3DL1A

Crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
237
structure length
210
Chain Sequence
b'EMPWEQALAIPVLAHLSSTEQHKLTQMAARFLQQKRLVALQGLELTPLHQARIAMLFCLPVLELGIEWLDGFHEVLIYPAPFQQGPVVLNWLDIQDSFDASGFNLVVHEVAHKLDTRDRASGVPLIPLREVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCHFYRQDPLARRRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Metal-dependent Hydrolase
publication title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
total genus 62
structure length 210
sequence length 237
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06167 Peptidase_M90 Glucose-regulated metallo-peptidase M90
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.150 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3dl1A01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dl1A02
1UTZA 4I35A 4L63A 1CGEA 3P24A 2Y6CA 1GKCA 1R1IA 2MLRA 4AIGA 1D8FA 4G9LA 1FLSA 1JH1A 1A85A 1MMBA 4J4MA 5D1UA 3N2UA 1CK7A 2JSDA 3Q2GA 3LMCA 1GE6A 4ZR5A 3HY7A 1HOVA 1FBLA 2I47A 4AXQA 1ND1A 4H76A 2E3XA 1EAKA 4WK7A 2SRTA 1H71P 2W13A 2FV9A 1YOUA 2W12A 1CQRA 4JPAA 1JAPA 1IADA 2MZIA 1HTDA 1GO7P 2JIHA 2L0RA 4GWMA 2V4BA 4I03A 2W0DA 4GR0A 3F16A 4G0DA 5D2BA 4EFSA 1SRPA 5I2ZA 2CKIA 3LJZA 4R3VA 2OZRA 1ZP5A 1C8TA 1XFVA 4H49A 1D8MA 4IN9A 1G9KA 3L0TA 3RTSA 3KWVC 3GBOA 1KUHA 3KMEA 4L6TA 5L7FA 4DV8A 4FVLA 2KRJA 1QIAA 2Z2DA 1O0TA 1K7IA 3LGPA 2O36A 3TVCA 2XS3A 5L79A 2OW9A 3LE9A 4AYKA 1OM8A 3U1RA 1XFUA 4WZVA 1JKYA 3G42A 2FV5A 2JNPA 4XBHA 3LIRA 4PKRA 3UVCA 3LJTA 1EB6A 1I1IP 1MMQA 5CXAA 2DW0A 1C7KA 3TSKA 3BA0A 5CUHA 1G49A 1Y8JA 1UTTA 1B8YA 2OW2A 1JAOA 3LILA 3N2VA 3HY9A 2X3AA 4A7BA 3LK8A 3CKIA 1J7NA 4DF9A 1CGFA 2MZEA 3LJGA 1QIBA 1IAAA 2POJA 3V96B 1BSWA 3EHYA 1JK3A 4ILWD 1K7QA 830CA 966CA 1O0QA 1I76A 4WKEA 3G5CA 1Y0VA 1ZTQA 1A86A 3KMCA 4FXQA 1OS9A 1BKCA 4L19A 2QPJA 1R1JA 3KHIA 3F17A 2RJQA 1GKDA 4IJOA 1KUGA 3F19A 1BKCE 5B5OA 5D1SA 2Y6DA 1ATLA 1JIZA 5BOTA 2OY4A 4HX3A 2MZHA 3HDBA 2PJTA 3LUNA 4JP4A 3ZXHA 3DSLA 2USNA 4H1QA 2DW2A 3P1VA 3NX7A 3DL1A 3O64A 1D7XA 2OW0A 1OO9A 1IACA 1ZVXA 4H30A 1K7GA 3K7LA 4GR3A 4GF1A 1XFWA 3LKAA 1HFSA 3WV3A 1CAQA 456CA 1YP1A 2DW1A 3ZUKA 3VI1A 2K2GA 3ELMA 3EHXA 3LEAA 1BUVM 4WF6A 3F15A 3KECA 4DPEA 1KUKA 2OXWA 2WO9A 5JMYA 3F18A 2CLTA 2OXZA 4JIJA 4FU4A 1CIZA 2YB9A 1AKLA 1GE7A 5CZMA 3RTTA 2DDYA 3VTGA 2OVXA 2JT6A 4ON1A 2N8RA 1BIWA 1QJJA 3KEJA 1ZS0A 1OM7A 1AF0A 4GR8A 1BKCI 4FXYP 1YCMA 2WOAA 3MA2A 3HBUP 3LQ0A 2JT5A 1KUFA 1PWWA 1XFXA 1DTHA 1BUDA 5B5PA 1HY7A 3EDGA 1SU3A 4H3XA 2W14A 1PWUA 2OY2A 4A3WA 3DPFA 1G12A 4PKVA 2D1NA 5I4OA 4AUOA 4CTHA 3F1AA 3ZVSA 5I3MA 2OXUA 2RJPA 1C3IA 1EUBA 1SLMA 1JANA 3AYUA 4GWNA 1PWQA 4XCTA 1OM6A 1BM6A 4JQGA 3DNGA 3O2XA 1G4KA 5D3CA 3I7IA 3WV1A 3HDAP 4XM8A 1JJ9A 3KEKA 4XM7A 1XUCA 1IABA 1UMTA 3B2ZA 1OS2A 1ZXVA 1MNCA 4QKZA 2OI0A 4GQLA 1ASTA 1PWVA 4IUWA 2A8HA 2EROA 4GUYA 1JIWP 2MLSA 2AYKA 3TT4A 2DDFA 1BQQM 2OW1A 1QICA 2XS4A 1IAEA 3B8ZA 1R55A 3EWJA 1DMTA 1XFZA 1OMJA 2OVZA 3DPEA 5I0LA 3AIGA 4WKIA 3LUMA 3EDHA 1SATA 3I7GA 2AIGP 3HYGA 3USNA 3EDIA 1HFCA 1XURA 1YQYA 2X3BA 5D1TA 4PKWA 3E8RA 4PKSA 1FM1A 2YIGA 1ZXCA 2HU6A 1SMPA 2J83A 1G05A 1KBCA 3L0VA 1B3DA 1IAGA 1Z3JA 3KRYA 3HBVP 1GXDA 2X3CA 1XFYA 2X7MA 2WO8A 2K9CA 1S4BP 5LABA 3WV2A 1BQOA 1D5JA 2TCLA 5I12A 4DD8A 4JA1A 1RM8A 4H84A 3OHOA 1UMSA 1L6JA 1QJIA 3SHIA 1CGLA 5BOYA 3LQBA 3OHLA 1PWPA 4H2EA 3AYKA 1AYKA 2ERPA 1UEAA 1MMPA 5I43A 3K7NA 4Q1LA 1R1HA 3Q2HA 4PKQA 3DWBA 1Q3AA 5H8XA 2E2DA 1GE5A 2O3EA 1WNIA 2ERQA 1ROSA 1MMRA 4HMAA 3HB2P 1XUDA 1I73A 1KAPP 1JAQA 1BZSA 1HV5A 1RMZA 4PKTA 1R54A 3TS4A 2D1OA 1USNA 2W15A 1Y93A 1QUAA 3EDZA 4XM6A 1CXVA 3B92A 5BPAA 5D7WA 4H82A 2J0TA 1SLNA 1GO8P 1KUIA 4PKUA 3LIKA
chains in the Genus database with same CATH superfamily
