3A8MB

Crystal structure of nitrile hydratase mutant y72f complexed with trimethylacetonitrile
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPFYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 57
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8mB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8mB02
3QZ9B 3VYGA 5L8RE 3VYGB 2D0QB 4ZGEB 2ZZDB 4OB2B 3QYGB 2CZ0B 2CZ7B 1QP3A 2PUKB 2DD4A 2DD4B 2QDYB 2WSCE 4FM4B 3QZ5B 2ZPEB 3HHTB 1PSEA 2DXBA 1AHJB 1UGPB 3A8OB 4OB3B 2DXBB 2ZZDA 2O01E 2ZPBB 4RKUE 1UGQB 2PVDB 2PVGB 3WVEB 2PU9B 4ZGDB 4XK8E 1QP2A 4OB0B 2WSFE 3X28B 3X25B 2DD5A 2DD5B 2CZ1B 1UGSB 3X24B 3A8MB 2PUOB 4L6V5 3QYHB 1JB0E 2ZPIB 3WVDB 2DXCB 1DJ7B 2ZCFB 3QXEB 4ZGJB 2CYZB 1GXIE 4OB1B 2ZPHB 4Y28E 1PSFA 2AHJB 3LW5E 3A8HB 2CZ6B 2DPPB 3A8LB 3X26B 2ZPGB 3A8GB 4KT0E 1V29B 3X20B 2DXCA 3VYHB 2ZPFB 2PVOB 2WSEE 1IREB 1UGRB
chains in the Genus database with same CATH superfamily
2GCXA 4Z89A 4B9XA 3OYIA 3ZBDA 1WGSA 2RH2A 4RUGA 1XO2A 1VQOA 1Q95G 2RB6A 3VYGA 3MO8A 2I0NA 4CFXB 1D3BB 3H41A 1MGQA 1N27A 3AHUA 2FL7A 1JXOA 2MK5A 4MIMA 4BCHB 3CC4Q 1NZ9A 3QJ6A 1N9RA 1AWWA 3VS1A 3PVLA 3JB9F 3QHRB 1GCQA 1H4LD 2DYBA 3SDZA 3EG9B 1VQPQ 1QQJA 3VS6A 4ZN3A 4HA8A 1AOJA 3CCVQ 4M7DC 3P8DA 3EGUA 8AT1B 1W98B 2O01E 2OTJQ 1OULA 1WI7A 4CC4B 1Q7YC 4C92F 1W2BP 1QLYA 2UZEB 1JXMA 2IIMA 1BKBA 1ABQA 2Y4YA 3OS1A 3I5SA 1QP2A 2P84A 2A3LA 2GTJA 4YOSA 2HL5C 4HNVA 4BBSM 2LZ6B 3CCRT 2KBTA 4C8QF 4R0KA 2LCSA 3VKHA 3OYGA 1NEBA 3BLQB 4EMKB 1IHVA 4J9BA 2O9VA 2QTXA 3CD6A 3A5ZB 3QDFA 1JB0E 4C92B 1T3LA 3NFCA 3G4SA 5IH2A 4WCIA 4LOCA 2YUNA 3MJXA 2JTEA 4KULA 1M3BA 1WXBA 2WHBB 5FU7B 2LW4A 3M54A 1WLPB 3M5AA 2CZ6B 3A8LB 4PJOD 4CC2A 2LCLA 1I07A 2A36A 2VXEA 4BY6C 2DEUA 3JCMg 4FL6A 3CCQA 4TTHA 4M78D 2DA9A 5FLXE 5GAOn 4EOIB 5LJ5d 3CCEA 3CPFA 4ROEA 4F7UF 1N5ZA 4HLQA 1U8RA 2JOYA 5CVIA 2CSQA 4EORB 3SFMA 2ROTA 4CI0C 4Z88A 3CCLT 1PHTA 4M7AA 4DBHA 4ELYC 2JVVA 1NE8A 1SHGA 2WFYB 1D0YA 1HJDA 1FYNA 2O4XA 3MEWA 1GBQA 3C12A 2M1HA 4ATOA 2RQUA 1YIJT 2UZDB 1X2KA 1E7PA 2LJ1A 3BE3A 4R55A 2WSCE 4F7SB 3THKA 3QZ5B 1XNIA 2J6FA 4MFEA 4M75D 4F7UB 4CFNB 1M2OA 4Y92A 4QVCA 2G3RA 1B3QA 3MHXA 2K79A 1E6HA 3MEVA 1JJ2A 5HBJB 2KQWA 2QASA 5CKEA 2ED0A 4J9FA 3TW7A 3EFSA 2CS7A 1HYOA 2QDLA 2DO3A 3H0FA 3LQ5B 2RA2A 3OS0A 3FIFA 2XG8D 2DTOA 1EX4A 4PFPA 4RCBA 1X6BA 1YFNA 2F5TX 1LNXA 2WJ9A 5KH6A 4X34A 2QI2A 3TNIB 2DNUA 1QCOA 5KYUA 5KYXA 5J26A 1OIUB 4EOQB 2KAFA 3QYHB 1S1NA 2DERA 1X01A 3J81E 1RAAB 2G6FX 5CEIB 4R56A 3TVTA 2YWWA 2O2OA 4C5HA 4J6WA 1NPRA 3LH5A 2C4GB 3DJBA 4DEXA 3OSVA 1U5SA 2LX9A 3CBOA 2WEVB 5GAN4 1QVFS 3CCRA 4BCFB 1M2VB 2NUPA 4M7DA 3MY1B 2CUBA 1G83A 1H3ZA 5GMKm 3CCUT 5GANg 3VS7A 4DQ2A 3VYHB 3HRSA 1OQKA 1ABOA 1UNHD 1MHNA 3DKMA 1C9BA 5GAMg 3GOXA 2B8AA 2KK4A 2HBPA 2IG0A 4KRTA 3K7AM 4AKIA 1BK2A 1YWPA 4BCQD 3JCMh 1WNLA 4C5EA 1C1AA 4JRIA 2L3RA 1GFDA 2J05A 3ZEHA 2E5KA 4XTXA 1YIJQ 1RAIB 1UE9A 5KE2A 1ZBJA 4M78C 1K4US 3CMEA 1UNLD 4RTVA 4NS5A 3G6ET 2XK0A 4RTUA 1VQLT 3HPWA 1G3YA 3FDRA 3M0SA 2RHUA 2FG0A 1VINA 3O5ZA 3MEAA 3RKYA 3A1PA 1NJIC 2K3XA 3E9FA 5DLOA 3RR6A 1PD0A 4IUTA 4ZGDB 5EG2A 2CGHA 2K3BA 4PJOE 5ICPB 2WXVB 4JZ3A 1VQ4Q 1CKAA 1SRMA 2LMJA 3SEMA 5CR2A 3CCLA 2P0QA 2Y90A 1M1FA 5LJ3j 2O31A 1ZA1B 1H8KA 3MP1A 5GAOr 1BI0A 2LVMA 2XKOC 2EFIA 3CEYA 1FWZA 2GNCA 3M57A 1ZSZB 4AKGA 2YRDA 5LJ3h 2XDDA 1JRIA 4M75C 3VS5A 3A8MB 5GMKj 2C5NB 3RIRA 1YJ9A 3QDRB 3P8BB 4L59A 5HK0A 2EYZA 2ZPIB 1I5LA 4BXXX 2YUQA 3M4YA 5GMKh 3WXMB 3M0TA 3ULRB 4N0AC 2ZPHB 1M90C 4GBQA 2QAZA 4J9GA 1OL2B 1OOTA 2M02A 2DL3A 2OX7A 5D7UA 3BG5A 3NGPA 1H1QB 3INZA 1IB8A 4PJMA 3QSUA 2QA4A 2HSEB 4KRDB 5AYFA 1K0SA 3CCUQ 2RHYA 2KVQG 2CP2A 3M55A 5GAN5 3CXCA 2PMIB 1OU8A 1B34B 3HFNA 3TREA 4ROCA 5GANj 1M3CA 1ENWA 2BPMB 1WHKA 3G71T 1UG1A 2QG9B 1SPKA 2D1XA 5GANh 1UHCA 1VYVA 4BACA 4LD9K 1KD1C 5I5ZB 2SRCA 4KH1B 1QVGA 1BIBA 3DOGB 2FVUA 2VC8A 5GAMh 2RO0A 1TUCA 3JCMW 5KE3A 1JQQA 3GBQA 4QVDA 4NSTB 2PZ1A 2NYSA 3SWNB 2BS4A 4QVZA 4UC4A 2QDYB 3HSBA 1TUGB 2EGEA 1V1CA 2JM9A 1VQLQ 1PSEA 1Q81U 2NUTA 1M4ZA 1UGPB 2J6KA 3JCMV 1JEGA 8ATCB 2DAQA 2LP5A 4BI8B 3OYNA 2PQWA 2X4WA 3EGDA 1VUBA 2MWOA 2KGTA 1OX9A 3VUZA 4MMKA 4A4HA 4XU3A 3CCSA 2FZKB 1D0ZA 1M1GA 3OYAA 4JPBW 4M7AD 1UJYA 3X24B 2GFUA 2RHIA 5A0LA 1KK7A 2RQTA 3G6EA 3JCMX 3RUXA 3I56A 1YHQT 1VYTA 1DJ7B 3LLRA 3I55T 2HAXA 4OB1B 3L1AA 2RI2A 4XTYA 2DJZA 4PJNA 1U1SA 1P5EB 1YNZA 3NTKA 2O9SA 3O8VA 4BY1X 5LJ5g 3DTOA 1CKBA 2K3YA 2VKNA 4O6JA 1FINB 1H26B 1Q86C 2QEXQ 3OMGA 2DMOA 3A98A 1AVZC 2K5LA 3D7SB 2KMTA 2DLPA 4ZNXA 4RTTA 4II5B 1W2BS 3NMZC 2PJQA 2X4XA 2VGMA 4PKCC 1VQ5A 1TFBA 3QKJA 1RABB 2GBQA 4PLLA 1X43A 1YJNQ 4LDXA 5CK9A 1M8VA 1S72T 4J7IA 4KGVB 1LPLA 4PJOG 2KEAA 4FYVB 3ASKA 1GL5A 1BIAA 1G3WA 1H1SB 3CCMA 3CPWA 3JCMf 2A0FB 3CMAT 4M7DD 1H1PB 4HVUA 2RN8A 2QTVA 1Q81R 2FPFA 3I35A 2XU8A 3G71A 4X1VA 2M0YA 3JCMb 4M77B 1A0NB 2FZGB 2JXBA 4RODA 1X6OA 1JSTB 3RMQA 2WSFE 3O0GD 2D6FA 3CC7T 1ZA2B 2YSQA 5LQFB 2OTLA 4CFVB 3C94A 1Q82U 5I21A 1UGSB 4XTWA 5KYWA 3RNJA 2DF6A 2L3SA 3TN8B 1B07A 1JBMA 1YCYA 3OYMA 1AWOA 3V7CA 2BZXA 2H3EB 2D8HA 1YHQQ 3I55Q 1SRLA 1OV3A 5FU6C 1HXDA 2E10A 4D8DA 3GIBA 1MMNA 1IO6A 1VIFA 1GFCA 1D0XA 3NTHA 3TEEA 1UNGD 3FC3A 2HSPA 3S6WA 4A63B 2FRWA 5GAN7 1F1BB 4M7AC 1M2VA 2LX7A 6AT1B 4BCOB 4J83A 2KT1A 4DEYA 2E64A 5FW9A 4ZTJA 1D3UB 1WZOA 4J9HA 3EFRA 3X20B 1JKWA 1H27B 1NM7A 2PVOB 1NPPA 2QQRA 1KQSP 1WXUA 4QQDA 5J39A 2VUBA 1LCKA 1PRMC 4NL2A 3HP9A 1N8RU 5LJ5h 1VIEA 2P4RA 5CIUA 5L8RE 3QHWB 4JJNK 2HDAA 2JTMA 4OMFB 1VQKT 4J8OA 3QYEA 2R7GA 3JAME 2DIQA 5CAIA 2F2XA 5GAOp 1M1KC 3VRZA 1VQMT 2EAYA 4VUBA 1EIFA 1B7TA 1ZUUA 4OF1A 1JSUB 4EOPB 4E7IA 1OKVB 4Y72B 2M16A 1VQ9T 1JOWA 4EMHA 5CQXA 2YLCA 4BBRM 4FM4B 3CMAQ 1ACMB 5GJVB 4LN2A 1QVPA 1WQWA 5GAMf 4FX3B 2FPEA 4KRCB 1R0CB 2E1HA 2K57A 2C5OB 4FCYA 2DL4A 2PVDB 1KHIA 2DXTA 3WVEB 1UFFA 4J5YA 2P0PA 3G1JA 2DTHA 2BUDA 1OU9A 5I11A 3OY9A 2X1NB 2HMAA 2QQSA 4E2FB 3DDPB 1NEGA 3M0PA 4A4GA 1S72A 3CC7Q 1N9SA 2K9GA 2COWA 4F6UB 4IKFA 1M3AA 2KRMA 5GAOl 4YOZA 3J80E 4NOYA 3M4GA 1Q82R 1E6GA 4L6V5 5GAN8 2ABLA 3E9GA 3WVDB 4CXAB 5IXBA 2V26A 1ZSGA 5IT9E 4JZ4A 3L2QA 1XOVA 1GY3B 2ENMA 4MFDA 2EBPA 2CKKA 4EONB 1Y7XA 3JCMP 1H28B 3EGXB 1AT1B 4FT4A 3CC4A 4EOKB 2GFAA 2I40B 1TWBA 4AFQC 4EMGA 4F04B 1VQPA 4M7DE 3H9NA 4ANJA 4PJOF 4XU0A 2DJQA 2CJMB 1G2BA 1B34A 3CCVA 4F14A 4ELJA 4FSXA 2WSEE 1K76A 3HB9A 2OTJA 1O9KB 2OAUA 4PJLA 3HZJA 2B9RA 1RI9A 5KCHA 3PVQA 2QQ8A 4AKHA 3DLMA 1T0HA 1N8RR 2KR6A 1VQKQ 4C8QB 2BE7D 3CCEQ 4QSHA 2YUPA 1VQMQ 2FEIA 2LRQA 2IW9B 4TVRA 1YITT 1Z9ZA 2BIVA 4PJOB 4ELZC 2PUKB 3SWNA 1VQ9Q 1BI1A 2DD4B 3ER0A 4JX4A 1X75C 2L8DA 2PK9B 4LDVA 2Z0WA 2ZZDA 1FMVA 1PM3A 1G3SA 4BCMD 1UGQB 3OQ5A 4D8KA 5HY6A 3PO3S 5D6WA 3M58A 1VQNT 2JW4A 2OI3A 5HCKA 3TSWA 4JDSA 3HFOA 2A08A 1YI2T 2EKHA 2QQBA 2A7YA 4FSSA 2H8HA 3CBMA 1EZZB 1N6AA 2LT1A 3CCJT 2C0TA 3OYEA 1VQ6A 2K5FA 3TNWB 3OW2S 2L5QA 1H641 3EFOB 2R58A 3JB9J 1AEYA 2BZYA 2EGAA 4L5GA 4BD3A 3QXEB 1VQ4T 3GTMS 5FROA 3HRTA 2X3XD 4Y28E 4N4GA 5LJ3e 3H6ZA 4LE9A 2CSIA 4A54A 2M0OA 1H24B 1BI2A 3CQTA 1SSFA 2C5VB 2YUOA 