A;  1S72 A;  4A4E A;  3PMI A;  4PNO A;  4M77 C;  1VQN T;  5GAN 2;  4QVC A;  4C8Q F;  4ZGJ B;  1YIT T;  3JCM d;  1M90 C;  4C92 B;  2EKO A;  3MP1 A;  1AHJ B;  2WSE E;  3CBM A;  3QYE A;  4AKH A;  5LJ3 h;  4UC4 A;  4E7J A;  1GXI E;  2AHJ B;  1Q86 C;  1WQ7 A;  4IKF A;  2PVD B;  2Y4X A;  3CD6 A;  3MEV A;  3HFN A;  3CCV A;  4HT8 A;  2KVQ G;  2ZCF B;  2KY9 A;  3SDZ A;  2JNG A;  5KE3 A;  5GAM d;  1YIT A;  3FJP A;  3HRT A;  4M77 E;  3OS2 A;  2DXU A;  3L2V A;  2RA2 A;  2X35 A;  4TVR A;  2RHU A;  1HK9 A;  1SSF A;  3CCU A;  2B8A A;  2DXC B;  2DTI A;  5GAN f;  4JX6 A;  5GMK l;  1YI2 T;  3G7Z A;  1W4S A;  1MHN A;  2LCL A;  2RI5 A;  4C8Q E;  3L2U A;  2VXF A;  2RHZ A;  1VQ7 T;  3EFS A;  5I2S A;  3DB4 A;  1QP3 A;  3P8H A;  4PL6 A;  3M5A A;  2DD4 B;  4M78 A;  2HNI A;  4O5V A;  3FLG A;  4J6Y A;  4DQ2 A;  4NL3 A;  2K3X A;  3OYC A;  3CXC A;  4BE0 A;  2DXB A;  1UGP B;  1FX7 A;  4ZN1 A;  5I21 A;  4XTZ A;  2JUF A;  4BE1 A;  5GAM j;  4XK8 E;  2XDB A;  4OB0 B;  5CO7 A;  3LGL A;  4M7A B;  1ZBX A;  5GAO n;  4JUV A;  2QQA A;  2DD5 A;  1YI2 A;  5FU7 B;  4FU6 A;  1LNX A;  5LJ5 g;  2E6Z A;  4DOV A;  1VQ7 A;  4J7F A;  5LJ5 e;  1O9S A;  2MWO A;  1G5V A;  4OB2 B;  4HNT A;  3JB9 F;  3MP8 A;  5KCH A;  2ZZD B;  3L2W A;  2IVW A;  4N4I A;  3GNF B;  3ZBD A;  4EMK B;  4HT9 A;  3GIB A;  3VJP A;  3RKX A;  1KD1 U;  2MAM A;  4PJO D;  2QDY B;  1VUB A;  1G3Y A;  2DEQ A;  5AYF A;  3HZJ A;  2E41 A;  3CME T;  2ZPG B;  1M5Q 1;  3H4C A;  2I2L A;  2DPP B;  4A4H A;  2KDS A;  2QA4 T;  3CCS T;  1XNI A;  1Y71 A;  2CS7 A;  2R5M A;  4OMF B;  2CYZ B;  4KUL A;  2DZ9 A;  2F5K A;  2E10 A;  2MF2 A;  4J8O A;  4EMH A;  4B9W A;  4M7D D;  1BIA A;  2BUD A;  2LT1 A;  2D0Q B;  2YHT A;  3BDL A;  4KT0 E;  4NOY A;  3WXM B;  3CC4 A;  1KQ2 A;  4FIB A;  3QZ5 B;  4P5N A;  3WVD B;  4BAC A;  3MO8 A;  1OZ2 A;  2PQW A;  1ZHI A;  5CQY A;  1VIE A;  3RKW A;  1OI1 A;  3CCE T;  3TEE A;  1RL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...