2ZPGB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 120min at 293k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
total genus 58
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpgB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpgB02
2DD5B 1IREB 3QZ5B 3WVDB 2ZPFB 1UGRB 3QXEB 4ZGJB 2ZCFB 1GXIE 3A8MB 2D0QB 2DD4A 2ZPEB 2PU9B 4OB1B 4ZGDB 4L6V5 4OB2B 4OB0B 3X28B 2PVDB 1PSEA 3LW5E 3HHTB 4Y28E 2PUOB 2CYZB 3VYGB 2DXCA 4FM4B 2O01E 4OB3B 3A8GB 2CZ1B 2WSEE 2CZ6B 4ZGEB 4KT0E 2ZPIB 1QP2A 2DXBA 2DD4B 2PVOB 3X20B 1UGQB 2CZ0B 1UGPB 4XK8E 3A8LB 3X25B 2WSFE 2ZZDA 2AHJB 3WVEB 1V29B 2WSCE 5L8RE 3A8HB 2DD5A 2DPPB 2ZPHB 3QYGB 2DXCB 1PSFA 1QP3A 1DJ7B 2PUKB 2ZPGB 2QDYB 3QYHB 4RKUE 2DXBB 3A8OB 2ZPBB 3VYHB 3X24B 2CZ7B 1UGSB 3QZ9B 1JB0E 3VYGA 3X26B 2ZZDB 2PVGB 1AHJB
chains in the Genus database with same CATH superfamily
3TREA 4HXJA 1QCOA 1JU5C 2CCHB 2LC4A 5I11A 2V1QA 1K0XA 1B3QA 4IIMA 1JBMA 2EQIA 2D0QB 3OS0A 1VQPA 1NYFA 4HVUA 2P4TA 3J80E 4FU6A 2OI3A 1NJIC 1TFBA 1VYUA 2QQRA 4RCBA 5J26A 4I3ZB 2VGMA 4XTZA 2A08A 1GY3B 3CCRQ 1Q7YC 1GBRA 3TW7A 2K5IA 3M54A 4BD3A 4XTVA 1BYMA 4A4KA 4C92E 2FHDA 5CR2A 4M75E 4F6SB 4M7DF 3VYGB 2FB7A 3CCJT 2MWOA 3HP9A 3E9FA 1NLPC 1K1ZA 2DVJA 1Q81C 3C95A 4FW2A 3TNWB 2O31A 3DDQB 2IG0A 4EONB 2OTJT 2COWA 2ZPIB 4BCOB 1KHIA 2X4XA 4BCKB 4MDWA 3CCUQ 4RTWA 3RMSA 1D3BA 3N5BB 1GCQA 1VQMA 2LP5A 1WZOA 2W0ZA 1VQ8T 2IW6B 4BY6C 3HTRA 3R6OA 3G4ST 1GCPA 2DPPB 4J9EA 3HBLA 2JTEA 1NM7A 2CP5A 3V8KA 1MGQA 1B07A 3MP8A 3M57A 3UDCA 5FW9A 3THKA 4C92G 4M75G 3BY7A 3SDZA 2G3RA 5D7UA 5L23A 4BCFB 2C0IA 1KC8C 4FYVB 4M78F 2DTHA 4XTUA 4QW2A 2KYBA 2R57A 2NUTB 1FKMA 3I56A 5C0MA 5LJ3h 1VQ6T 2A7YA 5IAYA 1ZSZC 4J5YA 2DETA 2DD5B 3S6WA 4QQ6A 1Y0MA 1AWJA 5HKCA 4HCBA 3CC4T 1M30A 4ZGDB 2LTOA 2YRDA 3OYMA 1N9RA 2CH4W 2DE0X 4TTHA 3OYYA 3FC3A 4MZMA 3O5ZA 4KUDK 3MP6A 3MHXA 3LWIA 1UUEA 4FSXA 3CCMQ 2G9XB 1SG5A 4TVRA 3VS2A 4LDVA 1K8AC 2LJ0A 2QQBA 3MEWA 4GY5A 2CZ1B 2FO0A 1K9MR 2RB6A 1R0BG 3CC7T 4BCPB 3CCVT 3E9GA 2DD4B 1PWTA 1OV3A 2O9VA 4F7UB 2XIDA 1M1KC 3SFMA 4C0DB 3I55T 3CQTA 3H8ZA 4RTUA 3PE0A 3QUIA 4LD9K 2VWFA 3HFNA 5GMKi 3QJYA 3BHVB 1TG0A 3RERA 1RAAB 1YCYA 4MDXA 2F5KA 4Y72B 3BHTB 2IN3A 2P4RA 2PHGA 1UE9A 4PFZA 1GH6B 4PJOF 4BY1X 3L42A 4BBRM 2BZ8A 1BIBA 3NMZC 2EKOA 5IXBA 2K9GA 4RCCA 2E5KA 1ZHIA 3CXCS 4BY6B 3CMAT 4OF1A 3RNJA 4OGCA 4JRIA 1VQPQ 3JCMX 1GL5A 1OZ3A 4M7AE 3M03A 3CCRT 3VKHA 2OX7A 3EG3A 2CDTA 4M4ZA 4Z8AA 4F6WB 3INZA 3DDPB 4JS5A 2SRCA 1BK2A 4AI6A 2XDPA 3L2ZA 3EGUA 2G77A 5DLQE 5A0LA 2RQTA 2ZZDB 3VS3A 4EORB 2JW4A 3CCQT 3C0CA 1U1TA 2QASA 4NSTB 2KK4A 3MI9B 2K3BA 3OYDA 1V76A 5I5ZB 2GTOA 3CCUT 2H3EB 1VIFA 1VQLQ 2NUPB 1O9KA 1VQ7Q 1ZSZB 1I1JA 1MUZA 3EG1A 3JCMJ 3VRZA 1LNXA 3M55A 2E5QA 2LJ3A 5CCAA 1I4K1 1H1QB 5FROA 3JCMd 1X6OA 4OMPA 2ECZA 2J05A 5GAMd 3OYGA 2EJGA 4M7AG 2K6DA 3REAB 3OYHA 1FXXA 5KYYA 4HLQA 4C8QG 4LN2A 5IN1A 1K9MU 4NOYA 2RM4A 2LVMA 1R0CB 3QIIA 3SB2A 4IUPA 3GPLA 4OMMA 1BI0A 2EQUA 2RMOA 4LD6A 1B34B 5KYWB 5IDPB 1U3OA 4DEXA 4ZGEB 5FU7C 5HVYB 1A0NB 2NYSA 4PK4A 3HKSA 1ABQA 2CZ0B 4KH0B 3CPWS 4RODA 2YUOA 1ZA1B 4J9GA 3ME9A 4E7IA 2EUFA 4BCJB 3HFOA 1TTHB 5J3BA 5LJ5d 3TSWA 3G4SA 5D6XA 3GLXA 1QLYA 4HL4A 1SHGA 2LCSA 4ME7A 1YJWT 3EGDA 3QG1A 2DL4A 3DLMA 4EOLB 2QQSA 4MMLA 1X2QA 4KGVB 4M7DC 3H0IA 2EGEA 2PJQA 3QHRB 4F7JB 3RKXA 5KE2A 4DOWA 2JJ9A 4BCGB 2O4XA 2VB6A 1N8RU 1IB8A 1NG2A 3HL8A 2MMPA 4HNUA 2YXYA 1QCFA 3TU4K 1Y96B 1VQ6A 4DA4A 3EFRA 5CIUA 1YI2Q 2VVKA 1YJNQ 4J7IA 2DTIA 1GUXB 2E6ZA 5KYUA 1P92A 4ZTFA 3WVDB 1BBZA 4CRLB 5HNBB 2WMBB 1G3SA 4F7SB 4JJNK 4F14A 2UZBB 1RADB 3QWXX 5L2WB 2L3QA 3EGXB 2IIMA 3QPHA 4F7LB 1OL1B 2XI9A 3P8DA 4XU2A 5EJCA 4XU1A 1BB9A 4CRIA 3GNFB 2PZ1A 3VS0A 3LYIA 4QQGA 4BE0A 2BE7D 1OL2B 1M90R 3IQLA 1K73R 4QVDA 1BI3A 4M78C 3G6EA 2PUOB 1WIEA 1U8RA 5A0DA 1SSFA 3CXCP 2EJFA 4MIMA 1YFNA 2XD0A 3BE3A 1U06A 5D6YA 4KGXB 4DBFA 1OU8A 5GANf 1WJSA 1RUWA 1KQ1A 1VQPT 2KRSA 2DX1A 3TNIB 1JXMA 5GANg 1PD0A 3X20B 3QHWB 4FYYB 2NWMA 5GMKe 5GANe 1OULA 2F1LA 2BS3A 2O9SA 2ZGWA 1FYNA 4UC4A 1D0ZA 2HEQA 1E6GA 1OZ2A 4ELJA 1JSUB 2LQNA 2C06A 3A8HB 3VS6A 4RG8A 5KYXA 2YSQA 2EGAA 3G71Q 2C0TA 2HBWA 1QMZB 2PTKA 2DXCB 4F7UE 1T3LA 1UDLA 3JCMc 1Y57A 3M0SA 2L2PA 5KCHA 1H8KA 3CCRA 2RJDA 3VV0A 3QKJA 2QDYB 3POMA 1K0SA 2O2OA 1UNGD 2PMIB 2CP2A 1JEGA 4FYWB 4IUVA 2HD0A 3T9NA 1VQMT 4EMKA 3TN8B 1VQOQ 2WJ9A 1URCB 2K2VA 3PFSA 1UB4A 4M7DB 3NGPA 1H27B 2RQWA 2GNCA 2K3YA 2MI6A 3VJPA 4EOOB 3PVLA 3EHQA 1RI9A 1F1BB 4KULA 1I8FA 4ZGJB 3CCUA 2WIHB 1TXQA 3A8MB 3CPWP 1YITQ 4PJOC 5IHNA 4AKHA 2M1HA 1M90U 4JRKA 1VYTA 2X4YA 1K73U 1PKSA 4XAXB 3D7SB 2EYQA 3CC2A 4OB0B 2KYMA 1I5LA 3VUZA 8ATCB 4JUVA 4BE1A 2W10A 2L89A 3SHWA 5I21A 4LNPA 3FIFA 4BI8B 2OJ2A 4J83A 3HPWA 4C0GA 2KMTA 4Y91A 2E6NA 3K7AM 4MFDA 4CXAB 2KY9A 2CP3A 2QDLA 1C0MA 1Y7XA 1JXOA 4C5IA 2YRVA 2EW3A 1NEGA 4XQ3A 1RAEB 2AZSA 3OW2S 2EGCA 4M78B 3NTIA 2PVOB 1KQSP 3FRNA 4PNOA 1M9SA 1I5OB 1YHQQ 2JMCA 2D9TA 1YI2T 2XG8D 5GAN8 4J6XA 2RD1A 1LPLA 1KFZA 3MPUB 1KD1R 1W6XA 1X01A 1N5ZA 1H3HA 1WJRA 5IHIA 2I2LA 4CI0C 3BDLA 1G5VA 3VKGA 4CFUB 1O9SA 3JRZA 1GCQC 2PUKB 1EZZB 2ABLA 2E3IA 2RH2A 2IPOB 5CVIA 4RUGA 2MK5A 4E7SA 1OKVB 4RTVA 5GAMj 2B9RA 1FMWA 1WX6A 3VYHB 1K9AA 5GAN5 2Y90A 3CCMA 2BE9B 4BCMB 1S72Q 3RIRA 2VV5A 3QZ9B 2KNBB 4M7DD 2OAUA 3MCAB 3A1PA 4WF2A 1AT1B 1MV3A 4LUEA 1WPYA 4M7AA 4YOSA 3WXMB 2PVGB 2QYZA 4C8QA 5IHYA 5LJ3d 4A4HA 2XMFA 3B57A 2KVQG 4KGZB 5ECAA 4BE2A 2LT1A 3AT1B 3LX7A 2RHXA 2BZXA 3OBWA 3HRUA 5FU6C 1W2BA 3LWHA 1KHCA 5I22A 3NPFA 3SEMA 1UGVA 2KXDA 2KMGA 2B8AA 3FDRA 3BLQB 5DM7R 3HO8A 4PJOB 4J9BA 4Y28E 1T0JA 4QVCA 4CFNB 1ZX6A 1H1RB 3UPUA 3QYEA 1CKBA 4IMYB 2O01E 2E10A 3A8GB 3TQ7P 2MCNA 1Q86R 2DA9A 1XOVA 4RTTA 1QVGA 2W9FA 3ZL7C 5IF1B 2QQAA 5FLXE 4M78D 1WHJA 3VUBA 2LNHB 3J81E 1CKAA 2JVVA 4AKIA 2JTMA 2OAWA 1VQOT 4OP0A 5HY6A 4QSHA 4ZN3A 1KD1U 4Q5WA 3RGFB 1PM3A 4PJMA 4A4EA 3M0TA 2YUQA 1FMKA 3VS7A 1QLBA 1M8VA 1SEMA 4PFOA 4C0DC 1YNZA 2DYBA 2KRMA 3VS4A 3PMTA 2RPNA 2PNIA 4II5B 2A37A 1PSFA 1VQLA 1YITT 4HT8A 1MHNA 2DL8A 3DL1A 1VQ7A 4NS5A 4CFUD 2RNAA 1NE8A 2V8JA 3PMIA 3OA6A 1FX7A 3UF4A 4CFVB 2RK2A 3LGLA 3OW2A 4OR5B 4D8DA 1GBQA 2VASA 2KGTA 5FWCA 1BU1A 3CC2Q 5GMKh 5FRMA 4HCZA 4BCMD 5GANh 5EC7A 5CKFA 2YLCA 1D3BB 2CGHA 1H25B 4C0FA 2EFIA 3EG0A 2VC8A 4HVVA 1KXUA 1IREB 4J6WA 2BIVA 1IGUA 2ZPFB 1WNLA 2KE9A 3KUFA 1WJQA 4R55A 2XHCA 1ACMB 1AWXA 4Z02A 1AZGB 2HL5C 4IUUA 2A36A 3LH5A 4M7DE 4J9CA 3HZJA 2QI2A 2IW9B 2I40B 4Z6YA 5HBHB 1PD1A 1YHQT 4EOIB 5GAOp 4ATOA 2DZ9A 1YP5A 4N4IA 2PVDB 5GJWB 2KI7A 1UNHD 3V7RA 2DZCA 2A0FB 4BXXX 3C12A 5IH2A 4JRQA 3MO8A 4PJOD 1E7OA 2EYYA 1QVFS 5FU6B 1XTDA 1Q86U 3JB9G 5EG2A 1WI7A 3I35A 1Q81U 2QGFB 4FT2A 3P8BB 1RACB 5GAN2 1VQ4Q 3RKWA 2CUDA 3M0RA 5M9OA 5LMKB 5DQWA 2W9ZA 2F2XA 4LDUA 1PHTA 3JCMg 4E6RA 5GAMg 1S72T 1TH7A 2MWPA 1YI2A 3JCMe 1Y71A 4OGEA 1YJNA 1WLPB 1UGPB 5GAMe 2J6KA 4M7DG 3DKMA 4BI4A 3OYIA 1KIKA 2DYIA 2H3JA 1I81A 3G6ET 4IURA 3HRSA 2CJMB 2CCIB 4M78E 3FJ5A 4LDWA 1AZEA 4EMHA 3QYGB 1XO2A 4KBMB 2QEXQ 1M5Q1 1WFWA 5GAOr 1J3TA 2BS2A 4VUBA 3URGA 