1UTZA 4I35A 4L63A 1CGEA 3P24A 2Y6CA 2WIHB 1GKCA 1TVIA 1R1IA 1XAXA 5LMKB 2MLRA 3X26B 4AIGA 1D8FA 4G9LA 1FLSA 1O9KA 1JH1A 1A85A 1MMBA 4J4MA 5D1UA 2BS4A 3M03A 3X28B 1H4LD 1CK7A 2JSDA 3N2UA 3Q2GA 3LMCA 1GE6A 2UZEB 4ZR5A 3HY7A 3QYGB 1HOVA 2AHJB 1FBLA 4CFUB 2I47A 4BY7X 4AXQA 1XO2A 5DQVA 4EOQB 4CFNB 1ND1A 2C5XB 4H76A 3A8GB 2E3XA 2DD4B 1JKWA 3BLHB 4HNUA 2QQ8A 3X25B 4HNTA 1EAKA 1OIYB 3TW7A 4WK7A 2SRTA 1H71P 2W13A 3MY1B 2FV9A 5LQFB 1YOUA 2UZDB 2V22B 2C4GB 2ZZDB 3VYHB 2I53A 4BCND 1CQRA 2W12A 4JPAA 1JAPA 4CFXB 1IADA 2MZIA 1HTDA 1E7PA 1GO7P 2JIHA 2L0RA 4GWMA 2V4BA 4I03A 2W0DA 4GR0A 3F16A 4G0DA 5D2BA 1UGRB 1SRPA 4EFSA 5I2ZA 3GTMS 2CKIA 3LJZA 4R3VA 4BCPB 2OZRA 1ZP5A 3QWLA 1C8TA 1XFVA 1D8MA 4H49A 1E9HB 4IN9A 1G9KA 3L0TA 3RTSA 3KWVC 2QFZA 1H1PB 2DXBB 4KRDB 3GBOA 1KUHA 4IMYB 4NSTB 2ZPIB 3TN8B 3KMEA 4F7LB 2B9RA 3VKHA 4L6TA 5L7FA 1H27B 4DV8A 4FVLA 5IHYA 2KRJA 1QIAA 2Z2DA 2QF7A 4Y72B 1O0TA 1K7IA 3LGPA 2O36A 3TVCA 2XS3A 5L79A 2OW9A 3LE9A 4AYKA 2IW9B 3F5XB 2W99A 1OM8A 3U1RA 2CJMB 1XFUA 3MIAB 4AKGA 4UN0A 4WZVA 1JKYA 1P5EB 2DXCB 3G42A 2FV5A 2JNPA 4XBHA 1OI9B 3LIRA 4PKRA 3DTIA 2G9XB 3UVCA 4OB2B 5ICPB 3QXEB 3LJTA 1EB6A 3B57A 2ZPGB 1I1IP 1MMQA 4YC3B 5IDPB 4II5B 3A8HB 3BG5A 3DDQB 4EC8B 1D3UB 2DW0A 1O9KB 5CXAA 1C7KA 3TSKA 2KR6A 3BHVB 4BCJB 4CFVB 3BA0A 5CUHA 4EC9B 4F6SB 5IDNB 3X24B 1G49A 2WPAB 1Y8JA 1UTTA 5CYIB 1B8YA 2OW2A 1JAOA 3LILA 3N2VA 4BCOB 3HY9A 2IVXA 2X3AA 4A7BA 3LK8A 3CKIA 1J7NA 4DF9A 1CGFA 2WXVB 2W96A 4EORB 3BG3A 2MZEA 4BY1X 3LJGA 2KMGA 3A8MB 1QIBA 1VYWB 1IAAA 3BLRB 2POJA 1FVVB 4BCGB 3V96B 1BSWA 3EHYA 1JK3A 4ILWD 1K7QA 830CA 966CA 3QYHB 1I76A 1O0QA 4HL4A 2WIPB 2W9FA 4WKEA 3G5CA 4I3ZB 1Y0VA 1ZTQA 1A86A 3KMCA 4FXQA 2UZLB 1OS9A 1BKCA 4L19A 2QPJA 1R1JA 2ZPBB 3WVDB 1N4MA 3KHIA 3F17A 2RJQA 1GKDA 4IJOA 1KUGA 3F19A 3MI9B 1BKCE 4L7AA 2WHBB 3LQ5B 2CZ6B 1OKWB 5B5OA 4MFEA 5D1SA 2Y6DA 1ATLA 4AKIA 2UZBB 4F6WB 1JIZA 5BOTA 2OY4A 2PMIB 3DDPB 4HX3A 2MZHA 3TNHB 3HDBA 4BCNB 3DTKA 2PJTA 1JSTB 3QZ5B 4ELJA 2YUFA 3DSLA 3LUNA 4JP4A 3ZXHA 2USNA 1AISB 4H1QA 2DW2A 3P1VA 3NX7A 2ZPHB 3DL1A 1FKMA 1OGUB 1D7XA 3O64A 4OB1B 2JGZB 3QHRB 2OW0A 2F2CA 4CRLB 1OO9A 1IACA 1ZVXA 4H30A 1K7GA 4MIMA 2QDJA 3MY5B 2C5OB 5EFQB 3K7LA 4HLQA 4GR3A 3EOCB 3RGFB 4F7JB 2ZPEB 1H26B 1VOLA 4GF1A 3HBLA 1XFWA 2R7GA 1HFSA 3LKAA 3WV3A 1CAQA 456CA 1YP1A 2DW1A 1JOWA 4ZGDB 3ZUKA 4KRCB 3HB9A 3WVEB 3VI1A 2K2GA 3ELMA 3EHXA 4ROEA 3LEAA 1H1RB 4AKHA 5CEIB 1BUVM 3BHUB 4WF6A 5HQ0B 1H28B 3F15A 3KECA 4DPEA 1KUKA 3PO3S 2OXWA 2WO9A 4BCKB 4YOZA 5BNJB 5JMYA 3F18A 1KXUA 2CLTA 2OXZA 5IF1B 2C6TB 1IREB 4JIJA 4FU4A 1FINB 1CIZA 2YB9A 1AKLA 1GE7A 5CZMA 3RTTA 2DDYA 3VTGA 2OVXA 1OL1B 4BCQD 2JT6A 1V29B 4ON1A 2N8RA 1OKVB 2WMBB 1BIWA 1QJJA 3KEJA 1ZS0A 1OM7A 1AF0A 3EIDB 4GR8A 1BKCI 1GY3B 5ACBA 4F7SB 4FXYP 4BBRM 1YCMA 5HBEB 2WMAB 1UNHD 3QYEA 2WOAA 3MA2A 3HBUP 3LQ0A 2JT5A 1KUFA 1PWWA 1XFXA 2IW8B 4JX6A 4MFDA 4CFWB 4ELLA 1DTHA 1BUDA 2DMEA 4JX4A 3A8LB 1HY7A 5B5PA 3EDGA 3POMA 1SU3A 4H3XA 4BCFB 2W14A 1PWUA 2OY2A 4A3WA 2W2HA 3HHTB 4EOOB 3DPFA 4YOSA 1G12A 4ROCA 4PKVA 2D1NA 2BS3A 2PK9B 4AUOA 5I4OA 4CTHA 3A8OB 1ENWA 3F1AA 3ZVSA 5I3MA 2OXUA 3O0GD 2RJPA 1C3IA 1EUBA 1SLMA 1JANA 4AI6A 3AYUA 1PKDB 2PK2A 4GWNA 1AHJB 4EOIB 1PWQA 4EOKB 1OM6A 4XCTA 4BCHB 1BM6A 3QHWB 1JSUB 2CCIB 4JQGA 3DNGA 3O2XA 1G4KA 3DJBA 5D3CA 4BXXX 3I7IA 3WV1A 1QLBA 3HDAP 4XM8A 1JJ9A 3KEKA 4XM7A 3DOGB 1XUCA 1QMZB 1IABA 3HO8A 1UMTA 3B2ZA 2ZCFB 1OS2A 1ZXVA 2BS2A 1MNCA 3BLQB 4FX3B 4F7NB 4QKZA 2OI0A 4GQLA 2CZ1B 2PHGA 1ASTA 1PWVA 4FM4B 4IUWA 2UUEB 1UNGD 5L2WB 3VKGA 2A8HA 3TNWB 2EROA 2CZ7B 5FGKB 5DQWA 4BCMD 4CFMB 4GUYA 2C5NB 1JIWP 2MLSA 2IW6B 2AYKA 3TT4A 2DDFA 1BQQM 2OW1A 1QICA 2XS4A 4EOPB 1IAEA 1R55A 1XFZA 4OGRB 4M6VA 2LW4A 1DMTA 3B8ZA 