3DL1A

Crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
237
structure length
210
Chain Sequence
EMPWEQALAIPVLAHLSSTEQHKLTQMAARFLQQKRLVALQGLELTPLHQARIAMLFCLPVLELGIEWLDGFHEVLIYPAPFQQGPVVLNWLDIQDSFDASGFNLVVHEVAHKLDTRDRASGVPLIPLREVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCHFYRQDPLARRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative Metal-dependent Hydrolase
publication title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
total genus 62
structure length 210
sequence length 237
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06167 Peptidase_M90 Glucose-regulated metallo-peptidase M90
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.150 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3dl1A01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dl1A02
1QICA 1YP1A 3LUNA 4PKWA 4HX3A 3EDIA 1B3DA 3SHIA 2AIGP 3KEKA 2WO9A 2OXZA 1HV5A 3AYUA 3B2ZA 4XM8A 1G9KA 1DMTA 3EDGA 1K7IA 4ILWD 3TSKA 1ROSA 1QUAA 2O36A 1JAOA 5JMYA 2I47A 3HY9A 3Q2GA 1BUVM 2XS4A 4GR8A 5D1TA 2OXWA 1I76A 1SRPA 1JIZA 1OM6A 1OM8A 3AIGA 1BQQM 3NX7A 3LILA 1KUIA 1XURA 2OVXA 3P1VA 1JJ9A 5CZMA 1O0TA 3V96B 1XFWA 3K7NA 4L63A 1QIAA 4AUOA 3KECA 5L7FA 1AF0A 1AKLA 1XFXA 4WK7A 1Z3JA 3G5CA 4IUWA 1J7NA 1Y0VA 2MLRA 2MZHA 3LJGA 1WNIA 2PJTA 1JANA 3LUMA 4JIJA 3HBVP 4GR0A 3F18A 1XFUA 5L79A 5I43A 4G0DA 2JIHA 1OS9A 3OHOA 2J83A 1S4BP 4J4MA 2X7MA 4WZVA 4FVLA 3CKIA 4FU4A 3EDHA 1BZSA 4JQGA 4H1QA 3I7GA 3F17A 3ELMA 2DW1A 3EHYA 1JKYA 3KMEA 1FLSA 2ERPA 1MMBA 1Y93A 1XFVA 1BKCI 3L0VA 3LE9A 4DV8A 3HBUP 3DL1A 2JNPA 2FV5A 4XCTA 3F19A 2OW9A 2JT5A 4XM7A 1CGFA 3OHLA 2CLTA 1UEAA 1GXDA 2SRTA 1GE7A 1GE6A 5BOTA 4A7BA 1CGLA 1SLNA 456CA 4IN9A 1XUDA 1UTTA 1MMRA 1GO7P 3KMCA 2WOAA 4I03A 3KEJA 2ERQA 2YB9A 1XFYA 4WKEA 4H76A 4QKZA 1BKCE 3F15A 3O64A 4PKRA 3EDZA 1Y8JA 5I3MA 3USNA 1ZS0A 3HDBA 1O0QA 1KUGA 1IADA 2OW1A 1EB6A 3DPEA 3N2UA 3RTTA 3DNGA 966CA 4H84A 1CK7A 4JPAA 1ZXCA 4GQLA 1I73A 1KBCA 1ZVXA 2OW0A 3LKAA 1JH1A 4DPEA 2CKIA 4ZR5A 2D1NA 2Y6DA 2WO8A 1CXVA 2POJA 1SMPA 3LK8A 3I7IA 3N2VA 2W12A 3TVCA 1G4KA 1UMSA 2USNA 1KUKA 4Q1LA 1MMQA 1SATA 4CTHA 1GE5A 5BPAA 1UMTA 4H30A 3B8ZA 2JSDA 1QIBA 4AXQA 1XUCA 1BM6A 1G05A 1DTHA 3K7LA 1IABA 3TT4A 3P24A 3ZXHA 3ZUKA 1YOUA 2X3AA 3LIKA 4PKVA 1FM1A 1OM7A 2X3CA 1R1IA 3BA0A 3DWBA 2OZRA 4GF1A 1R54A 1KUHA 1B8YA 5D7WA 1KAPP 1K7GA 2YIGA 1A85A 2A8HA 1JIWP 3MA2A 830CA 1ZTQA 3WV1A 1IAEA 5D1SA 2D1OA 1HFSA 1K7QA 4PKQA 5CUHA 4EFSA 1ZXVA 1CGEA 1Q3AA 3L0TA 3AYKA 4FXYP 1GO8P 3KRYA 2W15A 2DDYA 3HDAP 1C3IA 3LEAA 3LQ0A 1HTDA 2E2DA 2DW0A 4GWMA 2JT6A 1GKDA 1HY7A 4A3WA 2RJQA 3HYGA 1USNA 1FBLA 2OY2A 5BOYA 1MMPA 4FXQA 2X3BA 1RM8A 1EAKA 2W14A 3UVCA 4WKIA 2EROA 1G49A 3B92A 1D7XA 4DD8A 1IAAA 1H71P 4PKSA 4HMAA 3F16A 3LQBA 4PKTA 2L0RA 1ASTA 5D3CA 4H49A 2DW2A 5I2ZA 5D1UA 2E3XA 1R1HA 2OW2A 2MLSA 2W0DA 1RMZA 3KWVC 4H3XA 1JAQA 1CQRA 3VTGA 3LGPA 4AYKA 1YCMA 2J0TA 4H82A 1I1IP 1R55A 1QJJA 2HU6A 4R3VA 2O3EA 1L6JA 5B5OA 1KUFA 2DDFA 3TS4A 3HY7A 1EUBA 4GWNA 3KHIA 5B5PA 1D5JA 1CAQA 1UTZA 4ON1A 4L6TA 1JK3A 2W13A 1ATLA 1D8FA 4JP4A 2OVZA 1R1JA 4GUYA 4AIGA 1MNCA 5I4OA 5H8XA 1BUDA 2RJPA 1BQOA 3EWJA 1XFZA 4GR3A 2Z2DA 2MZEA 3DPFA 1PWPA 3G42A 2K2GA 3LJZA 1BIWA 3U1RA 5LABA 5D2BA 2MZIA 3ZVSA 3VI1A 1C8TA 1OO9A 1ND1A 2QPJA 1SU3A 2N8RA 3EHXA 3LMCA 4JA1A 3WV3A 1QJIA 5CXAA 4DF9A 2K9CA 4WF6A 1C7KA 3LJTA 1OS2A 3E8RA 3Q2HA 2TCLA 2FV9A 3GBOA 1OMJA 4PKUA 1A86A 2XS3A 4XM6A 5I0LA 3WV2A 4XBHA 1AYKA 1G12A 3F1AA 1HFCA 2V4BA 1CIZA 1GKCA 4H2EA 1PWUA 1BKCA 1BSWA 5I12A 1YQYA 3RTSA 1SLMA 1JAPA 1D8MA 2OI0A 3DSLA 4I35A 2Y6CA 1HOVA 1ZP5A 2OXUA 1IAGA 1PWVA 3LIRA 4G9LA 4L19A 1IACA 3O2XA 1PWQA 3HB2P 2AYKA 1PWWA 2OY4A 2KRJA 4IJOA
chains in the Genus database with same CATH superfamily
