2ZPGB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpgB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpgB02
3VYHB 3A8GB 1IREB 2ZZDA 3WVEB 3A8HB 1PSFA 3X28B 2WSFE 2WSEE 2DD4B 2CYZB 2DD5B 4OB0B 4L6V5 1UGQB 3A8LB 4ZGEB 2DD5A 4OB3B 2PVGB 3X26B 4XK8E 4RKUE 1GXIE 2PU9B 2PUOB 2CZ0B 2ZCFB 2DXBA 2QDYB 3WVDB 4FM4B 1AHJB 3QYGB 2PUKB 3QXEB 3A8OB 1PSEA 2ZPBB 5L8RE 4OB2B 3X20B 1JB0E 2DXBB 1V29B 3QYHB 2DXCB 1QP3A 2ZZDB 1UGPB 3QZ5B 2PVDB 2ZPHB 3VYGB 4ZGDB 2DD4A 1DJ7B 2ZPFB 2CZ1B 4Y28E 3A8MB 2DPPB 2CZ7B 2AHJB 2O01E 4OB1B 2ZPEB 3X25B 3QZ9B 2ZPGB 2WSCE 3LW5E 3VYGA 2DXCA 2ZPIB 3X24B 4ZGJB 2D0QB 2PVOB 4KT0E 1UGSB 1UGRB 2CZ6B 1QP2A 3HHTB
chains in the Genus database with same CATH superfamily
3VYHB 1VYUA 4NOYA 2HSEB 1Q82U 2OTLT 2OI3A 4PJOG 1URCB 4C0DC 5ACBA 1H26B 3OSVA 3CMEA 2VGMA 2CCIB 2DE0X 1VQMA 1X2QA 4LDXA 4HVWA 4IUTA 4YOZA 2FHDA 1Z9QA 2FRWA 2QAZA 4ELYC 4YOOA 1Q86R 3JCMJ 3UATA 1X69A 4Y92A 4CC2A 2RHZA 3POMA 2DTOA 5CO7A 2CCHB 5J39A 1I8FA 5A2QE 2EYZA 3FEOA 1OPLA 3R6NA 3DTOA 2K6DA 5D6WA 1VQNT 3HKSA 1VQ4A 2H8HA 1IXDA 4IIOA 3UPUA 2K3BA 4N0AC 3G6EA 4CC7A 5L2WB 1I5OB 1NYGA 4QQDA 4AG2C 3BG9A 2XIDA 3GPLA 3QYEA 2J6OA 4EMKA 2XK0A 1JQQA 2W10A 1VQ9Q 4CFVB 4M77G 2IVXA 4A53A 2GGRA 1QW1A 5IHYA 1OULA 1AZEA 1ZUUA 3CPWP 1QCOA 4LNPA 1M8MA 4Q5WA 3CD6A 1JU5C 3CC4A 2A0FB 2CSQA 1KSWA 1DJ7B 2EQJA 1ZSZA 2NWMA 1YHQQ 5GAN6 2RQWA 2LQKA 1H1PB 1N9SA 5A0DA 3JRZA 2MAMA 4M7DB 1TS9A 4F7UE 3BY7A 1KC8R 4CFXB 3EGDA 1SEMA 5I5ZB 4PNOA 3EH2A 3UA7A 3MEUA 4CFNB 2FG0A 2FZKB 5GJVB 4YTLA 3MO8A 3TREA 4J9BA 1AVZC 3HHTB 5CQXA 2QGGA 3LX7A 3JB9D 4FT2A 3CXCP 4DA4A 1W70A 4O5VA 2DD4B 2DD5B 1EZZB 2GCXA 1UG1A 3CCMQ 3OW2P 1I5LA 1E7OA 3OB9A 1LOJA 4RTTA 1K9MC 1OYXA 2J7IA 2DM1A 2HKQB 1K8AC 3CCQQ 2HZYA 2DO3A 2CKKA 2LJ1A 1EX4A 2ABLA 2KBTA 4HLQA 1TUDA 5GJWB 1ZSZC 1M8VA 1PRMC 2JTFA 3UA6A 1OU9A 4IUQA 3PVQA 2PUKB 3EGXA 5KYWA 2ED1A 3CD6Q 1HJDA 2ZPBB 1WJRA 2DK3A 2RMOA 3VS1A 4QQ6A 4MFEA 3MP6A 2YRDA 1YJWQ 1WI7A 2DXCB 1TSFA 3QJYA 5FU6C 5I21A 2KQWA 3A98A 2PVDB 4OGEA 4L59A 2QQ9A 1KQ1A 2JUFA 3E9GA 1JRIA 1WHHA 3CMAQ 2FL7A 2D8HA 4P5NA 4KGXB 2EGCA 3JCMX 3SEMA 3M0RA 1VQMT 2YSQA 1C6VX 2RJFA 4GY5A 1KC8C 1Q86C 1IB8A 1NEBA 3OBYA 5LJ3j 1FXXA 4R56A 2DVEA 3V8JA 1K73U 3I5SA 1TU0B 1M2VA 3QBYA 3LYIA 3M54A 3PMTA 4C8QA 3QZ9B 1PKDB 1ACMB 1I81A 4LUEA 3RKYA 3VYGA 1TUGB 2D0NA 3CCUQ 5ICPB 4FYWB 3L2RA 4LOCA 1TTHB 3QDFA 2RHXA 4RCCA 1MV3A 4G6LB 2QA4Q 2E5KA 4X9CA 2FZCB 2K4YA 5IF1B 3CPWS 3K7AM 3TVTA 4J9GA 2FVUA 2ZZDA 4KUIA 1M1KU 1G3WA 4OMPA 1Q7YR 3RR6A 3FC3A 1TUCA 3QYBA 2L5QA 2SEMA 4PJOE 2KNBB 2VUBA 3H8ZA 1K0XA 2IVWA 4M78F 2DXTA 4BCMD 4L6V5 3MKDA 5L23A 2MPXC 3AT1B 2E64A 4HNVA 3BE3A 1K76A 4D8DA 1S1NA 1NJIU 2GQIA 2MK5A 4Y72B 5GAOm 1MMAA 2ZAEA 4X9DA 2DZCA 1OGUB 2P4RA 2ZCFB 3WVDB 3QG1A 4JRIA 4JJBA 1H27B 4TVRA 5AT1B 1KD1U 3BLQB 2UZEB 3BHUB 2EQKA 2DFUA 4JUVA 2RI3A 1JB0E 4HCKA 2LNHB 3OYAA 4C8QC 2EQMA 4PKCC 1H1SB 2AKLA 2FPDA 1PC0A 2AZVA 2F2WA 1SHGA 4I3ZB 3QKJA 4BE2A 2EYQA 1AISB 1VQLA 1VQ6T 4E7KA 2LQ8A 4ZGDB 5GAOq 1H1RB 2XKOC 2D1XA 4C5GA 5I2SA 4RTZA 1BKBA 1Q81U 4EOOB 4M7AD 3FDRA 1QVGA 1WPYA 2QQ8A 1VA7A 1WXUA 2NUTA 2XI9A 2RI5A 1YFNA 4ANJA 3B57A 1NM7A 1X6BA 3FIFA 4PJNA 5IH2A 4DEXA 2IIMA 2GTJA 2DXCA 5EC7A 4CFUB 1ZSZB 2KK4A 1C9BA 5LJ5d 3TU4K 4XTXA 2BE7D 5HCKA 3L2QA 4M7AG 4XTZA 4M78E 5CR2A 3MIAB 4FYXB 1U8RA 1B34B 1WXBA 3NTKA 2V8KA 1LNXA 2CREA 2GNCA 4BCIB 4E7IA 1Y96B 1BU2A 2DTHA 1KD1R 4C92A 3A8HB 1PSFA 1UDLA 4JZ4A 2R5AA 3QHWB 4C92F 5CAIA 2LMJA 1D3BB 4XTWA 2QXFA 3BHVB 1UE9A 4X34A 1UGQB 3MEVA 1K73R 2J6FA 2DD5A 2IW9B 3JCMV 2QQBA 2E6ZA 2K5LA 5KYUB 3CBMA 3IQLA 1B07A 3X26B 2MYSA 2RJDA 4KRTA 3BHTB 5HNBB 5IHKA 7AT1B 2W96A 4B9WA 3KUFA 2PK9B 1M4ZA 4TTHA 3MP1A 5D6YA 4EOSB 1YN8A 2E10A 4PJJA 3MI9B 1GBRA 5GANd 1K4US 2O9VA 4QSHA 3NPFA 4F7JB 1QP3A 1Y7XA 3NGPA 3LH5A 3OS5A 1G5VA 4JRKA 2DJQA 2ED0A 4C5IA 2XDDA 1IHWA 3EGXB 4RTXA 5KYWB 4BDYA 4MDXA 2DD4A 1XTDA 3CXCA 3H9NA 1K9MU 2VXFA 1SSHA 1WNLA 4BCFB 2M02A 1FWZA 4OMNA 4M77E 1K8AU 2A7YA 3RERA 1JO8A 1K8AR 4A4FA 4OB1B 2JMAA 2LZ6B 3EG9B 4C92B 2BS3A 4YC3B 1GCQC 2YWWA 2QQAA 1WHGA 2CH4A 3TW6A 5FGKB 1RAIB 4BY6B 1M3BA 1YCYA 2B86A 3I9QA 1RACB 3DB4A 4F7NB 4RODA 3OYYA 4EMHA 2ROTA 4ZGJB 2GTOA 2AZSA 1TOVA 2CS7A 1VQOQ 4BCKB 3O0GD 2QI2A 4IURA 1N4MA 2XG8D 2LCSA 3H41A 2CZ6B 3GNFB 3S3MA 2SRCA 1Q95G 2I53A 4A4GA 2F69A 2RNAA 3CC7A 2BZ8A 2MWPA 2X3XD 4CRLB 3RNJA 4EOKB 2CSIA 3VS2A 3JCMQ 4DEYA 2FB7A 2UUEB 3H0FA 4FSSA 4ZTJA 1KC8U 2RO0A 3OYLA 2CH4W 1RI0A 1RAEB 2DYIA 3SHWA 4YOSA 2BTTA 1W2BA 5FU6B 4NL3A 1OOTA 2DBMA 4FX3B 4X1VA 3C4SA 3MEAA 1VQ7T 2H3JA 5GAMj 8AT1B 5LQFB 1RAHB 2V1QA 1GH6B 2DX1A 5KYXB 1BK2A 4F7UB 4M78C 3PVLA 1PSEA 3ZL7C 4PJOF 1JSUB 2L2PA 4OB2B 5M9OA 2EKHA 4C92C 1RAAB 2ZGWA 4C0ZA 5DLOA 5C0MA 3OYJA 4FYYB 1M1KC 4NL2A 2C06A 1QKXA 5FRMA 1UGPB 2W99A 3OMGA 1SG5A 2JXBA 1YITT 3HO8A 1GRIA 4KRDB 1QVPA 2G9XB 2VYTA 5LJ3g 1YWPA 1AT1B 2EJFA 2YXYA 2YLBA 1H3ZA 3V7CA 2OTLA 1W2BS 3VU3C 4LDWA 5KCHA 3CMET 3WXMB 2YUQA 3I56A 1H8KA 3JAME 3A5ZB 2E41A 2HQHA 2DRKA 4J6XA 1PD0A 5IDPB 1Y57A 2CJMB 4JLGA 4OMQA 4F7SB 3OBWA 5FWCA 5IAYA 3VUBA 3S6WA 4KH0B 2VC8A 2X9HA 4HA8A 4KH1B 3MJXA 3RIRA 3OYEA 3JCMP 4ZN1A 4A4HA 3RESA 3VS4A 5IT9E 1X2KA 4J9EA 2PNIA 4JLIA 2CT4A 2BZYA 3A8GB 1H28B 5CKBA 4NC6A 3M55A 4ROEA 1YBYA 1QVGS 4PFZA 3OYKA 4EONB 1P92A 4FT4A 5KCOA 1Q81C 4RTUA 4E7LA 2HSPA 1UNLD 1N6AA 3JCMc 1GFDA 1M1GA 1LPLA 2KR3A 1NZ9A 4RUGA 2PJQA 1PG5B 2H3EB 1SRMA 2JTEA 2XDPA 2MOXA 2JNGA 1KQSS 4BCPB 3GBQA 1YJWA 3F5XB 3HBLA 5J3BA 3CCVA 4ELLA 2KEAA 2XU8A 2JN0A 4OGCA 4F14A 4RKUE 1M30A 2PTKA 5KYYA 1GUXB 2G77A 1Y07A 4BBRM 4UN0A 1GBQA 1H641 3FJ5A 1I07A 3CCST 2HL5C 4UC4A 1UFFA 3CCJA 2GFAA 2DXBB 1JXOA 2KGTA 1YITA 1GFCA 4C0GA 1C0MA 1AD5A 2YRCA 5EJCA 2R57A 2E4HA 1N9RA 3EJ1B 4E7JA 1YHQT 1ZBJA 2HBWA 3JV3A 4FU6A 5GAMd 1I0CA 1WJSA 1ZP2A 3G4ST 4BE1A 2DXUA 2X51A 2DAQA 3OYMA 4QQGA 1JJ2S 1VQNA 1ABQA 2B9RA 2QGSA 3P8BB 1VQLT 3NTIA 4PL6A 3CCQA 4Z6YA 2DLPA 4FIBA 4EOPB 1SPKA 4RTYA 3VS5A 3QDRB 2LW4A 4MZTA 4R55A 4CXAB 3SD4A 2VWFA 3I55Q 4JJCA 4EOJB 5GMKi 1UNHD 2RI2A 3V8LA 3CD6T 2W0ZA 2G6FX 1X01A 3RBBB 1D0XA 4N4HA 1MUZA 1CKBA 2RHIA 2ZPIB 4C92E 5GAMe 1YI2T 1H3HA 1G2BA 1VYVA 2P4TA 1D1AA 1LVKA 1YIJA 3OYIA 3QWYA 3NTHA 3KXTA 1YCSB 3G6EQ 3M53A 1UUEA 4FSXA 4O6JA 1PHTA 5GAOr 3KHIA 4ELJA 2P0QA 4OF1A 2E3HA 3QHSA 3M5AA 3OSSC 3RMQA 3CCJQ 2F1LA 1YJNQ 5KYUA 4J9CA 2Y90A 3I5RA 2C5NB 1FMVA 4C8QG 3NFCA 1VQ8Q 4XAXB 4F16A 4DBRA 1ZA2B 2LNVA 3RKWA 1I1JA 3CCSA 3HPWA 3LH0A 2VV5A 3BDLA 1K9AA 2W9FA 2PUOB 3HFOA 1U1TA 2GF7A 5LMKB 2V1RA 5KE2A 4M7DF 3E1SA 2EQIA 2JT4A 2PHGA 5GAOp 4ZNXA 4WCIA 2DERA 4AI6A 3G4SA 4EMKB 5LJ5f 3UDCA 4AFSC 1HYOA 3CBPA 1VQMQ 1M90C 4AG1C 1ZLMA 2COWA 3CMEQ 3CCUA 2LCCA 4BE0A 2A37A 2DNUA 4QKUA 5HK0A 5D6XA 1TFBA 3URGA 3S3OA 2V8JA 2E12A 1VINA 3NDQA 1Z9ZA 4J6YA 3EG0A 1F1BB 1BU1A 4C8QD 1J3TA 1W98B 3REAB 2A3LA 4HL4A 2RB6A 4PJMA 1VQKQ 1IO6A 3SB2A 2MF2A 3ME9A 4PJOC 2BPMB 1S72A 1D1BA 3LWIA 4JS4A 2F2CA 5A0GA 3CCRT 4J9DA 1SKUB 1JBMA 4BUGA 1UNGD 2DETA 4HT9A 4D6WA 4F7LB 2XMFA 2HL3A 