2J6FA 5HCKA 1OI9B 2CSIA 2DO3A 4C8QF 2JGZB 5KH6A 3OYJA 2CT3A 2JM9A 3QDRB 2I0NA 5LJ5g 3EG2A 2ZPBB 1EX4A 2LDMA 2DF6A 3PO3S 4M77A 1WHHA 1C9BA 5LJ5e 2QA4Q 1LCKA 3PIPA 3S3OA 2WFYB 3H0FA 1ABOA 3H9NA 4DOVA 1FINB 5ACBA 3QHSA 3MY1B 3I9QA 2R5MA 1HD3A 3JSCA 1MMDA 2DIQA 4AT1B 3E19A 1R77A 1ZBXA 2EVRA 1RL2A 2YLBA 3JCMP 4IUTA 3MIAB 1GFDA 1UHFA 1K9MC 3M53A 1SSHA 2XK0A 4MFEA 1M2VA 1TOVA 3EFOA 4M78G 2OTLQ 1AEYA 2K5LA 3LGFA 1JJ2S 1N8RR 4LDYA 1KQ2A 3X28B 1WXBA 2J7IA 1M1GA 3LQ5B 1SF9A 5DLOA 3G71A 4XTYA 1T0HA 1H1SB 3FB9A 5GAOm 3META 2YT6A 1JKWA 4RTYA 2RQVA 4BI3A 1OEBA 1M3BA 2RHZA 5CK9A 4FM4B 5FRNA 2D8JA 3SWNA 3OYAA 2DXTA 2L5QA 4EOKB 4R56A 1VQOA 1PRMC 3SWNB 3JB9H 4PJOE 1MMNA 2QXFA 3CC2T 1O9KB 3NHNA 3EAEA 3OMCA 2WSFE 1TU0B 4AG2C 3R6NA 1UECA 6AT1B 5LJ3j 2WSCE 2FZCB 4FIBA 1D3UB 1AOJA 4X34A 2EJ9A 4PKCC 4IUQA 3JAME 1YITA 5KYYB 1K4US 1M27C 5C6SA 4AFUC 1QVFA 1G83A 2L3SA 2QTXA 2JS2A 3DB3A 2LW4A 3DJBA 3RESA 3HSBA 1NLOC 2FVUA 1YWPA 2W96A 3TSZA 1MNDA 5CEIB 1WHMA 2FZKB 1JO8A 1NPPA 3C94A 1UEBA 2E64A 5GAN3 1BCMA 1Q82R 1QMCA 4UN0A 3AHUA 2IVWA 2CP6A 3GOXA 2CUBA 1VQ4T 3EGDB 2HBPA 1AISB 1G3TA 3TW6A 1UJYA 1QWFA 4EMKC 2NLUA 4D8KA 1PG5B 3Q1JA 3OSVA 2WEVB 3M0QA 1YHQA 3SD4A 2RI5A 2BKZB 1PNJA 4OB1B 2DMOA 3QJ6A 3OYBA 2P0PA 5GMKl 5GAOq 2FPEA 3CCMT 2O4XB 5LQFB 1M3CA 1PSEA 2DRMA 2LQ8A 1C6VX 3EH2A 4N4GA 2EQMA 1C1AA 4QQDA 1VQNQ 3GTMS 4E7JA 2UZLB 1WHGA 2K3XA 2X51A 1VA7A 2E65A 5CQYA 4CC4B 3OYFA 2JS0A 4V2SA 1ZQ1A 2V8IA 2ENMA 2QEXT 2ATCB 5KYUB 2LT4A 4B9WA 2HZYA 1UJ0A 2ED1A 3V8LA 2HQXA 4MZTA 2CZ6B 1GRIA 3A98A 4A63B 3JCMV 1VYVA 2DXBA 1S72A 2KBTA 2RF0A 3CD6Q 3QO3A 2QA4T 1RAFB 4OMFB 1WXUA 4ELYC 4JLIA 3VS5A 2RI3A 4K11A 2CP7A 4JPBW 3GP8A 1H28B 3X25B 1SHFA 1JJ2A 2AKKA 1GFCA 2IVXA 3M0PA 3JCMb 4OGRB 3EIDB 2FEIA 4JLGA 2HSPA 4QKUA 3M9QA 2CT4A 4M77F 3I5RA 2QG9B 1H24B 4C92A 4M75A 1AWWA 2QDJA 4B6MA 2LMJA 2MAMA 4JS4A 3TEEA 3G33B 1X2KA 4YTLA 4HKEA 5HQ0B 3X24B 1Q82U 1WQWA 2JUFA 4YC3B 3RMQA 2KT8A 1D0YA 1LJOA 1VINA 4HVWA 1JB0E 1D09B 2Y4YA 1M90C 4JJBA 1K73C 3RBBB 2C6TB 3ER0A 2JM8A 2RJFA 1D1AA 2D6FA 2COZA 3OYNA 1V1CA 1W2BS 5KYXB 1VQLT 3QZ5B 2RK1A 1UGRB 4CFWB 1VQ7T 2PK2A 1SPKA 4LUDA 4X9DA 2LNVA 1Q95G 1ZA2B 3QBYA 2V22B 2XDDA 4AMCA 3UA7A 3QYBA 3F5XB 4YOZA 1MV0B 1RLQC 2FYKA 4C8QC 4OMOA 3GNGA 2DM1A 3QDFA 4RG2A 3HHTB 2EWNA 1R8OB 2YUNA 4EMKB 2QAZA 5LJ3g 4N0AA 1VQKA 2XDBA 3I5SA 2EPDA 2FPFA 1QVGS 1JSTB 5LJ3e 3PVQA 4Z89A 3OB9A 1H1PB 3MP1A 1Y07A 3NTKA 1SRLA 4F7UG 4EOSB 4XTXA 3CCJQ 1IHVA 2EYZA 1HXDA 4Z88A 1TD6A 1JRIA 4FSSA 2OTJQ 2YUPA 1JOWA 1OX9A 3EG9A 2EKHA 3H0HA 4F17A 3JB9J 5L8RE 3CCLQ 4C5GA 1OPKA 2HMAA 5DQVA 3DLLA 5IXFA 1X75C 1F5QB 2BPMB 1DJ7B 2VXEA 2BZYA 1KQSA 1ZUUA 4D6WA 2GTJA 2DILA 1HYOA 4KH1B 4DBRA 4BCHB 2H8HA 4II1A 1YJNT 4BBSM 2AZVA 4PJLA 4KRDB 5ICPB 2CZ7B 3ZFJA 3UATA 1RABB 4JJCA 1LVKA 4F16A 4HNVA 1VQ4A 4BB7A 2DRKA 2RO0A 2F69A 3BG3A 1B7TA 5A0GA 4OMNA 2C5VB 2KR6A 1G3YA 1OKWB 3M56A 4ESRA 5LL6S 1BCOA 2HDAA 3G1JA 3KBGA 3A5ZB 3CD6T 4KRCB 2R58A 4BUGA 5GAN4 1N6AA 1S1NA 2J6OA 2DIGA 3BFMA 4LE9A 2LRQA 3L2RA 4EOPB 3CC4Q 1D0XA 2EIFA 3PTAA 2KR3A 4JDSA 1G8XA 2GCXA 4ZTJA 4OVAA 1X43A 3EOCB 2E41A 2EYWA 2QEXA 1VQ5Q 2M9UA 1KD1C 2FG0A 4HA8A 2HQEA 3NFCA 3LLRA 4M7AB 2QTVA 4C8QB 3OYEA 3BDUA 4F6UB 2RN8A 1CSKA 3LH0A 4EPCA 1NJIR 2QA4A 3KFVA 1VYWB 4BCIB 4C92F 1OI1A 2FPDA 4M75F 1QQJA 3O8VA 1IO6A 1Q7YR 3OS1A 3CC7Q 1YJ9Q 3G71T 3DB4A 1PKTA 3MEVA 3CCVQ 2LCCA 4HCKA 4HNTA 2HNIA 2HKNA 2D0NA 4JZ4A 1W2BP 3ZEHA 2F2VA 1OPLA 1PRLC 1MMGA 3CCEA 3I55Q 2P0KA 1Q81R 2JN0A 4AG1C 2OTLA 4KUIA 3TVTA 3OY9A 1QP3A 2GQIA 4J9DA 2LQWA 2HSEB 2X35A 2KRNA 1QWEA 2HKQB 3ZBDA 2KSSA 3JB9F 4C5HA 3CEYA 2P84A 2V26A 1MMAA 1OQKA 1PC0A 1OYXA 3CMAQ 1IZ6A 1QVGP 1WHKA 1ZUYA 1OGUB 1WYXA 2M0OA 1OOTA 3VYGA 1VUBA 3X26B 1QW1A 4EOJB 1NPRA 3MY5B 1ZUKA 2DJQA 1VQKQ 2QQ9A 5CKDA 3KXTA 3JCMW 2PQWA 1JQQA 2WHBB 1T3SA 4C5EA 3QXEB 3EH1A 1W70A 2DERA 2AKLA 5EFQB 3OS5A 4M77C 8AT1B 1Q86C 2HCKA 3CCQQ 2L8DA 4YOOA 2WACA 3HB9A 4J6YA 5GAN7 1KC8R 2KAFA 4G6LB 2RJEA 2E4HA 2F2CA 1QKXA 4PL6A 1UFFA 2DAQA 3CCLT 2AIRB 2CKKA 3OW2P 2MOXA 2ED0A 3M59A 4JRPA 2F5TX 1I0CA 4M7AD 1BI1A 1NJIU 4C8QD 3CBMA 3RR6A 1M4ZA 2RHUA 2FRWA 3NTHA 3OBYA 1Q7YU 4EOMB 1QP2A 2KROA 1RI0A 1VQ9A 2Z0WA 3RKYA 2NUTA 3VU3C 2MIOA 2X9HA 3EFSA 3SWNC 5FGKB 4CFXB 2KT1A 3WVEB 5GMKm 3CMEQ 2V8KA 3RUXA 1BKBA 1YIJA 2DD5A 1K8AR 1RLPC 2R5AA 3UWNA 2RQUA 4AFZC 3JCMf 2K4YA 3OSSC 5GAMf 1HJDA 2P0QA 3DTOA 2LX7A 3GIBA 2WPAB 2E1HA 2RHYA 1YJWQ 4WTOB 2ZPGB 2XKOC 1VQNA 1M1KR 2DBKA 3E2UA 2UUEB 3QWYA 4OMQA 4DQ2A 2ZAEA 4HCCA 1UGSB 1TWBA 2EYXA 2PK9B 3CCSQ 3OQ5A 1VQ5T 5CKHA 4GBQA 2LZ6B 1M3AA 1IXDA 5IDNB 4X1VA 3H4CA 3FLGA 4M7AF 5LJ5f 3HRTA 2KEAA 3CD6A 3VRYA 1GXIE 2DD4A 1KC8U 4A54A 2HL3A 4F7UA 2I53A 3ASKA 2HAXA 3O0GD 1X6BA 1YJ9T 4JX6A 3P8HA 2DKGA 1QVPA 3PIOA 1W4SA 2K57A 1FWZA 5KYNA 2SEMA 5HK3A 4A53A 4M77B 3V8JA 2MF2A 1D1CA 1HK9A 2ROTA 4J9FA 2E3HA 1IHWA 1KSWA 3KHIA 1IRXA 2DVEA 3CCEQ 3M4YA 2UZDB 1XJWB 2X4JA 2WSEE 3NDQA 4E7HA 3H6ZA 4J7FA 4NC6A 2A3LA 4LOCA 2JNGA 1KG1A 1TSFA 5AYFA 4ROCA 5IT9E 3U23A 1M2VB 3EFOB 5GMKj 5GANj 4LDXA 1SKUB 2QGGA 1K8AU 2ZZDA 5GJVB 1H26B 4C8QE 3BLHB 1ZSGA 5KCOA 1VQKT 3MJXA 4F7NB 2MYSA 4ZN1A 4KRTA 3J7AF 2CSQA 2VKNA 2DL7A 5AT1B 4DEYA 5CKBA 4RTXA 4BY7X 4L59A 2C5XB 4FX3B 3L2VA 2DEUA 1M1KU 1AD5A 4QT7A 3V7CA 3ULRB 2NUPA 1QCNA 4A4FA 2QGSA 1N27A 1BU2A 1ZSZA 2DTOA 3MKDA 4RKUE 2R7GA 2EAYA 2QF7A 1N8RC 4NL3A 1LOJA 3M0UA 2HQHA 4C92C 2EBPA 1G3WA 2YDLA 4M75C 2FRYA 2MPXC 1P5EB 2C5NB 5HK0A 3M4GA 4Y92A 2BUDA 4DBHA 4CC2A 3G7ZA 4EC9B 1VQMQ 2LJ1A 1AHJB 2DFUA 3CCJA 2CH4A 1B34A 5KYWA 1UG1A 2ROLA 1UTIA 4BCNB 1BI2A 2D1XA 2K7AA 2ZPEB 3UT1A 2PU9B 2OTJA 2AT1B 4E7LA 2RA2A 1G2BA 1ZBJA 1QVFP 2YRCA 1VQ9Q 2LCLA 2DXUA 3CCLA 4PJOG 3CMET 3LW5E 3OYCA 1VQ8A 1KJWA 4O6JA 1H92A 1HSQA 4M77D 4GLKA 1W1FA 2M02A 3M58A 2CYZB 2BS4A 1Z9QA 1YIJQ 4ANJA 3OYLA 3C4SA 3I56Q 5J39A 1FVVB 1KK7A 5IHKA 3MEAA 1O75A 5CO7A 4ROEA 1AVZC 3S3NA 1PCXA 1PKDB 1X69A 4N0AC 1SRMA 4BDZA 4F70B 2F2WA 1Y96A 4OMLA 3CCST 4BCQB 2LX9A 3A8LB 1M2OA 2M16A 5GAOn 2AHJB 4IIOA 1GUXA 1V29B 2E12A 2KQWA 4PLIA 3FEOA 1UNLD 2M0YA 2JTFA 1Q82C 1KQSS 3PGGA 4J9HA 5HBJB 2JXBA 4PJJA 2B86A 1H641 1OU9A 2GBQA 1U5SA 2WIPB 2VUBA 3REBB 2DBMA 3EGXA 3CC4A 5FWBA 1NBEB 4C0ZA 4JX5A 2GFUA 3S3MA 4JJDA 1H3ZA 3QYHB 2ESWA 2DXBB 3H41A 2X3XD 2YHTA 4MMKA 3CXCA 1NZ9A 1VQ5A 1Z9ZA 1N9SA 5CKEA 5CAIA 1OX8A 4NL2A 4F7UF 4E2FB 1TUDA 1YBYA 4E7ZA 2CP0A 3UA6A 1E9HB 3CCET 2D8HA 2W99A 1D1BA 3TNHB 4FL6A 2DNUA 1WQ7A 1JJ2P 3JCMQ 2OTLT 4CFMB 4BCND 5DY9A 2DEQA 1RAGB 1TUCA 4C92B 1E7PA 4M75B 4RMOA 2X3WD 3CC7A 3FJPA 4RTZA 1YJ9A 1RAHB 3CCVA 3OS2A 3JCMh 2JOYA 4PFPA 5GAMh 4F04B 1H4LD 3QSUA 3I55A 2QFZA 4FT4A 1ENWA 9ATCB 1UHCA 2K5FA 4E7KA 4A4GA 4QVZA 4FW1A 2GF7A 1WHLA 4JX4A 4EDUA 2DXCA 4OB3B 1BIAA 4FYXB 2JT4A 5FU7B 4X9CA 4EC8B 5I2SA 1WGSA 2X4WA 3CPFA 3QWLA 4M7AC 2DL3A 4BACA 3CMAA 1ARKA 1TUGB 1AWOA 4M77E 5BNJB 5LJ3f 2FZGB 2DK3A 2L3PA 3JB9I 2A28A 4B9XA 4DBQA 4PJNA 5LJ5h 4M7DA 4XK8E 2GGRA 4BCQD 2VYTA 2QQ8A 5GAOl 2DMEA 3JV3A 3VKIA 3CPWA 1EFNA 3OMGA 1TS9A 2Y4XA 3CCQA 3E1SA 