1QICA 1YP1A 2KR6A 4MFEA 3LUNA 2BKZB 4PKWA 1H26B 3K7AM 4HX3A 3EDIA 2C5XB 1B3DA 3SHIA 3A8OB 2AIGP 3HB9A 3KEKA 2WO9A 2G77A 2OXZA 1HV5A 2WPAB 1TVIA 4BCFB 2DMEA 3AYUA 3B2ZA 4XM8A 1IREB 1DMTA 1G9KA 3EDGA 1OKWB 1K7IA 4ILWD 3BLQB 4LOCA 3TSKA 4TTHA 1AHJB 4YC3B 1ROSA 5HBEB 2CYZB 1QUAA 2O36A 1JAOA 2KMGA 5JMYA 4BCGB 2I47A 3HY9A 4EC9B 3Q2GA 1BUVM 1AISB 1GY3B 5IHYA 2XS4A 4GR8A 5D1TA 4BXXX 3DTOA 1H1SB 2OXWA 1OKVB 1I76A 1SRPA 1JIZA 2PK2A 1OM6A 3TNHB 3PO3S 1OM8A 3AIGA 1BQQM 3NX7A 2DD5B 3LILA 2WHBB 4EC8B 1KUIA 2DPPB 1XURA 2OVXA 3P1VA 1JJ9A 3BHTB 4BCND 5CZMA 1O0TA 3V96B 1XFWA 1G3NC 1ZP2A 4BCQD 4BCPB 3K7NA 5LQFB 4L63A 4HL4A 5HBHB 1QIAA 4AUOA 3X28B 3KECA 4NC6A 3DJBA 5L7FA 1AF0A 1AKLA 1GUXA 1XFXA 4WK7A 1Z3JA 2WEVB 1H1PB 3G5CA 2C5NB 2QF7A 2WXVB 4IUWA 4CFWB 1UNGD 1J7NA 3DDQB 1Y0VA 2MLRA 2MZHA 4CFMB 4F7JB 1WNIA 3LJGA 2EUFA 2G9XB 2PJTA 3M03A 5HQ0B 1JANA 3DTIA 5IDNB 3O0GD 3LUMA 4JIJA 1JSTB 4JX4A 4OB1B 5FGKB 4Z6YA 3F18A 3HBVP 4GR0A 1OIUB 3GTMS 1XFUA 5IF1B 5L79A 5I43A 4BCMD 4G0DA 3BG5A 2JIHA 4FX3B 1OS9A 3OHOA 4BCIB 1S4BP 2J83A 4J4MA 3X20B 2X7MA 4FVLA 1XO2A 2IN3A 3CKIA 4FU4A 4WZVA 3EDHA 1BZSA 4JQGA 4H1QA 3I7GA 3F17A 3ELMA 4MIMA 4EOOB 2DW1A 1JKYA 3HBLA 3EHYA 3KMEA 2W9ZA 3QYBA 1FLSA 2ERPA 1MMBA 1ENWA 1Y93A 1XFVA 1BKCI 3L0VA 3LE9A 2IW9B 4DV8A 3HBUP 3DL1A 2JNPA 3WVDB 2FV5A 4XCTA 3F19A 2OW9A 2JT5A 4XM7A 5HBJB 1CGFA 3OHLA 2CLTA 4G6LB 1UEAA 1GXDA 2SRTA 1GE7A 1GE6A 5BOTA 4OB3B 2PK9B 4A7BA 1CGLA 4CFVB 1SLNA 456CA 2WIPB 1UNLD 1OL1B 3LQ5B 4IN9A 1XUDA 1GH6B 1UTTA 2F2CA 1MMRA 1GO7P 3KMCA 5IDPB 2WOAA 4I03A 3KEJA 4BBSM 2ERQA 2YB9A 1XFYA 4WKEA 4H76A 1O9KB 4QKZA 2AHJB 1BKCE 3F15A 4MFDA 3O64A 2C4GB 1AD6A 4HLQA 4ROEA 4PKRA 1KXUA 2LW4A 3EDZA 1Y8JA 4OR5B 2QGSA 1FINB 5I3MA 5CEIB 3USNA 1ZS0A 3HDBA 1O0QA 1KUGA 1IADA 2OW1A 4CFUD 1EB6A 3DPEA 5DQVA 3N2UA 3RTTA 3DNGA 966CA 1JSUB 2JGZB 4H84A 1CK7A 2QQ8A 1ZXCA 4BCHB 4JPAA 4GQLA 4EOIB 1I73A 1KBCA 2IVXA 1ZVXA 2OW0A 2CZ6B 5ACBA 3DDPB 3QZ5B 3QYHB 4F7NB 4KRCB 1JH1A 3LKAA 2WFYB 4DPEA 4EOJB 2CKIA 4ZR5A 4UN0A 2D1NA 4ZGDB 4KRDB 2Y6DA 1O9KA 4OGRB 2WO8A 5LMKB 1CXVA 1OL2B 2POJA 1SMPA 2QDJA 3LK8A 3I7IA 5I5ZB 3H4CA 3N2VA 2W12A 3MIAB 3TVCA 1G4KA 1UMSA 1H1QB 1E9HB 2USNA 4BCKB 1KUKA 4Q1LA 4YOSA 1MMQA 4F6WB 1SATA 4CTHA 1W98B 2D0QB 4YOZA 4Y72B 3TNWB 1GE5A 5BPAA 1UMTA 4H30A 3QZ9B 3B8ZA 3VYGB 4EOPB 2JSDA 1QIBA 4AXQA 5HNBB 1XUCA 3BLRB 3DTKA 1BM6A 1G05A 3MI9B 1DTHA 3TW7A 3K7LA 1IABA 5DQWA 3TT4A 1UGPB 5BNJB 3P24A 4EOMB 2C6TB 4BY1X 3ZXHA 3ZUKA 1YOUA 1H27B 2X3AA 3LIKA 4PKVA 2UZDB 1FM1A 1OM7A 2X3CA 2DD4B 1V29B 3DTEA 1R1IA 3BA0A 1P5EB 2DXBB 3DWBA 2OZRA 4GF1A 1QLBA 1R54A 2ZPIB 3BG3A 1H25B 1KUHA 1OI9B 1B8YA 5D7WA 4BCNB 1KAPP 4AKGA 1K7GA 2YIGA 1A85A 2A8HA 1JIWP 4BCQB 4EORB 1XAXA 3MA2A 4I3ZB 830CA 4CFXB 1ZTQA 3WV1A 1IAEA 3TNIB 4II5B 5D1SA 4BBRM 2D1OA 1HFSA 1K7QA 4PKQA 2PJQA 2QDYB 4JX5A 5CUHA 3QHRB 1ZXVA 4EFSA 1CGEA 1Q3AA 3L0TA 3AYKA 4FXYP 4QSHA 1GO8P 3KRYA 4JX6A 2QFZA 2W15A 3F5XB 2X1NB 2DDYA 3HDAP 2CZ7B 1C3IA 3VKHA 3LEAA 3LQ0A 1HTDA 2E2DA 2DW0A 1D3UB 4GWMA 3A8MB 3VKGA 3G33B 2JT6A 1GKDA 1HY7A 4A3WA 4BCMB 3HHTB 2RJQA 4CRLB 1E7PA 1FVVB 4HNUA 4EOLB 1H24B 3HYGA 1USNA 1FBLA 2OY2A 5BOYA 1MMPA 4FXQA 2UZBB 4ZGEB 2X3BA 3QXEB 1RM8A 3A8LB 2WJ9A 1EAKA 2W14A 1H28B 4OB2B 1JKWA 2DXCB 3UVCA 4WKIA 1PKDB 1C9BA 1UNHD 2EROA 1G49A 3B92A 3B57A 1D7XA 4DD8A 1H1RB 1XM5A 3EJ1B 1IAAA 1H71P 4PKSA 4HMAA 2PMIB 3F16A 2IW8B 3LQBA 4PKTA 2L0RA 2I40B 1ASTA 3A8GB 2ZPBB 5D3CA 4F70B 4H49A 2DW2A 2CZ1B 2ZZDB 5I2ZA 5ICPB 5D1UA 4EOKB 1URCB 1R1HA 2E3XA 2OW2A 1F5QB 2W96A 2MLSA 2W0DA 2ZPHB 1RMZA 2WMAB 3KWVC 2W9FA 4H3XA 5HVYB 1UGRB 5EFQB 1JAQA 1UGQB 1CQRA 3VTGA 3LGPA 4IMYB 3BG9A 4AYKA 4RODA 1YCMA 1GUXB 2C5VB 3DOGB 4YOOA 4AKIA 2J0TA 3HO8A 4H82A 1I1IP 3X26B 