3A8MB

Crystal structure of nitrile hydratase mutant y72f complexed with trimethylacetonitrile
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPFYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 57
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8mB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8mB02
4XK8E 4ZGEB 3VYHB 1UGQB 2CZ0B 2ZPIB 3X28B 4OB3B 1PSEA 4FM4B 3VYGA 2WSCE 3QZ5B 2QDYB 3X25B 2DD4B 3X20B 2WSFE 3A8MB 1UGSB 5L8RE 4RKUE 1UGRB 3A8OB 3QZ9B 2O01E 3X26B 2DPPB 4KT0E 2CZ7B 1IREB 4OB0B 2PVOB 2DXCB 3QYGB 2PU9B 2DD5B 2PVDB 1GXIE 2DD4A 2DXBB 2CZ1B 4ZGJB 3WVDB 2CZ6B 3X24B 1JB0E 3QYHB 4L6V5 2WSEE 2DXCA 2ZZDB 1QP3A 2DD5A 4Y28E 1UGPB 2DXBA 1PSFA 2ZPFB 2ZPEB 1AHJB 3HHTB 3A8HB 1QP2A 2PUKB 3QXEB 2ZPGB 2ZZDA 2PUOB 4OB2B 4ZGDB 1DJ7B 3LW5E 2AHJB 3A8LB 2D0QB 2ZCFB 4OB1B 2ZPBB 2ZPHB 3WVEB 3A8GB 1V29B 2PVGB 2CYZB 3VYGB
chains in the Genus database with same CATH superfamily
3OYFA 3OS5A 2EQUA 3KUFA 5L23A 2FRYA 2E4HA 3HL8A 2K5LA 1BI1A 4BCJB 1QQJA 2FB7A 5LJ3d 1M90R 4C8QE 2RI5A 1AZGB 4BY1X 4TTHA 3TVTA 3X28B 3HZJA 4PJOB 2GCXA 1BI3A 1IHVA 1GRIA 1K9MC 4ATOA 2RMOA 2DKGA 3UA6A 2C5NB 2C0OA 1KXUA 3MPUB 3H41A 1GBRA 3BDLA 2WACA 1E7PA 3CD6Q 1K4US 2KT1A 2Y4YA 3RUXA 4RTWA 4M7AB 1K8AC 4MFDA 2EAYA 4II5B 1S72Q 1FMVA 4RKUE 1X75C 4F7UA 1NJIR 2DPPB 4KT0E 1HK9A 3NPFA 2DX1A 4IUTA 4RTZA 2QA4A 2PVDB 5CYIB 3VKHA 5GANe 2RI2A 2CZ1B 1BK2A 1AWJA 2I0NA 2QXFA 2CS7A 1NYFA 1KIKA 1Q7YU 2DL3A 4Z02A 1NEGA 4P5NA 3QWXX 4OR5B 1F1BB 2V8JA 2COWA 2JJ9A 2LP5A 3WXMB 2RN8A 3I56T 3H0FA 2DO3A 2K4YA 2C4GB 2ESWA 2HZYA 3TREA 4JRPA 3CPFA 1PSFA 3MP8A 3OYGA 2QQSA 2UZDB 3DOGB 2DTIA 1U1TA 2PUKB 2W10A 2KRNA 3J81E 5J26A 2MWOA 2OTLA 2ZZDA 2KXDA 4BI4A 3CCVA 1IGUA 5D6YA 1H3ZA 1I07A 1VUBA 1Q7YC 1FINB 1S1NA 4BB7A 1WDXA 3PVLA 2VVKA 2VGNA 1ZHIA 1VQLT 3UPUA 4A4FA 3JRZA 3KFVA 3BE3A 4RTTA 2DTOA 1EFNA 5IHNA 2DA9A 1VQ7T 2QGGA 2M9UA 4BI3A 2PVGB 4Y91A 2JTFA 2M0OA 1OQKA 1LNXA 3CMEA 2YUPA 1OIYB 1B34A 1VQOQ 4HCZA 3PVQA 1QVFP 4F7NB 3S3NA 1W2BA 2V22B 3BW1A 2YXYA 4M78F 5GJWB 3RKXA 1H28B 5GANf 1WHMA 2MIOA 2M1HA 1W98B 4M78G 1VQ4T 3CD6A 3OSSC 2M02A 2HSPA 2W9FA 3CMAT 4AFUC 1YIJT 2OTJQ 1EZZB 2DIGA 1VQ5A 3EFSA 1JXMA 2IN3A 5CO7A 1S72A 3CC7A 3I55Q 4PJOA 1UGRB 1KSWA 1YWPA 2MI6A 1XO2A 2O4XB 2CZ7B 3G6ET 2LDMA 1W2BP 2WIPB 2YRCA 1GXIE 2LX7A 4LOCA 4M7AA 3I56Q 2HMAA 1I8FA 3FB9A 4F17A 3F5XB 5L2WB 3G1JA 2ED0A 1NLOC 2FZKB 1Y96B 2L89A 5CVIA 1KD1U 4LDYA 2CP6A 2RK2A 1PCXA 4M77C 1GFDA 2GFAA 4Y28E 1M27C 3M57A 3OYBA 2CH4W 5GJVB 2UZEB 1WHKA 4BE1A 5I11A 1MV0B 1QCNA 4M4ZA 1VQLQ 4FT2A 5IHYA 4FYYB 2KEAA 1QCOA 3QJYA 4F7UE 2QDLA 5DLOA 2L3RA 1KD1C 2J6KA 5HKCA 1QVPA 4EOQB 1CSKA 3OSVA 3JCMQ 4E7HA 1VYTA 2K3XA 1Q7YR 5A2QE 4JX4A 4AG2C 2PQWA 3CCRT 2FZCB 2QTXA 3RGFB 2O2OA 2NYSA 1UNGD 4DOWA 1ABQA 4C0DC 4FW1A 1SSFA 4F16A 2BS3A 3BLHB 4C8QF 1VQ4Q 2XDDA 1MMDA 1VQOA 5CKFA 1BI2A 1YIJQ 4ZGEB 4C8QG 1X27A 4M75D 2OX7A 2W96A 3B57A 4NSTB 1UECA 2BE9B 4PLIA 1UNLD 4J7FA 4QQ6A 1NPRA 1X43A 4LUEA 4QVCA 2I53A 4GBQA 2XK0A 5I2MA 2B86A 1I4K1 3O0GD 1ZX6A 2J6FA 3I55A 4FYVB 2CUBA 1PRMC 1UGSB 3MEAA 3GOXA 1YJWQ 4BCMD 4QT7A 2P84A 5GAOn 2CH4A 1N27A 5CQYA 4F6SB 2M51A 2R57A 4OP0A 5GAMj 4Y92A 4J83A 1JEGA 3UDCA 3CPWA 2BZXA 3QWYA 1X6GA 2DXBB 1H1SB 5IH2A 2C5XB 2AKKA 4DOVA 2DLPA 1G2BA 1WQWA 2O4XA 3CBOA 4EMHA 2E6ZA 4JRIA 4IKFA 3M59A 1YP5A 2JS0A 5LJ3j 2COYA 2K6DA 3UF4A 4MZPA 2DBKA 5EC7A 3GPLA 3CCRQ 1VQ6A 4BCMB 1Y96A 4Y72B 4PJOE 1QP2A 4KGXB 4BCPB 2EUFA 5AYFA 3QJ6A 2EQJA 2EQMA 3HTRA 3C94A 3VS1A 3CCUT 5GAMe 1RLQC 4EORB 3LW5E 2XI9A 5KYNA 1G83A 3RR6A 3M54A 1G3TA 2D8HA 2LMJA 3QUIA 2QK0A 3PTAA 2YLCA 2IVXA 5EG2A 1V1CA 3RNJA 1T3SA 4RTXA 1V29B 4KRTA 4QKUA 5IAYA 3JV3A 5FLXE 2D1XA 2BTTA 4R56A 2DNUA 3LGFA 5HVYB 1JRIA 4BI8B 1N8RU 1U3OA 4ELJA 2DRMA 1HD3A 1R0BG 4C5IA 4AKHA 1WXTA 1PKSA 1BU1A 3I9QA 4XTZA 5KYWB 1IRXA 3CCEA 4X1VA 4JS5A 2KYBA 1FWZA 2DMOA 3L1AA 2ROTA 1ZSGA 3DDPB 5EFQB 1YJWA 3LWIA 1BKBA 1VQMA 2BZ8A 2HQHA 1N8RC 2R5AA 4RCBA 1Y7XA 1ZA2B 1VOLA 3BG3A 4PFOA 5GANg 4F7JB 1YJNQ 2JNGA 4GY5A 5GMKi 2NUPB 1OZ3A 3TNHB 1QMCA 3OB9A 3M4YA 1SHGA 2LVMA 3NTIA 2QAZA 5GAMf 1VQNA 3HO8A 2EGCA 2LJ3A 3BLQB 1H8KA 3JCMe 4BCHB 5GMKe 1YI2A 2JT4A 2F2CA 3CCUQ 2MYSA 2DXBA 3OS1A 4HL4A 1NM7A 4C92D 3L2ZA 3DLMA 2CSQA 3TW7A 2KMTA 2F5TX 5CKHA 1N5ZA 2RJEA 2YRDA 3OYDA 3VRZA 5LJ3f 4LDWA 4ESRA 4C0FA 3HRTA 2RJCA 2CT4A 2LT4A 2AHJB 1C0MA 4JRKA 2ZCFB 4XTYA 4LDXA 5DM7R 2JN0A 3OYKA 5I5ZB 5GAMh 1BCMA 3CC2T 4EOKB 3GTMS 1QLBA 1CKAA 2K9GA 4QQDA 2XDBA 1WHHA 2L3QA 2DYBA 1Z9QA 2CYZB 5C6SA 2RM4A 1M90U 2WFYB 3CBMA 4EC9B 3MEWA 2JW4A 2JXBA 3REAB 2AKLA 2A7YA 1Q86R 1BIAA 2XIDA 3A1PA 5GMKl 3RDVA 4J9DA 1JO8A 2V26A 3O8VA 5CEIB 1UG1A 2HCKA 2NLUA 1ZP2A 1WYXA 2E3HA 3OY9A 1M90C 3CCST 1H1PB 1NJIU 3EFOB 4NS5A 4ANJA 3BFMA 3E9FA 5KH6A 3QDFA 1SRMA 5KYWA 3THKA 3CC4T 2EGEA 3EH1A 3J7AF 4CFXB 1Y71A 3EG9B 3QHRB 3BHUB 5KCOA 2OTLT 3X24B 2GTOA 1WGSA 1NJIC 4FT4A 4N4HA 2EW3A 2LNHB 2H3JA 2EJ9A 3CCJA 2D9TA 2QF7A 4TVRA 2CREA 4AFQC 2NUPA 3N5BB 4PJOF 4KUIA 3G4ST 1HJDA 1YHQT 1I0CA 2DIQA 4PJOG 3M56A 3HHTB 4IUUA 3JCMh 5GMKh 5M9OA 4RTYA 3VS3A 4ROCA 2A37A 2KAFA 2VASA 4CC2A 3CC2Q 1QMZB 1D1AA 3EG1A 4BY6C 2YHTA 2F69A 2I40B 1EIFA 1LOJA 3G71A 4ZTFA 2ZGWA 4A4HA 1DJ7B 1PM3A 2E70A 3MCAB 4Z89A 3NDQA 5IXFA 2EIFA 2EYXA 3L42A 5I21A 3JCMc 5FW9A 4BCND 3A8LB 3JB9I 1IXDA 4HT9A 3MIAB 2WPAB 1OPKA 4LDUA 4M7DD 2L0AA 3QG1A 3NMZC 4FCYA 4XU3A 3CC7T 1AWWA 2C0IA 2DETA 2G9XB 2AIRB 2LTOA 3J80E 4J9FA 2CZ0B 2H8HA 5GAMd 2OJ2A 3CCQA 4J9GA 1RI0A 1YBYA 2XG8D 3VS0A 3TU4K 4M7AD 4FM4B 3CC4Q 1JOWA 1O9KB 1Y57A 2AK5A 2DVJA 2PK9B 4BY6B 3QBYA 5FGKB 2RPNA 4JRQA 5KYXB 3SHWA 4DEYA 2EQIA 3CPWS 1NE8A 2VUBA 2CP5A 1D3BB 2EJGA 4J9EA 3JCMJ 1N4MA 4EOJB 5IDPB 4M7DB 4EOOB 1PG5B 3U23A 4WTOB 4LN2A 1RABB 3UT1A 4XTUA 5GAN3 3JB9J 3HB9A 4HA8A 3G4SQ 2LW4A 4JJNK 4BBSM 3WVDB 1YHQQ 3EFOA 1VQ8A 3RKWA 4BCFB 1I5OB 2Z0WA 3HFOA 1TD6A 4HCKA 1O75A 2HKQB 3EG9A 2R7GA 5GAN2 2KGTA 4NC6A 3MI9B 2CP0A 1U1SA 1ZUYA 3C12A 2VKNA 1MHNA 1PKTA 3PE0A 2YUNA 2O88A 3L2QA 2X51A 4OMQA 4I3ZB 3CXCS 3RESA 2DK3A 5GAMg 5HNBB 2JZ2A 4MMKA 1M3BA 3RIRA 3E9GA 3JCMd 2MF2A 1D0XA 2D0QB 2CCHB 4B6MA 3META 2KQWA 2F5KA 3M5AA 3M55A 2ZPBB 1X6OA 4YC3B 1TG0A 1TS9A 1YITT 1YJ9T 2KBTA 4BCGB 1QLYA 4E7IA 3AT1B 2QTVA 5DQVA 1UGQB 5LJ3g 1IZ6A 4DA4A 4HXJA 2ZPIB 4D6WA 1OULA 3NFCA 4AKIA 4MMLA 1VQ9A 3GP8A 4PJJA 4ORZA 3JCMX 1QKWA 1NYGA 1ZSZC 2COZA 3OBWA 1RAFB 3RKYA 5GAOl 2LRQA 1XNIA 2FPDA 4BD3A 3QHWB 2F2XA 1WPYA 3QIIA 1VYWB 1KQ1A 3OYMA 4EOSB 1M1KR 1D1CA 1GH6B 1HSQA 4CFNB 1O9KA 1IREB 5A0LA 3EAEA 1ENWA 1PC0A 2JM8A 3K7AM 2MOXA 2PU9B 5KYXA 4L5GA 4FW2A 2EWNA 3BHVB 3GIBA 3DB4A 2HNIA 4QW2A 3RBBB 1QKXA 1GCQC 1D3BA 2QEXT 2IW8B 4BCQD 3FJPA 4M7DA 2C06A 1KQSA 3JCMg 4N4GA 1Q95G 1ZSZB 3JB9D 1IHWA 1K0XA 4K11A 4AFZC 4C92E 2KE9A 4A4GA 4CC3A 4XU1A 1JJ2S 2ZPEB 3ASKA 2GQVA 1WX6A 3OW2S 1Q82R 2RD1A 2DE0X 4JLGA 2P0PA 3PFSA 4UC4A 2RJDA 4EMKC 4EPCA 2X4YA 1YJ9Q 4JJBA 1KC8U 4ZGDB 2K5FA 1VQKT 4M6VA 3JB9H 3EGUA 1TH7A 1AD5A 2CUDA 1U06A 1NBEB 4M77D 3CCMT 1SHFA 1WHLA 1PHTA 1M8VA 2AT1B 4BCQB 1JSUB 2QQAA 