4M6VA 2ZPHB 1YWOA 1VOLA 3PT9A 2E70A 3PNWC 1ZLMA 2O88A 3DOGB 2WXVB 3L2QA 1VQ9T 3MEUA 2XU8A 1MNEA 2RHIA 2CS7A 2IW8B 3A8OB 3RDVA 4ELZC 5CQXA 4ZNXA 1NEBA 3BLRB 2EQJA 2BKDN 4BDYA 1M8MA 2VXFA 1WXTA 4M77G 2K2MA 3EG9B 5I2MA 1VQ8Q 1YIJT 3CBOA 4ELLA 1N4MA 1E6HA 3I56T 3G4SQ 2JZ2A 3BHUB 3EHRA 1VOMA 2L3RA 5CYIB 2ZCFB 2C0OA 2RQRA 4C92D 4M78A 2UZEB 3GF5A 4M75D 4IKFA 1X27A 1VQNT 3TCJA 4MZPA 4LXCA 4L6V5 4N4HA 4OB2B 3CMEA 5D6WA 4O5VA 2GQVA 4CC7A 5A2QE 5GANd 4J8OA 4PLLA 3OYKA 4XU3A 4WCIA 1AD6A 2C4GB 1YCSB 1W98B 4ORZA 3L1AA 1WDXA 1OIYB 5HBEB 1ZP2A 1QKWA 3M5AA 2COYA 2YWWA 2NUZA 1VIEA 1WA7A 1YJWA 1VQ6Q 2KXCA 2DJZA 2QK0A 3F70A 4AFSC 2CREA 2GFAA 3L2WA 3JB9D 4KT0E 7AT1B 2V1RA 1EIFA 1YN8A 3BG9A 3CCSA 1UGQB 1OIUB 3EJ1B 2DL5A 2J06A 2W2HA 2BTTA 1G3NC 2WMAB 4GLMA 4FCYA 4E47A 5GAN6 2FL7A 2LQKA 2C5OB 2L0AA 3V7SA 2RJCA 3CBPA 4L5GA 2AK5A 4JZ3A 2DLPA 1XNIA 1M1FA 3G6EQ 4P5NA 4EMGA 4J9IA 2EQKA 2M51A 2XICA 4AFQC 4XTWA 1I07A 1K76A 2JMAA 2RI2A 1IGQA 1XQHA 4XU0A 2G6FX 2X1NB 3BG5A 3BW1A 4HT9A 3GBQA 4EOQB 4AKGA 1RAIB 4R0KA 5LJ5j 2KDSA 4PJOA 3VS1A 4CC3A 5KE3A 1U1SA 1FMVA 2K79A 4EIKA 1X6GA 1NYGA 2VGNA 3L2UA
chains in the Genus database with same CATH topology
3GOXA 4M7AF 3TREA 1I8FA 5LJ5f 3HRTA 1VQ4T 2HBPA 3CD6A 2LC4A 1Q7YC 4ZGJB 1G3TA 3CCUA 3TW6A 1JBMA 4EMKC 2NLUA 1GXIE 3A8MB 2D0QB 2DD4A 3Q1JA 3OS0A 1KC8U 3OSVA 4A54A 1VQPA 1YHQA 4PJOC 3SD4A 4F7UA 2RI5A 2P4TA 3J80E 4FU6A 3ASKA 4OB1B 4AKHA 1NJIC 2HAXA 2QQRA 3QJ6A 2M1HA 3OYBA 1M90U 2P0PA 4RCBA 4JRKA 4JX6A 3P8HA 5J26A 2DKGA 2X4YA 5GMKl 5GAOq 2VGMA 4XAXB 4XTZA 1K73U 1QVPA 2EYQA 3CCMT 2O4XB 3CC2A 4OB0B 3PIOA 1I5LA 1W4SA 2K57A 1PSEA 2LQ8A 1FWZA 4N4GA 3VUZA 4JUVA 2EQMA 5HK3A 4QQDA 4BE1A 3TW7A 2K5IA 4A53A 4E7JA 3M54A 2K3XA 2L89A 4M77B 4BD3A 3V8JA 2MF2A 1HK9A 4XTVA 5I21A 1BYMA 4A4KA 2E65A 3FIFA 4BI8B 2FHDA 4C92E 5CQYA 4M75E 5CR2A 4J83A 3OYFA 4M7DF 3VYGB 2FB7A 1ZQ1A 2V8IA 3HPWA 3KHIA 4C0GA 2MWOA 2KMTA 2DVEA 3HP9A 4Y91A 2QEXT 3E9FA 2E6NA 3CCJT 3M4YA 4MFDA 2LT4A 1Q81C 2KY9A 4B9WA 3C95A 2X4JA 2WSEE 3V8LA 1Y7XA 2HQXA 4E7HA 3H6ZA 4J7FA 4MZTA 4C5IA 2CZ6B 2IG0A 2YRVA 4XQ3A 2OTJT 4NC6A 2A3LA 4LOCA 3JCMV 2ZPIB 2JNGA 3OW2S 1KG1A 1S72A 2DXBA 1KHIA 4M78B 2X4XA 3NTIA 5AYFA 4MDWA 3QO3A 2PVOB 5IT9E 2QA4T 3FRNA 4OMFB 4PNOA 3RMSA 5GMKj 4ELYC 1M9SA 4JLIA 5GANj 1D3BA 3N5BB 2RI3A 1VQMA 2D9TA 3GP8A 1JJ2A 1VQ8T 1YI2T 3X25B 2XG8D 2ZZDA 5GAN8 1K8AU 4C8QE 4J6XA 4BY6C 2RD1A 5KCOA 3JCMb 1VQKT 4JLGA 3R6OA 3G4ST 4ZN1A 2DPPB 1X01A 3J7AF 3M9QA 4M77F 3HBLA 1WJRA 5CKBA 3V8KA 2I2LA 4C92A 4CI0C 4M75A 4L59A 3L2VA 1MGQA 2QDJA 3BDLA 3MP8A 1M1KU 1G5VA 3M57A 3UDCA 3VKGA 2MAMA 1O9SA 3JRZA 3V7CA 4C92G 4JS4A 4M75G 3BY7A 3TEEA 2PUKB 3SDZA 2G3RA 4A4FA 1N27A 2RH2A 2DTOA 5CVIA 4RKUE 4V2SA 5GAMj 4YTLA 4HKEA 2EAYA 3VYHB 2QF7A 3X24B 1Q82U 1WQWA 5GAN5 2Y90A 1KC8C 2JUFA 3CCMA 3RMQA 4M78F 1N8RC 2DTHA 4XTUA 4QW2A 4NL3A 1LOJA 3RIRA 1LJOA 3QZ9B 2R57A 2VV5A 4C92C 1G3WA 4M75C 2OAUA 1JB0E 2Y4YA 3MCAB 1M90C 4M7DD 4WF2A 1K73C 1FKMA 5HK0A 3M4GA 3ER0A 5C0MA 3I56A 1WPYA 2BUDA 4M7AA 5LJ3h 2RJFA 1VQ6T 3WXMB 3G7ZA 2D6FA 2PVGB 2A7YA 4C8QA 1AHJB 5IAYA 4J5YA 3OYNA 2DD5B 3CCJA 1W2BS 1B34A 1VQLT 3QZ5B 5LJ3d 3S6WA 2RK1A 4A4HA 1UGRB 4QQ6A 1BI2A 2KVQG 1VQ7T 4BE2A 4X9DA 5HKCA 2LNVA 4HCBA 3CC4T 2LT1A 3LX7A 2RHXA 2ZPEB 3UT1A 2PU9B 2OTJA 3QBYA 4E7LA 3OBWA 2XDDA 3HRUA 2RA2A 4ZGDB 2LTOA 5FU6C 1W2BA 3LWHA 1KHCA 3OYMA 3QYBA 1N9RA 4LDXA 2LCLA 3OYYA 3FC3A 4MZMA 2FYKA 4C8QC 4KUDK 2DXUA 3CCLA 3GNGA 4PJOG 3MP6A 3CMET 3LW5E 3MHXA 4RG2A 3HHTB 2EWNA 3OYCA 3LWIA 1VQ8A 2KMGA 1R8OB 2B8AA 3FDRA 4M77D 4O6JA 4EMKB 4GLKA 5DM7R 5LJ3g 3HO8A 4N0AA 4PJOB 4FSXA 1VQKA 4Y28E 2XDBA 3M58A 2CYZB 4TVRA 4QVCA 1QVGS 2BS4A 3UPUA 3QYEA 5LJ3e 4LDVA 1K8AC 2QQBA 3MEWA 2O01E 3OYLA 2E10A 3A8GB 3C4SA 3OB9A 4GY5A 2CZ1B 3MP1A 1Y07A 2RB6A 3NTKA 3CC7T 5J39A 4F7UG 1XOVA 1QVGA 3MEAA 4XTXA 1O75A 3CCVT 3E9GA 5CO7A 2QQAA 3S3NA 2DD4B 1HXDA 5FLXE 4M78D 4N0AC 4BDZA 3VUBA 4F7UB 2XIDA 3J81E 1M1KC 2JVVA 4AKIA 2JTMA 1Y96A 3SFMA 1VQOT 3CCST 4C0DB 1JRIA 4OP0A 5HY6A 4QSHA 4ZN3A 3I55T 1KD1U 2LX9A 3H8ZA 3A8LB 3QUIA 4Q5WA 2M16A 4A4EA 4LD9K 5GAOn 3HFNA 5GMKi 2AHJB 3QJYA 5FRMA 3RERA 1QLBA 4KULA 1M8VA 1V29B 2E12A 2KQWA 5L8RE 4PLIA 4C0DC 3JB9J 3FEOA 1YCYA 2JTFA 2F5KA 1Q82C 3PMTA 4C5GA 4MDXA 1KQSS 3PGGA 3DLLA 1X75C 4PJOF 1H641 1PSFA 3L42A 4BBRM 1VQLA 1BIBA 1YITT 2EKOA 1MHNA 4HT8A 4RCCA 3DL1A 1DJ7B 1ZHIA 3CXCS 2VUBA 1VQ7A 4NS5A 2VXEA 4BY6B 3CC4A 1NE8A 3CMAT 2V8JA 1KQSA 4OF1A 4C0ZA 4JX5A 4JRIA 4OGCA 2GFUA 4D6WA 3S3MA 3PMIA 3OA6A 3JCMX 1FX7A 1OZ3A 4M7AE 1H3ZA 3QYHB 2RK2A 3LGLA 3CCRT 3VKHA 2DXBB 3OW2A 4II1A 2YHTA 3FLGA 4MMKA 4BBSM 1YJNT 3CXCA 1NZ9A 1VQ5A 1N9SA 5GMKh 3INZA 4HCZA 5CKEA 2CZ7B 5CAIA 4NL2A 4F7UF 5GANh 3ZFJA 5CKFA 2YLCA 4JS5A 1D3BB 4AI6A 1YBYA 2XDPA 3L2ZA 2G77A 2CGHA 4C0FA 5DLQE 5A0LA 2ZZDB 3CCET 2EFIA 4HNVA 1VQ4A 4BB7A 3CCQT 2RO0A 2F69A 3BG3A 1U1TA 2VC8A 4FL6A 1WQ7A 5A0GA 1IREB 4J6WA 3JCMQ 2OTLT 2BIVA 2KR6A 2ZPFB 1G3YA 1WNLA 3M56A 2KK4A 3KUFA 1WJQA 5DY9A 2DEQA 2XHCA 5LL6S 4R55A 3KBGA 3OYDA 4Z02A 4C92B 3A5ZB 1E7PA 4M75B 4RMOA 4IUUA 3CC7A 3CD6T 3FJPA 2R58A 1YJ9A 4BUGA 5GAN4 3CCUT 4M7DE 3CCVA 1N6AA 3HZJA 1VIFA 2QI2A 4Z6YA 2DIGA 3BFMA 3OS2A 1YHQT 3JCMh 2LRQA 5GAOp 3L2RA 4ATOA 2DZ9A 2JOYA 3JCMJ 5GAMh 1LNXA 3M55A 2E5QA 2PVDB 2EIFA 4N4IA 5CCAA 3PTAA 4JDSA 3QSUA 1I4K1 5FROA 2QFZA 3V7RA 3JCMd 2DZCA 1X6OA 4FT4A 3I55A 2GCXA 5GAMd 3OYGA 4ZTJA 2K5FA 2EJGA 3C12A 4OVAA 4E7KA 4M7AG 2E41A 4A4GA 3OYHA 4QVZA 3MO8A 4JRQA 2QEXA 2GF7A 1FXXA 4PJOD 4JX4A 4HLQA 4C8QG 1QVFS 2M9UA 5IN1A 1K9MU 4NOYA 4EDUA 5FU6B 1KD1C 2DXCA 4HA8A 2HQEA 1XTDA 2RM4A 2LVMA 3NFCA 3LLRA 5EG2A 4M7AB 3JB9G 1Q81U 1Q86U 3QIIA 4OB3B 1BIAA 5FU7B 3SB2A 4IUPA 3GPLA 4C8QB 1BI0A 4FT2A 3OYEA 2EQUA 4LD6A 3P8BB 4X9CA 3BDUA 1B34B 5GAN2 5I2SA 1WGSA 2X4WA 3CPFA 3QWLA 3RKWA 5M9OA 4M7AC 3LH0A 4ZGEB 4EPCA 4LDUA 5FU7C 4BACA 3CMAA 2QA4A 4M77E 3JCMg 5LJ3f 2DK3A 4C92F 1OI1A 3HKSA 3JB9I 4M75F 2CZ0B 4B9XA 5GAMg 1TH7A 3CPWS 2MWPA 1S72T 3O8VA 5LJ5h 1YI2A 3JCMe 1Y71A 4OGEA 3OS1A 1YJNA 3ME9A 1UGPB 4E7IA 4M7DA 3HFOA 4XK8E 3G71T 3DB4A 5GAMe 3MEVA 2LCCA 2VYTA 5J3BA 5LJ5d 2QQ8A 3G4SA 4M7DG 4HNTA 2HNIA 3DKMA 5D6XA 4BI4A 5GAOl 3OYIA 3GLXA 2H3JA 1I81A 3ZEHA 3G6ET 4IURA 4HL4A 3HRSA 3VKIA 3CPWA 3OMGA 3CCEA 4ME7A 1YJWT 3QG1A 2Y4XA 3DLMA 3CCQA 2P0KA 2QQSA 4M78E 4MMLA 3E1SA 2JN0A 4M6VA 2ZPHB 3QYGB 3PT9A 4LDWA 4EMHA 2E70A 2OTLA 4KUIA 4KBMB 3OY9A 1M5Q1 5GAOr 1QP3A 2BS2A 4M7DC 4VUBA 3PNWC 2X35A 3URGA 2DO3A 4C8QF 3OYJA 3RKXA 3ZBDA 5KE2A 5KH6A 3L2QA 2KSSA 3QDRB 4DOWA 1VQ9T 3MEUA 3JB9F 4C5HA 2O4XA 2XU8A 2RHIA 5LJ5g 2CS7A 1N8RU 3CEYA 3A8OB 4ELZC 2ZPBB 5CQXA 2LDMA 3HL8A 2MMPA 1OYXA 4HNUA 4M77A 5LJ5e 3TU4K 3PIPA 1IZ6A 2EQJA 1Y96B 2BKDN 4BDYA 3S3OA 2VXFA 1VQ6A 4M77G 4DA4A 3EFRA 2M0OA 5CIUA 5I2MA 3VYGA 1VUBA 1YIJT 3X26B 4DOVA 1QW1A 3CBOA 1NPRA 3QHSA 4J7IA 2DTIA 2E6ZA 4ZTFA 1P92A 2QQ9A 5CKDA 3KXTA 2R5MA 3I56T 3JCMW 2PQWA 3JSCA 3WVDB 2JZ2A 2DIQA 3E19A 1ZBXA 4C5EA 1G3SA 3QXEB 1RL2A 2L3RA 2YLBA 4IUTA 2ZCFB 3JCMP 4JJNK 3OS5A 4M77C 1K9MC 3M53A 