3A8MB

Crystal structure of nitrile hydratase mutant y72f complexed with trimethylacetonitrile
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPFYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 57
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8mB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8mB02
3VYGB 3X24B 2DXBB 3X28B 1PSFA 4OB1B 2WSCE 2ZPFB 2PVOB 4RKUE 4ZGDB 1PSEA 1UGSB 1IREB 2CZ6B 1GXIE 3LW5E 2WSEE 1QP3A 2ZPEB 2PUKB 2DXCB 4XK8E 3WVDB 2O01E 2DD5A 2ZPGB 3X25B 2D0QB 2CZ0B 3VYGA 4OB0B 4L6V5 2CYZB 2PUOB 3QZ9B 4OB2B 3A8HB 4FM4B 3WVEB 3A8GB 3A8MB 1JB0E 2CZ7B 2ZPBB 2ZCFB 3X26B 4KT0E 4ZGEB 2DPPB 2PVDB 2DD5B 4ZGJB 2ZPIB 3QYHB 3QYGB 1DJ7B 1AHJB 3HHTB 2WSFE 1UGRB 4OB3B 2QDYB 3QXEB 1UGQB 2AHJB 3VYHB 1UGPB 2CZ1B 2ZZDB 2DD4A 3X20B 3QZ5B 2PU9B 5L8RE 2PVGB 2DXCA 1QP2A 2ZPHB 2DD4B 2ZZDA 3A8LB 2DXBA 3A8OB 4Y28E 1V29B
chains in the Genus database with same CATH superfamily
3HO8A 4IURA 2E6NA 3QHRB 2XD0A 1VYWB 1FMWA 3RNJA 4LDXA 1VQLA 4TVRA 5LJ5f 1BK2A 2XU8A 4MMKA 2E41A 3M0SA 1JSTB 2DTHA 3CD6T 2EUFA 1JQQA 4MDWA 4AKHA 1M1KU 5FU6B 1OPKA 1MV0B 2P0KA 3LWHA 1KC8C 1KHIA 5FWBA 1OIUB 1NPRA 4F14A 4OP0A 2FL7A 1JBMA 1F5QB 1WZOA 1VQ6A 2V8JA 4CI0C 4XK8E 2P0PA 1XJWB 1T0JA 2DFUA 2M1HA 4Z88A 4KULA 3I55A 1D09B 1WHLA 4BCQD 1Q95G 3CCJT 5LJ3f 4PJOA 5I22A 4M75E 2YRDA 1UB4A 2KYMA 2AZVA 2VGMA 1YHQQ 3GP8A 2J6KA 3JCMd 3OS0A 2D1XA 4UC4A 1AZEA 2OTLT 2QK0A 4PJOD 3EFRA 4RMOA 3H9NA 3G1JA 1VQ6Q 1VQ8T 2JMAA 2A3LA 5FU6C 4J6XA 3D7SB 4II1A 3JAME 2JN0A 2KXCA 4IUVA 4F7UA 1S72Q 1Q81C 3DKMA 4E7JA 3L2VA 1LOJA 1V76A 3I55T 3L2WA 1VQ9T 3GNFB 2KYBA 3NPFA 2F1LA 4GLKA 3GBQA 2D9TA 2RJEA 3X20B 1VQKT 3BW1A 2EGCA 3CBOA 4J9CA 3MJXA 1QKWA 1E6HA 3CCQT 1ARKA 1MNEA 2XIDA 2M9UA 1PHTA 2ZZDA 3GNGA 2WPAB 2ED1A 1Q86R 4JZ4A 1FINB 1N8RC 1JRIA 2QTVA 3LYIA 1SRLA 3OMGA 4D8KA 1O9SA 1KC8U 1M90R 2DKGA 1JJ2A 4BXXX 2X9HA 5GAOp 5KYUB 4M7DC 3QBYA 2RF0A 4N4IA 1EFNA 4LDUA 1JXMA 5LQFB 3CXCA 1BI3A 4AT1B 2GQIA 4QT7A 1Q7YR 2AKKA 2B86A 3RBBB 3CCLA 4F7UG 4BDZA 1N5ZA 1WQWA 2KGTA 5GMKm 3RR6A 2I2LA 4LUDA 3G71A 3SB2A 3CMAQ 1OU8A 4M77E 4ZN3A 1YIJT 1VOMA 3CCLT 2O01E 4PJOE 3I5SA 1OULA 3NTIA 4AFUC 2QA4A 2J7IA 4L59A 2W99A 2LMJA 5HY6A 2PUOB 1XTDA 1VQLT 3C12A 2X4WA 2EBPA 1CSKA 1AWOA 4FU6A 4OF1A 4LE9A 2P84A 2K7AA 5M9OA 5GAOm 4A63B 1TSFA 2MAMA 3OYNA 2LTOA 4LOCA 1K9AA 2ROTA 4I3ZB 1MGQA 1VQNT 2RHIA 3RUXA 2QEXT 3VRYA 1XOVA 4QSHA 3META 1U5SA 1PCXA 3MO8A 1UGRB 4EMGA 3CC4T 3CBMA 3VKHA 1BCOA 4CFWB 4C5GA 5LJ5g 4PJOC 4X34A 4HCCA 4E7HA 4JRQA 4JRPA 1G5VA 1G3WA 2OX7A 4F7JB 3GF5A 1WNLA 1OGUB 3EOCB 1D1AA 4M7AG 1XNIA 2XK0A 1UNHD 1SHFA 3TSZA 1D1CA 4M77D 2C0OA 2C5VB 2KR6A 4WCIA 4A4FA 1B34B 3FEOA 4F17A 1IGUA 2C5OB 1PKTA 2IIMA 2LJ1A 2K5IA 5KE3A 4MZTA 3OYJA 5FU7C 3QSUA 1P5EB 2MPXC 4PFZA 2A7YA 2DLPA 2KVQG 4M77A 2D0NA 2X3WD 3TVTA 3QWLA 1AD5A 1PKSA 2VV5A 1X43A 1VQ4T 4CRLB 2QDJA 5GMKh 1VQNA 2C5XB 3CCMT 3V7RA 1UTIA 3H4CA 4M78C 4RTUA 2DXCB 1SF9A 1UUEA 4C5IA 4LD6A 4RTZA 4M7DD 3EJ1B 5DM7R 1G8XA 1QWFA 3QJYA 4J9EA 2OTJA 4C8QC 4NL3A 1WJSA 2DL3A 4J7FA 3X25B 5HNBB 4PLLA 4A4HA 2KEAA 4BB7A 4CRIA 2V22B 1QCNA 5FU7B 3PNWC 4HKEA 3JB9G 2YUNA 3EFSA 2LC4A 1PRMC 2E3HA 4F6WB 2P4RA 3PE0A 2QASA 3CCQA 1VYVA 4VUBA 3A8GB 1UNGD 2HSPA 1M1KR 2SRCA 1QLYA 3EG9B 3X26B 4KT0E 4ZGEB 2JXBA 4GY5A 3M03A 2DL7A 1UHFA 2YT6A 2JUFA 3M9QA 4QVZA 4KUDK 3FDRA 3QYHB 5KE2A 2GBQA 2PMIB 1QLBA 3DOGB 2FVUA 1SSFA 1G3YA 1JOWA 1IGQA 2HMAA 3MY1B 2JW4A 4CC7A 5GANd 1YCYA 2O31A 1VQKQ 1OV3A 1YFNA 1KJWA 2ZZDB 4F7UE 4M78E 3CCST 4J9HA 3CCJA 3CCQQ 1I81A 2G77A 3BDUA 4FYWB 3L2UA 5IDNB 4M7AF 3PMTA 4LDVA 2KK4A 1SHGA 3ASKA 3P8BB 2ZAEA 2FB7A 1MMAA 4B6MA 1WXUA 3MCAB 2KBTA 3BFMA 1JKWA 1M90C 1YHQT 1OL2B 2DBKA 2NUZA 4LNPA 3OYFA 3BHTB 2RK2A 2X4JA 2ZGWA 3I5RA 4EMKB 3JCMg 3BLHB 5HK3A 4KRDB 2CS7A 2EVRA 3MKDA 1GBRA 2LNVA 4DBRA 4LXCA 2PTKA 4HCBA 1Q7YC 3ZL7C 2V8IA 1NZ9A 1ZX6A 4BE0A 5GMKi 4EOSB 4EOOB 3OY9A 2LQ8A 2DL8A 2LQNA 1R8OB 2RI5A 1E9HB 2YHTA 2CT3A 1RAIB 1BIAA 1VQLQ 1KC8R 4XTVA 4F7LB 5KCHA 1Q82C 2C5NB 3OMCA 4EC8B 1FVVB 3G6EQ 4Y91A 4BCHB 4LDWA 2KAFA 1ZHIA 3INZA 1WJQA 2H8HA 4EONB 4CFVB 2K9GA 3JRZA 2EIFA 3KBGA 4F6UB 2L8DA 2Z0WA 1CKBA 1BIBA 3RDVA 1BI1A 2FPFA 4C5EA 4L5GA 3M58A 4PJJA 2EYXA 5CAIA 3AT1B 1YJ9A 1GH6B 4EOIB 4OGCA 3LQ5B 1QVGA 1N27A 4CC4B 3QXEB 1QVGP 2KRSA 1ZSZB 3CMET 3CC2Q 5GJVB 2L3QA 3LGFA 2W0ZA 3OYYA 5GAMe 1OIYB 1GFDA 5KYYA 1K73U 5LJ5d 1NG2A 9ATCB 2GTJA 3EGUA 3JB9F 5I11A 5CKBA 2QQAA 2MOXA 8AT1B 3NHNA 3RIRA 4BE1A 2KMTA 2R5MA 5GAOq 1YJWT 1KIKA 4QW2A 2FG0A 1S72A 1PSFA 1TU0B 2EGEA 1WFWA 3HKSA 2CT4A 2YUPA 3H8ZA 2RQUA 2VXEA 3MEWA 3QJ6A 1LJOA 1RADB 3TSWA 1K9MR 1IHVA 2DL4A 5GMKe 1RL2A 2CP6A 1UGSB 2GNCA 2Y4YA 2OTLA 1VQ5T 1KK7A 3V7CA 5LL6S 1T3SA 1EZZB 3NFCA 2C4GB 4M78D 3L2QA 4KBMB 2ZPEB 3VKGA 3LH5A 5HBHB 1U3OA 2D6FA 1WHMA 3CD6Q 1VQNQ 1RACB 1ZA1B 3HRUA 4OB0B 3F5XB 2BKZB 2F2WA 1B3QA 3CCRA 2UZBB 3R6NA 2HBPA 4Y72B 1M3CA 1GY3B 2NLUA 2E1HA 5HCKA 4CFUD 3VJPA 1KSWA 3F70A 5DLOA 3S3NA 2KY9A 5A0LA 2O9VA 2V1RA 4FSXA 5KYWB 2ZCFB 5GAN3 1YJ9Q 2DRMA 2DPPB 3OYCA 1YBYA 2P0QA 2LJ0A 