2NYSA 1VIEA 1VQLQ 2GQVA 4EDUA 3BG3A 1FKMA 2WIPB 1IREB 4FW1A 1EIFA 1VQ4T 3OS1A 2QTVA 1N5ZA 3OYGA 4BBSM 3FJPA 2VB6A 4PFOA 3V7RA 1O9KA 2ATCB 2DILA 2CP0A 5GMKl 1KXUA 1JXMA 4XTUA 2QGFB 3DB3A 3CXCS 1VQ5Q 1HK9A 3MP8A 2UZDB 5FLXE 1YJ9T 4N0AA 4JX4A 2O4XB 1OI9B 2PVGB 3V8KA 4ZTFA 4KULA 2KXCA 4DQ2A 2V8IA 3ER0A 1AHJB 1WXTA 3EG2A 1PRLC 3TSWA 5L8RE 1M90R 4PJOA 3X20B 2VXEA 4Z88A 4F7UG 3KFVA 2L3PA 2EYXA 4PJLA 4LUDA 4JX6A 2DIGA 2BS4A 3JCMg 2NUPA 3UT1A 1M27C 3JCMb 5GMKj 4DOVA 2X1NB 4E47A 1WZOA 3HRSA 1VUBA 3I55T 4JRQA 2QFZA 3TCJA 2FO0A 1FMKA 1BBZA 2DTIA 4RTVA 3CCVQ 4CC3A 1VQPA 2DJZA 5GMKe 1KJWA 2RHYA 3CPFA 4AKGA 2E70A 4BI4A 4DBFA 2AT1B 2RQUA 3E9FA 3SWNB 4IUUA 1P5EB 4D8KA 2E3IA 3L2ZA 1OX8A 1PCXA 1RLQC 3OYFA 1G3YA 3L1AA 2RQTA 5LJ5h 2HCKA 4ZN3A 1D0ZA 2L0AA 4C92D 4J9IA 2EBPA 1AWWA 4L5GA 2BS2A 1RUWA 4M77B 5GANe 4CC4B 3INZA 1UGVA 1D1CA 4JS5A 5I11A 3ZBDA 5HY6A 2K57A 2QA4A 2VVKA 3BG5A 2KMTA 1VQ8T 3HFNA 2CP5A 3JCMe 4M7DG 2WSEE 4JDSA 4XU1A 5LJ3e 5HK3A 1VQKT 1KFZA 1F5QB 4II5B 4M75A 3EOCB 5CKFA 4NSTB 4ROCA 4OB0B 3NHNA 2QG9B 3VKGA 1NPRA 1D09B 3EGDB 3CCEA 2BKDN 3A8LB 3CCLA 3CCRQ 5IHIA 3Q1JA 5GANh 2KRNA 3EG3A 1BIAA 2YLCA 4LXCA 2BZXA 1OQKA 2EVRA 3HRUA 1TH7A 1AWJA 1YI2Q 2CZ0B 1UHFA 4M78A 4J8OA 1KK7A 4ME7A 5ECAA 3PT9A 2C5XB 1T0HA 1UJ0A 3MCAB 4IIMA 3SWNA 4AFZC 3CCJT 1MMDA 2R5MA 1N8RU 4HCCA 1VQ5T 3VYGB 2IW8B 2J06A 3DDPB 1FX7A 3J7AF 4C8QF 3TNHB 1WA7A 1IGUA 3JCMf 2EWNA 1KQ2A 1YIJQ 9ATCB 2IN3A 3PTAA 3M0PA 3VV0A 3G1JA 1G3SA 2DEQA 2EW3A 3T9NA 4M4ZA 4RG2A 3M56A 4QVCA 2KVQG 3QWLA 4M77D 4EPCA 5CEIB 2GFUA 4HNUA 1YJNA 5DY9A 4J6WA 4PJOB 2CUBA 4JJDA 1SHFA 3F70A 5GAOn 2QK0A 4M75B 3EIDB 3BFMA 3EG9A 2KAFA 4MMLA 3ULRB 2KT8A 1UEBA 3EHRA 3L2WA 1T0JA 4M7DD 2WXVB 3CC2A 2DRMA 1AD6A 2CP7A 5LJ3f 3BLHB 2KRMA 1M90U 4M77F 1QP2A 4M77A 4Y91A 2DBKA 4IUVA 1QLYA 4JPBW 1OKVB 3VS3A 2YRVA 1VQ9A 5CYIB 1NYFA 1WFWA 2K2VA 5DM7R 3CC2Q 3EAEA 3CCLT 1JOWA 2NLUA 4F70B 1WJQA 2DYBA 2GBQA 2QQSA 1ZUYA 1BI1A 1R0CB 4QVDA 3PMIA 2L3RA 3LGFA 3BLRB 1A0NB 2AK5A 4E7SA 2VGNA 4AKIA 1G8XA 4BY6C 1PWTA 3GF5A 4BCQB 2DXBA 4HVUA 4CFUD 1LCKA 3A1PA 2CP3A 2PMIB 4M7DA 4LD9K 1Y71A 4XTYA 4J9FA 4K11A 3RGFB 4JJNK 5GAN3 5GAN4 2DL4A 5FRNA 2ZZDB 4C5EA 2DA9A 3L2VA 2ROLA 1QMCA 2YUOA 4M7AB 2HBPA 2RK1A 3M0SA 2L3SA 1XO2A 1YJ9Q 4FCYA 4BY7X 2BE9B 2HNIA 4CRIA 3TW7A 2X35A 1VQKA 2K79A 4OMMA 3REBB 1QKWA 4JRPA 1U3OA 3VRZA 2KXDA 3M0UA 3CCMT 3CCSQ 2LTOA 2VKNA 1B7TA 2D6FA 2CGHA 2IG0A 1U5SA 5KYXA 2KI7A 2LT1A 1QWFA 1FINB 1X6OA 3M4YA 1PNJA 1RI9A 3LW5E 1E6GA 3VUZA 3GP8A 4NS5A 3HB9A 4LN2A 4AFUC 1GL5A 2UZBB 1VQPQ 3PE0A 2DMOA 2F2XA 4BCGB 4OMLA 3JB9F 2RJCA 4XTVA 3JCMh 1BIBA 5EFQB 4GLKA 3G71A 4E2FB 1OX9A 2KYBA 1H92A 3VS0A 2RPNA 4J5YA 2IPOB 1QVFP 4Z02A 3TEEA 4N4GA 2WEVB 1BCMA 3OYDA 4F6SB 4HKEA 1RADB 2DKGA 2YT6A 5LJ5g 5I22A 2C4GB 3VRYA 2QEXT 1Q7YC 1H1QB 1UTIA 4M7DE 1OPKA 2EFIA 1HD3A 1ZQ1A 1IHVA 1M2OA 4KGZB 2NUTB 4DBQA 2P0KA 3U23A 4DOWA 2XICA 4KUDK 5HKCA 2I2LA 1QCFA 2HAXA 3EFOB 1PKSA 1BB9A 2OAUA 3OYNA 2PU9B 2C0IA 2KT1A 2P0PA 4II1A 5I2MA 4FM4B 5LJ3h 1B34A 1MMGA 2F5TX 3E19A 3SFMA 4HVVA 2RH2A 2HEQA 5LL6S 2EQUA 4Z89A 2X4YA 2YUPA 3HSBA 3ZFJA 1NJIR 3MHXA 3GIBA 3LWHA 3P8DA 4PFPA 4RCBA 1X43A 2BUDA 5GANf 2WJ9A 2D9TA 2L3QA 1WLPB 5HBHB 4OP0A 1CKAA 1NEGA 3PIPA 4WTOB 4BCNB 2G3RA 3D7SB 5CIUA 1T3SA 2WPAB 4LE9A 2ZPFB 3I55A 1SSFA 1D3UB 1VQOA 2DEUA 2O01E 1T3LA 5J26A 4V2SA 3EHQA 1BCOA 2MCNA 5DQVA 4OGRB 2RQRA 1WGSA 3G6ET 1TD6A 4AFQC 3EG1A 1KQSA 2D0QB 5GAN2 1H4LD 1N8RR 1MMNA 4XQ3A 4IKFA 2E65A 1AZGB 2NUZA 2QYZA 4J9HA 2EYWA 3O8VA 3N5BB 4HCBA 2LCLA 4EIKA 1N8RC 1VQ7A 4IUPA 2QEXA 3MY1B 3GOXA 4E7HA 4MFDA 2X4WA 3EFOA 1V76A 1VYTA 4M78G 2CDTA 2LDMA 2RN8A 1SRLA 1EFNA 2HMAA 2JJ9A 1JKWA 2RF0A 4WF2A 3G33B 4E7ZA 4EOQB 1D0YA 1XNIA 1QVGP 2JOYA 4BY1X 3P8HA 4CI0C 4OB3B 3RKXA 2NUPB 4EMGA 3VS6A 4XK8E 5DQWA 4BB7A 1VQOT 1GXIE 1D3BA 2LX7A 2EYYA 2LT4A 4M75C 1X75C 2BIVA 4F6UB 1W4SA 4OMFB 3PGGA 3CC4T 2I40B 1QQJA 4FYVB 5CKEA 3I56T 4GBQA 3UWNA 1NE8A 3OYBA 2FRYA 4RG8A 1AWOA 5KYNA 1YJNT 2WMBB 3G71T 1MGQA 1N27A 4XU2A 2MIOA 3RMSA 4RMOA 1WQ7A 3M0QA 1WHKA 4CFWB 2OTJT 2LRQA 2MWOA 3AHUA 1C1AA 1NG2A 2K9GA 4A4EA 1VQ7Q 2J6KA 2LC4A 1H25B 5BNJB 4PLLA 3ASKA 2M16A 3LQ5B 2QTXA 3DOGB 3CQTA 2C6TB 1YWOA 3M9QA 1M1FA 5CCAA 1TXQA 1E7PA 4F6WB 2IW6B 3LGLA 1ZBXA 2M0OA 1OL1B 2A08A 3TSZA 4Z8AA 2CP2A 3X24B 4BCOB 1VQNQ 2O31A 1OI1A 4FW2A 2DVJA 1JEGA 2YHTA 5GAN7 2EUFA 4ORZA 3EH1A 1S72T 2YUNA 2HD0A 1GCPA 4B9XA 3CCVT 1GY3B 2D8JA 1RLPC 3TNWB 2FEIA 2QASA 1YJWT 2A28A 3DL1A 1OL2B 5CKDA 1BI0A 1WIEA 2E6NA 4XU0A 1VQ9T 3QIIA 2XDBA 2KMGA 1HXDA 2X4JA 2WACA 1X27A 2JM9A 2Y4XA 3CMAT 2DL7A 2MMPA 4M77C 5LJ5j 5KE3A 3BDUA 5GANg 1K9MR 1VQPT 3DDQB 3JCMd 4MIMA 4EC9B 3ZEHA 3J81E 3JB9G 4M7DC 2L89A 1U06A 3VJPA 3QXEB 5IXBA 2W2HA 2R58A 4KRCB 3CCQT 2DL5A 5GAOl 1W2BP 2LQNA 4OMOA 5KYYB 2E5QA 3E2UA 4M6VA 2FPFA 3SWNC 3HTRA 3PO3S 1NLOC 4LDYA 5FW9A 2LVMA 3OYCA 4MMKA 2RA2A 4HCZA 2JTMA 4HNTA 3PFSA 2C5VB 2K7AA 4N4IA 5CQYA 1B3QA 1Q7YU 2JS0A 1WHLA 4M75D 4M75G 4JX5A 3C95A 1Q82R 3QHRB 2CZ1B 4F04B 3A8MB 2JZ2A 3HP9A 4QT7A 5HBJB 4M78B 2AIRB 3M59A 2KROA 1O75A 2C0TA 3C0CA 1QWEA 3X25B 1YJ9A 4DBHA 2WMAB 5EG2A 2ZPGB 2WSCE 3CMAA 1GUXA 1OEBA 4C5HA 1ARKA 3QPHA 4C0FA 3CPWA 1PKTA 1AWXA 3G71Q 2PVOB 2XD0A 4KT0E 4A4KA 5KH6A 5GAMh 1KHIA 3EFRA 4QW2A 2PK2A 2M0YA 3FLGA 3THKA 5GMKm 4BI3A 3L2UA 1YI2A 1WQWA 4HXJA 1KQSP 2C5OB 3HL8A 3WVEB 1M3AA 1YIJT 4J83A 2K5FA 4C0DB 5GAMf 2FZGB 4A63B 1IGQA 2V22B 1O9KB 1AOJA 4M78D 2JMCA 2I0NA 1MHNA 3M4GA 3CCEQ 3HRTA 2QQRA 4KBMB 2Z0WA 3KBGA 4FL6A 3I35A 3GNGA 3UF4A 4R0KA 1W1FA 2OTJA 2L8DA 1OIYB 4OVAA 5IN1A 1OU8A 3VKHA 2ENMA 3RDVA 3DKMA 3OQ5A 3I56Q 1I4K1 4PJOD 2WHBB 2KDSA 3CC7T 1MNEA 3G7ZA 1VQ6A 1OZ3A 3QYGB 1UECA 2X3WD 3J80E 5LJ3d 1M2VB 3M0TA 1M1KR 3M03A 4OR5B 4KGVB 1M5Q1 1FMWA 3DLMA 1ZSGA 3QYHB 1QMZB 3HZJA 8ATCB 3QWXX 5GAN5 1RAGB 4M75E 3OW2A 1G3NC 4BD3A 1Q82C 4BCQD 2P84A 5HQ0B 4ATOA 5LJ5e 2QA4T 3C94A 1K0SA 2OJ2A 5GANj 2KY9A 4AMCA 3DJBA 4GLMA 5HVYB 2X4XA 3META 4BDZA 3TN8B 2MI6A 4C92G 2CZ7B 4ESRA 2XHCA 2EKOA 6AT1B 3QSUA 1YHQA 2HDAA 1QVFS 1E6HA 2ESWA 5IDNB 5FU7C 1S72Q 3CBOA 3CC4Q 2F2VA 1JJ2P 4ELZC 1QVFA 4C8QE 2DL8A 1AEYA 1WX6A 1MV0B 3GTMS 3OY9A 3M57A 3JB9J 1PM3A 2M1HA 2KRSA 3QJ6A 1OKWB 1UGRB 3FB9A 1U1SA 1K1ZA 3S3NA 2OAWA 1G83A 4A54A 1ZHIA 1NLPC 1IZ6A 3C12A 2WSFE 3X28B 2HQEA 3DLLA 4B6MA 5IXFA 2OTJQ 2LX9A 4RTWA 1BI3A 1SF9A 2UZLB 3H0IA 2K3YA 1HSQA 1VQ5A 1R8OB 2EJGA 5DLQE 4AT1B 1VQ6Q 2KSSA 3V7SA 4CFMB 3G4SQ 2RJEA 2DL3A 3MY5B 2AKKA 2K5IA 2B8AA 4ZGEB 2PQWA 1QCNA 4BCHB 3OYHA 2KR6A 2QDLA 5GAMg 1FVVB 5GMKh 2JS2A 1TG0A 4M75F 1R0BG 2W9ZA 2O9SA 4J7IA 2O2OA 4JZ3A 3H0HA 1VYWB 2J05A 2QDJA 2EIFA 4EC8B 5HBEB 1CSKA 1TWBA 3R6OA 4VUBA 1XOVA 2M9UA 4J7FA 1M9SA 4F7UF 3EGUA 3CC2T 3CCLQ 4F7UA 5AYFA 5GAN8 2JW4A 5CVIA 2CP6A 3JB9H 3PNWC 3QO3A 3PIOA 2ZPHB 3MEWA 2CT3A 3TQ7P 2WIHB 1OV3A 1R77A 3QUIA 3SDZA 4LD6A 2E1HA 4MDWA 2EGAA 3VS7A 4M7AC 3H6ZA 1WHJA 1FYNA 2OTLQ 2DPPB 2KE9A 1M3CA 1OZ2A 1ZUKA 4BXXX 1RABB 4BCMB 2JM8A 2K3XA 2ZPEB 3MPUB 2C0OA 3M58A 4EORB 4HT8A 2HKNA 2R7GA 2LP5A 4BCJB 1YP5A 4M7AE 1QLBA 1PD1A 2OX7A 2QF7A 2F5KA 2RM4A 2JGZB 5CKHA 2M51A 1XQHA 1WYXA 2QEXQ 1GCQA 3CCET 4MZPA 1IRXA 4EOLB 2DIQA 4M7AF 2COZA 2ECZA 3OS2A 4M7AA 1Y0MA 2BKZB 3JSCA 3FRNA 4EOIB 1VQ8A 2CYZB 1VIFA 2EPDA 1Y96A 2WFYB 1YNZA 4PK4A 1UHCA 2LJ3A 2V26A 1VOLA 1YITQ 1KG1A 3GLXA 3TNIB 2YDLA 4LDVA 4BCND 1E9HB 3OA6A 1Q81R 1Q86U 1ZX6A 1H24B 4C8QB 1K73C 4EMKC 3CCMA 2COYA 4F17A 1VOMA 5FU7B 3RUXA 1UJYA 1WDXA 4BACA 2HQXA 2O88A 2QDYB 1KIKA 1V1CA 1ZA1B 2PZ1A 2Y4YA 3OMCA 2DZ9A 3A8OB 5D7UA 1BI2A 1RAFB 2DMEA 2EGEA 1V29B 1OIUB 3CCUT 4EOMB 4XU3A 1NBEB 3H4CA 2A36A 3LLRA 5FWBA 3JCMW 3CEYA 2KYMA 4PLIA 1JSTB 3BW1A 4LDUA 3QZ5B 3JB9I 2RHUA 2LJ0A 1JJ2A 3OW2S 4BI8B 5A0LA 2LQWA 1RL2A 5IHNA 4AKHA 1O9SA 1BYMA 1VQ4Q 5C6SA 1ENWA 4Y28E 3NMZC 2EAYA 2RD1A 1WHMA 2K2MA 1ABOA 3O5ZA 2AHJB 1X6GA 2VASA 2FPEA 1LJOA 5FROA 1NJIC 4E6RA 3CC7Q 1MNDA 2RK2A 3CCRA 2EJ9A 2RQVA 1UB4A 4MZMA 4IMYB 3L42A 3OS0A 4QVZA 5CK9A 2DF6A 1XJWB 3EFSA 2CUDA 2O4XA 1KHCA 2JVVA 2FYKA 1NPPA 1KD1C 1UGSB 3VKIA 1W6XA 1G3TA
