2ZPGB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpgB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpgB02
3X25B 4Y28E 2PVGB 3VYHB 2ZPIB 1DJ7B 3QXEB 3X20B 2DPPB 2DD5A 2DXCB 4L6V5 2DD4B 5L8RE 2D0QB 2PVOB 3QZ5B 2DXBB 2O01E 1IREB 3LW5E 2CZ7B 4RKUE 2CZ1B 3QYHB 2WSCE 2PUKB 4ZGJB 4OB0B 3A8GB 3X24B 3A8HB 2WSEE 4XK8E 2ZZDA 3A8LB 2PVDB 3A8MB 1UGRB 4FM4B 2CZ6B 2ZPGB 3VYGA 2ZCFB 3X28B 1PSEA 2WSFE 2DD5B 2CZ0B 4ZGEB 4OB1B 1QP2A 3HHTB 1PSFA 2ZPFB 1JB0E 3A8OB 2PUOB 2ZPHB 2DXCA 1UGSB 3WVDB 3X26B 1V29B 1UGQB 2CYZB 1QP3A 1AHJB 2QDYB 4OB2B 2ZPEB 2ZZDB 2PU9B 3QYGB 1UGPB 4OB3B 2DD4A 4ZGDB 3QZ9B 3VYGB 2AHJB 2ZPBB 3WVEB 4KT0E 1GXIE 2DXBA
chains in the Genus database with same CATH superfamily
4HNUA 1M1KU 1R0BG 2E5KA 4XU1A 5CO7A 5FU7C 5GAOn 3CCSA 4C5GA 2QEXA 3GF5A 1YCYA 3EH1A 5HK0A 1X69A 4RTYA 4LD9K 3RKXA 2AIRB 2RHZA 2K2VA 1RABB 3CEYA 3LH5A 4II1A 4Y72B 2O01E 2BS4A 1Q82C 4IUTA 1VQMQ 2XICA 3OB9A 4XU3A 1Y7XA 4KH0B 4BI4A 4FCYA 1UJYA 2KT1A 1IZ6A 1VQMA 3CQTA 3INZA 1UNLD 3S3MA 3HRUA 2RPNA 2O9VA 2DRKA 3G6EQ 2K9GA 2GTOA 3PGGA 1UTIA 1RADB 1K8AR 3JCMb 3G6EA 1IGQA 1HJDA 2SRCA 3EFRA 1AD6A 3QWXX 1IRXA 3SDZA 2LRQA 1LPLA 3MEUA 4J5YA 4OB1B 1QKXA 3TN8B 5LJ3f 2I53A 3OYLA 1N8RU 4KH1B 4PK4A 1PC0A 1QQJA 2RJFA 3ULRB 4ROCA 3QO3A 2MAMA 2WFYB 2C5XB 4K11A 3MO8A 3NDQA 4C0DC 2HSEB 1WIEA 1VQ7T 1V29B 5KCHA 1OIUB 1BI2A 1K8AU 1I81A 2FZCB 1RAAB 4JX5A 4F04B 2K79A 2EGCA 2LDMA 4DBFA 3H9NA 4EC9B 1U1SA 4RMOA 1X75C 4ZN3A 3QYGB 2MWOA 5BNJB 3CXCA 4FSSA 3CMET 3L2ZA 1W1FA 2C06A 3BFMA 3VYGB 3BG9A 2AHJB 4RCBA 2O4XB 2XDDA 1YN8A 2YDLA 3DOGB 1G5VA 4N4HA 4PJOG 3RESA 4C5EA 2HL5C 4R56A 1VQ7Q 3TU4K 2YT6A 3EGUA 1OULA 2VGMA 3M59A 1YJ9T 2OAUA 2P0KA 1HXDA 4FYVB 1KQ1A 4EMKC 2PVOB 3CXCP 2DXBB 2L3RA 3M0UA 2WEVB 4WTOB 3C95A 4IUUA 2V22B 3E1SA 5GAMh 2X9HA 2F2VA 1RI0A 1XTDA 5CR2A 1AZEA 4CI0C 1EZZB 2WSCE 5A0GA 2DF6A 4KBMB 1ZBJA 2NYSA 4MZMA 3CMEQ 3BLRB 3OQ5A 3JCMQ 4AI6A 1QLYA 4MMKA 2IW8B 1VQ9T 3BLQB 1M2OA 4YOZA 2JUFA 2C5NB 3DL1A 1GY3B 2K5FA 5DLOA 1TU0B 1Q86R 1T3SA 4WCIA 3CPWS 1H4LD 2D8JA 1E7PA 1YJ9Q 4M75E 1VQKA 3O8VA 5GAMg 3J81E 4XTYA 1KD1C 4BACA 1VQPT 3UT1A 3OSVA 3A8OB 3UA7A 4HL4A 2OAWA 2RHXA 2DXCA 3FJPA 2E6ZA 2W96A 1RACB 4A4HA 3JCMf 4XAXB 2M9UA 1WHKA 3OYEA 1SPKA 4CFVB 1VQ9Q 1Q86U 4RTXA 2QGSA 2C0OA 4J83A 4A63B 2BPMB 1X6OA 1WJQA 1FWZA 4X9DA 1VQ9A 1IHVA 1N9RA 2XD0A 3VJPA 2RI5A 2W10A 1ABOA 1PKTA 5ACBA 5GANh 1VQ4T 1WHMA 3UF4A 2EYQA 3VRYA 4DOWA 4ZGDB 2A0FB 1W98B 5A0LA 4NL3A 4CFUD 3HZJA 1PRMC 2UZLB 4YOSA 3VS7A 4BUGA 4BCND 1VQPQ 3VS0A 4D6WA 1YJWA 2NUZA 4E2FB 4NS5A 3VS6A 3LYIA 4C5IA 3PT9A 1VQPA 2HDAA 2X4WA 1GUXA 1MMNA 4Y91A 4BI8B 2IW9B 3VRZA 2QQAA 1TG0A 3QKJA 5IXBA 1IHWA 1VQ8T 2GQIA 2DBMA 3QDRB 4LDWA 3JB9D 4IIOA 1D3UB 3QZ5B 1C6VX 3NTHA 3BG5A 2CP2A 2BS3A 1WXUA 3EHQA 1VA7A 4CC4B 1GFDA 1SF9A 4EMKA 1VQ4Q 4F7LB 4PLIA 4C92E 5KYXA 2DIQA 4FU6A 3X24B 2O88A 4QVDA 1A0NB 1BK2A 4MZTA 4C8QC 1AWJA 3V7CA 4XK8E 2JT4A 2WMBB 7AT1B 1AZGB 2LMJA 3PMIA 1T0HA 1X2KA 1OI9B 1VQLT 2Y90A 5AT1B 1H3ZA 1RAGB 1K9MR 3E2UA 5CCAA 2VC8A 1RI9A 4HVWA 2QYZA 3CC4T 3BG3A 2X4JA 1TS9A 4BCMB 1VQ8Q 5EFQB 1JKWA 3KXTA 4ESRA 2OI3A 2J05A 4BY6C 5GAOr 1OPKA 1PG5B 5FWBA 2L89A 1UB4A 3MEWA 2J6FA 3HKSA 3P8HA 4EOKB 1E6GA 1ZSZB 1WLPB 1GRIA 3OYIA 2W99A 1YJNA 2HQEA 2EQJA 2YLBA 4DOVA 2QGFB 1K9MU 1QP3A 2DL4A 2J7IA 4E7IA 3BY7A 1M9SA 1VQLQ 1ZLMA 5LJ5f 2KVQG 3NMZC 2EW3A 2HZYA 1RAIB 4EMGA 1W2BS 1NJIR 1VQLA 3CC4Q 3RUXA 1WGSA 3QSUA 2VXEA 2KDSA 1YIJT 2P4RA 3RGFB 2YRVA 3M55A 4LXCA 1UGVA 1QW1A 2NUTA 2ZPBB 4HCBA 4LDYA 5GAN5 3KHIA 4PFPA 5CKBA 5KYNA 4DBQA 2DZCA 4Y28E 4BB7A 2ZPIB 4PJMA 4F7UB 3SWNA 2DD5A 5LL6S 4C8QF 1VQNT 4ME7A 3BDLA 1NJIU 2H8HA 2BKDN 1Q86C 3MJXA 1BKBA 2D0QB 3E9GA 4BXXX 1H28B 4BY7X 1QWEA 4M7AC 2NUPB 1QCOA 3OS2A 3REBB 4RTUA 3OYDA 1GCQC 3PO3S 3G4SA 3GOXA 1YIJQ 4TTHA 1M2VB 3M0RA 2DILA 1VYWB 5IN1A 3A8GB 1M90R 2QF7A 2PTKA 1YIJA 1WHLA 2LX7A 2A3LA 2NLUA 3HTRA 2AZSA 3OBYA 4C8QA 3DB3A 2QASA 4GLKA 4LDXA 2VGNA 2RN8A 2JTEA 3O0GD 2X1NB 1RL2A 3A5ZB 2GBQA 1VQNQ 3SFMA 3V7RA 1WHHA 1URCB 4RTWA 4AG1C 3QWLA 3A1PA 4BE1A 4O6JA 1VQNA 2XMFA 3HHTB 2IPOB 3JB9G 1PKDB 1M90U 3I55T 2OTLA 1U8RA 1ZSGA 3J80E 2P84A 4M75D 2HKNA 1UECA 1XQHA 2CP6A 3H0HA 4UC4A 1AISB 2J6OA 3WXMB 3OYFA 2JMCA 2EFIA 2CS7A 1KSWA 2JTMA 2WPAB 3IQLA 1UEBA 2BS2A 3OMCA 2JXBA 2Y4XA 2DVEA 1D3BB 1E7OA 4MFDA 3CMAT 4N4GA 2O2OA 5LJ3e 3DB4A 1YHQT 2H3EB 2P0QA 3FRNA 1OPLA 5GJVB 3I55Q 3ASKA 4PL6A 1JJ2S 2D1XA 2DMOA 1DJ7B 2DNUA 4EOMB 5ECAA 4HLQA 2RNAA 4PJOC 1K9MC 2XK0A 2ED0A 1G3YA 2CGHA 3M9QA 1UNHD 4FIBA 1M3AA 2E65A 5LJ3j 5DM7R 1BB9A 2CT3A 1BU2A 1N6AA 1BI0A 3MPUB 1CKAA 2B86A 4EOOB 3CMAQ 2VB6A 1NPRA 3MP8A 3RKWA 1LNXA 1N5ZA 4KGZB 1GCQA 1YHQQ 3BHTB 2A28A 1B07A 1VYTA 3CMAA 3A8LB 4OMOA 1J3TA 4C92D 2DEQA 1WXBA 4CXAB 4R0KA 2EYXA 4EMHA 2CP5A 1ABQA 5HY6A 1X6GA 2E1HA 4J9DA 3MY1B 4XU2A 3CBOA 5A0DA 2ZCFB 1MMAA 5M9OA 4J9FA 1NJIC 3EG9A 3EFSA 2NWMA 4BD3A 1EX4A 2E10A 1KK7A 3QYEA 4CFWB 4OVAA 1WJSA 1QVFS 2KYMA 1D09B 2R5MA 3WVDB 1MV0B 2D8HA 3VS4A 3G71A 3X26B 2RJDA 1TXQA 3PIPA 3M4GA 1PWTA 2KR3A 2RHUA 4ELJA 1H1SB 4C0FA 1QVPA 1PCXA 2DKGA 2M02A 1YFNA 1M1GA 2FZGB 2KROA 5CVIA 2H3JA 2EIFA 5I22A 5GMKi 4PJOF 1YP5A 2AKLA 4JX6A 4X9CA 8AT1B 2ATCB 1H25B 1I07A 2QDJA 4M7DB 2DL3A 1OU8A 1B34B 1M1KR 2F2XA 4N4IA 4MFEA 4YOOA 2CREA 4AFUC 1M90C 3JCMe 4QQ6A 1Y96B 4XTXA 3CCUT 2WACA 5HK3A 2LT1A 4M77E 3RR6A 4QVCA 3M03A 1KC8C 3QG1A 1U06A 4M75G 1TD6A 5DQVA 3DDPB 1T3LA 4F7UE 3EGXB 4BCIB 4EOLB 1M4ZA 1I1JA 5KYWB 4PFOA 4DQ2A 3QIIA 1M8MA 1BU1A 3R6NA 4PJOA 1OZ2A 3M53A 3LWHA 2COYA 2CZ1B 3CC2T 1NE8A 2K5LA 3RMQA 2DYIA 3H41A 3MKDA 5KH6A 3CCVT 3HBLA 2EKOA 5FU6B 4HT8A 4F6SB 2RK2A 2PJQA 2M51A 2FHDA 4EOIB 2ED1A 2PQWA 4FYYB 2EQKA 4I3ZB 3TSWA 1WHGA 2PK9B 1G3NC 2XDPA 3CCUQ 1KQ2A 1SSHA 2YHTA 2DA9A 4C92B 4JJBA 3VYGA 4WF2A 1BYMA 4JS4A 1QLBA 1V1CA 2I40B 5D6WA 1N8RR 4HNVA 3VUZA 2CCHB 3CC2Q 2EQUA 5J39A 3OW2A 3CCVQ 3KUFA 3CD6T 1PM3A 2RA2A 2BZYA 3EAEA 3CCVA 2EAYA 4FW1A 3EFOB 4JRIA 3VUBA 4JRPA 3G1JA 2PMIB 2MWPA 5AYFA 2ZPEB 2ZZDB 5GAMf 1M5Q1 4JJCA 5LQFB 2MI6A 4C92G 1MV3A 2WHBB 3HP9A 3CXCS 4XTUA 3JB9I 4BY1X 2JN0A 1B3QA 3OW2P 3BE3A 3PFSA 1O9KA 2HL3A 4JS5A 4IUQA 2K3XA 2RI3A 5GJWB 1PD0A 4E7LA 5IDNB 2EYYA 3EG3A 3SD4A 1UG1A 2PVGB 2QGGA 3CD6Q 4E47A 1JEGA 2EQIA 2DD4B 2IVXA 2D9TA 5LJ5e 4Z8AA 4OF1A 4BDZA 2VUBA 3QBYA 3NTIA 1VQ6T 1JXOA 2FRYA 2RI2A 4M78E 4KGVB 2KRSA 1BIAA 2HBPA 4XU0A 3E19A 3N5BB 1PHTA 2KSSA 4ELYC 3I9QA 3H0IA 4O5VA 3DJBA 2LNHB 5LJ5j 3LWIA 2CZ6B 1VQ7A 3JRZA 1Z9QA 2LZ6B 5GANf 3M4YA 4BCPB 3HSBA 5GMKh 2C5OB 2XIDA 1BBZA 2AZVA 2X3WD 2DO3A 2CH4A 1K0XA 4CRIA 2DMEA 1ZHIA 4MZPA 2DTOA 2CSQA 5D6YA 1JU5C 4B9XA 2YSQA 1CKBA 1VQ6Q 3CMEA 1H27B 4A4EA 2BZXA 2JVVA 4OMMA 2WMAB 2F1LA 1TWBA 1M1KC 1VQ5T 4BCMD 1VOMA 2V1RA 4JZ4A 1VQ6A 5DQWA 1VIFA 2KGTA 2RJEA 3NHNA 3HB9A 2FVUA 4II5B 3MP6A 2MOXA 1HYOA 3C94A 5C0MA 4CC3A 2DK3A 2RMOA 2YUOA 1TUDA 1YJ9A 1OOTA 2EJFA 1GBRA 2HEQA 4G6LB 2RQTA 4QVZA 3TREA 5I2SA 2X4YA 3JCMP 3MEVA 2O31A 2OTJT 4M7DE 5KYYB 4EIKA 1LCKA 3Q1JA 4EONB 3PNWC 1JXMA 3VS5A 2WIPB 