2ZPGB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpgB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpgB02
5L8RE 2QDYB 1GXIE 1UGRB 1QP2A 3X25B 2WSEE 2ZPIB 2PU9B 2CZ0B 2O01E 2AHJB 1UGQB 4FM4B 1IREB 1PSEA 4ZGJB 3QYGB 4L6V5 2ZPHB 3HHTB 2ZZDA 2DXBA 2ZPFB 2DXCB 3QYHB 4OB2B 4Y28E 3VYGB 2ZCFB 3X20B 3WVEB 3QZ9B 4KT0E 2DD5A 2DD4B 2CZ6B 3QZ5B 2WSCE 3QXEB 4OB1B 1V29B 2ZPGB 3LW5E 3A8GB 2DXBB 2ZZDB 4ZGEB 2CYZB 3A8MB 1UGSB 1PSFA 2DD5B 4OB3B 2ZPEB 2DPPB 3WVDB 2PVOB 2PVGB 2CZ1B 4RKUE 3VYGA 1QP3A 3X26B 3X24B 2ZPBB 2DXCA 4ZGDB 3VYHB 3X28B 4XK8E 4OB0B 1AHJB 1JB0E 2PUKB 3A8OB 2WSFE 2DD4A 2PUOB 3A8HB 2D0QB 3A8LB 2CZ7B 2PVDB 1UGPB 1DJ7B
chains in the Genus database with same CATH superfamily
4RUGA 1VA7A 3OYGA 3LYIA 4LNPA 4BACA 1Y7XA 3GOXA 1NJIC 1WYXA 3CPFA 3RR6A 1UGQB 3DDQB 1OPKA 1WDXA 2DKGA 4KRDB 2DAQA 5LJ5h 1YJWA 1NEBA 1H25B 1Y96A 1MV0B 3AT1B 3NTIA 4CFVB 5A2QE 4EOSB 1K8AU 3F70A 1QVGA 1VQ4A 1N9SA 1WQWA 2DXCB 4MFDA 3CMAQ 2DJZA 4V2SA 4Y92A 3M54A 4WTOB 3O5ZA 1I1JA 3M0QA 2UZLB 3NHNA 3JCMW 5CVIA 1WI7A 2CSIA 4PFPA 4JX4A 4MDXA 2CP5A 4IURA 2V8IA 1U06A 2EPDA 2DVEA 1GBRA 1NLPC 1GFDA 3QXEB 4OB1B 4OR5B 3V7SA 3BDUA 4M6VA 4JLGA 4PJOD 1P92A 1SSFA 1TSFA 1X75C 1K9AA 2FO0A 2EBPA 1VQLQ 2GTJA 5HK3A 3CD6A 2KYBA 4E2FB 2PVOB 1VQOQ 1FX7A 3TSZA 3M5AA 1LPLA 4FT4A 4BXXX 4PJOE 4IUUA 4M77C 3J80E 2UUEB 3H41A 1H1RB 5HQ0B 2PNIA 3P8BB 2DNUA 2DL3A 2K5LA 2YUOA 3NMZC 2CGHA 5GAMe 5CR2A 2E1HA 3QSUA 2LW4A 1QWEA 1JU5C 1YHQQ 2GTOA 3VJPA 2PUKB 2MPXC 3MEWA 4QVDA 1H27B 2VUBA 2JS2A 3I55T 1M90U 3ULRB 4KGXB 4FL6A 2M02A 1JOWA 1VQLT 4F7UG 1M1KR 2ZPIB 2W9ZA 2IW9B 4II1A 3CXCP 1M3AA 3QHWB 4LUDA 2F5TX 1D0ZA 3ZEHA 2O01E 1M5Q1 1G3TA 4NL3A 2HMAA 2KSSA 4F6UB 3KUFA 4AFZC 2LCSA 1GY3B 2OAWA 1SHFA 4ZGJB 2F69A 1VQ9Q 4L6V5 2YUQA 3FLGA 4NC6A 4C92D 4EOIB 1KD1U 1VQNT 1UJYA 4C0FA 3MPUB 2V26A 2EJ9A 2ZPFB 2BPMB 4LDUA 4BCFB 3CCEQ 3NFCA 4J7IA 4XTWA 4B9XA 5GANe 2O9VA 2B86A 3CCRQ 2K3XA 5IDPB 4EDUA 4BE0A 5KYWA 5FWBA 2RJFA 2HKNA 3U23A 5LJ3d 4ZTJA 1ZBXA 1X6GA 1M8MA 3CCRA 1Q82U 4J9GA 2LNVA 4Z6YA 3OQ5A 1V29B 2ZPGB 1D1AA 1MMNA 3CCLA 4EC9B 2KRMA 3CC7A 1BCOA 4DOWA 4EONB 1WHHA 3M59A 2BZ8A 2ROLA 3CCUA 2D8HA 2X4WA 2EJFA 4J6XA 3CXCA 2DD5B 2IIMA 3M0RA 4HNUA 2LJ3A 1YI2Q 1D0YA 4C5EA 4N0AC 1YIJA 4M77F 2VV5A 4ZGDB 1KSWA 1YJNT 1UB4A 1M1FA 2LQWA 1AT1B 4M77E 2QTXA 4A4FA 4KRCB 1W6XA 2DEQA 3HBLA 2DFUA 2W10A 3ZBDA 1T3SA 3TQ7P 4IUQA 1D09B 1TH7A 2FRYA 4XK8E 2EGEA 3OA6A 4LUEA 2QQAA 2COZA 1ZA1B 5GAMd 4BCMB 5C0MA 3JAME 3TREA 1BBZA 2P0KA 5GJVB 1R0BG 3G4SQ 2AZVA 2K2VA 5KYYB 4J9FA 4JZ3A 4JX6A 3QBYA 1T0HA 1OGUB 3HFNA 4OMLA 3QWXX 1G5VA 1GFCA 2AZSA 4MZTA 4KUDK 2ED0A 3OYHA 1K0XA 5GAN5 5LJ5d 2MI6A 2QEXQ 1IREB 4JS4A 2DZ9A 2CH4W 2X51A 2HQXA 2YDLA 5IAYA 3QYGB 2FB7A 4CC2A 1O9KA 4CRIA 1X2KA 2WMBB 5D6YA 1KQSS 2EAYA 1VYUA 1YJNQ 4OMPA 4C8QD 1A0NB 2E10A 1BKBA 1BIAA 1W2BP 2ENMA 4FW1A 3VYGB 3JV3A 4M75C 1QKXA 2W2HA 2FEIA 5C6SA 1BU2A 1YITT 3CC4T 2OI3A 1K73C 1QLYA 3EG0A 1GBQA 2DD4B 2X3WD 1T3LA 2R7GA 3JB9H 2E41A 2JTEA 3SDZA 4BCNB 2MK5A 3P8DA 1YBYA 2P4RA 4XTXA 1OI9B 2A0FB 3QWYA 4JJDA 5I21A 3SWNB 4M77A 2CCIB 3CCVT 1GUXB 4D6WA 3P8HA 3UF4A 4F7UA 3URGA 1H3HA 2RHYA 3M0PA 5GMKl 3PMTA 3HKSA 1OZ2A 1HSQA 2F2WA 1E6HA 2K3BA 3OYMA 1WHMA 2JZ2A 1IGQA 4BY6B 1QVFP 2PJQA 4M7DB 1VQNQ 1W4SA 2GF7A 2CP2A 3M4GA 3OMGA 3FEOA 1TD6A 4QKUA 2K2MA 1YHQT 1S1NA 5IHNA 1W2BA 4JPBW 1AHJB 3LH5A 5IDNB 1JSTB 2R5MA 3R6NA 4KH1B 1RI0A 4F6SB 3RKYA 3QG1A 1WJSA 1UHCA 1UGVA 1UGRB 4M7AF 4IIOA 4PLLA 1AZGB 3CCJA 1N27A 3H0HA 4JJBA 4JRKA 3HSBA 2NLUA 5HBEB 4NSTB 3TU4K 1VQPT 2YWWA 2ROTA 4AT1B 1VQ5T 1RI9A 4EOLB 4M4ZA 1VQLA 1IZ6A 3CC2A 4XU1A 4HLQA 1NJIU 2D8JA 1PSEA 2O31A 1QQJA 1QWFA 2EGAA 1YJWQ 4M75D 3H6ZA 2CSQA 3MIAB 3HFOA 1VINA 4LOCA 4RTXA 5LJ5g 2FZCB 2LQNA 3M56A 4C0ZA 2UZBB 1QMCA 2DXBA 1TUDA 3C0CA 1AWWA 1ZA2B 4FSSA 2WIHB 1VQ4Q 5KE3A 2X1NB 2RF0A 4E7LA 1ABQA 3CCQT 1JJ2P 3OYKA 3PIOA 4GBQA 4AMCA 4M7DG 2DTHA 1I8FA 2L3SA 5EG2A 2YRDA 1KC8C 5KCHA 3OS0A 3L2VA 3PT9A 3GPLA 2V22B 3LH0A 3BG5A 2CP7A 4BE1A 2DA9A 3MY5B 3RDVA 2MYSA 1G8XA 3CC4Q 4IIMA 3BHVB 3DDPB 3BLQB 3PVLA 4JUVA 2W9FA 5LJ3f 5GAMh 1BYMA 4ESRA 1EFNA 1D3UB 5D6XA 2MF2A 4PJOF 2AKLA 4DOVA 3CCUT 3VYGA 1UFFA 2OTJA 1PD1A 4BI4A 2H3JA 4MZMA 3JB9J 5LMKB 3VS1A 3VYHB 1VQ9A 1ABOA 2UZEB 3OW2S 9ATCB 4ORZA 1VQ8A 2EYWA 3H8ZA 2JNGA 1B34A 2EQJA 4PKCC 4E7HA 2NUPA 1OU8A 4N4GA 3B57A 4J7FA 2KVQG 3UPUA 5KYNA 1BCMA 3CBPA 5CKHA 2NUPB 5L8RE 3CCLT 3G4ST 3OYYA 4ATOA 2EKHA 3X25B 4AG1C 3JCMg 2C0OA 2LVMA 3MP6A 2SEMA 2QEXT 5D7UA 2JXBA 1NPRA 4M7DE 3REBB 2J6OA 1OZ3A 3FIFA 3JB9I 1ZUUA 1TUGB 4Z02A 2A7YA 5FU7C 1SPKA 2E3HA 3CEYA 1Q95G 3O0GD 5IHIA 2A28A 2L5QA 2C5OB 2RHXA 2XDDA 3LGLA 1AOJA 5DLOA 1V76A 5GAMj 3OYBA 1EZZB 1ZSGA 3VS5A 3VS3A 1PKTA 3RERA 4YC3B 1M2OA 2YXYA 2HBPA 3V7RA 2DD5A 2BE9B 4CC4B 4L59A 1M9SA 4ZTFA 1ZUKA 1OOTA 1SKUB 2GNCA 2LT4A 3QYEA 1N6AA 2WSCE 2DETA 1X6BA 4KRTA 4M78D 2F2CA 3C94A 3EGXA 3J81E 1UGSB 4UN0A 3BLHB 4OB3B 1I0CA 1WHGA 4M7DF 3CCUQ 5IT9E 4F6WB 1FINB 3N5BB 1LVKA 2DF6A 2DLPA 2G6FX 1YI2A 1PC0A 2QYZA 2DL5A 4DEXA 2QGGA 1M1KC 3VKIA 1T0JA 2KR3A 2YUNA 1P5EB 2JMCA 2V1RA 1SHGA 1GL5A 4J9HA 4RTZA 2JM9A 4EPCA 5GMKj 2D6FA 1KIKA 4QQ6A 4QVCA 4Y91A 4HVUA 4BY6C 3CCQA 5IH2A 2WSFE 1XJWB 2DD4A 4XAXB 4F7SB 1VQ7A 1VQKT 1Y57A 3VS7A 2F2XA 5GAOl 2E70A 2OAUA 3I9QA 2RM4A 4OGEA 2QXFA 3OMCA 4JDSA 1TXQA 2EW3A 2LZ6B 4AI6A 2CZ0B 1TTHB 1D0XA 2QGFB 3Q1JA 2HDAA 2VB6A 1FVVB 1NE8A 3PE0A 2MWOA 3V7CA 1AEYA 1IHVA 4J9EA 3META 4N4IA 1YJWT 5GAMg 5GAN7 5GMKi 2C0IA 4LD6A 4CFUD 1VQ4T 2RJCA 4CFWB 2V1QA 2BIVA 2RK2A 3E1SA 1M90R 4FX3B 3FDRA 2AKKA 3VU3C 3I56Q 3FJ5A 2NWMA 1NPPA 1R8OB 4PJJA 2ATCB 2FL7A 1Q86R 2LP5A 1KHIA 1VQMQ 4BI3A 1NEGA 2NUTA 3CD6T 2K4YA 8ATCB 1OU9A 2RQWA 1PWTA 5DQVA 3RMQA 5EFQB 4RG2A 2I40B 1PNJA 3H0IA 1VQMA 1I5LA 4FYXB 1FYNA 4FU6A 4EOMB 2EFIA 3EHQA 1VQOT 2HNIA 4QSHA 2KXCA 5GAN2 2CH4A 4M75F 2QAZA 4YOOA 2LX9A 3CMET 1OIYB 2K3YA 2PQWA 2RHZA 4M7DD 2ED1A 2DXCA 3OSSC 4PJNA 2OTLT 3O8VA 1KXUA 3BHTB 2DZCA 2JM8A 2LRQA 3QHRB 1YN8A 1M2VB 2KQWA 2KAFA 2LX7A 3VRYA 2C0TA 4QW2A 3OYLA 1JEGA 2CP3A 4CFUB 1S72Q 2GBQA 3E2UA 1U1TA 1AWXA 4M75G 1VQKQ 2W96A 3OY9A 3A8LB 3M0TA 5KYWB 4ZN1A 1YJNA 4HNVA 3DOGB 3CCVA 1YIJT 3JSCA 5HK0A 3OYAA 3HB9A 2X4JA 1N8RU 2B9RA 2CUDA 5IXFA 3CCVQ 1PRMC 3SEMA 1HJDA 5GANh 2RQRA 4O5VA 3T9NA 2KGTA 3CCST 4J9BA 4A4KA 2ESWA 1JXMA 2E64A 3G71Q 1SEMA 2DXTA 4IUPA 3GBQA 3NTKA 1AWOA 4FYVB 2KT1A 2HBWA 5GANj 2RH2A 4JS5A 4DBRA 1LCKA 2ZPHB 2HL5C 2QDJA 2KI7A 1N8RR 1H1SB 1TS9A 2FHDA 2DK3A 1EIFA 1WA7A 1FKMA 3QYHB 5HBHB 4KH0B 4OB2B 2FPEA 4C92F 4J6YA 1ZX6A 1KQ1A 2HQHA 1OIUB 2ZCFB 3RKWA 2JT4A 5CQYA 1IB8A 3QDFA 1VQ9T 3ZL7C 3JCMV 2HD0A 3QJYA 1PD0A 2X3XD 3RKXA 4LDWA 1MUZA 4JRIA 3OSVA 2MCNA 2VYTA 3QDRB 1CSKA 3TVTA 2YT6A 4J9IA 1IHWA 3TSWA 3DLMA 2DIGA 4FYYB 2CDTA 2CYZB 2L8DA 1JQQA 4HXJA 2B8AA 2DPPB 3EG1A 1X2QA 2VC8A 4BBSM 2VASA 4CC3A 1WZOA 3JCMd 2BZYA 2GGRA 2X4YA 4OF1A 3OS2A 3L2WA 2WJ9A 2WXVB 4MMLA 5CCAA 1G3SA 5I22A 2E3IA 4M78A 1OEBA 3LLRA 2K5IA 5EC7A 2RI2A 2VVKA 3HZJA 2DL4A 2COYA 2HKQB 