3OA6A 5A0GA 3LWHA 4M78C 1LJOA 3E2UA 4J6XA 4M75F 4RG8A 2LT1A 3LLRA 3OYYA 4KULA 3VYGB 1BBZA 4JDSA 2RHIA 3DKMA 3M0QA 4M75G 2W99A 2QG9B 1VQ7Q 4XK8E 3RMSA 1X01A 4CXAB 3GNFB 1TXQA 3MJXA 1X6BA 3S3MA 4OB3B 2L8DA 1R0CB 2KT8A 4EMKB 2BIVA 4QVZA 1UGVA 2WJ9A 4C5HA 5CCAA 3QZ5B 1WXBA 1T0HA 4XU0A 4M77B 1QVGS 2DD4B 1ABOA 1VQNT 1IB8A 1MGQA 2PHGA 4KH0B 4IUQA 3CMAQ 4N0AC 2QEXQ 1R8OB 3VUBA 1GL5A 3QYBA 4NL2A 5LL6S 4M78B 2X4WA 1TTHB 2PVOB 3JCMW 4C5GA 1VIFA 4QSHA 2RK1A 2DD5B 1SPKA 3MHXA 3G6EQ 1WFWA 2E5QA 2OTJA 2G6FX 2LNVA 2WMAB 2QI2A 3D7SB 1JB0E 4ZTJA 3LH5A 5LJ5j 1OX8A 1VYUA 2MK5A 2PTKA 4FL6A 4CFMB 4XTWA 1VQKQ 1RAGB 1NLPC 2IPOB 1ZLMA 4C0DB 4E2FB 1UGPB 2GQIA 4R55A 2CP2A 3JCMV 5CAIA 2DL4A 3I56A 2BKZB 1MUZA 2B9RA 3CCLT 4YOZA 5FRNA 3UA7A 3EHRA 3L2WA 1M3AA 2EJFA 4RG2A 3EFRA 1OEBA 1K0SA 1ZSZA 2WHBB 4C8QC 1ZBXA 4J8OA 1NPPA 5GAN6 4KUDK 3MP1A 3BG5A 4HT8A 4DEXA 1VQLA 2E10A 7AT1B 4PK4A 4M7DE 2E41A 3TSWA 3F70A 4NOYA 4IIMA 4F04B 2KNBB 2RQVA 5LJ5e 1VQ7A 1TSFA 3CPWP 4HVWA 3QPHA 3ZFJA 5CKBA 1XOVA 4JJCA 2QFZA 4II1A 4PJNA 4E7ZA 1VYVA 5IT9E 2JTEA 4KGVB 1GCQA 1Q86U 1AT1B 1KC8R 5D7UA 3S6WA 1XTDA 2RB6A 3I5RA 4M7AE 2V1QA 2E1HA 5DY9A 4OGRB 2GF7A 1AWXA 4ROEA 1OPLA 2BUDA 3VYGA 1VQPT 1VQ4A 1MNDA 2QDYB 2JOYA 1AD6A 3CXCA 4HVVA 3CMAA 1YIJA 4XTXA 3M0SA 1UEBA 1M8MA 2LCSA 2C5VB 4ZN3A 4BDYA 2WSFE 1URCB 2QGFB 3OYCA 2VXFA 3SWNC 5FRMA 1Q86C 1UHFA 1G3WA 4EMKA 4OB0B 1M3CA 4UN0A 4J6YA 3G6EA 3EJ1B 2L3SA 5GMKj 1KJWA 2X9HA 4M77A 3ER0A 2LCLA 2DD4A 3R6NA 2P0KA 2JM9A 1I5LA 3CCLQ 3GNGA 4M78A 2GFUA 3VV0A 2RHYA 1ZA1B 1RLPC 2WSEE 5GAOq 2F2WA 1X2QA 1E9HB 4C92F 1F5QB 3RERA 2DD5A 2FYKA 3HRUA 2BE7D 4C92G 5GAN5 5GAN7 1LVKA 1XJWB 2AZSA 3HPWA 3PMIA 4PJLA 1YN8A 1JXOA 2UUEB 1FXXA 4L59A 5HQ0B 5LJ5f 3SWNB 3TN8B 4LDVA 3A8HB 3V8JA 2UZLB 1FX7A 1PKDB 3BG9A 1CKBA 4DBFA 4RODA 4BCOB 4O6JA 2MWPA 1JQQA 2KR6A 4N0AA 1M5Q1 2HD0A 1U8RA 3CCRA 2KRSA 1MMAA 4F7UF 3WVEB 4FSSA 1MV3A 4XAXB 3PT9A 2CGHA 1TOVA 2MAMA 2YSQA 3SDZA 4F7UG 2NUTB 1WHGA 3M0UA 4OMOA 1K1ZA 8AT1B 1SEMA 2YWWA 3M03A 5HBJB 2EQKA 5HBHB 1QVFS 1UNHD 5LJ5h 2DILA 2CSIA 4BE0A 2ABLA 4RMOA 4CFVB 4Q5WA 3DLLA 1WXUA 2QYZA 4BCKB 2JMAA 1JJ2A 5FU7C 3HFNA 3OW2A 4HCCA 1M2OA 4BBRM 2V8IA 2VB6A 3ZL7C 2K79A 1QWEA 3X25B 1D3UB 1N9RA 1SG5A 2K2MA 1BU2A 4HNUA 4J5YA 1KHIA 2KROA 2D6FA 3LQ5B 2HDAA 4RTUA 4B9WA 5KYYB 1MMNA 3VS7A 1KQSS 4ELZC 2DXCB 2A08A 4QVDA 5IDNB 4FIBA 2QA4T 4JPBW 2LJ1A 1RAIB 2G3RA 4BE2A 2J05A 3DTOA 2SEMA 3OW2P 4XTVA 2RF0A 4JZ3A 2CZ6B 4J7IA 3L2VA 1I1JA 2KYMA 4A63B 4J9IA 4C0ZA 3OYEA 4PKCC 3EIDB 5GAN8 2HKNA 4J9HA 5GAOr 3M4GA 3VS6A 1W4SA 3JCMf 2K7AA 3OS2A 3KBGA 2R58A 2ATCB 3VKIA 1H26B 2BZYA 3UWNA 2RHUA 4JX5A 5AT1B 2DL7A 1YJNA 2FHDA 4J9CA 5CIUA 1QVGA 3V7SA 2DZCA 3H6ZA 1XQHA 2FPFA 3V7RA 3CCVT 5KE3A 3QXEB 2J6OA 2GGRA 2LJ0A 2RQWA 1WIEA 1B07A 2GTJA 2CP7A 4M77E 3CCUA 4F7LB 4M7DF 4EMGA 2FO0A 2ED1A 2Y4XA 2E3IA 1E6HA 1PWTA 1LPLA 3SWNA 3TSZA 5J39A 3I35A 4M7DG 4F70B 3EOCB 2A3LA 2KI7A 5CQXA 6AT1B 3CMET 2XD0A 3VU3C 1T3LA 4MZMA 2RA2A 3VYHB 1BI0A 4M7AF 1QW1A 4CRIA 3L2RA 1OV3A 4J9BA 4M7AG 1RL2A 1VIEA 2JTMA 1Y07A 2AZVA 2FPEA 1QWFA 5DLQE 3BY7A 1RAHB 4ZNXA 2NUTA 2RNAA 2QA4Q 3CD6T 1MNEA 1X2KA 2E65A 1VQ5T 1YNZA 3R6OA 3INZA 3UATA 1GUXB 3NHNA 4F6WB 5LJ5d 1YCSB 1S72T 3I5SA 3X20B 1M1KU 3HP9A 1N6AA 5KYUB 1BCOA 1BB9A 2JUFA 3CCSQ 1OKVB 1Q81R 1TUCA 4ELLA 4JZ4A 4BY7X 2FRWA 4E7LA 1P5EB 3MP6A 1QCFA 2LQ8A 2QQRA 4PJOC 1NZ9A 5HK0A 2P0QA 2EKHA 1WHJA 1KG1A 4F6UB 3JSCA 1M1KC 4LUDA 2L2PA 5KYYA 3OYNA 2OTLQ 1UUEA 3CCVQ 1GCPA 2DXCA 2LQNA 3MEVA 3A5ZB 2QQBA 4OMMA 4PFZA 5J3BA 4LNPA 2JVVA 4EOPB 4Z88A 4X9DA 1LCKA 2K3BA 3C0CA 2KSSA 2K57A 1Q82U 3EGDB 1PNJA 3FRNA 4E6RA 5KE2A 4JS4A 8ATCB 4DBHA 3TEEA 1SSHA 1UE9A 4EONB 2A36A 2O9VA 1D09B 1K8AU 2IW6B 4OMNA 3CMEQ 1WLPB 4BXXX 1AZEA 2E64A 4MFEA 4ME7A 2PMIB 2C0TA 4C5EA 1Y0MA 2LX9A 3KXTA 1FMWA 2QDJA 3G7ZA 9ATCB 4GLKA 1Q82C 3T9NA 4OMPA 2FL7A 2QASA 1G8XA 4X34A 5LJ5g 5HY6A 2MCNA 3CC2A 4CFWB 1H641 1VQOT 2DERA 1VQ5Q 2C6TB 4AG1C 3VS5A 2IW9B 2X4JA 3CC7Q 1JKWA 2XHCA 4A4KA 1VINA 1OIUB 1TUGB 3DDQB 2KRMA 4C0GA 3PIOA 4AFSC 4EOMB 3REBB 1AEYA 2OTJT 2XDPA 3OMGA 2ECZA 2K5IA 1WNLA 2X1NB 5D6WA 1H27B 1SKUB 2DXTA 3I55T 1D1BA 1UTIA 2QGSA 3QKJA 3OQ5A 3A8MB 3ZBDA 3CCSA 5L8RE 1RAAB 3A8OB 2O01E 2FEIA 3M0PA 2WMBB 2HAXA 1M30A 3QHSA 2YDLA 1VA7A 2D8JA 2W0ZA 3QYGB 3CC4A 2SRCA 4AKGA 1GUXA 2YRVA 4JUVA 2OAUA 1AVZC 2YUQA 3M9QA 4KRDB 1ACMB 4JX6A 1C9BA 3TNWB 4HLQA 4IUVA 4E7KA 4LD9K 1OZ2A 5KYUA 4EDUA 2HBWA 2EYZA 1QVFA 3JB9F 2E6NA 1JBMA 3H0HA 3JB9G 3VS2A 3OYLA 3JCMb 4DBRA 2DTHA 4MZTA 1VQ6T 3G4SA 1OKWB 1GY3B 2JGZB 1M1FA 1YHQA 2RO0A 2CCIB 3HSBA 1J3TA 2DEUA 1OGUB 4M77F 1U5SA 1M4ZA 1AISB 3PGGA 2BS2A 3Q1JA 4OB2B 3OMCA 4M77G 5BNJB 2EYWA 5LQFB 4EIKA 3QSUA 2KK4A 3EGDA 1W6XA 1N9SA 2L3PA 2PJQA 1NEBA 4JLIA 1K9MR 4LE9A 2A28A 3HKSA 1M1GA 1YITQ 3MY5B 1ZUKA 1NG2A 4DBQA 1K8AR 2V1RA 2PZ1A 1D0YA 1KQSP 2MPXC 3CCET 1UJYA 2V8KA 3EHQA 2BPMB 5A0DA 3DL1A 2LQKA 4M78D 2DJQA 4MIMA 1YJWT 3VRYA 1KC8C 2LQWA 2UZBB 1VQMT 1G5VA 2NWMA 5GANh 3EG2A 2YUOA 1OOTA 3L2UA 2DBMA 2HQEA 2DVEA 2PNIA 3QZ9B 3X26B 5D6XA 3PO3S 2X3WD 3SEMA 1RADB 1W70A 4DQ2A 2GBQA 2VC8A 2WXVB 3QO3A 4VUBA 1VQ6Q 1HYOA 4WF2A 5FU6C 1O9SA 1ZQ1A 2GNCA 1WJRA 3EG0A 1OU9A 2FZGB 4IIOA 4OF1A 3FJ5A 2P4RA 2G77A 1YI2T 3QYEA 2ENMA 2LCCA 1AWOA 3E1SA 4OVAA 3LH0A 2M16A 2F2VA 5GMKm 2IVWA 3RMQA 1T0JA 3PIPA 3KHIA 3MKDA 1YFNA 4OMFB 1UJ0A 3TNIB 5IF1B 2DF6A 3M53A 3OYJA 2ZPGB 4Z6YA 2B8AA 4KGZB 2Y90A 2O9SA 4M75C 2YLBA 2PUOB 2F1LA 3JAME 3FIFA 4RTVA 3VKGA 2DEQA 4XQ3A 2HBPA 2HL5C 1UHCA 1G3NC 1Z9ZA 2EVRA 4OB1B 2J7IA 4HKEA 4HVUA 1D0ZA 5FU6B 5ECAA 3EH2A 4PLLA 3CCMQ 4WCIA 3CCEQ 3PNWC 1M2VB 2DM1A 3EG3A 1P92A 1W1FA 4J6WA 1YJ9A 1FVVB 1YITA 2X4XA 5HCKA 3NTHA 2X3XD 4RUGA 1ZUUA 1UDLA 1VQMQ 4MDXA 2KVQG 4C8QD 2H3EB 4LXCA 3CQTA 2DZ9A 3FC3A 2HQXA 2DL5A 2X35A 5ACBA 4M75B 3DB3A 2QQ8A 3P8BB 1OU8A 1GBQA 4F7SB 2HSEB 1FYNA 2RHXA 4JJDA 1WJSA 3URGA 2PK2A 4EOIB 2RJFA 4QQGA 2BS4A 2WEVB 3G33B 2IIMA 4GLMA 1E7OA 1VQNQ 4CC7A 2I2LA 4KBMB 1ZBJA 1IO6A 1YJNT 1YI2Q 3H0IA 2YT6A 1B7TA 3H8ZA 2CJMB 5LMKB 3TCJA 5GANd 5I22A 3BHTB 4E7JA 1K76A 4C8QB 1H1QB 4BDZA 4OGEA 1B3QA 1OYXA 3GF5A 2XU8A 3BLRB 3QYHB 3O5ZA 4L6V5 2EBPA 4MDWA 1PRLC 2QEXA 4BACA 2XKOC 3CCJT 3M0RA 1WJQA 2RH2A 4X9CA 1QP3A 1KD1R 2J06A 2OAWA 5CKEA 3JCMP 3M58A 2LZ6B 2OI3A 2HL3A 4FU6A 2RI3A 1OI9B 1SRLA 4KRCB 1WA7A 3CBPA 3BDUA 4HCBA 1TU0B 1H3HA 5ICPB 1YWOA 4AT1B 4FYXB 1BIBA 3G71T 5CK9A 5LJ3e 3CXCP 3E19A 2R5MA 1VQKA 1KQ2A 3TQ7P 3FEOA 1KFZA 4A54A 3CCMA 3LX7A 2KDSA 1VOMA 4B9XA 2KR3A 2VV5A 2MMPA 1WQ7A 3IQLA 4D8KA 2EFIA 3DJBA 2VXEA 2EKOA 1WI7A 4CRLB 2QQ9A 3CCQT 4ELYC 4R0KA 4RCCA 3CEYA 1YCYA 1AOJA 1TUDA 1PSEA 5EJCA 2EPDA 1M2VA 1BYMA 2DFUA 3HRSA 3PMTA 3OBYA 2WSCE 1M9SA 2W2HA 1UFFA 5GAOp 2BKDN 5IXBA 3NTKA 1VQPQ 2ROLA 3EGXB 3C95A 1FMKA 1Q81U 2P4TA 4EC8B 3A98A 4E7SA 4FSXA 3VS4A 2JMCA 1KHCA 1H1RB 3CCJQ 4M75A 3S3OA 1UB4A 4C92C 1E6GA 4AI6A 3GLXA 2FVUA 4F14A 2L5QA 3OYAA 4OMLA 4ZGJB 1HXDA 3QDRB 3OYHA 4BUGA 4PFPA 1VQ8T 4A4EA 2KMGA 2IG0A 1RACB 3P8DA 1Q81C 5FWCA 3FLGA 4O5VA 5CR2A 4HNVA 3SFMA 5CKDA 