2V8KA 2KXDA 5IXFA 1VQ5Q 1NLPC 2A37A 1UUEA 2JGZB 3CCLT 3L2UA 1AVZC 1OQKA 2A7YA 4XTVA 2HSPA 4OMPA 5J26A 3CCJT 3CBMA 1VYUA 3ZFJA 2PNIA 1U3OA 2ZGWA 3LGFA 4M77D 2P0PA 3PIOA 2EYZA 4JPBW 1FMKA 3QPHA 2CZ7B 4C0GA 3L1AA 3SWNC 4M7AE 1D1AA 2DJQA 2W2HA 1VQOT 1N8RC 4ZGJB 4OB0B 4CRLB 5FU7B 4YC3B 1UNGD 4KGXB 2QQ8A 5EJCA 2OTJQ 2G9XB 4FYXB 1K8AC 1UGRB 1QCFA 2GGRA 1WFWA 4B9WA 5GAOl 3JB9F 3CCLQ 2FZKB 4ROEA 1TTHB 3TVTA 4EC8B 2IN3A 2KK4A 3CCJQ 1PSEA 1BI1A 4E6RA 4J9EA 5HBJB 2KI7A 1BI3A 1KQSA 2HAXA 1KG1A 1UJ0A 1WI7A 5IH2A 1K0SA 1QP2A 1JBMA 3URGA 3CCJA 1VQ4A 2ZPFB 2FRWA 3OYNA 2YUPA 1GCPA 1WPYA 2K5IA 2HQHA 2E70A 2MYSA 1VQOQ 4RG8A 1FVVB 4EORB 1Y71A 4DBRA 1M3CA 3PMTA 2L3QA 3CBPA 1H92A 1BIBA 3L2WA 2XI9A 2CUDA 1OU9A 1AHJB 2G6FX 1PKSA 2GFAA 1KQSP 2F69A 1ENWA 3CCET 3OS0A 2D0NA 1M2VA 1VQ8A 2PU9B 3BLHB 3BHVB 1TUCA 2DL5A 1Q81U 4NOYA 2HCKA 3V8JA 4QSHA 1I5OB 4VUBA 1I4K1 1IGUA 4KT0E 5CKDA 3PVLA 3F70A 5FRNA 1NYFA 4HKEA 3QHRB 3P8DA 4BDYA 1KHIA 5GAOm 3HRSA 3C12A 4EOPB 4B6MA 3V7SA 4L6V5 5GAOp 2EGAA 2RQWA 4FL6A 4BE0A 2C6TB 2KE9A 4HT9A 3DLLA 2GFUA 3CC4A 1OX9A 2VVKA 1C1AA 4M75C 3CCEQ 4HA8A 3JCMX 1IREB 3F5XB 6AT1B 3MY5B 1GUXB 4JUVA 1XNIA 2GF7A 4M77B 3CCEA 2QTXA 2C4GB 2JW4A 2E3HA 9ATCB 5IHNA 2PZ1A 2WSEE 1ZUYA 1KJWA 3DLMA 4RUGA 1YWOA 2YRDA 1SHFA 3GNGA 3QUIA 2DLPA 4JZ3A 3A8MB 2F5KA 2LP5A 4M78D 3GNFB 4BCGB 1D0YA 3C4SA 2K3BA 2RF0A 3UDCA 4BCHB 3U23A 3CC7T 5KYXB 2X35A 2BE9B 4F7NB 4E7JA 1UHCA 3HFNA 4DEYA 1ZBXA 2LJ0A 2QG9B 2BUDA 4LNPA 1NG2A 2DZ9A 1OKVB 4BI3A 2J6KA 3CCRT 5I2MA 1UGSB 1LJOA 4M77G 4PLLA 2FB7A 4OR5B 1GH6B 3MP1A 2RJCA 1WNLA 5LMKB 2EWNA 4F7UG 4HCZA 3QHSA 4JLGA 2KT8A 4PKCC 4Q5WA 4OMQA 2CT4A 4AKHA 1MUZA 4ANJA 3OS1A 3OYHA 3VS2A 2JOYA 1OZ3A 4BBRM 1H24B 2CP0A 2KXCA 3EGDB 3CC7Q 2ABLA 3EOCB 2L8DA 1FYNA 4OB3B 5A2QE 2LQWA 5DLQE 2FPEA 1RAHB 1WYXA 3JAME 1OL1B 4C92C 3OA6A 4M75F 1XOVA 3FDRA 1GXIE 1O9SA 4J8OA 1G8XA 3L2RA 5IT9E 3TEEA 3CCRQ 5C6SA 3MCAB 5J3BA 1ACMB 3VKHA 1ZUUA 4RG2A 4IUPA 1ARKA 2V26A 4X34A 5CQYA 3CCRA 1KIKA 4CFNB 4Z89A 4OMLA 3QDFA 1XO2A 4AMCA 4RTVA 1MMDA 2NUTB 4M7DD 1QMZB 3GLXA 4M7DF 2JS0A 5GAMe 2YUNA 1X01A 3E9FA 2KMGA 3TW7A 3M54A 5KE3A 2QQ9A 3ER0A 4M75A 1VOLA 3TSZA 3VU3C 3I55A 2K6DA 2QK0A 2DM1A 4M7AD 3MI9B 1UHFA 4CFXB 1JSTB 3REAB 2UZDB 2X4XA 4AFSC 5GAMj 5CK9A 4JX4A 1AWXA 4M78B 3QWYA 2MPXC 3X28B 4ORZA 4LD6A 5CQXA 1B34A 3RERA 1MMGA 1VYVA 5LJ3d 2BIVA 1MNEA 3TNIB 5KYUA 4Z02A 1PSFA 1Y96A 3BW1A 4C8QB 1JB0E 2VASA 2RHYA 2JTFA 1H1RB 2CSIA 2KYBA 1YHQA 2JZ2A 4EOJB 4C92F 2JJ9A 5KYWA 2DBKA 1WZOA 2K2MA 1UGQB 3TCJA 2KR6A 3FLGA 4MIMA 2CP7A 3HRTA 3V8LA 5GANe 2AK5A 1QVGA 4OB2B 4F7JB 3HPWA 1R77A 1X6BA 2I2LA 1MGQA 3RDVA 2EJGA 4BY6B 3NGPA 5FLXE 4Z6YA 4M78G 1E6HA 4XTZA 2IVWA 1OI1A 1R0CB 3JSCA 1SG5A 4KULA 4BCQD 3QZ9B 2ZAEA 3GPLA 2UZEB 4RTZA 5HCKA 4KUIA 5CKFA 4GY5A 4XQ3A 2JS2A 4C92A 4L59A 3PTAA 1X2QA 5GAN2 5GANj 4JJNK 2LCCA 3QXEB 2DXTA 2ENMA 1M30A 1QVGP 4E7KA 2DE0X 2YRCA 2CJMB 2L0AA 5IHIA 4C0ZA 2FG0A 3M0SA 5HBHB 5L8RE 1LOJA 5HNBB 2OX7A 3MIAB 4A4KA 4F7SB 2YWWA 4JDSA 1H26B 2UUEB 2F5TX 2PUKB 5DY9A 4FT4A 2KQWA 2A36A 3EFOA 2MCNA 1NLOC 3M56A 2C0IA 4ATOA 1OEBA 3M0TA 2DFUA 2ZZDA 2QEXT 2V1QA 3KFVA 3NFCA 3EJ1B 1SRMA 2IW6B 3GP8A 2WXVB 3DTOA 4ZN1A 2QQRA 3ME9A 2HMAA 3VKGA 4M7AB 5GAN3 3A98A 5FW9A 3TW6A 2DAQA 2LVMA 3POMA 2MK5A 4ZTFA 4E7ZA 1K9AA 4RCCA 3OYYA 1SKUB 4P5NA 2DRMA 4M7DG 3ZEHA 2HQXA 3JCMd 2PUOB 2FYKA 5IAYA 3OW2S 2QAZA 3AHUA 4OGEA 4M6VA 4HXJA 4LDUA 1E9HB 1O75A 4J7FA 1JSUB 1NEBA 3EG9B 3VS1A 3OYJA 3UPUA 2QEXQ 1Y57A 2O9SA 3CCUA 2QDYB 2O4XA 4LE9A 5IHYA 1FKMA 3MHXA 1NPPA 2RM4A 4M7AG 5L2WB 4PJJA 5L23A 1IB8A 1KD1U 2XKOC 2MMPA 3ZBDA 4E7SA 1UE9A 1S1NA 2IG0A 2K4YA 1G2BA 1WHJA 1I8FA 2FPFA 4ELLA 1QCNA 4RODA 2MF2A 3CC2A 4AKGA 1HD3A 1KXUA 2V8JA 2DXBA 4NC6A 4QQGA 2R7GA 4BCQB 4IUVA 2YUQA 5HKCA 3VYHB 3X20B 1D0XA 2CUBA 1YNZA 1RAEB 3AT1B 2HBWA 3OYKA 4IKFA 3M58A 2ESWA 2L3SA 2RQRA 3T9NA 2BE7D 1Q95G 2R57A 4D8KA 2GNCA 3LW5E 1UFFA 3M57A 2EYWA 2BZ8A 2LJ3A 4QW2A 1OGUB 1S72T 5HQ0B 3D7SB 1AWOA 1NZ9A 1I0CA 2EPDA 5GAN4 1ZSZC 3EHRA 1M27C 3FB9A 4PJOB 3SB2A 2A08A 2VWFA 1JRIA 2EQMA 2BKZB 2PVDB 3CD6A 4FM4B 3CPFA 2FEIA 4DEXA 2EUFA 4LN2A 4KRDB 2KMTA 4YTLA 1CSKA 2X3XD 2WSFE 5KYYA 2CZ0B 3OYMA 4ELZC 1SEMA 3RKYA 4EOQB 1WA7A 4Z88A 5GAN7 4A4GA 1K73R 4F70B 3GTMS 5GMKl 4C8QE 1S72Q 1H1PB 3CCMT 2CYZB 4M77C 1S72A 5LJ5d 3FIFA 4BCKB 1ZX6A 2LCSA 1U1TA 2PHGA 2G3RA 1PNJA 2E5QA 1VQKT 4JRKA 2Y4YA 2DTIA 1WQWA 3QJYA 5I5ZB 2LNVA 5I11A 2KY9A 1K73U 5KCOA 4HCKA 3QHWB 1PD1A 5CKHA 2HD0A 2RK1A 4OMFB 5LJ3h 1AOJA 3X25B 2LW4A 1VUBA 3GBQA 3S6WA 4J9BA 3CCMQ 2D6FA 1O9KB 1WJRA 2W9ZA 1K4US 3CCMA 1OKWB 4R55A 3LLRA 2KRNA 1VQKQ 1AWWA 4HNTA 1NYGA 4RKUE 5D7UA 2HNIA 1YJWT 5GMKm 3H6ZA 2R5AA 3G33B 1KFZA 2LCLA 1WDXA 5LJ3g 2KRMA 4A54A 1H8KA 2VXFA 3HO8A 2KBTA 2K57A 1VQ5A 3BDUA 3SEMA 4A4FA 2GTJA 1ZSZA 2L3PA 2DYBA 4M77F 3CPWA 1HSQA 3UA6A 5CKEA 4E7HA 1F5QB 2IIMA 4ZTJA 1M8VA 1KQSS 4F7UF 4NSTB 1W6XA 1G3WA 2COWA 3EG0A 5CEIB 1KHCA 2KEAA 2M0YA 2YXYA 4HVUA 1OIYB 1JOWA 1YJWQ 1TFBA 2DIGA 2L5QA 1X43A 1OL2B 3M5AA 1JQQA 4GLMA 5GAOq 3J7AF 3LGLA 2OTJA 2J06A 5D6XA 3MEAA 3CPWP 4IMYB 4F16A 1Y0MA 1IXDA 1UDLA 3CCLA 2I0NA 4CC2A 1NBEB 4M77A 3RBBB 3QJ6A 2LC4A 1Q81R 4F7UA 3TNWB 3OYAA 2JNGA 5GANg 2DL7A 4D8DA 4KUDK 2LX9A 1X27A 1RLQC 4M78C 2AT1B 5GAN6 4UN0A 2CDTA 1VQOA 1YJNT 2M0OA 1BCMA 2DX1A 1XJWB 1PRLC 2NUPA 4AFZC 3H0FA 2QQBA 1I5LA 4V2SA 2M16A 3I5RA 2F2WA 2YLCA 1ZUKA 2LQKA 3JCMh 2RO0A 2RQVA 2DXCB 2VYTA 2K7AA 4EDUA 2KAFA 1TH7A 3LQ5B 4F6WB 2R58A 3DKMA 3NPFA 4F6UB 4TVRA 1H641 4Y92A 4M4ZA 1RLPC 4C0DB 3O5ZA 3S3NA 2WJ9A 4OGRB 4F17A 1TUGB 2VKNA 5FGKB 2RH2A 3R6OA 3QYBA 1U5SA 2DXUA 2C5VB 1K73C 3B57A 3OYGA 2EKHA 2QI2A 1YJNQ 1FMVA 3EGDA 3JCMg 2FO0A 4J9CA 1ZA2B 2W0ZA 4QKUA 1ZP2A 2B9RA 2BTTA 4PJOE 2QFZA 2XU8A 3OYCA 1SHGA 5IF1B 5ICPB 1N27A 1VINA 1WXTA 2E4HA 3G4ST 2EVRA 4AG2C 1SRLA 3LX7A 1G3TA 1G3SA 2VV5A 2DERA 2ROLA 3OY9A 1C0MA 4M7DC 1C9BA 1D3BA 4M78F 4EMKB 2E3IA 2EBPA 2DEUA 2OJ2A 3VV0A 3TNHB 2E6NA 4CFUB 5KE2A 2ECZA 4BCNB 3FC3A 1YI2T 4C8QD 1W70A 3DDQB 2XG8D 4DA4A 2XHCA 1YBYA 1W2BA 5EG2A 2QXFA 2OTLT 2DTHA 3I56T 4L5GA 2L2PA 1Q7YR 2QTVA 3G4SQ 5GAN8 2UZBB 1T0JA 4BBSM 4AKIA 1AD5A 3PVQA 4FT2A 4CFMB 4DBHA 2F2CA 2MIOA 1AEYA 5FU6C 1EFNA 4FX3B 4M78A 1Y07A 5FROA 1IO6A 1D0ZA 3M0QA 2DPPB 2KNBB 2LQ8A 2LT4A 4OGCA 4J7IA 3VS3A 4OMNA 1W2BP 1KC8R 5FRMA 3SHWA 1YI2Q 2CH4W 3CC7A 5LJ5h 3NTKA 4LDVA 2XDBA 1Q7YU 3L2VA 1ZA1B 1YI2A 1D1CA 1P92A 3G7ZA 1QWFA 3OSSC 4J9IA 1QKWA 3JCMJ 1BCOA 2X51A 4AFQC 3RIRA 3JCMc 2OTLQ 3RMSA 2QQSA 3I56Q 4PJNA 3JCMW 3META 2V8IA 3V8KA 4N0AC 3I56A 4F14A 2K3YA 3OBWA 4QT7A 3FJ5A 1KC8U 3P8BB 1G83A 4JLIA 5GMKe 1TOVA 2ZPGB 1EIFA 4MDXA 2RD1A 2HKQB 4KRCB 1P5EB 2GCXA 5LJ5g 2C0TA 1RAFB 3SWNB 1Q82R 1OV3A 2DD5B 1M3BA 1NM7A 4FYWB 1Q81C 3H8ZA 4EPCA 1MHNA 3HFOA 1LVKA 1QMCA 2EJ9A 2SEMA 1OX8A 1YCSB 2ZPHB 1SSFA 2CP3A 4HCCA 3GIBA 1N4MA 4IIMA 1YITT 4M7AF 5GMKj 4PFZA 2W9FA 4KRTA 1FINB 5IHKA 4MMLA 3EG2A 3EIDB 1K76A 4J6XA 2M1HA 4J9HA 1M1FA 4QQDA 1W4SA 4M7DA 2DVJA 2LJ1A 4IURA 5GAMd 2DL8A 4ZNXA 4PJLA 1WX6A 1QVGS 2FL7A 3M0PA 1Q82U 4LUEA 1RUWA 2Z0WA 2E12A 1WQ7A 2COZA 1UGPB 1GFCA 1NEGA 5IDPB 3TQ7P 3FEOA 4MDWA 3EGXA 4GBQA 2RQUA 4BE2A 1FMWA 4CC7A 1N9SA 3EG1A 2RB6A 4LOCA 3BHUB 3G71T 4BCJB 4M7AA 4JJDA 3EH2A 3OMGA 1JJ2A 3LH0A 1GBQA 1YITQ 5HVYB 1F1BB 1OYXA 2QA4T 4C5HA 3OS5A 4BCFB 1YITA 2LQNA 4FSXA 2JM8A 4BCOB 3JCMV 3UATA 3ZL7C 4C8QG 3QYHB 1MNDA 1B7TA 5CAIA 3S3OA 4J6YA 4J9GA 4RTTA 3A8HB 1JJ2P 1GL5A 1Z9ZA 2GQVA 3JB9J 3KBGA 2FPDA 3G71Q 4EOSB 5GANd 4AT1B 2EGEA 4J6WA 4NL2A 2AKKA 4A53A 3L2QA 1AT1B 3CCQT 4N0AA 5I21A 4HVVA 4M75B 2QA4Q 2PK2A 4FW2A 3VKIA 2QA4A 1FX7A 4ZGEB 3C0CA 4PNOA 4PJOD 4X1VA 4XTWA 3CCST 1Q7YC 4JRQA 1QVFA 1ZQ1A 5HBEB 2LTOA 3RNJA 2JM9A 5FWCA 2E64A 2WIHB 2CCIB 1H3HA 1K1ZA 5EC7A 2B8AA 1D1BA 1R8OB 5KYUB 2DJZA 5CIUA 2DETA 3HL8A 3CCQQ 1FXXA 1VIEA 2RHIA 1V76A 2G77A 4LUDA 3JV3A 2P4TA 1VQMT 4OP0A 3I5SA 3K7AM 8ATCB 1KD1R 1TSFA 5CYIB 3PE0A 3CCQA 2QDLA 2E41A 1HK9A 1QVFP 1H1QB 2JMAA 3I35A 2DD4A 3H4CA 1YWPA 2ROTA 3L42A 1JO8A 2CKKA 3WVEB 3THKA 3G6ET 3UWNA 3OYBA 3JB9H 3CCSQ