4C92D 4M78A 3GF5A 4M75D 1Q86C 4IKFA 2XK0A 2L8DA 4MFEA 1VQNT 3TCJA 3QPHA 4M78G 2WACA 2XI9A 3P8DA 2K5LA 4MZPA 5EJCA 4XU2A 4L6V5 4XU1A 3LGFA 4N4HA 4OB2B 3HB9A 4J6YA 5GAN7 3CMEA 5D6WA 4O5VA 1JJ2S 4LDYA 2GQVA 2KAFA 4CRIA 1KQ2A 3GNFB 2RJEA 3X28B 3LYIA 5A2QE 4QQGA 4BE0A 5GANd 1M1GA 4J8OA 4PL6A 4PLLA 5DLOA 3OYKA 3G71A 4XTYA 4XU3A 2DAQA 3CCLT 3L1AA 3FB9A 2CKKA 4QVDA 5GAOm 3META 1BI3A 4M78C 3G6EA 2PUOB 3M5AA 4BI3A 1U8RA 5A0DA 1SSFA 5CK9A 1VIEA 2EJFA 2RHZA 4FM4B 3M59A 4JRPA 1YJWA 2F5TX 4M7AD 4MIMA 5FRNA 2XD0A 2DJZA 1BI1A 1NJIU 3SWNA 3OYAA 5D6YA 3F70A 3CBMA 4C8QD 2DXTA 3L2WA 2GFAA 2L5QA 1M4ZA 2RHUA 5GANf 1WJSA 3JB9D 1KQ1A 1VQPT 4R56A 4KT0E 3NTHA 3OBYA 1Q7YU 1EIFA 1QP2A 1VQOA 3BG9A 5GANg 3CCSA 1RI0A 3SWNB 1VQ9A 3X20B 3JB9H 4PJOE 1UGQB 2QXFA 3CC2T 5GMKe 5GANe 3RKYA 3VU3C 3EAEA 3OMCA 3EFSA 2BS3A 3SWNC 2WSFE 2ZGWA 4UC4A 3WVEB 5GMKm 1OZ2A 5LJ3j 4ELJA 2V8KA 2WSCE 3RUXA 1BKBA 2C06A 4FIBA 3A8HB 1YIJA 4E47A 2DD5A 4X34A 4RG8A 5GAN6 2EJ9A 2FL7A 2LQKA 4PKCC 2R5AA 4IUQA 3UWNA 3JAME 1YJ9T 3JCMf 2K4YA 1YITA 3V7SA 2RJCA 3CBPA 4L5GA 5C6SA 1QVFA 2DXCB 3OSSC 4F7UE 5GAMf 3JCMc 1XNIA 1M1FA 2P0QA 4P5NA 4EMGA 2EQKA 3GIBA 2XICA 2QTXA 4XTWA 2E1HA 3DB3A 2RHYA 5KCHA 2RI2A 3RESA 3CCRA 2ZPGB 2XKOC 1XQHA 2RJDA 4XU0A 3VV0A 3HSBA 1VQNA 2FVUA 3QKJA 2QDYB 3BG5A 3BW1A 4DQ2A 4IUVA 4HT9A 2HD0A 3T9NA 4HCCA 1VQMT 1NPPA 3C94A 4AKGA 1UEBA 4EMKA 5LJ5j 2E64A 1UGSB 2WJ9A 2KDSA 2K2VA 3PFSA 1UB4A 3OQ5A 5GAN3 4M7DB 4PJOA 5KE3A 1VQ5T 1U1SA 2K3YA 2MI6A 3VJPA 5CKHA 3AHUA 2IVWA 2VGNA 3H4CA 3L2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD5 B;  1IRE B;  3QZ5 B;  3WVD B;  2ZPF B;  1UGR B;  3QXE B;  4ZGJ B;  2ZCF B;  1GXI E;  3A8M B;  2D0Q B;  2DD4 A;  2ZPE B;  2PU9 B;  4OB1 B;  4ZGD B;  4L6V 5;  4OB2 B;  4OB0 B;  3X28 B;  2PVD B;  1PSE A;  3LW5 E;  3HHT B;  4Y28 E;  2PUO B;  2CYZ B;  3VYG B;  2DXC A;  4FM4 B;  2O01 E;  4OB3 B;  3A8G B;  2CZ1 B;  2WSE E;  2CZ6 B;  4ZGE B;  4KT0 E;  2ZPI B;  1QP2 A;  2DXB A;  2DD4 B;  2PVO B;  3X20 B;  1UGQ B;  2CZ0 B;  1UGP B;  4XK8 E;  3A8L B;  3X25 B;  2WSF E;  2ZZD A;  2AHJ B;  3WVE B;  1V29 B;  2WSC E;  5L8R E;  3A8H B;  2DD5 A;  2DPP B;  2ZPH B;  3QYG B;  2DXC B;  1PSF A;  1QP3 A;  1DJ7 B;  2PUK B;  2ZPG B;  2QDY B;  3QYH B;  4RKU E;  2DXB B;  3A8O B;  2ZPB B;  3VYH B;  3X24 B;  2CZ7 B;  1UGS B;  3QZ9 B;  1JB0 E;  3VYG A;  3X26 B;  2ZZD B;  2PVG B;  1AHJ B; 
#chains in the Genus database with same CATH topology
 3TRE A;  4HXJ A;  1QCO A;  1JU5 C;  2CCH B;  2LC4 A;  5I11 A;  2V1Q A;  1K0X A;  1B3Q A;  4IIM A;  1JBM A;  2EQI A;  2D0Q B;  3OS0 A;  1VQP A;  1NYF A;  4HVU A;  2P4T A;  3J80 E;  4FU6 A;  2OI3 A;  1NJI C;  1TFB A;  1VYU A;  2QQR A;  4RCB A;  5J26 A;  4I3Z B;  2VGM A;  4XTZ A;  2A08 A;  1GY3 B;  3CCR Q;  1Q7Y C;  1GBR A;  3TW7 A;  2K5I A;  3M54 A;  4BD3 A;  4XTV A;  1BYM A;  4A4K A;  4C92 E;  2FHD A;  5CR2 A;  4M75 E;  4F6S B;  4M7D F;  3VYG B;  2FB7 A;  3CCJ T;  2MWO A;  3HP9 A;  3E9F A;  1NLP C;  1K1Z A;  2DVJ A;  1Q81 C;  3C95 A;  4FW2 A;  3TNW B;  2O31 A;  3DDQ B;  2IG0 A;  4EON B;  2OTJ T;  2COW A;  2ZPI B;  4BCO B;  1KHI A;  2X4X A;  4BCK B;  4MDW A;  3CCU Q;  4RTW A;  3RMS A;  1D3B A;  3N5B B;  1GCQ A;  1VQM A;  2LP5 A;  1WZO A;  2W0Z A;  1VQ8 T;  2IW6 B;  4BY6 C;  3HTR A;  3R6O A;  3G4S T;  1GCP A;  2DPP B;  4J9E A;  3HBL A;  2JTE A;  1NM7 A;  2CP5 A;  3V8K A;  1MGQ A;  1B07 A;  3MP8 A;  3M57 A;  3UDC A;  5FW9 A;  3THK A;  4C92 G;  4M75 G;  3BY7 A;  3SDZ A;  2G3R A;  5D7U A;  5L23 A;  4BCF B;  2C0I A;  1KC8 C;  4FYV B;  4M78 F;  2DTH A;  4XTU A;  4QW2 A;  2KYB A;  2R57 A;  2NUT B;  1FKM A;  3I56 A;  5C0M A;  5LJ3 h;  1VQ6 T;  2A7Y A;  5IAY A;  1ZSZ C;  4J5Y A;  2DET A;  2DD5 B;  3S6W A;  4QQ6 A;  1Y0M A;  1AWJ A;  5HKC A;  4HCB A;  3CC4 T;  1M30 A;  4ZGD B;  2LTO A;  2YRD A;  3OYM A;  1N9R A;  2CH4 W;  2DE0 X;  4TTH A;  3OYY A;  3FC3 A;  4MZM A;  3O5Z A;  4KUD K;  3MP6 A;  3MHX A;  3LWI A;  1UUE A;  4FSX A;  3CCM Q;  2G9X B;  1SG5 A;  4TVR A;  3VS2 A;  4LDV A;  1K8A C;  2LJ0 A;  2QQB A;  3MEW A;  4GY5 A;  2CZ1 B;  2FO0 A;  1K9M R;  2RB6 A;  1R0B G;  3CC7 T;  4BCP B;  3CCV T;  3E9G A;  2DD4 B;  1PWT A;  1OV3 A;  2O9V A;  4F7U B;  2XID A;  1M1K C;  3SFM A;  4C0D B;  3I55 T;  3CQT A;  3H8Z A;  4RTU A;  3PE0 A;  3QUI A;  4LD9 K;  2VWF A;  3HFN A;  5GMK i;  3QJY A;  3BHV B;  1TG0 A;  3RER A;  1RAA B;  1YCY A;  4MDX A;  2F5K A;  4Y72 B;  3BHT B;  2IN3 A;  2P4R A;  2PHG A;  1UE9 A;  4PFZ A;  1GH6 B;  4PJO F;  4BY1 X;  3L42 A;  4BBR M;  2BZ8 A;  1BIB A;  3NMZ C;  2EKO A;  5IXB A;  2K9G A;  4RCC A;  2E5K A;  1ZHI A;  3CXC S;  4BY6 B;  3CMA T;  4OF1 A;  3RNJ A;  4OGC A;  4JRI A;  1VQP Q;  3JCM X;  1GL5 A;  1OZ3 A;  4M7A E;  3M03 A;  3CCR T;  3VKH A;  2OX7 A;  3EG3 A;  2CDT A;  4M4Z A;  4Z8A A;  4F6W B;  3INZ A;  3DDP B;  4JS5 A;  2SRC A;  1BK2 A;  4AI6 A;  2XDP A;  3L2Z A;  3EGU A;  2G77 A;  5DLQ E;  5A0L A;  2RQT A;  2ZZD B;  3VS3 A;  4EOR B;  2JW4 A;  3CCQ T;  3C0C A;  1U1T A;  2QAS A;  4NST B;  2KK4 A;  3MI9 B;  2K3B A;  3OYD A;  1V76 A;  5I5Z B;  2GTO A;  3CCU T;  2H3E B;  1VIF A;  1VQL Q;  2NUP B;  1O9K A;  1VQ7 Q;  1ZSZ B;  1I1J A;  1MUZ A;  3EG1 A;  3JCM J;  3VRZ A;  1LNX A;  3M55 A;  2E5Q A;  2LJ3 A;  5CCA A;  1I4K 1;  1H1Q B;  5FRO A;  3JCM d;  1X6O A;  4OMP A;  2ECZ A;  2J05 A;  5GAM d;  3OYG A;  2EJG A;  4M7A G;  2K6D A;  3REA B;  3OYH A;  1FXX A;  5KYY A;  4HLQ A;  4C8Q G;  4LN2 A;  5IN1 A;  1K9M U;  4NOY A;  2RM4 A;  2LVM A;  1R0C B;  3QII A;  3SB2 A;  4IUP A;  3GPL A;  4OMM A;  1BI0 A;  2EQU A;  2RMO A;  4LD6 A;  1B34 B;  5KYW B;  5IDP B;  1U3O A;  4DEX A;  4ZGE B;  5FU7 C;  5HVY B;  1A0N B;  2NYS A;  4PK4 A;  3HKS A;  1ABQ A;  2CZ0 B;  4KH0 B;  3CPW S;  4ROD A;  2YUO A;  1ZA1 B;  4J9G A;  3ME9 A;  4E7I A;  2EUF A;  4BCJ B;  3HFO A;  1TTH B;  5J3B A;  5LJ5 d;  3TSW A;  3G4S A;  5D6X A;  3GLX A;  1QLY A;  4HL4 A;  1SHG A;  2LCS A;  4ME7 A;  1YJW T;  3EGD A;  3QG1 A;  2DL4 A;  3DLM A;  4EOL B;  2QQS A;  4MML A;  1X2Q A;  4KGV B;  4M7D C;  3H0I A;  2EGE A;  2PJQ A;  3QHR B;  4F7J B;  3RKX A;  5KE2 A;  4DOW A;  2JJ9 A;  4BCG B;  2O4X A;  2VB6 A;  1N8R U;  1IB8 A;  1NG2 A;  3HL8 A;  2MMP A;  4HNU A;  2YXY A;  1QCF A;  3TU4 K;  1Y96 B;  1VQ6 A;  4DA4 A;  3EFR A;  5CIU A;  1YI2 Q;  2VVK A;  1YJN Q;  4J7I A;  2DTI A;  1GUX B;  2E6Z A;  5KYU A;  1P92 A;  4ZTF A;  3WVD B;  1BBZ A;  4CRL B;  5HNB B;  2WMB B;  1G3S A;  4F7S B;  4JJN K;  4F14 A;  2UZB B;  1RAD B;  3QWX X;  5L2W B;  2L3Q A;  3EGX B;  2IIM A;  3QPH A;  4F7L B;  1OL1 B;  2XI9 A;  3P8D A;  4XU2 A;  5EJC A;  4XU1 A;  1BB9 A;  4CRI A;  3GNF B;  2PZ1 A;  3VS0 A;  3LYI A;  4QQG A;  4BE0 A;  2BE7 D;  1OL2 B;  1M90 R;  3IQL A;  1K73 R;  4QVD A;  1BI3 A;  4M78 C;  3G6E A;  2PUO B;  1WIE A;  1U8R A;  5A0D A;  1SSF A;  3CXC P;  2EJF A;  4MIM A;  1YFN A;  2XD0 A;  3BE3 A;  1U06 A;  5D6Y A;  4KGX B;  4DBF A;  1OU8 A;  5GAN f;  1WJS A;  1RUW A;  1KQ1 A;  