4M78E 2R58A 2X4XA 5GAOp 3X28B 2KR6A 2EQKA 2CP6A 2A36A 3LGFA 3CPWA 4IKFA 1RAEB 4XU0A 4OVAA 2I53A 1JB0E 2LQKA 1BI0A 4WF2A 4D8KA 3WXMB 2RK1A 1X27A 1GCQA 1FMVA 5HBJB 2PVDB 2OTLQ 3NGPA 3QO3A 1E9HB 2M9UA 3CMAT 4D8DA 1QP2A 3EH1A 3S3MA 4BE2A 3BG3A 1AWJA 4MDWA 4XTUA 4PJOA 4AKHA 1WXBA 1G3NC 2ECZA 3PIPA 4LXCA 3MY1B 3EG9B 3VS2A 2IW6B 4CXAB 4R55A 2JUFA 2QQ8A 1MNEA 1NYGA 1MMGA 5HKCA 2LJ1A 1NM7A 1YIJQ 2ZZDA 1VQ6T 3OS5A 2RI5A 3OYCA 4XTYA 2XI9A 4XTZA 1YJ9A 3KBGA 2DL8A 1HK9A 1PRLC 4OGRB 2BZXA 3WVEB 2YLCA 1RAGB 4XU3A 1UECA 3QZ5B 3CCMQ 4ZNXA 2VKNA 2M16A 3SWNA 1B7TA 3EAEA 2YRCA 1WX6A 1ZSZC 2LQ8A 3A98A 3UDCA 4EMKC 4DQ2A 4I3ZB 4AFSC 3G6EA 2JMAA 1Q82R 3E9FA 1U1SA 2RQTA 3EFOB 3HPWA 3X26B 3X24B 1YCYA 2C5XB 1I07A 2PK9B 4C0DC 2QG9B 2OJ2A 1U5SA 4BY1X 1N9RA 3OW2P 2WACA 2GQIA 4OMNA 4M7AA 4Z88A 3MKDA 3EJ1B 4M77G 4M75B 5GAN6 5LJ5f 4DEYA 3PTAA 3A8HB 1H28B 2HZYA 3EGDA 3UWNA 4R0KA 4C8QB 1KD1C 4HCKA 4M7AB 2H8HA 1UGPB 2EKOA 1B34B 2WSEE 5AT1B 3CCET 1JO8A 4AFUC 4ELLA 2DM1A 4EOPB 2YLBA 4F7UF 3ER0A 4GLKA 3SHWA 5LJ3h 4F7UE 4F14A 1W1FA 1JJ2S 2DMEA 2F1LA 3HHTB 3CCLQ 2YUPA 4PK4A 4HCCA 4LDVA 5GANf 5CKDA 2C5NB 4Y72B 3TNIB 1M3BA 3EH2A 2A08A 2YSQA 2QA4A 2HSEB 2WPAB 3LX7A 5A0LA 1KC8R 2E6NA 5CQXA 2FPFA 2GFUA 3JCMb 1MNDA 1RL2A 1OKWB 1NG2A 1PHTA 1H24B 2KNBB 3BDLA 2CZ6B 5HNBB 4MMKA 1LOJA 4E7JA 1WXUA 3NPFA 2KRNA 4PJMA 5FGKB 1C6VX 3MP8A 2D0NA 5FU7B 3D7SB 1Q81C 5LJ3e 1K73R 4PJOG 1M2VA 3A5ZB 2WIPB 5GMKh 3NDQA 2L3PA 2ZZDB 1KD1R 2RQVA 4M7DA 3CCQQ 3EG2A 3DKMA 1PSFA 3REAB 1QLBA 2FRWA 1WLPB 2DYIA 4AG2C 1Y0MA 1VQ7Q 1M4ZA 3C95A 1QP3A 5KYXA 1VYTA 4RTVA 4BCMD 2L89A 1U3OA 1VIFA 2ZPBB 2EYXA 5A0DA 1BI3A 2HCKA 4MFEA 4R56A 1B07A 1WIEA 3V8KA 2UZDB 2I2LA 5CAIA 5KYXB 4NL2A 1CKBA 2MWPA 3A8OB 2RPNA 4HCZA 5GAN4 4F16A 3G71T 3E9GA 3MP1A 2OX7A 2LMJA 3OYFA 1WNLA 3K7AM 4A4HA 1K4US 2PU9B 1BK2A 2JOYA 4PL6A 4C8QE 4M78B 2NYSA 2WFYB 2KK4A 2RJEA 4KGVB 2P0PA 4BCOB 5ICPB 3C4SA 2D9TA 2AT1B 3CCJQ 2LC4A 4J83A 2XU8A 1HYOA 2OTJQ 4ME7A 4RG8A 2V8JA 2DILA 4BY7X 2O4XA 1QVFA 4M77B 5LQFB 1K9MC 1OQKA 3M58A 5L23A 1SSHA 4PFZA 4GY5A 2QI2A 3JCMP 3KHIA 3MJXA 3PVQA 1H1PB 4K11A 4BCGB 5KYYA 3QZ9B 2J05A 1RACB 2M0YA 2BKZB 3HRTA 3JCMh 1VQNA 1G2BA 2HSPA 2AK5A 2QQBA 3JCMe 5GJWB 1FXXA 2X9HA 2FYKA 3LW5E 5DM7R 1GCQC 1S72T 4KUIA 1X6OA 3CPWS 1PM3A 4BI8B 5KYUA 4RCCA 2M51A 3RIRA 2DL7A 4X1VA 2EQUA 4JJCA 1E6GA 2G9XB 3S3NA 2DMOA 2XDPA 3G33B 1KJWA 1M30A 4M78C 4P5NA 1UE9A 2KROA 3TW7A 1OYXA 1H4LD 1QCNA 2K79A 2LNHB 4E7SA 4LN2A 1WJQA 4O6JA 2KMGA 1M3CA 4EMGA 3CD6Q 3MCAB 2KE9A 1WHJA 1VQ6A 4HNTA 1VQ8Q 1ZUYA 1WPYA 1Q7YU 1Z9QA 4C8QG 3HL8A 2R57A 3DJBA 4YOZA 3L2ZA 1Y07A 3V8LA 2E12A 3H4CA 4HL4A 1N5ZA 3JB9F 2QQ9A 5IXBA 4M7DC 3C12A 3DB3A 3MO8A 3OB9A 4RTUA 3TN8B 3CBMA 3QUIA 1QVFS 1KQ2A 4Z89A 3GIBA 3CCMT 3QPHA 1BU1A 2YHTA 1AVZC 4IMYB 4FYWB 4ZN3A 1MMAA 3MEUA 1AD6A 1OL2B 3OBYA 4BCKB 3MI9B 4EIKA 4AKIA 3AHUA 1XOVA 1IRXA 5FU6C 4II5B 2PHGA 4J9CA 3F5XB 4CFXB 2LTOA 1WXTA 4F70B 2CT4A 4EOOB 3X20B 3ME9A 4ROEA 3VUBA 3RUXA 3EGXB 1TUCA 3GNFB 2DEUA 1HXDA 3CCEA 2OTJT 1BB9A 2LDMA 4BCJB 1VUBA 1UJ0A 3M57A 3A1PA 1RLQC 3OYJA 3UATA 2XD0A 1PCXA 1JXOA 2VGMA 1MHNA 1UHFA 2EYQA 4Q5WA 2MAMA 1PG5B 1KQSP 1XO2A 3WVDB 4KBMB 2PVGB 4OMQA 3G6ET 3TNHB 1G3WA 3QKJA 1Q82C 2CREA 1KC8U 3CC7Q 4EOJB 2K9GA 2JTMA 2DIQA 4PFOA 3MEAA 4M7AG 4M7AD 3BHUB 2RD1A 1UG1A 3EOCB 1I5OB 4HVWA 3VV0A 1OULA 2CS7A 2FPDA 1V1CA 4A63B 1QVGP 3QJ6A 3OYDA 4M7AC 2KY9A 3G7ZA 2J6FA 1JKWA 2Y4XA 1YP5A 3GTMS 1KG1A 4E7IA 1ENWA 3M55A 2XHCA 4RODA 2EQIA 4LE9A 4UC4A 3RESA 3RGFB 2XG8D 1XNIA 3GF5A 3CC2T 1SF9A 2EYZA 4CRLB 1YWOA 1E7PA 4M78F 1YWPA 4EMKA 2AHJB 3H0FA 2Y4YA 4M75A 2KBTA 1YNZA 3GNGA 1K9MR 4OGCA 1ZSZA 2KT8A 4FT2A 2GQVA 4IUVA 1KQSA 1R0CB 1N8RC 2EQMA 5I5ZB 4BCHB 1ZSZB 2VWFA 3SWNC 1AISB 1MGQA 1NYFA 2IVWA 5LJ3j 5ECAA 4EMKB 3CC7T 4JRPA 1RAIB 4M78G 2XMFA 5J26A 1YHQA 1H641 3CCRT 2VXFA 1G3YA 1WGSA 4OMMA 5GMKe 4GLMA 1RUWA 2PK2A 4F7UB 5GAMf 2RQUA 2DXUA 4EMHA 1GUXA 2QEXA 3I56T 4C0GA 4E7ZA 1R77A 3PMIA 4A53A 2XKOC 2RN8A 4J5YA 2G3RA 2RHIA 2RNAA 1GH6B 3VS4A 1TU0B 2QQSA 2C4GB 1KHCA 3HRUA 5LL6S 1K0SA 1YITQ 2EWNA 3JCMf 1TFBA 1WHKA 4B6MA 3RBBB 4X34A 1JRIA 7AT1B 2C5VB 1RLPC 1ZHIA 3ASKA 2W0ZA 5GAOq 1ZP2A 2IPOB 1RAFB 4DBQA 4HVVA 5HCKA 2JGZB 3OS1A 4FW2A 2E5QA 2COWA 1W98B 2DE0X 3OYNA 4RCBA 2J6KA 5M9OA 3G4SA 3I5RA 2QTVA 3LWHA 2P0QA 3JRZA 1UDLA 4JRQA 1M1GA 4CFMB 1RAHB 2JTFA 3S3OA 3M4YA 1W70A 2NUZA 4E6RA 1Q7YR 3POMA 4OB0B 1H8KA 1SRMA 5GANg 5KYUB 4E7KA 1ACMB 2FG0A 2QGSA 1UTIA 3CMEQ 1QKWA 1QCFA 1AZEA 1AD5A 1S72A 1VQ8T 2QDLA 3M0UA 4C8QC 5CO7A 4HKEA 2QFZA 1NZ9A 2IW8B 1UUEA 1K1ZA 4F7LB 2FZGB 2DO3A 1Q86U 2CJMB 1O9KB 4FM4B 1C1AA 1J3TA 2RO0A 1PKDB 1WFWA 1WQ7A 3EG9A 5J3BA 1BI2A 1QCOA 4RTTA 3TCJA 1IGUA 1KK7A 4HCBA 2BKDN 1SG5A 3EHRA 1IO6A 1Q86C 4BBRM 3BW1A 4BCQD 3M9QA 3PNWC 5CYIB 2V8KA 1I81A 3HRSA 4TTHA 3CC2Q 5FRNA 4NS5A 2F2VA 1D3BA 1C0MA 1NJIR 4N0AA 4Z8AA 3L2RA 3VUZA 1UNLD 4M75E 1ZQ1A 2WMAB 1F1BB 5L2WB 4EOKB 5FLXE 1VQ6Q 1YI2T 4BDYA 4F17A 2P4TA 3J7AF 4YOSA 2HAXA 1D3BB 4XQ3A 2KDSA 2OTLA 2QASA 2O9SA 4FSXA 5DY9A 2J7IA 2DXBB 3OYIA 1N4MA 4ZGEB 4C92E 3M03A 1O75A 1OI1A 3CMAA 5CKBA 1OKVB 1UEBA 2KYMA 5KCOA 3EGUA 4N4HA 4HT8A 3QHSA 3I55A 3HP9A 3CBOA 2LCCA 3JCMX 1H3ZA 4AKGA 3FRNA 3VS0A 1GCPA 3GP8A 1MV3A 1VQKA 3CCJT 3I55Q 4M7AE 2LT1A 3BG9A 3BFMA 2DTOA 3TNWB 3G71A 2EIFA 3HO8A 5GMKm 4F7JB 2DBKA 3THKA 4B9WA 2EGCA 1D1CA 3MEVA 2DX1A 2HEQA 3VKGA 1F5QB 4YTLA 2PTKA 2QQRA 1VQOA 2BTTA 1DJ7B 5GAN3 5FW9A 3CCMA 2O88A 2XIDA 3CQTA 2IN3A 4JZ4A 5GANd 3M0SA 2MMPA 4LDXA 2L3QA 1Q7YC 2L2PA 3VRZA 2R5AA 4JLIA 1M8VA 1FMKA 4LDYA 3EFOA 1YCSB 4BB7A 1VOLA 4DBHA 2JJ9A 3JCMJ 1U8RA 2GFAA 1QVPA 3KXTA 3PO3S 5GAOm 2DRMA 4J9DA 3VKHA 2C6TB 2PZ1A 4J8OA 2XK0A 1VQMT 4MIMA 2E6ZA 4ELYC 1FWZA 3OW2A 4ROCA 1M27C 1XTDA 2GCXA 4Y28E 3LWIA 3NTHA 1OL1B 4EOQB 1M90C 4BUGA 2DRKA 4PLIA 2P84A 3QWLA 2ZGWA 3CPWP 2I0NA 3CC4A 4EC8B 5EJCA 2DYBA 4AFQC 1VIEA 2PMIB 2KXDA 4A54A 4HT9A 5I2SA 2IVXA 1YJ9Q 4X9DA 3DLLA 2BS2A 4BCIB 3FJPA 2YRVA 3CCSA 1CKAA 3JCMc 2LJ0A 4CI0C 2A37A 1H92A 5FWCA 4M77D 4KULA 4C0DB 1VQ7T 3JCMQ 5LJ5e 3CCSQ 2A3LA 3DTOA 2RB6A 3INZA 4QVZA 4CC7A 1H26B 2KMTA 2DBMA 3R6OA 2F5KA 4PJOC 2RMOA 2O4XB 1K73U 1QMZB 5ACBA 1ZBJA 2ABLA 5HVYB 1LNXA 1LJOA 2QF7A 2KEAA 1OV3A 2H3EB 1PKSA 1HD3A 5CKFA 1Y96B 2K5FA 3GLXA 2QA4Q 4F04B 4ELZC 1NLOC 4XTVA 2K6DA 1H1QB 2BUDA 3SFMA 3I5SA 5D6WA 2HL3A 1K9MU 2D0QB 3G1JA 3BE3A 4BCQB 1RABB 5I11A 2RJDA 2KRSA 3TW6A 4C92B 2QDYB 5GAOr 1SRLA 5CIUA 3KFVA 3MHXA 3SD4A 4HA8A 3EGDB 2XICA 1JBMA 2CCHB 5CK9A 2BS3A 4OP0A 4BD3A 5LJ3g 1W2BS 1WJRA 2AIRB 1TG0A 2Y90A 1I4K1 1TOVA 1ZLMA 4L5GA 2J06A 1Z9ZA 3E19A 2IG0A 1ARKA 3L1AA 1TWBA 1JSUB 2L3RA 2BS4A 3OBWA 3FC3A 5CEIB 1RAAB 5DQWA 2JVVA 2RHUA 2M0OA 4G6LB 4KT0E 2D1XA 4DBFA 2MIOA 2DTIA 1G83A 3G6EQ 1FMWA 1QW1A 4EORB 1NBEB 1MMDA 1M1KU 1YJ9T 3DB4A 1C9BA 2EYYA 1VYVA 1VQPQ 1Y71A 3EFRA 3EFSA 4C92C 4FCYA 4FIBA 2SRCA 3L2QA 3L42A 1EX4A 4X9CA 4JJNK 2CP0A 4RTWA 1VQPA 1RADB 4C92G 5BNJB 4RKUE 2VGNA 1QVGS 1X69A 3QYBA 1WHLA 3OYEA 5FRMA 1E7OA 1VOMA 2K7AA 3RNJA 4C5IA 4OMOA 5KE2A 2C06A 5GAN8 4WCIA 4QT7A 3UA6A 1JJ2A 3RMSA 3S6WA 1URCB 2BE7D 6AT1B 5AYFA 5DLQE 5J39A 2CUBA 4E47A 5LJ5j 4TVRA 1UNHD 2CZ7B 3LQ5B 4VUBA 3ZFJA 4CFNB 2XDBA 3IQLA 1OPLA 3CMEA 1GXIE 2LCLA 4BCND 4C5GA 3BLRB 2NUTB 4RMOA 2CT3A 4JX5A 4PJLA 4J6WA 4IUTA 3QIIA 2VXEA 1UNGD 2ZAEA 4OMFB 5IF1B 2DJQA 3UT1A 2E4HA 3HTRA 1VYWB 2JS0A 3I56A 2G77A 3PGGA 1Q81R 3EIDB 1K8AR 4BDZA 2L0AA 2WEVB 3H9NA 4BCPB 5HY6A 1K76A 1OX9A 2K57A 4XU2A 5I2MA 1YITA 2Z0WA 2QK0A 5KH6A 3EG3A 2EUFA 4LD9K 2FZKB 3UA7A 1BIBA 2MOXA 3CXCS 4ELJA 5CKEA 1O9SA 4C5HA 2EVRA 2CKKA 5FU6B 3L2UA 4RTYA 1KFZA 3TEEA 4C92A 1D1BA 4F7NB 3A8GB 1GRIA 5GAOn 2X35A 1YFNA 1IXDA 3A8MB 2HQEA 3FB9A 1VQ5Q 2FVUA 4QQDA 2ZPEB 4MZPA 3BY7A 2CZ1B 3I35A 5IN1A 1BI1A 1VQ5A 5IHKA 2DERA 4DA4A 3DL1A 2W99A 2DVJA 4ANJA 4QQGA 4KGZB 4PNOA 1X43A 1Q81U 4A4EA 4C8QF 2O2OA 5IHYA 1XQHA 2JN0A 3V8JA 2QA4T 3PFSA 4C8QA 2WHBB 1B3QA 8AT1B 1K8AC 1OX8A 2EJGA 4NOYA 5FROA 3JB9G 4PJOB 4A4GA 2E65A 5A0GA 2PUOB 2RA2A 2JW4A 2RI3A 1X01A 3VS6A 3JB9D 2M1HA 2E5KA 3M53A 3SB2A