1RADB 3M56A 2ZPGB 4KT0E 5GMKe 1FKMA 5CO7A 3TNHB 3REBB 1Y96B 1TXQA 4QQ6A 2O88A 1TG0A 4DOVA 2K6DA 1VQ8T 1K73U 4IMYB 3JSCA 5IF1B 4HXJA 4LDUA 4PJJA 1QCNA 3GNGA 4BE2A 2IVWA 5AT1B 3RBBB 4BCJB 1NYFA 3KFVA 4AI6A 2GF7A 1YITQ 2CZ7B 3FJ5A 5LJ5f 4BY7X 1WQ7A 2HD0A 3EHQA 1NYGA 5GANe 2IN3A 2RHZA 4EMKC 2EJ9A 1YJWT 4DOWA 1MV3A 5CYIB 2RI5A 3E2UA 2RMOA 1OKWB 3QHSA 1AHJB 5GJWB 3JB9H 1OPKA 2PK2A 4YTLA 4HVVA 1QVFA 4J7FA 2LQNA 4AMCA 4LD6A 2L3QA 4C92C 4OVAA 2BS2A 1KJWA 5CQYA 1VQNQ 2PVGB 1K1ZA 3FLGA 3MP6A 4JJDA 4M77A 4XK8E 2QGFB 5GAN3 1OYXA 1YI2Q 4HVWA 1K9MU 4OGRB 5FU7C 1VQ7Q 2C5XB 1ZX6A 1BBZA 3VUBA 3CCJQ 2YLBA 4CFUB 5ACBA 3B57A 4B6MA 3V7RA 4BUGA 5DM7R 4AFZC 1QMCA 2MCNA 4JJBA 4M7DG 2RI3A 1WJSA 2AKLA 1RUWA 3S3NA 2PNIA 2DEQA 2LQ8A 4HKEA 1CSKA 1M9SA 2K4YA 2DXCB 2ZCFB 2YDLA 3M03A 3L2WA 3VRYA 2KROA 4HL4A 1YCSB 2C0IA 4F7NB 2NLUA 4C0GA 4M78E 3M53A 3PE0A 4ZTFA 4J9CA 1YIJA 3VJPA 3X26B 1QW1A 4C5GA 4QT7A 1V76A 2YT6A 2W0ZA 3GPLA 2W96A 1UGVA 2MMPA 2E4HA 1IREB 4OMNA 3CC2T 1VQ8Q 2C06A 3EG1A 2XICA 4KUIA 4MMLA 2G9XB 2K2VA 4QQGA 1K8AC 1P92A 2JMCA 2V8JA 4BCGB 1QWEA 1K73R 4IUPA 3LGFA 2QGSA 4KGZB 5HNBB 2Y4XA 5CKFA 3LGLA 4OGCA 1VQ4A 1M27C 3RMSA 2DRMA 2KXDA 1KC8U 4M75E 1QCFA 1UDLA 2R57A 2QF7A 3OS5A 4CC3A 3H0HA 2EIFA 4GLMA 4WF2A 2QEXT 1LVKA 1PKSA 1ZHIA 2CDTA 2DILA 3UATA 1NLPC 1YJWQ 3GNFB 3OW2P 1JJ2P 4AG1C 2DMEA 1QKWA 2V8KA 3BHUB 1G5VA 2WACA 5GAMj 2DBKA 4E7SA 1WHJA 1WX6A 1D3BA 2ZPBB 1JU5C 3P8HA 4OMOA 1AZEA 1OGUB 1BU2A 1AWXA 1OX8A 1YJNT 2XDPA 2KRNA 3KHIA 2KT8A 3VKIA 2D9TA 2DX1A 4MZPA 3EG9A 3V8JA 4A4EA 3CCUA 2B86A 1K9MR 1RLQC 1BCMA 1D09B 4M7AF 1G8XA 4BI4A 5C0MA 3PMIA 3VS4A 1I81A 1KQSS 3DB4A 3RKWA 2KR3A 2EPDA 1NJIU 1VYWB 3RDVA 2DVJA 5GMKl 3URGA 3R6NA 5IHYA 2ESWA 5FRNA 1KQ1A 2RQWA 3HRUA 4FIBA 3LWIA 3EGXA 2EQIA 3G33B 4EMKA 4Z02A 4N4HA 4KBMB 2DL7A 2E6NA 1VA7A 2MOXA 2LNHB 1UEBA 2AZVA 2X3WD 3JCMc 3KBGA 2QFZA 3I9QA 1VQLA 4C92A 2ZPFB 3CC2Q 5J3BA 2DRKA 1I5OB 1MMGA 2CT3A 3QZ9B 2JUFA 1O9KA 3L2UA 1M90U 4IIMA 4C0DB 2XHCA 2AT1B 2HQHA 2JGZB 2W99A 2QDJA 3HO8A 4C8QA 4PL6A 2DXUA 4ZGEB 2VASA 3FEOA 1XQHA 4XU2A 5I22A 2JNGA 2CP0A 2M51A 1R8OB 2E6ZA 2GGRA 3TQ7P 2A28A 2AZSA 2VYTA 2E3HA 4AFSC 1M5Q1 4JX5A 4JLGA 4PFOA 3LWHA 2NUZA 1KC8R 4FW2A 2DD4A 1ZSZC 4J6XA 3JCMQ 3BFMA 4A4FA 3QUIA 1AD5A 4JJCA 4M7DF 1KD1U 3EOCB 1KSWA 2KSSA 2LNVA 4BI3A 1VOMA 4AFUC 2BE9B 1VQOT 4GLKA 5EC7A 1HK9A 1H1RB 2E3IA 2XIDA 1PRLC 2BKDN 2J6OA 1SF9A 3Q1JA 4RG2A 1IGQA 4YOOA 2NWMA 2KI7A 3X28B 1W2BA 1N8RC 1WIEA 3PFSA 3HKSA 2CZ1B 4M78G 4OMQA 3RESA 2QEXA 3DL1A 4Z6YA 1T3SA 3NHNA 4F7UA 3TU4K 1ZUKA 2NUPB 4F7JB 4M7DB 4KUDK 3EFOA 2L2PA 3M59A 1UHFA 1OI1A 1I4K1 2YRCA 1NJIR 4ME7A 3BW1A 5L23A 1ZBXA 3GF5A 4P5NA 1OEBA 4E7LA 2RQVA 3NPFA 2ROLA 4J9IA 4BCNB 3OYCA 1BI3A 4XTZA 1YJNA 1YN8A 2CH4A 2KYBA 4LDYA 1AISB 4RMOA 1TSFA 2DPPB 4FYYB 5D6XA 4M77D 4HCBA 4OMPA 1WHGA 2KXCA 3OYFA 2JTFA 4M75G 1Y96A 3SWNC 2V1QA 3V8KA 1TH7A 1QKXA 3UA7A 3BDLA 2IPOB 2EJFA 4WTOB 1TD6A 2EUFA 1SHFA 2ATCB 4J9EA 1RAHB 1W6XA 2F2VA 4AT1B 4BE0A 3CD6T 4HCCA 2D8JA 4PNOA 3C4SA 1M90R 4BE1A 4EOLB 3G4ST 1PG5B 3BG9A 3POMA 3BY7A 1BB9A 1Y57A 3HTRA 2MIOA 1Q86U 1YWOA 4HNTA 2CP7A 3EH2A 5LJ5j 4HT9A 1NBEB 1GCPA 1WXTA 4BY6B 3NTIA 1IHWA 3DLLA 1YHQA 4HT8A 3I55A 2DXBB 3MEUA 2QQ9A 1HD3A 4KH0B 3CCQT 3GLXA 3M9QA 1ZQ1A 4ELLA 3CCET 1KD1R 4M7AE 1VQOQ 3LYIA 4C5IA 2FHDA 1XJWB 5IHKA 2PU9B 1C6VX 2RHXA 3ZFJA 5FWCA 2LTOA 1PWTA 1KIKA 1MMDA 4EOJB 3MI9B 3S3MA 1M8MA 2DD5B 2GQIA 2L89A 3OYYA 4F16A 5DQVA 2DZ9A 3FJPA 3QG1A 4G6LB 2PUOB 4M6VA 1UB4A 2G77A 4PFZA 3EJ1B 2M9UA 3MKDA 2XI9A 2CYZB 4QW2A 3I5RA 4MZMA 3META 1PCXA 1XTDA 4DBFA 1ZSZA 2DZCA 4JUVA 4E7KA 1R0BG 2YXYA 2E41A 2RNAA 5L2WB 2EW3A 4EOMB 1J3TA 4Y91A 9ATCB 5IHNA 1F5QB 1V29B 3CMAA 1T0JA 3BHVB 3H4CA 1SEMA 2JM8A 1TS9A 3S3OA 2EQJA 1NG2A 4HCZA 4OMMA 4DBQA 4MDWA 2LJ0A 1AD6A 2RM4A 3CD6Q 3L2RA 2UZBB 4RTYA 4RG8A 2KDSA 4RTZA 3EH1A 4J9DA 3VS3A 3MY5B 5GAOq 3RERA 2NUTB 4EC9B 2J06A 3G4SQ 2DL8A 4CFMB 2FO0A 4JX6A 5DQWA 4AG2C 4M77C 3CPWP 4ZN1A 5GMKi 2AIRB 1IXDA 3CC7A 2HZYA 2LQWA 3EGDB 2E12A 3JB9D 2DVEA 2MYSA 2SEMA 1Q86R 4EIKA 3H8ZA 1ZLMA 2JS0A 4M78F 2VB6A 2V22B 4XQ3A 2F5KA 1OZ3A 3EHRA 2HBWA 4GY5A 5IDPB 2EYWA 3CCQQ 4E7HA 2IW6B 1U3OA 2RD1A 4C92D 2RF0A 2BS3A 1M1KU 2IW8B 4LUEA 3QO3A 3RGFB 4M77E 5KCOA 1WFWA 2E65A 1Z9QA 2QK0A 3L42A 5CKBA 1URCB 1K73C 4C8QD 3JCMe 2EYQA 2FRYA 3LX7A 1QMZB 1U06A 4M78B 2ZAEA 4M75F 3CMET 2X4YA 5HKCA 3ZL7C 4E7JA 4IURA 5HQ0B 1Y0MA 4JRKA 1VQ6Q 4BCMB 4HNUA 5HK3A 2F69A 1VQKA 3PNWC 1GXIE 4EOOB 3BLHB 3V7SA 1VQ7T 1I8FA 1VQMA 2JMAA 5CCAA 1OL1B 4Z8AA 2FZCB 4RCCA 4BDZA 1VQ9A 3U23A 1Q7YU 1RAEB 3A8GB 1JJ2S 4M75B 3N5BB 1K9AA 2UZLB 2WMBB 2W2HA 5D6YA 2KMGA 1W70A 1K9MC 4J6YA 1AZGB 1KHCA 2QYZA 1YJ9T 2I2LA 2LDMA 2YHTA 3BLRB 2FYKA 2HKNA 1PKTA 2QGGA 1IRXA 3F5XB 1KQ2A 2RJDA 4CRIA 3OW2A 4M7AG 2MPXC 2DFUA 2CZ0B 2WIHB 5LJ3g 4F17A 3TSZA 1UTIA 1MUZA 3CCRQ 2C6TB 3E1SA 5KYYB 2RQRA 2KYMA 3H0IA 4I3ZB 1EFNA 2WIPB 2QA4T 3KUFA 2DTIA 5C6SA 1TUDA 3HHTB 4IIOA 5IHIA 4HCKA 3UWNA 2PTKA 1GUXB 3JV3A 5KYWB 4CFWB 3OBWA 2X9HA 2EGCA 1C0MA 2K2MA 3VS2A 1M1KR 2JJ9A 1RACB 2MF2A 3G7ZA 3X25B 2E5QA 4M4ZA 3AT1B 1PKDB 2KRSA 2F1LA 5DLQE 5GAMe 4DA4A 4LNPA 3BG3A 3CMEQ 2EQMA 2RJEA 2DETA 4ESRA 1KC8C 2K5IA 3F70A 1I0CA 4BCQB 1E7OA 2EKOA 1WJQA 4FT2A 2RPNA 1ZUYA 5GAN6 2LC4A 3REAB 2H3JA 3UF4A 3QJYA 1WPYA 1BCOA 2EWNA 3UPUA 2VWFA 4MDXA 4JS5A 2YRVA 5IDNB 1WHLA 4C8QC 1H3HA 3TCJA 1YITA 2BKZB 3JCMJ 3CCLQ 2A37A 2CP6A 2CUDA 2ZGWA 3VS0A 4PJOC 3CCST 2KE9A 1KXUA 2JZ2A 4OGEA 5A2QE 4F7LB 1SKUB 3SD4A 4C92E 1RAGB 1Q7YR 4Q5WA 4CFUD 3QWLA 3L2VA 1YJ9Q 3FRNA 1VQNA 1TOVA 2LCCA 2HEQA 2XDBA 3VYGB 4A53A 3QWXX 4NL3A 1WHHA 3I56T 3OYDA 2D0QB 1Q81C 4C8QE 4FU6A 4LUDA 3OYLA 1YI2A 3PT9A 4OB2B 2L3PA 1VQ7A 2CCIB 2MWPA 3CCJA 4M77G 2CT4A 2GTOA 4EPCA 4XU1A 1QP3A 4NC6A 2QA4Q 2CP5A 1G3NC 1FXXA 3OYBA 3V8LA 2DM1A 3SHWA 1YP5A 2X4JA 3VV0A 3DB3A 4PLIA 2DXBA 2BTTA 3A8OB 1OIYB 3C0CA 5LL6S 2P0KA 4RKUE 2DBMA 1K0XA 3PMTA 4RTXA 1U1TA 1ARKA 3CXCS 2XMFA 4FYWB 1VQ5T 1X6GA 4V2SA 1MV0B 3C95A 1X27A 4LDWA 1FX7A 1Y71A 1FVVB 4BCKB 5LMKB 2DD5A 1QWFA 3KXTA 3MPUB 4RTWA 4E6RA 2RJFA 1HSQA 4F7UE 4E7ZA 1TTHB 1VQ8A 4BCIB 1RLPC 2JN0A 1QVGS 3QBYA 3CCMT 2RJCA 5HVYB 1UUEA 3QYBA 1RAFB 3RKXA 4JRQA 3PTAA 4BCPB 3PGGA 1BU1A 4QKUA 4YC3B 4UN0A 4ZGJB 2W9FA 2VGNA 5BNJB 3BHTB 1MNEA 1KG1A 2EJGA 3MP8A 1BYMA 4IUVA 3CCSQ 1YJWA 3NDQA 3BDUA 2OTLT 1MMAA 4EDUA 3R6OA 2EYXA 2QQAA 2AKKA 2DK3A 1GRIA 2BZ8A 4MZTA 4X9DA 5FU6B 3G6EQ 2EQKA 1PNJA 4N4IA 1LJOA 2KY9A 4D6WA 2CH4W 3I56Q 1SSHA 3UDCA 2DYIA 3SB2A 4XAXB 3OYKA 5FRMA 3JCMd 2JT4A 1AWJA 5CKHA 1KQSA 2ZZDB 2MI6A 2V1RA 3EAEA 2PHGA 2HCKA 4M7AB 2W9ZA 2DE0X 5FGKB 3DDQB 3MCAB 3OYJA 2P4TA 2EVRA 1QVFP 1WHMA 2O4XB 4II1A 2J7IA 1H92A 4IUUA 4XTVA 1K8AU 2AK5A 2RK2A 1UECA 2VV5A 2XD0A 3J7AF 1OZ2A 3QWYA 4A4KA 1Q82C 2HKQB 5A0GA 4BB7A 2FB7A 4B9WA 1WA7A 4IUQA 2F2CA 5IXFA 2QXFA 1VQ5Q 5DY9A 1OPLA 1FMWA 2CP3A 2COYA 4PJOA 4EOSB 2IVXA 4OB0B 4JLIA 5LJ5e 4CRLB 5A0DA 1GH6B 3OMCA 5EFQB 3HL8A 3JB9G 4X9CA 1D1CA 4M78A 2E70A 2GQVA 5LJ3d 1O9SA 3CC2A 3JB9I 1RL2A 3IQLA 4FW1A 4F6SB 3L2ZA 