chains in the Genus database with same CATH topology
4HNUA 5LJ3h 1M1KU 3ASKA 3X25B 4XU1A 5CO7A 3P8DA 1VUBA 4PL6A 4BDYA 5FU7C 1JJ2S 3S6WA 1KHIA 5GAOm 3HRSA 3C12A 1DJ7B 5GAOn 3CCSA 4C5GA 2QEXA 3GF5A 1YCYA 5HK0A 3V7SA 4LD9K 4L6V5 3RKXA 4HLQA 5GAOp 4PJOC 2RHZA 1K9MC 3S3NA 2XK0A 2K2VA 4FL6A 4BE0A 2D6FA 1G3YA 1WJRA 2CGHA 3CEYA 3M9QA 4FIBA 4II1A 3DLLA 4HT9A 2GFUA 3F70A 3CCMA 4R55A 3CC4A 2E65A 4M75C 3LLRA 2O01E 5LJ3j 5DM7R 4HA8A 3JCMX 1IREB 2BS4A 4HNTA 1Q82C 4IUTA 4HKEA 4RKUE 2XICA 3OB9A 2HNIA 1YJWT 4JUVA 4XU3A 1XNIA 1Y7XA 4BI4A 2GF7A 4M77B 5GMKm 3CCEA 2QTXA 1N6AA 3H6ZA 1BI0A 2R5AA 1IZ6A 1VQMA 2LCLA 3RKWA 1NPRA 3MP8A 2WSEE 4A54A 5LJ3g 1LNXA 3INZA 3S3MA 3DLMA 2VXFA 3HRUA 3GNGA 3HO8A 3QUIA 3CMAA 2K57A 3PGGA 3A8LB 1VQ5A 3BDUA 4A4FA 4C92D 3A8MB 2F5KA 4M78D 2DEQA 3GNFB 3JCMb 3G6EA 3C4SA 3UDCA 4EMHA 5HY6A 3CC7T 2E1HA 3EFRA 4XU2A 4M77F 3CPWA 2X35A 3CBOA 4DA4A 5A0DA 3SDZA 2ZCFB 2LRQA 5CKEA 4E7HA 4E7JA 1M8VA 5M9OA 4ZTJA 1NJIC 3MEUA 1KQSS 1I5LA 3HFNA 3EFSA 4F7UF 4J5YA 1G3WA 4BD3A 1ZBXA 4OB1B 2E10A 1KHCA 2BUDA 5LJ3f 3OYLA 3QYEA 1N8RU 4OVAA 1WJSA 2DZ9A 1QVFS 4BI3A 2RJFA 3CCRT 2DIGA 1UGSB 1LJOA 2L5QA 4M77G 4PLLA 2FB7A 3QO3A 5I2MA 2MAMA 3M5AA 3MO8A 3MP1A 2R5MA 5GAOq 2RJCA 2OTLA 1WNLA 4C0DC 3J7AF 3WVDB 2EWNA 3LGLA 4F7UG 2OTJA 4HCZA 3G71A 3X26B 1V29B 2RJDA 3QHSA 4JLGA 1BI2A 5KCHA 3M4GA 3PIPA 1VQPA 1K8AU 5D6XA 3MEAA 4PKCC 1I81A 4Q5WA 4JX5A 4AKHA 2RHUA 3OS1A 4ELJA 3OYHA 2LDMA 4C0FA 3CCLA 1QVPA 2JOYA 2DKGA 1OZ3A 4M77A 4BBRM 1M1GA 1U1SA 5CVIA 4RMOA 2H3JA 2EIFA 1X75C 3QJ6A 5GMKi 4ZN3A 2LC4A 4F7UA 2L8DA 4PJOF 3QYGB 3OYAA 4OB3B 5A2QE 5DLQE 2MWOA 4JX6A 2JNGA 3CXCA 5GANg 4KUDK 4X9CA 3CMET 3JAME 2LX9A 3L2ZA 2QDJA 4C92C 3OA6A 4M7DB 4M78C 4M75F 2C06A 3BFMA 5GAN6 3VYGB 3BG9A 1XOVA 2AHJB 4RCBA 3JB9H 2O4XB 1B34B 3FDRA 1VQOA 1YJNT 1GXIE 1O9SA 4J8OA 4MFEA 2M0OA 4N4IA 2XDDA 2QQBA 1M90C 1G5VA 3L2RA 5IT9E 4N4HA 3TEEA 3JCMe 2M16A 4PJOG 5C6SA 3MCAB 5J3BA 4V2SA 4QQ6A 1Y96B 2YLCA 4XTXA 3RESA 3CCUT 2WACA 5HK3A 2LT1A 4M77E 4C5EA 4QVCA 2LQKA 3VKHA 3JCMh 2RO0A 4IUPA 4RG2A 1KC8C 4R56A 4X34A 5CQYA 3CCRA 3QG1A 2DXCB 2VYTA 4EDUA 3TU4K 2KAFA 1TH7A 2VGMA 4M75G 4F7UE 3M59A 2R58A 4M7DD 3DKMA 1YJ9T 2OAUA 2P0KA 3GLXA 1M4ZA 4M7DF 1HXDA 1KQ1A 4EMKC 4DQ2A 2PVOB 3QIIA 4TVRA 1H641 5GAMe 2DXBB 2L3RA 3C95A 4IUUA 1X01A 4PJOA 1OZ2A 3M53A 3E9FA 3E1SA 5GAMh 4C0DB 3LWHA 2KMGA 3TW7A 1RI0A 1XTDA 2WJ9A 2CZ1B 3M54A 4CI0C 1NE8A 5CR2A 5KE3A 2K5LA 2QQ9A 2WSCE 3RMQA 3ER0A 5A0GA 4KBMB 2RH2A 4M75A 3R6OA 5KH6A 3CCVT 3HBLA 3QYBA 2DXUA 2EKOA 4MZMA 5FU6B 3OQ5A 3VU3C 4HT8A 1K73C 2RK2A 3I55A 3JCMQ 4AI6A 3OYGA 2FHDA 4MMKA 2QI2A 4OMFB 1VQ9T 2PQWA 2JUFA 4M7AD 3JCMg 2EQKA 2X4XA 5GAMj 2XDPA 5CK9A 4JX4A 3DL1A 1KQ2A 4PJOE 2K5FA 5DLOA 2QFZA 2XU8A 3OYCA 2YHTA 4C92B 3CPWS 4M78B 1N27A 3VYGA 3X28B 4LD6A 5CQXA 1E7PA 4WF2A 1BYMA 4JS4A 1B34A 1QLBA 4M75E 3RERA 1VQKA 3O8VA 5LJ3d 5GAMg 3J81E 4XTYA 2BIVA 3G4ST 4BACA 1KD1C 5D6WA 3LX7A 1G3TA 4Z02A 1G3SA 1PSFA 1VQPT 1VQ7T 1Y96A 3BW1A 2VV5A 3UT1A 4HNVA 4C8QB 1JB0E 3A8OB 3OSVA 3VUZA 4HL4A 2RHYA 3OY9A 2JTFA 2RHXA 2DXCA 3FJPA 2EQUA 2E6ZA 5J39A 4A4HA 3OW2A 4M7DC 3JCMf 1YHQA 2JZ2A 3KUFA 4XAXB 2XD0A 3CD6T 1D3BA 4C92F 2M9UA 4M78F 4EMKB 3OYEA 2RA2A 1UGQB 3VV0A 2E6NA 3EAEA 3TCJA 3CCVA 1Q86U 2KR6A 2EAYA 4J83A 3FLGA 5KE2A 4JRIA 4MIMA 1X6OA 1WJQA 3VUBA 3FC3A 1YI2T 1FWZA 4JRPA 3HRTA 3V8LA 4C8QD 4X9DA 5GANe 1VQ9A 1QVGA 4OB2B 2MWPA 2XG8D 3HPWA 2ZPEB 2ZZDB 1N9RA 1YBYA 2XHCA 1M5Q1 2I2LA 5AYFA 2RI5A 3VJPA 1MGQA 5GAMf 1W2BA 4BY6B 2EJGA 5EG2A 5GANh 2MI6A 4C92G 2QXFA 5FLXE 4Z6YA 4M78G 1VQ4T 4XTZA 2IVWA 1OI1A 3HP9A 3CXCS 4XTUA 2DTHA 2EYQA 2OTLT 3JSCA 3I56T 3JB9I 3CC2T 4L5GA 4DOWA 4ZGDB 2JN0A 5A0LA 4NL3A 3HZJA 4KULA 5GAN8 3QZ9B 3PFSA 4BUGA 3GPLA 4KUIA 4D6WA 1YJWA 4BBSM 4AKIA 4FT2A 5CKFA 4JS5A 4IUQA 4NS5A 4GY5A 2K3XA 3LYIA 2RI3A 4C5IA 4XQ3A 4C92A 3PT9A 4L59A 4M78A 5FU6C 3SD4A 3PTAA 4E7LA 2X4WA 5GAN2 1Y07A 5FROA 5GANj 2PVGB 4Y91A 4BI8B 4JJNK 2LCCA 3QXEB 2DXTA 2QQAA 3QKJA 2DPPB 4E47A 4E7KA 2LQ8A 2LT4A 4OGCA 2DD4B 4J7IA 4C0ZA 1VQ8T 5FRMA 5L8RE 1LOJA 2D9TA 5LJ5e 3QDRB 4LDWA 3JB9D 3QZ5B 3CC7A 3NTHA 3BG5A 4OF1A 4BDZA 5LJ5h 4A4KA 3NTKA 4LDVA 2XDBA 2BS3A 1Q7YU 2VUBA 3QBYA 4JDSA 3L2VA 1YI2A 1P92A 3NTIA 3G7ZA 3OSSC 4EMKA 1VQ6T 3JCMJ 2F5TX 3RIRA 4PLIA 2PUKB 4C92E 2RI2A 4M78E 3RMSA 2QQSA 5DY9A 3JCMc 2DIQA 4FU6A 2KQWA 4FT4A 3X24B 3JCMW 4QVDA 1BIAA 3M56A 2HBPA 3META 2V8IA 4ATOA 4MZTA 4XU0A 3E19A 3N5BB 3V8KA 3V7CA 4C8QC 4N0AC 4XK8E 2KSSA 4ELYC 2ZZDA 3I56A 2QEXT 2K3YA 3CD6A 3PMIA 4O5VA 1VQLT 5LJ5j 3OBWA 2Y90A 3NFCA 3LWIA 1KC8U 3GP8A 3P8BB 1H3ZA 2CZ6B 4JLIA 1VQ7A 5CCAA 3JRZA 4ZN1A 2VC8A 2QQRA 3ME9A 5GMKe 5GANf 2ZPGB 1EIFA 3M4YA 3VKGA 4M7AB 3HSBA 2RD1A 3BG3A 3CC4T 4MDXA 5GAN3 2X4JA 5GMKh 2XIDA 3TW6A 2DAQA 2GCXA 2LVMA 4ZTFA 5LJ5g 2DO3A 3KXTA 3SWNB 2DD5B 4RCCA 4CRIA 3OYYA 1Q81C 4BY6C 1ZHIA 3H8ZA 4MZPA 4P5NA 2DTOA 1MHNA 3HFOA 4EPCA 5GAOr 2EJ9A 2L89A 3ZEHA 1UB4A 2HQXA 3MEWA 5D6YA 3HKSA 3P8HA 3JCMd 2PUOB 4B9XA 2ZPHB 3CMEA 1SSFA 4A4EA 4HCCA 3GIBA 2FYKA 5IAYA 3OW2S 2JVVA 3AHUA 4OGEA 1YITT 4M6VA 3OYIA 4LDUA 1M1KC 5GMKj 1VQ5T 4M7AF 1O75A 1YJNA 2HQEA 1VQ6A 2EQJA 2YLBA 4J7FA 4DOVA 1VIFA 4MMLA 1K9MU 1QP3A 2RJEA 4J6XA 3OYJA 2M1HA 3UPUA 1M1FA 4QQDA 1W4SA 4E7IA 3HB9A 2FVUA 4M7DA 3BY7A 4M7DG 1M9SA 4IURA 3MP6A 3CCUA 5GAMd 2QDYB 2O4XA 3C94A 5C0MA 2KVQG 5LJ5f 1QVGS 2DK3A 1FKMA 2FL7A 1Q82U 3MHXA 4EMGA 1W2BS 1NPPA 2RM4A 1VQLA 4M7AG 1YJ9A 2E12A 2EJFA 1WGSA 3RUXA 3QSUA 2VXEA 1WQ7A 1UGPB 2KDSA 1KD1U 2XKOC 2MMPA 1YIJT 3ZBDA 3FEOA 4QVZA 3TREA 2K4YA 2YRVA 2IG0A 3M55A 4MDWA 5I2SA 1I8FA 2X4YA 1QW1A 3JCMP 2MF2A 3MEVA 4BE2A 1N9SA 3CC2A 2ZPBB 4AKGA 2RB6A 4LDYA 5GAN5 4HCBA 3KHIA 2V8JA 2DXBA 4LOCA 4NC6A 3G71T 4M7DE 2OTJT 5CKBA 4M7AA 3Q1JA 4QQGA 4IUVA 3OMGA 3PNWC 2DZCA 1JJ2A 3LH0A 4Y28E 4BB7A 5HKCA 3VYHB 2ZPIB 2V8KA 4F7UB 3X20B 3SWNA 3CCLT 3L2UA 2DD5A 5LL6S 1OYXA 2A7YA 4C8QF 4C5HA 2QA4T 4XTVA 3OYKA 4IKFA 1VQNT 4ME7A 3BDLA 3OS5A 3M58A 1YITA 5J26A 3CCJT 1NJIU 