chains in the Genus database with same CATH topology
3VYHB 2HD0A 3INZA 3S3MA 4NOYA 4JS5A 4B9XA 3CCVT 1Q82U 3ZBDA 5HY6A 4A4GA 2K57A 2QA4A 2F69A 2OTLT 3CC7A 3BG5A 2KMTA 1VQ8T 3HFNA 4PJOG 1YJWT 2MWPA 4C0DC 3JCMe 3OSVA 3DL1A 3CMEA 2VGMA 5CKDA 1BI0A 3JCMQ 4M7DG 2WSEE 4JDSA 2E6NA 4XU0A 4XU1A 2FB7A 5HK3A 5LJ3e 1VQ9T 1VQMA 4IUTA 1VQKT 4LDXA 4M75A 2FHDA 3QIIA 4ZTJA 2XDBA 2KMGA 1HXDA 5CKFA 2X4JA 2WACA 4ELYC 4OB0B 2RO0A 1KC8U 3VKGA 3OYLA 1NPRA 3CCEA 3JCMJ 2Y4XA 2BKDN 3CMAT 3A8LB 1RI0A 2RHZA 2DTOA 2MMPA 4M77C 5GANe 5CO7A 5KE3A 3BDUA 5LJ5j 3CCLA 4HT9A 3Q1JA 5J39A 1W2BA 5FU6B 4NL3A 5GANg 1I8FA 5GANh 5A2QE 3FEOA 1BIAA 2YLCA 1VQPT 3C4SA 3MEAA 3HRUA 5D6WA 3JCMd 1VQNT 1TH7A 4MIMA 1VQ7T 2H3JA 3ZEHA 3HKSA 5GAMj 3J81E 2CZ0B 3JB9G 1VQ4A 4M78A 3UPUA 4M7DC 2L89A 3VJPA 3QXEB 4J8OA 4N0AC 4F7UB 2R58A 4M78C 1PSEA 3CCQT 4PJOF 5GAOl 3G6EA 4ME7A 4OB2B 5M9OA 4QQDA 4C92C 3BG9A 2XIDA 2ZGWA 3PT9A 4C0ZA 2E5QA 3GPLA 3QYEA 4M6VA 4EMKA 2XK0A 5DLOA 3SWNC 5C0MA 3OYJA 4M77G 4NL2A 1M1KC 3MCAB 4LDYA 4A53A 1QW1A 2C06A 3SWNA 2LVMA 3OYCA 4MMKA 1UGPB 2RA2A 4HCZA 3CCJT 2JTMA 5FRMA 2R5MA 4HCCA 1N8RU 1VQ5T 4HNTA 3PFSA 3OMGA 4Q5WA 3VYGB 4N4IA 5CQYA 1YITT 3J7AF 1FX7A 3HO8A 4C8QF 1Q7YU 3CD6A 3CC4A 1QVPA 3JCMf 2VYTA 4M75D 4M75G 5LJ3g 4JX5A 2EWNA 2EJFA 1KQ2A 2YLBA 1H3ZA 3V7CA 3C95A 2OTLA 1DJ7B 1W2BS 2EQJA 3VU3C 3PTAA 2CZ1B 3VV0A 3A8MB 1G3SA 2JZ2A 4LDWA 3HP9A 2DEQA 5GAN6 5KCHA 3CMET 3WXMB 2LQKA 3I56A 3T9NA 1N9SA 4M78B 5A0DA 4RG2A 3M56A 4QVCA 2KVQG 3QWLA 3JRZA 3A5ZB 3M59A 1O75A 2E41A 4M77D 2MAMA 4EPCA 2GFUA 4M7DB 4F7UE 3X25B 4HNUA 1YJ9A 1YJNA 3BY7A 4J6XA 5DY9A 5EG2A 4J6WA 2ZPGB 4PJOB 2WSCE 3CMAA 3F70A 5GAOn 4JLGA 3OBWA 4C5HA 4PNOA 4M75B 3BFMA 3VUBA 5IAYA 2KAFA 4MMLA 3S6WA 3QPHA 1UEBA 4C0FA 2VC8A 4HA8A 3CPWA 3MEUA 3L2WA 3RIRA 3OYEA 3JCMP 4ZN1A 4M7DD 4A4HA 2PVOB 3RESA 3CC2A 2XD0A 4KT0E 5IT9E 4A4KA 5KH6A 4YTLA 3MO8A 5GAMh 1KHIA 5LJ3f 3EFRA 4QW2A 3TREA 1M90U 3FLGA 5GMKm 4M77F 4BI3A 4JLIA 3L2UA 1QP2A 3HHTB 1YI2A 3A8GB 1WQWA 4M77A 5CQXA 4Y91A 5KE2A 5CKBA 4NC6A 3HL8A 3M55A 3LX7A 4IUVA 3JB9D 1YBYA 3WVEB 1YIJT 2YRVA 4FT2A 1VQ9A 4J83A 1QVGS 2K5FA 3OYKA 4C0DB 5GAMf 2K2VA 5DM7R 3EAEA 4DA4A 3CCLT 4O5VA 1P92A 2DD4B 2NLUA 4FT4A 5KCOA 1Q81C 2DD5B 1I5LA 2GCXA 4M78D 4E7LA 1WJQA 1MHNA 3M4GA 1N6AA 3OB9A 3HRTA 3JCMc 1LOJA 2QQRA 1M1GA 1K9MC 1OYXA 2QQSA 4KBMB 1NZ9A 1BI1A 3KBGA 3PMIA 4QVDA 4FL6A 2XDPA 3GNGA 2L3RA 3LGFA 1K8AC 2JNGA 1KQSS 2OTJA 1YJWA 2DO3A 2L8DA 4OVAA 3HBLA 5IN1A 2CKKA 3VKHA 5J3BA 3DKMA 3CCVA 2XU8A 2VGNA 3OQ5A 1I4K1 2JN0A 4HLQA 4AKIA 4OGCA 4RKUE 1M8VA 4BY6C 4PJOD 2G77A 1Y07A 4BBRM 2JTFA 2KDSA 3GF5A 2DXBA 3CC7T 1H641 3G7ZA 1VQ6A 4IUQA 1OZ3A 3QYGB 2PUKB 3CCST 4UC4A 4M7DA 3J80E 5LJ3d 4LD9K 2ZPBB 3CCJA 1Y71A 1WJRA 2DK3A 1M5Q1 4QQ6A 4XTYA 4MFEA 2GFAA 2DXBB 3MP6A 1YITA 4C0GA 3DLMA 5EJCA 3QYHB 2DXCB 3HZJA 1N9RA 2R57A 4JJNK 4E7JA 5GAN3 5GAN5 3QJYA 5GAN4 5FU6C 1YHQT 5FRNA 2ZZDB 4C5EA 5I21A 4FU6A 5GAMd 3L2VA 1WJSA 4M7AB 4M75E 2HBPA 2RK1A 2KQWA 4OGEA 2PVDB 4BD3A 3G4ST 4BE1A 3OW2A 4L59A 2QQ9A 1Q82C 1KQ1A 2JUFA 2DXUA 3E9GA 2DAQA 1JRIA 5LJ5e 4QQGA 3OYMA 2QA4T 3C94A 1JJ2S 3P8BB 1VQLT 1VQNA 2FL7A 5GANj 2KY9A 4P5NA 3JCMX 2HNIA 3NTIA 4CRIA 4PL6A 3TW7A 3CCQA 4Z6YA 2X35A 1VQMT 1VQKA 4FIBA 2RJFA 3QDRB 2X4XA 3META 4GY5A 4JRPA 5LJ3j 4BDZA 2MI6A 3OBYA 4C92G 2CZ7B 1FXXA 4MZTA 4R56A 2XHCA 2EKOA 3CCMT 2DVEA 2LTOA 3SD4A 3V8JA 4R55A 1K73U 1YHQA 3QSUA 2D6FA 2CGHA 2IG0A 1QVFS 5GMKi 3QBYA 2LT1A 2RI2A 3LYIA 3M54A 3V8LA 3CD6T 1X6OA 3M4YA 3PMTA 3QZ9B 5FU7C 4C8QA 3LW5E 1X01A 3CBOA 3VUZA 3GP8A 1I81A 4N4HA 4NS5A 3HB9A 3RKYA 3VYGA 4ELZC 1QVFA 2RHIA 4C8QE 2ZPIB 4C92E 3JAME 5GAMe 1YI2T 3L2RA 4LOCA 3JB9F 2RJCA 4XTVA 3OY9A 3M57A 2RHXA 4RCCA 2P4TA 3JCMh 2M1HA 3JB9J 3QJ6A 1BIBA 4GLKA 1YIJA 4X9CA 1UGRB 2K4YA 3FB9A 1U1SA 3G71A 3S3NA 3OYIA 3CPWS 3NTHA 3KXTA 3M53A 4J5YA 2FVUA 2ZZDA 4KUIA 4Z02A 4FSXA 3TEEA 4A54A 1G3WA 1ZHIA 4O6JA 5GAOr 1M1KU 4N4GA 1IZ6A 3KHIA 3C12A 3X28B 4ELJA 2HQEA 2P0QA 3QYBA 2WSFE 4HKEA 4OF1A 2L5QA 3OYDA 3QHSA 1Q86C 2LX9A 3M5AA 2DKGA 3OSSC 1BI3A 3RMQA 4PJOE 2K3YA 5LJ5g 1VQ5A 2VUBA 1R8OB 3H8ZA 2EJGA 2IVWA 2QEXT 1Q7YC 5DLQE 2Y90A 4M78F 2DXTA 4M7DE 4L6V5 2KSSA 2EFIA 3V7SA 1ZQ1A 2RJEA 4C8QG 2K5IA 2E64A 4HNVA 2B8AA 4ZGEB 3NFCA 1NJIU 4XAXB 2PQWA 2P0KA 2LNVA 3RKWA 4DOWA 2XICA 4KUDK 5HKCA 3CCSA 2I2LA 3HPWA 3LH0A 5GAOm 2HAXA 3OYHA 2KR6A 2OAUA 2VV5A 3BDLA 2DZCA 4X9DA 5GAMg 5GMKh 3OYNA 2PU9B 2PUOB 3HFOA 4M75F 1U1TA 2ZCFB 2GF7A 2P0PA 3WVDB 3QG1A 4FM4B 4II1A 5I2MA 4JRIA 5LJ3h 4TVRA 1B34A 3E19A 2F5TX 3E1SA 3SFMA 4M7DF 2RH2A 4J7IA 1KD1U 5LL6S 2EQKA 4JUVA 2EQUA 2RI3A 5GAOp 2QDJA 2EIFA 4AI6A 1JB0E 2X4YA 3G4SA 3HSBA 4EMKB 3OYAA 4C8QC 5LJ5f 2EQMA 4PKCC 3R6OA 3ZFJA 3UDCA 3MHXA 1XOVA 2M9UA 4J7FA 4VUBA 3GIBA 3LWHA 1M9SA 3P8DA 4F7UF 4RCBA 3CC2T 3CBPA 1M90C 4F7UA 2BUDA 5AYFA 3QKJA 5GANf 5GAN8 5CVIA 2WJ9A 4BE2A 2D9TA 3CCUA 2EYQA 2LCCA 4BE0A 1VQLA 3JB9H 1VQ6T 3PNWC 4OP0A 3QO3A 3PIOA 2ZPHB 3MEWA 5HK0A 4E7KA 2LQ8A 3PIPA 4ZGDB 3QUIA 5GAOq 3SDZA 4LD6A 5D6XA 3URGA 2G3RA 2E1HA 2XKOC 3S3OA 5CIUA 4MDWA 4C5GA 2V8JA 2E12A 5I2SA 4M7AC 3H6ZA 4J6YA 2ZPFB 1BKBA 1SSFA 3I55A 1Q81U 2DPPB 4C8QD 4M7AD 3FDRA 1VQOA 1QVGA 1WPYA 2QQ8A 2A3LA 2O01E 1OZ2A 5J26A 4HL4A 2RB6A 4V2SA 3SB2A 2XI9A 2RI5A 2MF2A 3ME9A 2K3XA 2ZPEB 4PJOC 1S72A 3FIFA 3M58A 1WGSA 3LWIA 4JS4A 4HT8A 3G6ET 5A0GA 3CCRT 2DXCA 4M7AE 1QLBA 1JBMA 4BUGA 2KK4A 5LJ5d 1KQSA 2D0QB 4D6WA 2QF7A 4XTXA 5GAN2 2F5KA 2RM4A 4XQ3A 3TU4K 2E65A 4IKFA 3L2QA 4M7AG 4XTZA 5CKHA 4M78E 5CR2A 1XQHA 3O8VA 3N5BB 4HCBA 2LCLA 1VIEA 3CCET 2GQVA 4EDUA 1B34B 3BG3A 3NTKA 4MZPA 1U8RA 1N8RC 2V8KA 1LNXA 1FKMA 1VQ7A 1IREB 4E7IA 4IUPA 2QEXA 1Y96B 1EIFA 2DIQA 2DTHA 4C92A 3A8HB 3GOXA 1PSFA 3OS1A 3OS2A 1VQ4T 2R5AA 4E7HA 4M7AF 4C92F 4M7AA 4MFDA 2X4WA 5CAIA 3OYGA 4BBSM 3FRNA 3JSCA 3FJPA 1D3BB 3V7RA 4XTWA 1VQ8A 2CYZB 1VIFA 2QXFA 2LDMA 4M78G 1Y96A 1KG1A 3GLXA 4WF2A 5GMKl 4XTUA 4LDVA 4X34A 1XNIA 1UGQB 3MEVA 3DB3A 3CXCS 2JOYA 1HK9A 3MP8A 3OA6A 1YJ9T 