2G9XB 2A28A 4C8QB 1VQ8Q 2BZXA 2KNBB 4MMLA 4PJMA 1FYNA 3CC2A 1G3TA 4O6JA 1E7OA 3SFMA 4M78B 3CMAT 5CO7A 4PL6A 3CCRQ 4OGEA 4XTXA 4OB3B 1VQ4Q 2AIRB 4JRIA 3EGDA 2VC8A 4JS5A 1VQ6T 4FYVB 4EOQB 4AI6A 3T9NA 1YITA 2K3XA 1YP5A 2DD4B 1VQKA 2A37A 2I0NA 4RG8A 5LJ3h 2WEVB 4C92F 1G2BA 2DA9A 4EDUA 4M7DF 4PJLA 2X1NB 2A0FB 1UHCA 3HTRA 3OS5A 3G7ZA 1VQPQ 1WXBA 5FROA 2L89A 5IF1B 4FIBA 4M75F 1SSHA 1Y57A 4JX5A 2L3SA 3MEAA 3KXTA 2MMPA 4RKUE 3OYGA 2RHUA 2YDLA 2GFUA 1ZUUA 4F7UF 2IPOB 2KE9A 2HEQA 3S3MA 4F70B 1RLQC 5DQVA 1TUGB 2NWMA 2Y4XA 3EAEA 4RTXA 3OS1A 2K2MA 3UF4A 1VA7A 5KYYB 3LW5E 1QP3A 3RMQA 1I4K1 2YSQA 1OZ2A 3WVDB 1H1SB 2DD5A 3CPWA 1KD1R 2UZLB 4XTZA 2QXFA 3VYGA 3RKWA 3URGA 3M59A 1VIFA 3QDFA 1E6GA 2EAYA 4IUQA 3E2UA 3JCMf 1M3BA 1OEBA 3HFOA 2BZYA 1X6OA 4DBFA 3CC7Q 1ZBJA 2XDDA 3CCSQ 2LCLA 4HNUA 2XMFA 2EW3A 1Y96B 1VQOA 2EJGA 4JS4A 2DK3A 4BCND 1VQ4A 2D8JA 4M7DA 3REBB 3SWNC 2K57A 3I9QA 4D8DA 4CC3A 2E5KA 2WJ9A 1M4ZA 1W2BA 4ZTJA 3VUBA 1R77A 3LH0A 4ELJA 4M6VA 3B57A 3VUZA 3OA6A 3G4ST 2R58A 1FMKA 4JLIA 2CZ1B 1D3UB 4BY7X 2VB6A 2J6OA 4NL2A 3QWYA 2QDLA 3SD4A 4BBSM 4M4ZA 5FWCA 3N5BB 1H1QB 2QQ8A 4NC6A 1M90U 2HBWA 2UZEB 2DJZA 2PHGA 1I0CA 4NOYA 4EIKA 4PKCC 3M56A 4HNVA 4OMNA 2NUPB 4GLMA 3DL1A 1BYMA 1EX4A 3OYBA 3AHUA 2LQWA 1Q7YU 4E7LA 2K4YA 2H3JA 2DMOA 2EKOA 3UPUA 1IRXA 3GTMS 2K79A 4FW1A 2NUTA 4C8QG 5C6SA 1R0CB 4JX4A 2ZPFB 4KUIA 2DIGA 1K0SA 1TXQA 4CFMB 4F7NB 2DX1A 4F16A 4N4GA 2CUBA 5GAMd 1RI0A 3G4SA 2KSSA 2LRQA 1X6BA 2NUPA 2COYA 3EG3A 1WPYA 2AK5A 2RHZA 1K73R 4FT2A 3JCMe 3KUFA 4BCGB 4E47A 3CCUT 2JNGA 4JZ3A 4OMMA 1X2QA 5LMKB 5CR2A 4MDXA 2D0QB 4RTYA 1AISB 1JSUB 3MEVA 5A2QE 1YNZA 2FZCB 2PNIA 2DVJA 4OB2B 3A8HB 5GAOr 3V8LA 2DZ9A 1VQ7Q 4AKIA 4CC2A 1AVZC 2W2HA 3ER0A 1K9MU 4BY6C 1NM7A 4B9XA 2O88A 3POMA 4C0ZA 4IUPA 2J05A 4XQ3A 2DAQA 2UUEB 3GOXA 1K4US 5IAYA 1TUCA 4IIMA 1Q82R 2FHDA 2CH4A 4F04B 2KMGA 3JCMX 5CQXA 4IIOA 4EOPB 4J83A 3DJBA 4J5YA 3JB9H 2MYSA 1AWXA 1UGQB 4UN0A 3BDLA 4WF2A 3VKIA 3EHQA 3R6OA 4IMYB 4N4HA 1UJYA 2G6FX 5IXFA 1W1FA 3PFSA 2HL3A 5CKEA 2DXCA 2LQKA 2EFIA 1A0NB 2MI6A 5HQ0B 2DYBA 1NJIC 4HCZA 3TREA 3OSVA 1VQOT 3HFNA 2OTJQ 3X24B 3GLXA 3JCMW 1AWWA 4DBHA 3BLRB 2BUDA 1HYOA 3CCLQ 2IVWA 3PVQA 2ECZA 3J81E 5IHYA 2LX9A 1C6VX 3BHVB 1M3AA 2WIHB 2DIQA 3FRNA 4KGXB 4PJNA 1JO8A 4M75C 2DO3A 1WJRA 4N0AC 1H3HA 3OQ5A 2OJ2A 3GIBA 3PVLA 3EG2A 2GFAA 1SEMA 3NTKA 2AKLA 1QQJA 2RH2A 2HZYA 2JVVA 4BCOB 4PJOF 1QW1A 5CKFA 2PUKB 5FRMA 1WA7A 4IUTA 4E7KA 1VQ5A 5CEIB 2X4XA 4DEYA 1YJ9T 3PMIA 1YJNA 5KCOA 1QMCA 4ZN1A 1W2BS 2QAZA 3LLRA 2CUDA 2VXFA 3QWXX 1HK9A 1GBQA 5EG2A 4A4EA 4G6LB 1PD0A 3MP6A 2K3YA 2BS3A 2COZA 2D8HA 4XTUA 4LUEA 1FMVA 2FZKB 4F7SB 3UT1A 4M7AE 2DXUA 5CK9A 2YUOA 1O9KA 2XHCA 1ZLMA 2G3RA 3GPLA 1GCPA 1K8AU 1ZBXA 1BI0A 1M1FA 1G3SA 1OX8A 1AZGB 1M5Q1 5HBJB 2BPMB 1TD6A 2ZPIB 1O9KB 2L5QA 5GANf 1G3NC 3NMZC 3MPUB 4DBQA 3REAB 2QEXA 2BTTA 2RQRA 1KD1U 2W96A 4HVVA 3A1PA 4M7DE 1IZ6A 3L2ZA 2C0IA 2VYTA 2LNHB 4BY6B 2K5LA 2J06A 2WMAB 3CMEA 4J9BA 4PNOA 4PFPA 4BCKB 1UE9A 2CP7A 2CJMB 1QP2A 3CCVA 2BZ8A 2RQTA 1R0BG 1NEGA 3KHIA 2COWA 4R0KA 3CCUA 2LT1A 1S72T 2VASA 3M0RA 5GAMh 2KT1A 1WYXA 4RTVA 2H3EB 4M77C 3OSSC 4J9IA 1TFBA 2HCKA 2RQWA 2DEUA 1VQ9Q 2QFZA 3UA6A 4XAXB 5GANe 3ZEHA 3V8JA 1BKBA 4LN2A 1WI7A 4C0GA 2F2VA 3OYKA 2QGGA 2DXTA 2DMEA 4WTOB 1E7PA 1PRLC 3EHRA 4QKUA 3CXCS 3CCEA 3S3OA 5D6YA 3HP9A 3JCMJ 1M1KC 4M7AD 4C5HA 1ZSGA 2DERA 1JJ2S 3TQ7P 3CCUQ 3BHUB 2DYIA 4QVCA 3TW6A 2IN3A 1K73C 3OW2S 3G4SQ 2ZPGB 3CPWS 1OU9A 5DLQE 4EOLB 3I35A 4YOSA 3Q1JA 3LGLA 1MMNA 3A98A 3TNIB 3CXCP 1H1RB 1UDLA 1XQHA 2OAUA 1QVFP 3A5ZB 2C6TB 1BB9A 2FRYA 4KRCB 2EGAA 2CGHA 1N9RA 4NSTB 2E12A 2DRKA 1M2VB 3CEYA 1H25B 1JJ2P 3FJPA 1T3LA 3EFOA 1YIJQ 2LT4A 4ZNXA 2F2CA 1MNDA 2DILA 3WXMB 1W2BP 1S1NA 1M9SA 1OL1B 1YI2Q 2EYZA 4HT9A 4N0AA 2GF7A 1VOLA 5IHIA 3FLGA 2DD5B 1VIEA 1DJ7B 1Q81U 2KXDA 4JRKA 3BG5A 2RM4A 3DLLA 2DNUA 2BS4A 2MIOA 2HDAA 5LJ3d 3ZFJA 2WSFE 2V1QA 3OYMA 1P92A 4M7AB 5GAMf 1UG1A 1GCQC 4XU1A 4FYXB 5D7UA 2I40B 2AZSA 5IHNA 2PU9B 4J8OA 2V8KA 1N4MA 4BCPB 2KR3A 5CIUA 1KHCA 3CCSA 1N8RU 2F69A 3HB9A 2EJFA 3H0IA 2AT1B 4LD9K 2JOYA 1H26B 3BY7A 4O5VA 2QGFB 1O75A 3VRZA 2WXVB 5I21A 2DXBB 2F5TX 4OB1B 3TNHB 3JCMV 4BI4A 1Y0MA 2GQVA 4R55A 3FIFA 3SWNA 1VQPT 1ENWA 4Y92A 5IXBA 4BCIB 3O5ZA 2RI3A 7AT1B 5LJ3j 1ZSZA 2KRMA 2K6DA 2GGRA 2ATCB 2CZ6B 1GCQA 1D1BA 1KQSA 1HXDA 5D6XA 2M0YA 1GXIE 1Z9QA 3BG3A 3M57A 4X9CA 1W4SA 2NUTB 4J6WA 4JX6A 1AWJA 2YRVA 1URCB 1M30A 3VS1A 2RNAA 1OOTA 3M4YA 2PQWA 3JCMQ 4JJCA 5IN1A 4MIMA 5L23A 3PIOA 5GMKj 2EQMA 1YITT 3UATA 2MCNA 3SEMA 5GAN8 5HKCA 4RCBA 1D3BB 2QYZA 3IQLA 1WHKA 4E7SA 4FW2A 2QF7A 2KDSA 1JB0E 3RESA 3OW2P 2E5QA 2VVKA 5KYXA 1KXUA 3HZJA 3L2RA 1UECA 3DB3A 5GAOl 2LP5A 4J9DA 2EQJA 4OR5B 1B07A 1VQPA 4LDYA 1OZ3A 3CBPA 5IH2A 2X4YA 2BE9B 1U06A 4BI8B 3CC7T 2QDYB 4YOOA 3PTAA 3UDCA 5CKDA 2O9SA 3M54A 1VUBA 5IHKA 4HXJA 2PK2A 2HQHA 1X75C 2K5FA 3M5AA 4EMKA 1QKXA 1M2VA 4C8QF 2L3PA 4CFUB 4AG2C 3C95A 2E10A 3BE3A 4Y28E 4CFNB 4M78F 2QQBA 1LNXA 2DETA 3VYGB 1C9BA 3PGGA 2A08A 5CQYA 3RKYA 4HT8A 1RUWA 2C0TA 4KH0B 4BCNB 