3DL1A

Crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
237
structure length
210
Chain Sequence
EMPWEQALAIPVLAHLSSTEQHKLTQMAARFLQQKRLVALQGLELTPLHQARIAMLFCLPVLELGIEWLDGFHEVLIYPAPFQQGPVVLNWLDIQDSFDASGFNLVVHEVAHKLDTRDRASGVPLIPLREVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCHFYRQDPLARRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Metal-dependent Hydrolase
publication title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
total genus 62
structure length 210
sequence length 237
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06167 Peptidase_M90 Glucose-regulated metallo-peptidase M90
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.150 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3dl1A01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dl1A02
3VTGA 1ZXVA 2KRJA 1RM8A 1GKCA 4FU4A 4HMAA 4DPEA 2DW0A 3TVCA 1JANA 1JIZA 1KBCA 1ZXCA 4AIGA 4GR3A 3O2XA 1USNA 1R1IA 4WZVA 1YCMA 3LMCA 3ZUKA 456CA 4XM8A 1K7IA 3SHIA 5CUHA 4FVLA 3NX7A 1HY7A 1OO9A 5D3CA 3U1RA 1QICA 1OM6A 3HBVP 4L19A 2OW1A 4ILWD 1G4KA 3TS4A 3G42A 1R54A 4QKZA 1GKDA 1GE5A 1XUDA 3AYUA 3HYGA 2FV5A 3DPFA 5D7WA 5B5PA 3B92A 1ZS0A 1G12A 3LKAA 1PWVA 4GWNA 4J4MA 5JMYA 2OXUA 4PKUA 5D1UA 3EWJA 4WF6A 3HDAP 2OI0A 3EDZA 1H71P 3DNGA 2OVXA 3WV3A 3LK8A 2MLSA 3F15A 3E8RA 4GWMA 1BSWA 3K7NA 4JPAA 1QIAA 4I03A 1UMSA 1ZP5A 2OY4A 1Q3AA 4H3XA 4GQLA 1D7XA 1J7NA 5D2BA 1GE6A 4DF9A 1MMRA 1KUIA 2MZEA 2WOAA 2K9CA 1SATA 1OMJA 2J83A 2OXWA 1A85A 1AKLA 1CXVA 2AYKA 1EAKA 1Y93A 4WKIA 3P24A 1G49A 4FXYP 1YOUA 1YP1A 1B8YA 3EDHA 5I2ZA 3I7GA 5L7FA 4L63A 1QJJA 2D1NA 4GUYA 2JNPA 4PKRA 1BIWA 4ZR5A 2X7MA 3LIKA 2OXZA 2MLRA 2V4BA 1FLSA 1CGFA 1HTDA 1ZVXA 3F17A 4GF1A 1KUFA 3EDGA 4DV8A 1FBLA 1XFZA 5I12A 3LUNA 2D1OA 3OHLA 4AXQA 4ON1A 1I76A 1PWUA 3DWBA 2E2DA 3G5CA 1HV5A 3KMEA 1SLMA 3LJTA 1I73A 1I1IP 3CKIA 1ROSA 3ELMA 4G0DA 1AYKA 3LJZA 1IAGA 1B3DA 1L6JA 1FM1A 1RMZA 1HOVA 2Y6DA 4PKWA 4IJOA 3AIGA 1ATLA 2OW9A 1MMBA 4R3VA 3LGPA 3TT4A 3HB2P 1C3IA 4WK7A 1JJ9A 4XM7A 1KAPP 2A8HA 3EHXA 5I0LA 5CXAA 2XS3A 1D5JA 1SRPA 1OM7A 3HDBA 1BM6A 1BQOA 2N8RA 3WV2A 2Z2DA 2E3XA 2L0RA 3F18A 3RTSA 2QPJA 2WO8A 1S4BP 1BUDA 3O64A 3KMCA 4H30A 1O0TA 2W15A 1DTHA 4H76A 4EFSA 4G9LA 3LEAA 1K7GA 2OZRA 1IAAA 2SRTA 3TSKA 2OW2A 830CA 1MMPA 1UEAA 1ND1A 2W14A 2J0TA 3N2UA 1R55A 4PKTA 3L0VA 3EHYA 2POJA 1JAPA 1UMTA 5H8XA 1QJIA 1KUHA 1UTTA 1GXDA 1YQYA 2DDFA 2WO9A 2W13A 3KWVC 4PKVA 1CGEA 1JAOA 1CK7A 1R1JA 3ZXHA 5I4OA 1C7KA 1D8MA 2O3EA 1SU3A 2TCLA 1GO7P 1R1HA 1G9KA 2DW2A 5BOYA 2JIHA 4JQGA 1Z3JA 2JT6A 5D1SA 2DW1A 2X3BA 5L79A 1OM8A 1BKCE 5I43A 1BKCI 1JH1A 4WKEA 5BOTA 5I3MA 3WV1A 4FXQA 2EROA 2ERQA 3N2VA 3HBUP 2ERPA 4AUOA 3DL1A 4H2EA 1MMQA 1JKYA 3VI1A 3LQBA 5CZMA 2USNA 1IAEA 2RJPA 1KUKA 1XFXA 2W0DA 5B5OA 1SLNA 1XURA 1K7QA 1PWQA 2YIGA 1Y0VA 4XBHA 1MNCA 3LE9A 2MZHA 2OW0A 1BZSA 4H49A 1QUAA 3F1AA 3KEJA 3BA0A 4CTHA 966CA 2JSDA 1JAQA 4IN9A 3LUMA 4H1QA 1JK3A 5LABA 1PWPA 1IADA 1OS2A 1QIBA 2PJTA 1XFVA 4AYKA 1SMPA 3KHIA 1BUVM 1ZTQA 1UTZA 2DDYA 3MA2A 3Q2GA 3DSLA 1BQQM 3F16A 1JIWP 1O0QA 1CQRA 4XM6A 3B8ZA 1EB6A 1XUCA 1C8TA 4XCTA 4IUWA 3V96B 4Q1LA 3UVCA 1XFYA 2RJQA 3KRYA 1D8FA 4PKQA 4JIJA 1XFWA 3EDIA 4GR0A 2JT5A 5D1TA 2MZIA 4A7BA 4PKSA 2OVZA 3ZVSA 1CIZA 2FV9A 3I7IA 1CAQA 1GO8P 2XS4A 3K7LA 3AYKA 1KUGA 2K2GA 1IABA 1EUBA 3GBOA 2YB9A 1GE7A 3L0TA 3RTTA 1Y8JA 3LIRA 1A86A 2Y6CA 4JP4A 4A3WA 3OHOA 3LJGA 1G05A 1ASTA 3F19A 2HU6A 4H84A 1BKCA 3KECA 1CGLA 2X3AA 4H82A 5BPAA 1IACA 4I35A 2AIGP 4HX3A 4GR8A 3LQ0A 3LILA 1OS9A 2CKIA 1PWWA 1DMTA 2X3CA 4DD8A 3DPEA 2I47A 2OY2A 1HFSA 3USNA 3B2ZA 3HY7A 3P1VA 1HFCA 2W12A 3HY9A 4L6TA 1AF0A 4JA1A 3KEKA 1WNIA 2CLTA 3Q2HA 1XFUA 2O36A
chains in the Genus database with same CATH superfamily
2R7GA 4EOQB 3VTGA 1ZXVA 1OIYB 4HL4A 4BCPB 2KRJA 3BHVB 1RM8A 1GKCA 1AHJB 4FU4A 2CZ0B 4HMAA 4DPEA 2DW0A 3WVDB 3TVCA 1JANA 1JIZA 1KBCA 1ZXCA 4Y72B 3VKGA 4ZGEB 1V29B 3HO8A 4AIGA 5IDPB 1OGUB 2WMAB 3X25B 3DTIA 4GR3A 5HBHB 1JKWA 3O2XA 4F7JB 1USNA 1R1IA 2IW6B 1YCMA 4WZVA 3LMCA 2ZPBB 3ZUKA 1UGRB 456CA 1OKVB 4BCMD 2ZCFB 4XM8A 3MY5B 1K7IA 3SHIA 5CUHA 1FINB 4OB3B 4BCIB 4BCJB 4FVLA 3NX7A 2WXVB 3X28B 4G6LB 1ENWA 1HY7A 1OO9A 5D3CA 3U1RA 1QICA 1OM6A 4YC3B 3HBVP 4YOOA 2OW1A 4ILWD 4L19A 4BXXX 5L2WB 3X20B 1G4KA 3TS4A 3HBLA 1URCB 3G42A 1R54A 4QKZA 2ZPFB 4HLQA 1GE5A 5HVYB 1GKDA 3QWLA 1XUDA 3AYUA 2F2CA 3HYGA 2FV5A 3DPFA 5D7WA 3O0GD 5B5PA 3DTOA 4CFMB 5EFQB 3B92A 1ZS0A 1PKDB 1G12A 3LKAA 2IW8B 1PWVA 4ELJA 3A8HB 4ZGDB 4GWNA 3X24B 4J4MA 5JMYA 2OXUA 4PKUA 1O9KB 1GUXB 3LQ5B 1OIUB 3RGFB 5D1UA 3EWJA 2G9XB 3POMA 4WF6A 3A8LB 4QSHA 1N4MA 4AKIA 2OI0A 1H71P 3EDZA 4BY7X 3HDAP 3DNGA 2OVXA 4NC6A 3WV3A 3LK8A 4HNUA 4EORB 4F7NB 2MLSA 1G3NC 3F15A 3E8RA 4GWMA 1BSWA 1H24B 3K7NA 3BLQB 4JPAA 1QIAA 4I03A 4EOMB 1OL1B 1UMSA 1E7PA 2BPMB 1ZP5A 2OY4A 4TTHA 1Q3AA 4GQLA 1D7XA 1J7NA 4H3XA 4BCFB 5D2BA 1GE6A 4FX3B 4DF9A 3TNHB 1MMRA 1KUIA 3BHUB 2MZEA 2K9CA 2WOAA 2PMIB 3HHTB 1SATA 3BLHB 1OMJA 4BCHB 2J83A 2G77A 4OB1B 4BCOB 4CFXB 2OXWA 3A8MB 2YUFA 1A85A 1AKLA 1CXVA 2AYKA 1EAKA 1Y93A 2CCIB 2W9FA 4CXAB 4WKIA 3P24A 2LW4A 1UNHD 1G49A 4FXYP 1XO2A 5IHYA 1YOUA 3EOCB 4CFUB 1YP1A 1B8YA 3EDHA 5I2ZA 3I7GA 2CZ6B 4F6UB 3EJ1B 3DDQB 5L7FA 1KXUA 4L63A 2CZ7B 4F6WB 1QJJA 2DXCB 4YOSA 2D1NA 4GUYA 2QF7A 2JNPA 4PKRA 3VYHB 1H1SB 1BIWA 4ZR5A 2WFYB 2X7MA 4EOPB 5BNJB 2IN3A 3GTMS 4EOIB 3DTKA 1UNLD 1H1QB 3LIKA 1VOLA 2OXZA 2MLRA 2V4BA 4NSTB 1OL2B 1FLSA 1CGFA 1HTDA 1ZVXA 3F17A 2IW9B 3BLRB 3X26B 1OZ9A 3BHTB 3PO3S 1KUFA 2W2HA 3EDGA 4GF1A 3QHRB 4DV8A 3QYBA 1FBLA 1XFZA 3EIDB 3LUNA 2D1OA 5I12A 3OHLA 4BCKB 4AXQA 4ON1A 1I76A 1PWUA 3HZJA 3DWBA 2E2DA 3G5CA 1HV5A 1UGQB 3KMEA 1OKWB 3B57A 1O9KA 3TW6A 1GUXA 1SLMA 1W98B 3LJTA 1I73A 1I1IP 4BBRM 3CKIA 3F5XB 1ROSA 3ELMA 5HBJB 5I5ZB 4G0DA 2BS2A 2WJ9A 1FVVB 4BCND 3DTEA 1AYKA 3A8GB 2IVXA 3LJZA 1IAGA 1B3DA 1L6JA 1QLBA 4AKHA 3A8OB 1FM1A 1RMZA 1HOVA 2Y6DA 4PKWA 4AKGA 3AIGA 4IJOA 1ATLA 3TW7A 5DQWA 2OW9A 1MMBA 1H26B 3QYHB 4R3VA 3LGPA 2KR6A 3TT4A 4F7LB 2DXBB 3HB2P 1C3IA 2DD5B 4WK7A 1JJ9A 4XM7A 1KAPP 2A8HA 4AI6A 3EHXA 2WMBB 5I0LA 5CXAA 2XS3A 5HBEB 2QFZA 1D5JA 1SRPA 4L7AA 1OM7A 3HDBA 4BCMB 1BM6A 1BQOA 1XAXA 2N8RA 2BKZB 2W9ZA 4ELLA 4F6SB 3WV2A 4EONB 5CYIB 2ZPIB 2Z2DA 3K7AM 2E3XA 2L0RA 3F18A 3RTSA 2X1NB 2QPJA 2WO8A 1S4BP 1BUDA 1P5EB 2V22B 5IF1B 2QGSA 3O64A 3KMCA 4ZGJB 4H30A 1O0TA 4M6VA 2W15A 2WPAB 4JX4A 1DTHA 4FM4B 4KRDB 4H76A 4EFSA 4G9LA 4LOCA 2C5NB 3LEAA 1K7GA 2OZRA 2I53A 2W96A 1IAAA 2SRTA 3H4CA 3TSKA 2OW2A 830CA 1MMPA 1UEAA 1ND1A 4EOJB 5FGKB 2W14A 2QDYB 2J0TA 3N2UA 1R55A 4PKTA 3L0VA 2UZDB 3EHYA 2POJA 1QMZB 3BG5A 4JX6A 3DDPB 1XM5A 1JAPA 1UMTA 2UZLB 5H8XA 1QJIA 2C5XB 1KUHA 4BY1X 4OB2B 1UTTA 1TFBA 1GXDA 3NDQA 2C6TB 1YQYA 2DDFA 2WO9A 5ICPB 2W13A 2CYZB 3KWVC 4PKVA 4Z6YA 1CGEA 2PJQA 3BG9A 1JAOA 1H1RB 1CK7A 1R1JA 3ZXHA 3G33B 2C5VB 3TNWB 5I4OA 1C7KA 1D8MA 2O3EA 1VYWB 4BCQD 2PK9B 1SU3A 2TCLA 2CZ1B 1GO7P 1R1HA 1G9KA 2DW2A 5BOYA 2JIHA 4CRLB 4JQGA 4BBSM 1Z3JA 2JT6A 1H4LD 1OI9B 1VINA 5D1SA 2WIPB 2DW1A 4EOLB 5ACBA 5HQ0B 2X3BA 5EJCA 1BU2A 5LQFB 5L79A 1OM8A 4ROEA 1BKCE 5I43A 1BKCI 1JH1A 4OB0B 4OR5B 4WKEA 5BOTA 2JGZB 5I3MA 1ZP2A 3WV1A 1AD6A 4FXQA 2BS4A 2EROA 3M03A 4CFWB 2ERQA 3N2VA 3HBUP 2ERPA 3TNIB 4CFVB 4AUOA 3DL1A 4H2EA 2CJMB 4OGRB 1MMQA 1GH6B 1JKYA 3VI1A 3LQBA 5CZMA 3QZ5B 4EC8B 2USNA 2DPPB 2C5OB 1IAEA 1KUKA 2RJPA 2UUEB 1XFXA 2W0DA 1TVIA 4F70B 5B5OA 1H28B 5CEIB 4HNVA 1UGPB 5LMKB 1SLNA 1XURA 1K7QA 4CFNB 1PWQA 2BS3A 2YIGA 4F7SB 2UZEB 1Y0VA 4YOZA 4XBHA 1TD6A 