4ORZA 3CCMQ 2DL5A 3VU3C 5I2MA 5KYUB 1GCQC 5KYXB 2HNIA 4C92G 1WDXA 3UA6A 2VVKA 4F70B 3CPWS 1PSFA 3G71Q 5I2SA 1D1AA 2OAWA 4LXCA 2AHJB 5GAOm 1Y07A 4C8QG 2HQXA 2ECZA 3LH0A 5M9OA 3A8HB 5CKDA 1IGUA 4M77F 4XTUA 2LJ3A 4M75A 4K11A 2F2WA 3OBYA 2L0AA 3OB9A 2OTLQ 1X69A 1VYUA 3E19A 1UGRB 4KGXB 1VOLA 3MIAB 2VXFA 1D1BA 2R5AA 1M30A 4N0AA 5GANd 3CXCP 1QLBA 5GAN2 4O5VA 4JRPA 2UUEB 2WPAB 2DKGA 3OSSC 2I53A 4OR5B 5HBEB 3VKGA 1MNDA 5GAMd 4BDYA 4PK4A 3QYGB 1W4SA 4EC8B 1RI0A 4BCND 1TU0B 2LT4A 3CC4T 2CREA 3QPHA 5KYYA 1X2QA 3M0RA 1N4MA 1PC0A 1PD1A 2LQKA 1VQPT 4OMLA 1QVGP 3FB9A 2HQEA 5FWBA 1JO8A 2ED1A 4JS4A 2ZPEB 1YBYA 3CCVT 1GUXA 1UJ0A 4OB3B 1K8AR 4F7UG 3T9NA 3QIIA 1O75A 4F6WB 1WJRA 2MAMA 2JS2A 2FPDA 2OTJT 2D0NA 3OA6A 1FMKA 4C0ZA 3HBLA 1ZP2A 1KFZA 1SG5A 3M0QA 3GP8A 2X51A 3JRZA 2R5MA 5IN1A 3EG0A 3EIDB 5LJ3f 2COZA 7AT1B 1OI9B 1W1FA 1H25B 2RK1A 2K7AA 1IZ6A 3TW6A 4DBRA 4E47A 3PIOA 5ECAA 1G3TA 1GBRA 1E9HB 2C0OA 2DIGA 2CCHB 1NLOC 4C0DC 5HBHB 2WMAB 4FYXB 4C0FA 2W10A 2KNBB 1LOJA 3EG2A 3PIPA 3EG3A 5IAYA 5KYNA 1R77A 1WYXA 2OJ2A 2EYYA 3OYHA 3LW5E 3CBPA 5EJCA 3UT1A 2V8IA 1I1JA 1S72Q 2HL3A 3ME9A 4OP0A 3M0UA 2X35A 4CC7A 2DXCA 3OS2A 2EQUA 1VQ6T 5GANf
chains in the Genus database with same CATH topology
2GCXA 4J6YA 2C06A 4B9XA 3OYIA 3ZBDA 1WGSA 2XICA 4KUIA 2RH2A 1KHCA 4MMLA 1YJ9T 1W2BS 2I2LA 2LDMA 2K2VA 4QQGA 1K8AC 1VQOA 1P92A 2RB6A 2YHTA 3VYGA 2X4XA 2VGMA 2V8JA 2FYKA 3MO8A 4PKCC 1VQ5A 3QKJA 4IUPA 3LGFA 2Y4XA 5CKFA 3LGLA 1D3BB 4OGCA 4PLLA 3RMSA 1VQ4A 1MGQA 1KQ2A 1N27A 2RJDA 3AHUA 4CRIA 2FL7A 3OW2A 4M7AG 4LDXA 5CK9A 1M8VA 1KC8U 1S72T 4J7IA 4M75E 4MIMA 2CZ0B 2R57A 2QF7A 3OS5A 1NZ9A 3QJ6A 5LJ3g 1N9RA 4PJOG 2EIFA 4WF2A 2QEXT 3JB9F 3E1SA 3SDZA 1ZHIA 3ASKA 2QA4T 3KUFA 1BIAA 1G3WA 2DTIA 3GNFB 3CCMA 5C6SA 3CPWA 3JCMf 4ZN3A 3CMAT 4HA8A 3HHTB 4M7DD 2V8KA 4M7DC 1G5VA 2WACA 3P8DA 5GAMj 3UWNA 1D3BA 2O01E 2ZPBB 3P8HA 1Q7YC 4C92F 2XU8A 3OBWA 3G71A 1BKBA 2Y4YA 3OS1A 1YJNT 3JCMb 1QP2A 2XDPA 2A3LA 4M77B 3KHIA 3VKIA 2D9TA 4MZPA 4HNVA 4BBSM 1X6OA 3CCRT 2MF2A 3RMQA 3V8JA 4A4EA 2WSFE 3G7ZA 3CCUA 4C8QF 3X25B 2D6FA 3CC7T 3VKHA 2E5QA 3OYGA 2OTLA 4EMKB 4M7AF 3C94A 5DLQE 4BI4A 5C0MA 3PMIA 1Q82U 1I81A 5GAMe 1KQSS 5I21A 3DB4A 3RKWA 1UGSB 4XTWA 4DA4A 3BG3A 1NJIU 2EQMA 2RJEA 2QTXA 3CD6A 1JBMA 1YCYA 3A5ZB 3OYMA 5GMKl 1KC8C 2K5IA 3F70A 3V7CA 3URGA 2EKOA 1JB0E 1WJQA 4C92B 4FT2A 5FU6C 3NFCA 5GAN6 1HXDA 3G4SA 2LC4A 5FRNA 2E10A 2H3JA 3GIBA 1KQ1A 1WPYA 2EWNA 3QJYA 4LOCA 3UPUA 1VIFA 3HRUA 4MDXA 4FIBA 3NTHA 3TEEA 3LWIA 4JS5A 2YRVA 4KULA 4C8QC 3FC3A 3TCJA 5FU7B 3M54A 4EMKA 4Z02A 1YITA 3S6WA 4N4HA 5GAN7 3M5AA 4KBMB 3JCMJ 4M7AC 2E6NA 2CZ6B 3A8LB 4J83A 2ZGWA 4PJOD 1UEBA 2E64A 4PJOC 3CCST 4ZTJA 3JCMc 2JZ2A 2LCLA 3KBGA 3EFRA 4OGEA 2QFZA 3X20B 5A2QE 1VQLA 2VXEA 4C92A 3SD4A 4BY6C 4C92E 2ZPFB 2PVOB 1NPPA 4Q5WA 5J3BA 2QQRA 3JCMg 4FL6A 3QWLA 3CCQA 4QQDA 5J39A 4M78D 3L2VA 2VUBA 3QZ9B 2JUFA 5FLXE 5GAOn 3L2UA 1M90U 4C0DB 2XHCA 4NL2A 5LJ5d 3CCEA 3CPFA 3HP9A 3FRNA 1N8RU 5LJ5h 1VQNA 1VIEA 5CIUA 4F7UF 5L8RE 4HLQA 2LCCA 2XDBA 3VYGB 2QDJA 4A53A 4NL3A 3I56T 1U8RA 3OYDA 2JOYA 2D0QB 3HO8A 5CVIA 4C8QA 4C8QE 4JJNK 2JTMA 4OMFB 2DXUA 4FU6A 4PL6A 4ZGEB 3SFMA 3FEOA 3OYLA 1XQHA 4J8OA 4XU2A 1YI2A 1VQKT 4CI0C 3QYEA 3JAME 2JNGA 4OB2B 3PT9A 3CCLT 1R8OB 1VQ7A 4M7AA 2E6ZA 4ELYC 2DIQA 5CAIA 2JVVA 1NE8A 5GAOp 1M1KC 2VYTA 2MWPA 2EAYA 3CCJA 4VUBA 1EIFA 4JX5A 1M5Q1 4JLGA 4M77G 4EPCA 4OF1A 4XU1A 3LWHA 1QP3A 2O4XA 3C12A 3MEWA 2M1HA 4E7IA 4ATOA 4NC6A 1YIJT 2M16A 1FXXA 2DD4A 4EMHA 3OYBA 3V8LA 1VQ9T 1E7PA 5CQXA 2YLCA 4BBRM 4J6XA 2WSCE 4R55A 4FM4B 3JCMQ 3QZ5B 3BFMA 1QVPA 2X4JA 1WQWA 3VV0A 4A4FA 3DB3A 4PLIA 3QUIA 2DXBA 1XNIA 5GAMf 4M7DF 3A8OB 4MFEA 1KD1U 4M75D 5LL6S 1K9MC 1Q81C 2P0KA 4F7UB 4RKUE 4QVCA 2E1HA 2G3RA 2K57A 2KSSA 2LNVA 4BI3A 2PVDB 3MHXA 1KHIA 2DXTA 3PMTA 1U1TA 3WVEB 3MEVA 3CXCS 1VQOT 1JJ2A 4GLKA 2KQWA 4J5YA 2P0PA 1VQ5T 5CKEA 1HK9A 2DTHA 2BUDA 3TW7A 3EFSA 2XIDA 4V2SA 2CS7A 2BKDN 3C95A 3OY9A 2QQSA 4LDWA 1FX7A 2DO3A 3Q1JA 1Y71A 4RG2A 2RA2A 3X28B 1W2BA 3OS0A 4A4GA 2DD5A 1S72A 1N8RC 3PFSA 3FIFA 2XG8D 1N9SA 2DTOA 3HKSA 4RCBA 3KXTA 2CZ1B 4M78G 3RESA 4IKFA 2QEXA 2RJFA 3DL1A 4Z6YA 2F5TX 1LNXA 4EMKC 2WJ9A 5GAOl 4F7UA 4F7UE 5KH6A 4X34A 2QI2A 3TU4K 1VQ8A 2JN0A 3J80E 1QVGS 3QBYA 4M7DB 4NOYA 3CCMT 4KUDK 2RJCA 3M4GA 3M59A 5J26A 4L6V5 1OI1A 1I4K1 5GAN8 2KAFA 3QYHB 3E9GA 3QYBA 3WVDB 1X01A 3RKXA 3J81E 3PTAA 4JRQA 4R56A 2OTLT 3PGGA 4ME7A 3BW1A 5IT9E 1ZBXA 3GF5A 4C5HA 4J6WA 1NPRA 4ZGJB 1XOVA 4P5NA 3L2QA 2VGNA 4E7LA 4MFDA 2CKKA 3OYCA 1BI3A 1Y7XA 4XTZA 1YJNA 3JCMP 3OSVA 3CBOA 2LX9A 3UDCA 4FT4A 3CC4A 4LDYA 1KG1A 5GAN4 2GFAA 1QVFS 2EJGA 5A0GA 3MP8A 4RMOA 3CCRA 4EMGA 2DPPB 5D6XA 4M77D 4HCBA 1VQPA 4M7DA 4M7DE 1BYMA 4IUVA 1H3ZA 5GMKm 1YJWA 4PJOF 3CCUT 4XU0A 3OYFA 2JTFA 4M75G 1Y96A 3SWNC 5GANg 3V8KA 1B34A 3BDUA 4DQ2A 4ELJA 3CCVA 4EDUA 3VYHB 1TH7A 3HRSA 2WSEE 3R6OA 4FSXA 3BDLA 2QQAA 2EJFA 2DK3A 3HB9A 2OTJA 4MZTA 4BE0A 4X9DA 1MHNA 3DKMA 5GAMg 5FU6B 2OAUA 3CD6T 4HCCA 2EQKA 3HZJA 4N4IA 1LJOA 2KY9A 4PNOA 4D6WA 3C4SA 5KCHA 3GOXA 2B8AA 2QQ8A 4AKHA 2HBPA 2IG0A 2KK4A 4AKIA 3DLMA 4XAXB 3SB2A 3JCMd 3OYKA 5FRMA 2KR6A 3G4ST 5CKHA 3BG9A 2ZZDB 2MI6A 1WNLA 3BY7A 3JCMh 4C8QB 1KQSA 4C5EA 3EAEA 4JRIA 4QSHA 2L3RA 4M7AB 1Q86U 2LRQA 3MCAB 4HNTA 4TVRA 3ZEHA 2P4TA 3OYJA 1YITT 2BIVA 5LJ5j 4HT9A 4XTXA 4ELZC 4PJOB 2PUKB 3SWNA 2O4XB 4II1A 5KE2A 1BI1A 4M78C 3NTIA 4BY6B 4IUUA 2DD4B 4XTVA 3CMEA 1K8AU 3ER0A 2RK2A 4JX4A 2VV5A 1X75C 2L8DA 1OZ2A 4NS5A 2XD0A 3DLLA 3G6ET 3J7AF 2XK0A 4LDVA 1VQLT 1YHQA 3HPWA 1G3YA 4HT8A 3FDRA 2RHUA 3I55A 2DXBB 3MEUA 2QQ9A 2ZZDA 4A4KA 3CCQT 1Q82C 3GLXA 3M9QA 4BB7A 1G3SA 2FB7A 1ZQ1A 1UGQB 3MEAA 3RKYA 4B9WA 4IUQA 3OQ5A 1NJIC 3CCET 2K3XA 5HY6A 5D6WA 2QXFA 3E9FA 3LYIA 3M58A 1VQNT 4M7AE 4C5IA 2FHDA 5DY9A 5DLOA 2PU9B 4ZGDB 4IUTA 5EG2A 2CGHA 4PJOA 4PJOE 4OB0B 2RHXA 4JDSA 4JLIA 3ZFJA 3HFOA 1YI2T 5LJ5e 2QQBA 5CR2A 5A0DA 3CCLA 2P0QA 2Y90A 1M1FA 5LJ3j 3OMCA 2LTOA 2A7YA 3HL8A 3CBMA 3JB9G 3MP1A 4X9CA 5GAOr 1BI0A 2LVMA 3S3MA 1N6AA 2XKOC 2EFIA 2LT1A 3CEYA 2DD5B 1FWZA 2L89A 3M57A 2E70A 3OYYA 4M78A 3CCJT 2GQVA 3OYEA 5LJ3d 4AKGA 1O9SA 2DZ9A 3FJPA 3CC2A 5LJ3h 1VQ6A 3QG1A 1JRIA 2K5FA 3JB9I 4M75C 2XDDA 1RL2A 3L2ZA 3A8MB 5GMKj 3OW2S 2L5QA 3RIRA 1YJ9A 2PUOB 3VU3C 3QDRB 1H641 4M6VA 3P8BB 4L59A 5I2MA 1UB4A 5HK0A 2G77A 2HNIA 2M9UA 4C92G 2R58A 3JB9J 2ZPIB 1I5LA 4L5GA 3M4YA 4BD3A 2XI9A 5GMKh 3WXMB 3QXEB 1VQ4T 5FROA 2CYZB 3HRTA 4N0AC 4QW2A 2ZPHB 1M90C 3CPWS 4Y28E 4N4GA 4MZMA 1PSFA 5LJ3e 5I2SA 3META 1XTDA 2AHJB 5GAOm 2DZCA 4JUVA 3H6ZA 1Y07A 3BG5A 4A54A 2HQXA 4C8QG 2M0OA 1BI2A 4E7KA 2E41A 3INZA 3A8HB 3LH0A 5M9OA 1SSFA 3QSUA 2QA4A 5CKDA 3M56A 4M77F 4XTUA 5AYFA 2ZPGB 2KVQG 2RHYA 4Y91A 4M75A 4KT0E 5GMKe 1V29B 1FKMA 3M55A 3OBYA 5GAN5 5CO7A 3CXCA 3CMAA 3OB9A 1Y96B 3H4CA 1B34B 3E19A 4QQ6A 3HFNA 3TREA 1UGRB 4DOVA 5GANj 3S3OA 1VQ8T 2EQJA 4HCZA 4MDWA 2VXFA 1K73U 2RM4A 3L2RA 2R5AA 3JSCA 4N0AA 4RG8A 5GANd 2KDSA 3G71T 4LDUA 5GAOq 1QLBA 5GANh 4O5VA 5GAN2 3GNGA 4JRPA 3RERA 4BE2A 2DKGA 4BACA 4LD9K 