1H4LD 3WVEB 1R55A 1QJJA 2HU6A 4R3VA 2O3EA 3BLHB 1L6JA 4AI6A 5B5OA 1KUFA 1OZ9A 2DDFA 3TS4A 3HY7A 4BCJB 3POMA 2B9RA 1EUBA 4GWNA 1VINA 3KHIA 5B5PA 4AKHA 1D5JA 2YUFA 1CAQA 1UTZA 4ON1A 3TN8B 4HNTA 3HZJA 4ROCA 4L6TA 2CCIB 3EOCB 1JK3A 2I53A 2CJMB 2W13A 1ATLA 1D8FA 4JP4A 1TD6A 1BU2A 2OVZA 2WIHB 1R1JA 4GUYA 4AIGA 2WMBB 1MNCA 3TW6A 5I4OA 3EIDB 4CFUB 4NSTB 5H8XA 1BUDA 2RJPA 1VOLA 1BQOA 3EWJA 1OIYB 3QHWB 1XFZA 4M6VA 1N4MA 2Z2DA 4GR3A 2ZPGB 4CFNB 2MZEA 4F6SB 1TFBA 3QWLA 3DPFA 4EOQB 1PWPA 3G42A 2K2GA 4BY7X 3LJZA 1BIWA 4ZGJB 3U1RA 5LABA 2V22B 3QYGB 2MZIA 5D2BA 3ZVSA 3VI1A 1C8TA 1OO9A 5CYIB 3NDQA 3X24B 1ND1A 2QPJA 1SU3A 2N8RA 3EHXA 3LMCA 4HNVA 2UZEB 2ZPFB 4JA1A 2W2HA 3WV3A 4ELJA 1QJIA 5CXAA 4DF9A 3RGFB 2ZCFB 2K9CA 4L7AA 4OB0B 4WF6A 1C7KA 3LJTA 1UGSB 3BHUB 1OS2A 3E8RA 3Q2HA 4F7LB 2TCLA 5EJCA 2FV9A 3GBOA 1OMJA 4PKUA 3QYEA 4EONB 1A86A 2XS3A 1JOWA 4XM6A 5I0LA 4BCOB 3WV2A 2IW6B 2UUEB 4XBHA 1AYKA 1G12A 3F1AA 1HFCA 2V4BA 4CXAB 4F7SB 2BS3A 1CIZA 1GKCA 3MY1B 4F6UB 3A8HB 4H2EA 1PWUA 1BKCA 1FKMA 1BSWA 3X25B 5I12A 2CZ0B 1YQYA 5L2WB 2R7GA 2ZPEB 3RTSA 3BHVB 1VYWB 1JAPA 1D8MA 1SLMA 2OI0A 2CCHB 2BPMB 4ELLA 3DSLA 4I35A 2Y6CA 2UZLB 1HOVA 1ZP5A 2OXUA 1IAGA 1PWVA 4EOSB 3LIRA 1OGUB 4G9LA 4L19A 1IACA 2BS4A 3O2XA 3MY5B 1PWQA 2W99A 3HB2P 1QMZB 2AYKA 2C5OB 1PWWA 2OY4A 2BS2A 2PHGA 4FM4B 3VYHB 2KRJA 4IJOA
chains in the Genus database with same CATH topology
1QICA 1YP1A 2KR6A 4MFEA 3LUNA 4PKWA 4HX3A 3EDIA 1B3DA 3SHIA 3A8OB 2AIGP 3HB9A 3KEKA 2WO9A 2G77A 2OXZA 1HV5A 3AYUA 3B2ZA 4XM8A 1IREB 1DMTA 1G9KA 3EDGA 1K7IA 4ILWD 3TSKA 4LOCA 1AHJB 1ROSA 2CYZB 1QUAA 2O36A 1JAOA 2KMGA 5JMYA 2I47A 3HY9A 3Q2GA 1BUVM 2XS4A 4GR8A 5D1TA 2OXWA 1I76A 1SRPA 1JIZA 1OM6A 1OM8A 3AIGA 1BQQM 3NX7A 2DD5B 3LILA 1KUIA 1XURA 2DPPB 2OVXA 3P1VA 1JJ9A 5CZMA 1O0TA 3V96B 1XFWA 3K7NA 4L63A 4HL4A 1QIAA 4AUOA 3X28B 3KECA 4NC6A 5L7FA 1AF0A 1AKLA 1XFXA 4WK7A 1Z3JA 3G5CA 2QF7A 4IUWA 1J7NA 1Y0VA 2MLRA 2MZHA 3LJGA 1WNIA 2PJTA 1JANA 3DTIA 3LUMA 4JIJA 4OB1B 4JX4A 4Z6YA 3HBVP 3F18A 4GR0A 1XFUA 5L79A 5I43A 4G0DA 3BG5A 2JIHA 1OS9A 3OHOA 2J83A 1S4BP 4J4MA 3X20B 2X7MA 4FVLA 4WZVA 3CKIA 4FU4A 3EDHA 1BZSA 4JQGA 4H1QA 3I7GA 3F17A 3ELMA 4MIMA 2DW1A 3EHYA 1JKYA 3HBLA 3KMEA 3QYBA 1FLSA 2ERPA 1MMBA 1Y93A 1XFVA 1BKCI 3L0VA 3LE9A 4DV8A 3HBUP 3DL1A 2JNPA 3WVDB 2FV5A 4XCTA 3F19A 2OW9A 2JT5A 4XM7A 1CGFA 3OHLA 2CLTA 1UEAA 1GXDA 2SRTA 1GE7A 1GE6A 5BOTA 4OB3B 4A7BA 1CGLA 1SLNA 456CA 4IN9A 1XUDA 1UTTA 1MMRA 1GO7P 3KMCA 2WOAA 4I03A 3KEJA 4BBSM 2ERQA 2YB9A 1XFYA 4WKEA 4H76A 4QKZA 2AHJB 1BKCE 3F15A 4MFDA 3O64A 4HLQA 4PKRA 3EDZA 1Y8JA 5I3MA 3USNA 1ZS0A 3HDBA 1O0QA 1KUGA 1IADA 2OW1A 1EB6A 3DPEA 3N2UA 3RTTA 3DNGA 966CA 4H84A 1CK7A 2QQ8A 1ZXCA 4JPAA 4GQLA 1I73A 1KBCA 1ZVXA 2OW0A 2CZ6B 3QZ5B 3QYHB 3LKAA 1JH1A 4DPEA 2CKIA 4ZR5A 2D1NA 4ZGDB 2Y6DA 2WO8A 1CXVA 2POJA 1SMPA 2QDJA 3LK8A 3I7IA 3H4CA 3N2VA 2W12A 3TVCA 1G4KA 1UMSA 2USNA 1KUKA 4Q1LA 1MMQA 1SATA 4CTHA 2D0QB 1GE5A 5BPAA 1UMTA 4H30A 3QZ9B 3B8ZA 3VYGB 2JSDA 1QIBA 4AXQA 1XUCA 3DTKA 1BM6A 1G05A 1DTHA 3TW7A 3K7LA 1IABA 3TT4A 1UGPB 3P24A 3ZXHA 3ZUKA 1YOUA 2X3AA 3LIKA 4PKVA 1FM1A 1OM7A 2X3CA 2DD4B 1V29B 3DTEA 1R1IA 3BA0A 2DXBB 3DWBA 2OZRA 4GF1A 1QLBA 1R54A 2ZPIB 3BG3A 1KUHA 1B8YA 5D7WA 1KAPP 4AKGA 1K7GA 2YIGA 1A85A 2A8HA 1JIWP 3MA2A 830CA 1ZTQA 3WV1A 1IAEA 5D1SA 4BBRM 2D1OA 1HFSA 1K7QA 4PKQA 2QDYB 4JX5A 5CUHA 4EFSA 1ZXVA 1CGEA 1Q3AA 3L0TA 3AYKA 4FXYP 4QSHA 1GO8P 3KRYA 4JX6A 2QFZA 2W15A 2DDYA 3HDAP 2CZ7B 1C3IA 3VKHA 3LEAA 3LQ0A 1HTDA 2E2DA 2DW0A 4GWMA 3A8MB 3VKGA 2JT6A 1GKDA 1HY7A 4A3WA 3HHTB 2RJQA 1E7PA 4HNUA 3HYGA 1USNA 1FBLA 2OY2A 5BOYA 1MMPA 4FXQA 4ZGEB 2X3BA 3QXEB 1RM8A 3A8LB 2WJ9A 1EAKA 2W14A 4OB2B 2DXCB 3UVCA 4WKIA 2EROA 1G49A 3B92A 1D7XA 4DD8A 