1MNCA 3LE9A 2MZHA 2OW0A 1BZSA 4H49A 1UNGD 1QUAA 3MI9B 3F1AA 3KEJA 3BA0A 4CTHA 966CA 1JSTB 3QYGB 2JSDA 1JAQA 4IN9A 3LUMA 4H1QA 4BCNB 2WIHB 1JK3A 3TN8B 5LABA 1PWPA 1IADA 1OS2A 1E9HB 1QIBA 2PJTA 4EOOB 1FKMA 2PHGA 1XFVA 4AYKA 4BCGB 1SMPA 3KHIA 3QZ9B 1BUVM 1ZTQA 1UTZA 2WHBB 2DDYA 3MA2A 4II5B 5DQVA 3Q2GA 2EUFA 3DSLA 1BQQM 1JOWA 3F16A 1H27B 1JIWP 1O0QA 2QDJA 1CQRA 4XM6A 3QHWB 3B8ZA 1EB6A 4MFEA 1XUCA 4KRCB 4I3ZB 2QQ8A 4MFDA 1C8TA 3QYEA 4XCTA 4IUWA 3V96B 1H25B 4Q1LA 3UVCA 2ZPEB 1F5QB 1XFYA 1D8FA 2RJQA 3KRYA 4PKQA 2C4GB 1XFWA 3EDIA 4JIJA 4GR0A 2JT5A 5D1TA 2MZIA 4A7BA 4PKSA 2DD4B 2OVZA 3ZVSA 1CIZA 2FV9A 3I7IA 1CAQA 3MY1B 4UN0A 1GO8P 4MIMA 4JX5A 2XS4A 3K7LA 3AYKA 1KUGA 2K2GA 1IABA 1EUBA 3GBOA 3MIAB 2YB9A 5IDNB 1GE7A 3L0TA 2KMGA 1JSUB 3RTTA 2AHJB 1Y8JA 3DOGB 3LIRA 1A86A 2Y6CA 3VYGB 4JP4A 4A3WA 4CFUD 2ZZDB 1D3UB 3OHOA 3LJGA 1G05A 1ASTA 2DMEA 1AISB 2HU6A 1BKCA 1IREB 3F19A 3KECA 1CGLA 2X3AA 4H84A 4ROCA 1GY3B 1H1PB 4H82A 5BPAA 2D0QB 4HNTA 1IACA 2AIGP 4I35A 4HX3A 4IMYB 4GR8A 2W99A 3LQ0A 2ZPHB 3LILA 2ZPGB 1OS9A 2CKIA 1PWWA 1DMTA 2CCHB 2B9RA 5HNBB 1C9BA 4EOKB 2X3CA 4DD8A 4EOSB 4EC9B 3DPEA 3DJBA 4BCQB 2I47A 2OY2A 1HFSA 3USNA 1UGSB 3B2ZA 3HY7A 2UZBB 3P1VA 1HFCA 2W12A 3HY9A 4L6TA 2PK2A 2I40B 3BG3A 3WVEB 1AF0A 4JA1A 2WEVB 3KEKA 3VKHA 3QXEB 1WNIA 2CLTA 3HB9A 4RODA 1XFUA 2O36A 3Q2HA
chains in the Genus database with same CATH topology
3VTGA 1ZXVA 4HL4A 2KRJA 1RM8A 1GKCA 1AHJB 4FU4A 2CZ0B 4HMAA 4DPEA 2DW0A 3WVDB 3TVCA 1JANA 1JIZA 1KBCA 1ZXCA 3VKGA 4ZGEB 1V29B 3HO8A 4AIGA 3X25B 3DTIA 4GR3A 3O2XA 1USNA 1R1IA 4WZVA 1YCMA 3LMCA 2ZPBB 3ZUKA 1UGRB 456CA 2ZCFB 4XM8A 1K7IA 3SHIA 5CUHA 4OB3B 4FVLA 3NX7A 3X28B 1HY7A 1OO9A 5D3CA 3U1RA 1QICA 1OM6A 3HBVP 4L19A 2OW1A 4ILWD 3X20B 1G4KA 3TS4A 3HBLA 3G42A 1R54A 4QKZA 2ZPFB 4HLQA 1GE5A 1GKDA 3QWLA 1XUDA 3AYUA 3HYGA 2FV5A 3DPFA 5D7WA 5B5PA 3B92A 1ZS0A 1G12A 3LKAA 1PWVA 4ELJA 3A8HB 4ZGDB 4GWNA 3X24B 4J4MA 5JMYA 2OXUA 4PKUA 5D1UA 3EWJA 4WF6A 3A8LB 4QSHA 2OI0A 4AKIA 3EDZA 1H71P 3HDAP 3DNGA 2OVXA 4NC6A 3WV3A 3LK8A 4HNUA 2MLSA 3F15A 3E8RA 4GWMA 1BSWA 3K7NA 4JPAA 1QIAA 4I03A 1UMSA 1E7PA 1ZP5A 2OY4A 1Q3AA 4H3XA 4GQLA 1D7XA 1J7NA 5D2BA 1GE6A 4DF9A 1MMRA 1KUIA 2MZEA 2WOAA 2K9CA 3HHTB 1SATA 1OMJA 2J83A 2G77A 4OB1B 2OXWA 3A8MB 2YUFA 1A85A 1AKLA 1CXVA 2AYKA 1EAKA 1Y93A 4WKIA 3P24A 1G49A 4FXYP 1YOUA 1YP1A 1B8YA 3EDHA 5I2ZA 3I7GA 2CZ6B 5L7FA 4L63A 2CZ7B 1QJJA 2DXCB 2D1NA 4GUYA 2QF7A 2JNPA 4PKRA 3VYHB 1BIWA 4ZR5A 2X7MA 3DTKA 3LIKA 2OXZA 2MLRA 2V4BA 1FLSA 1CGFA 1HTDA 1ZVXA 3F17A 4GF1A 3X26B 1KUFA 3EDGA 4DV8A 3QYBA 1FBLA 1XFZA 3LUNA 5I12A 2D1OA 3OHLA 4AXQA 4ON1A 1I76A 1PWUA 3HZJA 3DWBA 2E2DA 3G5CA 1HV5A 1UGQB 3KMEA 3TW6A 1SLMA 3LJTA 1I73A 1I1IP 4BBRM 3CKIA 1ROSA 3ELMA 4G0DA 2BS2A 2WJ9A 1AYKA 3DTEA 3A8GB 3LJZA 1IAGA 1B3DA 1L6JA 1QLBA 4AKHA 3A8OB 1FM1A 1RMZA 1HOVA 2Y6DA 4PKWA 4AKGA 3AIGA 4IJOA 1ATLA 3TW7A 2OW9A 1MMBA 3QYHB 4R3VA 3LGPA 2KR6A 3TT4A 2DXBB 3HB2P 1C3IA 2DD5B 4WK7A 1JJ9A 4XM7A 1KAPP 2A8HA 4AI6A 3EHXA 5I0LA 5CXAA 2XS3A 2QFZA 1D5JA 1SRPA 4L7AA 1OM7A 3HDBA 1BM6A 1BQOA 2N8RA 3WV2A 2Z2DA 2ZPIB 2E3XA 2L0RA 3F18A 3RTSA 2QPJA 2WO8A 1S4BP 1BUDA 3O64A 3KMCA 4ZGJB 4H30A 1O0TA 4M6VA 2W15A 4JX4A 1DTHA 4FM4B 4H76A 4EFSA 4G9LA 4LOCA 3LEAA 1K7GA 2OZRA 1IAAA 2SRTA 3H4CA 3TSKA 2OW2A 830CA 1MMPA 1UEAA 1ND1A 2W14A 2QDYB 2J0TA 3N2UA 1R55A 4PKTA 3L0VA 3EHYA 2POJA 3BG5A 4JX6A 1JAPA 1UMTA 5H8XA 1QJIA 1KUHA 4OB2B 1UTTA 1GXDA 1YQYA 2DDFA 2WO9A 2W13A 2CYZB 3KWVC 4PKVA 4Z6YA 1CGEA 3BG9A 1JAOA 1CK7A 1R1JA 3ZXHA 5I4OA 1C7KA 1D8MA 2O3EA 1SU3A 2TCLA 2CZ1B 1GO7P 1R1HA 1G9KA 2DW2A 5BOYA 2JIHA 4JQGA 4BBSM 1Z3JA 2JT6A 5D1SA 2DW1A 2X3BA 5EJCA 5L79A 1OM8A 1BKCE 5I43A 1BKCI 1JH1A 4OB0B 4WKEA 5BOTA 5I3MA 3WV1A 4FXQA 