3ZEHA 4D8DA 1G3YA 2DAQA 5KCHA 3G71Q 2XMFA 5IHKA 3VUZA 3AHUA 2KY9A 2CP3A 1TFBA 3P8HA 2CKKA 3V7CA 1A0NB 4C8QA 1K73U 3H9NA 1W2BS 1JJ2P 3VJPA 2ZPFB 3TW6A 3ME9A 3CCLA 1I81A 4V2SA 5GAOm 1ARKA 4LD6A 4CFUD 4FX3B 4C92B 5FU7B 5IHIA 4EOLB 2EGAA 5FWBA 3QWLA 3CCQQ 1OL1B 1K73C 5C0MA 3SB2A 1KK7A 1MMGA 5LJ3h 2ZPHB 1PD1A 2RQUA 3A8GB 2O31A 1OL2B 1GFCA 4E47A 5I2SA 5HBEB 1R77A 1SF9A 1K9AA 3V8LA 3MEUA 1VQ9T 1N8RR 2XICA 4XU2A 4CFUB 1RI9A 3GBQA 4F7UB 1V76A 1TWBA 4CC4B 3V8KA 1JSTB 2A0FB 2HEQA 4IURA 1VQPA 2W9ZA 1PD0A 2K3YA 4M78E 3M0TA 5HK3A 4Z8AA 3ULRB 1QVGP 2RQRA 3FDRA 1VQ8Q 1WZOA 3LGLA 4NL3A 1JU5C 4YOSA 1X69A 3OS0A 1G3SA 2DRKA 1H4LD 4PL6A 2DXUA 5IN1A 3LYIA 4IUPA 3POMA 3EGXA 3MY1B 2EYQA 1IGQA 2VYTA 5DQWA 4BCIB 1C6VX 2ZAEA 3MO8A 4PJMA 2DMEA 2E12A 4ZN1A 3HBLA 2E5KA 3C4SA 1RUWA 2CDTA 3SD4A 2C5OB 2VGMA 2ZZDB 1EX4A 4IMYB 1OI1A 4G6LB 2KXCA 2FG0A 2RQTA 3OYIA 2DL8A 1H25B 2K2VA 4M7DC 2EYYA 2RHZA 1C1AA 4N4IA 1AHJB 2VWFA 4OGCA 2DYIA 2NUZA 3H4CA 4PJOD 4A53A 4YOOA 4M75E 1H24B 4YTLA 5FROA 1OX9A 1RAEB 4HNTA 4KH1B 2LC4A 1FKMA 3NGPA 4M7AC 1B34B 4AMCA 5GAN4 2CT3A 2M0YA 1VQ9Q 1K9MU 2JS2A 1H92A 4FYWB 4PNOA 1K73R 2WIHB 4C92A 4BCNB 5GANj 2DJZA 4CI0C 2D0NA
chains in the Genus database with same CATH topology
3OYFA 3OS5A 1M1GA 2EQUA 3KUFA 1XOVA 1M90U 3HL8A 2QFZA 4II1A 2K5LA 1BI1A 5IT9E 2FB7A 5LJ3d 3CBMA 3MEWA 2RI5A 4C8QE 1Q86U 3X28B 3HZJA 1XTDA 2A7YA 2RB6A 3S6WA 4M7AE 1BIAA 2XIDA 2GCXA 1BI3A 2E1HA 5DY9A 5GMKl 2GF7A 3CCET 1K9MC 2V8KA 3O8VA 4ATOA 2BUDA 3VYGA 2DKGA 1VQPT 5A0DA 3DL1A 2NLUA 2LQKA 1VQ4A 3BDLA 2WACA 4M78D 2QDYB 2JOYA 1E7PA 3OY9A 4MIMA 3CXCA 1YJWT 1M90C 3CMAA 2Y4YA 1YIJA 4XTXA 3RUXA 1UEBA 4M7AB 1K8AC 1KC8C 4MFDA 1G5VA 4ZN3A 3CCST 1VQMT 1NJIU 2EAYA 4BDYA 2WSFE 5GANh 3OYCA 2VXFA 4NS5A 3SWNC 5FRMA 1Q86C 3BFMA 4RKUE 3L2UA 2HQEA 2DVEA 3E9FA 5KH6A 3QZ9B 1X75C 4F7UA 3X26B 1G3WA 2DPPB 4KT0E 4OB0B 1HK9A 5D6XA 4EMKA 3CC4T 4IUTA 4J6YA 3J7AF 1Y71A 3G6EA 2QA4A 5GMKj 2PVDB 4M77A 3VKHA 3ER0A 2LCLA 2DD4A 2RI2A 5GANe 4DQ2A 5KCOA 2CZ1B 2VC8A 3QO3A 2QXFA 2P0KA 2CS7A 4VUBA 2OTLT 3X24B 4WF2A 5FU6C 1I5LA 1O9SA 1WGSA 1ZQ1A 3GNGA 1NJIC 4M78A 1WJRA 2GFUA 4FT4A 3VV0A 2RHYA 4N4HA 2WSEE 4OF1A 5GAOq 1Q7YU 4Z02A 2G77A 1YI2T 3QYEA 2H3JA 2EJ9A 4P5NA 4C92F 2DD5A 2D9TA 3CCJA 2QF7A 2FYKA 2LCCA 4TVRA 3RERA 3HRUA 3E1SA 2V8JA 4OVAA 4C92G 3LH0A 2M16A 3N5BB 4PJOF 3WXMB 4KUIA 5GAN5 5GMKm 2IVWA 3PMIA 3HPWA 5GAN7 3I56T 3G4ST 3RMQA 1YHQT 1FXXA 2DO3A 2K4YA 4L59A 3TREA 3PIPA 2DIQA 4PJOG 3CPFA 3KHIA 1PSFA 3MP8A 2QQSA 5LJ5f 3SWNB 3M56A 3OYGA 3HHTB 2DTIA 4IUUA 3JCMh 4LDVA 3A8HB 1U1TA 3V8JA 2PUKB 4OMFB 5M9OA 5GMKh 1FX7A 3J81E 5J26A 2KAFA 3M53A 2MWOA 3OYJA 3BG9A 2ZPGB 4Z6YA 2B8AA 2ZZDA 2Y90A 4BI4A 3CCVA 4M75C 5D6YA 4BY6C 2YHTA 1VUBA 2F69A 2PUOB 2YLBA 1Q7YC 1H3ZA 1EIFA 1LOJA 3G71A 4O6JA 2ZGWA 4A4HA 4ZTFA 1DJ7B 2E70A 2MWPA 3MCAB 3JAME 3FIFA 3VKGA 2DEQA 2EIFA 2HBPA 3L42A 4XQ3A 3JCMc 4BB7A 5I21A 2KR6A 3A8LB 2VGNA 1ZHIA 4OB1B 1M5Q1 4HKEA 4N0AA 2HD0A 5FU6B 1U8RA 4JRPA 3UPUA 1VQLT 4A4FA 3JRZA 3JB9I 4PLLA 3CCRA 2DTOA 4HT9A 4LDUA 4F7UF 3WVEB 1VQ7T 4M7DD 3PNWC 4XAXB 3PT9A 2CGHA 2M9UA 2MAMA 2PVGB 3QG1A 2JTFA 2M0OA 4XU3A 3SDZA 4Y91A 1P92A 4J6WA 4F7UG 1YJ9A 1LNXA 1YITA 3CC7T 3CMEA 2X4XA 3NTHA 2LTOA 1B34A 2EQKA 3J80E 4HCZA 2CZ0B 4MDXA 2KVQG 4C8QD 1QVFS 5GAMd 3S3NA 5LJ5h 3CCQA 1W2BA 1RI0A 1YBYA 4BE0A 3BW1A 2XG8D 4RMOA 4M78F 4Q5WA 3DLLA 1JJ2A 2DZ9A 3TU4K 4M7AD 3RKXA 3FC3A 4FM4B 2HQXA 3HFNA 2X35A 5FU7C 5GANf 3OW2A 4HCCA 4BBRM 2V8IA 2M1HA 4M75B 4M78G 4BY6B 4JRQA 3QBYA 3DB3A 1VQ4T 2QQ8A 3CD6A 3OSSC 3P8BB 3CMAT 1YIJT 2DIGA 1VQ5A 3X25B 3EFSA 1N9RA 2RHXA 3CPWS 1WJSA 3URGA 1NE8A 5CO7A 1S72A 2VUBA 3CC7A 2RJFA 4QQGA 2BS4A 4HNUA 4J5YA 1KHIA 4PJOA 1D3BB 2EJGA 3JCMJ 1UGRB 2I2LA 2D6FA 4KBMB 4B9WA 2MI6A 4M7DB 2O4XB 2CZ7B 1KQSS 1YJNT 4ELZC 2DXCB 4QVDA 3G6ET 4FIBA 2QA4T 2LDMA 3UT1A 2G3RA 3H8ZA 4XTUA 4BE2A 3TCJA 5GANd 5GAN3 3JB9J 1GXIE 4LOCA 3HB9A 4E7JA 4M7AA 4HA8A 4XTVA 4C8QB 4JJNK 4BBSM 3WVDB 1I8FA 4BDZA 2CZ6B 3FB9A 4J7IA 1VQ8A 4OGEA 3L2VA 3RKWA 1OYXA 3GF5A 4C0ZA 3OYEA 2XU8A 3QYHB 3HFOA 4L6V5 4PKCC 1Y96B 4MDWA 5GAN8 2QEXA 2L89A 4BACA 5GAOr 5CVIA 1KD1U 2XKOC 4LDYA 3M4GA 3CCJT 1W4SA 1WJQA 3JCMf 2RH2A 2RK2A 4M77C 3OS2A 3KBGA 2R58A 1QP3A 1O75A 4X9CA 3VKIA 5GAN2 5CKEA 3UWNA 2GFAA 2RHUA 4NC6A 3M58A 4Y28E 3JCMP 4JX5A 4FU6A 3M57A 3OYBA 4BE1A 2RI3A 1YJNA 2FHDA 1U1SA 5CIUA 1QVGA 3V7SA 4FT2A 3C12A 3CBPA 3BDUA 2DZCA 3H6ZA 1XQHA 4HCBA 1MHNA 3ZFJA 3V7RA 3CCVT 3QJYA 5KE3A 4F7UE 3QXEB 1BIBA 5DLOA 2L3RA 3L2QA 3G71T 1KD1C 5CK9A 5LJ3e 5HKCA 3E19A 2R5MA 3RESA 1QVPA 2DK3A 3CXCS 5GAMg 2JZ2A 4MMKA 3RIRA 1VQKA 1KQ2A 3OSVA 3JCMQ 3E9GA 4M77E 3CCUA 4E7HA 3JCMd 3FEOA 2MF2A 2K3XA 4EMGA 4M7DF 2D0QB 4A54A 5A2QE 2Y4XA 4JX4A 3SWNA 3CCMA 3LX7A 2PQWA 2KDSA 2KQWA 3META 2F5KA 5J39A 3CCRT 4M7DG 3M5AA 2QTXA 3M55A 2ZPBB 4B9XA 4DOWA 1X6OA 2A3LA 4C0DC 1YJ9T 1YITT 1SSFA 5CQXA 2BS3A 3CMET 4C8QF 2VV5A 2MMPA 2XD0A 1WQ7A 3VU3C 2XDDA 4E7IA 2EFIA 1VQOA 4MZMA 1BI2A 5CKFA 2RA2A 4ZGEB 2VXEA 4C8QG 3VYHB 1BI0A 1UGQB 5LJ3g 2EKOA 4M7AF 1IZ6A 4M75D 1QW1A 2QQ9A 4DA4A 4CRIA 3L2RA 3CCQT 2ZPIB 4D6WA 4RCCA 4ELYC 3CEYA 1YCYA 4M7AG 1RL2A 1VIEA 4AKIA 1Y07A 2JTMA 3NFCA 4J7FA 4PLIA 4QQ6A 1PSEA 4MMLA 1NPRA 5EJCA 4QVCA 1VQ9A 3GP8A 1BYMA 5DLQE 2XK0A 5I2MA 3BY7A 3HRSA 3PMTA 1I4K1 3CD6T 3OBYA 3JCMX 2WSCE 1M9SA 2E65A 1VQ5T 3R6OA 3INZA 3OBWA 5GAOp 2BKDN 3RKYA 3NTKA 5LJ5d 2LRQA 5GAOl 1S72T 1XNIA 3I55A 3X20B 4BD3A 1M1KU 3C95A 3OYMA 1WPYA 3QIIA 1KQ1A 1UGSB 1N6AA 2P4TA 3HP9A 3MEAA 3GOXA 1Q81U 4M7DA 2JUFA 5GAOn 4FSXA 1N27A 1KHCA 1IREB 5CQYA 4M75A 3S3OA 1UB4A 5A0LA 2R57A 3EAEA 4OP0A 5GAMj 4E7LA 4J83A 4C92C 2PU9B 4L5GA 4AI6A 3GLXA 2EWNA 2FVUA 3MP6A 3UDCA 3GIBA 3CPWA 2LQ8A 2L5QA 3DB4A 2HNIA 2QQRA 4QW2A 2DXBB 3OYAA 4PJOC 1VQ8T 4ZGJB 1HXDA 3QDRB 3OYHA 4BUGA 1NZ9A 5HK0A 4A4EA 4DOVA 2KMGA 2IG0A 2P0QA 1D3BA 1KG1A 3JSCA 2QEXT 1M1KC 1WQWA 3P8DA 3FJPA 3OYNA 1Q81C 2O4XA 3CBOA 4EMHA 2E6ZA 2C06A 1KQSA 4JRIA 3FLGA 4IKFA 4O5VA 5CR2A 4HNVA 2DXCA 3SFMA 5CKDA 3MEVA 3ZEHA 3M59A 1G3YA 2DAQA 3A5ZB 2QQBA 3JCMg 5KCHA 4N4GA 3VUZA 3AHUA 5J3BA 5LJ3j 2KY9A 2JVVA 3JB9D 3P8HA 2CKKA 3V7CA 4C8QA 4X9DA 1K73U 1W2BS 4MZPA 2KSSA 4C92E 4A4GA 2K57A 1Q82U 4XU1A 3FRNA 3VJPA 2ZPFB 5KE2A 3TW6A 3GPLA 2ZPEB 4JS4A 1JJ2S 1VQ6A 1Y96A 3ASKA 2GQVA 3OW2S 3TEEA 4PJOE 1QP2A 2RD1A 3ME9A 5AYFA 4JLGA 1I81A 3CCLA 2P0PA 3PFSA 4UC4A 2RJDA 5GAOm 4LD6A 4V2SA 1K8AU 4EMKC 4EPCA 2X4YA 1KC8U 3QJ6A 2EQJA 2EQMA 4ZGDB 2K5FA 4C92B 3C94A 1VQKT 4M6VA 5FU7B 2E64A 3JB9H 3CCUT 4MFEA 4ME7A 4C5EA 5GAMe 3LW5E 1TH7A 2LX9A 3KXTA 4M77D 3QWLA 2XI9A 3CCMT 2QDJA 1K73C 1M8VA 3G7ZA 5C0MA 3SB2A 4BI3A 3M54A 1G3TA 4GLKA 1Q82C 2QQAA 5LJ3h 3T9NA 3QUIA 3OA6A 2ZPHB 5A0GA 3PTAA 2FL7A 2YLCA 4X34A 4M78C 5EG2A 3LWHA 3A8GB 1LJOA 5LJ5g 4J6XA 4M75F 5HY6A 1V29B 4CI0C 4RG8A 2LT1A 3CC2A 3LLRA 3OYYA 4KULA 1H641 1VQOT 3VYGB 4JDSA 5IAYA 5FLXE 4E47A 2RHIA 3DKMA 4M75G 5I2SA 4XK8E 4R56A 3LGFA 2X4JA 2XHCA 3RMSA 4A4KA 1X01A 1JRIA 4BI8B 1N8RU 3GNFB 4ELJA 3V8LA 3S3MA 4PJOB 4C5IA 4C0GA 3PIOA 3MEUA 4AKHA 4OB3B 