2BKDN 3CBMA 1Q86C 1BKBA 2D0QB 3T9NA 3E9GA 4FSXA 3ZFJA 2ZGWA 3LGFA 2R57A 4M7AC 4M77D 2P0PA 3PIOA 3OS2A 3JCMV 3QPHA 3LW5E 2CZ7B 4C0GA 3M57A 3OYDA 3L1AA 4C8QG 3SWNC 4M7AE 3G4SA 3QYHB 3GOXA 1VQOT 4QW2A 1N8RC 4ZGJB 5CAIA 3S3OA 1S72T 4OB0B 5IN1A 3A8GB 4J6YA 5FU7B 3A8HB 1NZ9A 2QF7A 2QQ8A 1YIJA 2GQVA 5GAN4 3JB9J 5EJCA 2A3LA 3KBGA 2NLUA 3FB9A 1K8AC 3SB2A 5GANd 4PJOB 4J6WA 1JRIA 2EQMA 2PVDB 3OBYA 1UGRB 4FM4B 3DB3A 4NL2A 3CPFA 4A53A 4C8QA 3L2QA 4GLKA 4N0AA 5GAOl 2VGNA 3CCQT 4B9WA 5I21A 4LDXA 3JB9F 1RL2A 3A5ZB 2KMTA 4M75B 4YTLA 3SFMA 3V7RA 3QWLA 2KK4A 4BE1A 1PSEA 1BI1A 3VKIA 2WSFE 4O6JA 1BI3A 1KQSA 2QA4A 1FX7A 2HAXA 1VQNA 2CZ0B 1KG1A 3OYMA 4ZGEB 4ELZC 1QP2A 3HHTB 3RKYA 1JBMA 3URGA 4PNOA 3CCJA 1VQ4A 2ZPFB 4PJOD 4XTWA 3OYNA 3JB9G 1M90U 3I55T 3CCST 5GAN7 4A4GA 1WPYA 4JRQA 1Q7YC 1U8RA 2K5IA 3J80E 1QVFA 1ZQ1A 2LTOA 2E70A 5GMKl 4M75D 4RG8A 4C8QE 5FRNA 1XQHA 1Y71A 4UC4A 2E64A 3PMTA 3CBPA 3CCMT 2CYZB 1BIBA 4M77C 3L2WA 1S72A 5LJ5d 3WXMB 2XI9A 3FIFA 3OYFA 2B8AA 2EFIA 1R8OB 1AHJB 2CS7A 1U1TA 2DJZA 5CIUA 2G3RA 3HL8A 2GFAA 1FXXA 1VIEA 2RHIA 2E5QA 2G77A 2F69A 1VQKT 2JTMA 3OS0A 3CCET 4JRKA 1VQ8A 1UEBA 2P4TA 2PU9B 2Y4YA 1VQMT 2BS2A 3OMCA 4OP0A 2DTIA 1WQWA 3QJYA 3CCQA 2Y4XA 2DVEA 2LNVA 1D3BB 1Q81U 4NOYA 2E41A 1HK9A 2KY9A 1K73U 3V8JA 5KCOA 2DD4A 4MFDA 4QSHA 3H4CA 3CMAT 4N4GA 5CKHA 4VUBA 5LJ3e 3L42A 3DB4A 1YHQT 2HD0A 1I4K1 2P0QA 2CKKA 3WVEB 4KT0E 5CKDA 2RK1A 3G6ET 3UWNA 3OYBA 3FRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X25 B;  4Y28 E;  2PVG B;  3VYH B;  2ZPI B;  1DJ7 B;  3QXE B;  3X20 B;  2DPP B;  2DD5 A;  2DXC B;  4L6V 5;  2DD4 B;  5L8R E;  2D0Q B;  2PVO B;  3QZ5 B;  2DXB B;  2O01 E;  1IRE B;  3LW5 E;  2CZ7 B;  4RKU E;  2CZ1 B;  3QYH B;  2WSC E;  2PUK B;  4ZGJ B;  4OB0 B;  3A8G B;  3X24 B;  3A8H B;  2WSE E;  4XK8 E;  2ZZD A;  3A8L B;  2PVD B;  3A8M B;  1UGR B;  4FM4 B;  2CZ6 B;  2ZPG B;  3VYG A;  2ZCF B;  3X28 B;  1PSE A;  2WSF E;  2DD5 B;  2CZ0 B;  4ZGE B;  4OB1 B;  1QP2 A;  3HHT B;  1PSF A;  2ZPF B;  1JB0 E;  3A8O B;  2PUO B;  2ZPH B;  2DXC A;  1UGS B;  3WVD B;  3X26 B;  1V29 B;  1UGQ B;  2CYZ B;  1QP3 A;  1AHJ B;  2QDY B;  4OB2 B;  2ZPE B;  2ZZD B;  2PU9 B;  3QYG B;  1UGP B;  4OB3 B;  2DD4 A;  4ZGD B;  3QZ9 B;  3VYG B;  2AHJ B;  2ZPB B;  3WVE B;  4KT0 E;  1GXI E;  2DXB A; 
#chains in the Genus database with same CATH topology
 4HNU A;  1M1K U;  1R0B G;  2E5K A;  4XU1 A;  5CO7 A;  5FU7 C;  5GAO n;  3CCS A;  4C5G A;  2QEX A;  3GF5 A;  1YCY A;  3EH1 A;  5HK0 A;  1X69 A;  4RTY A;  4LD9 K;  3RKX A;  2AIR B;  2RHZ A;  2K2V A;  1RAB B;  3CEY A;  3LH5 A;  4II1 A;  4Y72 B;  2O01 E;  2BS4 A;  1Q82 C;  4IUT A;  1VQM Q;  2XIC A;  3OB9 A;  4XU3 A;  1Y7X A;  4KH0 B;  4BI4 A;  4FCY A;  1UJY A;  2KT1 A;  1IZ6 A;  1VQM A;  3CQT A;  3INZ A;  1UNL D;  3S3M A;  3HRU A;  2RPN A;  2O9V A;  2DRK A;  3G6E Q;  2K9G A;  2GTO A;  3PGG A;  1UTI A;  1RAD B;  1K8A R;  3JCM b;  3G6E A;  1IGQ A;  1HJD A;  2SRC A;  3EFR A;  1AD6 A;  3QWX X;  1IRX A;  3SDZ A;  2LRQ A;  1LPL A;  3MEU A;  4J5Y A;  4OB1 B;  1QKX A;  3TN8 B;  5LJ3 f;  2I53 A;  3OYL A;  1N8R U;  4KH1 B;  4PK4 A;  1PC0 A;  1QQJ A;  2RJF A;  3ULR B;  4ROC A;  3QO3 A;  2MAM A;  2WFY B;  2C5X B;  4K11 A;  3MO8 A;  3NDQ A;  4C0D C;  2HSE B;  1WIE A;  1VQ7 T;  1V29 B;  5KCH A;  1OIU B;  1BI2 A;  1K8A U;  1I81 A;  2FZC B;  1RAA B;  4JX5 A;  4F04 B;  2K79 A;  2EGC A;  2LDM A;  4DBF A;  3H9N A;  4EC9 B;  1U1S A;  4RMO A;  1X75 C;  4ZN3 A;  3QYG B;  2MWO A;  5BNJ B;  3CXC A;  4FSS A;  3CME T;  3L2Z A;  1W1F A;  2C06 A;  3BFM A;  3VYG B;  3BG9 A;  2AHJ B;  4RCB A;  2O4X B;  2XDD A;  1YN8 A;  2YDL A;  3DOG B;  1G5V A;  4N4H A;  4PJO G;  3RES A;  4C5E A;  2HL5 C;  4R56 A;  1VQ7 Q;  3TU4 K;  2YT6 A;  3EGU A;  1OUL A;  2VGM A;  3M59 A;  1YJ9 T;  2OAU A;  2P0K A;  1HXD A;  4FYV B;  1KQ1 A;  4EMK C;  2PVO B;  3CXC P;  2DXB B;  2L3R A;  3M0U A;  2WEV B;  4WTO B;  3C95 A;  4IUU A;  2V22 B;  3E1S A;  5GAM h;  2X9H A;  2F2V A;  1RI0 A;  1XTD A;  5CR2 A;  1AZE A;  4CI0 C;  1EZZ B;  2WSC E;  5A0G A;  2DF6 A;  4KBM B;  1ZBJ A;  2NYS A;  4MZM A;  3CME Q;  3BLR B;  3OQ5 A;  3JCM Q;  4AI6 A;  1QLY A;  4MMK A;  2IW8 B;  1VQ9 T;  3BLQ B;  1M2O A;  4YOZ A;  2JUF A;  2C5N B;  3DL1 A;  1GY3 B;  2K5F A;  5DLO A;  1TU0 B;  1Q86 R;  1T3S A;  4WCI A;  3CPW S;  1H4L D;  2D8J A;  1E7P A;  1YJ9 Q;  4M75 E;  1VQK A;  3O8V A;  5GAM g;  3J81 E;  4XTY A;  1KD1 C;  4BAC A;  1VQP T;  3UT1 A;  3OSV A;  3A8O B;  3UA7 A;  4HL4 A;  2OAW A;  2RHX A;  2DXC A;  3FJP A;  2E6Z A;  2W96 A;  1RAC B;  4A4H A;  3JCM f;  4XAX B;  2M9U A;  1WHK A;  3OYE A;  1SPK A;  4CFV B;  1VQ9 Q;  1Q86 U;  4RTX A;  2QGS A;  2C0O A;  4J83 A;  4A63 B;  2BPM B;  1X6O A;  1WJQ A;  1FWZ A;  4X9D A;  1VQ9 A;  1IHV A;  1N9R A;  2XD0 A;  3VJP A;  2RI5 A;  2W10 A;  1ABO A;  1PKT A;  5ACB A;  5GAN h;  1VQ4 T;  1WHM A;  3UF4 A;  2EYQ A;  3VRY A;  4DOW A;  4ZGD B;  2A0F B;  1W98 B;  5A0L A;  4NL3 A;  4CFU D;  3HZJ A;  1PRM C;  2UZL B;  4YOS A;  3VS7 A;  4BUG A;  4BCN D;  1VQP Q;  3VS0 A;  4D6W A;  1YJW A;  2NUZ A;  4E2F B;  4NS5 A;  3VS6 A;  3LYI A;  4C5I A;  3PT9 A;  1VQP A;  2HDA A;  2X4W A;  1GUX A;  1MMN A;  4Y91 A;  4BI8 B;  2IW9 B;  3VRZ A;  2QQA A;  1TG0 A;  3QKJ A;  5IXB A;  1IHW A;  1VQ8 T;  2GQI A;  2DBM A;  3QDR B;  4LDW A;  3JB9 D;  4IIO A;  1D3U B;  3QZ5 B;  1C6V X;  3NTH A;  3BG5 A;  2CP2 A;  2BS3 A;  1WXU A;  3EHQ A;  1VA7 A;  4CC4 B;  1GFD A;  1SF9 A;  4EMK A;  1VQ4 Q;  4F7L B;  4PLI A;  4C92 E;  5KYX A;  2DIQ A;  4FU6 A;  3X24 B;  2O88 A;  4QVD A;  1A0N B;  1BK2 A;  4MZT A;  4C8Q C;  1AWJ A;  3V7C A;  4XK8 E;  2JT4 A;  2WMB B;  7AT1 B;  1AZG B;  2LMJ A;  3PMI A;  1T0H A;  1X2K A;  1OI9 B;  1VQL T;  2Y90 A;  5AT1 B;  1H3Z A;  1RAG B;  1K9M R;  3E2U A;  5CCA A;  2VC8 A;  1RI9 A;  4HVW A;  2QYZ A;  3CC4 T;  3BG3 A;  2X4J A;  1TS9 A;  4BCM B;  1VQ8 Q;  5EFQ B;  1JKW A;  3KXT A;  4ESR A;  2OI3 A;  2J05 A;  4BY6 C;  5GAO r;  1OPK A;  1PG5 B;  5FWB A;  2L89 A;  1UB4 A;  3MEW A;  2J6F A;  3HKS A;  3P8H A;  4EOK B;  1E6G A;  1ZSZ B;  1WLP B;  1GRI A;  3OYI A;  2W99 A;  1YJN A;  2HQE A;  2EQJ A;  2YLB A;  4DOV A;  2QGF B;  1K9M U;  1QP3 A;  2DL4 A;  2J7I A;  4E7I A;  3BY7 A;  1M9S A;  1VQL Q;  1ZLM A;  5LJ5 f;  2KVQ G;  3NMZ C;  2EW3 A;  2HZY A;  1RAI B;  4EMG A;  1W2B S;  1NJI R;  1VQL A;  3CC4 Q;  3RUX A;  1WGS A;  3QSU A;  2VXE A;  2KDS A;  1YIJ T;  2P4R A;  3RGF B;  2YRV A;  3M55 A;  4LXC A;  1UGV A;  1QW1 A;  2NUT A;  2ZPB B;  4HCB A;  4LDY A;  5GAN 5;  3KHI A;  4PFP A;  5CKB A;  5KYN A;  4DBQ A;  2DZC A;  4Y28 E;  4BB7 A;  2ZPI B;  4PJM A;  4F7U B;  3SWN A;  2DD5 A;  5LL6 S;  4C8Q F;  1VQN T;  4ME7 A;  3BDL A;  1NJI U;  2H8H A;  2BKD N;  1Q86 C;  3MJX A;  1BKB A;  2D0Q B;  3E9G A;  4BXX X;  1H28 B;  4BY7 X;  1QWE A;  4M7A C;  2NUP B;  1QCO A;  3OS2 A;  3REB B;  4RTU A;  3OYD A;  1GCQ C;  3PO3 S;  3G4S A;  3GOX A;  1YIJ Q;  4TTH A;  1M2V