2BS4A 2EROA 2ERQA 3N2VA 3HBUP 2ERPA 4AUOA 3DL1A 4H2EA 1MMQA 1JKYA 3VI1A 3LQBA 5CZMA 3QZ5B 2USNA 2DPPB 1IAEA 2RJPA 1KUKA 1XFXA 2W0DA 5B5OA 4HNVA 1UGPB 1SLNA 1XURA 1K7QA 1PWQA 2BS3A 2YIGA 1Y0VA 4XBHA 1MNCA 3LE9A 2MZHA 2OW0A 1BZSA 4H49A 1QUAA 3F1AA 3KEJA 3BA0A 4CTHA 966CA 2JSDA 3QYGB 1JAQA 4IN9A 3LUMA 4H1QA 1JK3A 5LABA 1PWPA 1IADA 1OS2A 1QIBA 2PJTA 1FKMA 1XFVA 4AYKA 1SMPA 3KHIA 3QZ9B 1BUVM 1ZTQA 1UTZA 2DDYA 3MA2A 3Q2GA 3DSLA 1BQQM 3F16A 1JIWP 1O0QA 2QDJA 1CQRA 4XM6A 3B8ZA 1EB6A 4MFEA 1XUCA 2QQ8A 4MFDA 1C8TA 3QYEA 4XCTA 4IUWA 3V96B 4Q1LA 3UVCA 2ZPEB 1XFYA 1D8FA 2RJQA 3KRYA 4PKQA 4JIJA 1XFWA 3EDIA 4GR0A 2JT5A 5D1TA 2MZIA 4A7BA 4PKSA 2DD4B 2OVZA 3ZVSA 1CIZA 2FV9A 3I7IA 1CAQA 1GO8P 4MIMA 4JX5A 2XS4A 3K7LA 3AYKA 1KUGA 2K2GA 1IABA 1EUBA 3GBOA 2YB9A 1GE7A 3L0TA 2KMGA 3RTTA 2AHJB 1Y8JA 3LIRA 1A86A 2Y6CA 3VYGB 4JP4A 4A3WA 2ZZDB 3OHOA 3LJGA 1G05A 1ASTA 3F19A 2HU6A 4H84A 1BKCA 1IREB 3KECA 1CGLA 2X3AA 4H82A 5BPAA 2D0QB 4HNTA 1IACA 2AIGP 4I35A 4HX3A 4GR8A 3LQ0A 2ZPHB 3LILA 2ZPGB 1OS9A 2CKIA 1PWWA 1DMTA 2X3CA 4DD8A 3DPEA 2I47A 2OY2A 1HFSA 3USNA 1UGSB 3B2ZA 3HY7A 3P1VA 1HFCA 2W12A 3HY9A 4L6TA 3BG3A 3WVEB 1AF0A 4JA1A 3KEKA 3VKHA 3QXEB 1WNIA 2CLTA 3HB9A 1XFUA 3Q2HA 2O36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTG A;  1ZXV A;  2KRJ A;  1RM8 A;  1GKC A;  4FU4 A;  4HMA A;  4DPE A;  2DW0 A;  3TVC A;  1JAN A;  1JIZ A;  1KBC A;  1ZXC A;  4AIG A;  4GR3 A;  3O2X A;  1USN A;  1R1I A;  4WZV A;  1YCM A;  3LMC A;  3ZUK A;  456C A;  4XM8 A;  1K7I A;  3SHI A;  5CUH A;  4FVL A;  3NX7 A;  1HY7 A;  1OO9 A;  5D3C A;  3U1R A;  1QIC A;  1OM6 A;  3HBV P;  4L19 A;  2OW1 A;  4ILW D;  1G4K A;  3TS4 A;  3G42 A;  1R54 A;  4QKZ A;  1GKD A;  1GE5 A;  1XUD A;  3AYU A;  3HYG A;  2FV5 A;  3DPF A;  5D7W A;  5B5P A;  3B92 A;  1ZS0 A;  1G12 A;  3LKA A;  1PWV A;  4GWN A;  4J4M A;  5JMY A;  2OXU A;  4PKU A;  5D1U A;  3EWJ A;  4WF6 A;  3HDA P;  2OI0 A;  3EDZ A;  1H71 P;  3DNG A;  2OVX A;  3WV3 A;  3LK8 A;  2MLS A;  3F15 A;  3E8R A;  4GWM A;  1BSW A;  3K7N A;  4JPA A;  1QIA A;  4I03 A;  1UMS A;  1ZP5 A;  2OY4 A;  1Q3A A;  4H3X A;  4GQL A;  1D7X A;  1J7N A;  5D2B A;  1GE6 A;  4DF9 A;  1MMR A;  1KUI A;  2MZE A;  2WOA A;  2K9C A;  1SAT A;  1OMJ A;  2J83 A;  2OXW A;  1A85 A;  1AKL A;  1CXV A;  2AYK A;  1EAK A;  1Y93 A;  4WKI A;  3P24 A;  1G49 A;  4FXY P;  1YOU A;  1YP1 A;  1B8Y A;  3EDH A;  5I2Z A;  3I7G A;  5L7F A;  4L63 A;  1QJJ A;  2D1N A;  4GUY A;  2JNP A;  4PKR A;  1BIW A;  4ZR5 A;  2X7M A;  3LIK A;  2OXZ A;  2MLR A;  2V4B A;  1FLS A;  1CGF A;  1HTD A;  1ZVX A;  3F17 A;  4GF1 A;  1KUF A;  3EDG A;  4DV8 A;  1FBL A;  1XFZ A;  5I12 A;  3LUN A;  2D1O A;  3OHL A;  4AXQ A;  4ON1 A;  1I76 A;  1PWU A;  3DWB A;  2E2D A;  3G5C A;  1HV5 A;  3KME A;  1SLM A;  3LJT A;  1I73 A;  1I1I P;  3CKI A;  1ROS A;  3ELM A;  4G0D A;  1AYK A;  3LJZ A;  1IAG A;  1B3D A;  1L6J A;  1FM1 A;  1RMZ A;  1HOV A;  2Y6D A;  4PKW A;  4IJO A;  3AIG A;  1ATL A;  2OW9 A;  1MMB A;  4R3V A;  3LGP A;  3TT4 A;  3HB2 P;  1C3I A;  4WK7 A;  1JJ9 A;  4XM7 A;  1KAP P;  2A8H A;  3EHX A;  5I0L A;  5CXA A;  2XS3 A;  1D5J A;  1SRP A;  1OM7 A;  3HDB A;  1BM6 A;  1BQO A;  2N8R A;  3WV2 A;  2Z2D A;  2E3X A;  2L0R A;  3F18 A;  3RTS A;  2QPJ A;  2WO8 A;  1S4B P;  1BUD A;  3O64 A;  3KMC A;  4H30 A;  1O0T A;  2W15 A;  1DTH A;  4H76 A;  4EFS A;  4G9L A;  3LEA A;  1K7G A;  2OZR A;  1IAA A;  2SRT A;  3TSK A;  2OW2 A;  830C A;  1MMP A;  1UEA A;  1ND1 A;  2W14 A;  2J0T A;  3N2U A;  1R55 A;  4PKT A;  3L0V A;  3EHY A;  2POJ A;  1JAP A;  1UMT A;  5H8X A;  1QJI A;  1KUH A;  1UTT A;  1GXD A;  1YQY A;  2DDF A;  2WO9 A;  2W13 A;  3KWV C;  4PKV A;  1CGE A;  1JAO A;  1CK7 A;  1R1J A;  3ZXH A;  5I4O