2JMCA 5AYFA 4ESRA 4OMOA 2LCCA 2K3BA 2QQSA 1D3BA 3HRSA 3NTHA 1RLPC 5ICPB 2XG8D 4PFOA 3CD6A 1LPLA 2E3IA 2O2OA 2ABLA 1QCFA 2P4TA 1M27C 3P8HA 1WXTA 2LX7A 2MF2A 3V8KA 3JCMc 4DEXA 4ELZC 1TWBA 3UWNA 2CSQA 1X2KA 1PC0A 3DB4A 4P5NA 2FYKA 3QKJA 1WQ7A 3V7SA 4M75D 2JM9A 3CPFA 3EFOB 2YWWA 3JSCA 5A0DA 1T0HA 2JS0A 3ZBDA 1OPLA 4RCCA 3E19A 4EORB 5LJ3g 2LZ6B 3CC4Q 3VS2A 1JXOA 4M78G 2XKOC 5AT1B 2KT8A 5HK0A 3JCMh 3DDPB 2X51A 5GAMj 2JS2A 1ZSZC 1QWEA 1H3ZA 2IVXA 4C0DC 1YHQA 1GRIA 1KQSP 1ACMB 1X69A 3QYGB 5GAN7 1YJNQ 5HVYB 1HD3A 3BLQB 2R5AA 2RI2A 2W9FA 1I07A 3M4GA 1YI2A 2PZ1A 3C4SA 2E65A 4C8QA 2YUQA 3G6ET 2W10A 1WLPB 4RTTA 3HSBA 4R56A 2WIPB 2DF6A 2CKKA 1H27B 2E4HA 3QZ5B 4KGZB 1NJIU 3QYEA 2WFYB 1WX6A 2CSIA 2YRCA 2RK1A 3EGXA 1PD1A 3I56Q 4M75G 2RJCA 4RTWA 3RERA 4M7DG 4MFEA 5IDPB 4GBQA 5KYNA 1WGSA 3JB9I 4F7UB 4MZMA 1H28B 5CYIB 3VS6A 1KQ2A 1BI2A 3CQTA 1FWZA 2MWOA 1VYUA 1M1GA 2CCHB 2PK9B 2WSCE 2K2VA 4XTWA 2XDBA 4PJOG 5HBEB 1NLPC 2PVOB 4OMLA 4BE2A 1PSEA 1OI1A 2JTFA 1KFZA 1AD6A 1HJDA 3HBLA 2EYQA 4QVDA 4II5B 2O4XA 2RO0A 4EMKC 5LJ5j 2W9ZA 1NBEB 3LWIA 4M77F 1YI2T 1UFFA 5CKHA 1K9MC 2UZDB 3CCVT 4J7IA 3HRTA 2DTIA 2VGNA 3OYAA 3G71T 3L1AA 3G33B 2DM1A 4JJDA 2YLCA 1FXXA 3QDRB 3JCMb 2QTXA 5I5ZB 5ACBA 2DZCA 2EPDA 1I1JA 1Q82U 2E64A 3CCEQ 4KRTA 3A8MB 1QVGS 2HD0A 2CZ7B 3PT9A 2ZPBB 2EQKA 2XI9A 3JB9J 3RKXA 4C8QD 4AMCA 2PVDB 4C8QE 3QYBA 1N9SA 3OYIA 1OQKA 2GTOA 4BCJB 2CH4W 3OYHA 1AHJB 5LJ5e 2FO0A 1KD1C 2HL5C 5FRNA 3THKA 1NYGA 3VS0A 3RGFB 1VQMQ 1UGPB 4ME7A 3QPHA 2JT4A 1H92A 4HA8A 3G6EA 2PVGB 2KRNA 2JTEA 2ZPHB 2QG9B 2WMBB 1ZUYA 5GAN6 1QMZB 4A4KA 2WACA 4FSSA 3K7AM 3OBYA 5EC7A 2VKNA 1YITQ 1RABB 1OYXA 1C1AA 4IKFA 4KH1B 2QI2A 3EG9A 5I2SA 1W98B 1WHHA 1YN8A 1JU5C 3E9GA 1VQMA 4NS5A 1B34A 2ESWA 2CP5A 3SHWA 1M2OA 3KFVA 2EYYA 3VV0A 3VU3C 5L2WB 1H4LD 1VQ7T 3HPWA 2JJ9A 4OMFB 2VWFA 3E9FA 3NGPA 1AT1B 4HLQA 4DQ2A 2JTMA 4IUUA 3M55A 1MMGA 3CCMA 2GCXA 3OYEA 4C0DB 1RI9A 1K8AR 2CYZB 1TTHB 1D0XA 3FJ5A 1YWPA 2BS2A 1SKUB 2EYWA 3H41A 3TU4K 2IW8B 2L2PA 3CMEQ 4JUVA 4PJOB 2OTLQ 2DJQA 3RMSA 2HQXA 1C0MA 4M77B 4M77G 3EH1A 1SG5A 2DVEA 2OI3A 4ANJA 4MZPA 2KI7A 4AFSC 4XU3A 4ZGJB 3CC7A 4FYYB 4OGRB 5FLXE 4JLGA 3L42A 1QVPA 1PKDB 1VQ9A 1AEYA 2X3XD 2CREA 5J26A 5KH6A 3TEEA 5FGKB 4BCMB 4QQDA 2CP0A 4ELLA 3QUIA 4C0FA 2RB6A 4JJBA 5L8RE 1TUDA 3MI9B 2KROA 1IO6A 2CCIB 2CP3A 1GL5A 2ENMA 3OYLA 3MHXA 4FL6A 3A8LB 1RAAB 3EG1A 4Z89A 1PNJA 4M78A 5KYUA 1MHNA 2JGZB 4MFDA 4D6WA 1NLOC 3MY5B 5GANh 3CCJQ 3U23A 3J7AF 1M8MA 2WHBB 4OMPA 3X28B 1QVFS 2DTOA 2ED0A 2JZ2A 2QQ9A 3VS3A 5EFQB 1BU1A 3EG0A 2NYSA 3OYDA 4F6SB 4BBRM 3NDQA 2M51A 1CKAA 3VS4A 5BNJB 1W6XA 1I5OB 4AKGA 5FW9A 3VS5A 2EWNA 2XICA 4FX3B 1X6GA 1X01A 4ATOA 3LX7A 4HCKA 4Z8AA 1TH7A 1YIJA 4OVAA 1FX7A 1WDXA 2RN8A 4BCMD 3OB9A 1OI9B 4ZTFA 3PO3S 2RD1A 1U8RA 2QA4T 2YXYA 5LJ5h 2M16A 1Z9ZA 4BD3A 2L0AA 2F2XA 4BUGA 1QCOA 2QQRA 1Q86C 1ZQ1A 5C0MA 2CZ0B 5GANj 4M7AA 2A36A 4L6V5 4C92G 3QZ9B 4X9DA 4BACA 2V26A 3TNWB 4FM4B 2RA2A 3H0FA 3M0UA 1X27A 3WVEB 1Q81R 2LW4A 5LJ3e 1BBZA 1UJ0A 2I53A 1ABOA 1IB8A 2DE0X 1K0XA 3MP8A 1N6AA 2DBMA 4XU0A 1BU2A 2QEXQ 3H6ZA 2FPEA 4E2FB 3JB9D 1VINA 5I2MA 1H24B 3M0TA 1GFCA 4DOVA 5GAMg 5CVIA 1W70A 4JPBW 3HL8A 4YTLA 3QHSA 1UGVA 3C94A 2BKDN 1N8RR 2XDPA 4HVWA 5GAN4 5GJWB 4XU2A 3QO3A 2M02A 1U1TA 3CC4A 1Y71A 2FEIA 1B7TA 2B8AA 3G71Q 2CDTA 2IW6B 2HKQB 1RAGB 3TW7A 2R57A 4BY1X 1LCKA 4E7ZA 1UNLD 1K76A 1V29B 1TOVA 4J9GA 4ELYC 3PIPA 3OW2A 1RAFB 4EOKB 2YLBA 2HQEA 1OKWB 1H1PB 2LVMA 4RUGA 1H641 3EH2A 4EOJB 2FPDA 1ZA2B 4C92A 1OX9A 5DQWA 3E1SA 2SEMA 4XTYA 3QHWB 2PJQA 4ZGDB 1J3TA 1OKVB 1BCMA 4BDYA 4FCYA 1IREB 3QG1A 4M7AC 1WIEA 2HSEB 3I55Q 3CCET 1NE8A 1YJWQ 5GANg 2RJFA 2B9RA 4A54A 1Y07A 5GMKl 2OTJT 4C92D 2R7GA 2WSEE 3FB9A 3DDQB 2EQUA 1MUZA 2ROLA 4ROCA 5IT9E 5KYXB 1YWOA 2O4XB 4K11A 4KGVB 2FZGB 4QQGA 1K1ZA 1VQ5Q 2HKNA 5EJCA 3FC3A 4Z6YA 2BIVA 4BI3A 3DLMA 4PLIA 2C06A 2OAWA 1KQ1A 3O0GD 2RHYA 1Q86U 3ULRB 1MV3A 1Y7XA 3MP1A 4AFZC 1WHJA 1YJWA 1M8VA 3EIDB 1G83A 3TN8B 1AOJA 4ORZA 4HNTA 1LVKA 2F5KA 4BCFB 1QVFA 4CXAB 3J80E 1MMDA 2RPNA 4J9FA 5D6WA 2Y90A 4PK4A 1KG1A 3BG9A 4DA4A 1YJNT 3HHTB 2DL5A 2FRWA 1IXDA 2HAXA 3DTOA 1ZP2A 4RG2A 5GAOn 2J6FA 4TTHA 2RJDA 2AHJB 3EGXB 3M53A 4HVUA 2DD4A 1HSQA 4C92B 4DOWA 1NEBA 2X35A 4E6RA 1KQSS 3SWNB 1IHWA 3M0QA 2IW9B 2JM8A 2DXBA 5CCAA 1F1BB 3C0CA 3I56T 1FKMA 3A8OB 4YOZA 2IG0A 4ROEA 4YC3B 5GAN2 3CCRT 1VYTA 1PWTA 4C92E 3P8DA 2CP2A 5J39A 4RODA 2E6ZA 3OS2A 3H0HA 1ZUKA 1ABQA 3S6WA 1V1CA 3CMAA 5KYWA 1XO2A 1YCSB 4V2SA 2RQVA 4X1VA 1RAEB 6AT1B 1VQMT 2LCSA 2QA4Q 2E70A 2KQWA 4A4GA 4HL4A 4EC9B 2M0OA 2DEQA 2VUBA 2MK5A 1Y96A 1PG5B 3JV3A 5A0GA 4CFXB 1NYFA 2EJ9A 1VQ7A 2RHXA 3EGDB 4A53A 4EPCA 3ME9A 1D0YA 1TG0A 2MWPA 4AG1C 1I5LA 1GUXB 4Z02A 4EOMB 2L3RA 1EIFA 5ECAA 4J6YA 3VS7A 4C92C 3I56A 4M75A 3OBWA 1RAHB 3CC2T 3CCVQ 1U1SA 4QQ6A 3MIAB 2LJ3A 2EQIA 3SDZA 4FT4A 1TS9A 3UA7A 3M0PA 2HNIA 1NJIR 4B9WA 3CCMQ 3CPWP 1VQOQ 4E7IA 3TCJA 4M7DB 4OMQA 3JCMP 2RMOA 3VYHB 1WHGA 1I8FA 3O8VA 4Q5WA 1SPKA 1D0ZA 4M75B 2QGSA 4EMHA 8ATCB 1NPPA 2BE7D 5J3BA 4AFQC 3MEUA 1SRMA 1GUXA 3QIIA 5GAN5 4JDSA 4BCQB 1PM3A 5DY9A 1H8KA 1UEBA 4JJNK 1K8AC 1JEGA 2EKHA 1VQ8A 2LDMA