1VQ9T 2L8DA 2XICA 4XU2A 4F7UB 4XTZA 2OTJT 4EMKB 2XDPA 3CCEA 3OMGA 2BIVA 4QVZA 4C5HA 2WJ9A 5CCAA 3V8KA 3QZ5B 1WNLA 2K5IA 4IURA 4JS5A 5D6WA 4M78E 1FWZA 2K3YA 5HK3A 1VQPA 2DXTA 3L1AA 3I55T 4XU0A 4M77B 1QVGS 3FDRA 2DD4B 1VQNT 1YJWA 1MGQA 3LWIA 3QKJA 3OQ5A 4IUQA 1BKBA 3A8MB 4N0AC 3LGLA 5L8RE 3ZBDA 3CCSA 4NL3A 1VQMA 1N8RC 1R8OB 2R5AA 3VUBA 3A8OB 2OTLA 3QYBA 4NL2A 1G3SA 2O01E 3OS0A 4PL6A 5LL6S 4M78B 2HAXA 2DXUA 2X4WA 3QHSA 4RCBA 2PVOB 5IN1A 3JCMW 1Y7XA 3QYGB 3CC4A 4C5GA 3LYIA 1VIFA 3BG3A 4QSHA 2RK1A 4AKGA 2DD5B 2YRVA 4IUPA 4JUVA 2OAUA 3M9QA 5GANg 3MHXA 2JNGA 4GY5A 5GMKi 4JX6A 2E5QA 2EYQA 4HLQA 2OTJA 1OZ3A 2LNVA 2VYTA 4IUVA 4E7KA 3OB9A 2QI2A 3MO8A 1OZ2A 3M4YA 4EDUA 4LD9K 1JB0E 2LVMA 4ZTJA 1QVFA 3JB9F 2E12A 5LJ5j 4ZN1A 3HBLA 3C4SA 3NTIA 5GAMf 1VQNA 2E6NA 1JBMA 3HO8A 3SD4A 2VGMA 4FL6A 3JB9G 2ZZDB 3OYLA 4XTWA 3JCMb 3JCMe 2DTHA 5GMKe 1YI2A 1OI1A 4C0DB 1UGPB 3OYIA 2DXBA 3OS1A 4HL4A 4R55A 3JCMV 5CAIA 2K2VA 4MZTA 4C92D 3I56A 3G4SA 1VQ6T 2RHZA 3L2ZA 4M7DC 4N4IA 3DLMA 1YHQA 1M1FA 1AHJB 4OGCA 3TW7A 3CCLT 3QPHA 2RO0A 3H4CA 2KMTA 2F5TX 5CKHA 5FRNA 3HSBA 4PJOD 2RJEA 3L2WA 4M77F 2EJFA 4A53A 3OYDA 4RG2A 1M4ZA 3PGGA 4LDWA 3EFRA 2BS2A 4M75E 5LJ3f 3HRTA 3Q1JA 4YTLA 5FROA 4OB2B 4C0FA 4C8QC 4HNTA 3OMCA 2RJCA 4M77G 1ZBXA 2LC4A 2LT4A 4J8OA 1NPPA 3QSUA 1FKMA 5GAN6 2KK4A 4KUDK 3MP1A 2AHJB 1B34B 3BG5A 4JRKA 4M7AC 2ZCFB 5GAN4 4XTYA 4HT8A 4LDXA 1VQLA 1K9MU 2E10A 2JN0A 5DM7R 1N9SA 4M7DE 3OYKA 5GAMh 3CC2T 2E41A 4JLIA 3F70A 1QLBA 4NOYA 4PNOA 4QQDA 1VQ7A 2XDBA 5LJ5e 4C92A 2CYZB 5GANj 5C6SA 2DJZA 3HKSA 2RM4A 5CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK8 E;  4ZGE B;  3VYH B;  1UGQ B;  2CZ0 B;  2ZPI B;  3X28 B;  4OB3 B;  1PSE A;  4FM4 B;  3VYG A;  2WSC E;  3QZ5 B;  2QDY B;  3X25 B;  2DD4 B;  3X20 B;  2WSF E;  3A8M B;  1UGS B;  5L8R E;  4RKU E;  1UGR B;  3A8O B;  3QZ9 B;  2O01 E;  3X26 B;  2DPP B;  4KT0 E;  2CZ7 B;  1IRE B;  4OB0 B;  2PVO B;  2DXC B;  3QYG B;  2PU9 B;  2DD5 B;  2PVD B;  1GXI E;  2DD4 A;  2DXB B;  2CZ1 B;  4ZGJ B;  3WVD B;  2CZ6 B;  3X24 B;  1JB0 E;  3QYH B;  4L6V 5;  2WSE E;  2DXC A;  2ZZD B;  1QP3 A;  2DD5 A;  4Y28 E;  1UGP B;  2DXB A;  1PSF A;  2ZPF B;  2ZPE B;  1AHJ B;  3HHT B;  3A8H B;  1QP2 A;  2PUK B;  3QXE B;  2ZPG B;  2ZZD A;  2PUO B;  4OB2 B;  4ZGD B;  1DJ7 B;  3LW5 E;  2AHJ B;  3A8L B;  2D0Q B;  2ZCF B;  4OB1 B;  2ZPB B;  2ZPH B;  3WVE B;  3A8G B;  1V29 B;  2PVG B;  2CYZ B;  3VYG B; 
#chains in the Genus database with same CATH topology
 3OYF A;  3OS5 A;  2EQU A;  3KUF A;  5L23 A;  2FRY A;  2E4H A;  3HL8 A;  2K5L A;  1BI1 A;  4BCJ B;  1QQJ A;  2FB7 A;  5LJ3 d;  1M90 R;  4C8Q E;  2RI5 A;  1AZG B;  4BY1 X;  4TTH A;  3TVT A;  3X28 B;  3HZJ A;  4PJO B;  2GCX A;  1BI3 A;  1IHV A;  1GRI A;  1K9M C;  4ATO A;  2RMO A;  2DKG A;  3UA6 A;  2C5N B;  2C0O A;  1KXU A;  3MPU B;  3H41 A;  1GBR A;  3BDL A;  2WAC A;  1E7P A;  3CD6 Q;  1K4U S;  2KT1 A;  2Y4Y A;  3RUX A;  4RTW A;  4M7A B;  1K8A C;  4MFD A;  2EAY A;  4II5 B;  1S72 Q;  1FMV A;  4RKU E;  1X75 C;  4F7U A;  1NJI R;  2DPP B;  4KT0 E;  1HK9 A;  3NPF A;  2DX1 A;  4IUT A;  4RTZ A;  2QA4 A;  2PVD B;  5CYI B;  3VKH A;  5GAN e;  2RI2 A;  2CZ1 B;  1BK2 A;  1AWJ A;  2I0N A;  2QXF A;  2CS7 A;  1NYF A;  1KIK A;  1Q7Y U;  2DL3 A;  4Z02 A;  1NEG A;  4P5N A;  3QWX X;  4OR5 B;  1F1B B;  2V8J A;  2COW A;  2JJ9 A;  2LP5 A;  3WXM B;  2RN8 A;  3I56 T;  3H0F A;  2DO3 A;  2K4Y A;  2C4G B;  2ESW A;  2HZY A;  3TRE A;  4JRP A;  3CPF A;  1PSF A;  3MP8 A;  3OYG A;  2QQS A;  2UZD B;  3DOG B;  2DTI A;  1U1T A;  2PUK B;  2W10 A;  2KRN A;  3J81 E;  5J26 A;  2MWO A;  2OTL A;  2ZZD A;  2KXD A;  4BI4 A;  3CCV A;  1IGU A;  5D6Y A;  1H3Z A;  1I07 A;  1VUB A;  1Q7Y C;  1FIN B;  1S1N A;  4BB7 A;  1WDX A;  3PVL A;  2VVK A;  2VGN A;  1ZHI A;  1VQL T;  3UPU A;  4A4F A;  3JRZ A;  3KFV A;  3BE3 A;  4RTT A;  2DTO A;  1EFN A;  5IHN A;  2DA9 A;  1VQ7 T;  2QGG A;  2M9U A;  4BI3 A;  2PVG B;  4Y91 A;  2JTF A;  2M0O A;  1OQK A;  1LNX A;  3CME A;  2YUP A;  1OIY B;  1B34 A;  1VQO Q;  4HCZ A;  3PVQ A;  1QVF P;  4F7N B;  3S3N A;  1W2B A;  2V22 B;  3BW1 A;  2YXY A;  4M78 F;  5GJW B;  3RKX A;  1H28 B;  5GAN f;  1WHM A;  2MIO A;  2M1H A;  1W98 B;  4M78 G;  1VQ4 T;  3CD6 A;  3OSS C;  2M02 A;  2HSP A;  2W9F A;  3CMA T;  4AFU C;  1YIJ T;  2OTJ Q;  1EZZ B;  2DIG A;  1VQ5 A;  3EFS A;  1JXM A;  2IN3 A;  5CO7 A;  1S72 A;  3CC7 A;  3I55 Q;  4PJO A;  1UGR B;  1KSW A;  1YWP A;  2MI6 A;  1XO2 A;  2O4X B;  2CZ7 B;  3G6E T;  2LDM A;  1W2B P;  2WIP B;  2YRC A;  1GXI E;  2LX7 A;  4LOC A;  4M7A A;  3I56 Q;  2HMA A;  1I8F A;  3FB9 A;  4F17 A;  3F5X B;  5L2W B;  3G1J A;  2ED0 A;  1NLO C;  2FZK B;  1Y96 B;  2L89 A;  5CVI A;  1KD1 U;  4LDY A;  2CP6 A;  2RK2 A;  1PCX A;  4M77 C;  1GFD A;  2GFA A;  4Y28 E;  1M27 C;  3M57 A;  3OYB A;  2CH4 W;  5GJV B;  2UZE B;  1WHK A;  4BE1 A;  5I11 A;  1MV0 B;  1QCN A;  4M4Z A;  1VQL Q;  4FT2 A;  5IHY A;  4FYY B;  2KEA A;  1QCO A;  3QJY A;  4F7U E;  2QDL A;  5DLO A;  2L3R A;  1KD1 C;  2J6K A;  5HKC A;  1QVP A;  4EOQ B;  1CSK A;  3OSV A;  3JCM Q;  4E7H A;  1VYT A;  2K3X A;  1Q7Y R;  5A2Q E;  4JX4 A;  4AG2 C;  2PQW A;  3CCR T;  2FZC B;  2QTX A;  3RGF B;  2O2O A;  2NYS A;  1UNG D;  4DOW A;  1ABQ A;  4C0D C;  4FW1 A;  1SSF A;  4F16 A;  2BS3 A;  3BLH B;  4C8Q F;  1VQ4 Q;  2XDD A;  1MMD A;  1VQO A;  5CKF A;  1BI2 A;  1YIJ Q;  4ZGE B;  4C8Q G;  1X27 A;  4M75 D;  2OX7 A;  2W96 A;  3B57 A;  4NST B;  1UEC A;  2BE9 B;  4PLI A;  1UNL D;  4J7F A;  4QQ6 A;  1NPR A;  1X43 A;  4LUE A;  4QVC A;  2I53 A;  4GBQ A;  2XK0 A;  5I2M A;  2B86 A;  1I4K 1;  3O0G D;  1ZX6 A;  2J6F A;  3I55 A;  4FYV B;  2CUB A;  1PRM C;  1UGS B;  3MEA A;  3GOX A;  1YJW Q;  4BCM D;  4QT7 A;  2P84 A;  5GAO n;  2CH4 A;  1N27 A;  5CQY A;  4F6S B;  2M51 A;  2R57 A;  4OP0 A;  5GAM j;  4Y92 A;  4J83 A;  1JEG A;  3UDC A;  3CPW A;  2BZX A;  3QWY A;  1X6G A;  2DXB B;  1H1S B;  5IH2 A;  2C5X B;  2AKK A;  4DOV A;  2DLP A;  1G2B A;  1WQW A;  2O4X A;  3CBO A;  4EMH A;  2E6Z A;  4JRI A;  4IKF A;  3M59 A;  1YP5 A;  2JS0 A;  5LJ3 j;  2COY A;  2K6D A;  3UF4 A;  4MZP A;  2DBK A;  5EC7 A;  3GPL A;  3CCR Q;  1VQ6 A;  4BCM B;  1Y96 A;  4Y72 B;  4PJO E;  1QP2 A;  4KGX B;  4BCP B;  2EUF A;  5AYF A;  3QJ6 A;  2EQJ A;  2EQM A;  3HTR A;  3C94 A;  3VS1 A;  3CCU T;  5GAM e;  1RLQ C;  4EOR B;  3LW5 E;  2XI9 A;  5KYN A;  1G83 A;  3RR6 A;  3M54 A;  1G3T A;  2D8H A;  2LMJ A;  3QUI A;  2QK0 A;  3PTA A;  2YLC A;  2IVX A;  5EG2 A;  1V1C A;  3RNJ A;  1T3S A;  4RTX A;  1V29 B;  4KRT A;  4QKU A;  5IAY A;  3JV3 A;  5FLX E;  2D1X A;  2BTT A;  4R56 A;  2DNU A;  3LGF A;  5HVY B;  1JRI A;  4BI8 B;  1N8R U;  1U3O A;  4ELJ A;  2DRM A;  1HD3 A;  1R0B G;  4C5I A;  4AKH A;  1WXT A;  1PKS A;  1BU1 A;  3I9Q A;  4XTZ A;  5KYW B;  1IRX A;  3CCE A;  4X1V A;  4JS5 A;  2KYB A;  1FWZ A;  2DMO A;  3L1A A;  2ROT A;  1ZSG A;  3DDP B;  5EFQ B;  1YJW A;  3LWI A;  1BKB A;  1VQM A;  2BZ8 A;  2HQH A;  1N8R C;  