A;  1C7K A;  1D8M A;  2O3E A;  1SU3 A;  2TCL A;  1GO7 P;  1R1H A;  1G9K A;  2DW2 A;  5BOY A;  2JIH A;  4JQG A;  1Z3J A;  2JT6 A;  5D1S A;  2DW1 A;  2X3B A;  5L79 A;  1OM8 A;  1BKC E;  5I43 A;  1BKC I;  1JH1 A;  4WKE A;  5BOT A;  5I3M A;  3WV1 A;  4FXQ A;  2ERO A;  2ERQ A;  3N2V A;  3HBU P;  2ERP A;  4AUO A;  3DL1 A;  4H2E A;  1MMQ A;  1JKY A;  3VI1 A;  3LQB A;  5CZM A;  2USN A;  1IAE A;  2RJP A;  1KUK A;  1XFX A;  2W0D A;  5B5O A;  1SLN A;  1XUR A;  1K7Q A;  1PWQ A;  2YIG A;  1Y0V A;  4XBH A;  1MNC A;  3LE9 A;  2MZH A;  2OW0 A;  1BZS A;  4H49 A;  1QUA A;  3F1A A;  3KEJ A;  3BA0 A;  4CTH A;  966C A;  2JSD A;  1JAQ A;  4IN9 A;  3LUM A;  4H1Q A;  1JK3 A;  5LAB A;  1PWP A;  1IAD A;  1OS2 A;  1QIB A;  2PJT A;  1XFV A;  4AYK A;  1SMP A;  3KHI A;  1BUV M;  1ZTQ A;  1UTZ A;  2DDY A;  3MA2 A;  3Q2G A;  3DSL A;  1BQQ M;  3F16 A;  1JIW P;  1O0Q A;  1CQR A;  4XM6 A;  3B8Z A;  1EB6 A;  1XUC A;  1C8T A;  4XCT A;  4IUW A;  3V96 B;  4Q1L A;  3UVC A;  1XFY A;  2RJQ A;  3KRY A;  1D8F A;  4PKQ A;  4JIJ A;  1XFW A;  3EDI A;  4GR0 A;  2JT5 A;  5D1T A;  2MZI A;  4A7B A;  4PKS A;  2OVZ A;  3ZVS A;  1CIZ A;  2FV9 A;  3I7I A;  1CAQ A;  1GO8 P;  2XS4 A;  3K7L A;  3AYK A;  1KUG A;  2K2G A;  1IAB A;  1EUB A;  3GBO A;  2YB9 A;  1GE7 A;  3L0T A;  3RTT A;  1Y8J A;  3LIR A;  1A86 A;  2Y6C A;  4JP4 A;  4A3W A;  3OHO A;  3LJG A;  1G05 A;  1AST A;  3F19 A;  2HU6 A;  4H84 A;  1BKC A;  3KEC A;  1CGL A;  2X3A A;  4H82 A;  5BPA A;  1IAC A;  4I35 A;  2AIG P;  4HX3 A;  4GR8 A;  3LQ0 A;  3LIL A;  1OS9 A;  2CKI A;  1PWW A;  1DMT A;  2X3C A;  4DD8 A;  3DPE A;  2I47 A;  2OY2 A;  1HFS A;  3USN A;  3B2Z A;  3HY7 A;  3P1V A;  1HFC A;  2W12 A;  3HY9 A;  4L6T A;  1AF0 A;  4JA1 A;  3KEK A;  1WNI A;  2CLT A;  3Q2H A;  1XFU A;  2O36 A; 
#chains in the Genus database with same CATH topology
 2R7G A;  4EOQ B;  3VTG A;  1ZXV A;  1OIY B;  4HL4 A;  4BCP B;  2KRJ A;  3BHV B;  1RM8 A;  1GKC A;  1AHJ B;  4FU4 A;  2CZ0 B;  4HMA A;  4DPE A;  2DW0 A;  3WVD B;  3TVC A;  1JAN A;  1JIZ A;  1KBC A;  1ZXC A;  4Y72 B;  3VKG A;  4ZGE B;  1V29 B;  3HO8 A;  4AIG A;  5IDP B;  1OGU B;  2WMA B;  3X25 B;  3DTI A;  4GR3 A;  5HBH B;  1JKW A;  3O2X A;  4F7J B;  1USN A;  1R1I A;  2IW6 B;  1YCM A;  4WZV A;  3LMC A;  2ZPB B;  3ZUK A;  1UGR B;  456C A;  1OKV B;  4BCM D;  2ZCF B;  4XM8 A;  3MY5 B;  1K7I A;  3SHI A;  5CUH A;  1FIN B;  4OB3 B;  4BCI B;  4BCJ B;  4FVL A;  3NX7 A;  2WXV B;  3X28 B;  4G6L B;  1ENW A;  1HY7 A;  1OO9 A;  5D3C A;  3U1R A;  1QIC A;  1OM6 A;  4YC3 B;  3HBV P;  4YOO A;  2OW1 A;  4ILW D;  4L19 A;  4BXX X;  5L2W B;  3X20 B;  1G4K A;  3TS4 A;  3HBL A;  1URC B;  3G42 A;  1R54 A;  4QKZ A;  2ZPF B;  4HLQ A;  1GE5 A;  5HVY B;  1GKD A;  3QWL A;  1XUD A;  3AYU A;  2F2C A;  3HYG A;  2FV5 A;  3DPF A;  5D7W A;  3O0G D;  5B5P A;  3DTO A;  4CFM B;  5EFQ B;  3B92 A;  1ZS0 A;  1PKD B;  1G12 A;  3LKA A;  2IW8 B;  1PWV A;  4ELJ A;  3A8H B;  4ZGD B;  4GWN A;  3X24 B;  4J4M A;  5JMY A;  2OXU A;  4PKU A;  1O9K B;  1GUX B;  3LQ5 B;  1OIU B;  3RGF B;  5D1U A;  3EWJ A;  2G9X B;  3POM A;  4WF6 A;  3A8L B;  4QSH A;  1N4M A;  4AKI A;  2OI0 A;  1H71 P;  3EDZ A;  4BY7 X;  3HDA P;  3DNG A;  2OVX A;  4NC6 A;  3WV3 A;  3LK8 A;  4HNU A;  4EOR B;  4F7N B;  2MLS A;  1G3N C;  3F15 A;  3E8R A;  4GWM A;  1BSW A;  1H24 B;  3K7N A;  3BLQ B;  4JPA A;  1QIA A;  4I03 A;  4EOM B;  1OL1 B;  1UMS A;  1E7P A;  2BPM B;  1ZP5 A;  2OY4 A;  4TTH A;  1Q3A A;  4GQL A;  1D7X A;  1J7N A;  4H3X A;  4BCF B;  5D2B A;  1GE6 A;  4FX3 B;  4DF9 A;  3TNH B;  1MMR A;  1KUI A;  3BHU B;  2MZE A;  2K9C A;  2WOA A;  2PMI B;  3HHT B;  1SAT A;  3BLH B;  1OMJ A;  4BCH B;  2J83 A;  2G77 A;  4OB1 B;  4BCO B;  