5FLXE 2DD5A 3JCMV 3P8HA 4N0AA 4CI0C 4OB3B 2QQBA 2E6ZA 2K5LA 3RKXA 1Q86U 3CBMA 4EMGA 4JX4A 2O4XB 2PVGB 3V8KA 4ZTFA 3X26B 4KULA 2RJDA 4XK8E 4C8QB 1K73C 4EMKC 4DQ2A 3CCMA 4BB7A 2V8IA 1VQOT 1GXIE 1D3BA 5FU7B 3RUXA 3ER0A 2LT4A 4M75C 2HQXA 4B9WA 2QDYB 3KUFA 1M4ZA 1X75C 4BACA 1AHJB 2Y4YA 2BIVA 1W4SA 3OMCA 4OMFB 3MP1A 2DZ9A 3A8OB 3PGGA 5D6YA 3CC4T 5L8RE 2E10A 4PJOA 3X20B 1BI2A 2VXEA 5CKEA 3I56T 1V29B 4F7UG 5GANd 3CCUT 4XU3A 3LLRA 3H4CA 3JCMW 3UWNA 4QSHA 1NE8A 3CEYA 3OYBA 1QP3A 1Y7XA 4PLIA 3BW1A 4LDUA 4JX6A 2DIGA 2BS4A 4RG8A 3JCMg 1YJNT 3OS5A 3QZ5B 3UT1A 3JB9I 4JRKA 2RHUA 1G5VA 3JCMb 3G71T 5GMKj 4DOVA 1MGQA 1N27A 1KC8C 4XU2A 4E47A 3HRSA 1JJ2A 3OW2S 4BI8B 4C5IA 1VUBA 2XDDA 3I55T 5A0LA 2QFZA 3TCJA 4JRQA 4BDYA 4MDXA 2DD4A 1RL2A 1XTDA 2DTIA 3RMSA 4RMOA 3CXCA 1WQ7A 1K9MU 4AKHA 1O9SA 2VXFA 1BYMA 5C6SA 1VQPA 2DJZA 5GMKe 1WNLA 2RHYA 3CPFA 2LRQA 4Y28E 1FWZA 2MWOA 2EAYA 2OTJT 4M77E 2RD1A 2A7YA 1K8AU 3AHUA 3RERA 4AKGA 2E70A 4A4EA 4BI4A 2AHJB 2LC4A 3E9FA 3SWNB 4A4FA 4PLLA 4IUUA 4OB1B 2M16A 3ASKA 1LJOA 5FROA 4C92B 1NJIC 2QTXA 2BS3A 2RK2A 3L2ZA 2QQAA 3CCRA 1M1FA 3M9QA 3TW6A 5CCAA 2EJ9A 3DLLA 1E7PA 1UB4A 4BY6B 3OYFA 1G3YA 3LGLA 1ZBXA 1YCYA 3L1AA 4MZMA 1S72T 2M0OA 3L42A 3OS0A 5LJ5h 3DB4A 4QVZA 4EMHA 3OYYA 5CK9A 4ZN3A 3X24B 4ZGJB 3EFSA 2O4XA 4C92D 1KHCA 2CS7A 2JVVA 1OI1A 2FYKA 1NPPA 1KD1C 1UGSB 3FC3A 4ATOA 4L5GA 2BS2A 2QI2A 4IURA 2YHTA 2XG8D 5GAN7 3VKIA 2CZ6B 3GNFB 1G3TA 4M77B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYH B;  3A8G B;  1IRE B;  2ZZD A;  3WVE B;  3A8H B;  1PSF A;  3X28 B;  2WSF E;  2WSE E;  2DD4 B;  2CYZ B;  2DD5 B;  4OB0 B;  4L6V 5;  1UGQ B;  3A8L B;  4ZGE B;  2DD5 A;  4OB3 B;  2PVG B;  3X26 B;  4XK8 E;  4RKU E;  1GXI E;  2PU9 B;  2PUO B;  2CZ0 B;  2ZCF B;  2DXB A;  2QDY B;  3WVD B;  4FM4 B;  1AHJ B;  3QYG B;  2PUK B;  3QXE B;  3A8O B;  1PSE A;  2ZPB B;  5L8R E;  4OB2 B;  3X20 B;  1JB0 E;  2DXB B;  1V29 B;  3QYH B;  2DXC B;  1QP3 A;  2ZZD B;  1UGP B;  3QZ5 B;  2PVD B;  2ZPH B;  3VYG B;  4ZGD B;  2DD4 A;  1DJ7 B;  2ZPF B;  2CZ1 B;  4Y28 E;  3A8M B;  2DPP B;  2CZ7 B;  2AHJ B;  2O01 E;  4OB1 B;  2ZPE B;  3X25 B;  3QZ9 B;  2ZPG B;  2WSC E;  3LW5 E;  3VYG A;  2DXC A;  2ZPI B;  3X24 B;  4ZGJ B;  2D0Q B;  2PVO B;  4KT0 E;  1UGS B;  1UGR B;  2CZ6 B;  1QP2 A;  3HHT B; 
#chains in the Genus database with same CATH topology
 3VYH B;  1VYU A;  4NOY A;  2HSE B;  1Q82 U;  2OTL T;  2OI3 A;  4PJO G;  1URC B;  4C0D C;  5ACB A;  1H26 B;  3OSV A;  3CME A;  2VGM A;  2CCI B;  2DE0 X;  1VQM A;  1X2Q A;  4LDX A;  4HVW A;  4IUT A;  4YOZ A;  2FHD A;  1Z9Q A;  2FRW A;  2QAZ A;  4ELY C;  4YOO A;  1Q86 R;  3JCM J;  3UAT A;  1X69 A;  4Y92 A;  4CC2 A;  2RHZ A;  3POM A;  2DTO A;  5CO7 A;  2CCH B;  5J39 A;  1I8F A;  5A2Q E;  2EYZ A;  3FEO A;  1OPL A;  3R6N A;  3DTO A;  2K6D A;  5D6W A;  1VQN T;  3HKS A;  1VQ4 A;  2H8H A;  1IXD A;  4IIO A;  3UPU A;  2K3B A;  4N0A C;  3G6E A;  4CC7 A;  5L2W B;  1I5O B;  1NYG A;  4QQD A;  4AG2 C;  3BG9 A;  2XID A;  3GPL A;  3QYE A;  2J6O A;  4EMK A;  2XK0 A;  1JQQ A;  2W10 A;  1VQ9 Q;  4CFV B;  4M77 G;  2IVX A;  4A53 A;  2GGR A;  1QW1 A;  5IHY A;  1OUL A;  1AZE A;  1ZUU A;  3CPW P;  1QCO A;  4LNP A;  1M8M A;  4Q5W A;  3CD6 A;  1JU5 C;  3CC4 A;  2A0F B;  2CSQ A;  1KSW A;  1DJ7 B;  2EQJ A;  1ZSZ A;  2NWM A;  1YHQ Q;  5GAN 6;  2RQW A;  2LQK A;  1H1P B;  1N9S A;  5A0D A;  3JRZ A;  2MAM A;  4M7D B;  1TS9 A;  4F7U E;  3BY7 A;  1KC8 R;  4CFX B;  3EGD A;  1SEM A;  5I5Z B;  4PNO A;  3EH2 A;  3UA7 A;  3MEU A;  4CFN B;  2FG0 A;  2FZK B;  5GJV B;  4YTL A;  3MO8 A;  3TRE A;  4J9B A;  1AVZ C;  3HHT B;  5CQX A;  2QGG A;  3LX7 A;  3JB9 D;  4FT2 A;  3CXC P;  4DA4 A;  1W70 A;  4O5V A;  2DD4 B;  2DD5 B;  1EZZ B;  2GCX A;  1UG1 A;  3CCM Q;  3OW2 P;  1I5L A;  1E7O A;  3OB9 A;  1LOJ A;  4RTT A;  1K9M C;  1OYX A;  2J7I A;  2DM1 A;  2HKQ B;  1K8A C;  3CCQ Q;  2HZY A;  2DO3 A;  2CKK A;  2LJ1 A;  1EX4 A;  2ABL A;  2KBT A;  4HLQ A;  1TUD A;  5GJW B;  1ZSZ C;  1M8V A;  1PRM C;  2JTF A;  3UA6 A;  1OU9 A;  4IUQ A;  3PVQ A;  2PUK B;  3EGX A;  5KYW A;  2ED1 A;  3CD6 Q;  1HJD A;  2ZPB B;  1WJR A;  2DK3 A;  2RMO A;  3VS1 A;  4QQ6 A;  4MFE A;  3MP6 A;  2YRD A;  1YJW Q;  1WI7 A;  2DXC B;  1TSF A;  3QJY A;  5FU6 C;  5I21 A;  2KQW A;  3A98 A;  2PVD B;  4OGE A;  4L59 A;  2QQ9 A;  1KQ1 A;  2JUF A;  3E9G A;  1JRI A;  1WHH A;  3CMA Q;  2FL7 A;  2D8H A;  4P5N A;  4KGX B;  2EGC A;  3JCM X;  3SEM A;  3M0R A;  1VQM T;  2YSQ A;  1C6V X;  2RJF A;  4GY5 A;  1KC8 C;  1Q86 C;  1IB8 A;  1NEB A;  3OBY A;  5LJ3 j;  1FXX A;  4R56 A;  2DVE A;  3V8J A;  1K73 U;  3I5S A;  1TU0 B;  1M2V A;  3QBY A;  3LYI A;  3M54 A;  3PMT A;  4C8Q A;  3QZ9 B;  1PKD B;  1ACM B;  1I81 A;  4LUE A;  3RKY A;  3VYG A;  1TUG B;  2D0N A;  3CCU Q;  5ICP B;  4FYW B;  3L2R A;  4LOC A;  1TTH B;  3QDF A;  2RHX A;  4RCC A;  1MV3 A;  4G6L B;  2QA4 Q;  2E5K A;  4X9C A;  2FZC B;  2K4Y A;  5IF1 B;  3CPW S;  3K7A M;  3TVT A;  4J9G A;  2FVU A;  2ZZD A;  4KUI A;  1M1K U;  1G3W A;  4OMP A;  1Q7Y R;  3RR6 A;  3FC3 A;  1TUC A;  3QYB A;  2L5Q A;  2SEM A;  4PJO E;  2KNB B;  2VUB A;  3H8Z A;  1K0X A;  2IVW A;  4M78 F;  2DXT A;  4BCM D;  4L6V 5;  3MKD A;  5L23 A;  2MPX C;  3AT1 B;  2E64 A;  4HNV A;  3BE3 A;  1K76 A;  4D8D A;  1S1N A;  1NJI U;  2GQI A;  2MK5 A;  4Y72 B;  5GAO m;  1MMA A;  2ZAE A;  4X9D A;  2DZC A;  1OGU B;  2P4R A;  2ZCF B;  3WVD B;  3QG1 A;  4JRI A;  4JJB A;  1H27 B;  4TVR A;  5AT1 B;  1KD1 U;  3BLQ B;  2UZE B;  3BHU B;  2EQK A;  2DFU A;  4JUV A;  2RI3 A;  1JB0 E;  4HCK A;  2LNH B;  3OYA A;  4C8Q C;  2EQM A;  4PKC C;  1H1S B;  2AKL A;  2FPD A;  1PC0 A;  2AZV A;  2F2W A;  1SHG A;  4I3Z B;  3QKJ A;  4BE2 A;  2EYQ A;  1AIS B;  1VQL A;  1VQ6 T;  4E7K A;  2LQ8 A;  4ZGD B;  5GAO q;  1H1R B;  2XKO C;  2D1X A;  4C5G A;  5I2S A;  4RTZ A;  1BKB A;  1Q81 U;  4EOO B;  4M7A D;  3FDR A;  1QVG A;  1WPY A;  2QQ8 A;  1VA7 A;  1WXU A;  2NUT A;  2XI9 A;  2RI5 A;  1YFN A;  4ANJ A;  3B57 A;  1NM7 A;  1X6B A;  3FIF A;  4PJN A;  5IH2 A;  4DEX A;  2IIM A;  2GTJ A;  2DXC A;  5EC7 A;  4CFU B;  1ZSZ B;  2KK4 A;  1C9B A;  5LJ5 d;  3TU4 K;  4XTX A;  2BE7 D;  5HCK A;  3L2Q A;  4M7A G;  4XTZ A;  4M78 E;  5CR2 A;  3MIA B;  4FYX B;  1U8R A;  1B34 B;  1WXB A;  3NTK A;  2V8K A;  1LNX A;  2CRE A;  2GNC A;  4BCI B;  4E7I A;  1Y96 B;  1BU2 A;  2DTH A;  1KD1 R;  4C92 A;  3A8H B;  1PSF A;  1UDL A;  4JZ4 A;  2R5A A;  3QHW B;  4C92 F;  5CAI A;  2LMJ A;  1D3B B;  4XTW A;  2QXF A;  3BHV B;  1UE9 A;  4X34 A;  1UGQ B;  3MEV A;  1K73 R;  2J6F A;  2DD5 A;  2IW9 B;  3JCM V;  2QQB A;  2E6Z A;  2K5L A;  5KYU B;  3CBM A;  3IQL A;  1B07 A;  3X26 B;  2MYS A;  2RJD A;  4KRT A;  3BHT B;  5HNB B;  5IHK A;  7AT1 B;  2W96 A;  4B9W A;  3KUF A;  2PK9 B;  1M4Z A;  4TTH A;  3MP1 A;  5D6Y A;  4EOS B;  1YN8 A;  2E10 A;  4PJJ A;  3MI9 B;  1GBR A;  5GAN d;  1K4U S;  2O9V A;  4QSH A;  3NPF A;  4F7J B;  1QP3 A;  1Y7X A;  3NGP A;  3LH5 