1VQP T;  2KRS A;  2DX1 A;  3TNI B;  1JXM A;  5GAN g;  1PD0 A;  3X20 B;  3QHW B;  4FYY B;  2NWM A;  5GMK e;  5GAN e;  1OUL A;  2F1L A;  2BS3 A;  2O9S A;  2ZGW A;  1FYN A;  4UC4 A;  1D0Z A;  2HEQ A;  1E6G A;  1OZ2 A;  4ELJ A;  1JSU B;  2LQN A;  2C06 A;  3A8H B;  3VS6 A;  4RG8 A;  5KYX A;  2YSQ A;  2EGA A;  3G71 Q;  2C0T A;  2HBW A;  1QMZ B;  2PTK A;  2DXC B;  4F7U E;  1T3L A;  1UDL A;  3JCM c;  1Y57 A;  3M0S A;  2L2P A;  5KCH A;  1H8K A;  3CCR A;  2RJD A;  3VV0 A;  3QKJ A;  2QDY B;  3POM A;  1K0S A;  2O2O A;  1UNG D;  2PMI B;  2CP2 A;  1JEG A;  4FYW B;  4IUV A;  2HD0 A;  3T9N A;  1VQM T;  4EMK A;  3TN8 B;  1VQO Q;  2WJ9 A;  1URC B;  2K2V A;  3PFS A;  1UB4 A;  4M7D B;  3NGP A;  1H27 B;  2RQW A;  2GNC A;  2K3Y A;  2MI6 A;  3VJP A;  4EOO B;  3PVL A;  3EHQ A;  1RI9 A;  1F1B B;  4KUL A;  1I8F A;  4ZGJ B;  3CCU A;  2WIH B;  1TXQ A;  3A8M B;  3CPW P;  1YIT Q;  4PJO C;  5IHN A;  4AKH A;  2M1H A;  1M90 U;  4JRK A;  1VYT A;  2X4Y A;  1K73 U;  1PKS A;  4XAX B;  3D7S B;  2EYQ A;  3CC2 A;  4OB0 B;  2KYM A;  1I5L A;  3VUZ A;  8ATC B;  4JUV A;  4BE1 A;  2W10 A;  2L89 A;  3SHW A;  5I21 A;  4LNP A;  3FIF A;  4BI8 B;  2OJ2 A;  4J83 A;  3HPW A;  4C0G A;  2KMT A;  4Y91 A;  2E6N A;  3K7A M;  4MFD A;  4CXA B;  2KY9 A;  2CP3 A;  2QDL A;  1C0M A;  1Y7X A;  1JXO A;  4C5I A;  2YRV A;  2EW3 A;  1NEG A;  4XQ3 A;  1RAE B;  2AZS A;  3OW2 S;  2EGC A;  4M78 B;  3NTI A;  2PVO B;  1KQS P;  3FRN A;  4PNO A;  1M9S A;  1I5O B;  1YHQ Q;  2JMC A;  2D9T A;  1YI2 T;  2XG8 D;  5GAN 8;  4J6X A;  2RD1 A;  1LPL A;  1KFZ A;  3MPU B;  1KD1 R;  1W6X A;  1X01 A;  1N5Z A;  1H3H A;  1WJR A;  5IHI A;  2I2L A;  4CI0 C;  3BDL A;  1G5V A;  3VKG A;  4CFU B;  1O9S A;  3JRZ A;  1GCQ C;  2PUK B;  1EZZ B;  2ABL A;  2E3I A;  2RH2 A;  2IPO B;  5CVI A;  4RUG A;  2MK5 A;  4E7S A;  1OKV B;  4RTV A;  5GAM j;  2B9R A;  1FMW A;  1WX6 A;  3VYH B;  1K9A A;  5GAN 5;  2Y90 A;  3CCM A;  2BE9 B;  4BCM B;  1S72 Q;  3RIR A;  2VV5 A;  3QZ9 B;  2KNB B;  4M7D D;  2OAU A;  3MCA B;  3A1P A;  4WF2 A;  1AT1 B;  1MV3 A;  4LUE A;  1WPY A;  4M7A A;  4YOS A;  3WXM B;  2PVG B;  2QYZ A;  4C8Q A;  5IHY A;  5LJ3 d;  4A4H A;  2XMF A;  3B57 A;  2KVQ G;  4KGZ B;  5ECA A;  4BE2 A;  2LT1 A;  3AT1 B;  3LX7 A;  2RHX A;  2BZX A;  3OBW A;  3HRU A;  5FU6 C;  1W2B A;  3LWH A;  1KHC A;  5I22 A;  3NPF A;  3SEM A;  1UGV A;  2KXD A;  2KMG A;  2B8A A;  3FDR A;  3BLQ B;  5DM7 R;  3HO8 A;  4PJO B;  4J9B A;  4Y28 E;  1T0J A;  4QVC A;  4CFN B;  1ZX6 A;  1H1R B;  3UPU A;  3QYE A;  1CKB A;  4IMY B;  2O01 E;  2E10 A;  3A8G B;  3TQ7 P;  2MCN A;  1Q86 R;  2DA9 A;  1XOV A;  4RTT A;  1QVG A;  2W9F A;  3ZL7 C;  5IF1 B;  2QQA A;  5FLX E;  4M78 D;  1WHJ A;  3VUB A;  2LNH B;  3J81 E;  1CKA A;  2JVV A;  4AKI A;  2JTM A;  2OAW A;  1VQO T;  4OP0 A;  5HY6 A;  4QSH A;  4ZN3 A;  1KD1 U;  4Q5W A;  3RGF B;  1PM3 A;  4PJM A;  4A4E A;  3M0T A;  2YUQ A;  1FMK A;  3VS7 A;  1QLB A;  1M8V A;  1SEM A;  4PFO A;  4C0D C;  1YNZ A;  2DYB A;  2KRM A;  3VS4 A;  3PMT A;  2RPN A;  2PNI A;  4II5 B;  2A37 A;  1PSF A;  1VQL A;  1YIT T;  4HT8 A;  1MHN A;  2DL8 A;  3DL1 A;  1VQ7 A;  4NS5 A;  4CFU D;  2RNA A;  1NE8 A;  2V8J A;  3PMI A;  3OA6 A;  1FX7 A;  3UF4 A;  4CFV B;  2RK2 A;  3LGL A;  3OW2 A;  4OR5 B;  4D8D A;  1GBQ A;  2VAS A;  2KGT A;  5FWC A;  1BU1 A;  3CC2 Q;  5GMK h;  5FRM A;  4HCZ A;  4BCM D;  5GAN h;  5EC7 A;  5CKF A;  2YLC A;  1D3B B;  2CGH A;  1H25 B;  4C0F A;  2EFI A;  3EG0 A;  2VC8 A;  4HVV A;  1KXU A;  1IRE B;  4J6W A;  2BIV A;  1IGU A;  2ZPF B;  1WNL A;  2KE9 A;  3KUF A;  1WJQ A;  4R55 A;  2XHC A;  1ACM B;  1AWX A;  4Z02 A;  1AZG B;  2HL5 C;  4IUU A;  2A36 A;  3LH5 A;  4M7D E;  4J9C A;  3HZJ A;  2QI2 A;  2IW9 B;  2I40 B;  4Z6Y A;  5HBH B;  1PD1 A;  1YHQ T;  4EOI B;  5GAO p;  4ATO A;  2DZ9 A;  1YP5 A;  4N4I A;  2PVD B;  5GJW B;  2KI7 A;  1UNH D;  3V7R A;  2DZC A;  2A0F B;  4BXX X;  3C12 A;  5IH2 A;  4JRQ A;  3MO8 A;  4PJO D;  1E7O A;  2EYY A;  1QVF S;  5FU6 B;  1XTD A;  1Q86 U;  3JB9 G;  5EG2 A;  1WI7 A;  3I35 A;  1Q81 U;  2QGF B;  4FT2 A;  3P8B B;  1RAC B;  5GAN 2;  1VQ4 Q;  3RKW A;  2CUD A;  3M0R A;  5M9O A;  5LMK B;  5DQW A;  2W9Z A;  2F2X A;  4LDU A;  1PHT A;  3JCM g;  4E6R A;  5GAM g;  1S72 T;  1TH7 A;  2MWP A;  1YI2 A;  3JCM e;  1Y71 A;  4OGE A;  1YJN A;  1WLP B;  1UGP B;  5GAM e;  2J6K A;  4M7D G;  3DKM A;  4BI4 A;  3OYI A;  1KIK A;  2DYI A;  2H3J A;  1I81 A;  3G6E T;  4IUR A;  3HRS A;  2CJM B;  2CCI B;  4M78 E;  3FJ5 A;  4LDW A;  1AZE A;  4EMH A;  3QYG B;  1XO2 A;  4KBM B;  2QEX Q;  1M5Q 1;  1WFW A;  5GAO r;  1J3T A;  2BS2 A;  4VUB A;  3URG A;  2J6F A;  5HCK A;  1OI9 B;  2CSI A;  2DO3 A;  4C8Q F;  2JGZ B;  5KH6 A;  3OYJ A;  2CT3 A;  2JM9 A;  3QDR B;  2I0N A;  5LJ5 g;  3EG2 A;  2ZPB B;  1EX4 A;  2LDM A;  2DF6 A;  3PO3 S;  4M77 A;  1WHH A;  1C9B A;  5LJ5 e;  2QA4 Q;  1LCK A;  3PIP A;  3S3O A;  2WFY B;  3H0F A;  1ABO A;  3H9N A;  4DOV A;  1FIN B;  5ACB A;  3QHS A;  3MY1 B;  3I9Q A;  2R5M A;  1HD3 A;  3JSC A;  1MMD A;  2DIQ A;  4AT1 B;  3E19 A;  1R77 A;  1ZBX A;  2EVR A;  1RL2 A;  2YLB A;  3JCM P;  4IUT A;  3MIA B;  1GFD A;  1UHF A;  1K9M C;  3M53 A;  1SSH A;  2XK0 A;  4MFE A;  1M2V A;  1TOV A;  3EFO A;  4M78 G;  2OTL Q;  1AEY A;  2K5L A;  3LGF A;  1JJ2 S;  1N8R R;  4LDY A;  1KQ2 A;  3X28 B;  1WXB A;  2J7I A;  1M1G A;  3LQ5 B;  1SF9 A;  5DLO A;  3G71 A;  4XTY A;  1T0H A;  1H1S B;  3FB9 A;  5GAO m;  3MET A;  2YT6 A;  1JKW A;  4RTY A;  2RQV A;  4BI3 A;  1OEB A;  1M3B A;  2RHZ A;  5CK9 A;  4FM4 B;  5FRN A;  2D8J A;  3SWN A;  3OYA A;  2DXT A;  2L5Q A;  4EOK B;  4R56 A;  1VQO A;  1PRM C;  3SWN B;  3JB9 H;  4PJO E;  1MMN A;  2QXF A;  3CC2 T;  1O9K B;  3NHN A;  3EAE A;  3OMC A;  2WSF E;  1TU0 B;  4AG2 C;  3R6N A;  1UEC A;  6AT1 B;  5LJ3 j;  2WSC E;  2FZC B;  4FIB A;  1D3U B;  1AOJ A;  4X34 A;  2EJ9 A;  4PKC C;  4IUQ A;  3JAM E;  1YIT A;  5KYY B;  1K4U S;  1M27 C;  5C6S A;  4AFU C;  1QVF A;  1G83 A;  2L3S A;  2QTX A;  2JS2 A;  3DB3 A;  2LW4 A;  3DJB A;  3RES A;  3HSB A;  1NLO C;  2FVU A;  1YWP A;  2W96 A;  3TSZ A;  1MND A;  5CEI B;  1WHM A;  2FZK B;  1JO8 A;  1NPP A;  3C94 A;  1UEB A;  2E64 A;  5GAN 3;  1BCM A;  1Q82 R;  1QMC A;  4UN0 A;  3AHU A;  2IVW A;  2CP6 A;  3GOX A;  2CUB A;  1VQ4 T;  3EGD B;  2HBP A;  1AIS B;  1G3T A;  3TW6 A;  1UJY A;  1QWF A;  4EMK C;  2NLU A;  4D8K A;  1PG5 B;  3Q1J A;  3OSV A;  2WEV B;  3M0Q A;  1YHQ A;  3SD4 A;  2RI5 A;  2BKZ B;  1PNJ A;  4OB1 B;  2DMO A;  3QJ6 A;  3OYB A;  2P0P A;  5GMK l;  5GAO q;  2FPE A;  3CCM T;  2O4X B;  5LQF B;  1M3C A;  1PSE A;  2DRM A;  2LQ8 A;  1C6V X;  3EH2 A;  4N4G A;  2EQM A;  1C1A A;  4QQD A;  1VQN Q;  3GTM S;  4E7J A;  2UZL B;  1WHG A;  2K3X A;  2X51 A;  1VA7 A;  2E65 A;  5CQY A;  4CC4 B;  3OYF A;  2JS0 A;  4V2S A;  1ZQ1 A;  2V8I A;  2ENM A;  2QEX T;  2ATC B;  5KYU B;  2LT4 A;  4B9W A;  2HZY A;  1UJ0 A;  2ED1 A;  3V8L A;  2HQX A;  4MZT A;  2CZ6 B;  1GRI A;  3A98 A;  4A63 