1IAAA 1H71P 4PKSA 4HMAA 3F16A 3LQBA 4PKTA 2L0RA 1ASTA 5D3CA 3A8GB 2ZPBB 4H49A 2DW2A 2CZ1B 2ZZDB 5I2ZA 5D1UA 2E3XA 1R1HA 2OW2A 2MLSA 2W0DA 2ZPHB 1RMZA 3KWVC 4H3XA 1UGRB 1JAQA 1UGQB 1CQRA 3VTGA 3LGPA 3BG9A 4AYKA 1YCMA 4AKIA 2J0TA 3HO8A 4H82A 1I1IP 3X26B 3WVEB 1R55A 1QJJA 2HU6A 4R3VA 2O3EA 1L6JA 4AI6A 5B5OA 1KUFA 2DDFA 3TS4A 3HY7A 1EUBA 4GWNA 3KHIA 5B5PA 4AKHA 1D5JA 2YUFA 1CAQA 1UTZA 4ON1A 4HNTA 3HZJA 4L6TA 1JK3A 2W13A 1ATLA 1D8FA 4JP4A 2OVZA 1R1JA 4GUYA 4AIGA 1MNCA 3TW6A 5I4OA 5H8XA 1BUDA 2RJPA 1BQOA 3EWJA 1XFZA 4M6VA 4GR3A 2Z2DA 2ZPGB 2MZEA 3QWLA 3DPFA 1PWPA 3G42A 2K2GA 3LJZA 1BIWA 4ZGJB 3U1RA 5LABA 3QYGB 2MZIA 5D2BA 3ZVSA 3VI1A 1C8TA 1OO9A 3X24B 1ND1A 2QPJA 1SU3A 2N8RA 3EHXA 3LMCA 4HNVA 2ZPFB 4JA1A 3WV3A 4ELJA 1QJIA 5CXAA 4DF9A 2ZCFB 2K9CA 4L7AA 4OB0B 4WF6A 1C7KA 3LJTA 1UGSB 1OS2A 3E8RA 3Q2HA 2TCLA 5EJCA 2FV9A 3GBOA 1OMJA 4PKUA 3QYEA 1A86A 2XS3A 4XM6A 5I0LA 3WV2A 4XBHA 1AYKA 1G12A 3F1AA 1HFCA 2V4BA 2BS3A 1CIZA 1GKCA 4H2EA 3A8HB 1PWUA 1BKCA 1FKMA 1BSWA 3X25B 5I12A 2CZ0B 1YQYA 2ZPEB 3RTSA 1SLMA 1JAPA 1D8MA 2OI0A 3DSLA 4I35A 2Y6CA 1HOVA 1ZP5A 2OXUA 1IAGA 1PWVA 3LIRA 4G9LA 4L19A 1IACA 2BS4A 3O2XA 1PWQA 3HB2P 2AYKA 1PWWA 2OY4A 2BS2A 4FM4B 3VYHB 2KRJA 4IJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QIC A;  1YP1 A;  3LUN A;  4PKW A;  4HX3 A;  3EDI A;  1B3D A;  3SHI A;  2AIG P;  3KEK A;  2WO9 A;  2OXZ A;  1HV5 A;  3AYU A;  3B2Z A;  4XM8 A;  1G9K A;  1DMT A;  3EDG A;  1K7I A;  4ILW D;  3TSK A;  1ROS A;  1QUA A;  2O36 A;  1JAO A;  5JMY A;  2I47 A;  3HY9 A;  3Q2G A;  1BUV M;  2XS4 A;  4GR8 A;  5D1T A;  2OXW A;  1I76 A;  1SRP A;  1JIZ A;  1OM6 A;  1OM8 A;  3AIG A;  1BQQ M;  3NX7 A;  3LIL A;  1KUI A;  1XUR A;  2OVX A;  3P1V A;  1JJ9 A;  5CZM A;  1O0T A;  3V96 B;  1XFW A;  3K7N A;  4L63 A;  1QIA A;  4AUO A;  3KEC A;  5L7F A;  1AF0 A;  1AKL A;  1XFX A;  4WK7 A;  1Z3J A;  3G5C A;  4IUW A;  1J7N A;  1Y0V A;  2MLR A;  2MZH A;  3LJG A;  1WNI A;  2PJT A;  1JAN A;  3LUM A;  4JIJ A;  3HBV P;  4GR0 A;  3F18 A;  1XFU A;  5L79 A;  5I43 A;  4G0D A;  2JIH A;  1OS9 A;  3OHO A;  2J83 A;  1S4B P;  4J4M A;  2X7M A;  4WZV A;  4FVL A;  3CKI A;  4FU4 A;  3EDH A;  1BZS A;  4JQG A;  4H1Q A;  3I7G A;  3F17 A;  3ELM A;  2DW1 A;  3EHY A;  1JKY A;  3KME A;  1FLS A;  2ERP A;  1MMB A;  1Y93 A;  1XFV A;  1BKC I;  3L0V A;  3LE9 A;  4DV8 A;  3HBU P;  3DL1 A;  2JNP A;  2FV5 A;  4XCT A;  3F19 A;  2OW9 A;  2JT5 A;  4XM7 A;  1CGF A;  3OHL A;  2CLT A;  1UEA A;  1GXD A;  2SRT A;  1GE7 A;  1GE6 A;  5BOT A;  4A7B A;  1CGL A;  1SLN A;  456C A;  4IN9 A;  1XUD A;  1UTT A;  1MMR A;  1GO7 P;  3KMC A;  2WOA A;  4I03 A;  3KEJ A;  2ERQ A;  2YB9 A;  1XFY A;  4WKE A;  4H76 A;  4QKZ A;  1BKC E;  3F15 A;  3O64 A;  4PKR A;  3EDZ A;  1Y8J A;  5I3M A;  3USN A;  1ZS0 A;  3HDB A;  1O0Q A;  1KUG A;  1IAD A;  2OW1 A;  1EB6 A;  3DPE A;  3N2U A;  3RTT A;  3DNG A;  966C A;  4H84 A;  1CK7 A;  4JPA A;  1ZXC A;  4GQL A;  1I73 A;  1KBC A;  1ZVX A;  2OW0 A;  3LKA A;  1JH1 A;  4DPE A;  2CKI A;  4ZR5 A;  2D1N A;  2Y6D A;  2WO8 A;  1CXV A;  2POJ A;  1SMP A;  3LK8 A;  3I7I A;  3N2V A;  2W12 A;  3TVC A;  1G4K A;  1UMS A;  2USN A;  1KUK A;  4Q1L A;  1MMQ A;  1SAT A;  4CTH A;  1GE5 A;  5BPA A;  1UMT A;  4H30 A;  3B8Z A;  2JSD A;  1QIB A;  4AXQ A;  1XUC A;  1BM6 A;  1G05 A;  1DTH A;  3K7L A;  1IAB A;  3TT4 A;  3P24 A;  3ZXH A;  3ZUK A;  1YOU A;  2X3A A;  3LIK A;  4PKV A;  1FM1 A;  1OM7 A;  2X3C A;  1R1I A;  3BA0 A;  3DWB A;  2OZR A;  4GF1 A;  1R54 A;  1KUH A;  1B8Y A;  5D7W A;  1KAP P;  1K7G A;  2YIG A;  1A85 A;  2A8H A;  1JIW P;  3MA2 A;  830C A;  1ZTQ A;  3WV1 A;  1IAE A;  5D1S A;  2D1O A;  1HFS A;  1K7Q A;  4PKQ A;  5CUH A;  4EFS A;  1ZXV A;  1CGE A;  