A;  3OS5 A;  1G5V A;  4JRK A;  2DJQ A;  2ED0 A;  4C5I A;  2XDD A;  1IHW A;  3EGX B;  4RTX A;  5KYW B;  4BDY A;  4MDX A;  2DD4 A;  1XTD A;  3CXC A;  3H9N A;  1K9M U;  2VXF A;  1SSH A;  1WNL A;  4BCF B;  2M02 A;  1FWZ A;  4OMN A;  4M77 E;  1K8A U;  2A7Y A;  3RER A;  1JO8 A;  1K8A R;  4A4F A;  4OB1 B;  2JMA A;  2LZ6 B;  3EG9 B;  4C92 B;  2BS3 A;  4YC3 B;  1GCQ C;  2YWW A;  2QQA A;  1WHG A;  2CH4 A;  3TW6 A;  5FGK B;  1RAI B;  4BY6 B;  1M3B A;  1YCY A;  2B86 A;  3I9Q A;  1RAC B;  3DB4 A;  4F7N B;  4ROD A;  3OYY A;  4EMH A;  2ROT A;  4ZGJ B;  2GTO A;  2AZS A;  1TOV A;  2CS7 A;  1VQO Q;  4BCK B;  3O0G D;  2QI2 A;  4IUR A;  1N4M A;  2XG8 D;  2LCS A;  3H41 A;  2CZ6 B;  3GNF B;  3S3M A;  2SRC A;  1Q95 G;  2I53 A;  4A4G A;  2F69 A;  2RNA A;  3CC7 A;  2BZ8 A;  2MWP A;  2X3X D;  4CRL B;  3RNJ A;  4EOK B;  2CSI A;  3VS2 A;  3JCM Q;  4DEY A;  2FB7 A;  2UUE B;  3H0F A;  4FSS A;  4ZTJ A;  1KC8 U;  2RO0 A;  3OYL A;  2CH4 W;  1RI0 A;  1RAE B;  2DYI A;  3SHW A;  4YOS A;  2BTT A;  1W2B A;  5FU6 B;  4NL3 A;  1OOT A;  2DBM A;  4FX3 B;  4X1V A;  3C4S A;  3MEA A;  1VQ7 T;  2H3J A;  5GAM j;  8AT1 B;  5LQF B;  1RAH B;  2V1Q A;  1GH6 B;  2DX1 A;  5KYX B;  1BK2 A;  4F7U B;  4M78 C;  3PVL A;  1PSE A;  3ZL7 C;  4PJO F;  1JSU B;  2L2P A;  4OB2 B;  5M9O A;  2EKH A;  4C92 C;  1RAA B;  2ZGW A;  4C0Z A;  5DLO A;  5C0M A;  3OYJ A;  4FYY B;  1M1K C;  4NL2 A;  2C06 A;  1QKX A;  5FRM A;  1UGP B;  2W99 A;  3OMG A;  1SG5 A;  2JXB A;  1YIT T;  3HO8 A;  1GRI A;  4KRD B;  1QVP A;  2G9X B;  2VYT A;  5LJ3 g;  1YWP A;  1AT1 B;  2EJF A;  2YXY A;  2YLB A;  1H3Z A;  3V7C A;  2OTL A;  1W2B S;  3VU3 C;  4LDW A;  5KCH A;  3CME T;  3WXM B;  2YUQ A;  3I56 A;  1H8K A;  3JAM E;  3A5Z B;  2E41 A;  2HQH A;  2DRK A;  4J6X A;  1PD0 A;  5IDP B;  1Y57 A;  2CJM B;  4JLG A;  4OMQ A;  4F7S B;  3OBW A;  5FWC A;  5IAY A;  3VUB A;  3S6W A;  4KH0 B;  2VC8 A;  2X9H A;  4HA8 A;  4KH1 B;  3MJX A;  3RIR A;  3OYE A;  3JCM P;  4ZN1 A;  4A4H A;  3RES A;  3VS4 A;  5IT9 E;  1X2K A;  4J9E A;  2PNI A;  4JLI A;  2CT4 A;  2BZY A;  3A8G B;  1H28 B;  5CKB A;  4NC6 A;  3M55 A;  4ROE A;  1YBY A;  1QVG S;  4PFZ A;  3OYK A;  4EON B;  1P92 A;  4FT4 A;  5KCO A;  1Q81 C;  4RTU A;  4E7L A;  2HSP A;  1UNL D;  1N6A A;  3JCM c;  1GFD A;  1M1G A;  1LPL A;  2KR3 A;  1NZ9 A;  4RUG A;  2PJQ A;  1PG5 B;  2H3E B;  1SRM A;  2JTE A;  2XDP A;  2MOX A;  2JNG A;  1KQS S;  4BCP B;  3GBQ A;  1YJW A;  3F5X B;  3HBL A;  5J3B A;  3CCV A;  4ELL A;  2KEA A;  2XU8 A;  2JN0 A;  4OGC A;  4F14 A;  4RKU E;  1M30 A;  2PTK A;  5KYY A;  1GUX B;  2G77 A;  1Y07 A;  4BBR M;  4UN0 A;  1GBQ A;  1H64 1;  3FJ5 A;  1I07 A;  3CCS T;  2HL5 C;  4UC4 A;  1UFF A;  3CCJ A;  2GFA A;  2DXB B;  1JXO A;  2KGT A;  1YIT A;  1GFC A;  4C0G A;  1C0M A;  1AD5 A;  2YRC A;  5EJC A;  2R57 A;  2E4H A;  1N9R A;  3EJ1 B;  4E7J A;  1YHQ T;  1ZBJ A;  2HBW A;  3JV3 A;  4FU6 A;  5GAM d;  1I0C A;  1WJS A;  1ZP2 A;  3G4S T;  4BE1 A;  2DXU A;  2X51 A;  2DAQ A;  3OYM A;  4QQG A;  1JJ2 S;  1VQN A;  1ABQ A;  2B9R A;  2QGS A;  3P8B B;  1VQL T;  3NTI A;  4PL6 A;  3CCQ A;  4Z6Y A;  2DLP A;  4FIB A;  4EOP B;  1SPK A;  4RTY A;  3VS5 A;  3QDR B;  2LW4 A;  4MZT A;  4R55 A;  4CXA B;  3SD4 A;  2VWF A;  3I55 Q;  4JJC A;  4EOJ B;  5GMK i;  1UNH D;  2RI2 A;  3V8L A;  3CD6 T;  2W0Z A;  2G6F X;  1X01 A;  3RBB B;  1D0X A;  4N4H A;  1MUZ A;  1CKB A;  2RHI A;  2ZPI B;  4C92 E;  5GAM e;  1YI2 T;  1H3H A;  1G2B A;  1VYV A;  2P4T A;  1D1A A;  1LVK A;  1YIJ A;  3OYI A;  3QWY A;  3NTH A;  3KXT A;  1YCS B;  3G6E Q;  3M53 A;  1UUE A;  4FSX A;  4O6J A;  1PHT A;  5GAO r;  3KHI A;  4ELJ A;  2P0Q A;  4OF1 A;  2E3H A;  3QHS A;  3M5A A;  3OSS C;  3RMQ A;  3CCJ Q;  2F1L A;  1YJN Q;  5KYU A;  4J9C A;  2Y90 A;  3I5R A;  2C5N B;  1FMV A;  4C8Q G;  3NFC A;  1VQ8 Q;  4XAX B;  4F16 A;  4DBR A;  1ZA2 B;  2LNV A;  3RKW A;  1I1J A;  3CCS A;  3HPW A;  3LH0 A;  2VV5 A;  3BDL A;  1K9A A;  2W9F A;  2PUO B;  3HFO A;  1U1T A;  2GF7 A;  5LMK B;  2V1R A;  5KE2 A;  4M7D F;  3E1S A;  2EQI A;  2JT4 A;  2PHG A;  5GAO p;  4ZNX A;  4WCI A;  2DER A;  4AI6 A;  3G4S A;  4EMK B;  5LJ5 f;  3UDC A;  4AFS C;  1HYO A;  3CBP A;  1VQM Q;  1M90 C;  4AG1 C;  1ZLM A;  2COW A;  3CME Q;  3CCU A;  2LCC A;  4BE0 A;  2A37 A;  2DNU A;  4QKU A;  5HK0 A;  5D6X A;  1TFB A;  3URG A;  3S3O A;  2V8J A;  2E12 A;  1VIN A;  3NDQ A;  1Z9Z A;  4J6Y A;  3EG0 A;  1F1B B;  1BU1 A;  4C8Q D;  1J3T A;  1W98 B;  3REA B;  2A3L A;  4HL4 A;  2RB6 A;  4PJM A;  1VQK Q;  1IO6 A;  3SB2 A;  2MF2 A;  3ME9 A;  4PJO C;  2BPM B;  1S72 A;  1D1B A;  3LWI A;  4JS4 A;  2F2C A;  5A0G A;  3CCR T;  4J9D A;  1SKU B;  1JBM A;  4BUG A;  1UNG D;  2DET A;  4HT9 A;  4D6W A;  4F7L B;  2XMF A;  2HL3 A;  2NYS A;  1VIE A;  1VQL Q;  2GQV A;  4EDU A;  3BG3 A;  1FKM A;  2WIP B;  1IRE B;  4FW1 A;  1EIF A;  1VQ4 T;  3OS1 A;  2QTV A;  1N5Z A;  3OYG A;  4BBS M;  3FJP A;  2VB6 A;  4PFO A;  3V7R A;  1O9K A;  2ATC B;  2DIL A;  2CP0 A;  5GMK l;  1KXU A;  1JXM A;  4XTU A;  2QGF B;  3DB3 A;  3CXC S;  1VQ5 Q;  1HK9 A;  3MP8 A;  2UZD B;  5FLX E;  1YJ9 T;  4N0A A;  4JX4 A;  2O4X B;  1OI9 B;  2PVG B;  3V8K A;  4ZTF A;  4KUL A;  2KXC A;  4DQ2 A;  2V8I A;  3ER0 A;  1AHJ B;  1WXT A;  3EG2 A;  1PRL C;  3TSW A;  5L8R E;  1M90 R;  4PJO A;  3X20 B;  2VXE A;  4Z88 A;  4F7U G;  3KFV A;  2L3P A;  2EYX A;  4PJL A;  4LUD A;  4JX6 A;  2DIG A;  2BS4 A;  3JCM g;  2NUP A;  3UT1 A;  1M27 C;  3JCM b;  5GMK j;  4DOV A;  2X1N B;  4E47 A;  1WZO A;  3HRS A;  1VUB A;  3I55 T;  4JRQ A;  2QFZ A;  3TCJ A;  2FO0 A;  1FMK A;  1BBZ A;  2DTI A;  4RTV A;  3CCV Q;  4CC3 A;  1VQP A;  2DJZ A;  5GMK e;  1KJW A;  2RHY A;  3CPF A;  4AKG A;  2E70 A;  4BI4 A;  4DBF A;  2AT1 B;  2RQU A;  3E9F A;  3SWN B;  4IUU A;  1P5E B;  4D8K A;  2E3I A;  3L2Z A;  1OX8 A;  1PCX A;  1RLQ C;  3OYF A;  1G3Y A;  3L1A A;  2RQT A;  5LJ5 h;  2HCK A;  4ZN3 A;  1D0Z A;  2L0A A;  4C92 D;  4J9I A;  2EBP A;  1AWW A;  4L5G A;  2BS2 A;  1RUW A;  4M77 B;  5GAN e;  4CC4 B;  3INZ A;  1UGV A;  1D1C A;  4JS5 A;  5I11 A;  3ZBD A;  5HY6 A;  2K57 A;  2QA4 A;  2VVK A;  3BG5 A;  2KMT A;  1VQ8 T;  3HFN A;  2CP5 A;  3JCM e;  4M7D G;  2WSE E;  4JDS A;  4XU1 A;  5LJ3 e;  5HK3 A;  1VQK T;  1KFZ A;  1F5Q B;  4II5 B;  4M75 A;  3EOC B;  5CKF A;  4NST B;  4ROC A;  4OB0 B;  3NHN A;  2QG9 B;  3VKG A;  1NPR A;  1D09 B;  3EGD B;  3CCE A;  2BKD N;  3A8L B;  3CCL A;  3CCR Q;  5IHI A;  3Q1J A;  5GAN h;  2KRN A;  3EG3 A;  1BIA A;  2YLC A;  4LXC A;  2BZX A;  1OQK A;  2EVR A;  3HRU A;  1TH7 A;  1AWJ A;  1YI2 Q;  2CZ0 B;  1UHF A;  4M78 A;  4J8O A;  1KK7 A;  4ME7 A;  5ECA A;  3PT9 A;  2C5X B;  1T0H A;  1UJ0 A;  3MCA B;  4IIM A;  3SWN A;  4AFZ C;  3CCJ T;  1MMD A;  2R5M A;  1N8R U;  4HCC A;  1VQ5 T;  3VYG B;  2IW8 B;  2J06 A;  3DDP B;  1FX7 A;  3J7A F;  4C8Q F;  3TNH B;  1WA7 A;  1IGU A;  3JCM f;  2EWN A;  1KQ2 A;  1YIJ Q;  9ATC B;  2IN3 A;  3PTA A;  3M0P A;  3VV0 A;  3G1J