2R5A A;  4RCB A;  1Y7X A;  1ZA2 B;  1VOL A;  3BG3 A;  4PFO A;  5GAN g;  4F7J B;  1YJN Q;  2JNG A;  4GY5 A;  5GMK i;  2NUP B;  1OZ3 A;  3TNH B;  1QMC A;  3OB9 A;  3M4Y A;  1SHG A;  2LVM A;  3NTI A;  2QAZ A;  5GAM f;  1VQN A;  3HO8 A;  2EGC A;  2LJ3 A;  3BLQ B;  1H8K A;  3JCM e;  4BCH B;  5GMK e;  1YI2 A;  2JT4 A;  2F2C A;  3CCU Q;  2MYS A;  2DXB A;  3OS1 A;  4HL4 A;  1NM7 A;  4C92 D;  3L2Z A;  3DLM A;  2CSQ A;  3TW7 A;  2KMT A;  2F5T X;  5CKH A;  1N5Z A;  2RJE A;  2YRD A;  3OYD A;  3VRZ A;  5LJ3 f;  4LDW A;  4ESR A;  4C0F A;  3HRT A;  2RJC A;  2CT4 A;  2LT4 A;  2AHJ B;  1C0M A;  4JRK A;  2ZCF B;  4XTY A;  4LDX A;  5DM7 R;  2JN0 A;  3OYK A;  5I5Z B;  5GAM h;  1BCM A;  3CC2 T;  4EOK B;  3GTM S;  1QLB A;  1CKA A;  2K9G A;  4QQD A;  2XDB A;  1WHH A;  2L3Q A;  2DYB A;  1Z9Q A;  2CYZ B;  5C6S A;  2RM4 A;  1M90 U;  2WFY B;  3CBM A;  4EC9 B;  3MEW A;  2JW4 A;  2JXB A;  3REA B;  2AKL A;  2A7Y A;  1Q86 R;  1BIA A;  2XID A;  3A1P A;  5GMK l;  3RDV A;  4J9D A;  1JO8 A;  2V26 A;  3O8V A;  5CEI B;  1UG1 A;  2HCK A;  2NLU A;  1ZP2 A;  1WYX A;  2E3H A;  3OY9 A;  1M90 C;  3CCS T;  1H1P B;  1NJI U;  3EFO B;  4NS5 A;  4ANJ A;  3BFM A;  3E9F A;  5KH6 A;  3QDF A;  1SRM A;  5KYW A;  3THK A;  3CC4 T;  2EGE A;  3EH1 A;  3J7A F;  4CFX B;  1Y71 A;  3EG9 B;  3QHR B;  3BHU B;  5KCO A;  2OTL T;  3X24 B;  2GTO A;  1WGS A;  1NJI C;  4FT4 A;  4N4H A;  2EW3 A;  2LNH B;  2H3J A;  2EJ9 A;  3CCJ A;  2D9T A;  2QF7 A;  4TVR A;  2CRE A;  4AFQ C;  2NUP A;  3N5B B;  4PJO F;  4KUI A;  3G4S T;  1HJD A;  1YHQ T;  1I0C A;  2DIQ A;  4PJO G;  3M56 A;  3HHT B;  4IUU A;  3JCM h;  5GMK h;  5M9O A;  4RTY A;  3VS3 A;  4ROC A;  2A37 A;  2KAF A;  2VAS A;  4CC2 A;  3CC2 Q;  1QMZ B;  1D1A A;  3EG1 A;  4BY6 C;  2YHT A;  2F69 A;  2I40 B;  1EIF A;  1LOJ A;  3G71 A;  4ZTF A;  2ZGW A;  4A4H A;  1DJ7 B;  1PM3 A;  2E70 A;  3MCA B;  4Z89 A;  3NDQ A;  5IXF A;  2EIF A;  2EYX A;  3L42 A;  5I21 A;  3JCM c;  5FW9 A;  4BCN D;  3A8L B;  3JB9 I;  1IXD A;  4HT9 A;  3MIA B;  2WPA B;  1OPK A;  4LDU A;  4M7D D;  2L0A A;  3QG1 A;  3NMZ C;  4FCY A;  4XU3 A;  3CC7 T;  1AWW A;  2C0I A;  2DET A;  2G9X B;  2AIR B;  2LTO A;  3J80 E;  4J9F A;  2CZ0 B;  2H8H A;  5GAM d;  2OJ2 A;  3CCQ A;  4J9G A;  1RI0 A;  1YBY A;  2XG8 D;  3VS0 A;  3TU4 K;  4M7A D;  4FM4 B;  3CC4 Q;  1JOW A;  1O9K B;  1Y57 A;  2AK5 A;  2DVJ A;  2PK9 B;  4BY6 B;  3QBY A;  5FGK B;  2RPN A;  4JRQ A;  5KYX B;  3SHW A;  4DEY A;  2EQI A;  3CPW S;  1NE8 A;  2VUB A;  2CP5 A;  1D3B B;  2EJG A;  4J9E A;  3JCM J;  1N4M A;  4EOJ B;  5IDP B;  4M7D B;  4EOO B;  1PG5 B;  3U23 A;  4WTO B;  4LN2 A;  1RAB B;  3UT1 A;  4XTU A;  5GAN 3;  3JB9 J;  3HB9 A;  4HA8 A;  3G4S Q;  2LW4 A;  4JJN K;  4BBS M;  3WVD B;  1YHQ Q;  3EFO A;  1VQ8 A;  3RKW A;  4BCF B;  1I5O B;  2Z0W A;  3HFO A;  1TD6 A;  4HCK A;  1O75 A;  2HKQ B;  3EG9 A;  2R7G A;  5GAN 2;  2KGT A;  4NC6 A;  3MI9 B;  2CP0 A;  1U1S A;  1ZUY A;  3C12 A;  2VKN A;  1MHN A;  1PKT A;  3PE0 A;  2YUN A;  2O88 A;  3L2Q A;  2X51 A;  4OMQ A;  4I3Z B;  3CXC S;  3RES A;  2DK3 A;  5GAM g;  5HNB B;  2JZ2 A;  4MMK A;  1M3B A;  3RIR A;  3E9G A;  3JCM d;  2MF2 A;  1D0X A;  2D0Q B;  2CCH B;  4B6M A;  3MET A;  2KQW A;  2F5K A;  3M5A A;  3M55 A;  2ZPB B;  1X6O A;  4YC3 B;  1TG0 A;  1TS9 A;  1YIT T;  1YJ9 T;  2KBT A;  4BCG B;  1QLY A;  4E7I A;  3AT1 B;  2QTV A;  5DQV A;  1UGQ B;  5LJ3 g;  1IZ6 A;  4DA4 A;  4HXJ A;  2ZPI B;  4D6W A;  1OUL A;  3NFC A;  4AKI A;  4MML A;  1VQ9 A;  3GP8 A;  4PJJ A;  4ORZ A;  3JCM X;  1QKW A;  1NYG A;  1ZSZ C;  2COZ A;  3OBW A;  1RAF B;  3RKY A;  5GAO l;  2LRQ A;  1XNI A;  2FPD A;  4BD3 A;  3QHW B;  2F2X A;  1WPY A;  3QII A;  1VYW B;  1KQ1 A;  3OYM A;  4EOS B;  1M1K R;  1D1C A;  1GH6 B;  1HSQ A;  4CFN B;  1O9K A;  1IRE B;  5A0L A;  3EAE A;  1ENW A;  1PC0 A;  2JM8 A;  3K7A M;  2MOX A;  2PU9 B;  5KYX A;  4L5G A;  4FW2 A;  2EWN A;  3BHV B;  3GIB A;  3DB4 A;  2HNI A;  4QW2 A;  3RBB B;  1QKX A;  1GCQ C;  1D3B A;  2QEX T;  2IW8 B;  4BCQ D;  3FJP A;  4M7D A;  2C06 A;  1KQS A;  3JCM g;  4N4G A;  1Q95 G;  1ZSZ B;  3JB9 D;  1IHW A;  1K0X A;  4K11 A;  4AFZ C;  4C92 E;  2KE9 A;  4A4G A;  4CC3 A;  4XU1 A;  1JJ2 S;  2ZPE B;  3ASK A;  2GQV A;  1WX6 A;  3OW2 S;  1Q82 R;  2RD1 A;  2DE0 X;  4JLG A;  2P0P A;  3PFS A;  4UC4 A;  2RJD A;  4EMK C;  4EPC A;  2X4Y A;  1YJ9 Q;  4JJB A;  1KC8 U;  4ZGD B;  2K5F A;  1VQK T;  4M6V A;  3JB9 H;  3EGU A;  1TH7 A;  1AD5 A;  2CUD A;  1U06 A;  1NBE B;  4M77 D;  3CCM T;  1SHF A;  1WHL A;  1PHT A;  1M8V A;  2AT1 B;  4BCQ B;  1JSU B;  2QQA A;  3OA6 A;  5A0G A;  3LWH A;  4M78 C;  1LJO A;  3E2U A;  4J6X A;  4M75 F;  4RG8 A;  2LT1 A;  3LLR A;  3OYY A;  4KUL A;  3VYG B;  1BBZ A;  4JDS A;  2RHI A;  3DKM A;  3M0Q A;  4M75 G;  2W99 A;  2QG9 B;  1VQ7 Q;  4XK8 E;  3RMS A;  1X01 A;  4CXA B;  3GNF B;  1TXQ A;  3MJX A;  1X6B A;  3S3M A;  4OB3 B;  2L8D A;  1R0C B;  2KT8 A;  4EMK B;  2BIV A;  4QVZ A;  1UGV A;  2WJ9 A;  4C5H A;  5CCA A;  3QZ5 B;  1WXB A;  1T0H A;  4XU0 A;  4M77 B;  1QVG S;  2DD4 B;  1ABO A;  1VQN T;  1IB8 A;  1MGQ A;  2PHG A;  4KH0 B;  4IUQ A;  3CMA Q;  4N0A C;  2QEX Q;  1R8O B;  3VUB A;  1GL5 A;  3QYB A;  4NL2 A;  5LL6 S;  4M78 B;  2X4W A;  1TTH B;  2PVO B;  3JCM W;  4C5G A;  1VIF A;  4QSH A;  2RK1 A;  2DD5 B;  1SPK A;  3MHX A;  3G6E Q;  1WFW A;  2E5Q A;  2OTJ A;  2G6F X;  2LNV A;  2WMA B;  2QI2 A;  3D7S B;  1JB0 E;  4ZTJ A;  3LH5 A;  5LJ5 j;  1OX8 A;  1VYU A;  2MK5 A;  2PTK A;  4FL6 A;  4CFM B;  4XTW A;  1VQK Q;  1RAG B;  1NLP C;  2IPO B;  1ZLM A;  4C0D B;  4E2F B;  1UGP B;  2GQI A;  4R55 A;  2CP2 A;  3JCM V;  5CAI A;  2DL4 A;  3I56 A;  2BKZ B;  1MUZ A;  2B9R A;  3CCL T;  4YOZ A;  5FRN A;  3UA7 A;  3EHR A;  3L2W A;  1M3A A;  2EJF A;  4RG2 A;  3EFR A;  1OEB A;  1K0S A;  1ZSZ A;  2WHB B;  4C8Q C;  1ZBX A;  4J8O A;  1NPP A;  5GAN 6;  4KUD K;  3MP1 A;  3BG5 A;  4HT8 A;  4DEX A;  1VQL A;  2E10 A;  7AT1 B;  4PK4 A;  4M7D E;  2E41 A;  3TSW A;  3F70 A;  4NOY A;  4IIM A;  4F04 B;  2KNB B;  2RQV A;  5LJ5 e;  1VQ7 A;  1TSF A;  3CPW P;  4HVW A;  3QPH A;  3ZFJ A;  5CKB A;  1XOV A;  4JJC A;  2QFZ A;  4II1 A;  4PJN A;  4E7Z A;  1VYV A;  5IT9 E;  2JTE A;  4KGV B;  1GCQ A;  1Q86 U;  1AT1 B;  1KC8 R;  5D7U A;  3S6W A;  1XTD A;  2RB6 A;  3I5R A;  4M7A E;  2V1Q A;  2E1H A;  5DY9 A;  4OGR B;  2GF7 A;  1AWX A;  4ROE A;  1OPL A;  2BUD A;  3VYG A;  1VQP T;  1VQ4 A;  1MND A;  2QDY B;  2JOY A;  1AD6 A;  3CXC A;  4HVV A;  3CMA A;  1YIJ A;  4XTX A;  3M0S A;  1UEB A;  1M8M A;  2LCS A;  2C5V B;  4ZN3 A;  4BDY A;  2WSF E;  1URC B;  2QGF B;  3OYC A;  2VXF A;  3SWN C;  5FRM A;  1Q86 C;  1UHF A;  1G3W A;  4EMK A;  4OB0 B;  1M3C A;  4UN0 A;  4J6Y A;  3G6E A;  3EJ1 B;  2L3S A;  5GMK j;  1KJW A;  2X9H A;  4M77 A;  3ER0 A;  2LCL A;  2DD4 A;  3R6N A;  2P0K A;  2JM9 A;  1I5L A;  3CCL Q;  3GNG A;  4M78 A;  2GFU A;  3VV0 A;  2RHY A;  1ZA1 B;  1RLP C;  2WSE E;  5GAO q;  2F2W A;  1X2Q A;  1E9H B;  4C92 F;  1F5Q B;  