1Q3A A;  3L0T A;  3AYK A;  4FXY P;  1GO8 P;  3KRY A;  2W15 A;  2DDY A;  3HDA P;  1C3I A;  3LEA A;  3LQ0 A;  1HTD A;  2E2D A;  2DW0 A;  4GWM A;  2JT6 A;  1GKD A;  1HY7 A;  4A3W A;  2RJQ A;  3HYG A;  1USN A;  1FBL A;  2OY2 A;  5BOY A;  1MMP A;  4FXQ A;  2X3B A;  1RM8 A;  1EAK A;  2W14 A;  3UVC A;  4WKI A;  2ERO A;  1G49 A;  3B92 A;  1D7X A;  4DD8 A;  1IAA A;  1H71 P;  4PKS A;  4HMA A;  3F16 A;  3LQB A;  4PKT A;  2L0R A;  1AST A;  5D3C A;  4H49 A;  2DW2 A;  5I2Z A;  5D1U A;  2E3X A;  1R1H A;  2OW2 A;  2MLS A;  2W0D A;  1RMZ A;  3KWV C;  4H3X A;  1JAQ A;  1CQR A;  3VTG A;  3LGP A;  4AYK A;  1YCM A;  2J0T A;  4H82 A;  1I1I P;  1R55 A;  1QJJ A;  2HU6 A;  4R3V A;  2O3E A;  1L6J A;  5B5O A;  1KUF A;  2DDF A;  3TS4 A;  3HY7 A;  1EUB A;  4GWN A;  3KHI A;  5B5P A;  1D5J A;  1CAQ A;  1UTZ A;  4ON1 A;  4L6T A;  1JK3 A;  2W13 A;  1ATL A;  1D8F A;  4JP4 A;  2OVZ A;  1R1J A;  4GUY A;  4AIG A;  1MNC A;  5I4O A;  5H8X A;  1BUD A;  2RJP A;  1BQO A;  3EWJ A;  1XFZ A;  4GR3 A;  2Z2D A;  2MZE A;  3DPF A;  1PWP A;  3G42 A;  2K2G A;  3LJZ A;  1BIW A;  3U1R A;  5LAB A;  5D2B A;  2MZI A;  3ZVS A;  3VI1 A;  1C8T A;  1OO9 A;  1ND1 A;  2QPJ A;  1SU3 A;  2N8R A;  3EHX A;  3LMC A;  4JA1 A;  3WV3 A;  1QJI A;  5CXA A;  4DF9 A;  2K9C A;  4WF6 A;  1C7K A;  3LJT A;  1OS2 A;  3E8R A;  3Q2H A;  2TCL A;  2FV9 A;  3GBO A;  1OMJ A;  4PKU A;  1A86 A;  2XS3 A;  4XM6 A;  5I0L A;  3WV2 A;  4XBH A;  1AYK A;  1G12 A;  3F1A A;  1HFC A;  2V4B A;  1CIZ A;  1GKC A;  4H2E A;  1PWU A;  1BKC A;  1BSW A;  5I12 A;  1YQY A;  3RTS A;  1SLM A;  1JAP A;  1D8M A;  2OI0 A;  3DSL A;  4I35 A;  2Y6C A;  1HOV A;  1ZP5 A;  2OXU A;  1IAG A;  1PWV A;  3LIR A;  4G9L A;  4L19 A;  1IAC A;  3O2X A;  1PWQ A;  3HB2 P;  2AYK A;  1PWW A;  2OY4 A;  2KRJ A;  4IJO A; 
#chains in the Genus database with same CATH topology
 1QIC A;  1YP1 A;  2KR6 A;  4MFE A;  3LUN A;  2BKZ B;  4PKW A;  1H26 B;  3K7A M;  4HX3 A;  3EDI A;  2C5X B;  1B3D A;  3SHI A;  3A8O B;  2AIG P;  3HB9 A;  3KEK A;  2WO9 A;  2G77 A;  2OXZ A;  1HV5 A;  2WPA B;  1TVI A;  4BCF B;  2DME A;  3AYU A;  3B2Z A;  4XM8 A;  1IRE B;  1DMT A;  1G9K A;  3EDG A;  1OKW B;  1K7I A;  4ILW D;  3BLQ B;  4LOC A;  3TSK A;  4TTH A;  1AHJ B;  4YC3 B;  1ROS A;  5HBE B;  2CYZ B;  1QUA A;  2O36 A;  1JAO A;  2KMG A;  5JMY A;  4BCG B;  2I47 A;  3HY9 A;  4EC9 B;  3Q2G A;  1BUV M;  1AIS B;  1GY3 B;  5IHY A;  2XS4 A;  4GR8 A;  5D1T A;  4BXX X;  3DTO A;  1H1S B;  2OXW A;  1OKV B;  1I76 A;  1SRP A;  1JIZ A;  2PK2 A;  1OM6 A;  3TNH B;  3PO3 S;  1OM8 A;  3AIG A;  1BQQ M;  3NX7 A;  2DD5 B;  3LIL A;  2WHB B;  4EC8 B;  1KUI A;  2DPP B;  1XUR A;  2OVX A;  3P1V A;  1JJ9 A;  3BHT B;  4BCN D;  5CZM A;  1O0T A;  3V96 B;  1XFW A;  1G3N C;  1ZP2 A;  4BCQ D;  4BCP B;  3K7N A;  5LQF B;  4L63 A;  4HL4 A;  5HBH B;  1QIA A;  4AUO A;  3X28 B;  3KEC A;  4NC6 A;  3DJB A;  5L7F A;  1AF0 A;  1AKL A;  1GUX A;  1XFX A;  4WK7 A;  1Z3J A;  2WEV B;  1H1P B;  3G5C A;  2C5N B;  2QF7 A;  2WXV B;  4IUW A;  4CFW B;  1UNG D;  1J7N A;  3DDQ B;  1Y0V A;  2MLR A;  2MZH A;  4CFM B;  4F7J B;  1WNI A;  3LJG A;  2EUF A;  2G9X B;  2PJT A;  3M03 A;  5HQ0 B;  1JAN A;  3DTI A;  5IDN B;  3O0G D;  3LUM A;  4JIJ A;  1JST B;  4JX4 A;  4OB1 B;  5FGK B;  4Z6Y A;  3F18 A;  3HBV P;  4GR0 A;  1OIU B;  3GTM S;  1XFU A;  5IF1 B;  5L79 A;  5I43 A;  4BCM D;  4G0D A;  3BG5 A;  2JIH A;  4FX3 B;  1OS9 A;  3OHO A;  4BCI B;  1S4B P;  2J83 A;  4J4M A;  3X20 B;  2X7M A;  4FVL A;  1XO2 A;  2IN3 A;  3CKI A;  4FU4 A;  4WZV A;  3EDH A;  1BZS A;  4JQG A;  4H1Q A;  3I7G A;  3F17 A;  3ELM A;  4MIM A;  4EOO B;  2DW1 A;  1JKY A;  3HBL A;  3EHY A;  3KME A;  2W9Z A;  3QYB A;  1FLS A;  2ERP A;  1MMB