B;  3JCM V;  1VYV A;  2DXB A;  1S72 A;  2KBT A;  2RF0 A;  3CD6 Q;  3QO3 A;  2QA4 T;  1RAF B;  4OMF B;  1WXU A;  4ELY C;  4JLI A;  3VS5 A;  2RI3 A;  4K11 A;  2CP7 A;  4JPB W;  3GP8 A;  1H28 B;  3X25 B;  1SHF A;  1JJ2 A;  2AKK A;  1GFC A;  2IVX A;  3M0P A;  3JCM b;  4OGR B;  3EID B;  2FEI A;  4JLG A;  2HSP A;  4QKU A;  3M9Q A;  2CT4 A;  4M77 F;  3I5R A;  2QG9 B;  1H24 B;  4C92 A;  4M75 A;  1AWW A;  2QDJ A;  4B6M A;  2LMJ A;  2MAM A;  4JS4 A;  3TEE A;  3G33 B;  1X2K A;  4YTL A;  4HKE A;  5HQ0 B;  3X24 B;  1Q82 U;  1WQW A;  2JUF A;  4YC3 B;  3RMQ A;  2KT8 A;  1D0Y A;  1LJO A;  1VIN A;  4HVW A;  1JB0 E;  1D09 B;  2Y4Y A;  1M90 C;  4JJB A;  1K73 C;  3RBB B;  2C6T B;  3ER0 A;  2JM8 A;  2RJF A;  1D1A A;  2D6F A;  2COZ A;  3OYN A;  1V1C A;  1W2B S;  5KYX B;  1VQL T;  3QZ5 B;  2RK1 A;  1UGR B;  4CFW B;  1VQ7 T;  2PK2 A;  1SPK A;  4LUD A;  4X9D A;  2LNV A;  1Q95 G;  1ZA2 B;  3QBY A;  2V22 B;  2XDD A;  4AMC A;  3UA7 A;  3QYB A;  3F5X B;  4YOZ A;  1MV0 B;  1RLQ C;  2FYK A;  4C8Q C;  4OMO A;  3GNG A;  2DM1 A;  3QDF A;  4RG2 A;  3HHT B;  2EWN A;  1R8O B;  2YUN A;  4EMK B;  2QAZ A;  5LJ3 g;  4N0A A;  1VQK A;  2XDB A;  3I5S A;  2EPD A;  2FPF A;  1QVG S;  1JST B;  5LJ3 e;  3PVQ A;  4Z89 A;  3OB9 A;  1H1P B;  3MP1 A;  1Y07 A;  3NTK A;  1SRL A;  4F7U G;  4EOS B;  4XTX A;  3CCJ Q;  1IHV A;  2EYZ A;  1HXD A;  4Z88 A;  1TD6 A;  1JRI A;  4FSS A;  2OTJ Q;  2YUP A;  1JOW A;  1OX9 A;  3EG9 A;  2EKH A;  3H0H A;  4F17 A;  3JB9 J;  5L8R E;  3CCL Q;  4C5G A;  1OPK A;  2HMA A;  5DQV A;  3DLL A;  5IXF A;  1X75 C;  1F5Q B;  2BPM B;  1DJ7 B;  2VXE A;  2BZY A;  1KQS A;  1ZUU A;  4D6W A;  2GTJ A;  2DIL A;  1HYO A;  4KH1 B;  4DBR A;  4BCH B;  2H8H A;  4II1 A;  1YJN T;  4BBS M;  2AZV A;  4PJL A;  4KRD B;  5ICP B;  2CZ7 B;  3ZFJ A;  3UAT A;  1RAB B;  4JJC A;  1LVK A;  4F16 A;  4HNV A;  1VQ4 A;  4BB7 A;  2DRK A;  2RO0 A;  2F69 A;  3BG3 A;  1B7T A;  5A0G A;  4OMN A;  2C5V B;  2KR6 A;  1G3Y A;  1OKW B;  3M56 A;  4ESR A;  5LL6 S;  1BCO A;  2HDA A;  3G1J A;  3KBG A;  3A5Z B;  3CD6 T;  4KRC B;  2R58 A;  4BUG A;  5GAN 4;  1N6A A;  1S1N A;  2J6O A;  2DIG A;  3BFM A;  4LE9 A;  2LRQ A;  3L2R A;  4EOP B;  3CC4 Q;  1D0X A;  2EIF A;  3PTA A;  2KR3 A;  4JDS A;  1G8X A;  2GCX A;  4ZTJ A;  4OVA A;  1X43 A;  3EOC B;  2E41 A;  2EYW A;  2QEX A;  1VQ5 Q;  2M9U A;  1KD1 C;  2FG0 A;  4HA8 A;  2HQE A;  3NFC A;  3LLR A;  4M7A B;  2QTV A;  4C8Q B;  3OYE A;  3BDU A;  4F6U B;  2RN8 A;  1CSK A;  3LH0 A;  4EPC A;  1NJI R;  2QA4 A;  3KFV A;  1VYW B;  4BCI B;  4C92 F;  1OI1 A;  2FPD A;  4M75 F;  1QQJ A;  3O8V A;  1IO6 A;  1Q7Y R;  3OS1 A;  3CC7 Q;  1YJ9 Q;  3G71 T;  3DB4 A;  1PKT A;  3MEV A;  3CCV Q;  2LCC A;  4HCK A;  4HNT A;  2HNI A;  2HKN A;  2D0N A;  4JZ4 A;  1W2B P;  3ZEH A;  2F2V A;  1OPL A;  1PRL C;  1MMG A;  3CCE A;  3I55 Q;  2P0K A;  1Q81 R;  2JN0 A;  4AG1 C;  2OTL A;  4KUI A;  3TVT A;  3OY9 A;  1QP3 A;  2GQI A;  4J9D A;  2LQW A;  2HSE B;  2X35 A;  2KRN A;  1QWE A;  2HKQ B;  3ZBD A;  2KSS A;  3JB9 F;  4C5H A;  3CEY A;  2P84 A;  2V26 A;  1MMA A;  1OQK A;  1PC0 A;  1OYX A;  3CMA Q;  1IZ6 A;  1QVG P;  1WHK A;  1ZUY A;  1OGU B;  1WYX A;  2M0O A;  1OOT A;  3VYG A;  1VUB A;  3X26 B;  1QW1 A;  4EOJ B;  1NPR A;  3MY5 B;  1ZUK A;  2DJQ A;  1VQK Q;  2QQ9 A;  5CKD A;  3KXT A;  3JCM W;  2PQW A;  1JQQ A;  2WHB B;  1T3S A;  4C5E A;  3QXE B;  3EH1 A;  1W70 A;  2DER A;  2AKL A;  5EFQ B;  3OS5 A;  4M77 C;  8AT1 B;  1Q86 C;  2HCK A;  3CCQ Q;  2L8D A;  4YOO A;  2WAC A;  3HB9 A;  4J6Y A;  5GAN 7;  1KC8 R;  2KAF A;  4G6L B;  2RJE A;  2E4H A;  2F2C A;  1QKX A;  4PL6 A;  1UFF A;  2DAQ A;  3CCL T;  2AIR B;  2CKK A;  3OW2 P;  2MOX A;  2ED0 A;  3M59 A;  4JRP A;  2F5T X;  1I0C A;  4M7A D;  1BI1 A;  1NJI U;  4C8Q D;  3CBM A;  3RR6 A;  1M4Z A;  2RHU A;  2FRW A;  3NTH A;  3OBY A;  1Q7Y U;  4EOM B;  1QP2 A;  2KRO A;  1RI0 A;  1VQ9 A;  2Z0W A;  3RKY A;  2NUT A;  3VU3 C;  2MIO A;  2X9H A;  3EFS A;  3SWN C;  5FGK B;  4CFX B;  2KT1 A;  3WVE B;  5GMK m;  3CME Q;  2V8K A;  3RUX A;  1BKB A;  1YIJ A;  2DD5 A;  1K8A R;  1RLP C;  2R5A A;  3UWN A;  2RQU A;  4AFZ C;  3JCM f;  2K4Y A;  3OSS C;  5GAM f;  1HJD A;  2P0Q A;  3DTO A;  2LX7 A;  3GIB A;  2WPA B;  2E1H A;  2RHY A;  1YJW Q;  4WTO B;  2ZPG B;  2XKO C;  1VQN A;  1M1K R;  2DBK A;  3E2U A;  2UUE B;  3QWY A;  4OMQ A;  4DQ2 A;  2ZAE A;  4HCC A;  1UGS B;  1TWB A;  2EYX A;  2PK9 B;  3CCS Q;  3OQ5 A;  1VQ5 T;  5CKH A;  4GBQ A;  2LZ6 B;  1M3A A;  1IXD A;  5IDN B;  4X1V A;  3H4C A;  3FLG A;  4M7A F;  5LJ5 f;  3HRT A;  2KEA A;  3CD6 A;  3VRY A;  1GXI E;  2DD4 A;  1KC8 U;  4A54 A;  2HL3 A;  4F7U A;  2I53 A;  3ASK A;  2HAX A;  3O0G D;  1X6B A;  1YJ9 T;  4JX6 A;  3P8H A;  2DKG A;  1QVP A;  3PIO A;  1W4S A;  2K57 A;  1FWZ A;  5KYN A;  2SEM A;  5HK3 A;  4A53 A;  4M77 B;  3V8J A;  2MF2 A;  1D1C A;  1HK9 A;  2ROT A;  4J9F A;  2E3H A;  1IHW A;  1KSW A;  3KHI A;  1IRX A;  2DVE A;  3CCE Q;  3M4Y A;  2UZD B;  1XJW B;  2X4J A;  2WSE E;  3NDQ A;  4E7H A;  3H6Z A;  4J7F A;  4NC6 A;  2A3L A;  4LOC A;  2JNG A;  1KG1 A;  1TSF A;  5AYF A;  4ROC A;  5IT9 E;  3U23 A;  1M2V B;  3EFO B;  5GMK j;  5GAN j;  4LDX A;  1SKU B;  2QGG A;  1K8A U;  2ZZD A;  5GJV B;  1H26 B;  4C8Q E;  3BLH B;  1ZSG A;  5KCO A;  1VQK T;  3MJX A;  4F7N B;  2MYS A;  4ZN1 A;  4KRT A;  3J7A F;  2CSQ A;  2VKN A;  2DL7 A;  5AT1 B;  4DEY A;  5CKB A;  4RTX A;  4BY7 X;  4L59 A;  2C5X B;  4FX3 B;  3L2V A;  2DEU A;  1M1K U;  1AD5 A;  4QT7 A;  3V7C A;  3ULR B;  2NUP A;  1QCN A;  4A4F A;  2QGS A;  1N27 A;  1BU2 A;  1ZSZ A;  2DTO A;  3MKD A;  4RKU E;  2R7G A;  2EAY A;  2QF7 A;  1N8R C;  4NL3 A;  1LOJ A;  3M0U A;  2HQH A;  4C92 C;  2EBP A;  1G3W A;  2YDL A;  4M75 C;  2FRY A;  2MPX C;  1P5E B;  2C5N B;  5HK0 A;  3M4G A;  4Y92 A;  2BUD A;  4DBH A;  4CC2 A;  3G7Z A;  4EC9 B;  1VQM Q;  2LJ1 A;  1AHJ B;  2DFU A;  3CCJ A;  2CH4 A;  1B34 A;  5KYW A;  1UG1 A;  2ROL A;  1UTI A;  4BCN B;  1BI2 A;  2D1X A;  2K7A A;  2ZPE B;  3UT1 A;  2PU9 B;  2OTJ A;  2AT1 B;  4E7L A;  2RA2 A;  1G2B A;  1ZBJ A;  1QVF P;  2YRC A;  1VQ9 Q;  2LCL A;  2DXU A;  3CCL A;  4PJO G;  3CME T;  3LW5 E;  3OYC A;  1VQ8 A;  1KJW A;  4O6J A;  1H92 A;  1HSQ A;  4M77 D;  4GLK A;  1W1F A;  2M02 A;  3M58 A;  2CYZ B;  2BS4 A;  1Z9Q A;  1YIJ Q;  4ANJ A;  3OYL A;  3C4S A;  3I56 Q;  5J39 A;  1FVV B;  1KK7 A;  5IHK A;  3MEA A;  1O75 A;  5CO7 A;  4ROE A;  1AVZ C;  3S3N A;  1PCX A;  1PKD B;  1X69 A;  4N0A C;  1SRM A;  4BDZ A;  4F70 B;  2F2W A;  1Y96 A;  4OML A;  3CCS T;  4BCQ B;  2LX9 A;  3A8L B;  1M2O A;  2M16 A;  5GAO n;  2AHJ B;  4IIO A;  1GUX A;  1V29 B;  2E12 A;  2KQW A;  4PLI A;  3FEO A;  1UNL D;  2M0Y A;  2JTF A;  1Q82 C;  1KQS S;  3PGG A;  4J9H A;  5HBJ B;  2JXB A;  4PJJ A;  2B86 A;  1H64 1;  1OU9 A;  2GBQ A;  1U5S A;  2WIP B;  2VUB A;  3REB B;  2DBM A;  3EGX A;  3CC4 A;  5FWB A;  1NBE B;  4C0Z A;  4JX5 A;  2GFU A;  3S3M A;  4JJD A;  1H3Z A;  3QYH B;  2ESW A;  2DXB