1OMJA 1VINA 3EWJA 4F70B 2OVZA 3DPEA 5I0LA 3AIGA 4WKIA 2W9ZA 1UGSB 4OR5B 2WFYB 5EJCA 3LUMA 3EDHA 1SATA 3I7GA 2AIGP 3HYGA 4EONB 1C9BA 3USNA 3DTOA 1HFCA 3EDIA 1TFBA 2I40B 1XURA 1YQYA 4OB0B 2X3BA 5D1TA 4CFUD 4PKWA 1UNLD 3E8RA 4BCQB 2X1NB 4PKSA 1FM1A 4G6LB 2YIGA 1ZXCA 2HU6A 2WJ9A 1OZ9A 1SMPA 2J83A 5HBHB 4YOOA 3H4CA 4OB3B 1G05A 4ZGJB 4BBSM 1KBCA 1H1SB 2QDYB 3L0VA 1B3DA 3X20B 1IAGA 3QYBA 1Z3JA 3VYGB 3KRYA 1H1QB 3HBVP 2D0QB 1GXDA 4EOJB 2X3CA 4HNVA 2IN3A 1XFYA 4CXAB 2X7MA 2WO8A 2CYZB 2K9CA 1S4BP 1F5QB 2G77A 5LABA 3WV2A 1BQOA 1D5JA 2TCLA 1TD6A 4QSHA 5I12A 5I5ZB 4EOSB 2CCHB 1GUXB 1XM5A 4DD8A 2BPMB 4JA1A 3K7AM 1RM8A 4H84A 3OHOA 1W98B 4NC6A 1UMSA 1L6JA 1G3NC 1QJIA 3SHIA 4LOCA 1CGLA 1ZP2A 3BHTB 3TNIB 5BOYA 3LQBA 3OHLA 2WEVB 2DD5B 1PWPA 1GH6B 4H2EA 3QZ9B 2CZ0B 4Z6YA 5HVYB 3AYKA 3EJ1B 1AYKA 2ERPA 5HBJB 1UEAA 2PJQA 1MMPA 5I43A 4EOMB 3K7NA 2ZPFB 4Q1LA 1R1HA 3Q2HA 4PKQA 3DWBA 3HZJA 1Q3AA 5H8XA 3BG9A 1BU2A 1URCB 2EUFA 1GE5A 2E2DA 4F6UB 2O3EA 1AD6A 1WNIA 2ERQA 2DPPB 1ROSA 1MMRA 4HMAA 3HB2P 2QGSA 1XUDA 1I73A 4JX5A 4EOLB 1KAPP 1JAQA 1OIUB 1BZSA 1GUXA 1HV5A 3DTEA 3TW6A 1RMZA 3G33B 4PKTA 4TTHA 1R54A 3NDQA 3TS4A 2D1OA 4RODA 1USNA 1Y93A 2W15A 2C5VB 1QUAA 3EDZA 1UGQB 2BKZB 4XM6A 1CXVA 1UGPB 4ZGEB 3B92A 5D7WA 5BPAA 4BCMB 2J0TA 1SLNA 4H82A 1H25B 1GO8P 1KUIA 1H24B 5HNBB 4BCIB 4PKUA 1OL2B 3LIKA
chains in the Genus database with same CATH topology
1UTZA 4I35A 4L63A 1CGEA 3P24A 2Y6CA 1GKCA 1R1IA 2MLRA 3X26B 4AIGA 1D8FA 4G9LA 1FLSA 1JH1A 1A85A 1MMBA 4J4MA 5D1UA 2BS4A 3X28B 3N2UA 1CK7A 2JSDA 3Q2GA 3LMCA 1GE6A 4ZR5A 3HY7A 3QYGB 1HOVA 2AHJB 1FBLA 2I47A 4AXQA 1ND1A 4H76A 3A8GB 2E3XA 2DD4B 4HNUA 4HNTA 1EAKA 2QQ8A 3X25B 4WK7A 3TW7A 2SRTA 1H71P 2W13A 2FV9A 1YOUA 2ZZDB 2W12A 3VYHB 1CQRA 4JPAA 1JAPA 1IADA 2MZIA 1HTDA 1E7PA 1GO7P 2JIHA 2L0RA 4GWMA 2V4BA 4I03A 2W0DA 4GR0A 3F16A 4G0DA 5D2BA 1UGRB 1SRPA 4EFSA 5I2ZA 2CKIA 3LJZA 4R3VA 2OZRA 1ZP5A 3QWLA 1C8TA 1XFVA 1D8MA 4H49A 4IN9A 1G9KA 3L0TA 3RTSA 3KWVC 2QFZA 2DXBB 3GBOA 1KUHA 2ZPIB 3KMEA 3VKHA 4L6TA 5L7FA 4DV8A 4FVLA 2KRJA 1QIAA 2Z2DA 2QF7A 1O0TA 1K7IA 3LGPA 2O36A 3TVCA 2XS3A 5L79A 2OW9A 3LE9A 4AYKA 1OM8A 3U1RA 1XFUA 4AKGA 4WZVA 1JKYA 2DXCB 3G42A 2FV5A 2JNPA 4XBHA 3LIRA 4PKRA 3DTIA 3UVCA 4OB2B 3QXEB 3LJTA 1EB6A 2ZPGB 1I1IP 1MMQA 3A8HB 3BG5A 5CXAA 2DW0A 1C7KA 3TSKA 2KR6A 3BA0A 5CUHA 3X24B 1G49A 1Y8JA 1UTTA 1B8YA 2OW2A 1JAOA 3LILA 3N2VA 3HY9A 2X3AA 4A7BA 3LK8A 3CKIA 1J7NA 4DF9A 1CGFA 3BG3A 2MZEA 3LJGA 2KMGA 3A8MB 1QIBA 1IAAA 2POJA 3V96B 1BSWA 3EHYA 1JK3A 4ILWD 1K7QA 830CA 966CA 1O0QA 3QYHB 1I76A 4HL4A 4WKEA 3G5CA 1Y0VA 1ZTQA 1A86A 3KMCA 4FXQA 1OS9A 1BKCA 4L19A 2QPJA 1R1JA 2ZPBB 3WVDB 3KHIA 3F17A 2RJQA 1GKDA 4IJOA 1KUGA 3F19A 1BKCE 4L7AA 2CZ6B 5B5OA 4MFEA 5D1SA 2Y6DA 1ATLA 4AKIA 1JIZA 5BOTA 2OY4A 4HX3A 2MZHA 3HDBA 3DTKA 2PJTA 4ELJA 3QZ5B 2YUFA 3LUNA 3DSLA 4JP4A 3ZXHA 2USNA 4H1QA 2DW2A 3P1VA 3NX7A 2ZPHB 3DL1A 1FKMA 3O64A 1D7XA 4OB1B 2OW0A 1OO9A 1IACA 1ZVXA 4H30A 1K7GA 4MIMA 2QDJA 3K7LA 4HLQA 4GR3A 2ZPEB 4GF1A 3HBLA 1XFWA 3LKAA 1HFSA 3WV3A 1CAQA 456CA 1YP1A 2DW1A 4ZGDB 3ZUKA 3HB9A 3WVEB 3VI1A 2K2GA 3ELMA 3EHXA 3LEAA 4AKHA 1BUVM 4WF6A 3F15A 3KECA 4DPEA 1KUKA 2OXWA 2WO9A 5JMYA 3F18A 2CLTA 2OXZA 1IREB 4JIJA 4FU4A 1CIZA 2YB9A 1AKLA 1GE7A 5CZMA 3RTTA 2DDYA 3VTGA 2OVXA 2JT6A 1V29B 4ON1A 2N8RA 1BIWA 1QJJA 3KEJA 1ZS0A 1OM7A 1AF0A 4GR8A 1BKCI 4FXYP 4BBRM 1YCMA 3QYEA 2WOAA 3MA2A 3HBUP 3LQ0A 2JT5A 1KUFA 1PWWA 1XFXA 4JX6A 4MFDA 1DTHA 1BUDA 4JX4A 3A8LB 1HY7A 5B5PA 3EDGA 1SU3A 4H3XA 2W14A 1PWUA 2OY2A 4A3WA 3HHTB 3DPFA 1G12A 4PKVA 2D1NA 2BS3A 5I4OA 4AUOA 4CTHA 3A8OB 3F1AA 3ZVSA 5I3MA 2OXUA 2RJPA 1C3IA 1EUBA 1SLMA 1JANA 4AI6A 3AYUA 4GWNA 1AHJB 1PWQA 4XCTA 1OM6A 1BM6A 4JQGA 3DNGA 3O2XA 1G4KA 5D3CA 