4CFX B;  2OXW A;  3A8M B;  2YUF A;  1A85 A;  1AKL A;  1CXV A;  2AYK A;  1EAK A;  1Y93 A;  2CCI B;  2W9F A;  4CXA B;  4WKI A;  3P24 A;  2LW4 A;  1UNH D;  1G49 A;  4FXY P;  1XO2 A;  5IHY A;  1YOU A;  3EOC B;  4CFU B;  1YP1 A;  1B8Y A;  3EDH A;  5I2Z A;  3I7G A;  2CZ6 B;  4F6U B;  3EJ1 B;  3DDQ B;  5L7F A;  1KXU A;  4L63 A;  2CZ7 B;  4F6W B;  1QJJ A;  2DXC B;  4YOS A;  2D1N A;  4GUY A;  2QF7 A;  2JNP A;  4PKR A;  3VYH B;  1H1S B;  1BIW A;  4ZR5 A;  2WFY B;  2X7M A;  4EOP B;  5BNJ B;  2IN3 A;  3GTM S;  4EOI B;  3DTK A;  1UNL D;  1H1Q B;  3LIK A;  1VOL A;  2OXZ A;  2MLR A;  2V4B A;  4NST B;  1OL2 B;  1FLS A;  1CGF A;  1HTD A;  1ZVX A;  3F17 A;  2IW9 B;  3BLR B;  3X26 B;  1OZ9 A;  3BHT B;  3PO3 S;  1KUF A;  2W2H A;  3EDG A;  4GF1 A;  3QHR B;  4DV8 A;  3QYB A;  1FBL A;  1XFZ A;  3EID B;  3LUN A;  2D1O A;  5I12 A;  3OHL A;  4BCK B;  4AXQ A;  4ON1 A;  1I76 A;  1PWU A;  3HZJ A;  3DWB A;  2E2D A;  3G5C A;  1HV5 A;  1UGQ B;  3KME A;  1OKW B;  3B57 A;  1O9K A;  3TW6 A;  1GUX A;  1SLM A;  1W98 B;  3LJT A;  1I73 A;  1I1I P;  4BBR M;  3CKI A;  3F5X B;  1ROS A;  3ELM A;  5HBJ B;  5I5Z B;  4G0D A;  2BS2 A;  2WJ9 A;  1FVV B;  4BCN D;  3DTE A;  1AYK A;  3A8G B;  2IVX A;  3LJZ A;  1IAG A;  1B3D A;  1L6J A;  1QLB A;  4AKH A;  3A8O B;  1FM1 A;  1RMZ A;  1HOV A;  2Y6D A;  4PKW A;  4AKG A;  3AIG A;  4IJO A;  1ATL A;  3TW7 A;  5DQW A;  2OW9 A;  1MMB A;  1H26 B;  3QYH B;  4R3V A;  3LGP A;  2KR6 A;  3TT4 A;  4F7L B;  2DXB B;  3HB2 P;  1C3I A;  2DD5 B;  4WK7 A;  1JJ9 A;  4XM7 A;  1KAP P;  2A8H A;  4AI6 A;  3EHX A;  2WMB B;  5I0L A;  5CXA A;  2XS3 A;  5HBE B;  2QFZ A;  1D5J A;  1SRP A;  4L7A A;  1OM7 A;  3HDB A;  4BCM B;  1BM6 A;  1BQO A;  1XAX A;  2N8R A;  2BKZ B;  2W9Z A;  4ELL A;  4F6S B;  3WV2 A;  4EON B;  5CYI B;  2ZPI B;  2Z2D A;  3K7A M;  2E3X A;  2L0R A;  3F18 A;  3RTS A;  2X1N B;  2QPJ A;  2WO8 A;  1S4B P;  1BUD A;  1P5E B;  2V22 B;  5IF1 B;  2QGS A;  3O64 A;  3KMC A;  4ZGJ B;  4H30 A;  1O0T A;  4M6V A;  2W15 A;  2WPA B;  4JX4 A;  1DTH A;  4FM4 B;  4KRD B;  4H76 A;  4EFS A;  4G9L A;  4LOC A;  2C5N B;  3LEA A;  1K7G A;  2OZR A;  2I53 A;  2W96 A;  1IAA A;  2SRT A;  3H4C A;  3TSK A;  2OW2 A;  830C A;  1MMP A;  1UEA A;  1ND1 A;  4EOJ B;  5FGK B;  2W14 A;  2QDY B;  2J0T A;  3N2U A;  1R55 A;  4PKT A;  3L0V A;  2UZD B;  3EHY A;  2POJ A;  1QMZ B;  3BG5 A;  4JX6 A;  3DDP B;  1XM5 A;  1JAP A;  1UMT A;  2UZL B;  5H8X A;  1QJI A;  2C5X B;  1KUH A;  4BY1 X;  4OB2 B;  1UTT A;  1TFB A;  1GXD A;  3NDQ A;  2C6T B;  1YQY A;  2DDF A;  2WO9 A;  5ICP B;  2W13 A;  2CYZ B;  3KWV C;  4PKV A;  4Z6Y A;  1CGE A;  2PJQ A;  3BG9 A;  1JAO A;  1H1R B;  1CK7 A;  1R1J A;  3ZXH A;  3G33 B;  2C5V B;  3TNW B;  5I4O A;  1C7K A;  1D8M A;  2O3E A;  1VYW B;  4BCQ D;  2PK9 B;  1SU3 A;  2TCL A;  2CZ1 B;  1GO7 P;  1R1H A;  1G9K A;  2DW2 A;  5BOY A;  2JIH A;  4CRL B;  4JQG A;  4BBS M;  1Z3J A;  2JT6 A;  1H4L D;  1OI9 B;  1VIN A;  5D1S A;  2WIP B;  2DW1 A;  4EOL B;  5ACB A;  5HQ0 B;  2X3B A;  5EJC A;  1BU2 A;  5LQF B;  5L79 A;  1OM8 A;  4ROE A;  1BKC E;  5I43 A;  1BKC I;  1JH1 A;  4OB0 B;  4OR5 B;  4WKE A;  5BOT A;  2JGZ B;  5I3M A;  1ZP2 A;  3WV1 A;  1AD6 A;  4FXQ A;  2BS4 A;  2ERO A;  3M03 A;  4CFW B;  2ERQ A;  3N2V A;  3HBU P;  2ERP A;  3TNI B;  4CFV B;  4AUO A;  3DL1 A;  4H2E A;  2CJM B;  4OGR B;  1MMQ A;  1GH6 B;  1JKY A;  3VI1 A;  3LQB A;  5CZM A;  3QZ5 B;  4EC8 B;  2USN A;  2DPP B;  2C5O B;  1IAE A;  1KUK A;  2RJP A;  2UUE B;  1XFX A;  2W0D A;  1TVI A;  4F70 B;  5B5O A;  1H28 B;  5CEI B;  4HNV A;  1UGP B;  5LMK B;  1SLN A;  1XUR A;  1K7Q A;  4CFN B;  1PWQ A;  2BS3 A;  2YIG A;  4F7S B;  2UZE B;  1Y0V A;  4YOZ A;  4XBH A;  1TD6 A;  1MNC