A;  1G3S A;  2DEQ A;  2EW3 A;  3T9N A;  4M4Z A;  4RG2 A;  3M56 A;  4QVC A;  2KVQ G;  3QWL A;  4M77 D;  4EPC A;  5CEI B;  2GFU A;  4HNU A;  1YJN A;  5DY9 A;  4J6W A;  4PJO B;  2CUB A;  4JJD A;  1SHF A;  3F70 A;  5GAO n;  2QK0 A;  4M75 B;  3EID B;  3BFM A;  3EG9 A;  2KAF A;  4MML A;  3ULR B;  2KT8 A;  1UEB A;  3EHR A;  3L2W A;  1T0J A;  4M7D D;  2WXV B;  3CC2 A;  2DRM A;  1AD6 A;  2CP7 A;  5LJ3 f;  3BLH B;  2KRM A;  1M90 U;  4M77 F;  1QP2 A;  4M77 A;  4Y91 A;  2DBK A;  4IUV A;  1QLY A;  4JPB W;  1OKV B;  3VS3 A;  2YRV A;  1VQ9 A;  5CYI B;  1NYF A;  1WFW A;  2K2V A;  5DM7 R;  3CC2 Q;  3EAE A;  3CCL T;  1JOW A;  2NLU A;  4F70 B;  1WJQ A;  2DYB A;  2GBQ A;  2QQS A;  1ZUY A;  1BI1 A;  1R0C B;  4QVD A;  3PMI A;  2L3R A;  3LGF A;  3BLR B;  1A0N B;  2AK5 A;  4E7S A;  2VGN A;  4AKI A;  1G8X A;  4BY6 C;  1PWT A;  3GF5 A;  4BCQ B;  2DXB A;  4HVU A;  4CFU D;  1LCK A;  3A1P A;  2CP3 A;  2PMI B;  4M7D A;  4LD9 K;  1Y71 A;  4XTY A;  4J9F A;  4K11 A;  3RGF B;  4JJN K;  5GAN 3;  5GAN 4;  2DL4 A;  5FRN A;  2ZZD B;  4C5E A;  2DA9 A;  3L2V A;  2ROL A;  1QMC A;  2YUO A;  4M7A B;  2HBP A;  2RK1 A;  3M0S A;  2L3S A;  1XO2 A;  1YJ9 Q;  4FCY A;  4BY7 X;  2BE9 B;  2HNI A;  4CRI A;  3TW7 A;  2X35 A;  1VQK A;  2K79 A;  4OMM A;  3REB B;  1QKW A;  4JRP A;  1U3O A;  3VRZ A;  2KXD A;  3M0U A;  3CCM T;  3CCS Q;  2LTO A;  2VKN A;  1B7T A;  2D6F A;  2CGH A;  2IG0 A;  1U5S A;  5KYX A;  2KI7 A;  2LT1 A;  1QWF A;  1FIN B;  1X6O A;  3M4Y A;  1PNJ A;  1RI9 A;  3LW5 E;  1E6G A;  3VUZ A;  3GP8 A;  4NS5 A;  3HB9 A;  4LN2 A;  4AFU C;  1GL5 A;  2UZB B;  1VQP Q;  3PE0 A;  2DMO A;  2F2X A;  4BCG B;  4OML A;  3JB9 F;  2RJC A;  4XTV A;  3JCM h;  1BIB A;  5EFQ B;  4GLK A;  3G71 A;  4E2F B;  1OX9 A;  2KYB A;  1H92 A;  3VS0 A;  2RPN A;  4J5Y A;  2IPO B;  1QVF P;  4Z02 A;  3TEE A;  4N4G A;  2WEV B;  1BCM A;  3OYD A;  4F6S B;  4HKE A;  1RAD B;  2DKG A;  2YT6 A;  5LJ5 g;  5I22 A;  2C4G B;  3VRY A;  2QEX T;  1Q7Y C;  1H1Q B;  1UTI A;  4M7D E;  1OPK A;  2EFI A;  1HD3 A;  1ZQ1 A;  1IHV A;  1M2O A;  4KGZ B;  2NUT B;  4DBQ A;  2P0K A;  3U23 A;  4DOW A;  2XIC A;  4KUD K;  5HKC A;  2I2L A;  1QCF A;  2HAX A;  3EFO B;  1PKS A;  1BB9 A;  2OAU A;  3OYN A;  2PU9 B;  2C0I A;  2KT1 A;  2P0P A;  4II1 A;  5I2M A;  4FM4 B;  5LJ3 h;  1B34 A;  1MMG A;  2F5T X;  3E19 A;  3SFM A;  4HVV A;  2RH2 A;  2HEQ A;  5LL6 S;  2EQU A;  4Z89 A;  2X4Y A;  2YUP A;  3HSB A;  3ZFJ A;  1NJI R;  3MHX A;  3GIB A;  3LWH A;  3P8D A;  4PFP A;  4RCB A;  1X43 A;  2BUD A;  5GAN f;  2WJ9 A;  2D9T A;  2L3Q A;  1WLP B;  5HBH B;  4OP0 A;  1CKA A;  1NEG A;  3PIP A;  4WTO B;  4BCN B;  2G3R A;  3D7S B;  5CIU A;  1T3S A;  2WPA B;  4LE9 A;  2ZPF B;  3I55 A;  1SSF A;  1D3U B;  1VQO A;  2DEU A;  2O01 E;  1T3L A;  5J26 A;  4V2S A;  3EHQ A;  1BCO A;  2MCN A;  5DQV A;  4OGR B;  2RQR A;  1WGS A;  3G6E T;  1TD6 A;  4AFQ C;  3EG1 A;  1KQS A;  2D0Q B;  5GAN 2;  1H4L D;  1N8R R;  1MMN A;  4XQ3 A;  4IKF A;  2E65 A;  1AZG B;  2NUZ A;  2QYZ A;  4J9H A;  2EYW A;  3O8V A;  3N5B B;  4HCB A;  2LCL A;  4EIK A;  1N8R C;  1VQ7 A;  4IUP A;  2QEX A;  3MY1 B;  3GOX A;  4E7H A;  4MFD A;  2X4W A;  3EFO A;  1V76 A;  1VYT A;  4M78 G;  2CDT A;  2LDM A;  2RN8 A;  1SRL A;  1EFN A;  2HMA A;  2JJ9 A;  1JKW A;  2RF0 A;  4WF2 A;  3G33 B;  4E7Z A;  4EOQ B;  1D0Y A;  1XNI A;  1QVG P;  2JOY A;  4BY1 X;  3P8H A;  4CI0 C;  4OB3 B;  3RKX A;  2NUP B;  4EMG A;  3VS6 A;  4XK8 E;  5DQW A;  4BB7 A;  1VQO T;  1GXI E;  1D3B A;  2LX7 A;  2EYY A;  2LT4 A;  4M75 C;  1X75 C;  2BIV A;  4F6U B;  1W4S A;  4OMF B;  3PGG A;  3CC4 T;  2I40 B;  1QQJ A;  4FYV B;  5CKE A;  3I56 T;  4GBQ A;  3UWN A;  1NE8 A;  3OYB A;  2FRY A;  4RG8 A;  1AWO A;  5KYN A;  1YJN T;  2WMB B;  3G71 T;  1MGQ A;  1N27 A;  4XU2 A;  2MIO A;  3RMS A;  4RMO A;  1WQ7 A;  3M0Q A;  1WHK A;  4CFW B;  2OTJ T;  2LRQ A;  2MWO A;  3AHU A;  1C1A A;  1NG2 A;  2K9G A;  4A4E A;  1VQ7 Q;  2J6K A;  2LC4 A;  1H25 B;  5BNJ B;  4PLL A;  3ASK A;  2M16 A;  3LQ5 B;  2QTX A;  3DOG B;  3CQT A;  2C6T B;  1YWO A;  3M9Q A;  1M1F A;  5CCA A;  1TXQ A;  1E7P A;  4F6W B;  2IW6 B;  3LGL A;  1ZBX A;  2M0O A;  1OL1 B;  2A08 A;  3TSZ A;  4Z8A A;  2CP2 A;  3X24 B;  4BCO B;  1VQN Q;  2O31 A;  1OI1 A;  4FW2 A;  2DVJ A;  1JEG A;  2YHT A;  5GAN 7;  2EUF A;  4ORZ A;  3EH1 A;  1S72 T;  2YUN A;  2HD0 A;  1GCP A;  4B9X A;  3CCV T;  1GY3 B;  2D8J A;  1RLP C;  3TNW B;  2FEI A;  2QAS A;  1YJW T;  2A28 A;  3DL1 A;  1OL2 B;  5CKD A;  1BI0 A;  1WIE A;  2E6N A;  4XU0 A;  1VQ9 T;  3QII A;  2XDB A;  2KMG A;  1HXD A;  2X4J A;  2WAC A;  1X27 A;  2JM9 A;  2Y4X A;  3CMA T;  2DL7 A;  2MMP A;  4M77 C;  5LJ5 j;  5KE3 A;  3BDU A;  5GAN g;  1K9M R;  1VQP T;  3DDQ B;  3JCM d;  4MIM A;  4EC9 B;  3ZEH A;  3J81 E;  3JB9 G;  4M7D C;  2L89 A;  1U06 A;  3VJP A;  3QXE B;  5IXB A;  2W2H A;  2R58 A;  4KRC B;  3CCQ T;  2DL5 A;  5GAO l;  1W2B P;  2LQN A;  4OMO A;  5KYY B;  2E5Q A;  3E2U A;  4M6V A;  2FPF A;  3SWN C;  3HTR A;  3PO3 S;  1NLO C;  4LDY A;  5FW9 A;  2LVM A;  3OYC A;  4MMK A;  2RA2 A;  4HCZ A;  2JTM A;  4HNT A;  3PFS A;  2C5V B;  2K7A A;  4N4I A;  5CQY A;  1B3Q A;  1Q7Y U;  2JS0 A;  1WHL A;  4M75 D;  4M75 G;  4JX5 A;  3C95 A;  1Q82 R;  3QHR B;  2CZ1 B;  4F04 B;  3A8M B;  2JZ2 A;  3HP9 A;  4QT7 A;  5HBJ B;  4M78 B;  2AIR B;  3M59 A;  2KRO A;  1O75 A;  2C0T A;  3C0C A;  1QWE A;  3X25 B;  1YJ9 A;  4DBH A;  2WMA B;  5EG2 A;  2ZPG B;  2WSC E;  3CMA A;  1GUX A;  1OEB A;  4C5H A;  1ARK A;  3QPH A;  4C0F A;  3CPW A;  1PKT A;  1AWX A;  3G71 Q;  2PVO B;  2XD0 A;  4KT0 E;  4A4K A;  5KH6 A;  5GAM h;  1KHI A;  3EFR A;  4QW2 A;  2PK2 A;  2M0Y A;  3FLG A;  3THK A;  5GMK m;  4BI3 A;  3L2U A;  1YI2 A;  1WQW A;  4HXJ A;  1KQS P;  2C5O B;  3HL8 A;  3WVE B;  1M3A A;  1YIJ T;  4J83 A;  2K5F A;  4C0D B;  5GAM f;  2FZG B;  4A63 B;  1IGQ A;  2V22 B;  1O9K B;  1AOJ A;  4M78 D;  2JMC A;  2I0N A;  1MHN A;  3M4G A;  3CCE Q;  3HRT A;  2QQR A;  4KBM B;  2Z0W A;  3KBG A;  4FL6 A;  3I35 A;  3GNG A;  3UF4 A;  4R0K A;  1W1F A;  2OTJ A;  2L8D A;  1OIY B;  4OVA A;  5IN1 A;  1OU8 A;  3VKH A;  2ENM A;  3RDV A;  3DKM A;  3OQ5 A;  3I56 Q;  1I4K 1;  4PJO D;  2WHB B;  2KDS A;  3CC7 T;  1MNE A;  3G7Z A;  1VQ6 A;  1OZ3 A;  3QYG B;  1UEC A;  2X3W D;  3J80 E;  5LJ3 d;  1M2V B;  3M0T A;  1M1K R;  3M03 A;  4OR5 B;  4KGV B;  1M5Q 1;  1FMW A;  3DLM A;  1ZSG A;  3QYH B;  1QMZ B;  3HZJ A;  8ATC B;  3QWX X;  5GAN 5;  1RAG B;  4M75 E;  3OW2 A;  1G3N C;  4BD3 A;  1Q82 C;  4BCQ D;  2P84 A;  5HQ0 B;  4ATO A;  5LJ5 e;  2QA4 T;  3C94 A;  1K0S A;  2OJ2 A;  5GAN j;  2KY9 A;  4AMC A;  3DJB A;  4GLM A;  5HVY B;  2X4X A;  3MET A;  4BDZ A;  3TN8 B;  2MI6 A;  4C92 G;  2CZ7 B;  4ESR A;  2XHC A;  2EKO A;  6AT1 B;  3QSU A;  1YHQ A;  2HDA A;  1QVF S;  1E6H A;  2ESW A;  5IDN B;  5FU7 C;  1S72 Q;  3CBO A;  3CC4 Q;  2F2V A;  1JJ2 P;  4ELZ C;  1QVF A;  4C8Q E;  2DL8 A;  1AEY A;  1WX6 A;  1MV0 B;  3GTM S;  