2IVWA 1KD1C 3OSSC 4JX6A 1QVGA 3VKGA 5GAMd 1BIBA 4BDYA 4M77C 2FVUA 2VC8A 4ZN1A 3QYGB 5GMKi 5GAMh 1W4SA 4AI6A 2RO0A 2GF7A 3CC7A 1RI0A 3JCMW 5KE3A 2CZ7B 2E12A 2LT4A 3CC4T 3QPHA 5LJ5f 3JB9D 4QVDA 1WQ7A 2DVEA 2HD0A 2LQKA 3H8ZA 3SWNB 5GANe 1VQPT 2RHZA 2BS4A 4QVZA 3FB9A 2EJ9A 2HQEA 4M78F 4UC4A 2QDYB 4XQ3A 4DOWA 1YJWT 3HSBA 2RI5A 4JS4A 2ZPEB 2F5KA 1OZ3A 1PSEA 1Q81U 1YBYA 3QHSA 4GY5A 3CCVT 1AHJB 1UGPB 4OB3B 1M4ZA 3JB9H 4E7HA 4F7UG 4YTLA 3T9NA 3QIIA 1QVFA 1O75A 1WJRA 2MAMA 4J7FA 3JCMV 2RD1A 4LD6A 4C92D 2OTJT 4C92C 4OVAA 2BS2A 2DAQA 2BS3A 5CQYA 3OA6A 2PVGB 1M1KU 3QO3A 3FLGA 3MP6A 4BI8B 3OYNA 2PQWA 2X4WA 4C0ZA 1VUBA 2MWOA 4M77A 4M77E 4XK8E 3HBLA 5KCOA 2E65A 5GAN3 1OYXA 3VUZA 3GP8A 3L42A 4MMKA 3JRZA 4A4HA 2R5MA 5CKBA 5FU7C 5IN1A 1K9MU 5LJ3f 1K73C 4XU3A 4C8QD 3CCSA 3VUBA 3JCMe 2EYQA 1M1GA 2YLBA 3LX7A 3OYAA 4M7AD 4M78B 2RK1A 1IZ6A 3V7RA 4BUGA 3TW6A 1VQMT 5DM7R 4E47A 4M75F 3X24B 2GFUA 3PIOA 2RHIA 4M7DG 5A0LA 3CMET 1G3TA 2RI3A 2X4YA 1WJSA 5HKCA 3G6EA 4E7JA 3JCMX 4IURA 2DIGA 4JRKA 3RUXA 3S3NA 2DEQA 3I56A 2LQ8A 4HKEA 4C0DC 1YHQT 1M9SA 2K4YA 2DXCB 4HNUA 1DJ7B 2ZCFB 3LLRA 5HK3A 4C0FA 3I55T 4BE1A 2HAXA 2F69A 1LOJA 1VQKA 3PNWC 3PIPA 5IAYA 1GXIE 4OB1B 3L2WA 3L1AA 2RI2A 4XTYA 2DJZA 3V7SA 1VQ7T 4HL4A 1I8FA 1VQMA 1U1SA 2NLUA 4C0GA 3OYHA 4M78E 5CCAA 3LW5E 3CBPA 3M53A 4ZTFA 5EJCA 3NTKA 1YIJA 4RCCA 4BDZA 1VQ9A 3O8VA 3UT1A 1Q7YU 2V8IA 3X26B 1QW1A 3VJPA 4C5GA 5LJ5g 3A8GB 1JJ2S 2K3YA 3ME9A 4OP0A 4O6JA 4M75B 3GPLA 1Q86C 2X35A 2MMPA 3N5BB 3OMGA 2DXCA 3OS2A 1IREB 2K5LA 2EQUA 3CC2T 5D6YA 1VQ6T 2KMTA 5GANf 2KMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ9 B;  3VYG A;  5L8R E;  3VYG B;  2D0Q B;  4ZGE B;  2ZZD B;  4OB2 B;  3QYG B;  2CZ0 B;  2CZ7 B;  1QP3 A;  2PUK B;  2DD4 A;  2DD4 B;  2QDY B;  2WSC E;  4FM4 B;  3QZ5 B;  2ZPE B;  3HHT B;  1PSE A;  2DXB A;  1AHJ B;  1UGP B;  3A8O B;  4OB3 B;  2DXB B;  2ZZD A;  2O01 E;  2ZPB B;  4RKU E;  1UGQ B;  2PVD B;  2PVG B;  3WVE B;  2PU9 B;  4ZGD B;  4XK8 E;  1QP2 A;  4OB0 B;  2WSF E;  3X28 B;  3X25 B;  2DD5 A;  2DD5 B;  2CZ1 B;  1UGS B;  3X24 B;  3A8M B;  2PUO B;  4L6V 5;  3QYH B;  1JB0 E;  2ZPI B;  3WVD B;  2DXC B;  1DJ7 B;  2ZCF B;  3QXE B;  4ZGJ B;  2CYZ B;  1GXI E;  4OB1 B;  2ZPH B;  4Y28 E;  1PSF A;  2AHJ B;  3LW5 E;  3A8H B;  2CZ6 B;  2DPP B;  3A8L B;  3X26 B;  2ZPG B;  3A8G B;  4KT0 E;  1V29 B;  3X20 B;  2DXC A;  3VYH B;  2ZPF B;  2PVO B;  2WSE E;  1IRE B;  1UGR B; 
#chains in the Genus database with same CATH topology
 2GCX A;  4Z89 A;  4B9X A;  3OYI A;  3ZBD A;  1WGS A;  2RH2 A;  4RUG A;  1XO2 A;  1VQO A;  1Q95 G;  2RB6 A;  3VYG A;  3MO8 A;  2I0N A;  4CFX B;  1D3B B;  3H41 A;  1MGQ A;  1N27 A;  3AHU A;  2FL7 A;  1JXO A;  2MK5 A;  4MIM A;  4BCH B;  3CC4 Q;  1NZ9 A;  3QJ6 A;  1N9R A;  1AWW A;  3VS1 A;  3PVL A;  3JB9 F;  3QHR B;  1GCQ A;  1H4L D;  2DYB A;  3SDZ A;  3EG9 B;  1VQP Q;  1QQJ A;  3VS6 A;  4ZN3 A;  4HA8 A;  1AOJ A;  3CCV Q;  4M7D C;  3P8D A;  3EGU A;  8AT1 B;  1W98 B;  2O01 E;  2OTJ Q;  1OUL A;  1WI7 A;  4CC4 B;  1Q7Y C;  4C92 F;  1W2B P;  1QLY A;  2UZE B;  1JXM A;  2IIM A;  1BKB A;  1ABQ A;  2Y4Y A;  3OS1 A;  3I5S A;  1QP2 A;  2P84 A;  2A3L A;  2GTJ A;  4YOS A;  2HL5 C;  4HNV A;  4BBS M;  2LZ6 B;  3CCR T;  2KBT A;  4C8Q F;  4R0K A;  2LCS A;  3VKH A;  3OYG A;  1NEB A;  3BLQ B;  4EMK B;  1IHV A;  4J9B A;  2O9V A;  2QTX A;  3CD6 A;  3A5Z B;  3QDF A;  1JB0 E;  4C92 B;  1T3L A;  3NFC A;  3G4S A;  5IH2 A;  4WCI A;  4LOC A;  2YUN A;  3MJX A;  2JTE A;  4KUL A;  1M3B A;  1WXB A;  2WHB B;  5FU7 B;  2LW4 A;  3M54 A;  1WLP B;  3M5A A;  2CZ6 B;  3A8L B;  4PJO D;  4CC2 A;  2LCL A;  1I07 A;  2A36 A;  2VXE A;  4BY6 C;  2DEU A;  3JCM g;  4FL6 A;  3CCQ A;  4TTH A;  4M78 D;  2DA9 A;  5FLX E;  5GAO n;  4EOI B;  5LJ5 d;  3CCE A;  3CPF A;  4ROE A;  4F7U F;  1N5Z A;  4HLQ A;  1U8R A;  2JOY A;  5CVI A;  2CSQ A;  4EOR B;  3SFM A;  2ROT A;  4CI0 C;  4Z88 A;  3CCL T;  1PHT A;  4M7A A;  4DBH A;  4ELY C;  2JVV A;  1NE8 A;  1SHG A;  2WFY B;  1D0Y A;  1HJD A;  1FYN A;  2O4X A;  3MEW A;  1GBQ A;  3C12 A;  2M1H A;  4ATO A;  2RQU A;  1YIJ T;  2UZD B;  1X2K A;  1E7P A;  2LJ1 A;  3BE3 A;  4R55 A;  2WSC E;  4F7S B;  3THK A;  3QZ5 B;  1XNI A;  2J6F A;  4MFE A;  4M75 D;  4F7U B;  4CFN B;  1M2O A;  4Y92 A;  4QVC A;  2G3R A;  1B3Q A;  3MHX A;  2K79 A;  1E6H A;  3MEV A;  1JJ2 A;  5HBJ B;  2KQW A;  2QAS A;  5CKE A;  2ED0 A;  4J9F A;  3TW7 A;  3EFS A;  2CS7 A;  1HYO A;  2QDL A;  2DO3 A;  3H0F A;  3LQ5 B;  2RA2 A;  3OS0 A;  3FIF A;  2XG8 D;  2DTO A;  1EX4 A;  4PFP A;  4RCB A;  1X6B A;  1YFN A;  2F5T X;  1LNX A;  2WJ9 A;  5KH6 A;  4X34 A;  2QI2 A;  3TNI B;  2DNU A;  1QCO A;  5KYU A;  5KYX A;  5J26 A;  1OIU B;  4EOQ B;  2KAF A;  3QYH B;  1S1N A;  2DER A;  1X01 A;  3J81 E;  1RAA B;  2G6F X;  5CEI B;  4R56 A;  3TVT A;  2YWW A;  2O2O A;  4C5H A;  4J6W A;  1NPR A;  3LH5 A;  2C4G B;  3DJB A;  4DEX A;  3OSV A;  1U5S A;  2LX9 A;  3CBO A;  2WEV B;  5GAN 4;  1QVF S;  3CCR A;  4BCF B;  1M2V B;  2NUP A;  4M7D A;  3MY1 B;  2CUB A;  1G83 A;  1H3Z A;  5GMK m;  3CCU T;  5GAN g;  3VS7 A;  4DQ2 A;  3VYH B;  3HRS A;  1OQK A;  1ABO A;  1UNH D;  1MHN A;  3DKM A;  1C9B A;  5GAM g;  3GOX A;  2B8A A;  2KK4 A;  2HBP A;  2IG0 A;  4KRT A;  3K7A M;  4AKI A;  1BK2 A;  1YWP A;  4BCQ D;  3JCM h;  1WNL A;  4C5E A;  1C1A A;  4JRI A;  2L3R A;  1GFD A;  2J05 A;  3ZEH A;  2E5K A;  4XTX A;  1YIJ Q;  1RAI B;  1UE9 A;  5KE2 A;  1ZBJ A;  4M78 C;  1K4U S;  3CME A;  1UNL D;  4RTV A;  4NS5 A;  3G6E T;  2XK0 A;  4RTU A;  1VQL T;  3HPW A;  1G3Y A;  3FDR A;  3M0S A;  2RHU A;  2FG0 A;  1VIN A;  3O5Z A;  3MEA A;  3RKY A;  3A1P A;  1NJI C;  2K3X A;  3E9F A;  5DLO A;  3RR6 A;  1PD0 A;  4IUT A;  4ZGD B;  5EG2 A;  2CGH A;  2K3B A;  4PJO E;  5ICP B;  2WXV B;  4JZ3 A;  1VQ4 Q;  1CKA A;  1SRM A;  2LMJ A;  3SEM A;  5CR2 A;  3CCL A;  2P0Q A;  2Y90 A;  1M1F A;  5LJ3 j;  2O31 A;  1ZA1 B;  1H8K A;  3MP1 A;  5GAO r;  1BI0 A;  2LVM A;  2XKO C;  2EFI A;  3CEY A;  1FWZ A;  2GNC A;  3M57 A;  1ZSZ B;  4AKG A;  2YRD A;  5LJ3 h;  2XDD A;  1JRI A;  4M75 C;  3VS5 A;  3A8M B;  5GMK j;  2C5N B;  3RIR A;  1YJ9 A;  3QDR B;  3P8B B;  4L59 A;  5HK0 A;  2EYZ A;  2ZPI B;  1I5L A;  4BXX X;  2YUQ A;  3M4Y A;  5GMK h;  3WXM B;  3M0T A;  3ULR B;  4N0A C;  2ZPH B;  1M90 C;  4GBQ A;  2QAZ A;  4J9G A;  1OL2 B;  1OOT A;  2M02 A;  2DL3 A;  2OX7 A;  5D7U A;  3BG5 A;  3NGP A;  1H1Q B;  3INZ A;  1IB8 A;  4PJM A;  3QSU A;  2QA4 A;  2HSE B;  4KRD B;  5AYF A;  1K0S A;  3CCU Q;  2RHY A;  2KVQ G;  2CP2 A;  3M55 A;  5GAN 5;  3CXC A;  2PMI B;  1OU8 A;  1B34 B;  3HFN A;  3TRE A;  4ROC A;  5GAN j;  1M3C A;  1ENW A;  2BPM B;  1WHK A;  3G71 T;  1UG1 A;  2QG9 B;  1SPK A;  2D1X A;  5GAN h;  1UHC A;  1VYV A;  4BAC A;  4LD9 K;  1KD1 C;  5I5Z B;  2SRC A;  4KH1 B;  1QVG A;  1BIB A;  3DOG B;  2FVU A;  2VC8 A;  5GAM h;  2RO0 A;  1TUC A;  3JCM W;  5KE3 A;  1JQQ A;  3GBQ A;  4QVD A;  4NST B;  2PZ1 A;  2NYS A;  3SWN B;  2BS4 A;  4QVZ A;  4UC4 A;  2QDY B;  3HSB A;  1TUG B;  2EGE A;  1V1C A;  2JM9 A;  1VQL Q;  1PSE A;  1Q81 U;  2NUT A;  1M4Z A;  1UGP B;  2J6K A;  3JCM V;  1JEG A;  8ATC B;  2DAQ A;  2LP5 A;  4BI8 B;  3OYN A;  2PQW A;  2X4W A;  3EGD A;  1VUB A;  2MWO A;  2KGT A;  1OX9 A;  3VUZ A;  4MMK A;  4A4H A;  4XU3 A;  3CCS A;  2FZK B;  1D0Z A;  1M1G A;  3OYA A;  4JPB W;  4M7A D;  1UJY A;  3X24 B;  2GFU A;  2RHI A;  5A0L A;  1KK7 A;  2RQT A;  3G6E A;  3JCM X;  3RUX A;  3I56 A;  1YHQ T;  1VYT A;  1DJ7 B;  3LLR A;  3I55 T;  2HAX A;  4OB1 B;  3L1A A;  2RI2 A;  4XTY A;  2DJZ A;  4PJN A;  1U1S A;  1P5E B;  1YNZ A;  3NTK A;  2O9S A;  3O8V A;  4BY1 X;  5LJ5 g;  3DTO A;  1CKB A;  2K3Y A;  2VKN A;  4O6J A;  1FIN B;  1H26 B;  1Q86 C;  2QEX Q;  3OMG A;  2DMO A;  3A98 A;  1AVZ C;  2K5L A;  3D7S B;  2KMT A;  2DLP A;  4ZNX A;  4RTT A;  4II5 B;  1W2B S;  3NMZ C;  2PJQ A;  2X4X A;  2VGM A;  4PKC C;  1VQ5 A;  1TFB A;  3QKJ A;  1RAB B;  2GBQ A;  4PLL A;  1X43 A;  1YJN Q;  4LDX A;  5CK9 A;  1M8V A;  1S72 T;  4J7I A;  4KGV B;  1LPL A;  4PJO G;  2KEA A;  4FYV B;  3ASK A;  1GL5 A;  1BIA A;  1G3W A;  1H1S B;  3CCM A;  3CPW A;  3JCM f;  2A0F B;  3CMA T;  4M7D D;  1H1P B;  4HVU A;  2RN8 A;  2QTV A;  1Q81 R;  2FPF A;  3I35 A;  2XU8 A;  3G71 A;  4X1V A;  2M0Y A;  3JCM b;  4M77 B;  1A0N B;  2FZG B;  2JXB A;  4ROD A;  1X6O A;  1JST B;  3RMQ A;  2WSF E;  3O0G D;  2D6F A;  3CC7 T;  1ZA2 B;  2YSQ A;  5LQF B;  2OTL A;  4CFV B;  3C94 A;  1Q82 U;  5I21 A;  1UGS B;  4XTW A;  5KYW A;  3RNJ A;  2DF6 A;  2L3S A;  3TN8 B;  1B07 A;  1JBM A;  1YCY A;  3OYM A;  1AWO A;  3V7C A;  2BZX A;  2H3E B;  2D8H A;  1YHQ Q;  3I55 Q;  1SRL A;  1OV3 A;  5FU6 C;  1HXD A;  2E10 A;  4D8D A;  3GIB A;  1MMN A;  1IO6 A;  1VIF A;  1GFC A;  1D0X A;  3NTH A;  3TEE A;  1UNG D;  3FC3 A;  2HSP A;  3S6W A;  4A63 B;  2FRW A;  5GAN 7;  1F1B B;  4M7A C;  1M2V A;  2LX7 A;  6AT1 B;  4BCO B;  4J83 A;  2KT1 A;  4DEY A;  2E64 A;  5FW9 A;  4ZTJ A;  1D3U B;  1WZO A;  4J9H A;  3EFR A;  3X20 B;  1JKW A;  1H27 B;  1NM7 A;  2PVO B;  1NPP A;  2QQR A;  1KQS P;  1WXU A;  4QQD A;  5J39 A;  2VUB A;  1LCK A;  1PRM C;  4NL2 A;  3HP9 A;  1N8R U;  5LJ5 h;  1VIE A;  2P4R A;  5CIU A;  5L8R E;  3QHW B;  4JJN K;  2HDA A;  2JTM A;  4OMF B;  1VQK T;  4J8O A;  3QYE A;  2R7G A;  3JAM E;  2DIQ A;  5CAI A;  2F2X A;  5GAO p;  1M1K C;  3VRZ A;  1VQM T;  2EAY A;  4VUB A;  1EIF A;  1B7T A;  1ZUU A;  4OF1 A;  1JSU B;  4EOP B;  4E7I A;  1OKV B;  4Y72 B;  2M16 A;  1VQ9 T;  1JOW A;  4EMH A;  5CQX A;  2YLC A;  4BBR M;  4FM4 B;  3CMA Q;  1ACM B;  5GJV B;  4LN2 A;  1QVP A;  1WQW A;  5GAM f;  4FX3 B;  2FPE A;  4KRC B;  1R0C B;  2E1H A;  2K57 A;  2C5O B;  4FCY A;  2DL4 A;  2PVD B;  1KHI A;  2DXT A;  3WVE B;  1UFF A;  4J5Y A;  2P0P A;  3G1J A;  2DTH A;  2BUD A;  1OU9 A;  5I11 A;  3OY9 A;  2X1N B;  2HMA A;  2QQS A;  4E2F B;  3DDP B;  1NEG A;  3M0P A;  4A4G A;  1S72 A;  3CC7 Q;  1N9S A;  2K9G A;  2COW A;  4F6U B;  4IKF A;  1M3A A;  2KRM A;  5GAO l;  4YOZ A;  3J80 E;  4NOY A;  3M4G A;  1Q82 R;  1E6G A;  4L6V 5;  5GAN 8;  2ABL A;  3E9G A;  3WVD B;  4CXA B;  5IXB A;  2V26 A;  1ZSG A;  5IT9 E;  4JZ4 A;  3L2Q A;  1XOV A;  1GY3 B;  2ENM A;  4MFD A;  2EBP A;  2CKK A;  4EON B;  1Y7X A;  3JCM P;  1H28 B;  3EGX B;  1AT1 B;  4FT4 A;  3CC4 A;  4EOK B;  2GFA A;  2I40 B;  1TWB A;  4AFQ C;  4EMG A;  4F04 B;  1VQP A;  4M7D E;  3H9N A;  4ANJ A;  4PJO F;  4XU0 A;  2DJQ A;  2CJM B;  1G2B A;  1B34 A;  3CCV A;  4F14 A;  4ELJ A;  4FSX A;  2WSE E;  1K76 A;  3HB9 A;  2OTJ A;  1O9K B;  2OAU A;  4PJL A;  3HZJ A;  2B9R A;  1RI9 A;  5KCH A;  3PVQ A;  2QQ8 A;  4AKH A;  3DLM A;  1T0H A;  1N8R R;  2KR6 A;  1VQK Q;  4C8Q B;  2BE7 D;  3CCE Q;  4QSH A;  2YUP A;  1VQM Q;  2FEI A;  2LRQ A;  2IW9 B;  4TVR A;  1YIT T;  1Z9Z A;  2BIV A;  4PJO B;  4ELZ C;  2PUK B;  3SWN A;  1VQ9 Q;  1BI1 A;  2DD4 B;  3ER0 A;  4JX4 A;  1X75 C;  2L8D A;  2PK9 B;  4LDV A;  2Z0W A;  2ZZD A;  1FMV A;  1PM3 A;  1G3S A;  4BCM D;  1UGQ B;  3OQ5 A;  4D8K A;  5HY6 A;  3PO3 S;  5D6W A;  3M58 A;  1VQN T;  2JW4 A;  2OI3 A;  5HCK A;  3TSW A;  4JDS A;  3HFO A;  2A08 A;  1YI2 T;  2EKH A;  2QQB A;  2A7Y A;  4FSS A;  2H8H A;  3CBM A;  1EZZ B;  1N6A A;  2LT1 A;  3CCJ T;  2C0T A;  3OYE A;  1VQ6 A;  2K5F A;  3TNW B;  3OW2 S;  2L5Q A;  1H64 1;  3EFO B;  2R58 A;  3JB9 J;  1AEY A;  2BZY A;  2EGA A;  4L5G A;  4BD3 A;  3QXE B;  1VQ4 T;  3GTM S;  5FRO A;  3HRT A;  2X3X D;  4Y28 E;  4N4G A;  5LJ3 e;  3H6Z A;  4LE9 A;  2CSI A;  4A54 A;  2M0O A;  1H24 B;  1BI2 A;  3CQT A;  1SSF A;  2C5V B;  2YUO A;  1RAD B;  3M56 A;  2ZPG B;  4KT0 E;  5GMK e;  1FKM A;  5CO7 A;  3TNH B;  3REB B;  1Y96 B;  1TXQ A;  4QQ6 A;  2O88 A;  1TG0 A;  4DOV A;  2K6D A;  1VQ8 T;  1K73 U;  4IMY B;  3JSC A;  5IF1 B;  4HXJ A;  4LDU A;  4PJJ A;  1QCN A;  3GNG A;  4BE2 A;  2IVW A;  5AT1 B;  3RBB B;  4BCJ B;  1NYF A;  3KFV A;  4AI6 A;  2GF7 A;  1YIT Q;  2CZ7 B;  3FJ5 A;  5LJ5 f;  4BY7 X;  1WQ7 A;  2HD0 A;  3EHQ A;  1NYG A;  5GAN e;  2IN3 A;  2RHZ A;  4EMK C;  2EJ9 A;  1YJW T;  4DOW A;  1MV3 A;  5CYI B;  2RI5 A;  3E2U A;  2RMO A;  1OKW B;  3QHS A;  1AHJ B;  5GJW B;  3JB9 H;  1OPK A;  2PK2 A;  4YTL A;  4HVV A;  1QVF A;  4J7F A;  2LQN A;  4AMC A;  4LD6 A;  2L3Q A;  4C92 C;  4OVA A;  2BS2 A;  1KJW A;  5CQY A;  1VQN Q;  2PVG B;  1K1Z A;  3FLG A;  3MP6 A;  4JJD A;  4M77 A;  4XK8 E;  2QGF B;  5GAN 3;  1OYX A;  1YI2 Q;  4HVW A;  1K9M U;  4OGR B;  5FU7 C;  1VQ7 Q;  2C5X B;  1ZX6 A;  1BBZ A;  3VUB A;  3CCJ Q;  2YLB A;  4CFU B;  5ACB A;  3B57 A;  4B6M A;  3V7R A;  4BUG A;  5DM7 R;  4AFZ C;  1QMC A;  2MCN A;  4JJB A;  4M7D G;  2RI3 A;  1WJS A;  2AKL A;  1RUW A;  3S3N A;  2PNI A;  2DEQ A;  2LQ8 A;  4HKE A;  1CSK A;  1M9S A;  2K4Y A;  2DXC B;  2ZCF B;  2YDL A;  3M03 A;  3L2W A;  3VRY A;  2KRO A;  4HL4 A;  1YCS B;  2C0I A;  4F7N B;  2NLU A;  4C0G A;  4M78 E;  3M53 A;  3PE0 A;  4ZTF A;  4J9C A;  1YIJ A;  3VJP A;  3X26 B;  1QW1 A;  4C5G A;  4QT7 A;  1V76 A;  2YT6 A;  2W0Z A;  3GPL A;  2W96 A;  1UGV A;  2MMP A;  2E4H A;  1IRE B;  4OMN A;  3CC2 T;  1VQ8 Q;  2C06 A;  3EG1 A;  2XIC A;  4KUI A;  4MML A;  2G9X B;  2K2V A;  4QQG A;  1K8A C;  1P92 A;  2JMC A;  2V8J A;  4BCG B;  1QWE A;  1K73 R;  4IUP A;  3LGF A;  2QGS A;  4KGZ B;  5HNB B;  2Y4X A;  5CKF A;  3LGL A;  4OGC A;  1VQ4 A;  1M27 C;  3RMS A;  2DRM A;  2KXD A;  1KC8 U;  4M75 E;  1QCF A;  1UDL A;  2R57 A;  2QF7 A;  3OS5 A;  4CC3 A;  3H0H A;  2EIF A;  4GLM A;  4WF2 A;  2QEX T;  1LVK A;  1PKS A;  1ZHI A;  2CDT A;  2DIL A;  3UAT A;  1NLP C;  1YJW Q;  3GNF B;  3OW2 P;  1JJ2 P;  4AG1 C;  2DME A;  1QKW A;  2V8K A;  3BHU B;  1G5V A;  2WAC A;  5GAM j;  2DBK A;  4E7S A;  1WHJ A;  1WX6 A;  1D3B A;  2ZPB B;  1JU5 C;  3P8H A;  4OMO A;  1AZE A;  1OGU B;  1BU2 A;  1AWX A;  1OX8 A;  1YJN T;  2XDP A;  2KRN A;  3KHI A;  2KT8 A;  3VKI A;  2D9T A;  2DX1 A;  4MZP A;  3EG9 A;  3V8J A;  4A4E A;  3CCU A;  2B86 A;  1K9M R;  1RLQ C;  1BCM A;  1D09 B;  4M7A F;  