A;  1ENW A;  1Y93 A;  1XFV A;  1BKC I;  3L0V A;  3LE9 A;  2IW9 B;  4DV8 A;  3HBU P;  3DL1 A;  2JNP A;  3WVD B;  2FV5 A;  4XCT A;  3F19 A;  2OW9 A;  2JT5 A;  4XM7 A;  5HBJ B;  1CGF A;  3OHL A;  2CLT A;  4G6L B;  1UEA A;  1GXD A;  2SRT A;  1GE7 A;  1GE6 A;  5BOT A;  4OB3 B;  2PK9 B;  4A7B A;  1CGL A;  4CFV B;  1SLN A;  456C A;  2WIP B;  1UNL D;  1OL1 B;  3LQ5 B;  4IN9 A;  1XUD A;  1GH6 B;  1UTT A;  2F2C A;  1MMR A;  1GO7 P;  3KMC A;  5IDP B;  2WOA A;  4I03 A;  3KEJ A;  4BBS M;  2ERQ A;  2YB9 A;  1XFY A;  4WKE A;  4H76 A;  1O9K B;  4QKZ A;  2AHJ B;  1BKC E;  3F15 A;  4MFD A;  3O64 A;  2C4G B;  1AD6 A;  4HLQ A;  4ROE A;  4PKR A;  1KXU A;  2LW4 A;  3EDZ A;  1Y8J A;  4OR5 B;  2QGS A;  1FIN B;  5I3M A;  5CEI B;  3USN A;  1ZS0 A;  3HDB A;  1O0Q A;  1KUG A;  1IAD A;  2OW1 A;  4CFU D;  1EB6 A;  3DPE A;  5DQV A;  3N2U A;  3RTT A;  3DNG A;  966C A;  1JSU B;  2JGZ B;  4H84 A;  1CK7 A;  2QQ8 A;  1ZXC A;  4BCH B;  4JPA A;  4GQL A;  4EOI B;  1I73 A;  1KBC A;  2IVX A;  1ZVX A;  2OW0 A;  2CZ6 B;  5ACB A;  3DDP B;  3QZ5 B;  3QYH B;  4F7N B;  4KRC B;  1JH1 A;  3LKA A;  2WFY B;  4DPE A;  4EOJ B;  2CKI A;  4ZR5 A;  4UN0 A;  2D1N A;  4ZGD B;  4KRD B;  2Y6D A;  1O9K A;  4OGR B;  2WO8 A;  5LMK B;  1CXV A;  1OL2 B;  2POJ A;  1SMP A;  2QDJ A;  3LK8 A;  3I7I A;  5I5Z B;  3H4C A;  3N2V A;  2W12 A;  3MIA B;  3TVC A;  1G4K A;  1UMS A;  1H1Q B;  1E9H B;  2USN A;  4BCK B;  1KUK A;  4Q1L A;  4YOS A;  1MMQ A;  4F6W B;  1SAT A;  4CTH A;  1W98 B;  2D0Q B;  4YOZ A;  4Y72 B;  3TNW B;  1GE5 A;  5BPA A;  1UMT A;  4H30 A;  3QZ9 B;  3B8Z A;  3VYG B;  4EOP B;  2JSD A;  1QIB A;  4AXQ A;  5HNB B;  1XUC A;  3BLR B;  3DTK A;  1BM6 A;  1G05 A;  3MI9 B;  1DTH A;  3TW7 A;  3K7L A;  1IAB A;  5DQW A;  3TT4 A;  1UGP B;  5BNJ B;  3P24 A;  4EOM B;  2C6T B;  4BY1 X;  3ZXH A;  3ZUK A;  1YOU A;  1H27 B;  2X3A A;  3LIK A;  4PKV A;  2UZD B;  1FM1 A;  1OM7 A;  2X3C A;  2DD4 B;  1V29 B;  3DTE A;  1R1I A;  3BA0 A;  1P5E B;  2DXB B;  3DWB A;  2OZR A;  4GF1 A;  1QLB A;  1R54 A;  2ZPI B;  3BG3 A;  1H25 B;  1KUH A;  1OI9 B;  1B8Y A;  5D7W A;  4BCN B;  1KAP P;  4AKG A;  1K7G A;  2YIG A;  1A85 A;  2A8H A;  1JIW P;  4BCQ B;  4EOR B;  1XAX A;  3MA2 A;  4I3Z B;  830C A;  4CFX B;  1ZTQ A;  3WV1 A;  1IAE A;  3TNI B;  4II5 B;  5D1S A;  4BBR M;  2D1O A;  1HFS A;  1K7Q A;  4PKQ A;  2PJQ A;  2QDY B;  4JX5 A;  5CUH A;  3QHR B;  1ZXV A;  4EFS A;  1CGE A;  1Q3A A;  3L0T A;  3AYK A;  4FXY P;  4QSH A;  1GO8 P;  3KRY A;  4JX6 A;  2QFZ A;  2W15 A;  3F5X B;  2X1N B;  2DDY A;  3HDA P;  2CZ7 B;  1C3I A;  3VKH A;  3LEA A;  3LQ0 A;  1HTD A;  2E2D A;  2DW0 A;  1D3U B;  4GWM A;  3A8M B;  3VKG A;  3G33 B;  2JT6 A;  1GKD A;  1HY7 A;  4A3W A;  4BCM B;  3HHT B;  2RJQ A;  4CRL B;  1E7P A;  1FVV B;  4HNU A;  4EOL B;  1H24 B;  3HYG A;  1USN A;  1FBL A;  2OY2 A;  5BOY A;  1MMP A;  4FXQ A;  2UZB B;  4ZGE B;  2X3B A;  3QXE B;  1RM8 A;  3A8L B;  2WJ9 A;  1EAK A;  2W14 A;  1H28 B;  4OB2 B;  1JKW A;  2DXC B;  3UVC A;  4WKI A;  1PKD B;  1C9B A;  1UNH D;  2ERO A;  1G49 A;  3B92 A;  3B57 A;  1D7X A;  4DD8 A;  1H1R B;  1XM5 A;  3EJ1 B;  1IAA A;  1H71 P;  4PKS A;  4HMA A;  2PMI B;  3F16 A;  2IW8 B;  3LQB A;  4PKT A;  2L0R A;  2I40 B;  1AST A;  3A8G B;  2ZPB B;  5D3C A;  4F70 B;  4H49 A;  2DW2 A;  2CZ1 B;  2ZZD B;  5I2Z A;  5ICP B;  5D1U A;  4EOK B;  1URC B;  1R1H A;  2E3X A;  2OW2 A;  1F5Q B;  2W96 A;  2MLS A;  2W0D A;  2ZPH B;  1RMZ A;  2WMA B;  3KWV C;  2W9F A;  4H3X A;  5HVY B;  1UGR B;  5EFQ B;  1JAQ A;  1UGQ B;  1CQR A;  3VTG A;  3LGP A;  4IMY B;  3BG9 A;  4AYK A;  4ROD A;  1YCM A;  1GUX B;  2C5V B;  3DOG B;  4YOO A;  4AKI A;  2J0T A;  3HO8 A;  4H82 A;  1I1I P;  3X26 B;  1H4L D;  3WVE