chains in the Genus database with same CATH topology
5L8RE 3CCLT 3G4ST 1S72A 1VQ8T 1B34B 3OYYA 4ATOA 4C8QC 5CO7A 3OYGA 4HKEA 2QFZA 3X25B 1NZ9A 3LYIA 2WSEE 4BACA 1Y7XA 3JCMg 3GOXA 1NJIC 2DO3A 3CPFA 1Q86U 3CCET 2LVMA 3MP6A 2QEXT 1UGQB 4FM4B 2DAQA 2DKGA 5LJ5h 1YJWA 1NPRA 2RO0A 4M7DE 1WQ7A 5J3BA 1BI2A 1OZ3A 3TCJA 2YLBA 3FIFA 4F7UF 3ER0A 3JB9I 1Y96A 4GLKA 4HCBA 5LJ3h 2BKDN 4Z02A 2A7YA 5FU7C 4F7UE 3NTIA 3CEYA 5A2QE 1JJ2S 1K8AU 1Q86C 3HHTB 2L5QA 4BBRM 3BW1A 2RHXA 3F70A 2XDDA 1QVGA 3LGLA 1VQ4A 1N9SA 3M9QA 5DLOA 3PNWC 1WQWA 4LDVA 2V8KA 4HCCA 5GANf 2DXCB 1I81A 3HRSA 5CKDA 5FRNA 4MFDA 4NS5A 5GAMj 2DJZA 4V2SA 1D3BA 2QA4A 3OYBA 3M54A 3LX7A 5A0LA 4N0AA 3L2RA 3JCMW 2E6NA 5CQXA 5CVIA 3VUZA 3RERA 2GFUA 3JCMb 2HBPA 4M75E 3V7RA 1ZQ1A 4JX4A 2DD5A 1RL2A 4MDXA 3BDLA 2CZ6B 4IURA 4L59A 2V8IA 5FLXE 4MMKA 4BDYA 1LOJA 1YI2T 1M9SA 4E7JA 4ZTFA 2P4TA 3J7AF 2HAXA 2LT4A 2DVEA 1D3BB 3QYEA 2KDSA 4XQ3A 1N6AA 2WSCE 3QXEB 4OB1B 3MP8A 2OTLA 5FU7B 1Q81C 4FSXA 3V7SA 5DY9A 5LJ3e 3BDUA 4PJOG 4M6VA 4JLGA 4M78D 2DXBB 4PJOD 1P92A 3OYIA 1SSFA 3A5ZB 5GMKh 1X75C 3C94A 2ZZDB 4M7DA 4ZGEB 3J81E 1UGSB 3DKMA 1PSFA 4C92E 5HK3A 1QLBA 4OB3B 1O75A 1OI1A 3CD6A 3CMAA 5CKBA 1UEBA 2PVOB 5KCOA 4M7DF 1FX7A 4N4HA 4HT8A 1M4ZA 1QVFA 3M5AA 3QHSA 4FT4A 3C95A 5IT9E 3I55A 1QP3A 3HP9A 3N5BB 4IUUA 3CBOA 2LCCA 4PJOE 3JCMX 2L89A 1VIFA 1H3ZA 4M77C 2ZPBB 4AKGA 3FRNA 5A0DA 3J80E 1YI2A 1BI3A 3GP8A 1M1KC 1VQKA 3CCJT 3P8BB 4MFEA 3VKIA 2LT1A 4R56A 4M7AE 2K5LA 3V8KA 2CGHA 5GAMe 5CR2A 2E1HA 3BG9A 2I2LA 3BFMA 5CAIA 2DTOA 3QSUA 3G71A 4EPCA 5GMKj 2EIFA 2D6FA 4NL2A 3HO8A 5GMKm 3VJPA 4QQ6A 4QVCA 2MWPA 4Y91A 4B9WA 4BY6C 3CCQA 3MEVA 2PUKB 3A8OB 3VKGA 2DD4A 2WSFE 3MEWA 4XAXB 4QVDA 4HCZA 4YTLA 2VUBA 5GAN4 2QQRA 3G71T 3I55T 1VQOA 1VQ7A 3E9GA 1M90U 1VQKT 3MP1A 3OYFA 1DJ7B 4FL6A 5GAN3 5GAOl 2E70A 1WNLA 3CCMA 2OAUA 2XIDA 4OGEA 2RM4A 4A4HA 2QXFA 3OMCA 4JDSA 5GANd 1VQLT 4F7UG 2ZPIB 2MMPA 4LDXA 2PU9B 4II1A 4AI6A 1Q7YC 2CZ0B 2JOYA 4PL6A 4C8QE 2F5TX 3Q1JA 4M78B 1NE8A 2R5AA 3ZEHA 2O01E 4JLIA 1M5Q1 1M8VA 2MWOA 3V7CA 1G3TA 2KK4A 4LDYA 2RJEA 3META 4N4IA 4NL3A 1YJWT 4BB7A 2KSSA 2P0PA 5GAMg 3KUFA 5GAN7 3JCMJ 1U8RA 3C4SA 2D9TA 5GMKi 2GFAA 2LC4A 4ZGJB 1QVPA 4J83A 2F69A 2XU8A 5GAOm 3KXTA 4L6V5 4LD6A 3FLGA 4NC6A 4C92D 4ME7A 3VKHA 4RG8A 1KD1U 2V8JA 1VQNT 4J8OA 2XK0A 4C0FA 2O4XA 1VQMT 4MIMA 2E6ZA 4M77B 1FWZA 2EJ9A 4ELYC 3OW2A 2ZPFB 1VQ4T 4LDUA 1K9MC 2RJCA 1XTDA 2GCXA 3M58A 2BIVA 2RK2A 3E1SA 3NFCA 4GY5A 4Y28E 3NTHA 3LWIA 4J7IA 2QI2A 4XTWA 4B9XA 5GANe 3JCMP 3KHIA 4BUGA 1M90C 2K3XA 3FDRA 4PLIA 4EDUA 4BE0A 3QZ9B 3VU3C 3QWLA 2ZGWA 2RJFA 1NPPA 1R8OB 5LJ3d 1ZBXA 4ZTJA 3CC4A 2FL7A 3HRTA 3JCMh 5EJCA 3CCRA 1Q82U 1VQNA 1KHIA 1VIEA 4BI3A 2LNVA 4Z6YA 4A54A 3CD6T 4HT9A 5I2SA 2K4YA 3OQ5A 2QQBA 3JCMe 4X9DA 3RMQA 3DLLA 1V29B 4RG2A 2BS2A 1FXXA 2ZPGB 2FYKA 2YRVA 3FJPA 3LW5E 5DM7R 3CCSA 1VQMA 1I5LA 1S72T 3CC7A 3CCLA 3JCMc 4DOWA 4CI0C 4KUIA 3M59A 1X6OA 4FU6A 2EFIA 4M77D 3CPWS 3CCUA 4KULA 4C0DB 2X4WA 2EJFA 2HNIA 4J6XA 4BI8B 5LJ5e 3JCMQ 2DD5B 2A3LA 4QSHA 3CXCA 4RCCA 2RB6A 3INZA 4HNUA 5GAN2 4QVZA 3RIRA 4M75F 2EQUA 2LX9A 4C5EA 2KMTA 3CMET 3S3NA 2XDPA 4N0AC 3R6OA 2K3YA 2F5KA 2PQWA 2RHZA 1YIJA 4M7DD 2DXCA 4M77F 3OSSC 2VV5A 2OTLT 4ZGDB 3O8VA 4M78C 2O4XB 1YJNT 1UB4A 1M1FA 2DZCA 2KQWA 2LRQA 1K73U 4M77E 4P5NA 1LNXA 2KAFA 1LJOA 2QF7A 2QTXA 4A4FA 3TW7A 4QW2A 1OYXA 2DEQA 3HBLA 3OYLA 5CKFA 3ZBDA 4IUQA 1Y96B 2K5FA 1TH7A 3GLXA 4XK8E 3OA6A 4ELZC 4XTVA 1U1TA 1WJQA 2BUDA 2QQAA 4M75G 2KMGA 4O6JA 3SFMA 4EMGA 5GAMd 1VQ7T 5C0MA 5D6WA 3MCAB 3JAME 3OY9A 3TREA 2D0QB 3A8LB 4HNTA 2P0KA 1K9MU 1VQ6A 4ZN1A 2K2VA 1YJNA 4HNVA 1WPYA 1Q7YU 4C8QG 2RJDA 3CCVA 3HL8A 1YIJT 4JX6A 2R57A 3TW6A 3JSCA 3QBYA 4C92B 5HK0A 2QDYB 3L2ZA 1Y07A 3V8LA 3OYAA 3HB9A 2E12A 3H4CA 4HL4A 5CIUA 5GAOr 2X4JA 3HFNA 1N8RU 3MHXA 3SD4A 1G5VA 4HA8A 4MZTA 3JB9F 4KUDK 3OYHA 2QQ9A 4M7DC 5GAN5 2XICA 3C12A 3DB3A 5GANh 3MO8A 4O5VA 1JBMA 3T9NA 5CK9A 5LJ5d 3CCST 3OB9A 2BS3A 4A4KA 2MI6A 2E64A 3CBMA 3QUIA 1QVFS 1KQ2A 3GIBA 1IREB 4JS4A 1VQOT 3CCMT 2DZ9A 2DXTA 3QPHA 4IUPA 4OP0A 4BD3A 5LJ3g 3NTKA 2HQXA 1WJRA 2YHTA 1W2BS 5IAYA 3QYGB 5GANj 2FB7A 2RH2A 4JS5A 4CRIA 2Y90A 2ZPHB 2QDJA 5D6YA 1KQSS 2EAYA 1I4K1 4L5GA 4ZN3A 2FHDA 3MEUA 4C8QD 2DK3A 1EIFA 3OBYA 3E19A 2IG0A 4AKIA 3AHUA 3L1AA 1XOVA 2E10A 1BKBA 1FKMA 3QYHB 1BIAA 5FU6C 2L3RA 4OB2B 2BS4A 3OBWA 3FC3A 3VYGB 4J6YA 4C92F 1KQ1A 2LTOA 4M75C 2JVVA 2ZCFB 2RHUA 3X20B 2M0OA 3RKWA 5C6SA 3ME9A 3CC4T 1YITT 1K73C 3VUBA 5CQYA 4KT0E 2DD4B 1VQ9T 3RUXA 3JCMV 2HD0A 3QJYA 2DTIA 3GNFB 3JB9H 2E41A 3RKXA 4LDWA 1QW1A 1HXDA 3SDZA 4JRIA 1YBYA 3OSVA 3P8DA 3CCEA 1YJ9T 1M1KU 2OTJT 3DB4A 2LDMA 2VYTA 4XTXA 3QDRB 1VUBA 3M57A 5I21A 3SWNB 3OYJA 2XD0A 3DLMA 2DIGA 1Y71A 3EFRA 2VGMA 1MHNA 3EFSA 4M77A 4C92C 2EYQA 3CCVT 4FIBA 4Q5WA 3L2QA 4D6WA 3L42A 2CYZB 2MAMA 4X9CA 4JJNK 3P8HA 4F7UA 2L8DA 1VQPA 3URGA 2RHYA 2B8AA 4C92G 2DPPB 3WVDB 4KBMB 5GMKl 2PVGB 3HKSA 3PMTA 3G6ET 2VC8A 1G3WA 1OZ2A 4BBSM 4RKUE 2VGNA 3OYMA 1QVGS 3QYBA 3QKJA 3JCMd 1Q82C 1KC8U 2JZ2A 3OYEA 5FRMA 2JTMA 2DIQA 2X4YA 4OF1A 4BY6B 4C5IA 5KE2A 3MEAA 2WJ9A 4MMLA 3OS2A 3L2WA 2C06A 5CCAA 1G3SA 4M7AG 2RD1A 5GAN8 4M78A 4M7AD 4M7DB 3LLRA 2K5IA 3VV0A 2CS7A 2RI2A 1W4SA 2GF7A 3HZJA 4M78E 2R58A 3M4GA 3OMGA 2X4XA 3QJ6A 3OYDA 3RMSA 3S6WA 3FEOA 1JJ2A 5GAOp 4M7AC 3X28B 2KR6A 2EQKA 2KY9A 3G7ZA 3LGFA 3CPWA 4IKFA 1YHQT 1W2BA 4XU0A 4OVAA 1AHJB 1JB0E 2LQKA 5AYFA 1BI0A 2Y4XA 5DLQE 4WF2A 2R5MA 5J39A 1KG1A 4E47A 5LJ5j 4E7IA 4TVRA 3M55A 3WXMB 2CZ7B 2RK1A 1RI0A 2XHCA 3RKYA 3QG1A 4VUBA 1WJSA 2PVDB 3ZFJA 4UC4A 3RESA 2XG8D 3QO3A 1XNIA 2XDBA 2M9UA 3CMEA 3CMAT 1GXIE 1UGRB 2LCLA 1QP2A 4M7AF 3GF5A 3S3MA 4PLLA 4C5GA 3CC2T 3CCJA 4BE2A 1N27A 4RMOA 3BG3A 4JRKA 4JX5A 3HSBA 1E7PA 4MDWA 4J6WA 2NLUA 4M78F 4IUTA 4XTUA 5CKHA 3QIIA 4EMKA 2AHJB 3TU4K 1VQPT 2VXEA 4PJOA 4AKHA 2Y4YA 4M75A 1VQ5T 4OMFB 1VQLA 3GNGA 4OGCA 1IZ6A 3CC2A 4XU1A 4FT2A 4HLQA 2GQVA 1NJIU 3PIPA 4IUVA 1KQSA 1PSEA 1N8RC 3UT1A 2EQMA 4M75D 