chains in the Genus database with same CATH topology
1K8AU 3HO8A 4IURA 3OSSC 5GAOq 1YJWT 1OYXA 4QW2A 2E6NA 2XD0A 1S72A 1PSFA 4IKFA 4LDXA 1VQLA 2QI2A 3HKSA 4TVRA 2QFZA 5LJ5f 2XU8A 4XAXB 4MMKA 5GANe 3ZEHA 5I2SA 3V8JA 2E41A 1BKBA 3H8ZA 4C0GA 2VXEA 3E9GA 3OYKA 3MEWA 2DTHA 3QJ6A 4NS5A 1VQMA 2DXTA 3JB9J 1LJOA 3CD6T 1E7PA 1B34A 5GMKe 4MDWA 3CXCS 3CCEA 1RL2A 1UGSB 4AKHA 2Y4YA 3VV0A 5D6YA 3S3OA 5FU6B 1M1KU 1VQ5T 3HP9A 3VU3C 2OTLA 2P0KA 3LWHA 1KC8C 3JCMJ 1KHIA 3V7CA 1M1KC 5LL6S 1NPRA 4M7AD 4OP0A 4C5HA 2FL7A 3NFCA 1VQ7T 3HPWA 1JBMA 4OMFB 4M78D 3L2QA 1JJ2S 3E9FA 1VQ6A 4KBMB 2ZPEB 3VKGA 2V8JA 4QVCA 4CI0C 4HLQA 3TW6A 4DQ2A 4XK8E 2P0PA 1K73C 3OW2S 2JTMA 4IUUA 2M1HA 2ZPGB 3CPWS 4KULA 5DLQE 3M55A 3I55A 2D6FA 3Q1JA 3LGLA 3CCMA 2GCXA 3OYEA 3HRUA 4C0DB 4OB0B 3CCRA 3CCJT 1XQHA 2CYZB 5LJ3f 2HBPA 2OAUA 4PJOA 3A5ZB 4M75E 2BS2A 2NLUA 1UB4A 2E1HA 3VJPA 3F70A 3TU4K 2CGHA 1N9RA 2E12A 5DLOA 2VGMA 3S3NA 3CEYA 4JUVA 2KY9A 3GP8A 5A0LA 3FJPA 4FSXA 4PJOB 3JCMd 3OS0A 3RMSA 4UC4A 2HQXA 4M77B 2LT4A 3WXMB 2OTLT 4M77G 2ZCFB 5GAN3 1M9SA 4PJOD 3EFRA 2DVEA 4RMOA 2DPPB 4HT9A 4MZPA 3OYCA 1VQ8T 4N0AA 1YBYA 2GF7A 2A3LA 2P0QA 3FLGA 2DD5B 4J6XA 4ZGJB 4XU3A 5FU6C 3CC7A 1VIEA 4C8QB 1DJ7B 5FLXE 1Q81U 4MMLA 4JRKA 3BG5A 3CC2A 1G3TA 4II1A 4JLGA 4O6JA 3JAME 2JN0A 1QVPA 3L42A 4IUVA 2RM4A 4F7UA 1Q81C 3DLLA 3SFMA 1VQ9A 4M78B 3CMAT 2BS4A 3DKMA 5CO7A 4PL6A 5J26A 5LJ3d 3ZFJA 2WSFE 3TEEA 5KH6A 4OGEA 4XTXA 4OB3B 4E7JA 3L2VA 1LOJA 3OYMA 3I55T 1P92A 4M7AB 4JRIA 5GAMf 3L2WA 1VQ9T 3GNFB 2VC8A 1YJ9T 4GLKA 4XU1A 4QQDA 5GANj 2D9TA 2RJEA 3QUIA 4JS5A 3X20B 4C0FA 1VQKT 3BW1A 2RB6A 3CBOA 2PU9B 4J8OA 2V8KA 5L8RE 1VQ6T 4AI6A 5CIUA 3CCQT 1KHCA 3T9NA 2XIDA 2K3XA 3CCSA 1YITA 2DD4B 1N8RU 2F69A 3OYLA 3HB9A 2EJFA 2M9UA 3A8LB 2ZZDA 3GNGA 3MHXA 4FL6A 4M78A 4D6WA 4LD9K 1MHNA 4MFDA 5GANh 2JOYA 5LJ3h 4RG8A 1N8RC 1JRIA 3BY7A 4O5VA 4C92F 3LYIA 1O75A 4EDUA 3J7AF 3OMGA 4M7DF 1O9SA 1KC8U 2DKGA 1JJ2A 3OS5A 2DXBB 5I21A 5GAOp 3X28B 3G7ZA 1QVFS 2DTOA 2JZ2A 2F5TX 4OB1B 2QQ9A 5FROA 3QBYA 4M7DC 4N4IA 3JCMV 2GQVA 4BI4A 2L89A 3FIFA 4R55A 3SWNA 3OYDA 1VQPT 4FIBA 4M75F 4LDUA 4BBRM 4JX5A 2RI3A 3MEAA 3KXTA 2MMPA 5LJ3j 3CXCA 4RKUE 4AKGA 3OYGA 2EWNA 2RHUA 2XICA 1BI3A 2GFUA 1X01A 4F7UF 4ATOA 3LX7A 3CCLA 3S3MA 2CZ6B 1TH7A 1YIJA 4OVAA 1KQSA 4F7UG 2Y4XA 4BDZA 1HXDA 3EAEA 1WQWA 5D6XA 5GMKm 1FX7A 3OS1A 1GXIE 2I2LA 3OB9A 3G71A 3SB2A 4ZTFA 2RD1A 4M77E 4ZN3A 3BG3A 3LW5E 1QP3A 2QA4T 1YIJT 1U8RA 3M57A 5LJ5h 2M16A 4BD3A 4X9CA 3CCLT 3RMQA 1I4K1 1W4SA 1OZ2A 3WVDB 2O01E 4PJOE 4J6WA 4BUGA 4JX6A 2DD5A 2YRVA 3CPWA 2QQRA 3NTIA 2QA4A 1Q86C 4L59A 1ZQ1A 5C0MA 2CZ0B 4XTZA 2QXFA 3M4YA 2PQWA 4L6V5 3VYGA 3RKWA 4M7AA 3URGA 3M59A 1VIFA 5HY6A 3JCMQ 2PUOB 4C92G 5IN1A 3QZ9B 1XTDA 4MIMA 2EAYA 4IUQA 1VQLT 4X9DA 3C12A 4BACA 3JCMf 3PIOA 5GMKj 2EQMA 1YITT 4FM4B 2RA2A 3HFOA 2X4WA 1VQ8A 1X6OA 5GAN8 5HKCA 3WVEB 4RCBA 1D3BB 4FU6A 5LJ3e 2QF7A 2KDSA 4OF1A 1QVGS 1JB0E 3RESA 2XDDA 2E5QA 5M9OA 5GAOm 2LCLA 4HNUA 3HZJA 3MP8A 1N6AA 2MAMA 4XU0A 3OYNA 2LTOA 4LOCA 3L2RA 3DB3A 3H6ZA 5GAOl 1MGQA 1Y96B 1VQOA 3JB9D 2EJGA 1VQNT 2RHIA 4JS4A 2DK3A 3RUXA 2EQJA 5I2MA 2QEXT 1VQ4A 4M7DA 4DOVA 5GAMg 5CVIA 3SWNC 2K57A 1VQPA 4LDYA 1OZ3A 2WJ9A 3HL8A 4YTLA 3QHSA 3C94A 1M4ZA 1XOVA 4QSHA 3CBPA 3META 2X4YA 1W2BA 3MO8A 4ZTJA 3VUBA 1UGRB 2BKDN 4BI8B 4EMGA 3CC7T 2QDYB 3PTAA 3LH0A 4ELJA 4M6VA 2XDPA 3UDCA 3VUZA 5CKDA 3CC4T 3OA6A 3G4ST 2R58A 3CBMA 3M54A 3VKHA 5GAN4 4JLIA 2CZ1B 4XU2A 1VUBA 4NL2A 3QO3A 4C5GA 3SD4A 4BBSM 1U1TA 3N5BB 2QQ8A 5LJ5g 3CC4A 4PJOC 4NC6A 1X75C 1Y71A 2K5FA 3M5AA 4X34A 4EMKA 1M90U 4HCCA 2DJZA 4NOYA 4C8QF 2B8AA 4E7HA 4PKCC 3M56A 4JRQA 4JRPA 4HNVA 1G3WA 3C95A 3TW7A 2E10A 1G5VA 2R57A 3GF5A 1WNLA 4Y28E 4M78F 4M7AG 1V29B 3OW2A 1XNIA 2XK0A 3DL1A 4ELYC 2QQBA 3PIPA 1BYMA 1LNXA 4M77D 3VYGB 2YLBA 2KR6A 3OYBA 2HQEA 3AHUA 3PGGA 1Q7YU 4E7LA 4A4FA 5CQYA 1B34B 2H3JA 2K4YA 3FEOA 2LVMA 3RKYA 2EKOA 1H641 3UPUA 4HT8A 4BE1A 4C8QG 5C6SA 4KUIA 4JX4A 2ZPFB 2K5IA 2DIGA 5KE3A 4MZTA 4C92A 3OYJA 5FU7C 3E1SA 4XTYA 5AYFA 3QSUA 4ZGDB 2A7YA 4N4GA 2KVQG 4M77A 2LCCA 4BDYA 1IREB 2QQSA 3QG1A 3QWLA 5GAMd 1D3BA 2VV5A 3HRSA 1RI0A 3NTHA 3G4SA 1VQ4T 2KSSA 4M7AC 2XG8D 2LRQA 3CD6A 2QDJA 1NE8A 3CCET 5GMKh 5GANg 1VQNA 2RJFA 4A54A 3CCMT 1Y07A 3V7RA 5GMKl 1WPYA 2RHZA 2P4TA 2OTJT 3H4CA 2WSEE 3P8HA 4M78C 4C92D 2DXCB 4FT2A 4C5IA 2MF2A 3KUFA 3JCMe 3FB9A 4LD6A 3JCMc 2EQUA 3V8KA 4E47A 4ELZC 3QJYA 5DM7R 3CCUT 5IT9E 2JNGA 4M7DD 3UWNA 2OTJA 4C8QC 4NL3A 3DB4A 4P5NA 1WJSA 5CR2A 4MDXA 4J7FA 3X25B 2FYKA 3QKJA 2D0QB 2O4XB 4PLLA 1WQ7A 3MEVA 3V7SA 4M75D 4A4HA 5A2QE 4BB7A 4CRIA 4QQGA 5FU7B 3PNWC 3CPFA 5EJCA 3JSCA 4HKEA 3JB9G 4OB2B 5A0DA 3FC3A 4Z6YA 3A8HB 2BIVA 3DLMA 3EFSA 4PLIA 3V8LA 2LC4A 4BI3A 2DZ9A 5GAOr 2C06A 1KQ1A 4AKIA 3ZBDA 4RCCA 3E19A 5LJ3g 3CCQA 2RHYA 3ER0A 4M78G 2XKOC 4VUBA 1K9MU 4BY6C 3A8GB 5HK0A 1Q86U 4B9XA 3JCMh 1Y7XA 3MP1A 5GAMj 4C0ZA 1YJWA 4IUPA 1M8VA 4XQ3A 2DAQA 1H3ZA 3X26B 3GOXA 4KT0E 4ZGEB 