A;  3LE9 A;  2MZH A;  2OW0 A;  1BZS A;  4H49 A;  1UNG D;  1QUA A;  3MI9 B;  3F1A A;  3KEJ A;  3BA0 A;  4CTH A;  966C A;  1JST B;  3QYG B;  2JSD A;  1JAQ A;  4IN9 A;  3LUM A;  4H1Q A;  4BCN B;  2WIH B;  1JK3 A;  3TN8 B;  5LAB A;  1PWP A;  1IAD A;  1OS2 A;  1E9H B;  1QIB A;  2PJT A;  4EOO B;  1FKM A;  2PHG A;  1XFV A;  4AYK A;  4BCG B;  1SMP A;  3KHI A;  3QZ9 B;  1BUV M;  1ZTQ A;  1UTZ A;  2WHB B;  2DDY A;  3MA2 A;  4II5 B;  5DQV A;  3Q2G A;  2EUF A;  3DSL A;  1BQQ M;  1JOW A;  3F16 A;  1H27 B;  1JIW P;  1O0Q A;  2QDJ A;  1CQR A;  4XM6 A;  3QHW B;  3B8Z A;  1EB6 A;  4MFE A;  1XUC A;  4KRC B;  4I3Z B;  2QQ8 A;  4MFD A;  1C8T A;  3QYE A;  4XCT A;  4IUW A;  3V96 B;  1H25 B;  4Q1L A;  3UVC A;  2ZPE B;  1F5Q B;  1XFY A;  1D8F A;  2RJQ A;  3KRY A;  4PKQ A;  2C4G B;  1XFW A;  3EDI A;  4JIJ A;  4GR0 A;  2JT5 A;  5D1T A;  2MZI A;  4A7B A;  4PKS A;  2DD4 B;  2OVZ A;  3ZVS A;  1CIZ A;  2FV9 A;  3I7I A;  1CAQ A;  3MY1 B;  4UN0 A;  1GO8 P;  4MIM A;  4JX5 A;  2XS4 A;  3K7L A;  3AYK A;  1KUG A;  2K2G A;  1IAB A;  1EUB A;  3GBO A;  3MIA B;  2YB9 A;  5IDN B;  1GE7 A;  3L0T A;  2KMG A;  1JSU B;  3RTT A;  2AHJ B;  1Y8J A;  3DOG B;  3LIR A;  1A86 A;  2Y6C A;  3VYG B;  4JP4 A;  4A3W A;  4CFU D;  2ZZD B;  1D3U B;  3OHO A;  3LJG A;  1G05 A;  1AST A;  2DME A;  1AIS B;  2HU6 A;  1BKC A;  1IRE B;  3F19 A;  3KEC A;  1CGL A;  2X3A A;  4H84 A;  4ROC A;  1GY3 B;  1H1P B;  4H82 A;  5BPA A;  2D0Q B;  4HNT A;  1IAC A;  2AIG P;  4I35 A;  4HX3 A;  4IMY B;  4GR8 A;  2W99 A;  3LQ0 A;  2ZPH B;  3LIL A;  2ZPG B;  1OS9 A;  2CKI A;  1PWW A;  1DMT A;  2CCH B;  2B9R A;  5HNB B;  1C9B A;  4EOK B;  2X3C A;  4DD8 A;  4EOS B;  4EC9 B;  3DPE A;  3DJB A;  4BCQ B;  2I47 A;  2OY2 A;  1HFS A;  3USN A;  1UGS B;  3B2Z A;  3HY7 A;  2UZB B;  3P1V A;  1HFC A;  2W12 A;  3HY9 A;  4L6T A;  2PK2 A;  2I40 B;  3BG3 A;  3WVE B;  1AF0 A;  4JA1 A;  2WEV B;  3KEK A;  3VKH A;  3QXE B;  1WNI A;  2CLT A;  3HB9 A;  4ROD A;  1XFU A;  2O36 A;  3Q2H A; 
#chains in the Genus database with same CATH homology
 3VTG A;  1ZXV A;  4HL4 A;  2KRJ A;  1RM8 A;  1GKC A;  1AHJ B;  4FU4 A;  2CZ0 B;  4HMA A;  4DPE A;  2DW0 A;  3WVD B;  3TVC A;  1JAN A;  1JIZ A;  1KBC A;  1ZXC A;  3VKG A;  4ZGE B;  1V29 B;  3HO8 A;  4AIG A;  3X25 B;  3DTI A;  4GR3 A;  3O2X A;  1USN A;  1R1I A;  4WZV A;  1YCM A;  3LMC A;  2ZPB B;  3ZUK A;  1UGR B;  456C A;  2ZCF B;  4XM8 A;  1K7I A;  3SHI A;  5CUH A;  4OB3 B;  4FVL A;  3NX7 A;  3X28 B;  1HY7 A;  1OO9 A;  5D3C A;  3U1R A;  1QIC A;  1OM6 A;  3HBV P;  4L19 A;  2OW1 A;  4ILW D;  3X20 B;  1G4K A;  3TS4 A;  3HBL A;  3G42 A;  1R54 A;  4QKZ A;  2ZPF B;  4HLQ A;  1GE5 A;  1GKD A;  3QWL A;  1XUD A;  3AYU A;  3HYG A;  2FV5 A;  3DPF A;  5D7W A;  5B5P A;  3B92 A;  1ZS0 A;  1G12 A;  3LKA A;  1PWV A;  4ELJ A;  3A8H B;  4ZGD B;  4GWN A;  3X24 B;  4J4M A;  5JMY A;  2OXU A;  4PKU A;  5D1U A;  3EWJ A;  4WF6 A;  3A8L B;  4QSH A;  2OI0 A;  4AKI A;  3EDZ A;  1H71 P;  3HDA P;  3DNG A;  2OVX A;  4NC6 A;  3WV3 A;  3LK8 A;  4HNU A;  2MLS A;  3F15 A;  3E8R A;  4GWM A;  1BSW A;  3K7N A;  4JPA A;  1QIA A;  4I03 A;  1UMS A;  1E7P A;  1ZP5 A;  2OY4 A;  1Q3A A;  4H3X A;  4GQL A;  1D7X A;  1J7N A;  5D2B A;  1GE6 A;  4DF9 A;  1MMR A;  1KUI A;  2MZE A;  2WOA A;  2K9C A;  3HHT B;  1SAT A;  1OMJ A;  2J83 A;  2G77 A;  4OB1 B;  2OXW A;  3A8M B;  2YUF A;  1A85 A;  1AKL A;  1CXV A;  2AYK A;  1EAK A;  1Y93 A;  4WKI A;  3P24 A;  1G49 A;  4FXY P;  1YOU A;  1YP1 A;  1B8Y A;  3EDH A;  5I2Z A;  3I7G A;  2CZ6 B;  5L7F A;  4L63 A;  2CZ7 B;  1QJJ A;  2DXC B;  2D1N A;  4GUY A;  2QF7 A;  2JNP A;  4PKR A;  3VYH B;  1BIW A;  4ZR5 A;  2X7M A;  3DTK A;  3LIK A;  2OXZ A;  2MLR A;  2V4B A;  