3OY9 A;  3M57 A;  3JB9 J;  1PM3 A;  2M1H A;  2KRS A;  3QJ6 A;  1OKW B;  1UGR B;  3FB9 A;  1U1S A;  1K1Z A;  3S3N A;  2OAW A;  1G83 A;  4A54 A;  1ZHI A;  1NLP C;  1IZ6 A;  3C12 A;  2WSF E;  3X28 B;  2HQE A;  3DLL A;  4B6M A;  5IXF A;  2OTJ Q;  2LX9 A;  4RTW A;  1BI3 A;  1SF9 A;  2UZL B;  3H0I A;  2K3Y A;  1HSQ A;  1VQ5 A;  1R8O B;  2EJG A;  5DLQ E;  4AT1 B;  1VQ6 Q;  2KSS A;  3V7S A;  4CFM B;  3G4S Q;  2RJE A;  2DL3 A;  3MY5 B;  2AKK A;  2K5I A;  2B8A A;  4ZGE B;  2PQW A;  1QCN A;  4BCH B;  3OYH A;  2KR6 A;  2QDL A;  5GAM g;  1FVV B;  5GMK h;  2JS2 A;  1TG0 A;  4M75 F;  1R0B G;  2W9Z A;  2O9S A;  4J7I A;  2O2O A;  4JZ3 A;  3H0H A;  1VYW B;  2J05 A;  2QDJ A;  2EIF A;  4EC8 B;  5HBE B;  1CSK A;  1TWB A;  3R6O A;  4VUB A;  1XOV A;  2M9U A;  4J7F A;  1M9S A;  4F7U F;  3EGU A;  3CC2 T;  3CCL Q;  4F7U A;  5AYF A;  5GAN 8;  2JW4 A;  5CVI A;  2CP6 A;  3JB9 H;  3PNW C;  3QO3 A;  3PIO A;  2ZPH B;  3MEW A;  2CT3 A;  3TQ7 P;  2WIH B;  1OV3 A;  1R77 A;  3QUI A;  3SDZ A;  4LD6 A;  2E1H A;  4MDW A;  2EGA A;  3VS7 A;  4M7A C;  3H6Z A;  1WHJ A;  1FYN A;  2OTL Q;  2DPP B;  2KE9 A;  1M3C A;  1OZ2 A;  1ZUK A;  4BXX X;  1RAB B;  4BCM B;  2JM8 A;  2K3X A;  2ZPE B;  3MPU B;  2C0O A;  3M58 A;  4EOR B;  4HT8 A;  2HKN A;  2R7G A;  2LP5 A;  4BCJ B;  1YP5 A;  4M7A E;  1QLB A;  1PD1 A;  2OX7 A;  2QF7 A;  2F5K A;  2RM4 A;  2JGZ B;  5CKH A;  2M51 A;  1XQH A;  1WYX A;  2QEX Q;  1GCQ A;  3CCE T;  4MZP A;  1IRX A;  4EOL B;  2DIQ A;  4M7A F;  2COZ A;  2ECZ A;  3OS2 A;  4M7A A;  1Y0M A;  2BKZ B;  3JSC A;  3FRN A;  4EOI B;  1VQ8 A;  2CYZ B;  1VIF A;  2EPD A;  1Y96 A;  2WFY B;  1YNZ A;  4PK4 A;  1UHC A;  2LJ3 A;  2V26 A;  1VOL A;  1YIT Q;  1KG1 A;  3GLX A;  3TNI B;  2YDL A;  4LDV A;  4BCN D;  1E9H B;  3OA6 A;  1Q81 R;  1Q86 U;  1ZX6 A;  1H24 B;  4C8Q B;  1K73 C;  4EMK C;  3CCM A;  2COY A;  4F17 A;  1VOM A;  5FU7 B;  3RUX A;  1UJY A;  1WDX A;  4BAC A;  2HQX A;  2O88 A;  2QDY B;  1KIK A;  1V1C A;  1ZA1 B;  2PZ1 A;  2Y4Y A;  3OMC A;  2DZ9 A;  3A8O B;  5D7U A;  1BI2 A;  1RAF B;  2DME A;  2EGE A;  1V29 B;  1OIU B;  3CCU T;  4EOM B;  4XU3 A;  1NBE B;  3H4C A;  2A36 A;  3LLR A;  5FWB A;  3JCM W;  3CEY A;  2KYM A;  4PLI A;  1JST B;  3BW1 A;  4LDU A;  3QZ5 B;  3JB9 I;  2RHU A;  2LJ0 A;  1JJ2 A;  3OW2 S;  4BI8 B;  5A0L A;  2LQW A;  1RL2 A;  5IHN A;  4AKH A;  1O9S A;  1BYM A;  1VQ4 Q;  5C6S A;  1ENW A;  4Y28 E;  3NMZ C;  2EAY A;  2RD1 A;  1WHM A;  2K2M A;  1ABO A;  3O5Z A;  2AHJ B;  1X6G A;  2VAS A;  2FPE A;  1LJO A;  5FRO A;  1NJI C;  4E6R A;  3CC7 Q;  1MND A;  2RK2 A;  3CCR A;  2EJ9 A;  2RQV A;  1UB4 A;  4MZM A;  4IMY B;  3L42 A;  3OS0 A;  4QVZ A;  5CK9 A;  2DF6 A;  1XJW B;  3EFS A;  2CUD A;  2O4X A;  1KHC A;  2JVV A;  2FYK A;  1NPP A;  1KD1 C;  1UGS B;  3VKI A;  1W6X A;  1G3T A; 
#chains in the Genus database with same CATH homology
 3VYH B;  2HD0 A;  3INZ A;  3S3M A;  4NOY A;  4JS5 A;  4B9X A;  3CCV T;  1Q82 U;  3ZBD A;  5HY6 A;  4A4G A;  2K57 A;  2QA4 A;  2F69 A;  2OTL T;  3CC7 A;  3BG5 A;  2KMT A;  1VQ8 T;  3HFN A;  4PJO G;  1YJW T;  2MWP A;  4C0D C;  3JCM e;  3OSV A;  3DL1 A;  3CME A;  2VGM A;  5CKD A;  1BI0 A;  3JCM Q;  4M7D G;  2WSE E;  4JDS A;  2E6N A;  4XU0 A;  4XU1 A;  2FB7 A;  5HK3 A;  5LJ3 e;  1VQ9 T;  1VQM A;  4IUT A;  1VQK T;  4LDX A;  4M75 A;  2FHD A;  3QII A;  4ZTJ A;  2XDB A;  2KMG A;  1HXD A;  5CKF A;  2X4J A;  2WAC A;  4ELY C;  4OB0 B;  2RO0 A;  1KC8 U;  3VKG A;  3OYL A;  1NPR A;  3CCE A;  3JCM J;  2Y4X A;  2BKD N;  3CMA T;  3A8L B;  1RI0 A;  2RHZ A;  2DTO A;  2MMP A;  4M77 C;  5GAN e;  5CO7 A;  5KE3 A;  3BDU A;  5LJ5 j;  3CCL A;  4HT9 A;  3Q1J A;  5J39 A;  1W2B A;  5FU6 B;  4NL3 A;  5GAN g;  1I8F A;  5GAN h;  5A2Q E;  3FEO A;  1BIA A;  2YLC A;  1VQP T;  3C4S A;  3MEA A;  3HRU A;  5D6W A;  3JCM d;  1VQN T;  1TH7 A;  4MIM A;  1VQ7 T;  2H3J A;  3ZEH A;  3HKS A;  5GAM j;  3J81 E;  2CZ0 B;  3JB9 G;  1VQ4 A;  4M78 A;  3UPU A;  4M7D C;  2L89 A;  3VJP A;  3QXE B;  4J8O A;  4N0A C;  4F7U B;  2R58 A;  4M78 C;  1PSE A;  3CCQ T;  4PJO F;  5GAO l;  3G6E A;  4ME7 A;  4OB2 B;  5M9O A;  4QQD A;  4C92 C;  3BG9 A;  2XID A;  2ZGW A;  3PT9 A;  4C0Z A;  2E5Q A;  3GPL A;  3QYE A;  4M6V A;  4EMK A;  2XK0 A;  5DLO A;  3SWN C;  5C0M A;  3OYJ A;  4M77 G;  4NL2 A;  1M1K C;  3MCA B;  4LDY A;  4A53 A;  1QW1 A;  2C06 A;  3SWN A;  2LVM A;  3OYC A;  4MMK A;  1UGP B;  2RA2 A;  4HCZ A;  3CCJ T;  2JTM A;  5FRM A;  2R5M A;  4HCC A;  1N8R U;  1VQ5 T;  4HNT A;  3PFS A;  3OMG A;  4Q5W A;  3VYG B;  4N4I A;  5CQY A;  1YIT T;  3J7A F;  1FX7 A;  3HO8 A;  4C8Q F;  1Q7Y U;  3CD6 A;  3CC4 A;  1QVP A;  3JCM f;  2VYT A;  4M75 D;  4M75 G;  5LJ3 g;  4JX5 A;  2EWN A;  2EJF A;  1KQ2 A;  2YLB A;  1H3Z A;  3V7C A;  3C95 A;  2OTL A;  1DJ7 B;  1W2B S;  2EQJ A;  3VU3 C;  3PTA A;  2CZ1 B;  3VV0 A;  3A8M B;  1G3S A;  2JZ2 A;  4LDW A;  3HP9 A;  2DEQ A;  5GAN 6;  5KCH A;  3CME T;  3WXM B;  2LQK A;  3I56 A;  3T9N A;  1N9S A;  4M78 B;  5A0D A;  4RG2 A;  3M56 A;  4QVC A;  2KVQ G;  3QWL A;  3JRZ A;  3A5Z B;  3M59 A;  1O75 A;  2E41 A;  4M77 D;  2MAM A;  4EPC A;  2GFU A;  4M7D B;  4F7U E;  3X25 B;  4HNU A;  1YJ9 A;  1YJN A;  3BY7 A;  4J6X A;  5DY9 A;  5EG2 A;  4J6W A;  2ZPG B;  4PJO B;  2WSC E;  3CMA A;  3F70 A;  5GAO n;  4JLG A;  3OBW A;  4C5H A;  4PNO A;  4M75 B;  3BFM A;  3VUB A;  5IAY A;  2KAF A;  4MML A;  3S6W A;  3QPH A;  1UEB A;  4C0F A;  2VC8 A;  4HA8 A;  3CPW A;  3MEU A;  3L2W A;  3RIR A;  3OYE A;  3JCM P;  4ZN1 A;  4M7D D;  4A4H A;  2PVO B;  3RES A;  3CC2 A;  2XD0 A;  4KT0 E;  5IT9 E;  4A4K A;  5KH6 A;  4YTL A;  3MO8 A;  5GAM h;  1KHI A;  5LJ3 f;  3EFR A;  4QW2 A;  3TRE A;  1M90 U;  3FLG A;  5GMK m;  4M77 F;  4BI3 A;  4JLI A;  3L2U A;  1QP2 A;  3HHT B;  1YI2 A;  3A8G B;  1WQW A;  4M77 A;  5CQX A;  4Y91 A;  5KE2 A;  5CKB A;  4NC6 A;  3HL8 A;  3M55 A;  3LX7 A;  4IUV A;  3JB9 D;  1YBY A;  3WVE B;  1YIJ T;  2YRV A;  4FT2 A;  1VQ9 A;  4J83 A;  1QVG S;  2K5F A;  3OYK A;  4C0D B;  5GAM f;  2K2V A;  5DM7 R;  3EAE A;  4DA4 A;  3CCL T;  4O5V A;  1P92 A;  2DD4 B;  2NLU A;  4FT4 A;  5KCO A;  1Q81 C;  2DD5 B;  1I5L A;  2GCX A;  4M78 D;  4E7L A;  1WJQ A;  1MHN A;  3M4G A;  1N6A A;  3OB9 A;  3HRT A;  3JCM c;  1LOJ A;  2QQR A;  1M1G A;  1K9M C;  1OYX A;  2QQS A;  4KBM B;  1NZ9 A;  1BI1 A;  3KBG A;  3PMI A;  4QVD A;  4FL6 A;  2XDP A;  3GNG A;  2L3R A;  3LGF A;  1K8A C;  2JNG A;  1KQS S;  2OTJ A;  1YJW A;  2DO3 A;  2L8D A;  4OVA A;  3HBL A;  5IN1 A;  2CKK A;  3VKH A;  5J3B A;  3DKM A;  3CCV A;  2XU8 A;  2VGN A;  3OQ5 A;  1I4K 1;  2JN0 A;  4HLQ A;  4AKI A;  4OGC A;  4RKU E;  1M8V A;  4BY6 C;  4PJO D;  2G77 A;  1Y07 A;  4BBR M;  2JTF A;  2KDS A;  3GF5 A;  2DXB A;  3CC7 T;  1H64 1;  3G7Z A;  1VQ6 A;  4IUQ A;  1OZ3 A;  3QYG B;  2PUK B;  3CCS T;  4UC4 A;  4M7D A;  3J80 E;  5LJ3 d;  4LD9 K;  2ZPB B;  3CCJ A;  1Y71 A;  1WJR A;  2DK3 A;  1M5Q 1;  4QQ6 A;  4XTY A;  4MFE A;  2GFA A;  2DXB B;  