3RER A;  2DD5 A;  2FYK A;  3HRU A;  2BE7 D;  4C92 G;  5GAN 5;  5GAN 7;  1LVK A;  1XJW B;  2AZS A;  3HPW A;  3PMI A;  4PJL A;  1YN8 A;  1JXO A;  2UUE B;  1FXX A;  4L59 A;  5HQ0 B;  5LJ5 f;  3SWN B;  3TN8 B;  4LDV A;  3A8H B;  3V8J A;  2UZL B;  1FX7 A;  1PKD B;  3BG9 A;  1CKB A;  4DBF A;  4ROD A;  4BCO B;  4O6J A;  2MWP A;  1JQQ A;  2KR6 A;  4N0A A;  1M5Q 1;  2HD0 A;  1U8R A;  3CCR A;  2KRS A;  1MMA A;  4F7U F;  3WVE B;  4FSS A;  1MV3 A;  4XAX B;  3PT9 A;  2CGH A;  1TOV A;  2MAM A;  2YSQ A;  3SDZ A;  4F7U G;  2NUT B;  1WHG A;  3M0U A;  4OMO A;  1K1Z A;  8AT1 B;  1SEM A;  2YWW A;  3M03 A;  5HBJ B;  2EQK A;  5HBH B;  1QVF S;  1UNH D;  5LJ5 h;  2DIL A;  2CSI A;  4BE0 A;  2ABL A;  4RMO A;  4CFV B;  4Q5W A;  3DLL A;  1WXU A;  2QYZ A;  4BCK B;  2JMA A;  1JJ2 A;  5FU7 C;  3HFN A;  3OW2 A;  4HCC A;  1M2O A;  4BBR M;  2V8I A;  2VB6 A;  3ZL7 C;  2K79 A;  1QWE A;  3X25 B;  1D3U B;  1N9R A;  1SG5 A;  2K2M A;  1BU2 A;  4HNU A;  4J5Y A;  1KHI A;  2KRO A;  2D6F A;  3LQ5 B;  2HDA A;  4RTU A;  4B9W A;  5KYY B;  1MMN A;  3VS7 A;  1KQS S;  4ELZ C;  2DXC B;  2A08 A;  4QVD A;  5IDN B;  4FIB A;  2QA4 T;  4JPB W;  2LJ1 A;  1RAI B;  2G3R A;  4BE2 A;  2J05 A;  3DTO A;  2SEM A;  3OW2 P;  4XTV A;  2RF0 A;  4JZ3 A;  2CZ6 B;  4J7I A;  3L2V A;  1I1J A;  2KYM A;  4A63 B;  4J9I A;  4C0Z A;  3OYE A;  4PKC C;  3EID B;  5GAN 8;  2HKN A;  4J9H A;  5GAO r;  3M4G A;  3VS6 A;  1W4S A;  3JCM f;  2K7A A;  3OS2 A;  3KBG A;  2R58 A;  2ATC B;  3VKI A;  1H26 B;  2BZY A;  3UWN A;  2RHU A;  4JX5 A;  5AT1 B;  2DL7 A;  1YJN A;  2FHD A;  4J9C A;  5CIU A;  1QVG A;  3V7S A;  2DZC A;  3H6Z A;  1XQH A;  2FPF A;  3V7R A;  3CCV T;  5KE3 A;  3QXE B;  2J6O A;  2GGR A;  2LJ0 A;  2RQW A;  1WIE A;  1B07 A;  2GTJ A;  2CP7 A;  4M77 E;  3CCU A;  4F7L B;  4M7D F;  4EMG A;  2FO0 A;  2ED1 A;  2Y4X A;  2E3I A;  1E6H A;  1PWT A;  1LPL A;  3SWN A;  3TSZ A;  5J39 A;  3I35 A;  4M7D G;  4F70 B;  3EOC B;  2A3L A;  2KI7 A;  5CQX A;  6AT1 B;  3CME T;  2XD0 A;  3VU3 C;  1T3L A;  4MZM A;  2RA2 A;  3VYH B;  1BI0 A;  4M7A F;  1QW1 A;  4CRI A;  3L2R A;  1OV3 A;  4J9B A;  4M7A G;  1RL2 A;  1VIE A;  2JTM A;  1Y07 A;  2AZV A;  2FPE A;  1QWF A;  5DLQ E;  3BY7 A;  1RAH B;  4ZNX A;  2NUT A;  2RNA A;  2QA4 Q;  3CD6 T;  1MNE A;  1X2K A;  2E65 A;  1VQ5 T;  1YNZ A;  3R6O A;  3INZ A;  3UAT A;  1GUX B;  3NHN A;  4F6W B;  5LJ5 d;  1YCS B;  1S72 T;  3I5S A;  3X20 B;  1M1K U;  3HP9 A;  1N6A A;  5KYU B;  1BCO A;  1BB9 A;  2JUF A;  3CCS Q;  1OKV B;  1Q81 R;  1TUC A;  4ELL A;  4JZ4 A;  4BY7 X;  2FRW A;  4E7L A;  1P5E B;  3MP6 A;  1QCF A;  2LQ8 A;  2QQR A;  4PJO C;  1NZ9 A;  5HK0 A;  2P0Q A;  2EKH A;  1WHJ A;  1KG1 A;  4F6U B;  3JSC A;  1M1K C;  4LUD A;  2L2P A;  5KYY A;  3OYN A;  2OTL Q;  1UUE A;  3CCV Q;  1GCP A;  2DXC A;  2LQN A;  3MEV A;  3A5Z B;  2QQB A;  4OMM A;  4PFZ A;  5J3B A;  4LNP A;  2JVV A;  4EOP B;  4Z88 A;  4X9D A;  1LCK A;  2K3B A;  3C0C A;  2KSS A;  2K57 A;  1Q82 U;  3EGD B;  1PNJ A;  3FRN A;  4E6R A;  5KE2 A;  4JS4 A;  8ATC B;  4DBH A;  3TEE A;  1SSH A;  1UE9 A;  4EON B;  2A36 A;  2O9V A;  1D09 B;  1K8A U;  2IW6 B;  4OMN A;  3CME Q;  1WLP B;  4BXX X;  1AZE A;  2E64 A;  4MFE A;  4ME7 A;  2PMI B;  2C0T A;  4C5E A;  1Y0M A;  2LX9 A;  3KXT A;  1FMW A;  2QDJ A;  3G7Z A;  9ATC B;  4GLK A;  1Q82 C;  3T9N A;  4OMP A;  2FL7 A;  2QAS A;  1G8X A;  4X34 A;  5LJ5 g;  5HY6 A;  2MCN A;  3CC2 A;  4CFW B;  1H64 1;  1VQO T;  2DER A;  1VQ5 Q;  2C6T B;  4AG1 C;  3VS5 A;  2IW9 B;  2X4J A;  3CC7 Q;  1JKW A;  2XHC A;  4A4K A;  1VIN A;  1OIU B;  1TUG B;  3DDQ B;  2KRM A;  4C0G A;  3PIO A;  4AFS C;  4EOM B;  3REB B;  1AEY A;  2OTJ T;  2XDP A;  3OMG A;  2ECZ A;  2K5I A;  1WNL A;  2X1N B;  5D6W A;  1H27 B;  1SKU B;  2DXT A;  3I55 T;  1D1B A;  1UTI A;  2QGS A;  3QKJ A;  3OQ5 A;  3A8M B;  3ZBD A;  3CCS A;  5L8R E;  1RAA B;  3A8O B;  2O01 E;  2FEI A;  3M0P A;  2WMB B;  2HAX A;  1M30 A;  3QHS A;  2YDL A;  1VA7 A;  2D8J A;  2W0Z A;  3QYG B;  3CC4 A;  2SRC A;  4AKG A;  1GUX A;  2YRV A;  4JUV A;  2OAU A;  1AVZ C;  2YUQ A;  3M9Q A;  4KRD B;  1ACM B;  4JX6 A;  1C9B A;  3TNW B;  4HLQ A;  4IUV A;  4E7K A;  4LD9 K;  1OZ2 A;  5KYU A;  4EDU A;  2HBW A;  2EYZ A;  1QVF A;  3JB9 F;  2E6N A;  1JBM A;  3H0H A;  3JB9 G;  3VS2 A;  3OYL A;  3JCM b;  4DBR A;  2DTH A;  4MZT A;  1VQ6 T;  3G4S A;  1OKW B;  1GY3 B;  2JGZ B;  1M1F A;  1YHQ A;  2RO0 A;  2CCI B;  3HSB A;  1J3T A;  2DEU A;  1OGU B;  4M77 F;  1U5S A;  1M4Z A;  1AIS B;  3PGG A;  2BS2 A;  3Q1J A;  4OB2 B;  3OMC A;  4M77 G;  5BNJ B;  2EYW A;  5LQF B;  4EIK A;  3QSU A;  2KK4 A;  3EGD A;  1W6X A;  1N9S A;  2L3P A;  2PJQ A;  1NEB A;  4JLI A;  1K9M R;  4LE9 A;  2A28 A;  3HKS A;  1M1G A;  1YIT Q;  3MY5 B;  1ZUK A;  1NG2 A;  4DBQ A;  1K8A R;  2V1R A;  2PZ1 A;  1D0Y A;  1KQS P;  2MPX C;  3CCE T;  1UJY A;  2V8K A;  3EHQ A;  2BPM B;  5A0D A;  3DL1 A;  2LQK A;  4M78 D;  2DJQ A;  4MIM A;  1YJW T;  3VRY A;  1KC8 C;  2LQW A;  2UZB B;  1VQM T;  1G5V A;  2NWM A;  5GAN h;  3EG2 A;  2YUO A;  1OOT A;  3L2U A;  2DBM A;  2HQE A;  2DVE A;  2PNI A;  3QZ9 B;  3X26 B;  5D6X A;  3PO3 S;  2X3W D;  3SEM A;  1RAD B;  1W70 A;  4DQ2 A;  2GBQ A;  2VC8 A;  2WXV B;  3QO3 A;  4VUB A;  1VQ6 Q;  1HYO A;  4WF2 A;  5FU6 C;  1O9S A;  1ZQ1 A;  2GNC A;  1WJR A;  3EG0 A;  1OU9 A;  2FZG B;  4IIO A;  4OF1 A;  3FJ5 A;  2P4R A;  2G77 A;  1YI2 T;  3QYE A;  2ENM A;  2LCC A;  1AWO A;  3E1S A;  4OVA A;  3LH0 A;  2M16 A;  2F2V A;  5GMK m;  2IVW A;  3RMQ A;  1T0J A;  3PIP A;  3KHI A;  3MKD A;  1YFN A;  4OMF B;  1UJ0 A;  3TNI B;  5IF1 B;  2DF6 A;  3M53 A;  3OYJ A;  2ZPG B;  4Z6Y A;  2B8A A;  4KGZ B;  2Y90 A;  2O9S A;  4M75 C;  2YLB A;  2PUO B;  2F1L A;  3JAM E;  3FIF A;  4RTV A;  3VKG A;  2DEQ A;  4XQ3 A;  2HBP A;  2HL5 C;  1UHC A;  1G3N C;  1Z9Z A;  2EVR A;  4OB1 B;  2J7I A;  4HKE A;  4HVU A;  1D0Z A;  5FU6 B;  5ECA A;  3EH2 A;  4PLL A;  3CCM Q;  4WCI A;  3CCE Q;  3PNW C;  1M2V B;  2DM1 A;  3EG3 A;  1P92 A;  1W1F A;  4J6W A;  1YJ9 A;  1FVV B;  1YIT A;  2X4X A;  5HCK A;  3NTH A;  2X3X D;  4RUG A;  1ZUU A;  1UDL A;  1VQM Q;  4MDX A;  2KVQ G;  4C8Q D;  2H3E B;  4LXC A;  3CQT A;  2DZ9 A;  3FC3 A;  2HQX A;  2DL5 A;  2X35 A;  5ACB A;  4M75 B;  3DB3 A;  2QQ8 A;  3P8B B;  1OU8 A;  1GBQ A;  4F7S B;  2HSE B;  1FYN A;  2RHX A;  4JJD A;  1WJS A;  3URG A;  2PK2 A;  4EOI B;  2RJF A;  4QQG A;  2BS4 A;  2WEV B;  3G33 B;  2IIM A;  4GLM A;  1E7O A;  1VQN Q;  4CC7 A;  2I2L A;  4KBM B;  1ZBJ A;  1IO6 A;  1YJN T;  1YI2 Q;  3H0I A;  2YT6 A;  1B7T A;  3H8Z A;  2CJM B;  5LMK B;  3TCJ A;  5GAN d;  5I22 A;  3BHT B;  4E7J A;  1K76 A;  4C8Q B;  1H1Q B;  4BDZ A;  4OGE A;  1B3Q A;  1OYX A;  3GF5 A;  2XU8 A;  3BLR B;  3QYH B;  3O5Z A;  4L6V 5;  2EBP A;  4MDW A;  1PRL C;  2QEX A;  4BAC A;  2XKO C;  3CCJ T;  3M0R A;  1WJQ A;  2RH2 A;  4X9C A;  1QP3 A;  1KD1 R;  2J06 A;  2OAW A;  5CKE A;  3JCM P;  3M58 A;  2LZ6 B;  2OI3 A;  2HL3 A;  4FU6 A;  2RI3 A;  1OI9 B;  1SRL