1G8X A;  4BI4 A;  5C0M A;  3PMI A;  3VS4 A;  1I81 A;  1KQS S;  3DB4 A;  3RKW A;  2KR3 A;  2EPD A;  1NJI U;  1VYW B;  3RDV A;  2DVJ A;  5GMK l;  3URG A;  3R6N A;  5IHY A;  2ESW A;  5FRN A;  1KQ1 A;  2RQW A;  3HRU A;  4FIB A;  3LWI A;  3EGX A;  2EQI A;  3G33 B;  4EMK A;  4Z02 A;  4N4H A;  4KBM B;  2DL7 A;  2E6N A;  1VA7 A;  2MOX A;  2LNH B;  1UEB A;  2AZV A;  2X3W D;  3JCM c;  3KBG A;  2QFZ A;  3I9Q A;  1VQL A;  4C92 A;  2ZPF B;  3CC2 Q;  5J3B A;  2DRK A;  1I5O B;  1MMG A;  2CT3 A;  3QZ9 B;  2JUF A;  1O9K A;  3L2U A;  1M90 U;  4IIM A;  4C0D B;  2XHC A;  2AT1 B;  2HQH A;  2JGZ B;  2W99 A;  2QDJ A;  3HO8 A;  4C8Q A;  4PL6 A;  2DXU A;  4ZGE B;  2VAS A;  3FEO A;  1XQH A;  4XU2 A;  5I22 A;  2JNG A;  2CP0 A;  2M51 A;  1R8O B;  2E6Z A;  2GGR A;  3TQ7 P;  2A28 A;  2AZS A;  2VYT A;  2E3H A;  4AFS C;  1M5Q 1;  4JX5 A;  4JLG A;  4PFO A;  3LWH A;  2NUZ A;  1KC8 R;  4FW2 A;  2DD4 A;  1ZSZ C;  4J6X A;  3JCM Q;  3BFM A;  4A4F A;  3QUI A;  1AD5 A;  4JJC A;  4M7D F;  1KD1 U;  3EOC B;  1KSW A;  2KSS A;  2LNV A;  4BI3 A;  1VOM A;  4AFU C;  2BE9 B;  1VQO T;  4GLK A;  5EC7 A;  1HK9 A;  1H1R B;  2E3I A;  2XID A;  1PRL C;  2BKD N;  2J6O A;  1SF9 A;  3Q1J A;  4RG2 A;  1IGQ A;  4YOO A;  2NWM A;  2KI7 A;  3X28 B;  1W2B A;  1N8R C;  1WIE A;  3PFS A;  3HKS A;  2CZ1 B;  4M78 G;  4OMQ A;  3RES A;  2QEX A;  3DL1 A;  4Z6Y A;  1T3S A;  3NHN A;  4F7U A;  3TU4 K;  1ZUK A;  2NUP B;  4F7J B;  4M7D B;  4KUD K;  3EFO A;  2L2P A;  3M59 A;  1UHF A;  1OI1 A;  1I4K 1;  2YRC A;  1NJI R;  4ME7 A;  3BW1 A;  5L23 A;  1ZBX A;  3GF5 A;  4P5N A;  1OEB A;  4E7L A;  2RQV A;  3NPF A;  2ROL A;  4J9I A;  4BCN B;  3OYC A;  1BI3 A;  4XTZ A;  1YJN A;  1YN8 A;  2CH4 A;  2KYB A;  4LDY A;  1AIS B;  4RMO A;  1TSF A;  2DPP B;  4FYY B;  5D6X A;  4M77 D;  4HCB A;  4OMP A;  1WHG A;  2KXC A;  3OYF A;  2JTF A;  4M75 G;  1Y96 A;  3SWN C;  2V1Q A;  3V8K A;  1TH7 A;  1QKX A;  3UA7 A;  3BDL A;  2IPO B;  2EJF A;  4WTO B;  1TD6 A;  2EUF A;  1SHF A;  2ATC B;  4J9E A;  1RAH B;  1W6X A;  2F2V A;  4AT1 B;  4BE0 A;  3CD6 T;  4HCC A;  2D8J A;  4PNO A;  3C4S A;  1M90 R;  4BE1 A;  4EOL B;  3G4S T;  1PG5 B;  3BG9 A;  3POM A;  3BY7 A;  1BB9 A;  1Y57 A;  3HTR A;  2MIO A;  1Q86 U;  1YWO A;  4HNT A;  2CP7 A;  3EH2 A;  5LJ5 j;  4HT9 A;  1NBE B;  1GCP A;  1WXT A;  4BY6 B;  3NTI A;  1IHW A;  3DLL A;  1YHQ A;  4HT8 A;  3I55 A;  2DXB B;  3MEU A;  2QQ9 A;  1HD3 A;  4KH0 B;  3CCQ T;  3GLX A;  3M9Q A;  1ZQ1 A;  4ELL A;  3CCE T;  1KD1 R;  4M7A E;  1VQO Q;  3LYI A;  4C5I A;  2FHD A;  1XJW B;  5IHK A;  2PU9 B;  1C6V X;  2RHX A;  3ZFJ A;  5FWC A;  2LTO A;  1PWT A;  1KIK A;  1MMD A;  4EOJ B;  3MI9 B;  3S3M A;  1M8M A;  2DD5 B;  2GQI A;  2L89 A;  3OYY A;  4F16 A;  5DQV A;  2DZ9 A;  3FJP A;  3QG1 A;  4G6L B;  2PUO B;  4M6V A;  1UB4 A;  2G77 A;  4PFZ A;  3EJ1 B;  2M9U A;  3MKD A;  2XI9 A;  2CYZ B;  4QW2 A;  3I5R A;  4MZM A;  3MET A;  1PCX A;  1XTD A;  4DBF A;  1ZSZ A;  2DZC A;  4JUV A;  4E7K A;  1R0B G;  2YXY A;  2E41 A;  2RNA A;  5L2W B;  2EW3 A;  4EOM B;  1J3T A;  4Y91 A;  9ATC B;  5IHN A;  1F5Q B;  1V29 B;  3CMA A;  1T0J A;  3BHV B;  3H4C A;  1SEM A;  2JM8 A;  1TS9 A;  3S3O A;  2EQJ A;  1NG2 A;  4HCZ A;  4OMM A;  4DBQ A;  4MDW A;  2LJ0 A;  1AD6 A;  2RM4 A;  3CD6 Q;  3L2R A;  2UZB B;  4RTY A;  4RG8 A;  2KDS A;  4RTZ A;  3EH1 A;  4J9D A;  3VS3 A;  3MY5 B;  5GAO q;  3RER A;  2NUT B;  4EC9 B;  2J06 A;  3G4S Q;  2DL8 A;  4CFM B;  2FO0 A;  4JX6 A;  5DQW A;  4AG2 C;  4M77 C;  3CPW P;  4ZN1 A;  5GMK i;  2AIR B;  1IXD A;  3CC7 A;  2HZY A;  2LQW A;  3EGD B;  2E12 A;  3JB9 D;  2DVE A;  2MYS A;  2SEM A;  1Q86 R;  4EIK A;  3H8Z A;  1ZLM A;  2JS0 A;  4M78 F;  2VB6 A;  2V22 B;  4XQ3 A;  2F5K A;  1OZ3 A;  3EHR A;  2HBW A;  4GY5 A;  5IDP B;  2EYW A;  3CCQ Q;  4E7H A;  2IW6 B;  1U3O A;  2RD1 A;  4C92 D;  2RF0 A;  2BS3 A;  1M1K U;  2IW8 B;  4LUE A;  3QO3 A;  3RGF B;  4M77 E;  5KCO A;  1WFW A;  2E65 A;  1Z9Q A;  2QK0 A;  3L42 A;  5CKB A;  1URC B;  1K73 C;  4C8Q D;  3JCM e;  2EYQ A;  2FRY A;  3LX7 A;  1QMZ B;  1U06 A;  4M78 B;  2ZAE A;  4M75 F;  3CME T;  2X4Y A;  5HKC A;  3ZL7 C;  4E7J A;  4IUR A;  5HQ0 B;  1Y0M A;  4JRK A;  1VQ6 Q;  4BCM B;  4HNU A;  5HK3 A;  2F69 A;  1VQK A;  3PNW C;  1GXI E;  4EOO B;  3BLH B;  3V7S A;  1VQ7 T;  1I8F A;  1VQM A;  2JMA A;  5CCA A;  1OL1 B;  4Z8A A;  2FZC B;  4RCC A;  4BDZ A;  1VQ9 A;  3U23 A;  1Q7Y U;  1RAE B;  3A8G B;  1JJ2 S;  4M75 B;  3N5B B;  1K9A A;  2UZL B;  2WMB B;  2W2H A;  5D6Y A;  2KMG A;  1W70 A;  1K9M C;  4J6Y A;  1AZG B;  1KHC A;  2QYZ A;  1YJ9 T;  2I2L A;  2LDM A;  2YHT A;  3BLR B;  2FYK A;  2HKN A;  1PKT A;  2QGG A;  1IRX A;  3F5X B;  1KQ2 A;  2RJD A;  4CRI A;  3OW2 A;  4M7A G;  2MPX C;  2DFU A;  2CZ0 B;  2WIH B;  5LJ3 g;  4F17 A;  3TSZ A;  1UTI A;  1MUZ A;  3CCR Q;  2C6T B;  3E1S A;  5KYY B;  2RQR A;  2KYM A;  3H0I A;  4I3Z B;  1EFN A;  2WIP B;  2QA4 T;  3KUF A;  2DTI A;  5C6S A;  1TUD A;  3HHT B;  4IIO A;  5IHI A;  4HCK A;  3UWN A;  2PTK A;  1GUX B;  3JV3 A;  5KYW B;  4CFW B;  3OBW A;  2X9H A;  2EGC A;  1C0M A;  2K2M A;  3VS2 A;  1M1K R;  2JJ9 A;  1RAC B;  2MF2 A;  3G7Z A;  3X25 B;  2E5Q A;  4M4Z A;  3AT1 B;  1PKD B;  2KRS A;  2F1L A;  5DLQ E;  5GAM e;  4DA4 A;  4LNP A;  3BG3 A;  3CME Q;  2EQM A;  2RJE A;  2DET A;  4ESR A;  1KC8 C;  2K5I A;  3F70 A;  1I0C A;  4BCQ B;  1E7O A;  2EKO A;  1WJQ A;  4FT2 A;  2RPN A;  1ZUY A;  5GAN 6;  2LC4 A;  3REA B;  2H3J A;  3UF4 A;  3QJY A;  1WPY A;  1BCO A;  2EWN A;  3UPU A;  2VWF A;  4MDX A;  4JS5 A;  2YRV A;  5IDN B;  1WHL A;  4C8Q C;  1H3H A;  3TCJ A;  1YIT A;  2BKZ B;  3JCM J;  3CCL Q;  2A37 A;  2CP6 A;  2CUD A;  2ZGW A;  3VS0 A;  4PJO C;  3CCS T;  2KE9 A;  1KXU A;  2JZ2 A;  4OGE A;  5A2Q E;  4F7L B;  1SKU B;  3SD4 A;  4C92 E;  1RAG B;  1Q7Y R;  4Q5W A;  4CFU D;  3QWL A;  3L2V A;  1YJ9 Q;  3FRN A;  1VQN A;  1TOV A;  2LCC A;  2HEQ A;  2XDB A;  3VYG B;  4A53 A;  3QWX X;  4NL3 A;  1WHH A;  3I56 T;  3OYD A;  2D0Q B;  1Q81 C;  4C8Q E;  4FU6 A;  4LUD A;  3OYL A;  1YI2 A;  3PT9 A;  4OB2 B;  2L3P A;  1VQ7 A;  2CCI B;  2MWP A;  3CCJ A;  4M77 G;  2CT4 A;  2GTO A;  4EPC A;  4XU1 A;  1QP3 A;  4NC6 A;  2QA4 Q;  2CP5 A;  1G3N C;  1FXX A;  3OYB A;  3V8L A;  2DM1 A;  3SHW A;  1YP5 A;  2X4J A;  3VV0 A;  3DB3 A;  4PLI A;  2DXB A;  2BTT A;  3A8O B;  1OIY B;  3C0C A;  5LL6 S;  2P0K A;  4RKU E;  2DBM A;  1K0X A;  3PMT A;  4RTX A;  1U1T A;  1ARK A;  3CXC S;  2XMF A;  4FYW B;  1VQ5 T;  1X6G A;  4V2S A;  1MV0 B;  3C95 A;  1X27 A;  4LDW A;  1FX7 A;  1Y71 A;  1FVV B;  4BCK B;  5LMK B;  2DD5 A;  1QWF A;  3KXT A;  3MPU B;  4RTW A;  4E6R A;  2RJF A;  1HSQ A;  4F7U E;  4E7Z A;  1TTH B;  1VQ8 A;  4BCI B;  1RLP C;  2JN0 A;  1QVG S;  3QBY A;  3CCM T;  2RJC A;  5HVY B;  1UUE A;  3QYB A;  1RAF B;  3RKX A;  4JRQ A;  3PTA A;  4BCP B;  3PGG A;  1BU1 A;  4QKU A;  4YC3 B;  4UN0 A;  4ZGJ B;  2W9F A;  2VGN A;  5BNJ B;  3BHT B;  1MNE A;  1KG1 A;  2EJG A;  3MP8 A;  1BYM A;  4IUV