3SWNC 3H6ZA 4R55A 2JUFA 2QQ8A 3HFOA 1MGQA 2IVWA 4LOCA 5HKCA 5LJ3j 5LJ5g 4EMKB 2ZZDA 3I56A 3CC7T 3M56A 4C0ZA 2G77A 1VQ6T 3PGGA 2DXBA 4JRPA 3OS5A 4BDZA 2RI5A 3OYCA 4XTYA 2XI9A 4M78G 4XTZA 5HY6A 1YJ9A 2K57A 4XU2A 5J26A 5I2MA 5KE3A 1YITA 1YHQA 3KBGA 1HK9A 4E7LA 1H641 3CCQT 3CCRT 5KH6A 3OYKA 2VXFA 3WVEB 1G3YA 1WGSA 2YLCA 5GMKe 3PIOA 4M7DG 2DTHA 4LD9K 4XU3A 5GAMf 4F7UB 1I8FA 5EG2A 2DXUA 1BIBA 1KC8C 3CXCS 5KCHA 3OS0A 4EMHA 3L2VA 3PT9A 3GPLA 4ELJA 5CKEA 2QEXA 3I56T 4C0GA 1O9SA 3QZ5B 3LH0A 3PMIA 4C5HA 3BG5A 2CKKA 2M16A 4A53A 5FU6B 3SWNA 2XKOC 3EAEA 3L2UA 4J5YA 4BE1A 3TEEA 4C92A 2G3RA 2LQ8A 2RHIA 3A8GB 5GAOn 3UDCA 2X35A 4EMKC 2QQSA 4DQ2A 1KHCA 3A8MB 2HQEA 3HRUA 4JUVA 3FB9A 5LJ3f 5LL6S 5GAMh 3G6EA 2FVUA 1BYMA 3E9FA 4QQDA 4PJOC 2ZPEB 2EWNA 3BY7A 4MZPA 3JCMf 1U1SA 5D6XA 2CZ1B 2MF2A 4PJOF 4DOVA 3CCUT 4X34A 3VYGA 1JRIA 1ZHIA 1BI1A 3ASKA 5IN1A 5GAOq 1VQ5A 3HPWA 3X26B 4BI4A 2OTJA 4DA4A 3X24B 2H3JA 1YCYA 4MZMA 3JB9J 3DL1A 3OS1A 3VYHB 1VQ9A 2E5QA 4QQGA 4C0DC 3OW2S 3OYNA 4PNOA 4RCBA 5M9OA 1Q81U 3G4SA 4A4EA 1VQ8A 3LWHA 4C8QF 2P0QA 3H8ZA 3JRZA 4JRQA 2JNGA 1B34A 1N9RA 1M1GA 2EQJA 2WACA 1XQHA 2JN0A 2JTFA 4PKCC 4E7HA 3S3OA 3M4YA 3V8JA 4M7AA 4N4GA 2QA4T 3PFSA 4C8QA 4OB0B 4J7FA 1K8AC 4M77G 2KVQG 2EJGA 4NOYA 5FROA 5GANg 4M75B 5GAN6 3UPUA 4E7KA 3JB9G 5LJ5f 4A4GA 2E65A 5A0GA 4PJOB 2PUOB 3PTAA 3A8HB 2RA2A 3UWNA 2RI3A 1X01A 3CBPA 4C8QB 3JB9D 1KD1C 2M1HA 3M53A 4M7AB 1UGPB 2EKOA 3SB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R E;  2QDY B;  1GXI E;  1UGR B;  1QP2 A;  3X25 B;  2WSE E;  2ZPI B;  2PU9 B;  2CZ0 B;  2O01 E;  2AHJ B;  1UGQ B;  4FM4 B;  1IRE B;  1PSE A;  4ZGJ B;  3QYG B;  4L6V 5;  2ZPH B;  3HHT B;  2ZZD A;  2DXB A;  2ZPF B;  2DXC B;  3QYH B;  4OB2 B;  4Y28 E;  3VYG B;  2ZCF B;  3X20 B;  3WVE B;  3QZ9 B;  4KT0 E;  2DD5 A;  2DD4 B;  2CZ6 B;  3QZ5 B;  2WSC E;  3QXE B;  4OB1 B;  1V29 B;  2ZPG B;  3LW5 E;  3A8G B;  2DXB B;  2ZZD B;  4ZGE B;  2CYZ B;  3A8M B;  1UGS B;  1PSF A;  2DD5 B;  4OB3 B;  2ZPE B;  2DPP B;  3WVD B;  2PVO B;  2PVG B;  2CZ1 B;  4RKU E;  3VYG A;  1QP3 A;  3X26 B;  3X24 B;  2ZPB B;  2DXC A;  4ZGD B;  3VYH B;  3X28 B;  4XK8 E;  4OB0 B;  1AHJ B;  1JB0 E;  2PUK B;  3A8O B;  2WSF E;  2DD4 A;  2PUO B;  3A8H B;  2D0Q B;  3A8L B;  2CZ7 B;  2PVD B;  1UGP B;  1DJ7 B; 
#chains in the Genus database with same CATH topology
 4RUG A;  1VA7 A;  3OYG A;  3LYI A;  4LNP A;  4BAC A;  1Y7X A;  3GOX A;  1NJI C;  1WYX A;  3CPF A;  3RR6 A;  1UGQ B;  3DDQ B;  1OPK A;  1WDX A;  2DKG A;  4KRD B;  2DAQ A;  5LJ5 h;  1YJW A;  1NEB A;  1H25 B;  1Y96 A;  1MV0 B;  3AT1 B;  3NTI A;  4CFV B;  5A2Q E;  4EOS B;  1K8A U;  3F70 A;  1QVG A;  1VQ4 A;  1N9S A;  1WQW A;  2DXC B;  4MFD A;  3CMA Q;  2DJZ A;  4V2S A;  4Y92 A;  3M54 A;  4WTO B;  3O5Z A;  1I1J A;  3M0Q A;  2UZL B;  3NHN A;  3JCM W;  5CVI A;  1WI7 A;  2CSI A;  4PFP A;  4JX4 A;  4MDX A;  2CP5 A;  4IUR A;  2V8I A;  1U06 A;  2EPD A;  2DVE A;  1GBR A;  1NLP C;  1GFD A;  3QXE B;  4OB1 B;  4OR5 B;  3V7S A;  3BDU A;  4M6V A;  4JLG A;  4PJO D;  1P92 A;  1SSF A;  1TSF A;  1X75 C;  1K9A A;  2FO0 A;  2EBP A;  1VQL Q;  2GTJ A;  5HK3 A;  3CD6 A;  2KYB A;  4E2F B;  2PVO B;  1VQO Q;  1FX7 A;  3TSZ A;  3M5A A;  1LPL A;  4FT4 A;  4BXX X;  4PJO E;  4IUU A;  4M77 C;  3J80 E;  2UUE B;  3H41 A;  1H1R B;  5HQ0 B;  2PNI A;  3P8B B;  2DNU A;  2DL3 A;  2K5L A;  2YUO A;  3NMZ C;  2CGH A;  5GAM e;  5CR2 A;  2E1H A;  3QSU A;  2LW4 A;  1QWE A;  1JU5 C;  1YHQ Q;  2GTO A;  3VJP A;  2PUK B;  2MPX C;  3MEW A;  4QVD A;  1H27 B;  2VUB A;  2JS2 A;  3I55 T;  1M90 U;  3ULR B;  4KGX B;  4FL6 A;  2M02 A;  1JOW A;  1VQL T;  4F7U G;  1M1K R;  2ZPI B;  2W9Z A;  2IW9 B;  4II1 A;  3CXC P;  1M3A A;  3QHW B;  4LUD A;  2F5T X;  1D0Z A;  3ZEH A;  2O01 E;  1M5Q 1;  1G3T A;  4NL3 A;  2HMA A;  2KSS A;  4F6U B;  3KUF A;  4AFZ C;  2LCS A;  1GY3 B;  2OAW A;  1SHF A;  4ZGJ B;  2F69 A;  1VQ9 Q;  4L6V 5;  2YUQ A;  3FLG A;  4NC6 A;  4C92 D;  4EOI B;  1KD1 U;  1VQN T;  1UJY A;  4C0F A;  3MPU B;  2V26 A;  2EJ9 A;  2ZPF B;  2BPM B;  4LDU A;  4BCF B;  3CCE Q;  3NFC A;  4J7I A;  4XTW A;  4B9X A;  5GAN e;  2O9V A;  2B86 A;  3CCR Q;  2K3X A;  5IDP B;  4EDU A;  4BE0 A;  5KYW A;  5FWB A;  2RJF A;  2HKN A;  3U23 A;  5LJ3 d;  4ZTJ A;  1ZBX A;  1X6G A;  1M8M A;  3CCR A;  1Q82 U;  4J9G A;  2LNV A;  4Z6Y A;  3OQ5 A;  1V29 B;  2ZPG B;  1D1A A;  1MMN A;  3CCL A;  4EC9 B;  2KRM A;  3CC7 A;  1BCO A;  4DOW A;  4EON B;  1WHH A;  3M59 A;  2BZ8 A;  2ROL A;  3CCU A;  2D8H A;  2X4W A;  2EJF A;  4J6X A;  3CXC A;  2DD5 B;  2IIM A;  3M0R A;  4HNU A;  2LJ3 A;  1YI2 Q;  1D0Y A;  4C5E A;  4N0A C;  1YIJ A;  4M77 F;  2VV5 A;  4ZGD B;  1KSW A;  1YJN T;  1UB4 A;  1M1F A;  2LQW A;  1AT1 B;  4M77 E;  2QTX A;  4A4F A;  4KRC B;  1W6X A;  2DEQ A;  3HBL A;  2DFU A;  2W10 A;  3ZBD A;  1T3S A;  3TQ7 P;  4IUQ A;  1D09 B;  1TH7 A;  2FRY A;  4XK8 E;  2EGE A;  3OA6 A;  4LUE A;  2QQA A;  2COZ A;  1ZA1 B;  5GAM d;  4BCM B;  5C0M A;  3JAM E;  3TRE A;  1BBZ A;  2P0K A;  5GJV B;  1R0B G;  3G4S Q;  2AZV A;  2K2V A;  5KYY B;  4J9F A;  4JZ3 A;  4JX6 A;  3QBY A;  1T0H A;  1OGU B;  3HFN A;  4OML A;  3QWX X;  1G5V A;  1GFC A;  2AZS A;  4MZT A;  4KUD K;  2ED0 A;  3OYH A;  1K0X A;  5GAN 5;  5LJ5 d;  2MI6 A;  2QEX Q;  1IRE B;  4JS4 A;  2DZ9 A;  2CH4 W;  2X51 A;  2HQX A;  2YDL A;  5IAY A;  3QYG B;  2FB7 A;  4CC2 A;  1O9K A;  4CRI A;  1X2K A;  2WMB B;  5D6Y A;  1KQS S;  2EAY A;  1VYU A;  1YJN Q;  4OMP A;  4C8Q D;  1A0N B;  2E10 A;  1BKB A;  1BIA A;  1W2B P;  2ENM A;  4FW1 A;  3VYG B;  3JV3 A;  4M75 C;  1QKX A;  2W2H A;  2FEI A;  5C6S A;  1BU2 A;  1YIT T;  3CC4 T;  2OI3 A;  1K73 C;  1QLY A;  3EG0 A;  1GBQ A;  2DD4 B;  2X3W D;  1T3L A;  2R7G A;  3JB9 H;  2E41 A;  2JTE A;  3SDZ A;  4BCN B;  2MK5 A;  3P8D A;  1YBY A;  2P4R A;  4XTX A;  1OI9 B;  2A0F B;  3QWY A;  4JJD A;  5I21 A;  3SWN B;  4M77 A;  2CCI B;  3CCV T;  1GUX B;  4D6W A;  3P8H A;  3UF4 A;  4F7U A;  3URG A;  1H3H A;  2RHY A;  3M0P A;  5GMK l;  3PMT A;  3HKS A;  1OZ2 A;  1HSQ A;  2F2W A;  1E6H A;  2K3B A;  3OYM A;  1WHM A;  2JZ2 A;  1IGQ A;  4BY6 B;  1QVF P;  2PJQ A;  4M7D B;  1VQN Q;  1W4S A;  2GF7 A;  2CP2 A;  3M4G A;  3OMG A;  3FEO A;  1TD6 A;  4QKU A;  2K2M A;  1YHQ T;  1S1N A;  5IHN A;  1W2B A;  4JPB W;  1AHJ B;  3LH5 A;  5IDN B;  1JST B;  2R5M A;  3R6N A;  4KH1 B;  1RI0 A;  4F6S B;  3RKY A;  3QG1 A;  1WJS A;  1UHC A;  1UGV A;  1UGR B;  4M7A F;  4IIO A;  4PLL A;  1AZG B;  3CCJ A;  1N27 A;  3H0H A;  4JJB A;  4JRK A;  3HSB A;  2NLU A;  5HBE B;  4NST B;  3TU4 K;  1VQP T;  2YWW A;  2ROT A;  4AT1 B;  1VQ5 T;  1RI9 A;  4EOL B;  4M4Z A;  1VQL A;  1IZ6 A;  3CC2 A;  4XU1 A;  4HLQ A;  1NJI U;  2D8J A;  1PSE A;  2O31 A;  1QQJ A;  1QWF A;  2EGA A;  1YJW Q;  4M75 D;  3H6Z A;  2CSQ A;  3MIA B;  3HFO A;  1VIN A;  4LOC A;  4RTX A;  5LJ5 g;  2FZC B;  2LQN A;  3M56 A;  4C0Z A;  2UZB B;  1QMC A;  2DXB A;  1TUD A;  3C0C A;  1AWW A;  1ZA2 