B;  3M0R A;  2DIL A;  1VYW B;  5IN1 A;  3A8G B;  1M90 R;  2QF7 A;  2PTK A;  1YIJ A;  1WHL A;  2LX7 A;  2A3L A;  2NLU A;  3HTR A;  2AZS A;  3OBY A;  4C8Q A;  3DB3 A;  2QAS A;  4GLK A;  4LDX A;  2VGN A;  2RN8 A;  2JTE A;  3O0G D;  2X1N B;  1RL2 A;  3A5Z B;  2GBQ A;  1VQN Q;  3SFM A;  3V7R A;  1WHH A;  1URC B;  4RTW A;  4AG1 C;  3QWL A;  3A1P A;  4BE1 A;  4O6J A;  1VQN A;  2XMF A;  3HHT B;  2IPO B;  3JB9 G;  1PKD B;  1M90 U;  3I55 T;  2OTL A;  1U8R A;  1ZSG A;  3J80 E;  2P84 A;  4M75 D;  2HKN A;  1UEC A;  1XQH A;  2CP6 A;  3H0H A;  4UC4 A;  1AIS B;  2J6O A;  3WXM B;  3OYF A;  2JMC A;  2EFI A;  2CS7 A;  1KSW A;  2JTM A;  2WPA B;  3IQL A;  1UEB A;  2BS2 A;  3OMC A;  2JXB A;  2Y4X A;  2DVE A;  1D3B B;  1E7O A;  4MFD A;  3CMA T;  4N4G A;  2O2O A;  5LJ3 e;  3DB4 A;  1YHQ T;  2H3E B;  2P0Q A;  3FRN A;  1OPL A;  5GJV B;  3I55 Q;  3ASK A;  4PL6 A;  1JJ2 S;  2D1X A;  2DMO A;  1DJ7 B;  2DNU A;  4EOM B;  5ECA A;  4HLQ A;  2RNA A;  4PJO C;  1K9M C;  2XK0 A;  2ED0 A;  1G3Y A;  2CGH A;  3M9Q A;  1UNH D;  4FIB A;  1M3A A;  2E65 A;  5LJ3 j;  5DM7 R;  1BB9 A;  2CT3 A;  1BU2 A;  1N6A A;  1BI0 A;  3MPU B;  1CKA A;  2B86 A;  4EOO B;  3CMA Q;  2VB6 A;  1NPR A;  3MP8 A;  3RKW A;  1LNX A;  1N5Z A;  4KGZ B;  1GCQ A;  1YHQ Q;  3BHT B;  2A28 A;  1B07 A;  1VYT A;  3CMA A;  3A8L B;  4OMO A;  1J3T A;  4C92 D;  2DEQ A;  1WXB A;  4CXA B;  4R0K A;  2EYX A;  4EMH A;  2CP5 A;  1ABQ A;  5HY6 A;  1X6G A;  2E1H A;  4J9D A;  3MY1 B;  4XU2 A;  3CBO A;  5A0D A;  2ZCF B;  1MMA A;  5M9O A;  4J9F A;  1NJI C;  3EG9 A;  3EFS A;  2NWM A;  4BD3 A;  1EX4 A;  2E10 A;  1KK7 A;  3QYE A;  4CFW B;  4OVA A;  1WJS A;  1QVF S;  2KYM A;  1D09 B;  2R5M A;  3WVD B;  1MV0 B;  2D8H A;  3VS4 A;  3G71 A;  3X26 B;  2RJD A;  1TXQ A;  3PIP A;  3M4G A;  1PWT A;  2KR3 A;  2RHU A;  4ELJ A;  1H1S B;  4C0F A;  1QVP A;  1PCX A;  2DKG A;  2M02 A;  1YFN A;  1M1G A;  2FZG B;  2KRO A;  5CVI A;  2H3J A;  2EIF A;  5I22 A;  5GMK i;  4PJO F;  1YP5 A;  2AKL A;  4JX6 A;  4X9C A;  8AT1 B;  2ATC B;  1H25 B;  1I07 A;  2QDJ A;  4M7D B;  2DL3 A;  1OU8 A;  1B34 B;  1M1K R;  2F2X A;  4N4I A;  4MFE A;  4YOO A;  2CRE A;  4AFU C;  1M90 C;  3JCM e;  4QQ6 A;  1Y96 B;  4XTX A;  3CCU T;  2WAC A;  5HK3 A;  2LT1 A;  4M77 E;  3RR6 A;  4QVC A;  3M03 A;  1KC8 C;  3QG1 A;  1U06 A;  4M75 G;  1TD6 A;  5DQV A;  3DDP B;  1T3L A;  4F7U E;  3EGX B;  4BCI B;  4EOL B;  1M4Z A;  1I1J A;  5KYW B;  4PFO A;  4DQ2 A;  3QII A;  1M8M A;  1BU1 A;  3R6N A;  4PJO A;  1OZ2 A;  3M53 A;  3LWH A;  2COY A;  2CZ1 B;  3CC2 T;  1NE8 A;  2K5L A;  3RMQ A;  2DYI A;  3H41 A;  3MKD A;  5KH6 A;  3CCV T;  3HBL A;  2EKO A;  5FU6 B;  4HT8 A;  4F6S B;  2RK2 A;  2PJQ A;  2M51 A;  2FHD A;  4EOI B;  2ED1 A;  2PQW A;  4FYY B;  2EQK A;  4I3Z B;  3TSW A;  1WHG A;  2PK9 B;  1G3N C;  2XDP A;  3CCU Q;  1KQ2 A;  1SSH A;  2YHT A;  2DA9 A;  4C92 B;  4JJB A;  3VYG A;  4WF2 A;  1BYM A;  4JS4 A;  1QLB A;  1V1C A;  2I40 B;  5D6W A;  1N8R R;  4HNV A;  3VUZ A;  2CCH B;  3CC2 Q;  2EQU A;  5J39 A;  3OW2 A;  3CCV Q;  3KUF A;  3CD6 T;  1PM3 A;  2RA2 A;  2BZY A;  3EAE A;  3CCV A;  2EAY A;  4FW1 A;  3EFO B;  4JRI A;  3VUB A;  4JRP A;  3G1J A;  2PMI B;  2MWP A;  5AYF A;  2ZPE B;  2ZZD B;  5GAM f;  1M5Q 1;  4JJC A;  5LQF B;  2MI6 A;  4C92 G;  1MV3 A;  2WHB B;  3HP9 A;  3CXC S;  4XTU A;  3JB9 I;  4BY1 X;  2JN0 A;  1B3Q A;  3OW2 P;  3BE3 A;  3PFS A;  1O9K A;  2HL3 A;  4JS5 A;  4IUQ A;  2K3X A;  2RI3 A;  5GJW B;  1PD0 A;  4E7L A;  5IDN B;  2EYY A;  3EG3 A;  3SD4 A;  1UG1 A;  2PVG B;  2QGG A;  3CD6 Q;  4E47 A;  1JEG A;  2EQI A;  2DD4 B;  2IVX A;  2D9T A;  5LJ5 e;  4Z8A A;  4OF1 A;  4BDZ A;  2VUB A;  3QBY A;  3NTI A;  1VQ6 T;  1JXO A;  2FRY A;  2RI2 A;  4M78 E;  4KGV B;  2KRS A;  1BIA A;  2HBP A;  4XU0 A;  3E19 A;  3N5B B;  1PHT A;  2KSS A;  4ELY C;  3I9Q A;  3H0I A;  4O5V A;  3DJB A;  2LNH B;  5LJ5 j;  3LWI A;  2CZ6 B;  1VQ7 A;  3JRZ A;  1Z9Q A;  2LZ6 B;  5GAN f;  3M4Y A;  4BCP B;  3HSB A;  5GMK h;  2C5O B;  2XID A;  1BBZ A;  2AZV A;  2X3W D;  2DO3 A;  2CH4 A;  1K0X A;  4CRI A;  2DME A;  1ZHI A;  4MZP A;  2DTO A;  2CSQ A;  5D6Y A;  1JU5 C;  4B9X A;  2YSQ A;  1CKB A;  1VQ6 Q;  3CME A;  1H27 B;  4A4E A;  2BZX A;  2JVV A;  4OMM A;  2WMA B;  2F1L A;  1TWB A;  1M1K C;  1VQ5 T;  4BCM D;  1VOM A;  2V1R A;  4JZ4 A;  1VQ6 A;  5DQW A;  1VIF A;  2KGT A;  2RJE A;  3NHN A;  3HB9 A;  2FVU A;  4II5 B;  3MP6 A;  2MOX A;  1HYO A;  3C94 A;  5C0M A;  4CC3 A;  2DK3 A;  2RMO A;  2YUO A;  1TUD A;  1YJ9 A;  1OOT A;  2EJF A;  1GBR A;  2HEQ A;  4G6L B;  2RQT A;  4QVZ A;  3TRE A;  5I2S A;  2X4Y A;  3JCM P;  3MEV A;  2O31 A;  2OTJ T;  4M7D E;  5KYY B;  4EIK A;  1LCK A;  3Q1J A;  4EON B;  3PNW C;  1JXM A;  3VS5 A;  2WIP B;  2V8K A;  2KXD A;  5IXF A;  1VQ5 Q;  1NLP C;  2A37 A;  1UUE A;  2JGZ B;  3CCL T;  3L2U A;  1AVZ C;  1OQK A;  2A7Y A;  4XTV A;  2HSP A;  4OMP A;  5J26 A;  3CCJ T;  3CBM A;  1VYU A;  3ZFJ A;  2PNI A;  1U3O A;  2ZGW A;  3LGF A;  4M77 D;  2P0P A;  3PIO A;  2EYZ A;  4JPB W;  1FMK A;  3QPH A;  2CZ7 B;  4C0G A;  3L1A A;  3SWN C;  4M7A E;  1D1A A;  2DJQ A;  2W2H A;  1VQO T;  1N8R C;  4ZGJ B;  4OB0 B;  4CRL B;  5FU7 B;  4YC3 B;  1UNG D;  4KGX B;  2QQ8 A;  5EJC A;  2OTJ Q;  2G9X B;  4FYX B;  1K8A C;  1UGR B;  1QCF A;  2GGR A;  1WFW A;  4B9W A;  5GAO l;  3JB9 F;  3CCL Q;  2FZK B;  4ROE A;  1TTH B;  3TVT A;  4EC8 B;  2IN3 A;  2KK4 A;  3CCJ Q;  1PSE A;  1BI1 A;  4E6R A;  4J9E A;  5HBJ B;  2KI7 A;  1BI3 A;  1KQS A;  2HAX A;  1KG1 A;  1UJ0 A;  1WI7 A;  5IH2 A;  1K0S A;  1QP2 A;  1JBM A;  3URG A;  3CCJ A;  1VQ4 A;  2ZPF B;  2FRW A;  3OYN A;  2YUP A;  1GCP A;  1WPY A;  2K5I A;  2HQH A;  2E70 A;  2MYS A;  1VQO Q;  4RG8 A;  1FVV B;  4EOR B;  1Y71 A;  4DBR A;  1M3C A;  3PMT A;  2L3Q A;  3CBP A;  1H92 A;  1BIB A;  3L2W A;  2XI9 A;  2CUD A;  1OU9 A;  1AHJ B;  2G6F X;  1PKS A;  2GFA A;  1KQS P;  2F69 A;  1ENW A;  3CCE T;  3OS0 A;  2D0N A;  1M2V A;  1VQ8 A;  2PU9 B;  3BLH B;  3BHV B;  1TUC A;  2DL5 A;  1Q81 U;  4NOY A;  2HCK A;  3V8J A;  4QSH A;  1I5O B;  4VUB A;  1I4K 1;  1IGU A;  4KT0 E;  5CKD A;  3PVL A;  3F70 A;  5FRN A;  1NYF A;  4HKE A;  3QHR B;  3P8D A;  4BDY A;  1KHI A;  5GAO m;  3HRS A;  3C12 A;  4EOP B;  4B6M A;  3V7S A;  4L6V 5;  5GAO p;  2EGA A;  2RQW A;  4FL6 A;  4BE0 A;  2C6T B;  2KE9 A;  4HT9 A;  3DLL A;  2GFU A;  3CC4 A;  1OX9 A;  2VVK A;  1C1A A;  4M75 C;  3CCE Q;  4HA8 A;  3JCM X;  1IRE B;  3F5X B;  6AT1 B;  3MY5 B;  1GUX B;  4JUV A;  1XNI A;  2GF7 A;  4M77 B;  3CCE A;  2QTX A;  2C4G B;  2JW4 A;  2E3H A;  9ATC B;  5IHN A;  2PZ1 A;  2WSE E;  1ZUY A;  1KJW A;  3DLM A;  4RUG A;  1YWO A;  2YRD A;  1SHF A;  3GNG A;  3QUI A;  2DLP A;  4JZ3 A;  3A8M B;  2F5K A;  2LP5 A;  4M78 D;  3GNF B;  4BCG B;  1D0Y A;  3C4S A;  2K3B A;  2RF0 A;  3UDC A;  4BCH B;  3U23 A;  3CC7 T;  5KYX B;  2X35 A;  2BE9 B;  4F7N B;  4E7J A;  1UHC A;  3HFN A;  4DEY A;  1ZBX A;  2LJ0 A;  2QG9 B;  2BUD