3I7IA 3WV1A 1QLBA 3HDAP 4XM8A 1JJ9A 3KEKA 4XM7A 1XUCA 1IABA 3HO8A 1UMTA 3B2ZA 2ZCFB 1OS2A 1ZXVA 2BS2A 1MNCA 4QKZA 2OI0A 4GQLA 2CZ1B 1ASTA 1PWVA 4FM4B 4IUWA 3VKGA 2A8HA 2EROA 2CZ7B 4GUYA 1JIWP 2MLSA 2AYKA 3TT4A 2DDFA 1BQQM 2OW1A 1QICA 2XS4A 1IAEA 1R55A 1XFZA 4M6VA 1DMTA 3B8ZA 3EWJA 1OMJA 2OVZA 3DPEA 5I0LA 3AIGA 4WKIA 1UGSB 5EJCA 3LUMA 3EDHA 1SATA 3I7GA 2AIGP 3HYGA 3USNA 3EDIA 1HFCA 1XURA 1YQYA 4OB0B 2X3BA 5D1TA 4PKWA 3E8RA 4PKSA 1FM1A 2YIGA 1ZXCA 2HU6A 2WJ9A 1SMPA 2J83A 3H4CA 4OB3B 1G05A 4ZGJB 4BBSM 1KBCA 2QDYB 3L0VA 1B3DA 3X20B 1IAGA 3QYBA 1Z3JA 3VYGB 3KRYA 3HBVP 2D0QB 1GXDA 2X3CA 4HNVA 1XFYA 2X7MA 2WO8A 2CYZB 2K9CA 1S4BP 2G77A 5LABA 3WV2A 1BQOA 1D5JA 2TCLA 4QSHA 5I12A 4DD8A 4JA1A 1RM8A 4H84A 3OHOA 4NC6A 1UMSA 1L6JA 1QJIA 3SHIA 4LOCA 1CGLA 5BOYA 3LQBA 3OHLA 2DD5B 1PWPA 4H2EA 3QZ9B 2CZ0B 4Z6YA 3AYKA 1AYKA 2ERPA 1UEAA 1MMPA 5I43A 3K7NA 2ZPFB 4Q1LA 1R1HA 3Q2HA 4PKQA 3DWBA 3HZJA 1Q3AA 5H8XA 3BG9A 2E2DA 1GE5A 2O3EA 1WNIA 2ERQA 2DPPB 1ROSA 1MMRA 4HMAA 3HB2P 1XUDA 1I73A 4JX5A 1KAPP 1JAQA 1BZSA 1HV5A 3DTEA 3TW6A 1RMZA 4PKTA 1R54A 3TS4A 2D1OA 1USNA 2W15A 1Y93A 1QUAA 3EDZA 1UGQB 4XM6A 1CXVA 1UGPB 4ZGEB 3B92A 5D7WA 5BPAA 4H82A 2J0TA 1SLNA 1GO8P 1KUIA 4PKUA 3LIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTZ A;  4I35 A;  4L63 A;  1CGE A;  3P24 A;  2Y6C A;  1GKC A;  1R1I A;  2MLR A;  4AIG A;  1D8F A;  4G9L A;  1FLS A;  1JH1 A;  1A85 A;  1MMB A;  4J4M A;  5D1U A;  3N2U A;  1CK7 A;  2JSD A;  3Q2G A;  3LMC A;  1GE6 A;  4ZR5 A;  3HY7 A;  1HOV A;  1FBL A;  2I47 A;  4AXQ A;  1ND1 A;  4H76 A;  2E3X A;  1EAK A;  4WK7 A;  2SRT A;  1H71 P;  2W13 A;  2FV9 A;  1YOU A;  2W12 A;  1CQR A;  4JPA A;  1JAP A;  1IAD A;  2MZI A;  1HTD A;  1GO7 P;  2JIH A;  2L0R A;  4GWM A;  2V4B A;  4I03 A;  2W0D A;  4GR0 A;  3F16 A;  4G0D A;  5D2B A;  4EFS A;  1SRP A;  5I2Z A;  2CKI A;  3LJZ A;  4R3V A;  2OZR A;  1ZP5 A;  1C8T A;  1XFV A;  4H49 A;  1D8M A;  4IN9 A;  1G9K A;  3L0T A;  3RTS A;  3KWV C;  3GBO A;  1KUH A;  3KME A;  4L6T A;  5L7F A;  4DV8 A;  4FVL A;  2KRJ A;  1QIA A;  2Z2D A;  1O0T A;  1K7I A;  3LGP A;  2O36 A;  3TVC A;  2XS3 A;  5L79 A;  2OW9 A;  3LE9 A;  4AYK A;  1OM8 A;  3U1R A;  1XFU A;  4WZV A;  1JKY A;  3G42 A;  2FV5 A;  2JNP A;  4XBH A;  3LIR A;  4PKR A;  3UVC A;  3LJT A;  1EB6 A;  1I1I P;  1MMQ A;  5CXA A;  2DW0 A;  1C7K A;  3TSK A;  3BA0 A;  5CUH A;  1G49 A;  1Y8J A;  1UTT A;  1B8Y A;  2OW2 A;  1JAO A;  3LIL A;  3N2V A;  3HY9 A;  2X3A A;  4A7B A;  3LK8 A;  3CKI A;  1J7N A;  4DF9 A;  1CGF A;  2MZE A;  3LJG A;  1QIB A;  1IAA A;  2POJ A;  3V96 B;  1BSW A;  3EHY A;  1JK3 A;  4ILW D;  1K7Q A;  830C A;  966C A;  1O0Q A;  1I76 A;  4WKE A;  3G5C A;  1Y0V A;  1ZTQ A;  1A86 A;  3KMC A;  4FXQ A;  1OS9 A;  1BKC A;  4L19 A;  2QPJ A;  1R1J A;  3KHI A;  3F17 A;  2RJQ A;  1GKD A;  4IJO A;  1KUG A;  3F19 A;  1BKC E;  5B5O A;  5D1S A;  2Y6D A;  1ATL A;  1JIZ A;  5BOT A;  2OY4 A;  4HX3 A;  2MZH A;  3HDB A;  2PJT A;  3LUN A;  4JP4 A;  3ZXH A;  3DSL A;  2USN A;  4H1Q A;  2DW2 A;  3P1V A;  3NX7 A;  3DL1 A;  3O64 A;  1D7X A;  2OW0 A;  1OO9 A;  1IAC A;  1ZVX A;  4H30 A;  1K7G A;  3K7L A;  4GR3 A;  4GF1 A;  1XFW A;  3LKA A;  1HFS A;  3WV3 A;  1CAQ A;  456C A;  1YP1 A;  2DW1 A;  3ZUK A;  3VI1 A;  2K2G A;  3ELM A;  3EHX A;  3LEA A;  1BUV M;  4WF6 A;  3F15 A;  3KEC A;  4DPE A;  1KUK A;  2OXW A;  2WO9 A;  5JMY A;  3F18 A;  2CLT A;  2OXZ A;  4JIJ A;  4FU4 A;  1CIZ A;  2YB9 A;  1AKL A;  1GE7 A;  5CZM A;  3RTT A;  2DDY A;  3VTG A;  2OVX A;  2JT6 A;  4ON1 A;  2N8R A;  1BIW A;  1QJJ A;  3KEJ A;  1ZS0 A;  1OM7 A;  1AF0 A;  4GR8 A;  1BKC I;  4FXY P;  1YCM A;  2WOA A;  3MA2 A;  3HBU P;  3LQ0 A;  2JT5 A;  1KUF A;  1PWW A;  1XFX A;  