B;  1R55 A;  1QJJ A;  2HU6 A;  4R3V A;  2O3E A;  3BLH B;  1L6J A;  4AI6 A;  5B5O A;  1KUF A;  1OZ9 A;  2DDF A;  3TS4 A;  3HY7 A;  4BCJ B;  3POM A;  2B9R A;  1EUB A;  4GWN A;  1VIN A;  3KHI A;  5B5P A;  4AKH A;  1D5J A;  2YUF A;  1CAQ A;  1UTZ A;  4ON1 A;  3TN8 B;  4HNT A;  3HZJ A;  4ROC A;  4L6T A;  2CCI B;  3EOC B;  1JK3 A;  2I53 A;  2CJM B;  2W13 A;  1ATL A;  1D8F A;  4JP4 A;  1TD6 A;  1BU2 A;  2OVZ A;  2WIH B;  1R1J A;  4GUY A;  4AIG A;  2WMB B;  1MNC A;  3TW6 A;  5I4O A;  3EID B;  4CFU B;  4NST B;  5H8X A;  1BUD A;  2RJP A;  1VOL A;  1BQO A;  3EWJ A;  1OIY B;  3QHW B;  1XFZ A;  4M6V A;  1N4M A;  2Z2D A;  4GR3 A;  2ZPG B;  4CFN B;  2MZE A;  4F6S B;  1TFB A;  3QWL A;  3DPF A;  4EOQ B;  1PWP A;  3G42 A;  2K2G A;  4BY7 X;  3LJZ A;  1BIW A;  4ZGJ B;  3U1R A;  5LAB A;  2V22 B;  3QYG B;  2MZI A;  5D2B A;  3ZVS A;  3VI1 A;  1C8T A;  1OO9 A;  5CYI B;  3NDQ A;  3X24 B;  1ND1 A;  2QPJ A;  1SU3 A;  2N8R A;  3EHX A;  3LMC A;  4HNV A;  2UZE B;  2ZPF B;  4JA1 A;  2W2H A;  3WV3 A;  4ELJ A;  1QJI A;  5CXA A;  4DF9 A;  3RGF B;  2ZCF B;  2K9C A;  4L7A A;  4OB0 B;  4WF6 A;  1C7K A;  3LJT A;  1UGS B;  3BHU B;  1OS2 A;  3E8R A;  3Q2H A;  4F7L B;  2TCL A;  5EJC A;  2FV9 A;  3GBO A;  1OMJ A;  4PKU A;  3QYE A;  4EON B;  1A86 A;  2XS3 A;  1JOW A;  4XM6 A;  5I0L A;  4BCO B;  3WV2 A;  2IW6 B;  2UUE B;  4XBH A;  1AYK A;  1G12 A;  3F1A A;  1HFC A;  2V4B A;  4CXA B;  4F7S B;  2BS3 A;  1CIZ A;  1GKC A;  3MY1 B;  4F6U B;  3A8H B;  4H2E A;  1PWU A;  1BKC A;  1FKM A;  1BSW A;  3X25 B;  5I12 A;  2CZ0 B;  1YQY A;  5L2W B;  2R7G A;  2ZPE B;  3RTS A;  3BHV B;  1VYW B;  1JAP A;  1D8M A;  1SLM A;  2OI0 A;  2CCH B;  2BPM B;  4ELL A;  3DSL A;  4I35 A;  2Y6C A;  2UZL B;  1HOV A;  1ZP5 A;  2OXU A;  1IAG A;  1PWV A;  4EOS B;  3LIR A;  1OGU B;  4G9L A;  4L19 A;  1IAC A;  2BS4 A;  3O2X A;  3MY5 B;  1PWQ A;  2W99 A;  3HB2 P;  1QMZ B;  2AYK A;  2C5O B;  1PWW A;  2OY4 A;  2BS2 A;  2PHG A;  4FM4 B;  3VYH B;  2KRJ A;  4IJO A; 
#chains in the Genus database with same CATH homology
 1QIC A;  1YP1 A;  2KR6 A;  4MFE A;  3LUN A;  4PKW A;  4HX3 A;  3EDI A;  1B3D A;  3SHI A;  3A8O B;  2AIG P;  3HB9 A;  3KEK A;  2WO9 A;  2G77 A;  2OXZ A;  1HV5 A;  3AYU A;  3B2Z A;  4XM8 A;  1IRE B;  1DMT A;  1G9K A;  3EDG A;  1K7I A;  4ILW D;  3TSK A;  4LOC A;  1AHJ B;  1ROS A;  2CYZ B;  1QUA A;  2O36 A;  1JAO A;  2KMG A;  5JMY A;  2I47 A;  3HY9 A;  3Q2G A;  1BUV M;  2XS4 A;  4GR8 A;  5D1T A;  2OXW A;  1I76 A;  1SRP A;  1JIZ A;  1OM6 A;  1OM8 A;  3AIG A;  1BQQ M;  3NX7 A;  2DD5 B;  3LIL A;  1KUI A;  1XUR A;  2DPP B;  2OVX A;  3P1V A;  1JJ9 A;  5CZM A;  1O0T A;  3V96 B;  1XFW A;  3K7N A;  4L63 A;  4HL4 A;  1QIA A;  4AUO A;  3X28 B;  3KEC A;  4NC6 A;  5L7F A;  1AF0 A;  1AKL A;  1XFX A;  4WK7 A;  1Z3J A;  3G5C A;  2QF7 A;  4IUW A;  1J7N A;  1Y0V A;  2MLR A;  2MZH A;  3LJG A;  1WNI A;  2PJT A;  1JAN A;  3DTI A;  3LUM A;  4JIJ A;  4OB1 B;  4JX4 A;  4Z6Y A;  3HBV P;  3F18 A;  4GR0 A;  1XFU A;  5L79 A;  5I43 A;  4G0D A;  3BG5 A;  2JIH A;  1OS9 A;  3OHO A;  2J83 A;  1S4B P;  4J4M A;  3X20 B;  2X7M A;  4FVL A;  4WZV A;  3CKI A;  4FU4 A;  3EDH A;  1BZS A;  4JQG A;  4H1Q A;  3I7G A;  3F17 A;  3ELM A;  4MIM A;  2DW1 A;  3EHY A;  1JKY A;  3HBL A;  3KME A;  3QYB A;  1FLS A;  2ERP A;  1MMB A;  1Y93 A;  1XFV A;  1BKC I;  3L0V A;  3LE9 A;  4DV8 A;  3HBU P;  3DL1 A;  2JNP A;  3WVD B;  2FV5 A;  4XCT A;  3F19 A;  2OW9 A;  2JT5 A;  4XM7 A;  1CGF A;  3OHL A;  2CLT A;  1UEA A;  1GXD A;  2SRT A;  1GE7 A;  1GE6 A;  5BOT A;  4OB3 B;  4A7B A;  1CGL A;  1SLN A;  456C A;  4IN9 A;  1XUD A;  1UTT A;  1MMR A;  1GO7 P;  3KMC A;  2WOA A;  4I03 A;  3KEJ A;  4BBS M;  2ERQ A;  2YB9 A;  