A;  4LNP A;  1NG2 A;  2DZ9 A;  1OKV B;  4BI3 A;  2J6K A;  3CCR T;  5I2M A;  1UGS B;  1LJO A;  4M77 G;  4PLL A;  2FB7 A;  4OR5 B;  1GH6 B;  3MP1 A;  2RJC A;  1WNL A;  5LMK B;  2EWN A;  4F7U G;  4HCZ A;  3QHS A;  4JLG A;  2KT8 A;  4PKC C;  4Q5W A;  4OMQ A;  2CT4 A;  4AKH A;  1MUZ A;  4ANJ A;  3OS1 A;  3OYH A;  3VS2 A;  2JOY A;  1OZ3 A;  4BBR M;  1H24 B;  2CP0 A;  2KXC A;  3EGD B;  3CC7 Q;  2ABL A;  3EOC B;  2L8D A;  1FYN A;  4OB3 B;  5A2Q E;  2LQW A;  5DLQ E;  2FPE A;  1RAH B;  1WYX A;  3JAM E;  1OL1 B;  4C92 C;  3OA6 A;  4M75 F;  1XOV A;  3FDR A;  1GXI E;  1O9S A;  4J8O A;  1G8X A;  3L2R A;  5IT9 E;  3TEE A;  3CCR Q;  5C6S A;  3MCA B;  5J3B A;  1ACM B;  3VKH A;  1ZUU A;  4RG2 A;  4IUP A;  1ARK A;  2V26 A;  4X34 A;  5CQY A;  3CCR A;  1KIK A;  4CFN B;  4Z89 A;  4OML A;  3QDF A;  1XO2 A;  4AMC A;  4RTV A;  1MMD A;  2NUT B;  4M7D D;  1QMZ B;  3GLX A;  4M7D F;  2JS0 A;  5GAM e;  2YUN A;  1X01 A;  3E9F A;  2KMG A;  3TW7 A;  3M54 A;  5KE3 A;  2QQ9 A;  3ER0 A;  4M75 A;  1VOL A;  3TSZ A;  3VU3 C;  3I55 A;  2K6D A;  2QK0 A;  2DM1 A;  4M7A D;  3MI9 B;  1UHF A;  4CFX B;  1JST B;  3REA B;  2UZD B;  2X4X A;  4AFS C;  5GAM j;  5CK9 A;  4JX4 A;  1AWX A;  4M78 B;  3QWY A;  2MPX C;  3X28 B;  4ORZ A;  4LD6 A;  5CQX A;  1B34 A;  3RER A;  1MMG A;  1VYV A;  5LJ3 d;  2BIV A;  1MNE A;  3TNI B;  5KYU A;  4Z02 A;  1PSF A;  1Y96 A;  3BW1 A;  4C8Q B;  1JB0 E;  2VAS A;  2RHY A;  2JTF A;  1H1R B;  2CSI A;  2KYB A;  1YHQ A;  2JZ2 A;  4EOJ B;  4C92 F;  2JJ9 A;  5KYW A;  2DBK A;  1WZO A;  2K2M A;  1UGQ B;  3TCJ A;  2KR6 A;  3FLG A;  4MIM A;  2CP7 A;  3HRT A;  3V8L A;  5GAN e;  2AK5 A;  1QVG A;  4OB2 B;  4F7J B;  3HPW A;  1R77 A;  1X6B A;  2I2L A;  1MGQ A;  3RDV A;  2EJG A;  4BY6 B;  3NGP A;  5FLX E;  4Z6Y A;  4M78 G;  1E6H A;  4XTZ A;  2IVW A;  1OI1 A;  1R0C B;  3JSC A;  1SG5 A;  4KUL A;  4BCQ D;  3QZ9 B;  2ZAE A;  3GPL A;  2UZE B;  4RTZ A;  5HCK A;  4KUI A;  5CKF A;  4GY5 A;  4XQ3 A;  2JS2 A;  4C92 A;  4L59 A;  3PTA A;  1X2Q A;  5GAN 2;  5GAN j;  4JJN K;  2LCC A;  3QXE B;  2DXT A;  2ENM A;  1M30 A;  1QVG P;  4E7K A;  2DE0 X;  2YRC A;  2CJM B;  2L0A A;  5IHI A;  4C0Z A;  2FG0 A;  3M0S A;  5HBH B;  5L8R E;  1LOJ A;  5HNB B;  2OX7 A;  3MIA B;  4A4K A;  4F7S B;  2YWW A;  4JDS A;  1H26 B;  2UUE B;  2F5T X;  2PUK B;  5DY9 A;  4FT4 A;  2KQW A;  2A36 A;  3EFO A;  2MCN A;  1NLO C;  3M56 A;  2C0I A;  4ATO A;  1OEB A;  3M0T A;  2DFU A;  2ZZD A;  2QEX T;  2V1Q A;  3KFV A;  3NFC A;  3EJ1 B;  1SRM A;  2IW6 B;  3GP8 A;  2WXV B;  3DTO A;  4ZN1 A;  2QQR A;  3ME9 A;  2HMA A;  3VKG A;  4M7A B;  5GAN 3;  3A98 A;  5FW9 A;  3TW6 A;  2DAQ A;  2LVM A;  3POM A;  2MK5 A;  4ZTF A;  4E7Z A;  1K9A A;  4RCC A;  3OYY A;  1SKU B;  4P5N A;  2DRM A;  4M7D G;  3ZEH A;  2HQX A;  3JCM d;  2PUO B;  2FYK A;  5IAY A;  3OW2 S;  2QAZ A;  3AHU A;  4OGE A;  4M6V A;  4HXJ A;  4LDU A;  1E9H B;  1O75 A;  4J7F A;  1JSU B;  1NEB A;  3EG9 B;  3VS1 A;  3OYJ A;  3UPU A;  2QEX Q;  1Y57 A;  2O9S A;  3CCU A;  2QDY B;  2O4X A;  4LE9 A;  5IHY A;  1FKM A;  3MHX A;  1NPP A;  2RM4 A;  4M7A G;  5L2W B;  4PJJ A;  5L23 A;  1IB8 A;  1KD1 U;  2XKO C;  2MMP A;  3ZBD A;  4E7S A;  1UE9 A;  1S1N A;  2IG0 A;  2K4Y A;  1G2B A;  1WHJ A;  1I8F A;  2FPF A;  4ELL A;  1QCN A;  4ROD A;  2MF2 A;  3CC2 A;  4AKG A;  1HD3 A;  1KXU A;  2V8J A;  2DXB A;  4NC6 A;  4QQG A;  2R7G A;  4BCQ B;  4IUV A;  2YUQ A;  5HKC A;  3VYH B;  3X20 B;  1D0X A;  2CUB A;  1YNZ A;  1RAE B;  3AT1 B;  2HBW A;  3OYK A;  4IKF A;  3M58 A;  2ESW A;  2L3S A;  2RQR A;  3T9N A;  2BE7 D;  1Q95 G;  2R57 A;  4D8K A;  2GNC A;  3LW5 E;  1UFF A;  3M57 A;  2EYW A;  2BZ8 A;  2LJ3 A;  4QW2 A;  1OGU B;  1S72 T;  5HQ0 B;  3D7S B;  1AWO A;  1NZ9 A;  1I0C A;  2EPD A;  5GAN 4;  1ZSZ C;  3EHR A;  1M27 C;  3FB9 A;  4PJO B;  3SB2 A;  2A08 A;  2VWF A;  1JRI A;  2EQM A;  2BKZ B;  2PVD B;  3CD6 A;  4FM4 B;  3CPF A;  2FEI A;  4DEX A;  2EUF A;  4LN2 A;  4KRD B;  2KMT A;  4YTL A;  1CSK A;  2X3X D;  2WSF E;  5KYY A;  2CZ0 B;  3OYM A;  4ELZ C;  1SEM A;  3RKY A;  4EOQ B;  1WA7 A;  4Z88 A;  5GAN 7;  4A4G A;  1K73 R;  4F70 B;  3GTM S;  5GMK l;  4C8Q E;  1S72 Q;  1H1P B;  3CCM T;  2CYZ B;  4M77 C;  1S72 A;  5LJ5 d;  3FIF A;  4BCK B;  1ZX6 A;  2LCS A;  1U1T A;  2PHG A;  2G3R A;  1PNJ A;  2E5Q A;  1VQK T;  4JRK A;  2Y4Y A;  2DTI A;  1WQW A;  3QJY A;  5I5Z B;  2LNV A;  5I11 A;  2KY9 A;  1K73 U;  5KCO A;  4HCK A;  3QHW B;  1PD1 A;  5CKH A;  2HD0 A;  2RK1 A;  4OMF B;  5LJ3 h;  1AOJ A;  3X25 B;  2LW4 A;  1VUB A;  3GBQ A;  3S6W A;  4J9B A;  3CCM Q;  2D6F A;  1O9K B;  1WJR A;  2W9Z A;  1K4U S;  3CCM A;  1OKW B;  4R55 A;  3LLR A;  2KRN A;  1VQK Q;  1AWW A;  4HNT A;  1NYG A;  4RKU E;  5D7U A;  2HNI A;  1YJW T;  5GMK m;  3H6Z A;  2R5A A;  3G33 B;  1KFZ A;  2LCL A;  1WDX A;  5LJ3 g;  2KRM A;  4A54 A;  1H8K A;  2VXF A;  3HO8 A;  2KBT A;  2K57 A;  1VQ5 A;  3BDU A;  3SEM A;  4A4F A;  2GTJ A;  1ZSZ A;  2L3P A;  2DYB A;  4M77 F;  3CPW A;  1HSQ A;  3UA6 A;  5CKE A;  4E7H A;  1F5Q B;  2IIM A;  4ZTJ A;  1M8V A;  1KQS S;  4F7U F;  4NST B;  1W6X A;  1G3W A;  2COW A;  3EG0 A;  5CEI B;  1KHC A;  2KEA A;  2M0Y A;  2YXY A;  4HVU A;  1OIY B;  1JOW A;  1YJW Q;  1TFB A;  2DIG A;  2L5Q A;  1X43 A;  1OL2 B;  3M5A A;  1JQQ A;  4GLM A;  5GAO q;  3J7A F;  3LGL A;  2OTJ A;  2J06 A;  5D6X A;  3MEA A;  3CPW P;  4IMY B;  4F16 A;  1Y0M A;  1IXD A;  1UDL A;  3CCL A;  2I0N A;  4CC2 A;  1NBE B;  4M77 A;  3RBB B;  3QJ6 A;  2LC4 A;  1Q81 R;  4F7U A;  3TNW B;  3OYA A;  2JNG A;  5GAN g;  2DL7 A;  4D8D A;  4KUD K;  2LX9 A;  1X27 A;  1RLQ C;  4M78 C;  2AT1 B;  5GAN 6;  4UN0 A;  2CDT A;  1VQO A;  1YJN T;  2M0O A;  1BCM A;  2DX1 A;  1XJW B;  1PRL C;  2NUP A;  4AFZ C;  3H0F A;  2QQB A;  1I5L A;  4V2S A;  2M16 A;  3I5R A;  2F2W A;  2YLC A;  1ZUK A;  2LQK A;  3JCM h;  2RO0 A;  2RQV A;  2DXC B;  2VYT A;  2K7A A;  4EDU A;  2KAF A;  1TH7 A;  3LQ5 B;  4F6W B;  2R58 A;  3DKM A;  3NPF A;  4F6U B;  4TVR A;  1H64 1;  4Y92 A;  4M4Z A;  1RLP C;  4C0D B;  3O5Z A;  3S3N A;  2WJ9 A;  4OGR B;  4F17 A;  1TUG B;  2VKN A;  5FGK B;  2RH2 A;  3R6O A;  3QYB A;  1U5S A;  2DXU A;  2C5V B;  1K73 C;  3B57 A;  3OYG A;  2EKH A;  2QI2 A;  1YJN Q;  1FMV A;  3EGD A;  3JCM g;  2FO0 A;  4J9C A;  1ZA2 B;  2W0Z A;  4QKU A;  1ZP2 A;  2B9R A;  2BTT A;  4PJO E;  2QFZ A;  2XU8 A;  3OYC A;  1SHG A;  5IF1 B;  5ICP B;  1N27 A;  1VIN A;  1WXT A;  2E4H A;  3G4S T;  2EVR A;  4AG2 C;  1SRL A;  3LX7 A;  1G3T A;  1G3S A;  2VV5 A;  2DER A;  2ROL A;  3OY9 A;  1C0M A;  4M7D C;  1C9B A;  1D3B A;  4M78 F;  4EMK B;  2E3I A;  2EBP A;  2DEU A;  2OJ2 A;  3VV0 A;  3TNH B;  2E6N A;  4CFU B;  5KE2 A;  2ECZ A;  4BCN B;  3FC3 A;  1YI2 T;  4C8Q D;  1W70 A;  3DDQ B;  2XG8 D;  4DA4 A;  2XHC A;  1YBY A;  1W2B A;  5EG2 A;  2QXF A;  2OTL T;  2DTH A;  3I56 T;  4L5G A;  2L2P A;  1Q7Y R;  2QTV A;  3G4S Q;  5GAN 8;  2UZB B;  1T0J A;  4BBS M;  4AKI A;  1AD5 A;  3PVQ A;  