1FLS A;  1CGF A;  1HTD A;  1ZVX A;  3F17 A;  4GF1 A;  3X26 B;  1KUF A;  3EDG A;  4DV8 A;  3QYB A;  1FBL A;  1XFZ A;  3LUN A;  5I12 A;  2D1O A;  3OHL A;  4AXQ A;  4ON1 A;  1I76 A;  1PWU A;  3HZJ A;  3DWB A;  2E2D A;  3G5C A;  1HV5 A;  1UGQ B;  3KME A;  3TW6 A;  1SLM A;  3LJT A;  1I73 A;  1I1I P;  4BBR M;  3CKI A;  1ROS A;  3ELM A;  4G0D A;  2BS2 A;  2WJ9 A;  1AYK A;  3DTE A;  3A8G B;  3LJZ A;  1IAG A;  1B3D A;  1L6J A;  1QLB A;  4AKH A;  3A8O B;  1FM1 A;  1RMZ A;  1HOV A;  2Y6D A;  4PKW A;  4AKG A;  3AIG A;  4IJO A;  1ATL A;  3TW7 A;  2OW9 A;  1MMB A;  3QYH B;  4R3V A;  3LGP A;  2KR6 A;  3TT4 A;  2DXB B;  3HB2 P;  1C3I A;  2DD5 B;  4WK7 A;  1JJ9 A;  4XM7 A;  1KAP P;  2A8H A;  4AI6 A;  3EHX A;  5I0L A;  5CXA A;  2XS3 A;  2QFZ A;  1D5J A;  1SRP A;  4L7A A;  1OM7 A;  3HDB A;  1BM6 A;  1BQO A;  2N8R A;  3WV2 A;  2Z2D A;  2ZPI B;  2E3X A;  2L0R A;  3F18 A;  3RTS A;  2QPJ A;  2WO8 A;  1S4B P;  1BUD A;  3O64 A;  3KMC A;  4ZGJ B;  4H30 A;  1O0T A;  4M6V A;  2W15 A;  4JX4 A;  1DTH A;  4FM4 B;  4H76 A;  4EFS A;  4G9L A;  4LOC A;  3LEA A;  1K7G A;  2OZR A;  1IAA A;  2SRT A;  3H4C A;  3TSK A;  2OW2 A;  830C A;  1MMP A;  1UEA A;  1ND1 A;  2W14 A;  2QDY B;  2J0T A;  3N2U A;  1R55 A;  4PKT A;  3L0V A;  3EHY A;  2POJ A;  3BG5 A;  4JX6 A;  1JAP A;  1UMT A;  5H8X A;  1QJI A;  1KUH A;  4OB2 B;  1UTT A;  1GXD A;  1YQY A;  2DDF A;  2WO9 A;  2W13 A;  2CYZ B;  3KWV C;  4PKV A;  4Z6Y A;  1CGE A;  3BG9 A;  1JAO A;  1CK7 A;  1R1J A;  3ZXH A;  5I4O A;  1C7K A;  1D8M A;  2O3E A;  1SU3 A;  2TCL A;  2CZ1 B;  1GO7 P;  1R1H A;  1G9K A;  2DW2 A;  5BOY A;  2JIH A;  4JQG A;  4BBS M;  1Z3J A;  2JT6 A;  5D1S A;  2DW1 A;  2X3B A;  5EJC A;  5L79 A;  1OM8 A;  1BKC E;  5I43 A;  1BKC I;  1JH1 A;  4OB0 B;  4WKE A;  5BOT A;  5I3M A;  3WV1 A;  4FXQ A;  2BS4 A;  2ERO A;  2ERQ A;  3N2V A;  3HBU P;  2ERP A;  4AUO A;  3DL1 A;  4H2E A;  1MMQ A;  1JKY A;  3VI1 A;  3LQB A;  5CZM A;  3QZ5 B;  2USN A;  2DPP B;  1IAE A;  2RJP A;  1KUK A;  1XFX A;  2W0D A;  5B5O A;  4HNV A;  1UGP B;  1SLN A;  1XUR A;  1K7Q A;  1PWQ A;  2BS3 A;  2YIG A;  1Y0V A;  4XBH A;  1MNC A;  3LE9 A;  2MZH A;  2OW0 A;  1BZS A;  4H49 A;  1QUA A;  3F1A A;  3KEJ A;  3BA0 A;  4CTH A;  966C A;  2JSD A;  3QYG B;  1JAQ A;  4IN9 A;  3LUM A;  4H1Q A;  1JK3 A;  5LAB A;  1PWP A;  1IAD A;  1OS2 A;  1QIB A;  2PJT A;  1FKM A;  1XFV A;  4AYK A;  1SMP A;  3KHI A;  3QZ9 B;  1BUV M;  1ZTQ A;  1UTZ A;  2DDY A;  3MA2 A;  3Q2G A;  3DSL A;  1BQQ M;  3F16 A;  1JIW P;  1O0Q A;  2QDJ A;  1CQR A;  4XM6 A;  3B8Z A;  1EB6 A;  4MFE A;  1XUC A;  2QQ8 A;  4MFD A;  1C8T A;  3QYE A;  4XCT A;  4IUW A;  3V96 B;  4Q1L A;  3UVC A;  2ZPE B;  1XFY A;  1D8F A;  2RJQ A;  3KRY A;  4PKQ A;  4JIJ A;  1XFW A;  3EDI A;  4GR0 A;  2JT5 A;  5D1T A;  2MZI A;  4A7B A;  4PKS A;  2DD4 B;  2OVZ A;  3ZVS A;  1CIZ A;  2FV9 A;  3I7I A;  1CAQ A;  1GO8 P;  4MIM A;  4JX5 A;  2XS4 A;  3K7L A;  3AYK A;  1KUG A;  2K2G A;  1IAB A;  1EUB A;  3GBO A;  2YB9 A;  1GE7 A;  3L0T A;  2KMG A;  3RTT A;  2AHJ B;  1Y8J A;  3LIR A;  1A86 A;  2Y6C A;  3VYG B;  4JP4 A;  4A3W A;  2ZZD B;  3OHO A;  3LJG A;  1G05 A;  1AST A;  3F19 A;  2HU6 A;  4H84 A;  1BKC A;  1IRE B;  3KEC A;  1CGL A;  2X3A A;  4H82 A;  5BPA A;  2D0Q B;  4HNT A;  1IAC A;  2AIG P;  4I35 A;  4HX3 A;  4GR8 A;  3LQ0 A;  2ZPH B;  3LIL A;  2ZPG B;  1OS9 A;  2CKI A;  1PWW A;  1DMT A;  2X3C A;  4DD8 A;  3DPE A;  2I47 A;  2OY2 A;  1HFS A;  3USN A;  1UGS B;  3B2Z A;  3HY7 A;  3P1V A;  1HFC A;  2W12 A;  3HY9 A;  4L6T A;  3BG3 A;  3WVE B;  1AF0 A;  4JA1 A;  3KEK A;  3VKH A;  3QXE B;  1WNI A;  2CLT A;  3HB9 A;  1XFU A;  3Q2H A;  2O36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...