4GY5A 5IAYA 4C0DC 1YHQA 4HNTA 2F5KA 3M9QA 2JUFA 4QVZA 4KUDK 3FDRA 1QVFA 3QYHB 5KE2A 2FHDA 3QYGB 5GAN7 3J80E 1QLBA 5D6WA 2Y90A 2R5AA 1KG1A 2RI2A 2FVUA 1SSFA 2KMGA 3BG9A 3M4GA 4DA4A 3JCMX 3HHTB 5CQXA 4J83A 3C4SA 1YI2A 1YJNT 1G3YA 2HAXA 4J5YA 2E65A 4C8QA 4RG2A 3JB9H 5GANd 5GAOn 3G6ET 1UGQB 2RJDA 3BDLA 2AHJB 4WF2A 1YCYA 3VKIA 3M53A 4R56A 3HSBA 3R6OA 2ZZDB 4F7UE 2CKKA 2DD4A 4M78E 4C92B 3CCST 4N4HA 4DOWA 3QZ5B 3CCJA 3PFSA 1NJIU 3QYEA 2X35A 1KQSS 3SWNB 1I81A 2RK1A 5CKEA 2G77A 2DXCA 2LQKA 2EFIA 3BDUA 4M75G 2MI6A 1NJIC 3L2UA 2DXBA 5CCAA 4M7AF 3I56T 2RJCA 1FKMA 3A8OB 3PMTA 4LDVA 4HCZA 3RERA 3TREA 2KK4A 3ASKA 2IG0A 5GAN2 4M7DG 3CCRT 4MFEA 3OSVA 3P8BB 1VQOT 2FB7A 3HFNA 3X24B 4C92E 1WGSA 3JB9I 3MCAB 4F7UB 3GLXA 4MZMA 3BFMA 3JCMW 1M90C 1YHQT 2BUDA 3OYFA 1KQ2A 1BI2A 3P8DA 2RK2A 2X4JA 1FWZA 2IVWA 2MWOA 2ZGWA 4EMKB 1M1GA 2WSCE 3JCMg 5J39A 2K2VA 4XTWA 5HK3A 3J81E 2E6ZA 2XDBA 4PJOG 2CS7A 2PVOB 2LX9A 3S6WA 3OS2A 3FRNA 2DIQA 4BE2A 2LNVA 3CMAA 1VQKA 1PSEA 4M75C 1OI1A 2DO3A 2JTFA 4HCBA 4V2SA 1Q7YC 1WJRA 2V8IA 4N0AC 3OQ5A 3GIBA 1NZ9A 2GFAA 3HBLA 4BE0A 1VQMT 2EYQA 3NTKA 4QVDA 5GMKi 2E70A 2KQWA 2RH2A 4A4GA 2JVVA 2LQ8A 3OY9A 2O4XA 2RO0A 4HL4A 4PJOF 1QW1A 4EMKC 5LJ5j 5CKFA 2PUKB 5FRMA 1R8OB 2RI5A 4IUTA 4E7KA 3LWIA 2M0OA 2X4XA 1VQ5A 2DEQA 2VUBA 4M77F 2YHTA 3PMIA 1Y96A 5CKHA 5KCOA 4ZN1A 1YI2T 1YJNA 1W2BS 1K9MC 3CCVT 3LLRA 2VXFA 1BIAA 5A0GA 4J7IA 3HRTA 2DTIA 2EJ9A 2VGNA 3OYAA 3G71T 1VQ7A 2RHXA 3L1AA 1HK9A 4A53A 4EPCA 4XTVA 5EG2A 2YLCA 4A4EA 5KCHA 3ME9A 1Q82C 1FXXA 3QDRB 3JCMb 2QTXA 3MP6A 2BS3A 2DZCA 2K3YA 3OMCA 4XTUA 2MWPA 1Q82U 1I5LA 2E64A 4Z02A 4Y91A 3UT1A 4M7AE 2DXUA 2L3RA 1EIFA 4LDWA 5CK9A 3A8MB 2KAFA 4J6YA 1ZHIA 4C92C 2HD0A 1WJQA 2XHCA 3INZA 2CZ7B 2ZPBB 2EQKA 2G3RA 2XI9A 3OBWA 3PT9A 1ZBXA 4M75A 3I56A 3GPLA 1BI0A 1M1FA 3CC2T 1G3SA 3RKXA 1U1SA 4C8QD 3JRZA 2EIFA 3KBGA 4QQ6A 1M5Q1 2PVDB 4C8QE 2L8DA 2ZPIB 3QYBA 1N9SA 3OYIA 2L5QA 1BIBA 1BI1A 4C5EA 3OYHA 5GANf 1AHJB 3SDZA 4L5GA 4FT4A 5LJ5e 3M58A 5CAIA 1KD1C 1YJ9A 2HNIA 4B9WA 2QEXA 4OGCA 5FRNA 4E7IA 3TCJA 1QVGA 1N27A 1KD1U 4M7DB 3QXEB 4M7DE 3JCMP 1IZ6A 3L2ZA 3CMET 3VYHB 1UGPB 2VYTA 4ME7A 3QPHA 3LGFA 1I8FA 3O8VA 4HA8A 4Q5WA 4BY6B 3G6EA 2K5LA 4M75B 4EMHA 3CMEA 4PNOA 2PVGB 1NPPA 5J3BA 3OYYA 5GAMe 3MEUA 1QP2A 1K73U 2ZPHB 5LJ5d 3QIIA 5GAN5 4JDSA 3CCVA 3JB9F 5GAN6 3CCUA 3KHIA 4A4KA 2WACA 5DY9A 5CKBA 2LT1A 2QQAA 3OBYA 1S72T 1UEBA 5GAMh 4JJNK 3RIRA 1K8AC 4M77C 2KMTA 2R5MA 2LDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYG B;  3X24 B;  2DXB B;  3X28 B;  1PSF A;  4OB1 B;  2WSC E;  2ZPF B;  2PVO B;  4RKU E;  4ZGD B;  1PSE A;  1UGS B;  1IRE B;  2CZ6 B;  1GXI E;  3LW5 E;  2WSE E;  1QP3 A;  2ZPE B;  2PUK B;  2DXC B;  4XK8 E;  3WVD B;  2O01 E;  2DD5 A;  2ZPG B;  3X25 B;  2D0Q B;  2CZ0 B;  3VYG A;  4OB0 B;  4L6V 5;  2CYZ B;  2PUO B;  3QZ9 B;  4OB2 B;  3A8H B;  4FM4 B;  3WVE B;  3A8G B;  3A8M B;  1JB0 E;  2CZ7 B;  2ZPB B;  2ZCF B;  3X26 B;  4KT0 E;  4ZGE B;  2DPP B;  2PVD B;  2DD5 B;  4ZGJ B;  2ZPI B;  3QYH B;  3QYG B;  1DJ7 B;  1AHJ B;  3HHT B;  2WSF E;  1UGR B;  4OB3 B;  2QDY B;  3QXE B;  1UGQ B;  2AHJ B;  3VYH B;  1UGP B;  2CZ1 B;  2ZZD B;  2DD4 A;  3X20 B;  3QZ5 B;  2PU9 B;  5L8R E;  2PVG B;  2DXC A;  1QP2 A;  2ZPH B;  2DD4 B;  2ZZD A;  3A8L B;  2DXB A;  3A8O B;  4Y28 E;  1V29 B; 
#chains in the Genus database with same CATH topology
 3HO8 A;  4IUR A;  2E6N A;  3QHR B;  2XD0 A;  1VYW B;  1FMW A;  3RNJ A;  4LDX A;  1VQL A;  4TVR A;  5LJ5 f;  1BK2 A;  2XU8 A;  4MMK A;  2E41 A;  3M0S A;  1JST B;  2DTH A;  3CD6 T;  2EUF A;  1JQQ A;  4MDW A;  4AKH A;  1M1K U;  5FU6 B;  1OPK A;  1MV0 B;  2P0K A;  3LWH A;  1KC8 C;  1KHI A;  5FWB A;  1OIU B;  1NPR A;  4F14 A;  4OP0 A;  2FL7 A;  1JBM A;  1F5Q B;  1WZO A;  1VQ6 A;  2V8J A;  4CI0 C;  4XK8 E;  2P0P A;  1XJW B;  1T0J A;  2DFU A;  2M1H A;  4Z88 A;  4KUL A;  3I55 A;  1D09 B;  1WHL A;  4BCQ D;  1Q95 G;  3CCJ T;  5LJ3 f;  4PJO A;  5I22 A;  4M75 E;  2YRD A;  1UB4 A;  2KYM A;  2AZV A;  2VGM A;  1YHQ Q;  3GP8 A;  2J6K A;  3JCM d;  3OS0 A;  2D1X A;  4UC4 A;  1AZE A;  2OTL T;  2QK0 A;  4PJO D;  3EFR A;  4RMO A;  3H9N A;  3G1J A;  1VQ6 Q;  1VQ8 T;  2JMA A;  2A3L A;  5FU6 C;  4J6X A;  3D7S B;  4II1 A;  3JAM E;  2JN0 A;  2KXC A;  4IUV A;  4F7U A;  1S72 Q;  1Q81 C;  3DKM A;  4E7J A;  3L2V A;  1LOJ A;  1V76 A;  3I55 T;  3L2W A;  1VQ9 T;  3GNF B;  2KYB A;  3NPF A;  2F1L A;  4GLK A;  3GBQ A;  2D9T A;  2RJE A;  3X20 B;  1VQK T;  3BW1 A;  2EGC A;  3CBO A;  4J9C A;  3MJX A;  1QKW A;  1E6H A;  3CCQ T;  1ARK A;  1MNE A;  2XID A;  2M9U A;  1PHT A;  2ZZD A;  3GNG A;  2WPA B;  2ED1 A;  1Q86 R;  4JZ4 A;  1FIN B;  1N8R C;  1JRI A;  2QTV A;  3LYI A;  1SRL A;  3OMG A;  4D8K A;  1O9S A;  1KC8 U;  1M90 R;  2DKG A;  1JJ2 A;  4BXX X;  2X9H A;  5GAO p;  5KYU B;  4M7D C;  3QBY A;  2RF0 A;  4N4I A;  1EFN A;  4LDU A;  1JXM A;  5LQF B;  3CXC A;  1BI3 A;  4AT1 B;  2GQI A;  4QT7 A;  1Q7Y R;  2AKK A;  2B86 A;  3RBB B;  3CCL A;  4F7U G;  4BDZ A;  1N5Z A;  1WQW A;  2KGT