4FT2 A;  4CFM B;  4DBH A;  2F2C A;  2MIO A;  1AEY A;  5FU6 C;  1EFN A;  4FX3 B;  4M78 A;  1Y07 A;  5FRO A;  1IO6 A;  1D0Z A;  3M0Q A;  2DPP B;  2KNB B;  2LQ8 A;  2LT4 A;  4OGC A;  4J7I A;  3VS3 A;  4OMN A;  1W2B P;  1KC8 R;  5FRM A;  3SHW A;  1YI2 Q;  2CH4 W;  3CC7 A;  5LJ5 h;  3NTK A;  4LDV A;  2XDB A;  1Q7Y U;  3L2V A;  1ZA1 B;  1YI2 A;  1D1C A;  1P92 A;  3G7Z A;  1QWF A;  3OSS C;  4J9I A;  1QKW A;  3JCM J;  1BCO A;  2X51 A;  4AFQ C;  3RIR A;  3JCM c;  2OTL Q;  3RMS A;  2QQS A;  3I56 Q;  4PJN A;  3JCM W;  3MET A;  2V8I A;  3V8K A;  4N0A C;  3I56 A;  4F14 A;  2K3Y A;  3OBW A;  4QT7 A;  3FJ5 A;  1KC8 U;  3P8B B;  1G83 A;  4JLI A;  5GMK e;  1TOV A;  2ZPG B;  1EIF A;  4MDX A;  2RD1 A;  2HKQ B;  4KRC B;  1P5E B;  2GCX A;  5LJ5 g;  2C0T A;  1RAF B;  3SWN B;  1Q82 R;  1OV3 A;  2DD5 B;  1M3B A;  1NM7 A;  4FYW B;  1Q81 C;  3H8Z A;  4EPC A;  1MHN A;  3HFO A;  1LVK A;  1QMC A;  2EJ9 A;  2SEM A;  1OX8 A;  1YCS B;  2ZPH B;  1SSF A;  2CP3 A;  4HCC A;  3GIB A;  1N4M A;  4IIM A;  1YIT T;  4M7A F;  5GMK j;  4PFZ A;  2W9F A;  4KRT A;  1FIN B;  5IHK A;  4MML A;  3EG2 A;  3EID B;  1K76 A;  4J6X A;  2M1H A;  4J9H A;  1M1F A;  4QQD A;  1W4S A;  4M7D A;  2DVJ A;  2LJ1 A;  4IUR A;  5GAM d;  2DL8 A;  4ZNX A;  4PJL A;  1WX6 A;  1QVG S;  2FL7 A;  3M0P A;  1Q82 U;  4LUE A;  1RUW A;  2Z0W A;  2E12 A;  1WQ7 A;  2COZ A;  1UGP B;  1GFC A;  1NEG A;  5IDP B;  3TQ7 P;  3FEO A;  4MDW A;  3EGX A;  4GBQ A;  2RQU A;  4BE2 A;  1FMW A;  4CC7 A;  1N9S A;  3EG1 A;  2RB6 A;  4LOC A;  3BHU B;  3G71 T;  4BCJ B;  4M7A A;  4JJD A;  3EH2 A;  3OMG A;  1JJ2 A;  3LH0 A;  1GBQ A;  1YIT Q;  5HVY B;  1F1B B;  1OYX A;  2QA4 T;  4C5H A;  3OS5 A;  4BCF B;  1YIT A;  2LQN A;  4FSX A;  2JM8 A;  4BCO B;  3JCM V;  3UAT A;  3ZL7 C;  4C8Q G;  3QYH B;  1MND A;  1B7T A;  5CAI A;  3S3O A;  4J6Y A;  4J9G A;  4RTT A;  3A8H B;  1JJ2 P;  1GL5 A;  1Z9Z A;  2GQV A;  3JB9 J;  3KBG A;  2FPD A;  3G71 Q;  4EOS B;  5GAN d;  4AT1 B;  2EGE A;  4J6W A;  4NL2 A;  2AKK A;  4A53 A;  3L2Q A;  1AT1 B;  3CCQ T;  4N0A A;  5I21 A;  4HVV A;  4M75 B;  2QA4 Q;  2PK2 A;  4FW2 A;  3VKI A;  2QA4 A;  1FX7 A;  4ZGE B;  3C0C A;  4PNO A;  4PJO D;  4X1V A;  4XTW A;  3CCS T;  1Q7Y C;  4JRQ A;  1QVF A;  1ZQ1 A;  5HBE B;  2LTO A;  3RNJ A;  2JM9 A;  5FWC A;  2E64 A;  2WIH B;  2CCI B;  1H3H A;  1K1Z A;  5EC7 A;  2B8A A;  1D1B A;  1R8O B;  5KYU B;  2DJZ A;  5CIU A;  2DET A;  3HL8 A;  3CCQ Q;  1FXX A;  1VIE A;  2RHI A;  1V76 A;  2G77 A;  4LUD A;  3JV3 A;  2P4T A;  1VQM T;  4OP0 A;  3I5S A;  3K7A M;  8ATC B;  1KD1 R;  1TSF A;  5CYI B;  3PE0 A;  3CCQ A;  2QDL A;  2E41 A;  1HK9 A;  1QVF P;  1H1Q B;  2JMA A;  3I35 A;  2DD4 A;  3H4C A;  1YWP A;  2ROT A;  3L42 A;  1JO8 A;  2CKK A;  3WVE B;  3THK A;  3G6E T;  3UWN A;  3OYB A;  3JB9 H;  3CCS Q; 
#chains in the Genus database with same CATH homology
 4HNU A;  5LJ3 h;  1M1K U;  3ASK A;  3X25 B;  4XU1 A;  5CO7 A;  3P8D A;  1VUB A;  4PL6 A;  4BDY A;  5FU7 C;  1JJ2 S;  3S6W A;  1KHI A;  5GAO m;  3HRS A;  3C12 A;  1DJ7 B;  5GAO n;  3CCS A;  4C5G A;  2QEX A;  3GF5 A;  1YCY A;  5HK0 A;  3V7S A;  4LD9 K;  4L6V 5;  3RKX A;  4HLQ A;  5GAO p;  4PJO C;  2RHZ A;  1K9M C;  3S3N A;  2XK0 A;  2K2V A;  4FL6 A;  4BE0 A;  2D6F A;  1G3Y A;  1WJR A;  2CGH A;  3CEY A;  3M9Q A;  4FIB A;  4II1 A;  3DLL A;  4HT9 A;  2GFU A;  3F70 A;  3CCM A;  4R55 A;  3CC4 A;  2E65 A;  4M75 C;  3LLR A;  2O01 E;  5LJ3 j;  5DM7 R;  4HA8 A;  3JCM X;  1IRE B;  2BS4 A;  4HNT A;  1Q82 C;  4IUT A;  4HKE A;  4RKU E;  2XIC A;  3OB9 A;  2HNI A;  1YJW T;  4JUV A;  4XU3 A;  1XNI A;  1Y7X A;  4BI4 A;  2GF7 A;  4M77 B;  5GMK m;  3CCE A;  2QTX A;  1N6A A;  3H6Z A;  1BI0 A;  2R5A A;  1IZ6 A;  1VQM A;  2LCL A;  3RKW A;  1NPR A;  3MP8 A;  2WSE E;  4A54 A;  5LJ3 g;  1LNX A;  3INZ A;  3S3M A;  3DLM A;  2VXF A;  3HRU A;  3GNG A;  3HO8 A;  3QUI A;  3CMA A;  2K57 A;  3PGG A;  3A8L B;  1VQ5 A;  3BDU A;  4A4F A;  4C92 D;  3A8M B;  2F5K A;  4M78 D;  2DEQ A;  3GNF B;  3JCM b;  3G6E A;  3C4S A;  3UDC A;  4EMH A;  5HY6 A;  3CC7 T;  2E1H A;  3EFR A;  4XU2 A;  4M77 F;  3CPW A;  2X35 A;  3CBO A;  4DA4 A;  5A0D A;  3SDZ A;  2ZCF B;  2LRQ A;  5CKE A;  4E7H A;  4E7J A;  1M8V A;  5M9O A;  4ZTJ A;  1NJI C;  3MEU A;  1KQS S;  1I5L A;  3HFN A;  3EFS A;  4F7U F;  4J5Y A;  1G3W A;  4BD3 A;  1ZBX A;  4OB1 B;  2E10 A;  1KHC A;  2BUD A;  5LJ3 f;  3OYL A;  3QYE A;  1N8R U;  4OVA A;  1WJS A;  2DZ9 A;  1QVF S;  4BI3 A;  2RJF A;  3CCR T;  2DIG A;  1UGS B;  1LJO A;  2L5Q A;  4M77 G;  4PLL A;  2FB7 A;  3QO3 A;  5I2M A;  2MAM A;  3M5A A;  3MO8 A;  3MP1 A;  2R5M A;  5GAO q;  2RJC A;  2OTL A;  1WNL A;  4C0D C;  3J7A F;  3WVD B;  2EWN A;  3LGL A;  4F7U G;  2OTJ A;  4HCZ A;  3G71 A;  3X26 B;  1V29 B;  2RJD A;  3QHS A;  4JLG A;  1BI2 A;  5KCH A;  3M4G A;  3PIP A;  1VQP A;  1K8A U;  5D6X A;  3MEA A;  4PKC C;  1I81 A;  4Q5W A;  4JX5 A;  4AKH A;  2RHU A;  3OS1 A;  4ELJ A;  3OYH A;  2LDM A;  4C0F A;  3CCL A;  1QVP A;  2JOY A;  2DKG A;  1OZ3 A;  4M77 A;  4BBR M;  1M1G A;  1U1S A;  5CVI A;  4RMO A;  2H3J A;  2EIF A;  1X75 C;  3QJ6 A;  5GMK i;  4ZN3 A;  2LC4 A;  4F7U A;  2L8D A;  4PJO F;  3QYG B;  3OYA A;  4OB3 B;  5A2Q E;  5DLQ E;  2MWO A;  4JX6 A;  2JNG A;  3CXC A;  5GAN g;  4KUD K;  4X9C A;  3CME T;  3JAM E;  2LX9 A;  3L2Z A;  2QDJ A;  4C92 C;  3OA6 A;  4M7D B;  4M78 C;  4M75 F;  2C06 A;  3BFM A;  5GAN 6;  3VYG B;  3BG9 A;  1XOV A;  2AHJ B;  4RCB A;  3JB9 H;  2O4X B;  1B34 B;  3FDR A;  1VQO A;  1YJN T;  1GXI E;  1O9S A;  4J8O A;  4MFE A;  2M0O A;  4N4I A;  2XDD A;  2QQB A;  1M90 C;  1G5V A;  3L2R A;  5IT9 E;  4N4H A;  3TEE A;  3JCM e;  2M16 A;  4PJO G;  5C6S A;  3MCA B;  5J3B A;  4V2S A;  4QQ6 A;  1Y96 B;  2YLC A;  4XTX A;  3RES A;  3CCU T;  2WAC A;  5HK3 A;  2LT1 A;  4M77 E;  4C5E A;  4QVC A;  2LQK A;  3VKH A;  3JCM h;  2RO0 A;  4IUP A;  4RG2 A;  1KC8 C;  4R56 A;  4X34 A;  5CQY A;  3CCR A;  3QG1 A;  2DXC B;  2VYT A;  4EDU A;  3TU4 K;  2KAF A;  1TH7 A;  2VGM A;  4M75 G;  4F7U E;  3M59 A;  2R58 A;  4M7D D;  3DKM A;  1YJ9 T;  2OAU A;  2P0K A;  3GLX A;  1M4Z A;  4M7D F;  1HXD A;  1KQ1 A;  4EMK C;  4DQ2 A;  2PVO B;  3QII A;  4TVR A;  1H64 1;  5GAM e;  2DXB B;  2L3R A;  3C95 A;  4IUU A;  1X01 A;  4PJO A;  1OZ2 A;  3M53 A;  3E9F A;  3E1S A;  5GAM h;  4C0D B;  3LWH A;  2KMG A;  3TW7 A;  1RI0 A;  1XTD A;  2WJ9 A;  2CZ1 B;  3M54 A;  4CI0 C;  1NE8 A;  5CR2 A;  5KE3 A;  2K5L A;  2QQ9 A;  2WSC E;  3RMQ A;  3ER0 A;  5A0G A;  4KBM B;  2RH2 A;  4M75 A;  3R6O A;  5KH6 A;  3CCV T;  3HBL A;  3QYB A;  2DXU A;  2EKO A;  4MZM A;  5FU6 B;  3OQ5 A;  3VU3 C;  4HT8 A;  1K73 C;  2RK2 A;  3I55 A;  3JCM Q;  4AI6 A;  3OYG A;  2FHD A;  4MMK A;  2QI2 A;  4OMF B;  1VQ9 T;  2PQW A;  2JUF A;  4M7A D;  3JCM g;  2EQK A;  2X4X A;  5GAM j;  2XDP A;  5CK9 A;  4JX4 A;  3DL1 A;  1KQ2 A;  4PJO E;  2K5F A;  5DLO A;  2QFZ A;  2XU8 A;  3OYC A;  2YHT A;  4C92 B;  3CPW S;  4M78 B;  1N27 