A;  4KRC B;  1WA7 A;  3CBP A;  3BDU A;  4HCB A;  1TU0 B;  1H3H A;  5ICP B;  1YWO A;  4AT1 B;  4FYX B;  1BIB A;  3G71 T;  5CK9 A;  5LJ3 e;  3CXC P;  3E19 A;  2R5M A;  1VQK A;  1KQ2 A;  3TQ7 P;  3FEO A;  1KFZ A;  4A54 A;  3CCM A;  3LX7 A;  2KDS A;  1VOM A;  4B9X A;  2KR3 A;  2VV5 A;  2MMP A;  1WQ7 A;  3IQL A;  4D8K A;  2EFI A;  3DJB A;  2VXE A;  2EKO A;  1WI7 A;  4CRL B;  2QQ9 A;  3CCQ T;  4ELY C;  4R0K A;  4RCC A;  3CEY A;  1YCY A;  1AOJ A;  1TUD A;  1PSE A;  5EJC A;  2EPD A;  1M2V A;  1BYM A;  2DFU A;  3HRS A;  3PMT A;  3OBY A;  2WSC E;  1M9S A;  2W2H A;  1UFF A;  5GAO p;  2BKD N;  5IXB A;  3NTK A;  1VQP Q;  2ROL A;  3EGX B;  3C95 A;  1FMK A;  1Q81 U;  2P4T A;  4EC8 B;  3A98 A;  4E7S A;  4FSX A;  3VS4 A;  2JMC A;  1KHC A;  1H1R B;  3CCJ Q;  4M75 A;  3S3O A;  1UB4 A;  4C92 C;  1E6G A;  4AI6 A;  3GLX A;  2FVU A;  4F14 A;  2L5Q A;  3OYA A;  4OML A;  4ZGJ B;  1HXD A;  3QDR B;  3OYH A;  4BUG A;  4PFP A;  1VQ8 T;  4A4E A;  2KMG A;  2IG0 A;  1RAC B;  3P8D A;  1Q81 C;  5FWC A;  3FLG A;  4O5V A;  5CR2 A;  4HNV A;  3SFM A;  5CKD A;  3ZEH A;  4D8D A;  1G3Y A;  2DAQ A;  5KCH A;  3G71 Q;  2XMF A;  5IHK A;  3VUZ A;  3AHU A;  2KY9 A;  2CP3 A;  1TFB A;  3P8H A;  2CKK A;  3V7C A;  1A0N B;  4C8Q A;  1K73 U;  3H9N A;  1W2B S;  1JJ2 P;  3VJP A;  2ZPF B;  3TW6 A;  3ME9 A;  3CCL A;  1I81 A;  4V2S A;  5GAO m;  1ARK A;  4LD6 A;  4CFU D;  4FX3 B;  4C92 B;  5FU7 B;  5IHI A;  4EOL B;  2EGA A;  5FWB A;  3QWL A;  3CCQ Q;  1OL1 B;  1K73 C;  5C0M A;  3SB2 A;  1KK7 A;  1MMG A;  5LJ3 h;  2ZPH B;  1PD1 A;  2RQU A;  3A8G B;  2O31 A;  1OL2 B;  1GFC A;  4E47 A;  5I2S A;  5HBE B;  1R77 A;  1SF9 A;  1K9A A;  3V8L A;  3MEU A;  1VQ9 T;  1N8R R;  2XIC A;  4XU2 A;  4CFU B;  1RI9 A;  3GBQ A;  4F7U B;  1V76 A;  1TWB A;  4CC4 B;  3V8K A;  1JST B;  2A0F B;  2HEQ A;  4IUR A;  1VQP A;  2W9Z A;  1PD0 A;  2K3Y A;  4M78 E;  3M0T A;  5HK3 A;  4Z8A A;  3ULR B;  1QVG P;  2RQR A;  3FDR A;  1VQ8 Q;  1WZO A;  3LGL A;  4NL3 A;  1JU5 C;  4YOS A;  1X69 A;  3OS0 A;  1G3S A;  2DRK A;  1H4L D;  4PL6 A;  2DXU A;  5IN1 A;  3LYI A;  4IUP A;  3POM A;  3EGX A;  3MY1 B;  2EYQ A;  1IGQ A;  2VYT A;  5DQW A;  4BCI B;  1C6V X;  2ZAE A;  3MO8 A;  4PJM A;  2DME A;  2E12 A;  4ZN1 A;  3HBL A;  2E5K A;  3C4S A;  1RUW A;  2CDT A;  3SD4 A;  2C5O B;  2VGM A;  2ZZD B;  1EX4 A;  4IMY B;  1OI1 A;  4G6L B;  2KXC A;  2FG0 A;  2RQT A;  3OYI A;  2DL8 A;  1H25 B;  2K2V A;  4M7D C;  2EYY A;  2RHZ A;  1C1A A;  4N4I A;  1AHJ B;  2VWF A;  4OGC A;  2DYI A;  2NUZ A;  3H4C A;  4PJO D;  4A53 A;  4YOO A;  4M75 E;  1H24 B;  4YTL A;  5FRO A;  1OX9 A;  1RAE B;  4HNT A;  4KH1 B;  2LC4 A;  1FKM A;  3NGP A;  4M7A C;  1B34 B;  4AMC A;  5GAN 4;  2CT3 A;  2M0Y A;  1VQ9 Q;  1K9M U;  2JS2 A;  1H92 A;  4FYW B;  4PNO A;  1K73 R;  2WIH B;  4C92 A;  4BCN B;  5GAN j;  2DJZ A;  4CI0 C;  2D0N A; 
#chains in the Genus database with same CATH homology
 3OYF A;  3OS5 A;  1M1G A;  2EQU A;  3KUF A;  1XOV A;  1M90 U;  3HL8 A;  2QFZ A;  4II1 A;  2K5L A;  1BI1 A;  5IT9 E;  2FB7 A;  5LJ3 d;  3CBM A;  3MEW A;  2RI5 A;  4C8Q E;  1Q86 U;  3X28 B;  3HZJ A;  1XTD A;  2A7Y A;  2RB6 A;  3S6W A;  4M7A E;  1BIA A;  2XID A;  2GCX A;  1BI3 A;  2E1H A;  5DY9 A;  5GMK l;  2GF7 A;  3CCE T;  1K9M C;  2V8K A;  3O8V A;  4ATO A;  2BUD A;  3VYG A;  2DKG A;  1VQP T;  5A0D A;  3DL1 A;  2NLU A;  2LQK A;  1VQ4 A;  3BDL A;  2WAC A;  4M78 D;  2QDY B;  2JOY A;  1E7P A;  3OY9 A;  4MIM A;  3CXC A;  1YJW T;  1M90 C;  3CMA A;  2Y4Y A;  1YIJ A;  4XTX A;  3RUX A;  1UEB A;  4M7A B;  1K8A C;  1KC8 C;  4MFD A;  1G5V A;  4ZN3 A;  3CCS T;  1VQM T;  1NJI U;  2EAY A;  4BDY A;  2WSF E;  5GAN h;  3OYC A;  2VXF A;  4NS5 A;  3SWN C;  5FRM A;  1Q86 C;  3BFM A;  4RKU E;  3L2U A;  2HQE A;  2DVE A;  3E9F A;  5KH6 A;  3QZ9 B;  1X75 C;  4F7U A;  3X26 B;  1G3W A;  2DPP B;  4KT0 E;  4OB0 B;  1HK9 A;  5D6X A;  4EMK A;  3CC4 T;  4IUT A;  4J6Y A;  3J7A F;  1Y71 A;  3G6E A;  2QA4 A;  5GMK j;  2PVD B;  4M77 A;  3VKH A;  3ER0 A;  2LCL A;  2DD4 A;  2RI2 A;  5GAN e;  4DQ2 A;  5KCO A;  2CZ1 B;  2VC8 A;  3QO3 A;  2QXF A;  2P0K A;  2CS7 A;  4VUB A;  2OTL T;  3X24 B;  4WF2 A;  5FU6 C;  1I5L A;  1O9S A;  1WGS A;  1ZQ1 A;  3GNG A;  1NJI C;  4M78 A;  1WJR A;  2GFU A;  4FT4 A;  3VV0 A;  2RHY A;  4N4H A;  2WSE E;  4OF1 A;  5GAO q;  1Q7Y U;  4Z02 A;  2G77 A;  1YI2 T;  3QYE A;  2H3J A;  2EJ9 A;  4P5N A;  4C92 F;  2DD5 A;  2D9T A;  3CCJ A;  2QF7 A;  2FYK A;  2LCC A;  4TVR A;  3RER A;  3HRU A;  3E1S A;  2V8J A;  4OVA A;  4C92 G;  3LH0 A;  2M16 A;  3N5B B;  4PJO F;  3WXM B;  4KUI A;  5GAN 5;  5GMK m;  2IVW A;  3PMI A;  3HPW A;  5GAN 7;  3I56 T;  3G4S T;  3RMQ A;  1YHQ T;  1FXX A;  2DO3 A;  2K4Y A;  4L59 A;  3TRE A;  3PIP A;  2DIQ A;  4PJO G;  3CPF A;  3KHI A;  1PSF A;  3MP8 A;  2QQS A;  5LJ5 f;  3SWN B;  3M56 A;  3OYG A;  3HHT B;  2DTI A;  4IUU A;  3JCM h;  4LDV A;  3A8H B;  1U1T A;  3V8J A;  2PUK B;  4OMF B;  5M9O A;  5GMK h;  1FX7 A;  3J81 E;  5J26 A;  2KAF A;  3M53 A;  2MWO A;  3OYJ A;  3BG9 A;  2ZPG B;  4Z6Y A;  2B8A A;  2ZZD A;  2Y90 A;  4BI4 A;  3CCV A;  4M75 C;  5D6Y A;  4BY6 C;  2YHT A;  1VUB A;  2F69 A;  2PUO B;  2YLB A;  1Q7Y C;  1H3Z A;  1EIF A;  1LOJ A;  3G71 A;  4O6J A;  2ZGW A;  4A4H A;  4ZTF A;  1DJ7 B;  2E70 A;  2MWP A;  3MCA B;  3JAM E;  3FIF A;  3VKG A;  2DEQ A;  2EIF A;  2HBP A;  3L42 A;  4XQ3 A;  3JCM c;  4BB7 A;  5I21 A;  2KR6 A;  3A8L B;  2VGN A;  1ZHI A;  4OB1 B;  1M5Q 1;  4HKE A;  4N0A A;  2HD0 A;  5FU6 B;  1U8R A;  4JRP A;  3UPU A;  1VQL T;  4A4F A;  3JRZ A;  3JB9 I;  4PLL A;  3CCR A;  2DTO A;  4HT9 A;  4LDU A;  4F7U F;  3WVE B;  1VQ7 T;  4M7D D;  3PNW C;  4XAX B;  3PT9 A;  2CGH A;  2M9U A;  2MAM A;  2PVG B;  3QG1 A;  2JTF A;  2M0O A;  4XU3 A;  3SDZ A;  4Y91 A;  1P92 A;  4J6W A;  4F7U G;  1YJ9 A;  1LNX A;  1YIT A;  3CC7 T;  3CME A;  2X4X A;  3NTH A;  2LTO A;  1B34 A;  2EQK A;  3J80 E;  4HCZ A;  2CZ0 B;  4MDX A;  2KVQ G;  4C8Q D;  1QVF S;  5GAM d;  3S3N A;  5LJ5 h;  3CCQ A;  1W2B A;  1RI0 A;  1YBY A;  4BE0 A;  3BW1 A;  2XG8 D;  4RMO A;  4M78 F;  4Q5W A;  3DLL A;  1JJ2 A;  2DZ9 A;  3TU4 K;  4M7A D;  3RKX A;  3FC3 A;  4FM4 B;  2HQX A;  3HFN A;  2X35 A;  5FU7 C;  5GAN f;  3OW2 A;  4HCC A;  4BBR M;  2V8I A;  2M1H A;  4M75 B;  4M78 G;  4BY6 B;  4JRQ A;  3QBY A;  3DB3 A;  1VQ4 T;  2QQ8 A;  3CD6 A;  3OSS C;  3P8B B;  3CMA T;  1YIJ T;  2DIG A;  1VQ5 A;  3X25 B;  3EFS A;  1N9R A;  2RHX A;  3CPW S;  1WJS A;  3URG A;  1NE8 A;  5CO7 A;  1S72 A;  2VUB A;  3CC7 A;  2RJF A;  4QQG A;  2BS4 A;  4HNU A;  4J5Y A;  1KHI A;  4PJO A;  1D3B B;  2EJG A;  3JCM J;  1UGR B;  2I2L A;  2D6F A;  4KBM B;  4B9W A;  2MI6 A;  4M7D B;  2O4X B;  2CZ7 B;  1KQS S;  1YJN T;  4ELZ C;  2DXC B;  4QVD A;  3G6E T;  4FIB A;  2QA4 T;  2LDM A;  3UT1 A;  2G3R A;  3H8Z A;  4XTU A;  4BE2 A;  3TCJ A;  5GAN d;  5GAN 3;  3JB9 J;  1GXI E;  4LOC A;  3HB9 A;  4E7J A;  4M7A A;  4HA8 A;  4XTV A;  4C8Q B;  4JJN K;  4BBS M;  3WVD B;  