A;  3CCS Q;  1YJW A;  3NDQ A;  3BDU A;  2OTL T;  1MMA A;  4EDU A;  3R6O A;  2EYX A;  2QQA A;  2AKK A;  2DK3 A;  1GRI A;  2BZ8 A;  4MZT A;  4X9D A;  5FU6 B;  3G6E Q;  2EQK A;  1PNJ A;  4N4I A;  1LJO A;  2KY9 A;  4D6W A;  2CH4 W;  3I56 Q;  1SSH A;  3UDC A;  2DYI A;  3SB2 A;  4XAX B;  3OYK A;  5FRM A;  3JCM d;  2JT4 A;  1AWJ A;  5CKH A;  1KQS A;  2ZZD B;  2MI6 A;  2V1R A;  3EAE A;  2PHG A;  2HCK A;  4M7A B;  2W9Z A;  2DE0 X;  5FGK B;  3DDQ B;  3MCA B;  3OYJ A;  2P4T A;  2EVR A;  1QVF P;  1WHM A;  2O4X B;  4II1 A;  2J7I A;  1H92 A;  4IUU A;  4XTV A;  1K8A U;  2AK5 A;  2RK2 A;  1UEC A;  2VV5 A;  2XD0 A;  3J7A F;  1OZ2 A;  3QWY A;  4A4K A;  1Q82 C;  2HKQ B;  5A0G A;  4BB7 A;  2FB7 A;  4B9W A;  1WA7 A;  4IUQ A;  2F2C A;  5IXF A;  2QXF A;  1VQ5 Q;  5DY9 A;  1OPL A;  1FMW A;  2CP3 A;  2COY A;  4PJO A;  4EOS B;  2IVX A;  4OB0 B;  4JLI A;  5LJ5 e;  4CRL B;  5A0D A;  1GH6 B;  3OMC A;  5EFQ B;  3HL8 A;  3JB9 G;  4X9C A;  1D1C A;  4M78 A;  2E70 A;  2GQV A;  5LJ3 d;  1O9S A;  3CC2 A;  3JB9 I;  1RL2 A;  3IQL A;  4FW1 A;  4F6S B;  3L2Z A;  4ORZ A;  3CCM Q;  2DL5 A;  3VU3 C;  5I2M A;  5KYU B;  1GCQ C;  5KYX B;  2HNI A;  4C92 G;  1WDX A;  3UA6 A;  2VVK A;  4F70 B;  3CPW S;  1PSF A;  3G71 Q;  5I2S A;  1D1A A;  2OAW A;  4LXC A;  2AHJ B;  5GAO m;  1Y07 A;  4C8Q G;  2HQX A;  2ECZ A;  3LH0 A;  5M9O A;  3A8H B;  5CKD A;  1IGU A;  4M77 F;  4XTU A;  2LJ3 A;  4M75 A;  4K11 A;  2F2W A;  3OBY A;  2L0A A;  3OB9 A;  2OTL Q;  1X69 A;  1VYU A;  3E19 A;  1UGR B;  4KGX B;  1VOL A;  3MIA B;  2VXF A;  1D1B A;  2R5A A;  1M30 A;  4N0A A;  5GAN d;  3CXC P;  1QLB A;  5GAN 2;  4O5V A;  4JRP A;  2UUE B;  2WPA B;  2DKG A;  3OSS C;  2I53 A;  4OR5 B;  5HBE B;  3VKG A;  1MND A;  5GAM d;  4BDY A;  4PK4 A;  3QYG B;  1W4S A;  4EC8 B;  1RI0 A;  4BCN D;  1TU0 B;  2LT4 A;  3CC4 T;  2CRE A;  3QPH A;  5KYY A;  1X2Q A;  3M0R A;  1N4M A;  1PC0 A;  1PD1 A;  2LQK A;  1VQP T;  4OML A;  1QVG P;  3FB9 A;  2HQE A;  5FWB A;  1JO8 A;  2ED1 A;  4JS4 A;  2ZPE B;  1YBY A;  3CCV T;  1GUX A;  1UJ0 A;  4OB3 B;  1K8A R;  4F7U G;  3T9N A;  3QII A;  1O75 A;  4F6W B;  1WJR A;  2MAM A;  2JS2 A;  2FPD A;  2OTJ T;  2D0N A;  3OA6 A;  1FMK A;  4C0Z A;  3HBL A;  1ZP2 A;  1KFZ A;  1SG5 A;  3M0Q A;  3GP8 A;  2X51 A;  3JRZ A;  2R5M A;  5IN1 A;  3EG0 A;  3EID B;  5LJ3 f;  2COZ A;  7AT1 B;  1OI9 B;  1W1F A;  1H25 B;  2RK1 A;  2K7A A;  1IZ6 A;  3TW6 A;  4DBR A;  4E47 A;  3PIO A;  5ECA A;  1G3T A;  1GBR A;  1E9H B;  2C0O A;  2DIG A;  2CCH B;  1NLO C;  4C0D C;  5HBH B;  2WMA B;  4FYX B;  4C0F A;  2W10 A;  2KNB B;  1LOJ A;  3EG2 A;  3PIP A;  3EG3 A;  5IAY A;  5KYN A;  1R77 A;  1WYX A;  2OJ2 A;  2EYY A;  3OYH A;  3LW5 E;  3CBP A;  5EJC A;  3UT1 A;  2V8I A;  1I1J A;  1S72 Q;  2HL3 A;  3ME9 A;  4OP0 A;  3M0U A;  2X35 A;  4CC7 A;  2DXC A;  3OS2 A;  2EQU A;  1VQ6 T;  5GAN f; 
#chains in the Genus database with same CATH homology
 2GCX A;  4J6Y A;  2C06 A;  4B9X A;  3OYI A;  3ZBD A;  1WGS A;  2XIC A;  4KUI A;  2RH2 A;  1KHC A;  4MML A;  1YJ9 T;  1W2B S;  2I2L A;  2LDM A;  2K2V A;  4QQG A;  1K8A C;  1VQO A;  1P92 A;  2RB6 A;  2YHT A;  3VYG A;  2X4X A;  2VGM A;  2V8J A;  2FYK A;  3MO8 A;  4PKC C;  1VQ5 A;  3QKJ A;  4IUP A;  3LGF A;  2Y4X A;  5CKF A;  3LGL A;  1D3B B;  4OGC A;  4PLL A;  3RMS A;  1VQ4 A;  1MGQ A;  1KQ2 A;  1N27 A;  2RJD A;  3AHU A;  4CRI A;  2FL7 A;  3OW2 A;  4M7A G;  4LDX A;  5CK9 A;  1M8V A;  1KC8 U;  1S72 T;  4J7I A;  4M75 E;  4MIM A;  2CZ0 B;  2R57 A;  2QF7 A;  3OS5 A;  1NZ9 A;  3QJ6 A;  5LJ3 g;  1N9R A;  4PJO G;  2EIF A;  4WF2 A;  2QEX T;  3JB9 F;  3E1S A;  3SDZ A;  1ZHI A;  3ASK A;  2QA4 T;  3KUF A;  1BIA A;  1G3W A;  2DTI A;  3GNF B;  3CCM A;  5C6S A;  3CPW A;  3JCM f;  4ZN3 A;  3CMA T;  4HA8 A;  3HHT B;  4M7D D;  2V8K A;  4M7D C;  1G5V A;  2WAC A;  3P8D A;  5GAM j;  3UWN A;  1D3B A;  2O01 E;  2ZPB B;  3P8H A;  1Q7Y C;  4C92 F;  2XU8 A;  3OBW A;  3G71 A;  1BKB A;  2Y4Y A;  3OS1 A;  1YJN T;  3JCM b;  1QP2 A;  2XDP A;  2A3L A;  4M77 B;  3KHI A;  3VKI A;  2D9T A;  4MZP A;  4HNV A;  4BBS M;  1X6O A;  3CCR T;  2MF2 A;  3RMQ A;  3V8J A;  4A4E A;  2WSF E;  3G7Z A;  3CCU A;  4C8Q F;  3X25 B;  2D6F A;  3CC7 T;  3VKH A;  2E5Q A;  3OYG A;  2OTL A;  4EMK B;  4M7A F;  3C94 A;  5DLQ E;  4BI4 A;  5C0M A;  3PMI A;  1Q82 U;  1I81 A;  5GAM e;  1KQS S;  5I21 A;  3DB4 A;  3RKW A;  1UGS B;  4XTW A;  4DA4 A;  3BG3 A;  1NJI U;  2EQM A;  2RJE A;  2QTX A;  3CD6 A;  1JBM A;  1YCY A;  3A5Z B;  3OYM A;  5GMK l;  1KC8 C;  2K5I A;  3F70 A;  3V7C A;  3URG A;  2EKO A;  1JB0 E;  1WJQ A;  4C92 B;  4FT2 A;  5FU6 C;  3NFC A;  5GAN 6;  1HXD A;  3G4S A;  2LC4 A;  5FRN A;  2E10 A;  2H3J A;  3GIB A;  1KQ1 A;  1WPY A;  2EWN A;  3QJY A;  4LOC A;  3UPU A;  1VIF A;  3HRU A;  4MDX A;  4FIB A;  3NTH A;  3TEE A;  3LWI A;  4JS5 A;  2YRV A;  4KUL A;  4C8Q C;  3FC3 A;  3TCJ A;  5FU7 B;  3M54 A;  4EMK A;  4Z02 A;  1YIT A;  3S6W A;  4N4H A;  5GAN 7;  3M5A A;  4KBM B;  3JCM J;  4M7A C;  2E6N A;  2CZ6 B;  3A8L B;  4J83 A;  2ZGW A;  4PJO D;  1UEB A;  2E64 A;  4PJO C;  3CCS T;  4ZTJ A;  3JCM c;  2JZ2 A;  2LCL A;  3KBG A;  3EFR A;  4OGE A;  2QFZ A;  3X20 B;  5A2Q E;  1VQL A;  2VXE A;  4C92 A;  3SD4 A;  4BY6 C;  4C92 E;  2ZPF B;  2PVO B;  1NPP A;  4Q5W A;  5J3B A;  2QQR A;  3JCM g;  4FL6 A;  3QWL A;  3CCQ A;  4QQD A;  5J39 A;  4M78 D;  3L2V A;  2VUB A;  3QZ9 B;  2JUF A;  5FLX E;  5GAO n;  3L2U A;  1M90 U;  4C0D B;  2XHC A;  4NL2 A;  5LJ5 d;  3CCE A;  3CPF A;  3HP9 A;  3FRN A;  1N8R U;  5LJ5 h;  1VQN A;  1VIE A;  5CIU A;  4F7U F;  5L8R E;  4HLQ A;  2LCC A;  2XDB A;  3VYG B;  2QDJ A;  4A53 A;  4NL3 A;  3I56 T;  1U8R A;  3OYD A;  2JOY A;  2D0Q B;  3HO8 A;  5CVI A;  4C8Q A;  4C8Q E;  4JJN K;  2JTM A;  4OMF B;  2DXU A;  4FU6 A;  4PL6 A;  4ZGE B;  3SFM A;  3FEO A;  3OYL A;  1XQH A;  4J8O A;  4XU2 A;  1YI2 A;  1VQK T;  4CI0 C;  3QYE A;  3JAM E;  2JNG A;  4OB2 B;  3PT9 A;  3CCL T;  1R8O B;  1VQ7 A;  4M7A A;  2E6Z A;  4ELY C;  2DIQ A;  5CAI A;  2JVV A;  1NE8 A;  5GAO p;  1M1K C;  2VYT A;  2MWP A;  2EAY A;  3CCJ A;  4VUB A;  1EIF A;  4JX5 A;  1M5Q 1;  4JLG A;  4M77 G;  4EPC A;  4OF1 A;  4XU1 A;  3LWH A;  1QP3 A;  2O4X A;  3C12 A;  3MEW A;  2M1H A;  4E7I A;  4ATO A;  4NC6 A;  1YIJ T;  2M16 A;  1FXX A;  2DD4 A;  4EMH A;  3OYB A;  3V8L A;  1VQ9 T;  1E7P A;  5CQX A;  2YLC A;  4BBR M;  4J6X A;  2WSC E;  4R55 A;  4FM4 B;  3JCM Q;  3QZ5 B;  3BFM A;  1QVP A;  2X4J A;  1WQW A;  3VV0 A;  4A4F A;  3DB3 A;  4PLI A;  3QUI A;  2DXB A;  1XNI A;  5GAM f;  4M7D F;  3A8O B;  4MFE A;  1KD1 U;  4M75 D;  5LL6 S;  1K9M C;  1Q81 C;  2P0K A;  4F7U B;  4RKU E;  4QVC A;  2E1H A;  2G3R A;  2K57 A;  2KSS A;  2LNV A;  4BI3 A;  2PVD B;  3MHX A;  1KHI A;  2DXT A;  3PMT A;  1U1T A;  3WVE B;  3MEV A;  3CXC S;  1VQO T;  1JJ2 A;  4GLK A;  2KQW A;  4J5Y A;  2P0P A;  1VQ5 T;  5CKE A;  1HK9 A;  2DTH A;  2BUD A;  3TW7 A;  3EFS A;  2XID A;  4V2S A;  2CS7 A;  2BKD N;  3C95 A;  3OY9 A;  