A;  3VYG A;  3X28 B;  4LD6 A;  5CQX A;  1E7P A;  4WF2 A;  1BYM A;  4JS4 A;  1B34 A;  1QLB A;  4M75 E;  3RER A;  1VQK A;  3O8V A;  5LJ3 d;  5GAM g;  3J81 E;  4XTY A;  2BIV A;  3G4S T;  4BAC A;  1KD1 C;  5D6W A;  3LX7 A;  1G3T A;  4Z02 A;  1G3S A;  1PSF A;  1VQP T;  1VQ7 T;  1Y96 A;  3BW1 A;  2VV5 A;  3UT1 A;  4HNV A;  4C8Q B;  1JB0 E;  3A8O B;  3OSV A;  3VUZ A;  4HL4 A;  2RHY A;  3OY9 A;  2JTF A;  2RHX A;  2DXC A;  3FJP A;  2EQU A;  2E6Z A;  5J39 A;  4A4H A;  3OW2 A;  4M7D C;  3JCM f;  1YHQ A;  2JZ2 A;  3KUF A;  4XAX B;  2XD0 A;  3CD6 T;  1D3B A;  4C92 F;  2M9U A;  4M78 F;  4EMK B;  3OYE A;  2RA2 A;  1UGQ B;  3VV0 A;  2E6N A;  3EAE A;  3TCJ A;  3CCV A;  1Q86 U;  2KR6 A;  2EAY A;  4J83 A;  3FLG A;  5KE2 A;  4JRI A;  4MIM A;  1X6O A;  1WJQ A;  3VUB A;  3FC3 A;  1YI2 T;  1FWZ A;  4JRP A;  3HRT A;  3V8L A;  4C8Q D;  4X9D A;  5GAN e;  1VQ9 A;  1QVG A;  4OB2 B;  2MWP A;  2XG8 D;  3HPW A;  2ZPE B;  2ZZD B;  1N9R A;  1YBY A;  2XHC A;  1M5Q 1;  2I2L A;  5AYF A;  2RI5 A;  3VJP A;  1MGQ A;  5GAM f;  1W2B A;  4BY6 B;  2EJG A;  5EG2 A;  5GAN h;  2MI6 A;  4C92 G;  2QXF A;  5FLX E;  4Z6Y A;  4M78 G;  1VQ4 T;  4XTZ A;  2IVW A;  1OI1 A;  3HP9 A;  3CXC S;  4XTU A;  2DTH A;  2EYQ A;  2OTL T;  3JSC A;  3I56 T;  3JB9 I;  3CC2 T;  4L5G A;  4DOW A;  4ZGD B;  2JN0 A;  5A0L A;  4NL3 A;  3HZJ A;  4KUL A;  5GAN 8;  3QZ9 B;  3PFS A;  4BUG A;  3GPL A;  4KUI A;  4D6W A;  1YJW A;  4BBS M;  4AKI A;  4FT2 A;  5CKF A;  4JS5 A;  4IUQ A;  4NS5 A;  4GY5 A;  2K3X A;  3LYI A;  2RI3 A;  4C5I A;  4XQ3 A;  4C92 A;  3PT9 A;  4L59 A;  4M78 A;  5FU6 C;  3SD4 A;  3PTA A;  4E7L A;  2X4W A;  5GAN 2;  1Y07 A;  5FRO A;  5GAN j;  2PVG B;  4Y91 A;  4BI8 B;  4JJN K;  2LCC A;  3QXE B;  2DXT A;  2QQA A;  3QKJ A;  2DPP B;  4E47 A;  4E7K A;  2LQ8 A;  2LT4 A;  4OGC A;  2DD4 B;  4J7I A;  4C0Z A;  1VQ8 T;  5FRM A;  5L8R E;  1LOJ A;  2D9T A;  5LJ5 e;  3QDR B;  4LDW A;  3JB9 D;  3QZ5 B;  3CC7 A;  3NTH A;  3BG5 A;  4OF1 A;  4BDZ A;  5LJ5 h;  4A4K A;  3NTK A;  4LDV A;  2XDB A;  2BS3 A;  1Q7Y U;  2VUB A;  3QBY A;  4JDS A;  3L2V A;  1YI2 A;  1P92 A;  3NTI A;  3G7Z A;  3OSS C;  4EMK A;  1VQ6 T;  3JCM J;  2F5T X;  3RIR A;  4PLI A;  2PUK B;  4C92 E;  2RI2 A;  4M78 E;  3RMS A;  2QQS A;  5DY9 A;  3JCM c;  2DIQ A;  4FU6 A;  2KQW A;  4FT4 A;  3X24 B;  3JCM W;  4QVD A;  1BIA A;  3M56 A;  2HBP A;  3MET A;  2V8I A;  4ATO A;  4MZT A;  4XU0 A;  3E19 A;  3N5B B;  3V8K A;  3V7C A;  4C8Q C;  4N0A C;  4XK8 E;  2KSS A;  4ELY C;  2ZZD A;  3I56 A;  2QEX T;  2K3Y A;  3CD6 A;  3PMI A;  4O5V A;  1VQL T;  5LJ5 j;  3OBW A;  2Y90 A;  3NFC A;  3LWI A;  1KC8 U;  3GP8 A;  3P8B B;  1H3Z A;  2CZ6 B;  4JLI A;  1VQ7 A;  5CCA A;  3JRZ A;  4ZN1 A;  2VC8 A;  2QQR A;  3ME9 A;  5GMK e;  5GAN f;  2ZPG B;  1EIF A;  3M4Y A;  3VKG A;  4M7A B;  3HSB A;  2RD1 A;  3BG3 A;  3CC4 T;  4MDX A;  5GAN 3;  2X4J A;  5GMK h;  2XID A;  3TW6 A;  2DAQ A;  2GCX A;  2LVM A;  4ZTF A;  5LJ5 g;  2DO3 A;  3KXT A;  3SWN B;  2DD5 B;  4RCC A;  4CRI A;  3OYY A;  1Q81 C;  4BY6 C;  1ZHI A;  3H8Z A;  4MZP A;  4P5N A;  2DTO A;  1MHN A;  3HFO A;  4EPC A;  5GAO r;  2EJ9 A;  2L89 A;  3ZEH A;  1UB4 A;  2HQX A;  3MEW A;  5D6Y A;  3HKS A;  3P8H A;  3JCM d;  2PUO B;  4B9X A;  2ZPH B;  3CME A;  1SSF A;  4A4E A;  4HCC A;  3GIB A;  2FYK A;  5IAY A;  3OW2 S;  2JVV A;  3AHU A;  4OGE A;  1YIT T;  4M6V A;  3OYI A;  4LDU A;  1M1K C;  5GMK j;  1VQ5 T;  4M7A F;  1O75 A;  1YJN A;  2HQE A;  1VQ6 A;  2EQJ A;  2YLB A;  4J7F A;  4DOV A;  1VIF A;  4MML A;  1K9M U;  1QP3 A;  2RJE A;  4J6X A;  3OYJ A;  2M1H A;  3UPU A;  1M1F A;  4QQD A;  1W4S A;  4E7I A;  3HB9 A;  2FVU A;  4M7D A;  3BY7 A;  4M7D G;  1M9S A;  4IUR A;  3MP6 A;  3CCU A;  5GAM d;  2QDY B;  2O4X A;  3C94 A;  5C0M A;  2KVQ G;  5LJ5 f;  1QVG S;  2DK3 A;  1FKM A;  2FL7 A;  1Q82 U;  3MHX A;  4EMG A;  1W2B S;  1NPP A;  2RM4 A;  1VQL A;  4M7A G;  1YJ9 A;  2E12 A;  2EJF A;  1WGS A;  3RUX A;  3QSU A;  2VXE A;  1WQ7 A;  1UGP B;  2KDS A;  1KD1 U;  2XKO C;  2MMP A;  1YIJ T;  3ZBD A;  3FEO A;  4QVZ A;  3TRE A;  2K4Y A;  2YRV A;  2IG0 A;  3M55 A;  4MDW A;  5I2S A;  1I8F A;  2X4Y A;  1QW1 A;  3JCM P;  2MF2 A;  3MEV A;  4BE2 A;  1N9S A;  3CC2 A;  2ZPB B;  4AKG A;  2RB6 A;  4LDY A;  5GAN 5;  4HCB A;  3KHI A;  2V8J A;  2DXB A;  4LOC A;  4NC6 A;  3G71 T;  4M7D E;  2OTJ T;  5CKB A;  4M7A A;  3Q1J A;  4QQG A;  4IUV A;  3OMG A;  3PNW C;  2DZC A;  1JJ2 A;  3LH0 A;  4Y28 E;  4BB7 A;  5HKC A;  3VYH B;  2ZPI B;  2V8K A;  4F7U B;  3X20 B;  3SWN A;  3CCL T;  3L2U A;  2DD5 A;  5LL6 S;  1OYX A;  2A7Y A;  4C8Q F;  4C5H A;  2QA4 T;  4XTV A;  3OYK A;  4IKF A;  1VQN T;  4ME7 A;  3BDL A;  3OS5 A;  3M58 A;  1YIT A;  5J26 A;  3CCJ T;  1NJI U;  2BKD N;  3CBM A;  1Q86 C;  1BKB A;  2D0Q B;  3T9N A;  3E9G A;  4FSX A;  3ZFJ A;  2ZGW A;  3LGF A;  2R57 A;  4M7A C;  4M77 D;  2P0P A;  3PIO A;  3OS2 A;  3JCM V;  3QPH A;  3LW5 E;  2CZ7 B;  4C0G A;  3M57 A;  3OYD A;  3L1A A;  4C8Q G;  3SWN C;  4M7A E;  3G4S A;  3QYH B;  3GOX A;  1VQO T;  4QW2 A;  1N8R C;  4ZGJ B;  5CAI A;  3S3O A;  1S72 T;  4OB0 B;  5IN1 A;  3A8G B;  4J6Y A;  5FU7 B;  3A8H B;  1NZ9 A;  2QF7 A;  2QQ8 A;  1YIJ A;  2GQV A;  5GAN 4;  3JB9 J;  5EJC A;  2A3L A;  3KBG A;  2NLU A;  3FB9 A;  1K8A C;  3SB2 A;  5GAN d;  4PJO B;  4J6W A;  1JRI A;  2EQM A;  2PVD B;  3OBY A;  1UGR B;  4FM4 B;  3DB3 A;  4NL2 A;  3CPF A;  4A53 A;  4C8Q A;  3L2Q A;  4GLK A;  4N0A A;  5GAO l;  2VGN A;  3CCQ T;  4B9W A;  5I21 A;  4LDX A;  3JB9 F;  1RL2 A;  3A5Z B;  2KMT A;  4M75 B;  4YTL A;  3SFM A;  3V7R A;  3QWL A;  2KK4 A;  4BE1 A;  1PSE A;  1BI1 A;  3VKI A;  2WSF E;  4O6J A;  1BI3 A;  1KQS A;  2QA4 A;  1FX7 A;  2HAX A;  1VQN A;  2CZ0 B;  1KG1 A;  3OYM A;  4ZGE B;  4ELZ C;  1QP2 A;  3HHT B;  3RKY A;  1JBM A;  3URG A;  4PNO A;  3CCJ A;  1VQ4 A;  2ZPF B;  4PJO D;  4XTW A;  3OYN A;  3JB9 G;  1M90 U;  3I55 T;  3CCS T;  5GAN 7;  4A4G A;  1WPY A;  4JRQ A;  1Q7Y C;  1U8R A;  2K5I A;  3J80 E;  1QVF A;  1ZQ1 A;  2LTO A;  2E70 A;  5GMK l;  4M75 D;  4RG8 A;  4C8Q E;  5FRN A;  1XQH A;  1Y71 A;  4UC4 A;  2E64 A;  3PMT A;  3CBP A;  3CCM T;  2CYZ B;  1BIB A;  4M77 C;  3L2W A;  1S72 A;  5LJ5 d;  3WXM B;  2XI9 A;  3FIF A;  3OYF A;  2B8A A;  2EFI A;  1R8O B;  1AHJ B;  2CS7 A;  1U1T A;  2DJZ A;  5CIU A;  2G3R A;  3HL8 A;  2GFA A;  1FXX A;  1VIE A;  2RHI A;  2E5Q A;  2G77 A;  2F69 A;  1VQK T;  2JTM A;  3OS0 A;  3CCE T;  4JRK A;  1VQ8 A;  1UEB A;  2P4T A;  2PU9 B;  2Y4Y A;  1VQM T;  2BS2 A;  3OMC A;  4OP0 A;  2DTI A;  1WQW A;  3QJY A;  3CCQ A;  2Y4X A;  2DVE A;  2LNV A;  1D3B B;  1Q81 U;  4NOY A;  2E41 A;  1HK9 A;  2KY9 A;  1K73 U;  3V8J A;  5KCO A;  2DD4 A;  4MFD A;  4QSH A;  3H4C A;  3CMA T;  4N4G A;  5CKH A;  4VUB A;  5LJ3 e;  3L42 A;  3DB4 A;  1YHQ T;  2HD0 A;  1I4K 1;  2P0Q A;  2CKK A;  3WVE B;  4KT0 E;  5CKD A;  2RK1 A;  3G6E T;  3UWN A;  3OYB A;  3FRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...