1I8F A;  4BDZ A;  2CZ6 B;  3FB9 A;  4J7I A;  1VQ8 A;  4OGE A;  3L2V A;  3RKW A;  1OYX A;  3GF5 A;  4C0Z A;  3OYE A;  2XU8 A;  3QYH B;  3HFO A;  4L6V 5;  4PKC C;  1Y96 B;  4MDW A;  5GAN 8;  2QEX A;  2L89 A;  4BAC A;  5GAO r;  5CVI A;  1KD1 U;  2XKO C;  4LDY A;  3M4G A;  3CCJ T;  1W4S A;  1WJQ A;  3JCM f;  2RH2 A;  2RK2 A;  4M77 C;  3OS2 A;  3KBG A;  2R58 A;  1QP3 A;  1O75 A;  4X9C A;  3VKI A;  5GAN 2;  5CKE A;  3UWN A;  2GFA A;  2RHU A;  4NC6 A;  3M58 A;  4Y28 E;  3JCM P;  4JX5 A;  4FU6 A;  3M57 A;  3OYB A;  4BE1 A;  2RI3 A;  1YJN A;  2FHD A;  1U1S A;  5CIU A;  1QVG A;  3V7S A;  4FT2 A;  3C12 A;  3CBP A;  3BDU A;  2DZC A;  3H6Z A;  1XQH A;  4HCB A;  1MHN A;  3ZFJ A;  3V7R A;  3CCV T;  3QJY A;  5KE3 A;  4F7U E;  3QXE B;  1BIB A;  5DLO A;  2L3R A;  3L2Q A;  3G71 T;  1KD1 C;  5CK9 A;  5LJ3 e;  5HKC A;  3E19 A;  2R5M A;  3RES A;  1QVP A;  2DK3 A;  3CXC S;  5GAM g;  2JZ2 A;  4MMK A;  3RIR A;  1VQK A;  1KQ2 A;  3OSV A;  3JCM Q;  3E9G A;  4M77 E;  3CCU A;  4E7H A;  3JCM d;  3FEO A;  2MF2 A;  2K3X A;  4EMG A;  4M7D F;  2D0Q B;  4A54 A;  5A2Q E;  2Y4X A;  4JX4 A;  3SWN A;  3CCM A;  3LX7 A;  2PQW A;  2KDS A;  2KQW A;  3MET A;  2F5K A;  5J39 A;  3CCR T;  4M7D G;  3M5A A;  2QTX A;  3M55 A;  2ZPB B;  4B9X A;  4DOW A;  1X6O A;  2A3L A;  4C0D C;  1YJ9 T;  1YIT T;  1SSF A;  5CQX A;  2BS3 A;  3CME T;  4C8Q F;  2VV5 A;  2MMP A;  2XD0 A;  1WQ7 A;  3VU3 C;  2XDD A;  4E7I A;  2EFI A;  1VQO A;  4MZM A;  1BI2 A;  5CKF A;  2RA2 A;  4ZGE B;  2VXE A;  4C8Q G;  3VYH B;  1BI0 A;  1UGQ B;  5LJ3 g;  2EKO A;  4M7A F;  1IZ6 A;  4M75 D;  1QW1 A;  2QQ9 A;  4DA4 A;  4CRI A;  3L2R A;  3CCQ T;  2ZPI B;  4D6W A;  4RCC A;  4ELY C;  3CEY A;  1YCY A;  4M7A G;  1RL2 A;  1VIE A;  4AKI A;  1Y07 A;  2JTM A;  3NFC A;  4J7F A;  4PLI A;  4QQ6 A;  1PSE A;  4MML A;  1NPR A;  5EJC A;  4QVC A;  1VQ9 A;  3GP8 A;  1BYM A;  5DLQ E;  2XK0 A;  5I2M A;  3BY7 A;  3HRS A;  3PMT A;  1I4K 1;  3CD6 T;  3OBY A;  3JCM X;  2WSC E;  1M9S A;  2E65 A;  1VQ5 T;  3R6O A;  3INZ A;  3OBW A;  5GAO p;  2BKD N;  3RKY A;  3NTK A;  5LJ5 d;  2LRQ A;  5GAO l;  1S72 T;  1XNI A;  3I55 A;  3X20 B;  4BD3 A;  1M1K U;  3C95 A;  3OYM A;  1WPY A;  3QII A;  1KQ1 A;  1UGS B;  1N6A A;  2P4T A;  3HP9 A;  3MEA A;  3GOX A;  1Q81 U;  4M7D A;  2JUF A;  5GAO n;  4FSX A;  1N27 A;  1KHC A;  1IRE B;  5CQY A;  4M75 A;  3S3O A;  1UB4 A;  5A0L A;  2R57 A;  3EAE A;  4OP0 A;  5GAM j;  4E7L A;  4J83 A;  4C92 C;  2PU9 B;  4L5G A;  4AI6 A;  3GLX A;  2EWN A;  2FVU A;  3MP6 A;  3UDC A;  3GIB A;  3CPW A;  2LQ8 A;  2L5Q A;  3DB4 A;  2HNI A;  2QQR A;  4QW2 A;  2DXB B;  3OYA A;  4PJO C;  1VQ8 T;  4ZGJ B;  1HXD A;  3QDR B;  3OYH A;  4BUG A;  1NZ9 A;  5HK0 A;  4A4E A;  4DOV A;  2KMG A;  2IG0 A;  2P0Q A;  1D3B A;  1KG1 A;  3JSC A;  2QEX T;  1M1K C;  1WQW A;  3P8D A;  3FJP A;  3OYN A;  1Q81 C;  2O4X A;  3CBO A;  4EMH A;  2E6Z A;  2C06 A;  1KQS A;  4JRI A;  3FLG A;  4IKF A;  4O5V A;  5CR2 A;  4HNV A;  2DXC A;  3SFM A;  5CKD A;  3MEV A;  3ZEH A;  3M59 A;  1G3Y A;  2DAQ A;  3A5Z B;  2QQB A;  3JCM g;  5KCH A;  4N4G A;  3VUZ A;  3AHU A;  5J3B A;  5LJ3 j;  2KY9 A;  2JVV A;  3JB9 D;  3P8H A;  2CKK A;  3V7C A;  4C8Q A;  4X9D A;  1K73 U;  1W2B S;  4MZP A;  2KSS A;  4C92 E;  4A4G A;  2K57 A;  1Q82 U;  4XU1 A;  3FRN A;  3VJP A;  2ZPF B;  5KE2 A;  3TW6 A;  3GPL A;  2ZPE B;  4JS4 A;  1JJ2 S;  1VQ6 A;  1Y96 A;  3ASK A;  2GQV A;  3OW2 S;  3TEE A;  4PJO E;  1QP2 A;  2RD1 A;  3ME9 A;  5AYF A;  4JLG A;  1I81 A;  3CCL A;  2P0P A;  3PFS A;  4UC4 A;  2RJD A;  5GAO m;  4LD6 A;  4V2S A;  1K8A U;  4EMK C;  4EPC A;  2X4Y A;  1KC8 U;  3QJ6 A;  2EQJ A;  2EQM A;  4ZGD B;  2K5F A;  4C92 B;  3C94 A;  1VQK T;  4M6V A;  5FU7 B;  2E64 A;  3JB9 H;  3CCU T;  4MFE A;  4ME7 A;  4C5E A;  5GAM e;  3LW5 E;  1TH7 A;  2LX9 A;  3KXT A;  4M77 D;  3QWL A;  2XI9 A;  3CCM T;  2QDJ A;  1K73 C;  1M8V A;  3G7Z A;  5C0M A;  3SB2 A;  4BI3 A;  3M54 A;  1G3T A;  4GLK A;  1Q82 C;  2QQA A;  5LJ3 h;  3T9N A;  3QUI A;  3OA6 A;  2ZPH B;  5A0G A;  3PTA A;  2FL7 A;  2YLC A;  4X34 A;  4M78 C;  5EG2 A;  3LWH A;  3A8G B;  1LJO A;  5LJ5 g;  4J6X A;  4M75 F;  5HY6 A;  1V29 B;  4CI0 C;  4RG8 A;  2LT1 A;  3CC2 A;  3LLR A;  3OYY A;  4KUL A;  1H64 1;  1VQO T;  3VYG B;  4JDS A;  5IAY A;  5FLX E;  4E47 A;  2RHI A;  3DKM A;  4M75 G;  5I2S A;  4XK8 E;  4R56 A;  3LGF A;  2X4J A;  2XHC A;  3RMS A;  4A4K A;  1X01 A;  1JRI A;  4BI8 B;  1N8R U;  3GNF B;  4ELJ A;  3V8L A;  3S3M A;  4PJO B;  4C5I A;  4C0G A;  3PIO A;  3MEU A;  4AKH A;  4OB3 B;  1VQ9 T;  2L8D A;  2XIC A;  4XU2 A;  4F7U B;  4XTZ A;  2OTJ T;  4EMK B;  2XDP A;  3CCE A;  3OMG A;  2BIV A;  4QVZ A;  4C5H A;  2WJ9 A;  5CCA A;  3V8K A;  3QZ5 B;  1WNL A;  2K5I A;  4IUR A;  4JS5 A;  5D6W A;  4M78 E;  1FWZ A;  2K3Y A;  5HK3 A;  1VQP A;  2DXT A;  3L1A A;  3I55 T;  4XU0 A;  4M77 B;  1QVG S;  3FDR A;  2DD4 B;  1VQN T;  1YJW A;  1MGQ A;  3LWI A;  3QKJ A;  3OQ5 A;  4IUQ A;  1BKB A;  3A8M B;  4N0A C;  3LGL A;  5L8R E;  3ZBD A;  3CCS A;  4NL3 A;  1VQM A;  1N8R C;  1R8O B;  2R5A A;  3VUB A;  3A8O B;  2OTL A;  3QYB A;  4NL2 A;  1G3S A;  2O01 E;  3OS0 A;  4PL6 A;  5LL6 S;  4M78 B;  2HAX A;  2DXU A;  2X4W A;  3QHS A;  4RCB A;  2PVO B;  5IN1 A;  3JCM W;  1Y7X A;  3QYG B;  3CC4 A;  4C5G A;  3LYI A;  1VIF A;  3BG3 A;  4QSH A;  2RK1 A;  4AKG A;  2DD5 B;  2YRV A;  4IUP A;  4JUV A;  2OAU A;  3M9Q A;  5GAN g;  3MHX A;  2JNG A;  4GY5 A;  5GMK i;  4JX6 A;  2E5Q A;  2EYQ A;  4HLQ A;  2OTJ A;  1OZ3 A;  2LNV A;  2VYT A;  4IUV A;  4E7K A;  3OB9 A;  2QI2 A;  3MO8 A;  1OZ2 A;  3M4Y A;  4EDU A;  4LD9 K;  1JB0 E;  2LVM A;  4ZTJ A;  1QVF A;  3JB9 F;  2E12 A;  5LJ5 j;  4ZN1 A;  3HBL A;  3C4S A;  3NTI A;  5GAM f;  1VQN A;  2E6N A;  1JBM A;  3HO8 A;  3SD4 A;  2VGM A;  4FL6 A;  3JB9 G;  2ZZD B;  3OYL A;  4XTW A;  3JCM b;  3JCM e;  2DTH A;  5GMK e;  1YI2 A;  1OI1 A;  4C0D B;  1UGP B;  3OYI A;  2DXB A;  3OS1 A;  4HL4 A;  4R55 A;  3JCM V;  5CAI A;  2K2V A;  4MZT A;  4C92 D;  3I56 A;  3G4S A;  1VQ6 T;  2RHZ A;  3L2Z A;  4M7D C;  4N4I A;  3DLM A;  1YHQ A;  1M1F A;  1AHJ B;  4OGC A;  3TW7 A;  3CCL T;  3QPH A;  2RO0 A;  3H4C A;  2KMT A;  2F5T X;  5CKH A;  5FRN A;  3HSB A;  4PJO D;  2RJE A;  3L2W A;  4M77 F;  2EJF A;  4A53 A;  3OYD A;  4RG2 A;  1M4Z A;  3PGG A;  4LDW A;  3EFR A;  2BS2 A;  4M75 E;  5LJ3 f;  3HRT A;  3Q1J A;  4YTL A;  5FRO A;  4OB2 B;  4C0F A;  4C8Q C;  4HNT A;  3OMC A;  2RJC A;  4M77 G;  1ZBX A;  2LC4 A;  2LT4 A;  4J8O A;  1NPP A;  3QSU A;  1FKM A;  5GAN 6;  2KK4 A;  4KUD K;  3MP1 A;  2AHJ B;  1B34 B;  3BG5 A;  4JRK A;  4M7A C;  2ZCF B;  5GAN 4;  4XTY A;  4HT8 A;  4LDX A;  1VQL A;  1K9M U;  2E10 A;  2JN0 A;  5DM7 R;  1N9S A;  4M7D E;  3OYK A;  5GAM h;  3CC2 T;  2E41 A;  4JLI A;  3F70 A;  1QLB A;  4NOY A;  4PNO A;  4QQD A;  1VQ7 A;  2XDB A;  5LJ5 e;  4C92 A;  2CYZ B;  5GAN j;  5C6S A;  2DJZ A;  3HKS A;  2RM4 A;  5CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...