1DTH A;  1BUD A;  5B5P A;  1HY7 A;  3EDG A;  1SU3 A;  4H3X A;  2W14 A;  1PWU A;  2OY2 A;  4A3W A;  3DPF A;  1G12 A;  4PKV A;  2D1N A;  5I4O A;  4AUO A;  4CTH A;  3F1A A;  3ZVS A;  5I3M A;  2OXU A;  2RJP A;  1C3I A;  1EUB A;  1SLM A;  1JAN A;  3AYU A;  4GWN A;  1PWQ A;  4XCT A;  1OM6 A;  1BM6 A;  4JQG A;  3DNG A;  3O2X A;  1G4K A;  5D3C A;  3I7I A;  3WV1 A;  3HDA P;  4XM8 A;  1JJ9 A;  3KEK A;  4XM7 A;  1XUC A;  1IAB A;  1UMT A;  3B2Z A;  1OS2 A;  1ZXV A;  1MNC A;  4QKZ A;  2OI0 A;  4GQL A;  1AST A;  1PWV A;  4IUW A;  2A8H A;  2ERO A;  4GUY A;  1JIW P;  2MLS A;  2AYK A;  3TT4 A;  2DDF A;  1BQQ M;  2OW1 A;  1QIC A;  2XS4 A;  1IAE A;  3B8Z A;  1R55 A;  3EWJ A;  1DMT A;  1XFZ A;  1OMJ A;  2OVZ A;  3DPE A;  5I0L A;  3AIG A;  4WKI A;  3LUM A;  3EDH A;  1SAT A;  3I7G A;  2AIG P;  3HYG A;  3USN A;  3EDI A;  1HFC A;  1XUR A;  1YQY A;  2X3B A;  5D1T A;  4PKW A;  3E8R A;  4PKS A;  1FM1 A;  2YIG A;  1ZXC A;  2HU6 A;  1SMP A;  2J83 A;  1G05 A;  1KBC A;  3L0V A;  1B3D A;  1IAG A;  1Z3J A;  3KRY A;  3HBV P;  1GXD A;  2X3C A;  1XFY A;  2X7M A;  2WO8 A;  2K9C A;  1S4B P;  5LAB A;  3WV2 A;  1BQO A;  1D5J A;  2TCL A;  5I12 A;  4DD8 A;  4JA1 A;  1RM8 A;  4H84 A;  3OHO A;  1UMS A;  1L6J A;  1QJI A;  3SHI A;  1CGL A;  5BOY A;  3LQB A;  3OHL A;  1PWP A;  4H2E A;  3AYK A;  1AYK A;  2ERP A;  1UEA A;  1MMP A;  5I43 A;  3K7N A;  4Q1L A;  1R1H A;  3Q2H A;  4PKQ A;  3DWB A;  1Q3A A;  5H8X A;  2E2D A;  1GE5 A;  2O3E A;  1WNI A;  2ERQ A;  1ROS A;  1MMR A;  4HMA A;  3HB2 P;  1XUD A;  1I73 A;  1KAP P;  1JAQ A;  1BZS A;  1HV5 A;  1RMZ A;  4PKT A;  1R54 A;  3TS4 A;  2D1O A;  1USN A;  2W15 A;  1Y93 A;  1QUA A;  3EDZ A;  4XM6 A;  1CXV A;  3B92 A;  5BPA A;  5D7W A;  4H82 A;  2J0T A;  1SLN A;  1GO8 P;  1KUI A;  4PKU A;  3LIK A; 
#chains in the Genus database with same CATH topology
 1UTZ A;  4I35 A;  4L63 A;  1CGE A;  3P24 A;  2Y6C A;  2WIH B;  1GKC A;  1TVI A;  1R1I A;  1XAX A;  5LMK B;  2MLR A;  3X26 B;  4AIG A;  1D8F A;  4G9L A;  1FLS A;  1O9K A;  1JH1 A;  1A85 A;  1MMB A;  4J4M A;  5D1U A;  2BS4 A;  3M03 A;  3X28 B;  1H4L D;  1CK7 A;  2JSD A;  3N2U A;  3Q2G A;  3LMC A;  1GE6 A;  2UZE B;  4ZR5 A;  3HY7 A;  3QYG B;  1HOV A;  2AHJ B;  1FBL A;  4CFU B;  2I47 A;  4BY7 X;  4AXQ A;  1XO2 A;  5DQV A;  4EOQ B;  4CFN B;  1ND1 A;  2C5X B;  4H76 A;  3A8G B;  2E3X A;  2DD4 B;  1JKW A;  3BLH B;  4HNU A;  2QQ8 A;  3X25 B;  4HNT A;  1EAK A;  1OIY B;  3TW7 A;  4WK7 A;  2SRT A;  1H71 P;  2W13 A;  3MY1 B;  2FV9 A;  5LQF B;  1YOU A;  2UZD B;  2V22 B;  2C4G B;  2ZZD B;  3VYH B;  2I53 A;  4BCN D;  1CQR A;  2W12 A;  4JPA A;  1JAP A;  4CFX B;  1IAD A;  2MZI A;  1HTD A;  1E7P A;  1GO7 P;  2JIH A;  2L0R A;  4GWM A;  2V4B A;  4I03 A;  2W0D A;  4GR0 A;  3F16 A;  4G0D A;  5D2B A;  1UGR B;  1SRP A;  4EFS A;  5I2Z A;  3GTM S;  2CKI A;  3LJZ A;  4R3V A;  4BCP B;  2OZR A;  1ZP5 A;  3QWL A;  1C8T A;  1XFV A;  1D8M A;  4H49 A;  1E9H B;  4IN9 A;  1G9K A;  3L0T A;  3RTS A;  3KWV C;  2QFZ A;  1H1P B;  2DXB B;  4KRD B;  3GBO A;  1KUH A;  4IMY B;  4NST B;  2ZPI B;  3TN8 B;  3KME A;  4F7L B;  2B9R A;  3VKH A;  4L6T A;  5L7F A;  1H27 B;  4DV8 A;  4FVL A;  5IHY A;  2KRJ A;  1QIA A;  2Z2D A;  2QF7 A;  4Y72 B;  1O0T A;  1K7I A;  3LGP A;  2O36 A;  3TVC A;  2XS3 A;  5L79 A;  2OW9 A;  3LE9 A;  4AYK A;  2IW9 B;  3F5X B;  2W99 A;  1OM8 A;  3U1R A;  2CJM B;  1XFU A;  3MIA B;  4AKG A;  4UN0 A;  4WZV A;  1JKY A;  1P5E B;  2DXC B;  3G42 A;  2FV5 A;  2JNP A;  4XBH A;  1OI9 B;  3LIR A;  4PKR A;  3DTI A;  2G9X B;  3UVC A;  4OB2 B;  5ICP B;  3QXE B;  3LJT A;  1EB6 A;  3B57 A;  2ZPG B;  1I1I P;  1MMQ A;  4YC3 B;  5IDP B;  4II5 B;  3A8H B;  3BG5 A;  3DDQ B;  4EC8 B;  1D3U B;  