A;  5GMK m;  3RR6 A;  2I2L A;  4LUD A;  3G71 A;  3SB2 A;  3CMA Q;  1OU8 A;  4M77 E;  4ZN3 A;  1YIJ T;  1VOM A;  3CCL T;  2O01 E;  4PJO E;  3I5S A;  1OUL A;  3NTI A;  4AFU C;  2QA4 A;  2J7I A;  4L59 A;  2W99 A;  2LMJ A;  5HY6 A;  2PUO B;  1XTD A;  1VQL T;  3C12 A;  2X4W A;  2EBP A;  1CSK A;  1AWO A;  4FU6 A;  4OF1 A;  4LE9 A;  2P84 A;  2K7A A;  5M9O A;  5GAO m;  4A63 B;  1TSF A;  2MAM A;  3OYN A;  2LTO A;  4LOC A;  1K9A A;  2ROT A;  4I3Z B;  1MGQ A;  1VQN T;  2RHI A;  3RUX A;  2QEX T;  3VRY A;  1XOV A;  4QSH A;  3MET A;  1U5S A;  1PCX A;  3MO8 A;  1UGR B;  4EMG A;  3CC4 T;  3CBM A;  3VKH A;  1BCO A;  4CFW B;  4C5G A;  5LJ5 g;  4PJO C;  4X34 A;  4HCC A;  4E7H A;  4JRQ A;  4JRP A;  1G5V A;  1G3W A;  2OX7 A;  4F7J B;  3GF5 A;  1WNL A;  1OGU B;  3EOC B;  1D1A A;  4M7A G;  1XNI A;  2XK0 A;  1UNH D;  1SHF A;  3TSZ A;  1D1C A;  4M77 D;  2C0O A;  2C5V B;  2KR6 A;  4WCI A;  4A4F A;  1B34 B;  3FEO A;  4F17 A;  1IGU A;  2C5O B;  1PKT A;  2IIM A;  2LJ1 A;  2K5I A;  5KE3 A;  4MZT A;  3OYJ A;  5FU7 C;  3QSU A;  1P5E B;  2MPX C;  4PFZ A;  2A7Y A;  2DLP A;  2KVQ G;  4M77 A;  2D0N A;  2X3W D;  3TVT A;  3QWL A;  1AD5 A;  1PKS A;  2VV5 A;  1X43 A;  1VQ4 T;  4CRL B;  2QDJ A;  5GMK h;  1VQN A;  2C5X B;  3CCM T;  3V7R A;  1UTI A;  3H4C A;  4M78 C;  4RTU A;  2DXC B;  1SF9 A;  1UUE A;  4C5I A;  4LD6 A;  4RTZ A;  4M7D D;  3EJ1 B;  5DM7 R;  1G8X A;  1QWF A;  3QJY A;  4J9E A;  2OTJ A;  4C8Q C;  4NL3 A;  1WJS A;  2DL3 A;  4J7F A;  3X25 B;  5HNB B;  4PLL A;  4A4H A;  2KEA A;  4BB7 A;  4CRI A;  2V22 B;  1QCN A;  5FU7 B;  3PNW C;  4HKE A;  3JB9 G;  2YUN A;  3EFS A;  2LC4 A;  1PRM C;  2E3H A;  4F6W B;  2P4R A;  3PE0 A;  2QAS A;  3CCQ A;  1VYV A;  4VUB A;  3A8G B;  1UNG D;  2HSP A;  1M1K R;  2SRC A;  1QLY A;  3EG9 B;  3X26 B;  4KT0 E;  4ZGE B;  2JXB A;  4GY5 A;  3M03 A;  2DL7 A;  1UHF A;  2YT6 A;  2JUF A;  3M9Q A;  4QVZ A;  4KUD K;  3FDR A;  3QYH B;  5KE2 A;  2GBQ A;  2PMI B;  1QLB A;  3DOG B;  2FVU A;  1SSF A;  1G3Y A;  1JOW A;  1IGQ A;  2HMA A;  3MY1 B;  2JW4 A;  4CC7 A;  5GAN d;  1YCY A;  2O31 A;  1VQK Q;  1OV3 A;  1YFN A;  1KJW A;  2ZZD B;  4F7U E;  4M78 E;  3CCS T;  4J9H A;  3CCJ A;  3CCQ Q;  1I81 A;  2G77 A;  3BDU A;  4FYW B;  3L2U A;  5IDN B;  4M7A F;  3PMT A;  4LDV A;  2KK4 A;  1SHG A;  3ASK A;  3P8B B;  2ZAE A;  2FB7 A;  1MMA A;  4B6M A;  1WXU A;  3MCA B;  2KBT A;  3BFM A;  1JKW A;  1M90 C;  1YHQ T;  1OL2 B;  2DBK A;  2NUZ A;  4LNP A;  3OYF A;  3BHT B;  2RK2 A;  2X4J A;  2ZGW A;  3I5R A;  4EMK B;  3JCM g;  3BLH B;  5HK3 A;  4KRD B;  2CS7 A;  2EVR A;  3MKD A;  1GBR A;  2LNV A;  4DBR A;  4LXC A;  2PTK A;  4HCB A;  1Q7Y C;  3ZL7 C;  2V8I A;  1NZ9 A;  1ZX6 A;  4BE0 A;  5GMK i;  4EOS B;  4EOO B;  3OY9 A;  2LQ8 A;  2DL8 A;  2LQN A;  1R8O B;  2RI5 A;  1E9H B;  2YHT A;  2CT3 A;  1RAI B;  1BIA A;  1VQL Q;  1KC8 R;  4XTV A;  4F7L B;  5KCH A;  1Q82 C;  2C5N B;  3OMC A;  4EC8 B;  1FVV B;  3G6E Q;  4Y91 A;  4BCH B;  4LDW A;  2KAF A;  1ZHI A;  3INZ A;  1WJQ A;  2H8H A;  4EON B;  4CFV B;  2K9G A;  3JRZ A;  2EIF A;  3KBG A;  4F6U B;  2L8D A;  2Z0W A;  1CKB A;  1BIB A;  3RDV A;  1BI1 A;  2FPF A;  4C5E A;  4L5G A;  3M58 A;  4PJJ A;  2EYX A;  5CAI A;  3AT1 B;  1YJ9 A;  1GH6 B;  4EOI B;  4OGC A;  3LQ5 B;  1QVG A;  1N27 A;  4CC4 B;  3QXE B;  1QVG P;  2KRS A;  1ZSZ B;  3CME T;  3CC2 Q;  5GJV B;  2L3Q A;  3LGF A;  2W0Z A;  3OYY A;  5GAM e;  1OIY B;  1GFD A;  5KYY A;  1K73 U;  5LJ5 d;  1NG2 A;  9ATC B;  2GTJ A;  3EGU A;  3JB9 F;  5I11 A;  5CKB A;  2QQA A;  2MOX A;  8AT1 B;  3NHN A;  3RIR A;  4BE1 A;  2KMT A;  2R5M A;  5GAO q;  1YJW T;  1KIK A;  4QW2 A;  2FG0 A;  1S72 A;  1PSF A;  1TU0 B;  2EGE A;  1WFW A;  3HKS A;  2CT4 A;  2YUP A;  3H8Z A;  2RQU A;  2VXE A;  3MEW A;  3QJ6 A;  1LJO A;  1RAD B;  3TSW A;  1K9M R;  1IHV A;  2DL4 A;  5GMK e;  1RL2 A;  2CP6 A;  1UGS B;  2GNC A;  2Y4Y A;  2OTL A;  1VQ5 T;  1KK7 A;  3V7C A;  5LL6 S;  1T3S A;  1EZZ B;  3NFC A;  2C4G B;  4M78 D;  3L2Q A;  4KBM B;  2ZPE B;  3VKG A;  3LH5 A;  5HBH B;  1U3O A;  2D6F A;  1WHM A;  3CD6 Q;  1VQN Q;  1RAC B;  1ZA1 B;  3HRU A;  4OB0 B;  3F5X B;  2BKZ B;  2F2W A;  1B3Q A;  3CCR A;  2UZB B;  3R6N A;  2HBP A;  4Y72 B;  1M3C A;  1GY3 B;  2NLU A;  2E1H A;  5HCK A;  4CFU D;  3VJP A;  1KSW A;  3F70 A;  5DLO A;  3S3N A;  2KY9 A;  5A0L A;  2O9V A;  2V1R A;  4FSX A;  5KYW B;  2ZCF B;  5GAN 3;  1YJ9 Q;  2DRM A;  2DPP B;  3OYC A;  1YBY A;  2P0Q A;  2LJ0 A;  2G9X B;  2A28 A;  4C8Q B;  1VQ8 Q;  2BZX A;  2KNB B;  4MML A;  4PJM A;  1FYN A;  3CC2 A;  1G3T A;  4O6J A;  1E7O A;  3SFM A;  4M78 B;  3CMA T;  5CO7 A;  4PL6 A;  3CCR Q;  4OGE A;  4XTX A;  4OB3 B;  1VQ4 Q;  2AIR B;  4JRI A;  3EGD A;  2VC8 A;  4JS5 A;  1VQ6 T;  4FYV B;  4EOQ B;  4AI6 A;  3T9N A;  1YIT A;  2K3X A;  1YP5 A;  2DD4 B;  1VQK A;  2A37 A;  2I0N A;  4RG8 A;  5LJ3 h;  2WEV B;  4C92 F;  1G2B A;  2DA9 A;  4EDU A;  4M7D F;  4PJL A;  2X1N B;  2A0F B;  1UHC A;  3HTR A;  3OS5 A;  3G7Z A;  1VQP Q;  1WXB A;  5FRO A;  2L89 