3MP6 A;  1YIT A;  4C0G A;  3DLM A;  5EJC A;  3QYH B;  2DXC B;  3HZJ A;  1N9R A;  2R57 A;  4JJN K;  4E7J A;  5GAN 3;  5GAN 5;  3QJY A;  5GAN 4;  5FU6 C;  1YHQ T;  5FRN A;  2ZZD B;  4C5E A;  5I21 A;  4FU6 A;  5GAM d;  3L2V A;  1WJS A;  4M7A B;  4M75 E;  2HBP A;  2RK1 A;  2KQW A;  4OGE A;  2PVD B;  4BD3 A;  3G4S T;  4BE1 A;  3OW2 A;  4L59 A;  2QQ9 A;  1Q82 C;  1KQ1 A;  2JUF A;  2DXU A;  3E9G A;  2DAQ A;  1JRI A;  5LJ5 e;  4QQG A;  3OYM A;  2QA4 T;  3C94 A;  1JJ2 S;  3P8B B;  1VQL T;  1VQN A;  2FL7 A;  5GAN j;  2KY9 A;  4P5N A;  3JCM X;  2HNI A;  3NTI A;  4CRI A;  4PL6 A;  3TW7 A;  3CCQ A;  4Z6Y A;  2X35 A;  1VQM T;  1VQK A;  4FIB A;  2RJF A;  3QDR B;  2X4X A;  3MET A;  4GY5 A;  4JRP A;  5LJ3 j;  4BDZ A;  2MI6 A;  3OBY A;  4C92 G;  2CZ7 B;  1FXX A;  4MZT A;  4R56 A;  2XHC A;  2EKO A;  3CCM T;  2DVE A;  2LTO A;  3SD4 A;  3V8J A;  4R55 A;  1K73 U;  1YHQ A;  3QSU A;  2D6F A;  2CGH A;  2IG0 A;  1QVF S;  5GMK i;  3QBY A;  2LT1 A;  2RI2 A;  3LYI A;  3M54 A;  3V8L A;  3CD6 T;  1X6O A;  3M4Y A;  3PMT A;  3QZ9 B;  5FU7 C;  4C8Q A;  3LW5 E;  1X01 A;  3CBO A;  3VUZ A;  3GP8 A;  1I81 A;  4N4H A;  4NS5 A;  3HB9 A;  3RKY A;  3VYG A;  4ELZ C;  1QVF A;  2RHI A;  4C8Q E;  2ZPI B;  4C92 E;  3JAM E;  5GAM e;  1YI2 T;  3L2R A;  4LOC A;  3JB9 F;  2RJC A;  4XTV A;  3OY9 A;  3M57 A;  2RHX A;  4RCC A;  2P4T A;  3JCM h;  2M1H A;  3JB9 J;  3QJ6 A;  1BIB A;  4GLK A;  1YIJ A;  4X9C A;  1UGR B;  2K4Y A;  3FB9 A;  1U1S A;  3G71 A;  3S3N A;  3OYI A;  3CPW S;  3NTH A;  3KXT A;  3M53 A;  4J5Y A;  2FVU A;  2ZZD A;  4KUI A;  4Z02 A;  4FSX A;  3TEE A;  4A54 A;  1G3W A;  1ZHI A;  4O6J A;  5GAO r;  1M1K U;  4N4G A;  1IZ6 A;  3KHI A;  3C12 A;  3X28 B;  4ELJ A;  2HQE A;  2P0Q A;  3QYB A;  2WSF E;  4HKE A;  4OF1 A;  2L5Q A;  3OYD A;  3QHS A;  1Q86 C;  2LX9 A;  3M5A A;  2DKG A;  3OSS C;  1BI3 A;  3RMQ A;  4PJO E;  2K3Y A;  5LJ5 g;  1VQ5 A;  2VUB A;  1R8O B;  3H8Z A;  2EJG A;  2IVW A;  2QEX T;  1Q7Y C;  5DLQ E;  2Y90 A;  4M78 F;  2DXT A;  4M7D E;  4L6V 5;  2KSS A;  2EFI A;  3V7S A;  1ZQ1 A;  2RJE A;  4C8Q G;  2K5I A;  2E64 A;  4HNV A;  2B8A A;  4ZGE B;  3NFC A;  1NJI U;  4XAX B;  2PQW A;  2P0K A;  2LNV A;  3RKW A;  4DOW A;  2XIC A;  4KUD K;  5HKC A;  3CCS A;  2I2L A;  3HPW A;  3LH0 A;  5GAO m;  2HAX A;  3OYH A;  2KR6 A;  2OAU A;  2VV5 A;  3BDL A;  2DZC A;  4X9D A;  5GAM g;  5GMK h;  3OYN A;  2PU9 B;  2PUO B;  3HFO A;  4M75 F;  1U1T A;  2ZCF B;  2GF7 A;  2P0P A;  3WVD B;  3QG1 A;  4FM4 B;  4II1 A;  5I2M A;  4JRI A;  5LJ3 h;  4TVR A;  1B34 A;  3E19 A;  2F5T X;  3E1S A;  3SFM A;  4M7D F;  2RH2 A;  4J7I A;  1KD1 U;  5LL6 S;  2EQK A;  4JUV A;  2EQU A;  2RI3 A;  5GAO p;  2QDJ A;  2EIF A;  4AI6 A;  1JB0 E;  2X4Y A;  3G4S A;  3HSB A;  4EMK B;  3OYA A;  4C8Q C;  5LJ5 f;  2EQM A;  4PKC C;  3R6O A;  3ZFJ A;  3UDC A;  3MHX A;  1XOV A;  2M9U A;  4J7F A;  4VUB A;  3GIB A;  3LWH A;  1M9S A;  3P8D A;  4F7U F;  4RCB A;  3CC2 T;  3CBP A;  1M90 C;  4F7U A;  2BUD A;  5AYF A;  3QKJ A;  5GAN f;  5GAN 8;  5CVI A;  2WJ9 A;  4BE2 A;  2D9T A;  3CCU A;  2EYQ A;  2LCC A;  4BE0 A;  1VQL A;  3JB9 H;  1VQ6 T;  3PNW C;  4OP0 A;  3QO3 A;  3PIO A;  2ZPH B;  3MEW A;  5HK0 A;  4E7K A;  2LQ8 A;  3PIP A;  4ZGD B;  3QUI A;  5GAO q;  3SDZ A;  4LD6 A;  5D6X A;  3URG A;  2G3R A;  2E1H A;  2XKO C;  3S3O A;  5CIU A;  4MDW A;  4C5G A;  2V8J A;  2E12 A;  5I2S A;  4M7A C;  3H6Z A;  4J6Y A;  2ZPF B;  1BKB A;  1SSF A;  3I55 A;  1Q81 U;  2DPP B;  4C8Q D;  4M7A D;  3FDR A;  1VQO A;  1QVG A;  1WPY A;  2QQ8 A;  2A3L A;  2O01 E;  1OZ2 A;  5J26 A;  4HL4 A;  2RB6 A;  4V2S A;  3SB2 A;  2XI9 A;  2RI5 A;  2MF2 A;  3ME9 A;  2K3X A;  2ZPE B;  4PJO C;  1S72 A;  3FIF A;  3M58 A;  1WGS A;  3LWI A;  4JS4 A;  4HT8 A;  3G6E T;  5A0G A;  3CCR T;  2DXC A;  4M7A E;  1QLB A;  1JBM A;  4BUG A;  2KK4 A;  5LJ5 d;  1KQS A;  2D0Q B;  4D6W A;  2QF7 A;  4XTX A;  5GAN 2;  2F5K A;  2RM4 A;  4XQ3 A;  3TU4 K;  2E65 A;  4IKF A;  3L2Q A;  4M7A G;  4XTZ A;  5CKH A;  4M78 E;  5CR2 A;  1XQH A;  3O8V A;  3N5B B;  4HCB A;  2LCL A;  1VIE A;  3CCE T;  2GQV A;  4EDU A;  1B34 B;  3BG3 A;  3NTK A;  4MZP A;  1U8R A;  1N8R C;  2V8K A;  1LNX A;  1FKM A;  1VQ7 A;  1IRE B;  4E7I A;  4IUP A;  2QEX A;  1Y96 B;  1EIF A;  2DIQ A;  2DTH A;  4C92 A;  3A8H B;  3GOX A;  1PSF A;  3OS1 A;  3OS2 A;  1VQ4 T;  2R5A A;  4E7H A;  4M7A F;  4C92 F;  4M7A A;  4MFD A;  2X4W A;  5CAI A;  3OYG A;  4BBS M;  3FRN A;  3JSC A;  3FJP A;  1D3B B;  3V7R A;  4XTW A;  1VQ8 A;  2CYZ B;  1VIF A;  2QXF A;  2LDM A;  4M78 G;  1Y96 A;  1KG1 A;  3GLX A;  4WF2 A;  5GMK l;  4XTU A;  4LDV A;  4X34 A;  1XNI A;  1UGQ B;  3MEV A;  3DB3 A;  3CXC S;  2JOY A;  1HK9 A;  3MP8 A;  3OA6 A;  1YJ9 T;  5FLX E;  2DD5 A;  3JCM V;  3P8H A;  4N0A A;  4CI0 C;  4OB3 B;  2QQB A;  2E6Z A;  2K5L A;  3RKX A;  1Q86 U;  3CBM A;  4EMG A;  4JX4 A;  2O4X B;  2PVG B;  3V8K A;  4ZTF A;  3X26 B;  4KUL A;  2RJD A;  4XK8 E;  4C8Q B;  1K73 C;  4EMK C;  4DQ2 A;  3CCM A;  4BB7 A;  2V8I A;  1VQO T;  1GXI E;  1D3B A;  5FU7 B;  3RUX A;  3ER0 A;  2LT4 A;  4M75 C;  2HQX A;  4B9W A;  2QDY B;  3KUF A;  1M4Z A;  1X75 C;  4BAC A;  1AHJ B;  2Y4Y A;  2BIV A;  1W4S A;  3OMC A;  4OMF B;  3MP1 A;  2DZ9 A;  3A8O B;  3PGG A;  5D6Y A;  3CC4 T;  5L8R E;  2E10 A;  4PJO A;  3X20 B;  1BI2 A;  2VXE A;  5CKE A;  3I56 T;  1V29 B;  4F7U G;  5GAN d;  3CCU T;  4XU3 A;  3LLR A;  3H4C A;  3JCM W;  3UWN A;  4QSH A;  1NE8 A;  3CEY A;  3OYB A;  1QP3 A;  1Y7X A;  4PLI A;  3BW1 A;  4LDU A;  4JX6 A;  2DIG A;  2BS4 A;  4RG8 A;  3JCM g;  1YJN T;  3OS5 A;  3QZ5 B;  3UT1 A;  3JB9 I;  4JRK A;  2RHU A;  1G5V A;  3JCM b;  3G71 T;  5GMK j;  4DOV A;  1MGQ A;  1N27 A;  1KC8 C;  4XU2 A;  4E47 A;  3HRS A;  1JJ2 A;  3OW2 S;  4BI8 B;  4C5I A;  1VUB A;  2XDD A;  3I55 T;  5A0L A;  2QFZ A;  3TCJ A;  4JRQ A;  4BDY A;  4MDX A;  2DD4 A;  1RL2 A;  1XTD A;  2DTI A;  3RMS A;  4RMO A;  3CXC A;  1WQ7 A;  1K9M U;  4AKH A;  1O9S A;  2VXF A;  1BYM A;  5C6S A;  1VQP A;  2DJZ A;  5GMK e;  1WNL A;  2RHY A;  3CPF A;  2LRQ A;  4Y28 E;  1FWZ A;  2MWO A;  2EAY A;  2OTJ T;  4M77 E;  2RD1 A;  2A7Y A;  1K8A U;  3AHU A;  3RER A;  4AKG A;  2E70 A;  4A4E A;  4BI4 A;  2AHJ B;  2LC4 A;  3E9F A;  3SWN B;  4A4F A;  4PLL A;  4IUU A;  4OB1 B;  2M16 A;  3ASK A;  1LJO A;  5FRO A;  4C92 B;  1NJI C;  2QTX A;  2BS3 A;  2RK2 A;  3L2Z A;  2QQA A;  3CCR A;  1M1F A;  3M9Q A;  3TW6 A;  5CCA A;  2EJ9 A;  3DLL A;  1E7P A;  1UB4 A;  4BY6 B;  3OYF A;  1G3Y A;  3LGL A;  1ZBX A;  1YCY A;  3L1A A;  4MZM A;  1S72 T;  2M0O A;  3L42 A;  3OS0 A;  5LJ5 h;  3DB4 A;  4QVZ A;  4EMH A;  3OYY A;  5CK9 A;  4ZN3 A;  3X24 B;  4ZGJ B;  3EFS A;  2O4X A;  4C92 D;  1KHC A;  2CS7 A;  2JVV A;  1OI1 A;  2FYK A;  1NPP A;  1KD1 C;  1UGS B;  3FC3 A;  4ATO A;  4L5G A;  2BS2 A;  2QI2 A;  4IUR A;  2YHT A;  2XG8 D;  5GAN 7;  3VKI A;  2CZ6 B;  3GNF B;  1G3T A;  4M77 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...