B;  4FSS A;  2WIH B;  1VQ4 Q;  5KE3 A;  2X1N B;  2RF0 A;  4E7L A;  1ABQ A;  3CCQ T;  1JJ2 P;  3OYK A;  3PIO A;  4GBQ A;  4AMC A;  4M7D G;  2DTH A;  1I8F A;  2L3S A;  5EG2 A;  2YRD A;  1KC8 C;  5KCH A;  3OS0 A;  3L2V A;  3PT9 A;  3GPL A;  2V22 B;  3LH0 A;  3BG5 A;  2CP7 A;  4BE1 A;  2DA9 A;  3MY5 B;  3RDV A;  2MYS A;  1G8X A;  3CC4 Q;  4IIM A;  3BHV B;  3DDP B;  3BLQ B;  3PVL A;  4JUV A;  2W9F A;  5LJ3 f;  5GAM h;  1BYM A;  4ESR A;  1EFN A;  1D3U B;  5D6X A;  2MF2 A;  4PJO F;  2AKL A;  4DOV A;  3CCU T;  3VYG A;  1UFF A;  2OTJ A;  1PD1 A;  4BI4 A;  2H3J A;  4MZM A;  3JB9 J;  5LMK B;  3VS1 A;  3VYH B;  1VQ9 A;  1ABO A;  2UZE B;  3OW2 S;  9ATC B;  4ORZ A;  1VQ8 A;  2EYW A;  3H8Z A;  2JNG A;  1B34 A;  2EQJ A;  4PKC C;  4E7H A;  2NUP A;  1OU8 A;  4N4G A;  3B57 A;  4J7F A;  2KVQ G;  3UPU A;  5KYN A;  1BCM A;  3CBP A;  5CKH A;  2NUP B;  5L8R E;  3CCL T;  3G4S T;  3OYY A;  4ATO A;  2EKH A;  3X25 B;  4AG1 C;  3JCM g;  2C0O A;  2LVM A;  3MP6 A;  2SEM A;  2QEX T;  5D7U A;  2JXB A;  1NPR A;  4M7D E;  3REB B;  2J6O A;  1OZ3 A;  3FIF A;  3JB9 I;  1ZUU A;  1TUG B;  4Z02 A;  2A7Y A;  5FU7 C;  1SPK A;  2E3H A;  3CEY A;  1Q95 G;  3O0G D;  5IHI A;  2A28 A;  2L5Q A;  2C5O B;  2RHX A;  2XDD A;  3LGL A;  1AOJ A;  5DLO A;  1V76 A;  5GAM j;  3OYB A;  1EZZ B;  1ZSG A;  3VS5 A;  3VS3 A;  1PKT A;  3RER A;  4YC3 B;  1M2O A;  2YXY A;  2HBP A;  3V7R A;  2DD5 A;  2BE9 B;  4CC4 B;  4L59 A;  1M9S A;  4ZTF A;  1ZUK A;  1OOT A;  1SKU B;  2GNC A;  2LT4 A;  3QYE A;  1N6A A;  2WSC E;  2DET A;  1X6B A;  4KRT A;  4M78 D;  2F2C A;  3C94 A;  3EGX A;  3J81 E;  1UGS B;  4UN0 A;  3BLH B;  4OB3 B;  1I0C A;  1WHG A;  4M7D F;  3CCU Q;  5IT9 E;  4F6W B;  1FIN B;  3N5B B;  1LVK A;  2DF6 A;  2DLP A;  2G6F X;  1YI2 A;  1PC0 A;  2QYZ A;  2DL5 A;  4DEX A;  2QGG A;  1M1K C;  3VKI A;  1T0J A;  2KR3 A;  2YUN A;  1P5E B;  2JMC A;  2V1R A;  1SHG A;  1GL5 A;  4J9H A;  4RTZ A;  2JM9 A;  4EPC A;  5GMK j;  2D6F A;  1KIK A;  4QQ6 A;  4QVC A;  4Y91 A;  4HVU A;  4BY6 C;  3CCQ A;  5IH2 A;  2WSF E;  1XJW B;  2DD4 A;  4XAX B;  4F7S B;  1VQ7 A;  1VQK T;  1Y57 A;  3VS7 A;  2F2X A;  5GAO l;  2E70 A;  2OAU A;  3I9Q A;  2RM4 A;  4OGE A;  2QXF A;  3OMC A;  4JDS A;  1TXQ A;  2EW3 A;  2LZ6 B;  4AI6 A;  2CZ0 B;  1TTH B;  1D0X A;  2QGF B;  3Q1J A;  2HDA A;  2VB6 A;  1FVV B;  1NE8 A;  3PE0 A;  2MWO A;  3V7C A;  1AEY A;  1IHV A;  4J9E A;  3MET A;  4N4I A;  1YJW T;  5GAM g;  5GAN 7;  5GMK i;  2C0I A;  4LD6 A;  4CFU D;  1VQ4 T;  2RJC A;  4CFW B;  2V1Q A;  2BIV A;  2RK2 A;  3E1S A;  1M90 R;  4FX3 B;  3FDR A;  2AKK A;  3VU3 C;  3I56 Q;  3FJ5 A;  2NWM A;  1NPP A;  1R8O B;  4PJJ A;  2ATC B;  2FL7 A;  1Q86 R;  2LP5 A;  1KHI A;  1VQM Q;  4BI3 A;  1NEG A;  2NUT A;  3CD6 T;  2K4Y A;  8ATC B;  1OU9 A;  2RQW A;  1PWT A;  5DQV A;  3RMQ A;  5EFQ B;  4RG2 A;  2I40 B;  1PNJ A;  3H0I A;  1VQM A;  1I5L A;  4FYX B;  1FYN A;  4FU6 A;  4EOM B;  2EFI A;  3EHQ A;  1VQO T;  2HNI A;  4QSH A;  2KXC A;  5GAN 2;  2CH4 A;  4M75 F;  2QAZ A;  4YOO A;  2LX9 A;  3CME T;  1OIY B;  2K3Y A;  2PQW A;  2RHZ A;  4M7D D;  2ED1 A;  2DXC A;  3OSS C;  4PJN A;  2OTL T;  3O8V A;  1KXU A;  3BHT B;  2DZC A;  2JM8 A;  2LRQ A;  3QHR B;  1YN8 A;  1M2V B;  2KQW A;  2KAF A;  2LX7 A;  3VRY A;  2C0T A;  4QW2 A;  3OYL A;  1JEG A;  2CP3 A;  4CFU B;  1S72 Q;  2GBQ A;  3E2U A;  1U1T A;  1AWX A;  4M75 G;  1VQK Q;  2W96 A;  3OY9 A;  3A8L B;  3M0T A;  5KYW B;  4ZN1 A;  1YJN A;  4HNV A;  3DOG B;  3CCV A;  1YIJ T;  3JSC A;  5HK0 A;  3OYA A;  3HB9 A;  2X4J A;  1N8R U;  2B9R A;  2CUD A;  5IXF A;  3CCV Q;  1PRM C;  3SEM A;  1HJD A;  5GAN h;  2RQR A;  4O5V A;  3T9N A;  2KGT A;  3CCS T;  4J9B A;  4A4K A;  2ESW A;  1JXM A;  2E64 A;  3G71 Q;  1SEM A;  2DXT A;  4IUP A;  3GBQ A;  3NTK A;  1AWO A;  4FYV B;  2KT1 A;  2HBW A;  5GAN j;  2RH2 A;  4JS5 A;  4DBR A;  1LCK A;  2ZPH B;  2HL5 C;  2QDJ A;  2KI7 A;  1N8R R;  1H1S B;  1TS9 A;  2FHD A;  2DK3 A;  1EIF A;  1WA7 A;  1FKM A;  3QYH B;  5HBH B;  4KH0 B;  4OB2 B;  2FPE A;  4C92 F;  4J6Y A;  1ZX6 A;  1KQ1 A;  2HQH A;  1OIU B;  2ZCF B;  3RKW A;  2JT4 A;  5CQY A;  1IB8 A;  3QDF A;  1VQ9 T;  3ZL7 C;  3JCM V;  2HD0 A;  3QJY A;  1PD0 A;  2X3X D;  3RKX A;  4LDW A;  1MUZ A;  4JRI A;  3OSV A;  2MCN A;  2VYT A;  3QDR B;  1CSK A;  3TVT A;  2YT6 A;  4J9I A;  1IHW A;  3TSW A;  3DLM A;  2DIG A;  4FYY B;  2CDT A;  2CYZ B;  2L8D A;  1JQQ A;  4HXJ A;  2B8A A;  2DPP B;  3EG1 A;  1X2Q A;  2VC8 A;  4BBS M;  2VAS A;  4CC3 A;  1WZO A;  3JCM d;  2BZY A;  2GGR A;  2X4Y A;  4OF1 A;  3OS2 A;  3L2W A;  2WJ9 A;  2WXV B;  4MML A;  5CCA A;  1G3S A;  5I22 A;  2E3I A;  4M78 A;  1OEB A;  3LLR A;  2K5I A;  5EC7 A;  2RI2 A;  2VVK A;  3HZJ A;  2DL4 A;  2COY A;  2HKQ B;  4M78 E;  2R58 A;  2X4X A;  5GAO p;  3X28 B;  2KR6 A;  2EQK A;  2CP6 A;  2A36 A;  3LGF A;  3CPW A;  4IKF A;  1RAE B;  4XU0 A;  4OVA A;  2I53 A;  1JB0 E;  2LQK A;  1BI0 A;  4WF2 A;  4D8K A;  3WXM B;  2RK1 A;  1X27 A;  1GCQ A;  1FMV A;  5HBJ B;  2PVD B;  2OTL Q;  3NGP A;  3QO3 A;  1E9H B;  2M9U A;  3CMA T;  4D8D A;  1QP2 A;  3EH1 A;  3S3M A;  4BE2 A;  3BG3 A;  1AWJ A;  4MDW A;  4XTU A;  4PJO A;  4AKH A;  1WXB A;  1G3N C;  2ECZ A;  3PIP A;  4LXC A;  3MY1 B;  3EG9 B;  3VS2 A;  2IW6 B;  4CXA B;  4R55 A;  2JUF A;  2QQ8 A;  1MNE A;  1NYG A;  1MMG A;  5HKC A;  2LJ1 A;  1NM7 A;  1YIJ Q;  2ZZD A;  1VQ6 T;  3OS5 A;  2RI5 A;  3OYC A;  4XTY A;  2XI9 A;  4XTZ A;  1YJ9 A;  3KBG A;  2DL8 A;  1HK9 A;  1PRL C;  4OGR B;  2BZX A;  3WVE B;  2YLC A;  1RAG B;  4XU3 A;  1UEC A;  3QZ5 B;  3CCM Q;  4ZNX A;  2VKN A;  2M16 A;  3SWN A;  1B7T A;  3EAE A;  2YRC A;  1WX6 A;  1ZSZ C;  2LQ8 A;  3A98 A;  3UDC A;  4EMK C;  4DQ2 A;  4I3Z B;  4AFS C;  3G6E A;  2JMA A;  1Q82 R;  3E9F A;  1U1S A;  2RQT A;  3EFO B;  3HPW A;  3X26 B;  3X24 B;  1YCY A;  2C5X B;  1I07 A;  2PK9 B;  4C0D C;  2QG9 B;  2OJ2 A;  1U5S A;  4BY1 X;  1N9R A;  3OW2 P;  2WAC A;  2GQI A;  4OMN A;  4M7A A;  4Z88 A;  3MKD A;  3EJ1 B;  4M77 G;  4M75 B;  5GAN 6;  5LJ5 f;  4DEY A;  3PTA A;  3A8H B;  1H28 B;  2HZY A;  3EGD A;  3UWN A;  4R0K A;  4C8Q B;  1KD1 C;  4HCK A;  4M7A B;  2H8H A;  1UGP B;  2EKO A;  1B34 B;  2WSE E;  5AT1 B;  3CCE T;  1JO8 A;  4AFU C;  4ELL A;  2DM1 A;  4EOP B;  2YLB A;  4F7U F;  3ER0 A;  4GLK A;  3SHW A;  5LJ3 h;  4F7U E;  4F14 A;  1W1F A;  1JJ2 S;  2DME A;  2F1L A;  3HHT B;  3CCL Q;  2YUP A;  4PK4 A;  4HCC A;  4LDV A;  5GAN f;  5CKD A;  2C5N B;  4Y72 B;  3TNI B;  1M3B A;  3EH2 A;  2A08 A;  2YSQ A;  2QA4 A;  2HSE B;  2WPA B;  3LX7 A;  5A0L A;  1KC8 R;  2E6N A;  5CQX A;  2FPF A;  2GFU A;  3JCM b;  1MND A;  1RL2 A;  1OKW B;  1NG2 A;  1PHT A;  1H24 B;  2KNB B;  3BDL A;  2CZ6 B;  5HNB B;  4MMK A;  1LOJ A;  4E7J A;  1WXU A;  3NPF A;  2KRN A;  4PJM A;  5FGK B;  1C6V X;  3MP8 A;  2D0N A;  5FU7 B;  3D7S B;  1Q81 C;  5LJ3 e;  1K73 R;  4PJO G;  1M2V A;  3A5Z B;  2WIP B;  5GMK h;  3NDQ A;  2L3P A;  2ZZD B;  1KD1 R;  2RQV