1XFY A;  4WKE A;  4H76 A;  4QKZ A;  2AHJ B;  1BKC E;  3F15 A;  4MFD A;  3O64 A;  4HLQ A;  4PKR A;  3EDZ A;  1Y8J A;  5I3M A;  3USN A;  1ZS0 A;  3HDB A;  1O0Q A;  1KUG A;  1IAD A;  2OW1 A;  1EB6 A;  3DPE A;  3N2U A;  3RTT A;  3DNG A;  966C A;  4H84 A;  1CK7 A;  2QQ8 A;  1ZXC A;  4JPA A;  4GQL A;  1I73 A;  1KBC A;  1ZVX A;  2OW0 A;  2CZ6 B;  3QZ5 B;  3QYH B;  3LKA A;  1JH1 A;  4DPE A;  2CKI A;  4ZR5 A;  2D1N A;  4ZGD B;  2Y6D A;  2WO8 A;  1CXV A;  2POJ A;  1SMP A;  2QDJ A;  3LK8 A;  3I7I A;  3H4C A;  3N2V A;  2W12 A;  3TVC A;  1G4K A;  1UMS A;  2USN A;  1KUK A;  4Q1L A;  1MMQ A;  1SAT A;  4CTH A;  2D0Q B;  1GE5 A;  5BPA A;  1UMT A;  4H30 A;  3QZ9 B;  3B8Z A;  3VYG B;  2JSD A;  1QIB A;  4AXQ A;  1XUC A;  3DTK A;  1BM6 A;  1G05 A;  1DTH A;  3TW7 A;  3K7L A;  1IAB A;  3TT4 A;  1UGP B;  3P24 A;  3ZXH A;  3ZUK A;  1YOU A;  2X3A A;  3LIK A;  4PKV A;  1FM1 A;  1OM7 A;  2X3C A;  2DD4 B;  1V29 B;  3DTE A;  1R1I A;  3BA0 A;  2DXB B;  3DWB A;  2OZR A;  4GF1 A;  1QLB A;  1R54 A;  2ZPI B;  3BG3 A;  1KUH A;  1B8Y A;  5D7W A;  1KAP P;  4AKG A;  1K7G A;  2YIG A;  1A85 A;  2A8H A;  1JIW P;  3MA2 A;  830C A;  1ZTQ A;  3WV1 A;  1IAE A;  5D1S A;  4BBR M;  2D1O A;  1HFS A;  1K7Q A;  4PKQ A;  2QDY B;  4JX5 A;  5CUH A;  4EFS A;  1ZXV A;  1CGE A;  1Q3A A;  3L0T A;  3AYK A;  4FXY P;  4QSH A;  1GO8 P;  3KRY A;  4JX6 A;  2QFZ A;  2W15 A;  2DDY A;  3HDA P;  2CZ7 B;  1C3I A;  3VKH A;  3LEA A;  3LQ0 A;  1HTD A;  2E2D A;  2DW0 A;  4GWM A;  3A8M B;  3VKG A;  2JT6 A;  1GKD A;  1HY7 A;  4A3W A;  3HHT B;  2RJQ A;  1E7P A;  4HNU A;  3HYG A;  1USN A;  1FBL A;  2OY2 A;  5BOY A;  1MMP A;  4FXQ A;  4ZGE B;  2X3B A;  3QXE B;  1RM8 A;  3A8L B;  2WJ9 A;  1EAK A;  2W14 A;  4OB2 B;  2DXC B;  3UVC A;  4WKI A;  2ERO A;  1G49 A;  3B92 A;  1D7X A;  4DD8 A;  1IAA A;  1H71 P;  4PKS A;  4HMA A;  3F16 A;  3LQB A;  4PKT A;  2L0R A;  1AST A;  5D3C A;  3A8G B;  2ZPB B;  4H49 A;  2DW2 A;  2CZ1 B;  2ZZD B;  5I2Z A;  5D1U A;  2E3X A;  1R1H A;  2OW2 A;  2MLS A;  2W0D A;  2ZPH B;  1RMZ A;  3KWV C;  4H3X A;  1UGR B;  1JAQ A;  1UGQ B;  1CQR A;  3VTG A;  3LGP A;  3BG9 A;  4AYK A;  1YCM A;  4AKI A;  2J0T A;  3HO8 A;  4H82 A;  1I1I P;  3X26 B;  3WVE B;  1R55 A;  1QJJ A;  2HU6 A;  4R3V A;  2O3E A;  1L6J A;  4AI6 A;  5B5O A;  1KUF A;  2DDF A;  3TS4 A;  3HY7 A;  1EUB A;  4GWN A;  3KHI A;  5B5P A;  4AKH A;  1D5J A;  2YUF A;  1CAQ A;  1UTZ A;  4ON1 A;  4HNT A;  3HZJ A;  4L6T A;  1JK3 A;  2W13 A;  1ATL A;  1D8F A;  4JP4 A;  2OVZ A;  1R1J A;  4GUY A;  4AIG A;  1MNC A;  3TW6 A;  5I4O A;  5H8X A;  1BUD A;  2RJP A;  1BQO A;  3EWJ A;  1XFZ A;  4M6V A;  4GR3 A;  2Z2D A;  2ZPG B;  2MZE A;  3QWL A;  3DPF A;  1PWP A;  3G42 A;  2K2G A;  3LJZ A;  1BIW A;  4ZGJ B;  3U1R A;  5LAB A;  3QYG B;  2MZI A;  5D2B A;  3ZVS A;  3VI1 A;  1C8T A;  1OO9 A;  3X24 B;  1ND1 A;  2QPJ A;  1SU3 A;  2N8R A;  3EHX A;  3LMC A;  4HNV A;  2ZPF B;  4JA1 A;  3WV3 A;  4ELJ A;  1QJI A;  5CXA A;  4DF9 A;  2ZCF B;  2K9C A;  4L7A A;  4OB0 B;  4WF6 A;  1C7K A;  3LJT A;  1UGS B;  1OS2 A;  3E8R A;  3Q2H A;  2TCL A;  5EJC A;  2FV9 A;  3GBO A;  1OMJ A;  4PKU A;  3QYE A;  1A86 A;  2XS3 A;  4XM6 A;  5I0L A;  3WV2 A;  4XBH A;  1AYK A;  1G12 A;  3F1A A;  1HFC A;  2V4B A;  2BS3 A;  1CIZ A;  1GKC A;  4H2E A;  3A8H B;  1PWU A;  1BKC A;  1FKM A;  1BSW A;  3X25 B;  5I12 A;  2CZ0 B;  1YQY A;  2ZPE B;  3RTS A;  1SLM A;  1JAP A;  1D8M A;  2OI0 A;  3DSL A;  4I35 A;  2Y6C A;  1HOV A;  1ZP5 A;  2OXU A;  1IAG A;  1PWV A;  3LIR A;  4G9L A;  4L19 A;  1IAC A;  2BS4 A;  3O2X A;  1PWQ A;  3HB2 P;  2AYK A;  1PWW A;  2OY4 A;  2BS2 A;  4FM4 B;  3VYH B;  2KRJ A;  4IJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...