2DW0 A;  1O9K B;  5CXA A;  1C7K A;  3TSK A;  2KR6 A;  3BHV B;  4BCJ B;  4CFV B;  3BA0 A;  5CUH A;  4EC9 B;  4F6S B;  5IDN B;  3X24 B;  1G49 A;  2WPA B;  1Y8J A;  1UTT A;  5CYI B;  1B8Y A;  2OW2 A;  1JAO A;  3LIL A;  3N2V A;  4BCO B;  3HY9 A;  2IVX A;  2X3A A;  4A7B A;  3LK8 A;  3CKI A;  1J7N A;  4DF9 A;  1CGF A;  2WXV B;  2W96 A;  4EOR B;  3BG3 A;  2MZE A;  4BY1 X;  3LJG A;  2KMG A;  3A8M B;  1QIB A;  1VYW B;  1IAA A;  3BLR B;  2POJ A;  1FVV B;  4BCG B;  3V96 B;  1BSW A;  3EHY A;  1JK3 A;  4ILW D;  1K7Q A;  830C A;  966C A;  3QYH B;  1I76 A;  1O0Q A;  4HL4 A;  2WIP B;  2W9F A;  4WKE A;  3G5C A;  4I3Z B;  1Y0V A;  1ZTQ A;  1A86 A;  3KMC A;  4FXQ A;  2UZL B;  1OS9 A;  1BKC A;  4L19 A;  2QPJ A;  1R1J A;  2ZPB B;  3WVD B;  1N4M A;  3KHI A;  3F17 A;  2RJQ A;  1GKD A;  4IJO A;  1KUG A;  3F19 A;  3MI9 B;  1BKC E;  4L7A A;  2WHB B;  3LQ5 B;  2CZ6 B;  1OKW B;  5B5O A;  4MFE A;  5D1S A;  2Y6D A;  1ATL A;  4AKI A;  2UZB B;  4F6W B;  1JIZ A;  5BOT A;  2OY4 A;  2PMI B;  3DDP B;  4HX3 A;  2MZH A;  3TNH B;  3HDB A;  4BCN B;  3DTK A;  2PJT A;  1JST B;  3QZ5 B;  4ELJ A;  2YUF A;  3DSL A;  3LUN A;  4JP4 A;  3ZXH A;  2USN A;  1AIS B;  4H1Q A;  2DW2 A;  3P1V A;  3NX7 A;  2ZPH B;  3DL1 A;  1FKM A;  1OGU B;  1D7X A;  3O64 A;  4OB1 B;  2JGZ B;  3QHR B;  2OW0 A;  2F2C A;  4CRL B;  1OO9 A;  1IAC A;  1ZVX A;  4H30 A;  1K7G A;  4MIM A;  2QDJ A;  3MY5 B;  2C5O B;  5EFQ B;  3K7L A;  4HLQ A;  4GR3 A;  3EOC B;  3RGF B;  4F7J B;  2ZPE B;  1H26 B;  1VOL A;  4GF1 A;  3HBL A;  1XFW A;  2R7G A;  1HFS A;  3LKA A;  3WV3 A;  1CAQ A;  456C A;  1YP1 A;  2DW1 A;  1JOW A;  4ZGD B;  3ZUK A;  4KRC B;  3HB9 A;  3WVE B;  3VI1 A;  2K2G A;  3ELM A;  3EHX A;  4ROE A;  3LEA A;  1H1R B;  4AKH A;  5CEI B;  1BUV M;  3BHU B;  4WF6 A;  5HQ0 B;  1H28 B;  3F15 A;  3KEC A;  4DPE A;  1KUK A;  3PO3 S;  2OXW A;  2WO9 A;  4BCK B;  4YOZ A;  5BNJ B;  5JMY A;  3F18 A;  1KXU A;  2CLT A;  2OXZ A;  5IF1 B;  2C6T B;  1IRE B;  4JIJ A;  4FU4 A;  1FIN B;  1CIZ A;  2YB9 A;  1AKL A;  1GE7 A;  5CZM A;  3RTT A;  2DDY A;  3VTG A;  2OVX A;  1OL1 B;  4BCQ D;  2JT6 A;  1V29 B;  4ON1 A;  2N8R A;  1OKV B;  2WMB B;  1BIW A;  1QJJ A;  3KEJ A;  1ZS0 A;  1OM7 A;  1AF0 A;  3EID B;  4GR8 A;  1BKC I;  1GY3 B;  5ACB A;  4F7S B;  4FXY P;  4BBR M;  1YCM A;  5HBE B;  2WMA B;  1UNH D;  3QYE A;  2WOA A;  3MA2 A;  3HBU P;  3LQ0 A;  2JT5 A;  1KUF A;  1PWW A;  1XFX A;  2IW8 B;  4JX6 A;  4MFD A;  4CFW B;  4ELL A;  1DTH A;  1BUD A;  2DME A;  4JX4 A;  3A8L B;  1HY7 A;  5B5P A;  3EDG A;  3POM A;  1SU3 A;  4H3X A;  4BCF B;  2W14 A;  1PWU A;  2OY2 A;  4A3W A;  2W2H A;  3HHT B;  4EOO B;  3DPF A;  4YOS A;  1G12 A;  4ROC A;  4PKV A;  2D1N A;  2BS3 A;  2PK9 B;  4AUO A;  5I4O A;  4CTH A;  3A8O B;  1ENW A;  3F1A A;  3ZVS A;  5I3M A;  2OXU A;  3O0G D;  2RJP A;  1C3I A;  1EUB A;  1SLM A;  1JAN A;  4AI6 A;  3AYU A;  1PKD B;  2PK2 A;  4GWN A;  1AHJ B;  4EOI B;  1PWQ A;  4EOK B;  1OM6 A;  4XCT A;  4BCH B;  1BM6 A;  3QHW B;  1JSU B;  2CCI B;  4JQG A;  3DNG A;  3O2X A;  1G4K A;  3DJB A;  5D3C A;  4BXX X;  3I7I A;  3WV1 A;  1QLB A;  3HDA P;  4XM8 A;  1JJ9 A;  3KEK A;  4XM7 A;  3DOG B;  1XUC A;  1QMZ B;  1IAB A;  3HO8 A;  1UMT A;  3B2Z A;  2ZCF B;  1OS2 A;  1ZXV A;  2BS2 A;  1MNC A;  3BLQ B;  4FX3 B;  4F7N B;  4QKZ A;  2OI0 A;  4GQL A;  2CZ1 B;  2PHG A;  1AST A;  1PWV A;  4FM4 B;  4IUW A;  2UUE B;  1UNG D;  5L2W B;  3VKG A;  2A8H A;  3TNW B;  2ERO A;  2CZ7 B;  5FGK B;  5DQW A;  4BCM D;  4CFM B;  4GUY A;  2C5N B;  1JIW P;  2MLS A;  2IW6 B;  2AYK A;  3TT4 A;  2DDF A;  1BQQ M;  2OW1 A;  1QIC A;  2XS4 A;  4EOP B;  1IAE A;  1R55 A;  1XFZ A;  4OGR B;  4M6V A;  2LW4 A;  1DMT A;  3B8Z A;  1OMJ A;  1VIN