A;  4M7D A;  3CCQ Q;  3EG2 A;  3DKM A;  1PSF A;  3REA B;  1QLB A;  2FRW A;  1WLP B;  2DYI A;  4AG2 C;  1Y0M A;  1VQ7 Q;  1M4Z A;  3C95 A;  1QP3 A;  5KYX A;  1VYT A;  4RTV A;  4BCM D;  2L89 A;  1U3O A;  1VIF A;  2ZPB B;  2EYX A;  5A0D A;  1BI3 A;  2HCK A;  4MFE A;  4R56 A;  1B07 A;  1WIE A;  3V8K A;  2UZD B;  2I2L A;  5CAI A;  5KYX B;  4NL2 A;  1CKB A;  2MWP A;  3A8O B;  2RPN A;  4HCZ A;  5GAN 4;  4F16 A;  3G71 T;  3E9G A;  3MP1 A;  2OX7 A;  2LMJ A;  3OYF A;  1WNL A;  3K7A M;  4A4H A;  1K4U S;  2PU9 B;  1BK2 A;  2JOY A;  4PL6 A;  4C8Q E;  4M78 B;  2NYS A;  2WFY B;  2KK4 A;  2RJE A;  4KGV B;  2P0P A;  4BCO B;  5ICP B;  3C4S A;  2D9T A;  2AT1 B;  3CCJ Q;  2LC4 A;  4J83 A;  2XU8 A;  1HYO A;  2OTJ Q;  4ME7 A;  4RG8 A;  2V8J A;  2DIL A;  4BY7 X;  2O4X A;  1QVF A;  4M77 B;  5LQF B;  1K9M C;  1OQK A;  3M58 A;  5L23 A;  1SSH A;  4PFZ A;  4GY5 A;  2QI2 A;  3JCM P;  3KHI A;  3MJX A;  3PVQ A;  1H1P B;  4K11 A;  4BCG B;  5KYY A;  3QZ9 B;  2J05 A;  1RAC B;  2M0Y A;  2BKZ B;  3HRT A;  3JCM h;  1VQN A;  1G2B A;  2HSP A;  2AK5 A;  2QQB A;  3JCM e;  5GJW B;  1FXX A;  2X9H A;  2FYK A;  3LW5 E;  5DM7 R;  1GCQ C;  1S72 T;  4KUI A;  1X6O A;  3CPW S;  1PM3 A;  4BI8 B;  5KYU A;  4RCC A;  2M51 A;  3RIR A;  2DL7 A;  4X1V A;  2EQU A;  4JJC A;  1E6G A;  2G9X B;  3S3N A;  2DMO A;  2XDP A;  3G33 B;  1KJW A;  1M30 A;  4M78 C;  4P5N A;  1UE9 A;  2KRO A;  3TW7 A;  1OYX A;  1H4L D;  1QCN A;  2K79 A;  2LNH B;  4E7S A;  4LN2 A;  1WJQ A;  4O6J A;  2KMG A;  1M3C A;  4EMG A;  3CD6 Q;  3MCA B;  2KE9 A;  1WHJ A;  1VQ6 A;  4HNT A;  1VQ8 Q;  1ZUY A;  1WPY A;  1Q7Y U;  1Z9Q A;  4C8Q G;  3HL8 A;  2R57 A;  3DJB A;  4YOZ A;  3L2Z A;  1Y07 A;  3V8L A;  2E12 A;  3H4C A;  4HL4 A;  1N5Z A;  3JB9 F;  2QQ9 A;  5IXB A;  4M7D C;  3C12 A;  3DB3 A;  3MO8 A;  3OB9 A;  4RTU A;  3TN8 B;  3CBM A;  3QUI A;  1QVF S;  1KQ2 A;  4Z89 A;  3GIB A;  3CCM T;  3QPH A;  1BU1 A;  2YHT A;  1AVZ C;  4IMY B;  4FYW B;  4ZN3 A;  1MMA A;  3MEU A;  1AD6 A;  1OL2 B;  3OBY A;  4BCK B;  3MI9 B;  4EIK A;  4AKI A;  3AHU A;  1XOV A;  1IRX A;  5FU6 C;  4II5 B;  2PHG A;  4J9C A;  3F5X B;  4CFX B;  2LTO A;  1WXT A;  4F70 B;  2CT4 A;  4EOO B;  3X20 B;  3ME9 A;  4ROE A;  3VUB A;  3RUX A;  3EGX B;  1TUC A;  3GNF B;  2DEU A;  1HXD A;  3CCE A;  2OTJ T;  1BB9 A;  2LDM A;  4BCJ B;  1VUB A;  1UJ0 A;  3M57 A;  3A1P A;  1RLQ C;  3OYJ A;  3UAT A;  2XD0 A;  1PCX A;  1JXO A;  2VGM A;  1MHN A;  1UHF A;  2EYQ A;  4Q5W A;  2MAM A;  1PG5 B;  1KQS P;  1XO2 A;  3WVD B;  4KBM B;  2PVG B;  4OMQ A;  3G6E T;  3TNH B;  1G3W A;  3QKJ A;  1Q82 C;  2CRE A;  1KC8 U;  3CC7 Q;  4EOJ B;  2K9G A;  2JTM A;  2DIQ A;  4PFO A;  3MEA A;  4M7A G;  4M7A D;  3BHU B;  2RD1 A;  1UG1 A;  3EOC B;  1I5O B;  4HVW A;  3VV0 A;  1OUL A;  2CS7 A;  2FPD A;  1V1C A;  4A63 B;  1QVG P;  3QJ6 A;  3OYD A;  4M7A C;  2KY9 A;  3G7Z A;  2J6F A;  1JKW A;  2Y4X A;  1YP5 A;  3GTM S;  1KG1 A;  4E7I A;  1ENW A;  3M55 A;  2XHC A;  4ROD A;  2EQI A;  4LE9 A;  4UC4 A;  3RES A;  3RGF B;  2XG8 D;  1XNI A;  3GF5 A;  3CC2 T;  1SF9 A;  2EYZ A;  4CRL B;  1YWO A;  1E7P A;  4M78 F;  1YWP A;  4EMK A;  2AHJ B;  3H0F A;  2Y4Y A;  4M75 A;  2KBT A;  1YNZ A;  3GNG A;  1K9M R;  4OGC A;  1ZSZ A;  2KT8 A;  4FT2 A;  2GQV A;  4IUV A;  1KQS A;  1R0C B;  1N8R C;  2EQM A;  5I5Z B;  4BCH B;  1ZSZ B;  2VWF A;  3SWN C;  1AIS B;  1MGQ A;  1NYF A;  2IVW A;  5LJ3 j;  5ECA A;  4EMK B;  3CC7 T;  4JRP A;  1RAI B;  4M78 G;  2XMF A;  5J26 A;  1YHQ A;  1H64 1;  3CCR T;  2VXF A;  1G3Y A;  1WGS A;  4OMM A;  5GMK e;  4GLM A;  1RUW A;  2PK2 A;  4F7U B;  5GAM f;  2RQU A;  2DXU A;  4EMH A;  1GUX A;  2QEX A;  3I56 T;  4C0G A;  4E7Z A;  1R77 A;  3PMI A;  4A53 A;  2XKO C;  2RN8 A;  4J5Y A;  2G3R A;  2RHI A;  2RNA A;  1GH6 B;  3VS4 A;  1TU0 B;  2QQS A;  2C4G B;  1KHC A;  3HRU A;  5LL6 S;  1K0S A;  1YIT Q;  2EWN A;  3JCM f;  1TFB A;  1WHK A;  4B6M A;  3RBB B;  4X34 A;  1JRI A;  7AT1 B;  2C5V B;  1RLP C;  1ZHI A;  3ASK A;  2W0Z A;  5GAO q;  1ZP2 A;  2IPO B;  1RAF B;  4DBQ A;  4HVV A;  5HCK A;  2JGZ B;  3OS1 A;  4FW2 A;  2E5Q A;  2COW A;  1W98 B;  2DE0 X;  3OYN A;  4RCB A;  2J6K A;  5M9O A;  3G4S A;  3I5R A;  2QTV A;  3LWH A;  2P0Q A;  3JRZ A;  1UDL A;  4JRQ A;  1M1G A;  4CFM B;  1RAH B;  2JTF A;  3S3O A;  3M4Y A;  1W70 A;  2NUZ A;  4E6R A;  1Q7Y R;  3POM A;  4OB0 B;  1H8K A;  1SRM A;  5GAN g;  5KYU B;  4E7K A;  1ACM B;  2FG0 A;  2QGS A;  1UTI A;  3CME Q;  1QKW A;  1QCF A;  1AZE A;  1AD5 A;  1S72 A;  1VQ8 T;  2QDL A;  3M0U A;  4C8Q C;  5CO7 A;  4HKE A;  2QFZ A;  1NZ9 A;  2IW8 B;  1UUE A;  1K1Z A;  4F7L B;  2FZG B;  2DO3 A;  1Q86 U;  2CJM B;  1O9K B;  4FM4 B;  1C1A A;  1J3T A;  2RO0 A;  1PKD B;  1WFW A;  1WQ7 A;  3EG9 A;  5J3B A;  1BI2 A;  1QCO A;  4RTT A;  3TCJ A;  1IGU A;  1KK7 A;  4HCB A;  2BKD N;  1SG5 A;  3EHR A;  1IO6 A;  1Q86 C;  4BBR M;  3BW1 A;  4BCQ D;  3M9Q A;  3PNW C;  5CYI B;  2V8K A;  1I81 A;  3HRS A;  4TTH A;  3CC2 Q;  5FRN A;  4NS5 A;  2F2V A;  1D3B A;  1C0M A;  1NJI R;  4N0A A;  4Z8A A;  3L2R A;  3VUZ A;  1UNL D;  4M75 E;  1ZQ1 A;  2WMA B;  1F1B B;  5L2W B;  4EOK B;  5FLX E;  1VQ6 Q;  1YI2 T;  4BDY A;  4F17 A;  2P4T A;  3J7A F;  4YOS A;  2HAX A;  1D3B B;  4XQ3 A;  2KDS A;  2OTL A;  2QAS A;  2O9S A;  4FSX A;  5DY9 A;  2J7I A;  2DXB B;  3OYI A;  1N4M A;  4ZGE B;  4C92 E;  3M03 A;  1O75 A;  1OI1 A;  3CMA A;  5CKB A;  1OKV B;  1UEB A;  2KYM A;  5KCO A;  3EGU A;  4N4H A;  4HT8 A;  3QHS A;  3I55 A;  3HP9 A;  3CBO A;  2LCC A;  3JCM X;  1H3Z A;  4AKG A;  3FRN A;  3VS0 A;  1GCP A;  3GP8 A;  1MV3 A;  1VQK A;  3CCJ T;  3I55 Q;  4M7A E;  2LT1 A;  3BG9 A;  3BFM A;  2DTO A;  3TNW B;  3G71 A;  2EIF A;  3HO8 A;  5GMK m;  4F7J B;  2DBK A;  3THK A;  4B9W A;  2EGC A;  1D1C A;  3MEV A;  2DX1 A;  2HEQ A;  3VKG A;  1F5Q B;  4YTL A;  2PTK A;  2QQR A;  1VQO A;  2BTT A;  1DJ7 B;  5GAN 3;  5FW9 A;  3CCM A;  2O88 A;  2XID A;  3CQT A;  2IN3 A;  4JZ4 A;  5GAN d;  3M0S A;  2MMP A;  4LDX A;  2L3Q A;  1Q7Y C;  2L2P A;  3VRZ A;  2R5A A;  4JLI A;  1M8V A;  1FMK A;  4LDY A;  3EFO A;  1YCS B;  4BB7 A;  1VOL A;  4DBH A;  2JJ9 A;  3JCM J;  1U8R A;  2GFA A;  1QVP A;  3KXT A;  3PO3 S;  5GAO m;  2DRM A;  4J9D A;  3VKH A;  2C6T B;  2PZ1 A;  4J8O A;  2XK0 A;  1VQM T;  4MIM A;  2E6Z A;  4ELY C;  1FWZ A;  3OW2 A;  4ROC A;  1M27 C;  1XTD A;  2GCX A;  4Y28 E;  3LWI A;  3NTH A;  1OL1 B;  4EOQ B;  1M90 C;  4BUG A;  2DRK A;  4PLI A;  2P84 A;  3QWL A;  2ZGW A;  3CPW P;  2I0N A;  3CC4 A;  4EC8 B;  5EJC A;  2DYB A;  4AFQ C;  1VIE A;  2PMI B;  2KXD A;  4A54 A;  4HT9 A;  5I2S A;  2IVX A;  1YJ9 Q;  4X9D A;  3DLL A;  2BS2 A;  4BCI B;  3FJP A;  2YRV A;  3CCS A;  1CKA A;  3JCM c;  2LJ0 A;  4CI0 C;  2A37 A;  1H92 A;  5FWC A;  4M77 D;  4KUL A;  4C0D B;  1VQ7 T;  3JCM Q;  5LJ5 e;  3CCS Q;  2A3L A;  3DTO A;  2RB6 A;  3INZ A;  4QVZ A;  4CC7 A;  1H26 B;  2KMT A;  2DBM A;  3R6O A;  2F5K A;  4PJO C;  2RMO A;  2O4X B;  1K73 U;  