A;  5IF1 B;  4FIB A;  4M75 F;  1SSH A;  1Y57 A;  4JX5 A;  2L3S A;  3MEA A;  3KXT A;  2MMP A;  4RKU E;  3OYG A;  2RHU A;  2YDL A;  2GFU A;  1ZUU A;  4F7U F;  2IPO B;  2KE9 A;  2HEQ A;  3S3M A;  4F70 B;  1RLQ C;  5DQV A;  1TUG B;  2NWM A;  2Y4X A;  3EAE A;  4RTX A;  3OS1 A;  2K2M A;  3UF4 A;  1VA7 A;  5KYY B;  3LW5 E;  1QP3 A;  3RMQ A;  1I4K 1;  2YSQ A;  1OZ2 A;  3WVD B;  1H1S B;  2DD5 A;  3CPW A;  1KD1 R;  2UZL B;  4XTZ A;  2QXF A;  3VYG A;  3RKW A;  3URG A;  3M59 A;  1VIF A;  3QDF A;  1E6G A;  2EAY A;  4IUQ A;  3E2U A;  3JCM f;  1M3B A;  1OEB A;  3HFO A;  2BZY A;  1X6O A;  4DBF A;  3CC7 Q;  1ZBJ A;  2XDD A;  3CCS Q;  2LCL A;  4HNU A;  2XMF A;  2EW3 A;  1Y96 B;  1VQO A;  2EJG A;  4JS4 A;  2DK3 A;  4BCN D;  1VQ4 A;  2D8J A;  4M7D A;  3REB B;  3SWN C;  2K57 A;  3I9Q A;  4D8D A;  4CC3 A;  2E5K A;  2WJ9 A;  1M4Z A;  1W2B A;  4ZTJ A;  3VUB A;  1R77 A;  3LH0 A;  4ELJ A;  4M6V A;  3B57 A;  3VUZ A;  3OA6 A;  3G4S T;  2R58 A;  1FMK A;  4JLI A;  2CZ1 B;  1D3U B;  4BY7 X;  2VB6 A;  2J6O A;  4NL2 A;  3QWY A;  2QDL A;  3SD4 A;  4BBS M;  4M4Z A;  5FWC A;  3N5B B;  1H1Q B;  2QQ8 A;  4NC6 A;  1M90 U;  2HBW A;  2UZE B;  2DJZ A;  2PHG A;  1I0C A;  4NOY A;  4EIK A;  4PKC C;  3M56 A;  4HNV A;  4OMN A;  2NUP B;  4GLM A;  3DL1 A;  1BYM A;  1EX4 A;  3OYB A;  3AHU A;  2LQW A;  1Q7Y U;  4E7L A;  2K4Y A;  2H3J A;  2DMO A;  2EKO A;  3UPU A;  1IRX A;  3GTM S;  2K79 A;  4FW1 A;  2NUT A;  4C8Q G;  5C6S A;  1R0C B;  4JX4 A;  2ZPF B;  4KUI A;  2DIG A;  1K0S A;  1TXQ A;  4CFM B;  4F7N B;  2DX1 A;  4F16 A;  4N4G A;  2CUB A;  5GAM d;  1RI0 A;  3G4S A;  2KSS A;  2LRQ A;  1X6B A;  2NUP A;  2COY A;  3EG3 A;  1WPY A;  2AK5 A;  2RHZ A;  1K73 R;  4FT2 A;  3JCM e;  3KUF A;  4BCG B;  4E47 A;  3CCU T;  2JNG A;  4JZ3 A;  4OMM A;  1X2Q A;  5LMK B;  5CR2 A;  4MDX A;  2D0Q B;  4RTY A;  1AIS B;  1JSU B;  3MEV A;  5A2Q E;  1YNZ A;  2FZC B;  2PNI A;  2DVJ A;  4OB2 B;  3A8H B;  5GAO r;  3V8L A;  2DZ9 A;  1VQ7 Q;  4AKI A;  4CC2 A;  1AVZ C;  2W2H A;  3ER0 A;  1K9M U;  4BY6 C;  1NM7 A;  4B9X A;  2O88 A;  3POM A;  4C0Z A;  4IUP A;  2J05 A;  4XQ3 A;  2DAQ A;  2UUE B;  3GOX A;  1K4U S;  5IAY A;  1TUC A;  4IIM A;  1Q82 R;  2FHD A;  2CH4 A;  4F04 B;  2KMG A;  3JCM X;  5CQX A;  4IIO A;  4EOP B;  4J83 A;  3DJB A;  4J5Y A;  3JB9 H;  2MYS A;  1AWX A;  1UGQ B;  4UN0 A;  3BDL A;  4WF2 A;  3VKI A;  3EHQ A;  3R6O A;  4IMY B;  4N4H A;  1UJY A;  2G6F X;  5IXF A;  1W1F A;  3PFS A;  2HL3 A;  5CKE A;  2DXC A;  2LQK A;  2EFI A;  1A0N B;  2MI6 A;  5HQ0 B;  2DYB A;  1NJI C;  4HCZ A;  3TRE A;  3OSV A;  1VQO T;  3HFN A;  2OTJ Q;  3X24 B;  3GLX A;  3JCM W;  1AWW A;  4DBH A;  3BLR B;  2BUD A;  1HYO A;  3CCL Q;  2IVW A;  3PVQ A;  2ECZ A;  3J81 E;  5IHY A;  2LX9 A;  1C6V X;  3BHV B;  1M3A A;  2WIH B;  2DIQ A;  3FRN A;  4KGX B;  4PJN A;  1JO8 A;  4M75 C;  2DO3 A;  1WJR A;  4N0A C;  1H3H A;  3OQ5 A;  2OJ2 A;  3GIB A;  3PVL A;  3EG2 A;  2GFA A;  1SEM A;  3NTK A;  2AKL A;  1QQJ A;  2RH2 A;  2HZY A;  2JVV A;  4BCO B;  4PJO F;  1QW1 A;  5CKF A;  2PUK B;  5FRM A;  1WA7 A;  4IUT A;  4E7K A;  1VQ5 A;  5CEI B;  2X4X A;  4DEY A;  1YJ9 T;  3PMI A;  1YJN A;  5KCO A;  1QMC A;  4ZN1 A;  1W2B S;  2QAZ A;  3LLR A;  2CUD A;  2VXF A;  3QWX X;  1HK9 A;  1GBQ A;  5EG2 A;  4A4E A;  4G6L B;  1PD0 A;  3MP6 A;  2K3Y A;  2BS3 A;  2COZ A;  2D8H A;  4XTU A;  4LUE A;  1FMV A;  2FZK B;  4F7S B;  3UT1 A;  4M7A E;  2DXU A;  5CK9 A;  2YUO A;  1O9K A;  2XHC A;  1ZLM A;  2G3R A;  3GPL A;  1GCP A;  1K8A U;  1ZBX A;  1BI0 A;  1M1F A;  1G3S A;  1OX8 A;  1AZG B;  1M5Q 1;  5HBJ B;  2BPM B;  1TD6 A;  2ZPI B;  1O9K B;  2L5Q A;  5GAN f;  1G3N C;  3NMZ C;  3MPU B;  4DBQ A;  3REA B;  2QEX A;  2BTT A;  2RQR A;  1KD1 U;  2W96 A;  4HVV A;  3A1P A;  4M7D E;  1IZ6 A;  3L2Z A;  2C0I A;  2VYT A;  2LNH B;  4BY6 B;  2K5L A;  2J06 A;  2WMA B;  3CME A;  4J9B A;  4PNO A;  4PFP A;  4BCK B;  1UE9 A;  2CP7 A;  2CJM B;  1QP2 A;  3CCV A;  2BZ8 A;  2RQT A;  1R0B G;  1NEG A;  3KHI A;  2COW A;  4R0K A;  3CCU A;  2LT1 A;  1S72 T;  2VAS A;  3M0R A;  5GAM h;  2KT1 A;  1WYX A;  4RTV A;  2H3E B;  4M77 C;  3OSS C;  4J9I A;  1TFB A;  2HCK A;  2RQW A;  2DEU A;  1VQ9 Q;  2QFZ A;  3UA6 A;  4XAX B;  5GAN e;  3ZEH A;  3V8J A;  1BKB A;  4LN2 A;  1WI7 A;  4C0G A;  2F2V A;  3OYK A;  2QGG A;  2DXT A;  2DME A;  4WTO B;  1E7P A;  1PRL C;  3EHR A;  4QKU A;  3CXC S;  3CCE A;  3S3O A;  5D6Y A;  3HP9 A;  3JCM J;  1M1K C;  4M7A D;  4C5H A;  1ZSG A;  2DER A;  1JJ2 S;  3TQ7 P;  3CCU Q;  3BHU B;  2DYI A;  4QVC A;  3TW6 A;  2IN3 A;  1K73 C;  3OW2 S;  3G4S Q;  2ZPG B;  3CPW S;  1OU9 A;  5DLQ E;  4EOL B;  3I35 A;  4YOS A;  3Q1J A;  3LGL A;  1MMN A;  3A98 A;  3TNI B;  3CXC P;  1H1R B;  1UDL A;  1XQH A;  2OAU A;  1QVF P;  3A5Z B;  2C6T B;  1BB9 A;  2FRY A;  4KRC B;  2EGA A;  2CGH A;  1N9R A;  4NST B;  2E12 A;  2DRK A;  1M2V B;  3CEY A;  1H25 B;  1JJ2 P;  3FJP A;  1T3L A;  3EFO A;  1YIJ Q;  2LT4 A;  4ZNX A;  2F2C A;  1MND A;  2DIL A;  3WXM B;  1W2B P;  