A;  3EWJ A;  4F70 B;  2OVZ A;  3DPE A;  5I0L A;  3AIG A;  4WKI A;  2W9Z A;  1UGS B;  4OR5 B;  2WFY B;  5EJC A;  3LUM A;  3EDH A;  1SAT A;  3I7G A;  2AIG P;  3HYG A;  4EON B;  1C9B A;  3USN A;  3DTO A;  1HFC A;  3EDI A;  1TFB A;  2I40 B;  1XUR A;  1YQY A;  4OB0 B;  2X3B A;  5D1T A;  4CFU D;  4PKW A;  1UNL D;  3E8R A;  4BCQ B;  2X1N B;  4PKS A;  1FM1 A;  4G6L B;  2YIG A;  1ZXC A;  2HU6 A;  2WJ9 A;  1OZ9 A;  1SMP A;  2J83 A;  5HBH B;  4YOO A;  3H4C A;  4OB3 B;  1G05 A;  4ZGJ B;  4BBS M;  1KBC A;  1H1S B;  2QDY B;  3L0V A;  1B3D A;  3X20 B;  1IAG A;  3QYB A;  1Z3J A;  3VYG B;  3KRY A;  1H1Q B;  3HBV P;  2D0Q B;  1GXD A;  4EOJ B;  2X3C A;  4HNV A;  2IN3 A;  1XFY A;  4CXA B;  2X7M A;  2WO8 A;  2CYZ B;  2K9C A;  1S4B P;  1F5Q B;  2G77 A;  5LAB A;  3WV2 A;  1BQO A;  1D5J A;  2TCL A;  1TD6 A;  4QSH A;  5I12 A;  5I5Z B;  4EOS B;  2CCH B;  1GUX B;  1XM5 A;  4DD8 A;  2BPM B;  4JA1 A;  3K7A M;  1RM8 A;  4H84 A;  3OHO A;  1W98 B;  4NC6 A;  1UMS A;  1L6J A;  1G3N C;  1QJI A;  3SHI A;  4LOC A;  1CGL A;  1ZP2 A;  3BHT B;  3TNI B;  5BOY A;  3LQB A;  3OHL A;  2WEV B;  2DD5 B;  1PWP A;  1GH6 B;  4H2E A;  3QZ9 B;  2CZ0 B;  4Z6Y A;  5HVY B;  3AYK A;  3EJ1 B;  1AYK A;  2ERP A;  5HBJ B;  1UEA A;  2PJQ A;  1MMP A;  5I43 A;  4EOM B;  3K7N A;  2ZPF B;  4Q1L A;  1R1H A;  3Q2H A;  4PKQ A;  3DWB A;  3HZJ A;  1Q3A A;  5H8X A;  3BG9 A;  1BU2 A;  1URC B;  2EUF A;  1GE5 A;  2E2D A;  4F6U B;  2O3E A;  1AD6 A;  1WNI A;  2ERQ A;  2DPP B;  1ROS A;  1MMR A;  4HMA A;  3HB2 P;  2QGS A;  1XUD A;  1I73 A;  4JX5 A;  4EOL B;  1KAP P;  1JAQ A;  1OIU B;  1BZS A;  1GUX A;  1HV5 A;  3DTE A;  3TW6 A;  1RMZ A;  3G33 B;  4PKT A;  4TTH A;  1R54 A;  3NDQ A;  3TS4 A;  2D1O A;  4ROD A;  1USN A;  1Y93 A;  2W15 A;  2C5V B;  1QUA A;  3EDZ A;  1UGQ B;  2BKZ B;  4XM6 A;  1CXV A;  1UGP B;  4ZGE B;  3B92 A;  5D7W A;  5BPA A;  4BCM B;  2J0T A;  1SLN A;  4H82 A;  1H25 B;  1GO8 P;  1KUI A;  1H24 B;  5HNB B;  4BCI B;  4PKU A;  1OL2 B;  3LIK A; 
#chains in the Genus database with same CATH homology
 1UTZ A;  4I35 A;  4L63 A;  1CGE A;  3P24 A;  2Y6C A;  1GKC A;  1R1I A;  2MLR A;  3X26 B;  4AIG A;  1D8F A;  4G9L A;  1FLS A;  1JH1 A;  1A85 A;  1MMB A;  4J4M A;  5D1U A;  2BS4 A;  3X28 B;  3N2U A;  1CK7 A;  2JSD A;  3Q2G A;  3LMC A;  1GE6 A;  4ZR5 A;  3HY7 A;  3QYG B;  1HOV A;  2AHJ B;  1FBL A;  2I47 A;  4AXQ A;  1ND1 A;  4H76 A;  3A8G B;  2E3X A;  2DD4 B;  4HNU A;  4HNT A;  1EAK A;  2QQ8 A;  3X25 B;  4WK7 A;  3TW7 A;  2SRT A;  1H71 P;  2W13 A;  2FV9 A;  1YOU A;  2ZZD B;  2W12 A;  3VYH B;  1CQR A;  4JPA A;  1JAP A;  1IAD A;  2MZI A;  1HTD A;  1E7P A;  1GO7 P;  2JIH A;  2L0R A;  4GWM A;  2V4B A;  4I03 A;  2W0D A;  4GR0 A;  3F16 A;  4G0D A;  5D2B A;  1UGR B;  1SRP A;  4EFS A;  5I2Z A;  2CKI A;  3LJZ A;  4R3V A;  2OZR A;  1ZP5 A;  3QWL A;  1C8T A;  1XFV A;  1D8M A;  4H49 A;  4IN9 A;  1G9K A;  3L0T A;  3RTS A;  3KWV C;  2QFZ A;  2DXB B;  3GBO A;  1KUH A;  2ZPI B;  3KME A;  3VKH A;  4L6T A;  5L7F A;  4DV8 A;  4FVL A;  2KRJ A;  1QIA A;  2Z2D A;  2QF7 A;  1O0T A;  1K7I A;  3LGP A;  2O36 A;  3TVC A;  2XS3 A;  5L79 A;  2OW9 A;  3LE9 A;  4AYK A;  1OM8 A;  3U1R A;  1XFU A;  4AKG A;  4WZV A;  1JKY A;  2DXC B;  3G42 A;  2FV5 A;  2JNP A;  4XBH A;  3LIR A;  4PKR A;  3DTI A;  3UVC A;  4OB2 B;  3QXE B;  3LJT A;  1EB6 A;  2ZPG B;  1I1I P;  1MMQ A;  3A8H B;  3BG5 A;  5CXA A;  2DW0 A;  1C7K A;  3TSK A;  2KR6 A;  3BA0 A;  5CUH A;  3X24 B;  1G49 A;  1Y8J A;  1UTT A;  1B8Y A;  2OW2 A;  1JAO A;  3LIL A;  3N2V A;  3HY9 A;  2X3A A;  4A7B A;  3LK8 A;  3CKI A;  1J7N A;  4DF9 A;  1CGF A;  3BG3 A;  2MZE A;  3LJG A;  2KMG A;  3A8M B;  1QIB A;  1IAA A;  2POJ A;  3V96 B;  1BSW A;  