1QMZ B;  5ACB A;  1ZBJ A;  2ABL A;  5HVY B;  1LNX A;  1LJO A;  2QF7 A;  2KEA A;  1OV3 A;  2H3E B;  1PKS A;  1HD3 A;  5CKF A;  1Y96 B;  2K5F A;  3GLX A;  2QA4 Q;  4F04 B;  4ELZ C;  1NLO C;  4XTV A;  2K6D A;  1H1Q B;  2BUD A;  3SFM A;  3I5S A;  5D6W A;  2HL3 A;  1K9M U;  2D0Q B;  3G1J A;  3BE3 A;  4BCQ B;  1RAB B;  5I11 A;  2RJD A;  2KRS A;  3TW6 A;  4C92 B;  2QDY B;  5GAO r;  1SRL A;  5CIU A;  3KFV A;  3MHX A;  3SD4 A;  4HA8 A;  3EGD B;  2XIC A;  1JBM A;  2CCH B;  5CK9 A;  2BS3 A;  4OP0 A;  4BD3 A;  5LJ3 g;  1W2B S;  1WJR A;  2AIR B;  1TG0 A;  2Y90 A;  1I4K 1;  1TOV A;  1ZLM A;  4L5G A;  2J06 A;  1Z9Z A;  3E19 A;  2IG0 A;  1ARK A;  3L1A A;  1TWB A;  1JSU B;  2L3R A;  2BS4 A;  3OBW A;  3FC3 A;  5CEI B;  1RAA B;  5DQW A;  2JVV A;  2RHU A;  2M0O A;  4G6L B;  4KT0 E;  2D1X A;  4DBF A;  2MIO A;  2DTI A;  1G83 A;  3G6E Q;  1FMW A;  1QW1 A;  4EOR B;  1NBE B;  1MMD A;  1M1K U;  1YJ9 T;  3DB4 A;  1C9B A;  2EYY A;  1VYV A;  1VQP Q;  1Y71 A;  3EFR A;  3EFS A;  4C92 C;  4FCY A;  4FIB A;  2SRC A;  3L2Q A;  3L42 A;  1EX4 A;  4X9C A;  4JJN K;  2CP0 A;  4RTW A;  1VQP A;  1RAD B;  4C92 G;  5BNJ B;  4RKU E;  2VGN A;  1QVG S;  1X69 A;  3QYB A;  1WHL A;  3OYE A;  5FRM A;  1E7O A;  1VOM A;  2K7A A;  3RNJ A;  4C5I A;  4OMO A;  5KE2 A;  2C06 A;  5GAN 8;  4WCI A;  4QT7 A;  3UA6 A;  1JJ2 A;  3RMS A;  3S6W A;  1URC B;  2BE7 D;  6AT1 B;  5AYF A;  5DLQ E;  5J39 A;  2CUB A;  4E47 A;  5LJ5 j;  4TVR A;  1UNH D;  2CZ7 B;  3LQ5 B;  4VUB A;  3ZFJ A;  4CFN B;  2XDB A;  3IQL A;  1OPL A;  3CME A;  1GXI E;  2LCL A;  4BCN D;  4C5G A;  3BLR B;  2NUT B;  4RMO A;  2CT3 A;  4JX5 A;  4PJL A;  4J6W A;  4IUT A;  3QII A;  2VXE A;  1UNG D;  2ZAE A;  4OMF B;  5IF1 B;  2DJQ A;  3UT1 A;  2E4H A;  3HTR A;  1VYW B;  2JS0 A;  3I56 A;  2G77 A;  3PGG A;  1Q81 R;  3EID B;  1K8A R;  4BDZ A;  2L0A A;  2WEV B;  3H9N A;  4BCP B;  5HY6 A;  1K76 A;  1OX9 A;  2K57 A;  4XU2 A;  5I2M A;  1YIT A;  2Z0W A;  2QK0 A;  5KH6 A;  3EG3 A;  2EUF A;  4LD9 K;  2FZK B;  3UA7 A;  1BIB A;  2MOX A;  3CXC S;  4ELJ A;  5CKE A;  1O9S A;  4C5H A;  2EVR A;  2CKK A;  5FU6 B;  3L2U A;  4RTY A;  1KFZ A;  3TEE A;  4C92 A;  1D1B A;  4F7N B;  3A8G B;  1GRI A;  5GAO n;  2X35 A;  1YFN A;  1IXD A;  3A8M B;  2HQE A;  3FB9 A;  1VQ5 Q;  2FVU A;  4QQD A;  2ZPE B;  4MZP A;  3BY7 A;  2CZ1 B;  3I35 A;  5IN1 A;  1BI1 A;  1VQ5 A;  5IHK A;  2DER A;  4DA4 A;  3DL1 A;  2W99 A;  2DVJ A;  4ANJ A;  4QQG A;  4KGZ B;  4PNO A;  1X43 A;  1Q81 U;  4A4E A;  4C8Q F;  2O2O A;  5IHY A;  1XQH A;  2JN0 A;  3V8J A;  2QA4 T;  3PFS A;  4C8Q A;  2WHB B;  1B3Q A;  8AT1 B;  1K8A C;  1OX8 A;  2EJG A;  4NOY A;  5FRO A;  3JB9 G;  4PJO B;  4A4G A;  2E65 A;  5A0G A;  2PUO B;  2RA2 A;  2JW4 A;  2RI3 A;  1X01 A;  3VS6 A;  3JB9 D;  2M1H A;  2E5K A;  3M53 A;  3SB2 A; 
#chains in the Genus database with same CATH homology
 5L8R E;  3CCL T;  3G4S T;  1S72 A;  1VQ8 T;  1B34 B;  3OYY A;  4ATO A;  4C8Q C;  5CO7 A;  3OYG A;  4HKE A;  2QFZ A;  3X25 B;  1NZ9 A;  3LYI A;  2WSE E;  4BAC A;  1Y7X A;  3JCM g;  3GOX A;  1NJI C;  2DO3 A;  3CPF A;  1Q86 U;  3CCE T;  2LVM A;  3MP6 A;  2QEX T;  1UGQ B;  4FM4 B;  2DAQ A;  2DKG A;  5LJ5 h;  1YJW A;  1NPR A;  2RO0 A;  4M7D E;  1WQ7 A;  5J3B A;  1BI2 A;  1OZ3 A;  3TCJ A;  2YLB A;  3FIF A;  4F7U F;  3ER0 A;  3JB9 I;  1Y96 A;  4GLK A;  4HCB A;  5LJ3 h;  2BKD N;  4Z02 A;  2A7Y A;  5FU7 C;  4F7U E;  3NTI A;  3CEY A;  5A2Q E;  1JJ2 S;  1K8A U;  1Q86 C;  3HHT B;  2L5Q A;  4BBR M;  3BW1 A;  2RHX A;  3F70 A;  2XDD A;  1QVG A;  3LGL A;  1VQ4 A;  1N9S A;  3M9Q A;  5DLO A;  3PNW C;  1WQW A;  4LDV A;  2V8K A;  4HCC A;  5GAN f;  2DXC B;  1I81 A;  3HRS A;  5CKD A;  5FRN A;  4MFD A;  4NS5 A;  5GAM j;  2DJZ A;  4V2S A;  1D3B A;  2QA4 A;  3OYB A;  3M54 A;  3LX7 A;  5A0L A;  4N0A A;  3L2R A;  3JCM W;  2E6N A;  5CQX A;  5CVI A;  3VUZ A;  3RER A;  2GFU A;  3JCM b;  2HBP A;  4M75 E;  3V7R A;  1ZQ1 A;  4JX4 A;  2DD5 A;  1RL2 A;  4MDX A;  3BDL A;  2CZ6 B;  4IUR A;  4L59 A;  2V8I A;  5FLX E;  4MMK A;  4BDY A;  1LOJ A;  1YI2 T;  1M9S A;  4E7J A;  4ZTF A;  2P4T A;  3J7A F;  2HAX A;  2LT4 A;  2DVE A;  1D3B B;  3QYE A;  2KDS A;  4XQ3 A;  1N6A A;  2WSC E;  3QXE B;  4OB1 B;  3MP8 A;  2OTL A;  5FU7 B;  1Q81 C;  4FSX A;  3V7S A;  5DY9 A;  5LJ3 e;  3BDU A;  4PJO G;  4M6V A;  4JLG A;  4M78 D;  2DXB B;  4PJO D;  1P92 A;  3OYI A;  1SSF A;  3A5Z B;  5GMK h;  1X75 C;  3C94 A;  2ZZD B;  4M7D A;  4ZGE B;  3J81 E;  1UGS B;  3DKM A;  1PSF A;  4C92 E;  5HK3 A;  1QLB A;  4OB3 B;  1O75 A;  1OI1 A;  3CD6 A;  3CMA A;  5CKB A;  1UEB A;  2PVO B;  5KCO A;  4M7D F;  1FX7 A;  4N4H A;  4HT8 A;  1M4Z A;  1QVF A;  3M5A A;  3QHS A;  4FT4 A;  3C95 A;  5IT9 E;  3I55 A;  1QP3 A;  3HP9 A;  3N5B B;  4IUU A;  3CBO A;  2LCC A;  4PJO E;  3JCM X;  2L89 A;  1VIF A;  1H3Z A;  4M77 C;  2ZPB B;  4AKG A;  3FRN A;  5A0D A;  3J80 E;  1YI2 A;  1BI3 A;  3GP8 A;  1M1K C;  1VQK A;  3CCJ T;  3P8B B;  4MFE A;  3VKI A;  2LT1 A;  4R56 A;  4M7A E;  2K5L A;  3V8K A;  2CGH A;  5GAM e;  5CR2 A;  2E1H A;  3BG9 A;  2I2L A;  3BFM A;  5CAI A;  2DTO A;  3QSU A;  3G71 A;  4EPC A;  5GMK j;  2EIF A;  2D6F A;  4NL2 A;  3HO8 A;  5GMK m;  3VJP A;  4QQ6 A;  4QVC A;  2MWP A;  4Y91 A;  4B9W A;  4BY6 C;  3CCQ A;  3MEV A;  2PUK B;  3A8O B;  3VKG A;  2DD4 A;  2WSF E;  3MEW A;  4XAX B;  4QVD A;  4HCZ A;  4YTL A;  2VUB A;  5GAN 4;  2QQR A;  3G71 T;  3I55 T;  1VQO A;  1VQ7 A;  3E9G A;  1M90 U;  1VQK T;  3MP1 A;  3OYF A;  1DJ7 B;  4FL6 A;  5GAN 3;  5GAO l;  2E70 A;  1WNL A;  3CCM A;  2OAU A;  2XID A;  4OGE A;  2RM4 A;  4A4H A;  2QXF A;  3OMC A;  4JDS A;  5GAN d;  1VQL T;  4F7U G;  2ZPI B;  2MMP A;  4LDX A;  2PU9 B;  4II1 A;  4AI6 A;  1Q7Y C;  2CZ0 B;  2JOY A;  4PL6 A;  4C8Q E;  2F5T X;  3Q1J A;  4M78 B;  1NE8 A;  2R5A A;  3ZEH A;  2O01 E;  4JLI A;  1M5Q 1;  1M8V A;  2MWO A;  3V7C A;  1G3T A;  2KK4 A;  4LDY A;  2RJE A;  3MET A;  4N4I A;  4NL3 A;  1YJW T;  4BB7 A;  2KSS A;  2P0P A;  5GAM g;  3KUF A;  5GAN 7;  3JCM J;  1U8R A;  3C4S A;  2D9T A;  5GMK i;  2GFA A;  2LC4 A;  4ZGJ B;  1QVP A;  4J83 A;  2F69 A;  2XU8 A;  5GAO m;  3KXT A;  4L6V 5;  4LD6 A;  3FLG A;  4NC6 A;  4C92 D;  4ME7 A;  3VKH A;  4RG8 A;  1KD1 U;  2V8J A;  1VQN T;  4J8O A;  2XK0 A;  4C0F A;  2O4X A;  1VQM T;  4MIM A;  2E6Z A;  4M77 B;  1FWZ A;  2EJ9 A;  4ELY C;  3OW2 A;  2ZPF B;  1VQ4 T;  4LDU A;  1K9M C;  2RJC A;  1XTD A;  2GCX A;  3M58 A;  2BIV A;  2RK2 A;  3E1S A;  3NFC A;  4GY5 A;  4Y28 E;  3NTH A;  3LWI A;  4J7I A;  2QI2 A;  4XTW A;  4B9X A;  5GAN e;  3JCM P;  3KHI A;  4BUG A;  1M90 C;  2K3X A;  3FDR A;  4PLI A;  4EDU A;  4BE0 A;  3QZ9 B;  3VU3 C;  3QWL A;  2ZGW A;  2RJF A;  1NPP A;  1R8O B;  5LJ3 d;  1ZBX A;  4ZTJ A;  3CC4 A;  2FL7 A;  3HRT A;  3JCM h;  5EJC A;  3CCR A;  1Q82 U;  1VQN A;  1KHI A;  1VIE A;  4BI3 A;  2LNV A;  4Z6Y A;  4A54 A;  3CD6 T;  4HT9 A;  5I2S A;  2K4Y A;  3OQ5 A;  2QQB A;  3JCM e;  4X9D A;  3RMQ A;  