2QQS A;  4LDW A;  1FX7 A;  2DO3 A;  3Q1J A;  1Y71 A;  4RG2 A;  2RA2 A;  3X28 B;  1W2B A;  3OS0 A;  4A4G A;  2DD5 A;  1S72 A;  1N8R C;  3PFS A;  3FIF A;  2XG8 D;  1N9S A;  2DTO A;  3HKS A;  4RCB A;  3KXT A;  2CZ1 B;  4M78 G;  3RES A;  4IKF A;  2QEX A;  2RJF A;  3DL1 A;  4Z6Y A;  2F5T X;  1LNX A;  4EMK C;  2WJ9 A;  5GAO l;  4F7U A;  4F7U E;  5KH6 A;  4X34 A;  2QI2 A;  3TU4 K;  1VQ8 A;  2JN0 A;  3J80 E;  1QVG S;  3QBY A;  4M7D B;  4NOY A;  3CCM T;  4KUD K;  2RJC A;  3M4G A;  3M59 A;  5J26 A;  4L6V 5;  1OI1 A;  1I4K 1;  5GAN 8;  2KAF A;  3QYH B;  3E9G A;  3QYB A;  3WVD B;  1X01 A;  3RKX A;  3J81 E;  3PTA A;  4JRQ A;  4R56 A;  2OTL T;  3PGG A;  4ME7 A;  3BW1 A;  5IT9 E;  1ZBX A;  3GF5 A;  4C5H A;  4J6W A;  1NPR A;  4ZGJ B;  1XOV A;  4P5N A;  3L2Q A;  2VGN A;  4E7L A;  4MFD A;  2CKK A;  3OYC A;  1BI3 A;  1Y7X A;  4XTZ A;  1YJN A;  3JCM P;  3OSV A;  3CBO A;  2LX9 A;  3UDC A;  4FT4 A;  3CC4 A;  4LDY A;  1KG1 A;  5GAN 4;  2GFA A;  1QVF S;  2EJG A;  5A0G A;  3MP8 A;  4RMO A;  3CCR A;  4EMG A;  2DPP B;  5D6X A;  4M77 D;  4HCB A;  1VQP A;  4M7D A;  4M7D E;  1BYM A;  4IUV A;  1H3Z A;  5GMK m;  1YJW A;  4PJO F;  3CCU T;  4XU0 A;  3OYF A;  2JTF A;  4M75 G;  1Y96 A;  3SWN C;  5GAN g;  3V8K A;  1B34 A;  3BDU A;  4DQ2 A;  4ELJ A;  3CCV A;  4EDU A;  3VYH B;  1TH7 A;  3HRS A;  2WSE E;  3R6O A;  4FSX A;  3BDL A;  2QQA A;  2EJF A;  2DK3 A;  3HB9 A;  2OTJ A;  4MZT A;  4BE0 A;  4X9D A;  1MHN A;  3DKM A;  5GAM g;  5FU6 B;  2OAU A;  3CD6 T;  4HCC A;  2EQK A;  3HZJ A;  4N4I A;  1LJO A;  2KY9 A;  4PNO A;  4D6W A;  3C4S A;  5KCH A;  3GOX A;  2B8A A;  2QQ8 A;  4AKH A;  2HBP A;  2IG0 A;  2KK4 A;  4AKI A;  3DLM A;  4XAX B;  3SB2 A;  3JCM d;  3OYK A;  5FRM A;  2KR6 A;  3G4S T;  5CKH A;  3BG9 A;  2ZZD B;  2MI6 A;  1WNL A;  3BY7 A;  3JCM h;  4C8Q B;  1KQS A;  4C5E A;  3EAE A;  4JRI A;  4QSH A;  2L3R A;  4M7A B;  1Q86 U;  2LRQ A;  3MCA B;  4HNT A;  4TVR A;  3ZEH A;  2P4T A;  3OYJ A;  1YIT T;  2BIV A;  5LJ5 j;  4HT9 A;  4XTX A;  4ELZ C;  4PJO B;  2PUK B;  3SWN A;  2O4X B;  4II1 A;  5KE2 A;  1BI1 A;  4M78 C;  3NTI A;  4BY6 B;  4IUU A;  2DD4 B;  4XTV A;  3CME A;  1K8A U;  3ER0 A;  2RK2 A;  4JX4 A;  2VV5 A;  1X75 C;  2L8D A;  1OZ2 A;  4NS5 A;  2XD0 A;  3DLL A;  3G6E T;  3J7A F;  2XK0 A;  4LDV A;  1VQL T;  1YHQ A;  3HPW A;  1G3Y A;  4HT8 A;  3FDR A;  2RHU A;  3I55 A;  2DXB B;  3MEU A;  2QQ9 A;  2ZZD A;  4A4K A;  3CCQ T;  1Q82 C;  3GLX A;  3M9Q A;  4BB7 A;  1G3S A;  2FB7 A;  1ZQ1 A;  1UGQ B;  3MEA A;  3RKY A;  4B9W A;  4IUQ A;  3OQ5 A;  1NJI C;  3CCE T;  2K3X A;  5HY6 A;  5D6W A;  2QXF A;  3E9F A;  3LYI A;  3M58 A;  1VQN T;  4M7A E;  4C5I A;  2FHD A;  5DY9 A;  5DLO A;  2PU9 B;  4ZGD B;  4IUT A;  5EG2 A;  2CGH A;  4PJO A;  4PJO E;  4OB0 B;  2RHX A;  4JDS A;  4JLI A;  3ZFJ A;  3HFO A;  1YI2 T;  5LJ5 e;  2QQB A;  5CR2 A;  5A0D A;  3CCL A;  2P0Q A;  2Y90 A;  1M1F A;  5LJ3 j;  3OMC A;  2LTO A;  2A7Y A;  3HL8 A;  3CBM A;  3JB9 G;  3MP1 A;  4X9C A;  5GAO r;  1BI0 A;  2LVM A;  3S3M A;  1N6A A;  2XKO C;  2EFI A;  2LT1 A;  3CEY A;  2DD5 B;  1FWZ A;  2L89 A;  3M57 A;  2E70 A;  3OYY A;  4M78 A;  3CCJ T;  2GQV A;  3OYE A;  5LJ3 d;  4AKG A;  1O9S A;  2DZ9 A;  3FJP A;  3CC2 A;  5LJ3 h;  1VQ6 A;  3QG1 A;  1JRI A;  2K5F A;  3JB9 I;  4M75 C;  2XDD A;  1RL2 A;  3L2Z A;  3A8M B;  5GMK j;  3OW2 S;  2L5Q A;  3RIR A;  1YJ9 A;  2PUO B;  3VU3 C;  3QDR B;  1H64 1;  4M6V A;  3P8B B;  4L59 A;  5I2M A;  1UB4 A;  5HK0 A;  2G77 A;  2HNI A;  2M9U A;  4C92 G;  2R58 A;  3JB9 J;  2ZPI B;  1I5L A;  4L5G A;  3M4Y A;  4BD3 A;  2XI9 A;  5GMK h;  3WXM B;  3QXE B;  1VQ4 T;  5FRO A;  2CYZ B;  3HRT A;  4N0A C;  4QW2 A;  2ZPH B;  1M90 C;  3CPW S;  4Y28 E;  4N4G A;  4MZM A;  1PSF A;  5LJ3 e;  5I2S A;  3MET A;  1XTD A;  2AHJ B;  5GAO m;  2DZC A;  4JUV A;  3H6Z A;  1Y07 A;  3BG5 A;  4A54 A;  2HQX A;  4C8Q G;  2M0O A;  1BI2 A;  4E7K A;  2E41 A;  3INZ A;  3A8H B;  3LH0 A;  5M9O A;  1SSF A;  3QSU A;  2QA4 A;  5CKD A;  3M56 A;  4M77 F;  4XTU A;  5AYF A;  2ZPG B;  2KVQ G;  2RHY A;  4Y91 A;  4M75 A;  4KT0 E;  5GMK e;  1V29 B;  1FKM A;  3M55 A;  3OBY A;  5GAN 5;  5CO7 A;  3CXC A;  3CMA A;  3OB9 A;  1Y96 B;  3H4C A;  1B34 B;  3E19 A;  4QQ6 A;  3HFN A;  3TRE A;  1UGR B;  4DOV A;  5GAN j;  3S3O A;  1VQ8 T;  2EQJ A;  4HCZ A;  4MDW A;  2VXF A;  1K73 U;  2RM4 A;  3L2R A;  2R5A A;  3JSC A;  4N0A A;  4RG8 A;  5GAN d;  2KDS A;  3G71 T;  4LDU A;  5GAO q;  1QLB A;  5GAN h;  4O5V A;  5GAN 2;  3GNG A;  4JRP A;  3RER A;  4BE2 A;  2DKG A;  4BAC A;  4LD9 K;  2IVW A;  1KD1 C;  3OSS C;  4JX6 A;  1QVG A;  3VKG A;  5GAM d;  1BIB A;  4BDY A;  4M77 C;  2FVU A;  2VC8 A;  4ZN1 A;  3QYG B;  5GMK i;  5GAM h;  1W4S A;  4AI6 A;  2RO0 A;  2GF7 A;  3CC7 A;  1RI0 A;  3JCM W;  5KE3 A;  2CZ7 B;  2E12 A;  2LT4 A;  3CC4 T;  3QPH A;  5LJ5 f;  3JB9 D;  4QVD A;  1WQ7 A;  2DVE A;  2HD0 A;  2LQK A;  3H8Z A;  3SWN B;  5GAN e;  1VQP T;  2RHZ A;  2BS4 A;  4QVZ A;  3FB9 A;  2EJ9 A;  2HQE A;  4M78 F;  4UC4 A;  2QDY B;  4XQ3 A;  4DOW A;  1YJW T;  3HSB A;  2RI5 A;  4JS4 A;  2ZPE B;  2F5K A;  1OZ3 A;  1PSE A;  1Q81 U;  1YBY A;  3QHS A;  4GY5 A;  3CCV T;  1AHJ B;  1UGP B;  4OB3 B;  1M4Z A;  3JB9 H;  4E7H A;  4F7U G;  4YTL A;  3T9N A;  3QII A;  1QVF A;  1O75 A;  1WJR A;  2MAM A;  4J7F A;  3JCM V;  2RD1 A;  4LD6 A;  4C92 D;  2OTJ T;  4C92 C;  4OVA A;  2BS2 A;  2DAQ A;  2BS3 A;  5CQY A;  3OA6 A;  2PVG B;  1M1K U;  3QO3 A;  3FLG A;  3MP6 A;  4BI8 B;  3OYN A;  2PQW A;  2X4W A;  4C0Z A;  1VUB A;  2MWO A;  4M77 A;  4M77 E;  4XK8 E;  3HBL A;  5KCO A;  2E65 A;  5GAN 3;  1OYX A;  3VUZ A;  3GP8 A;  3L42 A;  4MMK A;  3JRZ A;  4A4H A;  2R5M A;  5CKB A;  5FU7 C;  5IN1 A;  1K9M U;  5LJ3 f;  1K73 C;  4XU3 A;  4C8Q D;  3CCS A;  3VUB A;  3JCM e;  2EYQ A;  1M1G A;  2YLB A;  3LX7 A;  3OYA A;  4M7A D;  4M78 B;  2RK1 A;  1IZ6 A;  3V7R A;  4BUG A;  3TW6 A;  1VQM T;  5DM7 R;  4E47 A;  4M75 F;  3X24 B;  2GFU A;  3PIO A;  2RHI A;  4M7D G;  5A0L A;  3CME T;  1G3T A;  2RI3 A;  2X4Y A;  1WJS A;  5HKC A;  3G6E A;  4E7J A;  3JCM X;  4IUR A;  2DIG A;  4JRK A;  3RUX A;  3S3N A;  2DEQ A;  3I56 A;  2LQ8 A;  4HKE A;  4C0D C;  1YHQ T;  1M9S A;  2K4Y A;  2DXC B;  4HNU A;  1DJ7 B;  2ZCF B;  3LLR A;  5HK3 A;  4C0F A;  3I55 T;  4BE1 A;  2HAX A;  2F69 A;  1LOJ A;  1VQK A;  3PNW C;  3PIP A;  5IAY A;  1GXI E;  4OB1 B;  3L2W A;  3L1A A;  2RI2 A;  4XTY A;  2DJZ A;  3V7S A;  1VQ7 T;  4HL4 A;  1I8F A;  1VQM A;  1U1S A;  2NLU A;  4C0G A;  3OYH A;  4M78 E;  5CCA A;  3LW5 E;  3CBP A;  3M53 A;  4ZTF A;  5EJC A;  3NTK A;  1YIJ A;  4RCC A;  4BDZ A;  1VQ9 A;  3O8V A;  3UT1 A;  1Q7Y U;  2V8I A;  3X26 B;  1QW1 A;  3VJP A;  4C5G A;  5LJ5 g;  3A8G B;  1JJ2 S;  2K3Y A;  3ME9 A;  4OP0 A;  4O6J A;  4M75 B;  3GPL A;  1Q86 C;  2X35 A;  2MMP A;  3N5B B;  3OMG A;  2DXC A;  3OS2 A;  1IRE B;  2K5L A;  2EQU A;  3CC2 T;  5D6Y A;  1VQ6 T;  2KMT A;  5GAN f;  2KMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...