3EHY A;  1JK3 A;  4ILW D;  1K7Q A;  830C A;  966C A;  1O0Q A;  3QYH B;  1I76 A;  4HL4 A;  4WKE A;  3G5C A;  1Y0V A;  1ZTQ A;  1A86 A;  3KMC A;  4FXQ A;  1OS9 A;  1BKC A;  4L19 A;  2QPJ A;  1R1J A;  2ZPB B;  3WVD B;  3KHI A;  3F17 A;  2RJQ A;  1GKD A;  4IJO A;  1KUG A;  3F19 A;  1BKC E;  4L7A A;  2CZ6 B;  5B5O A;  4MFE A;  5D1S A;  2Y6D A;  1ATL A;  4AKI A;  1JIZ A;  5BOT A;  2OY4 A;  4HX3 A;  2MZH A;  3HDB A;  3DTK A;  2PJT A;  4ELJ A;  3QZ5 B;  2YUF A;  3LUN A;  3DSL A;  4JP4 A;  3ZXH A;  2USN A;  4H1Q A;  2DW2 A;  3P1V A;  3NX7 A;  2ZPH B;  3DL1 A;  1FKM A;  3O64 A;  1D7X A;  4OB1 B;  2OW0 A;  1OO9 A;  1IAC A;  1ZVX A;  4H30 A;  1K7G A;  4MIM A;  2QDJ A;  3K7L A;  4HLQ A;  4GR3 A;  2ZPE B;  4GF1 A;  3HBL A;  1XFW A;  3LKA A;  1HFS A;  3WV3 A;  1CAQ A;  456C A;  1YP1 A;  2DW1 A;  4ZGD B;  3ZUK A;  3HB9 A;  3WVE B;  3VI1 A;  2K2G A;  3ELM A;  3EHX A;  3LEA A;  4AKH A;  1BUV M;  4WF6 A;  3F15 A;  3KEC A;  4DPE A;  1KUK A;  2OXW A;  2WO9 A;  5JMY A;  3F18 A;  2CLT A;  2OXZ A;  1IRE B;  4JIJ A;  4FU4 A;  1CIZ A;  2YB9 A;  1AKL A;  1GE7 A;  5CZM A;  3RTT A;  2DDY A;  3VTG A;  2OVX A;  2JT6 A;  1V29 B;  4ON1 A;  2N8R A;  1BIW A;  1QJJ A;  3KEJ A;  1ZS0 A;  1OM7 A;  1AF0 A;  4GR8 A;  1BKC I;  4FXY P;  4BBR M;  1YCM A;  3QYE A;  2WOA A;  3MA2 A;  3HBU P;  3LQ0 A;  2JT5 A;  1KUF A;  1PWW A;  1XFX A;  4JX6 A;  4MFD A;  1DTH A;  1BUD A;  4JX4 A;  3A8L B;  1HY7 A;  5B5P A;  3EDG A;  1SU3 A;  4H3X A;  2W14 A;  1PWU A;  2OY2 A;  4A3W A;  3HHT B;  3DPF A;  1G12 A;  4PKV A;  2D1N A;  2BS3 A;  5I4O A;  4AUO A;  4CTH A;  3A8O B;  3F1A A;  3ZVS A;  5I3M A;  2OXU A;  2RJP A;  1C3I A;  1EUB A;  1SLM A;  1JAN A;  4AI6 A;  3AYU A;  4GWN A;  1AHJ B;  1PWQ A;  4XCT A;  1OM6 A;  1BM6 A;  4JQG A;  3DNG A;  3O2X A;  1G4K A;  5D3C A;  3I7I A;  3WV1 A;  1QLB A;  3HDA P;  4XM8 A;  1JJ9 A;  3KEK A;  4XM7 A;  1XUC A;  1IAB A;  3HO8 A;  1UMT A;  3B2Z A;  2ZCF B;  1OS2 A;  1ZXV A;  2BS2 A;  1MNC A;  4QKZ A;  2OI0 A;  4GQL A;  2CZ1 B;  1AST A;  1PWV A;  4FM4 B;  4IUW A;  3VKG A;  2A8H A;  2ERO A;  2CZ7 B;  4GUY A;  1JIW P;  2MLS A;  2AYK A;  3TT4 A;  2DDF A;  1BQQ M;  2OW1 A;  1QIC A;  2XS4 A;  1IAE A;  1R55 A;  1XFZ A;  4M6V A;  1DMT A;  3B8Z A;  3EWJ A;  1OMJ A;  2OVZ A;  3DPE A;  5I0L A;  3AIG A;  4WKI A;  1UGS B;  5EJC A;  3LUM A;  3EDH A;  1SAT A;  3I7G A;  2AIG P;  3HYG A;  3USN A;  3EDI A;  1HFC A;  1XUR A;  1YQY A;  4OB0 B;  2X3B A;  5D1T A;  4PKW A;  3E8R A;  4PKS A;  1FM1 A;  2YIG A;  1ZXC A;  2HU6 A;  2WJ9 A;  1SMP A;  2J83 A;  3H4C A;  4OB3 B;  1G05 A;  4ZGJ B;  4BBS M;  1KBC A;  2QDY B;  3L0V A;  1B3D A;  3X20 B;  1IAG A;  3QYB A;  1Z3J A;  3VYG B;  3KRY A;  3HBV P;  2D0Q B;  1GXD A;  2X3C A;  4HNV A;  1XFY A;  2X7M A;  2WO8 A;  2CYZ B;  2K9C A;  1S4B P;  2G77 A;  5LAB A;  3WV2 A;  1BQO A;  1D5J A;  2TCL A;  4QSH A;  5I12 A;  4DD8 A;  4JA1 A;  1RM8 A;  4H84 A;  3OHO A;  4NC6 A;  1UMS A;  1L6J A;  1QJI A;  3SHI A;  4LOC A;  1CGL A;  5BOY A;  3LQB A;  3OHL A;  2DD5 B;  1PWP A;  4H2E A;  3QZ9 B;  2CZ0 B;  4Z6Y A;  3AYK A;  1AYK A;  2ERP A;  1UEA A;  1MMP A;  5I43 A;  3K7N A;  2ZPF B;  4Q1L A;  1R1H A;  3Q2H A;  4PKQ A;  3DWB A;  3HZJ A;  1Q3A A;  5H8X A;  3BG9 A;  2E2D A;  1GE5 A;  2O3E A;  1WNI A;  2ERQ A;  2DPP B;  1ROS A;  1MMR A;  4HMA A;  3HB2 P;  1XUD A;  1I73 A;  4JX5 A;  1KAP P;  1JAQ A;  1BZS A;  1HV5 A;  3DTE A;  3TW6 A;  1RMZ A;  4PKT A;  1R54 A;  3TS4 A;  2D1O A;  1USN A;  2W15 A;  1Y93 A;  1QUA A;  3EDZ A;  1UGQ B;  4XM6 A;  1CXV A;  1UGP B;  4ZGE B;  3B92 A;  5D7W A;  5BPA A;  4H82 A;  2J0T A;  1SLN A;  1GO8 P;  1KUI A;  4PKU A;  3LIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...