3DLL A;  1V29 B;  4RG2 A;  2BS2 A;  1FXX A;  2ZPG B;  2FYK A;  2YRV A;  3FJP A;  3LW5 E;  5DM7 R;  3CCS A;  1VQM A;  1I5L A;  1S72 T;  3CC7 A;  3CCL A;  3JCM c;  4DOW A;  4CI0 C;  4KUI A;  3M59 A;  1X6O A;  4FU6 A;  2EFI A;  4M77 D;  3CPW S;  3CCU A;  4KUL A;  4C0D B;  2X4W A;  2EJF A;  2HNI A;  4J6X A;  4BI8 B;  5LJ5 e;  3JCM Q;  2DD5 B;  2A3L A;  4QSH A;  3CXC A;  4RCC A;  2RB6 A;  3INZ A;  4HNU A;  5GAN 2;  4QVZ A;  3RIR A;  4M75 F;  2EQU A;  2LX9 A;  4C5E A;  2KMT A;  3CME T;  3S3N A;  2XDP A;  4N0A C;  3R6O A;  2K3Y A;  2F5K A;  2PQW A;  2RHZ A;  1YIJ A;  4M7D D;  2DXC A;  4M77 F;  3OSS C;  2VV5 A;  2OTL T;  4ZGD B;  3O8V A;  4M78 C;  2O4X B;  1YJN T;  1UB4 A;  1M1F A;  2DZC A;  2KQW A;  2LRQ A;  1K73 U;  4M77 E;  4P5N A;  1LNX A;  2KAF A;  1LJO A;  2QF7 A;  2QTX A;  4A4F A;  3TW7 A;  4QW2 A;  1OYX A;  2DEQ A;  3HBL A;  3OYL A;  5CKF A;  3ZBD A;  4IUQ A;  1Y96 B;  2K5F A;  1TH7 A;  3GLX A;  4XK8 E;  3OA6 A;  4ELZ C;  4XTV A;  1U1T A;  1WJQ A;  2BUD A;  2QQA A;  4M75 G;  2KMG A;  4O6J A;  3SFM A;  4EMG A;  5GAM d;  1VQ7 T;  5C0M A;  5D6W A;  3MCA B;  3JAM E;  3OY9 A;  3TRE A;  2D0Q B;  3A8L B;  4HNT A;  2P0K A;  1K9M U;  1VQ6 A;  4ZN1 A;  2K2V A;  1YJN A;  4HNV A;  1WPY A;  1Q7Y U;  4C8Q G;  2RJD A;  3CCV A;  3HL8 A;  1YIJ T;  4JX6 A;  2R57 A;  3TW6 A;  3JSC A;  3QBY A;  4C92 B;  5HK0 A;  2QDY B;  3L2Z A;  1Y07 A;  3V8L A;  3OYA A;  3HB9 A;  2E12 A;  3H4C A;  4HL4 A;  5CIU A;  5GAO r;  2X4J A;  3HFN A;  1N8R U;  3MHX A;  3SD4 A;  1G5V A;  4HA8 A;  4MZT A;  3JB9 F;  4KUD K;  3OYH A;  2QQ9 A;  4M7D C;  5GAN 5;  2XIC A;  3C12 A;  3DB3 A;  5GAN h;  3MO8 A;  4O5V A;  1JBM A;  3T9N A;  5CK9 A;  5LJ5 d;  3CCS T;  3OB9 A;  2BS3 A;  4A4K A;  2MI6 A;  2E64 A;  3CBM A;  3QUI A;  1QVF S;  1KQ2 A;  3GIB A;  1IRE B;  4JS4 A;  1VQO T;  3CCM T;  2DZ9 A;  2DXT A;  3QPH A;  4IUP A;  4OP0 A;  4BD3 A;  5LJ3 g;  3NTK A;  2HQX A;  1WJR A;  2YHT A;  1W2B S;  5IAY A;  3QYG B;  5GAN j;  2FB7 A;  2RH2 A;  4JS5 A;  4CRI A;  2Y90 A;  2ZPH B;  2QDJ A;  5D6Y A;  1KQS S;  2EAY A;  1I4K 1;  4L5G A;  4ZN3 A;  2FHD A;  3MEU A;  4C8Q D;  2DK3 A;  1EIF A;  3OBY A;  3E19 A;  2IG0 A;  4AKI A;  3AHU A;  3L1A A;  1XOV A;  2E10 A;  1BKB A;  1FKM A;  3QYH B;  1BIA A;  5FU6 C;  2L3R A;  4OB2 B;  2BS4 A;  3OBW A;  3FC3 A;  3VYG B;  4J6Y A;  4C92 F;  1KQ1 A;  2LTO A;  4M75 C;  2JVV A;  2ZCF B;  2RHU A;  3X20 B;  2M0O A;  3RKW A;  5C6S A;  3ME9 A;  3CC4 T;  1YIT T;  1K73 C;  3VUB A;  5CQY A;  4KT0 E;  2DD4 B;  1VQ9 T;  3RUX A;  3JCM V;  2HD0 A;  3QJY A;  2DTI A;  3GNF B;  3JB9 H;  2E41 A;  3RKX A;  4LDW A;  1QW1 A;  1HXD A;  3SDZ A;  4JRI A;  1YBY A;  3OSV A;  3P8D A;  3CCE A;  1YJ9 T;  1M1K U;  2OTJ T;  3DB4 A;  2LDM A;  2VYT A;  4XTX A;  3QDR B;  1VUB A;  3M57 A;  5I21 A;  3SWN B;  3OYJ A;  2XD0 A;  3DLM A;  2DIG A;  1Y71 A;  3EFR A;  2VGM A;  1MHN A;  3EFS A;  4M77 A;  4C92 C;  2EYQ A;  3CCV T;  4FIB A;  4Q5W A;  3L2Q A;  4D6W A;  3L42 A;  2CYZ B;  2MAM A;  4X9C A;  4JJN K;  3P8H A;  4F7U A;  2L8D A;  1VQP A;  3URG A;  2RHY A;  2B8A A;  4C92 G;  2DPP B;  3WVD B;  4KBM B;  5GMK l;  2PVG B;  3HKS A;  3PMT A;  3G6E T;  2VC8 A;  1G3W A;  1OZ2 A;  4BBS M;  4RKU E;  2VGN A;  3OYM A;  1QVG S;  3QYB A;  3QKJ A;  3JCM d;  1Q82 C;  1KC8 U;  2JZ2 A;  3OYE A;  5FRM A;  2JTM A;  2DIQ A;  2X4Y A;  4OF1 A;  4BY6 B;  4C5I A;  5KE2 A;  3MEA A;  2WJ9 A;  4MML A;  3OS2 A;  3L2W A;  2C06 A;  5CCA A;  1G3S A;  4M7A G;  2RD1 A;  5GAN 8;  4M78 A;  4M7A D;  4M7D B;  3LLR A;  2K5I A;  3VV0 A;  2CS7 A;  2RI2 A;  1W4S A;  2GF7 A;  3HZJ A;  4M78 E;  2R58 A;  3M4G A;  3OMG A;  2X4X A;  3QJ6 A;  3OYD A;  3RMS A;  3S6W A;  3FEO A;  1JJ2 A;  5GAO p;  4M7A C;  3X28 B;  2KR6 A;  2EQK A;  2KY9 A;  3G7Z A;  3LGF A;  3CPW A;  4IKF A;  1YHQ T;  1W2B A;  4XU0 A;  4OVA A;  1AHJ B;  1JB0 E;  2LQK A;  5AYF A;  1BI0 A;  2Y4X A;  5DLQ E;  4WF2 A;  2R5M A;  5J39 A;  1KG1 A;  4E47 A;  5LJ5 j;  4E7I A;  4TVR A;  3M55 A;  3WXM B;  2CZ7 B;  2RK1 A;  1RI0 A;  2XHC A;  3RKY A;  3QG1 A;  4VUB A;  1WJS A;  2PVD B;  3ZFJ A;  4UC4 A;  3RES A;  2XG8 D;  3QO3 A;  1XNI A;  2XDB A;  2M9U A;  3CME A;  3CMA T;  1GXI E;  1UGR B;  2LCL A;  1QP2 A;  4M7A F;  3GF5 A;  3S3M A;  4PLL A;  4C5G A;  3CC2 T;  3CCJ A;  4BE2 A;  1N27 A;  4RMO A;  3BG3 A;  4JRK A;  4JX5 A;  3HSB A;  1E7P A;  4MDW A;  4J6W A;  2NLU A;  4M78 F;  4IUT A;  4XTU A;  5CKH A;  3QII A;  4EMK A;  2AHJ B;  3TU4 K;  1VQP T;  2VXE A;  4PJO A;  4AKH A;  2Y4Y A;  4M75 A;  1VQ5 T;  4OMF B;  1VQL A;  3GNG A;  4OGC A;  1IZ6 A;  3CC2 A;  4XU1 A;  4FT2 A;  4HLQ A;  2GQV A;  1NJI U;  3PIP A;  4IUV A;  1KQS A;  1PSE A;  1N8R C;  3UT1 A;  2EQM A;  4M75 D;  3SWN C;  3H6Z A;  4R55 A;  2JUF A;  2QQ8 A;  3HFO A;  1MGQ A;  2IVW A;  4LOC A;  5HKC A;  5LJ3 j;  5LJ5 g;  4EMK B;  2ZZD A;  3I56 A;  3CC7 T;  3M56 A;  4C0Z A;  2G77 A;  1VQ6 T;  3PGG A;  2DXB A;  4JRP A;  3OS5 A;  4BDZ A;  2RI5 A;  3OYC A;  4XTY A;  2XI9 A;  4M78 G;  4XTZ A;  5HY6 A;  1YJ9 A;  2K57 A;  4XU2 A;  5J26 A;  5I2M A;  5KE3 A;  1YIT A;  1YHQ A;  3KBG A;  1HK9 A;  4E7L A;  1H64 1;  3CCQ T;  3CCR T;  5KH6 A;  3OYK A;  2VXF A;  3WVE B;  1G3Y A;  1WGS A;  2YLC A;  5GMK e;  3PIO A;  4M7D G;  2DTH A;  4LD9 K;  4XU3 A;  5GAM f;  4F7U B;  1I8F A;  5EG2 A;  2DXU A;  1BIB A;  1KC8 C;  3CXC S;  5KCH A;  3OS0 A;  4EMH A;  3L2V A;  3PT9 A;  3GPL A;  4ELJ A;  5CKE A;  2QEX A;  3I56 T;  4C0G A;  1O9S A;  3QZ5 B;  3LH0 A;  3PMI A;  4C5H A;  3BG5 A;  2CKK A;  2M16 A;  4A53 A;  5FU6 B;  3SWN A;  2XKO C;  3EAE A;  3L2U A;  4J5Y A;  4BE1 A;  3TEE A;  4C92 A;  2G3R A;  2LQ8 A;  2RHI A;  3A8G B;  5GAO n;  3UDC A;  2X35 A;  4EMK C;  2QQS A;  4DQ2 A;  1KHC A;  3A8M B;  2HQE A;  3HRU A;  4JUV A;  3FB9 A;  5LJ3 f;  5LL6 S;  5GAM h;  3G6E A;  2FVU A;  1BYM A;  3E9F A;  4QQD A;  4PJO C;  2ZPE B;  2EWN A;  3BY7 A;  4MZP A;  3JCM f;  1U1S A;  5D6X A;  2CZ1 B;  2MF2 A;  4PJO F;  4DOV A;  3CCU T;  4X34 A;  3VYG A;  1JRI A;  1ZHI A;  1BI1 A;  3ASK A;  5IN1 A;  5GAO q;  1VQ5 A;  3HPW A;  3X26 B;  4BI4 A;  2OTJ A;  4DA4 A;  3X24 B;  2H3J A;  1YCY A;  4MZM A;  3JB9 J;  3DL1 A;  3OS1 A;  3VYH B;  1VQ9 A;  2E5Q A;  4QQG A;  4C0D C;  3OW2 S;  3OYN A;  4PNO A;  4RCB A;  5M9O A;  1Q81 U;  3G4S A;  4A4E A;  1VQ8 A;  3LWH A;  4C8Q F;  2P0Q A;  3H8Z A;  3JRZ A;  4JRQ A;  2JNG A;  1B34 A;  1N9R A;  1M1G A;  2EQJ A;  2WAC A;  1XQH A;  2JN0 A;  2JTF A;  4PKC C;  4E7H A;  3S3O A;  3M4Y A;  3V8J A;  4M7A A;  4N4G A;  2QA4 T;  3PFS A;  4C8Q A;  4OB0 B;  4J7F A;  1K8A C;  4M77 G;  2KVQ G;  2EJG A;  4NOY A;  5FRO A;  5GAN g;  4M75 B;  5GAN 6;  3UPU A;  4E7K A;  3JB9 G;  5LJ5 f;  4A4G A;  2E65 A;  5A0G A;  4PJO B;  2PUO B;  3PTA A;  3A8H B;  2RA2 A;  3UWN A;  2RI3 A;  1X01 A;  3CBP A;  4C8Q B;  3JB9 D;  1KD1 C;  2M1H A;  3M53 A;  4M7A B;  1UGP B;  2EKO A;  3SB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...