B;  3H41 A;  2X3X D;  2YHT A;  4MMK A;  3CXC A;  1NZ9 A;  1VQ5 A;  1Z9Z A;  1N9S A;  5CKE A;  5CAI A;  1OX8 A;  4NL2 A;  4F7U F;  4E2F B;  1TUD A;  1YBY A;  4E7Z A;  2CP0 A;  3UA6 A;  1E9H B;  3CCE T;  2D8H A;  2W99 A;  1D1B A;  3TNH B;  4FL6 A;  2DNU A;  1WQ7 A;  1JJ2 P;  3JCM Q;  2OTL T;  4CFM B;  4BCN D;  5DY9 A;  2DEQ A;  1RAG B;  1TUC A;  4C92 B;  1E7P A;  4M75 B;  4RMO A;  2X3W D;  3CC7 A;  3FJP A;  4RTZ A;  1YJ9 A;  1RAH B;  3CCV A;  3OS2 A;  3JCM h;  2JOY A;  4PFP A;  5GAM h;  4F04 B;  1H4L D;  3QSU A;  3I55 A;  2QFZ A;  4FT4 A;  1ENW A;  9ATC B;  1UHC A;  2K5F A;  4E7K A;  4A4G A;  4QVZ A;  4FW1 A;  2GF7 A;  1WHL A;  4JX4 A;  4EDU A;  2DXC A;  4OB3 B;  1BIA A;  4FYX B;  2JT4 A;  5FU7 B;  4X9C A;  4EC8 B;  5I2S A;  1WGS A;  2X4W A;  3CPF A;  3QWL A;  4M7A C;  2DL3 A;  4BAC A;  3CMA A;  1ARK A;  1TUG B;  1AWO A;  4M77 E;  5BNJ B;  5LJ3 f;  2FZG B;  2DK3 A;  2L3P A;  3JB9 I;  2A28 A;  4B9X A;  4DBQ A;  4PJN A;  5LJ5 h;  4M7D A;  4XK8 E;  2GGR A;  4BCQ D;  2VYT A;  2QQ8 A;  5GAO l;  2DME A;  3JV3 A;  3VKI A;  3CPW A;  1EFN A;  3OMG A;  1TS9 A;  2Y4X A;  3CCQ A;  3E1S A;  4M6V A;  2ZPH B;  1YWO A;  1VOL A;  3PT9 A;  2E70 A;  3PNW C;  1ZLM A;  2O88 A;  3DOG B;  2WXV B;  3L2Q A;  1VQ9 T;  3MEU A;  2XU8 A;  1MNE A;  2RHI A;  2CS7 A;  2IW8 B;  3A8O B;  3RDV A;  4ELZ C;  5CQX A;  4ZNX A;  1NEB A;  3BLR B;  2EQJ A;  2BKD N;  4BDY A;  1M8M A;  2VXF A;  1WXT A;  4M77 G;  2K2M A;  3EG9 B;  5I2M A;  1VQ8 Q;  1YIJ T;  3CBO A;  4ELL A;  1N4M A;  1E6H A;  3I56 T;  3G4S Q;  2JZ2 A;  3BHU B;  3EHR A;  1VOM A;  2L3R A;  5CYI B;  2ZCF B;  2C0O A;  2RQR A;  4C92 D;  4M78 A;  2UZE B;  3GF5 A;  4M75 D;  4IKF A;  1X27 A;  1VQN T;  3TCJ A;  4MZP A;  4LXC A;  4L6V 5;  4N4H A;  4OB2 B;  3CME A;  5D6W A;  4O5V A;  2GQV A;  4CC7 A;  5A2Q E;  5GAN d;  4J8O A;  4PLL A;  3OYK A;  4XU3 A;  4WCI A;  1AD6 A;  2C4G B;  1YCS B;  1W98 B;  4ORZ A;  3L1A A;  1WDX A;  1OIY B;  5HBE B;  1ZP2 A;  1QKW A;  3M5A A;  2COY A;  2YWW A;  2NUZ A;  1VIE A;  1WA7 A;  1YJW A;  1VQ6 Q;  2KXC A;  2DJZ A;  2QK0 A;  3F70 A;  4AFS C;  2CRE A;  2GFA A;  3L2W A;  3JB9 D;  4KT0 E;  7AT1 B;  2V1R A;  1EIF A;  1YN8 A;  3BG9 A;  3CCS A;  1UGQ B;  1OIU B;  3EJ1 B;  2DL5 A;  2J06 A;  2W2H A;  2BTT A;  1G3N C;  2WMA B;  4GLM A;  4FCY A;  4E47 A;  5GAN 6;  2FL7 A;  2LQK A;  2C5O B;  2L0A A;  3V7S A;  2RJC A;  3CBP A;  4L5G A;  2AK5 A;  4JZ3 A;  2DLP A;  1XNI A;  1M1F A;  3G6E Q;  4P5N A;  4EMG A;  4J9I A;  2EQK A;  2M51 A;  2XIC A;  4AFQ C;  4XTW A;  1I07 A;  1K76 A;  2JMA A;  2RI2 A;  1IGQ A;  1XQH A;  4XU0 A;  2G6F X;  2X1N B;  3BG5 A;  3BW1 A;  4HT9 A;  3GBQ A;  4EOQ B;  4AKG A;  1RAI B;  4R0K A;  5LJ5 j;  2KDS A;  4PJO A;  3VS1 A;  4CC3 A;  5KE3 A;  1U1S A;  1FMV A;  2K79 A;  4EIK A;  1X6G A;  1NYG A;  2VGN A;  3L2U A; 
#chains in the Genus database with same CATH homology
 3GOX A;  4M7A F;  3TRE A;  1I8F A;  5LJ5 f;  3HRT A;  1VQ4 T;  2HBP A;  3CD6 A;  2LC4 A;  1Q7Y C;  4ZGJ B;  1G3T A;  3CCU A;  3TW6 A;  1JBM A;  4EMK C;  2NLU A;  1GXI E;  3A8M B;  2D0Q B;  2DD4 A;  3Q1J A;  3OS0 A;  1KC8 U;  3OSV A;  4A54 A;  1VQP A;  1YHQ A;  4PJO C;  3SD4 A;  4F7U A;  2RI5 A;  2P4T A;  3J80 E;  4FU6 A;  3ASK A;  4OB1 B;  4AKH A;  1NJI C;  2HAX A;  2QQR A;  3QJ6 A;  2M1H A;  3OYB A;  1M90 U;  2P0P A;  4RCB A;  4JRK A;  4JX6 A;  3P8H A;  5J26 A;  2DKG A;  2X4Y A;  5GMK l;  5GAO q;  2VGM A;  4XAX B;  4XTZ A;  1K73 U;  1QVP A;  2EYQ A;  3CCM T;  2O4X B;  3CC2 A;  4OB0 B;  3PIO A;  1I5L A;  1W4S A;  2K57 A;  1PSE A;  2LQ8 A;  1FWZ A;  4N4G A;  3VUZ A;  4JUV A;  2EQM A;  5HK3 A;  4QQD A;  4BE1 A;  3TW7 A;  2K5I A;  4A53 A;  4E7J A;  3M54 A;  2K3X A;  2L89 A;  4M77 B;  4BD3 A;  3V8J A;  2MF2 A;  1HK9 A;  4XTV A;  5I21 A;  1BYM A;  4A4K A;  2E65 A;  3FIF A;  4BI8 B;  2FHD A;  4C92 E;  5CQY A;  4M75 E;  5CR2 A;  4J83 A;  3OYF A;  4M7D F;  3VYG B;  2FB7 A;  1ZQ1 A;  2V8I A;  3HPW A;  3KHI A;  4C0G A;  2MWO A;  2KMT A;  2DVE A;  3HP9 A;  4Y91 A;  2QEX T;  3E9F A;  2E6N A;  3CCJ T;  3M4Y A;  4MFD A;  2LT4 A;  1Q81 C;  2KY9 A;  4B9W A;  3C95 A;  2X4J A;  2WSE E;  3V8L A;  1Y7X A;  2HQX A;  4E7H A;  3H6Z A;  4J7F A;  4MZT A;  4C5I A;  2CZ6 B;  2IG0 A;  2YRV A;  4XQ3 A;  2OTJ T;  4NC6 A;  2A3L A;  4LOC A;  3JCM V;  2ZPI B;  2JNG A;  3OW2 S;  1KG1 A;  1S72 A;  2DXB A;  1KHI A;  4M78 B;  2X4X A;  3NTI A;  5AYF A;  4MDW A;  3QO3 A;  2PVO B;  5IT9 E;  2QA4 T;  3FRN A;  4OMF B;  4PNO A;  3RMS A;  5GMK j;  4ELY C;  1M9S A;  4JLI A;  5GAN j;  1D3B A;  3N5B B;  2RI3 A;  1VQM A;  2D9T A;  3GP8 A;  1JJ2 A;  1VQ8 T;  1YI2 T;  3X25 B;  2XG8 D;  2ZZD A;  5GAN 8;  1K8A U;  4C8Q E;  4J6X A;  4BY6 C;  2RD1 A;  5KCO A;  3JCM b;  1VQK T;  4JLG A;  3R6O A;  3G4S T;  4ZN1 A;  2DPP B;  1X01 A;  3J7A F;  3M9Q A;  4M77 F;  3HBL A;  1WJR A;  5CKB A;  3V8K A;  2I2L A;  4C92 A;  4CI0 C;  4M75 A;  4L59 A;  3L2V A;  1MGQ A;  2QDJ A;  3BDL A;  3MP8 A;  1M1K U;  1G5V A;  3M57 A;  3UDC A;  3VKG A;  2MAM A;  1O9S A;  3JRZ A;  3V7C A;  4C92 G;  4JS4 A;  4M75 G;  3BY7 A;  3TEE A;  2PUK B;  3SDZ A;  2G3R A;  4A4F A;  1N27 A;  2RH2 A;  2DTO A;  5CVI A;  4RKU E;  4V2S A;  5GAM j;  4YTL A;  4HKE A;  2EAY A;  3VYH B;  2QF7 A;  3X24 B;  1Q82 U;  1WQW A;  5GAN 5;  2Y90 A;  1KC8 C;  2JUF A;  3CCM A;  3RMQ A;  4M78 F;  1N8R C;  2DTH A;  4XTU A;  4QW2 A;  4NL3 A;  1LOJ A;  3RIR A;  1LJO A;  3QZ9 B;  2R57 A;  2VV5 A;  4C92 C;  1G3W A;  4M75 C;  2OAU A;  1JB0 E;  2Y4Y A;  3MCA B;  1M90 C;  4M7D D;  4WF2 A;  1K73 C;  1FKM A;  5HK0 A;  3M4G A;  3ER0 A;  5C0M A;  3I56 A;  1WPY A;  2BUD A;  4M7A A;  5LJ3 h;  2RJF A;  1VQ6 T;  3WXM B;  3G7Z A;  2D6F A;  2PVG B;  2A7Y A;  4C8Q A;  1AHJ B;  5IAY A;  4J5Y A;  3OYN A;  2DD5 B;  3CCJ A;  1W2B S;  1B34 A;  1VQL T;  3QZ5 B;  5LJ3 d;  3S6W A;  2RK1 A;  4A4H A;  1UGR B;  4QQ6 A;  1BI2 A;  2KVQ G;  1VQ7 T;  4BE2 A;  4X9D A;  5HKC A;  2LNV A;  4HCB A;  3CC4 T;  2LT1 A;  3LX7 A;  2RHX A;  2ZPE B;  3UT1 A;  2PU9 B;  2OTJ A;  3QBY A;  4E7L A;  3OBW A;  2XDD A;  3HRU A;  2RA2 A;  4ZGD B;  2LTO A;  5FU6 C;  1W2B A;  3LWH A;  1KHC A;  3OYM A;  3QYB A;  1N9R A;  4LDX A;  2LCL A;  3OYY A;  3FC3 A;  4MZM A;  2FYK A;  4C8Q C;  4KUD K;  2DXU A;  3CCL A;  3GNG A;  4PJO G;  3MP6 A;  3CME T;  3LW5 E;  3MHX A;  4RG2 A;  3HHT B;  2EWN A;  3OYC A;  3LWI A;  1VQ8 A;  2KMG A;  1R8O B;  2B8A A;  3FDR A;  4M77 D;  4O6J A;  4EMK B;  4GLK A;  5DM7 R;  5LJ3 g;  3HO8 A;  4N0A A;  4PJO B;  4FSX A;  1VQK A;  4Y28 E;  2XDB A;  3M58 A;  2CYZ B;  4TVR A;  4QVC A;  1QVG S;  2BS4 A;  3UPU A;  3QYE A;  5LJ3 e;  4LDV A;  1K8A C;  2QQB A;  3MEW A;  2O01 E;  3OYL A;  2E10 A;  3A8G B;  3C4S A;  3OB9 A;  4GY5 A;  2CZ1 B;  3MP1 A;  1Y07 A;  2RB6 A;  3NTK A;  3CC7 T;  5J39 A;  4F7U G;  1XOV A;  1QVG A;  3MEA A;  4XTX A;  1O75 A;  3CCV T;  3E9G A;  5CO7 A;  2QQA A;  3S3N A;  2DD4 B;  1HXD A;  5FLX E;  4M78 D;  4N0A C;  4BDZ A;  3VUB A;  4F7U B;  2XID A;  3J81 E;  1M1K C;  2JVV A;  4AKI A;  2JTM A;  1Y96 A;  3SFM A;  1VQO T;  3CCS T;  4C0D B;  1JRI A;  4OP0 A;  5HY6 A;  4QSH A;  4ZN3 A;  3I55 T;  1KD1 U;  2LX9 A;  3H8Z A;  3A8L B;  3QUI A;  4Q5W A;  2M16 A;  4A4E A;  4LD9 K;  5GAO n;  3HFN A;  5GMK i;  2AHJ B;  3QJY A;  5FRM A;  3RER A;  1QLB A;  4KUL A;  1M8V A;  1V29 B;  2E12 A;  2KQW A;  5L8R E;  4PLI A;  4C0D C;  3JB9 J;  3FEO A;  1YCY A;  2JTF A;  2F5K A;  1Q82 C;  3PMT A;  4C5G A;  4MDX A;  1KQS S;  3PGG A;  3DLL A;  1X75 C;  4PJO F;  1H64 1;  1PSF A;  3L42 A;  4BBR M;  1VQL A;  1BIB A;  1YIT T;  2EKO A;  1MHN A;  4HT8 A;  4RCC A;  3DL1 A;  1DJ7 B;  1ZHI A;  3CXC S;  2VUB A;  1VQ7 A;  4NS5 A;  2VXE A;  4BY6 B;  3CC4 A;  1NE8 A;  3CMA T;  2V8J A;  1KQS A;  4OF1 A;  4C0Z A;  4JX5 A;  4JRI A;  4OGC A;  2GFU A;  4D6W A;  3S3M A;  3PMI A;  3OA6 A;  3JCM X;  1FX7 A;  1OZ3 A;  4M7A E;  1H3Z A;  3QYH B;  2RK2 A;  3LGL A;  3CCR T;  3VKH A;  2DXB B;  3OW2 A;  4II1 A;  2YHT A;  3FLG A;  4MMK A;  4BBS M;  1YJN T;  3CXC A;  1NZ9 A;  1VQ5 A;  1N9S A;  5GMK h;  3INZ A;  4HCZ A;  5CKE A;  2CZ7 B;  5CAI A;  4NL2 A;  4F7U F;  5GAN h;  3ZFJ A;  5CKF A;  2YLC A;  4JS5 A;  1D3B B;  4AI6 A;  1YBY A;  2XDP A;  3L2Z A;  2G77 A;  2CGH A;  4C0F A;  5DLQ E;  5A0L A;  2ZZD B;  3CCE T;  2EFI A;  4HNV A;  1VQ4 A;  4BB7 A;  3CCQ T;  2RO0 A;  2F69 A;  3BG3 A;  1U1T A;  2VC8 A;  4FL6 A;  1WQ7 A;  5A0G A;  1IRE B;  4J6W A;  3JCM Q;  2OTL T;  2BIV A;  2KR6 A;  2ZPF B;  1G3Y A;  1WNL A;  3M56 A;  2KK4 A;  3KUF A;  1WJQ A;  5DY9 A;  2DEQ A;  2XHC A;  5LL6 S;  4R55 A;  3KBG A;  3OYD A;  4Z02 A;  4C92 B;  3A5Z B;  1E7P A;  4M75 B;  4RMO A;  4IUU A;  3CC7 A;  3CD6 T;  3FJP A;  2R58 A;  1YJ9 A;  4BUG A;  5GAN 4;  3CCU T;  4M7D E;  3CCV A;  1N6A A;  3HZJ A;  1VIF A;  2QI2 A;  4Z6Y A;  2DIG A;  3BFM A;  3OS2 A;  1YHQ T;  3JCM h;  2LRQ A;  5GAO p;  3L2R A;  4ATO A;  2DZ9 A;  2JOY A;  3JCM J;  5GAM h;  1LNX A;  3M55 A;  2E5Q A;  2PVD B;  2EIF A;  4N4I A;  5CCA A;  3PTA A;  4JDS A;  3QSU A;  1I4K 1;  5FRO A;  2QFZ A;  3V7R A;  3JCM d;  2DZC A;  1X6O A;  4FT4 A;  3I55 A;  2GCX A;  5GAM d;  3OYG A;  4ZTJ A;  2K5F A;  2EJG A;  3C12 A;  4OVA A;  4E7K A;  4M7A G;  2E41 A;  4A4G A;  3OYH A;  4QVZ A;  3MO8 A;  4JRQ A;  2QEX A;  2GF7 A;  1FXX A;  4PJO D;  4JX4 A;  4HLQ A;  4C8Q G;  1QVF S;  2M9U A;  5IN1 A;  1K9M U;  4NOY A;  4EDU A;  5FU6 B;  1KD1 C;  2DXC A;  4HA8 A;  2HQE A;  1XTD A;  2RM4 A;  2LVM A;  3NFC A;  3LLR A;  5EG2 A;  4M7A B;  3JB9 G;  1Q81 U;  1Q86 U;  3QII A;  4OB3 B;  1BIA A;  5FU7 B;  3SB2 A;  4IUP A;  3GPL A;  4C8Q B;  1BI0 A;  4FT2 A;  3OYE A;  2EQU A;  4LD6 A;  3P8B B;  4X9C A;  3BDU A;  1B34 B;  5GAN 2;  5I2S A;  1WGS A;  2X4W A;  3CPF A;  3QWL A;  3RKW A;  5M9O A;  4M7A C;  3LH0 A;  4ZGE B;  4EPC A;  4LDU A;  5FU7 C;  4BAC A;  3CMA A;  2QA4 A;  4M77 E;  3JCM g;  5LJ3 f;  2DK3 A;  4C92 F;  1OI1 A;  3HKS A;  3JB9 I;  4M75 F;  2CZ0 B;  4B9X A;  5GAM g;  1TH7 A;  3CPW S;  2MWP A;  1S72 T;  3O8V A;  5LJ5 h;  1YI2 A;  3JCM e;  1Y71 A;  4OGE A;  3OS1 A;  1YJN A;  3ME9 A;  1UGP B;  4E7I A;  4M7D A;  3HFO A;  4XK8 E;  3G71 T;  3DB4 A;  5GAM e;  3MEV A;  2LCC A;  2VYT A;  5J3B A;  5LJ5 d;  2QQ8 A;  3G4S A;  4M7D G;  4HNT A;  2HNI A;  3DKM A;  5D6X A;  4BI4 A;  5GAO l;  3OYI A;  3GLX A;  2H3J A;  1I81 A;  3ZEH A;  3G6E T;  4IUR A;  4HL4 A;  3HRS A;  3VKI A;  3CPW A;  3OMG A;  3CCE A;  4ME7 A;  1YJW T;  3QG1 A;  2Y4X A;  3DLM A;  3CCQ A;  2P0K A;  2QQS A;  4M78 E;  4MML A;  3E1S A;  2JN0 A;  4M6V A;  2ZPH B;  3QYG B;  3PT9 A;  4LDW A;  4EMH A;  2E70 A;  2OTL A;  4KUI A;  4KBM B;  3OY9 A;  1M5Q 1;  5GAO r;  1QP3 A;  2BS2 A;  4M7D C;  4VUB A;  3PNW C;  2X35 A;  3URG A;  2DO3 A;  4C8Q F;  3OYJ A;  3RKX A;  3ZBD A;  5KE2 A;  5KH6 A;  3L2Q A;  2KSS A;  3QDR B;  4DOW A;  1VQ9 T;  3MEU A;  3JB9 F;  4C5H A;  2O4X A;  2XU8 A;  2RHI A;  5LJ5 g;  2CS7 A;  1N8R U;  3CEY A;  3A8O B;  4ELZ C;  2ZPB B;  5CQX A;  2LDM A;  3HL8 A;  2MMP A;  1OYX A;  4HNU A;  4M77 A;  5LJ5 e;  3TU4 K;  3PIP A;  1IZ6 A;  2EQJ A;  1Y96 B;  2BKD N;  4BDY A;  3S3O A;  2VXF A;  1VQ6 A;  4M77 G;  4DA4 A;  3EFR A;  2M0O A;  5CIU A;  5I2M A;  3VYG A;  1VUB A;  1YIJ T;  3X26 B;  4DOV A;  1QW1 A;  3CBO A;  1NPR A;  3QHS A;  4J7I A;  2DTI A;  2E6Z A;  4ZTF A;  1P92 A;  2QQ9 A;  5CKD A;  3KXT A;  2R5M A;  3I56 T;  3JCM W;  2PQW A;  3JSC A;  3WVD B;  2JZ2 A;  2DIQ A;  3E19 A;  1ZBX A;  4C5E A;  1G3S A;  3QXE B;  1RL2 A;  2L3R A;  2YLB A;  4IUT A;  2ZCF B;  3JCM P;  4JJN K;  3OS5 A;  4M77 C;  1K9M C;  3M53 A;  4C92 D;  4M78 A;  3GF5 A;  4M75 D;  1Q86 C;  4IKF A;  2XK0 A;  2L8D A;  4MFE A;  1VQN T;  3TCJ A;  3QPH A;  4M78 G;  2WAC A;  2XI9 A;  3P8D A;  2K5L A;  4MZP A;  5EJC A;  4XU2 A;  4L6V 5;  4XU1 A;  3LGF A;  4N4H A;  4OB2 B;  3HB9 A;  4J6Y A;  5GAN 7;  3CME A;  5D6W A;  4O5V A;  1JJ2 S;  4LDY A;  2GQV A;  2KAF A;  4CRI A;  1KQ2 A;  3GNF B;  2RJE A;  3X28 B;  3LYI A;  5A2Q E;  4QQG A;  4BE0 A;  5GAN d;  1M1G A;  4J8O A;  4PL6 A;  4PLL A;  5DLO A;  3OYK A;  3G71 A;  4XTY A;  4XU3 A;  2DAQ A;  3CCL T;  3L1A A;  3FB9 A;  2CKK A;  4QVD A;  5GAO m;  3MET A;  1BI3 A;  4M78 C;  3G6E A;  2PUO B;  3M5A A;  4BI3 A;  1U8R A;  5A0D A;  1SSF A;  5CK9 A;  1VIE A;  2EJF A;  2RHZ A;  4FM4 B;  3M59 A;  4JRP A;  1YJW A;  2F5T X;  4M7A D;  4MIM A;  5FRN A;  2XD0 A;  2DJZ A;  1BI1 A;  1NJI U;  3SWN A;  3OYA A;  5D6Y A;  3F70 A;  3CBM A;  4C8Q D;  2DXT A;  3L2W A;  2GFA A;  2L5Q A;  1M4Z A;  2RHU A;  5GAN f;  1WJS A;  3JB9 D;  1KQ1 A;  1VQP T;  4R56 A;  4KT0 E;  3NTH A;  3OBY A;  1Q7Y U;  1EIF A;  1QP2 A;  1VQO A;  3BG9 A;  5GAN g;  3CCS A;  1RI0 A;  3SWN B;  1VQ9 A;  3X20 B;  3JB9 H;  4PJO E;  1UGQ B;  2QXF A;  3CC2 T;  5GMK e;  5GAN e;  3RKY A;  3VU3 C;  3EAE A;  3OMC A;  3EFS A;  2BS3 A;  3SWN C;  2WSF E;  2ZGW A;  4UC4 A;  3WVE B;  5GMK m;  1OZ2 A;  5LJ3 j;  4ELJ A;  2V8K A;  2WSC E;  3RUX A;  1BKB A;  2C06 A;  4FIB A;  3A8H B;  1YIJ A;  4E47 A;  2DD5 A;  4X34 A;  4RG8 A;  5GAN 6;  2EJ9 A;  2FL7 A;  2LQK A;  4PKC C;  2R5A A;  4IUQ A;  3UWN A;  3JAM E;  1YJ9 T;  3JCM f;  2K4Y A;  1YIT A;  3V7S A;  2RJC A;  3CBP A;  4L5G A;  5C6S A;  1QVF A;  2DXC B;  3OSS C;  4F7U E;  5GAM f;  3JCM c;  1XNI A;  1M1F A;  2P0Q A;  4P5N A;  4EMG A;  2EQK A;  3GIB A;  2XIC A;  2QTX A;  4XTW A;  2E1H A;  3DB3 A;  2RHY A;  5KCH A;  2RI2 A;  3RES A;  3CCR A;  2ZPG B;  2XKO C;  1XQH A;  2RJD A;  4XU0 A;  3VV0 A;  3HSB A;  1VQN A;  2FVU A;  3QKJ A;  2QDY B;  3BG5 A;  3BW1 A;  4DQ2 A;  4IUV A;  4HT9 A;  2HD0 A;  3T9N A;  4HCC A;  1VQM T;  1NPP A;  3C94 A;  4AKG A;  1UEB A;  4EMK A;  5LJ5 j;  2E64 A;  1UGS B;  2WJ9 A;  2KDS A;  2K2V A;  3PFS A;  1UB4 A;  3OQ5 A;  5GAN 3;  4M7D B;  4PJO A;  5KE3 A;  1VQ5 T;  1U1S A;  2K3Y A;  2MI6 A;  3VJP A;  5CKH A;  3AHU A;  2IVW A;  2VGN A;  3H4C A;  3L2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...