1S1N A;  1M9S A;  1OL1 B;  1YI2 Q;  2EYZ A;  4HT9 A;  4N0A A;  2GF7 A;  1VOL A;  5IHI A;  3FLG A;  2DD5 B;  1VIE A;  1DJ7 B;  1Q81 U;  2KXD A;  4JRK A;  3BG5 A;  2RM4 A;  3DLL A;  2DNU A;  2BS4 A;  2MIO A;  2HDA A;  5LJ3 d;  3ZFJ A;  2WSF E;  2V1Q A;  3OYM A;  1P92 A;  4M7A B;  5GAM f;  1UG1 A;  1GCQ C;  4XU1 A;  4FYX B;  5D7U A;  2I40 B;  2AZS A;  5IHN A;  2PU9 B;  4J8O A;  2V8K A;  1N4M A;  4BCP B;  2KR3 A;  5CIU A;  1KHC A;  3CCS A;  1N8R U;  2F69 A;  3HB9 A;  2EJF A;  3H0I A;  2AT1 B;  4LD9 K;  2JOY A;  1H26 B;  3BY7 A;  4O5V A;  2QGF B;  1O75 A;  3VRZ A;  2WXV B;  5I21 A;  2DXB B;  2F5T X;  4OB1 B;  3TNH B;  3JCM V;  4BI4 A;  1Y0M A;  2GQV A;  4R55 A;  3FIF A;  3SWN A;  1VQP T;  1ENW A;  4Y92 A;  5IXB A;  4BCI B;  3O5Z A;  2RI3 A;  7AT1 B;  5LJ3 j;  1ZSZ A;  2KRM A;  2K6D A;  2GGR A;  2ATC B;  2CZ6 B;  1GCQ A;  1D1B A;  1KQS A;  1HXD A;  5D6X A;  2M0Y A;  1GXI E;  1Z9Q A;  3BG3 A;  3M57 A;  4X9C A;  1W4S A;  2NUT B;  4J6W A;  4JX6 A;  1AWJ A;  2YRV A;  1URC B;  1M30 A;  3VS1 A;  2RNA A;  1OOT A;  3M4Y A;  2PQW A;  3JCM Q;  4JJC A;  5IN1 A;  4MIM A;  5L23 A;  3PIO A;  5GMK j;  2EQM A;  1YIT T;  3UAT A;  2MCN A;  3SEM A;  5GAN 8;  5HKC A;  4RCB A;  1D3B B;  2QYZ A;  3IQL A;  1WHK A;  4E7S A;  4FW2 A;  2QF7 A;  2KDS A;  1JB0 E;  3RES A;  3OW2 P;  2E5Q A;  2VVK A;  5KYX A;  1KXU A;  3HZJ A;  3L2R A;  1UEC A;  3DB3 A;  5GAO l;  2LP5 A;  4J9D A;  2EQJ A;  4OR5 B;  1B07 A;  1VQP A;  4LDY A;  1OZ3 A;  3CBP A;  5IH2 A;  2X4Y A;  2BE9 B;  1U06 A;  4BI8 B;  3CC7 T;  2QDY B;  4YOO A;  3PTA A;  3UDC A;  5CKD A;  2O9S A;  3M54 A;  1VUB A;  5IHK A;  4HXJ A;  2PK2 A;  2HQH A;  1X75 C;  2K5F A;  3M5A A;  4EMK A;  1QKX A;  1M2V A;  4C8Q F;  2L3P A;  4CFU B;  4AG2 C;  3C95 A;  2E10 A;  3BE3 A;  4Y28 E;  4CFN B;  4M78 F;  2QQB A;  1LNX A;  2DET A;  3VYG B;  1C9B A;  3PGG A;  2A08 A;  5CQY A;  3RKY A;  4HT8 A;  1RUW A;  2C0T A;  4KH0 B;  4BCN B;  2JMC A;  5AYF A;  4ESR A;  4OMO A;  2LCC A;  2K3B A;  2QQS A;  1D3B A;  3HRS A;  3NTH A;  1RLP C;  5ICP B;  2XG8 D;  4PFO A;  3CD6 A;  1LPL A;  2E3I A;  2O2O A;  2ABL A;  1QCF A;  2P4T A;  1M27 C;  3P8H A;  1WXT A;  2LX7 A;  2MF2 A;  3V8K A;  3JCM c;  4DEX A;  4ELZ C;  1TWB A;  3UWN A;  2CSQ A;  1X2K A;  1PC0 A;  3DB4 A;  4P5N A;  2FYK A;  3QKJ A;  1WQ7 A;  3V7S A;  4M75 D;  2JM9 A;  3CPF A;  3EFO B;  2YWW A;  3JSC A;  5A0D A;  1T0H A;  2JS0 A;  3ZBD A;  1OPL A;  4RCC A;  3E19 A;  4EOR B;  5LJ3 g;  2LZ6 B;  3CC4 Q;  3VS2 A;  1JXO A;  4M78 G;  2XKO C;  5AT1 B;  2KT8 A;  5HK0 A;  3JCM h;  3DDP B;  2X51 A;  5GAM j;  2JS2 A;  1ZSZ C;  1QWE A;  1H3Z A;  2IVX A;  4C0D C;  1YHQ A;  1GRI A;  1KQS P;  1ACM B;  1X69 A;  3QYG B;  5GAN 7;  1YJN Q;  5HVY B;  1HD3 A;  3BLQ B;  2R5A A;  2RI2 A;  2W9F A;  1I07 A;  3M4G A;  1YI2 A;  2PZ1 A;  3C4S A;  2E65 A;  4C8Q A;  2YUQ A;  3G6E T;  2W10 A;  1WLP B;  4RTT A;  3HSB A;  4R56 A;  2WIP B;  2DF6 A;  2CKK A;  1H27 B;  2E4H A;  3QZ5 B;  4KGZ B;  1NJI U;  3QYE A;  2WFY B;  1WX6 A;  2CSI A;  2YRC A;  2RK1 A;  3EGX A;  1PD1 A;  3I56 Q;  4M75 G;  2RJC A;  4RTW A;  3RER A;  4M7D G;  4MFE A;  5IDP B;  4GBQ A;  5KYN A;  1WGS A;  3JB9 I;  4F7U B;  4MZM A;  1H28 B;  5CYI B;  3VS6 A;  1KQ2 A;  1BI2 A;  3CQT A;  1FWZ A;  2MWO A;  1VYU A;  1M1G A;  2CCH B;  2PK9 B;  2WSC E;  2K2V A;  4XTW A;  2XDB A;  4PJO G;  5HBE B;  1NLP C;  2PVO B;  4OML A;  4BE2 A;  1PSE A;  1OI1 A;  2JTF A;  1KFZ A;  1AD6 A;  1HJD A;  3HBL A;  2EYQ A;  4QVD A;  4II5 B;  2O4X A;  2RO0 A;  4EMK C;  5LJ5 j;  2W9Z A;  1NBE B;  3LWI A;  4M77 F;  1YI2 T;  1UFF A;  5CKH A;  1K9M C;  2UZD B;  3CCV T;  4J7I A;  3HRT A;  2DTI A;  2VGN A;  3OYA A;  3G71 T;  3L1A A;  3G33 B;  2DM1 A;  4JJD A;  2YLC A;  1FXX A;  3QDR B;  3JCM b;  2QTX A;  5I5Z B;  5ACB A;  2DZC A;  2EPD A;  1I1J A;  1Q82 U;  2E64 A;  3CCE Q;  4KRT A;  3A8M B;  1QVG S;  2HD0 A;  2CZ7 B;  3PT9 A;  2ZPB B;  2EQK A;  2XI9 A;  3JB9 J;  3RKX A;  4C8Q D;  4AMC A;  2PVD B;  4C8Q E;  3QYB A;  1N9S A;  3OYI A;  1OQK A;  2GTO A;  4BCJ B;  2CH4 W;  3OYH A;  1AHJ B;  5LJ5 e;  2FO0 A;  1KD1 C;  2HL5 C;  5FRN A;  3THK A;  1NYG A;  3VS0 A;  3RGF B;  1VQM Q;  1UGP B;  4ME7 A;  3QPH A;  2JT4 A;  1H92 A;  4HA8 A;  3G6E A;  2PVG B;  2KRN A;  2JTE A;  2ZPH B;  2QG9 B;  2WMB B;  1ZUY A;  5GAN 6;  1QMZ B;  4A4K A;  2WAC A;  4FSS A;  3K7A M;  3OBY A;  5EC7 A;  2VKN A;  1YIT Q;  1RAB B;  1OYX A;  1C1A A;  4IKF A;  4KH1 B;  2QI2 A;  3EG9 A;  5I2S A;  1W98 B;  1WHH A;  1YN8 A;  1JU5 C;  3E9G A;  1VQM A;  4NS5 A;  1B34 A;  2ESW A;  2CP5 A;  3SHW A;  1M2O A;  3KFV A;  2EYY A;  3VV0 A;  3VU3 C;  5L2W B;  1H4L D;  1VQ7 T;  3HPW A;  2JJ9 A;  4OMF B;  2VWF A;  3E9F A;  3NGP A;  1AT1 B;  4HLQ A;  4DQ2 A;  2JTM A;  4IUU A;  3M55 A;  1MMG A;  3CCM A;  2GCX A;  3OYE A;  4C0D B;  1RI9 A;  1K8A R;  2CYZ B;  1TTH B;  1D0X A;  3FJ5 A;  1YWP A;  2BS2 A;  1SKU B;  2EYW A;  3H41 A;  3TU4 K;  2IW8 B;  2L2P A;  3CME Q;  4JUV A;  4PJO B;  2OTL Q;  2DJQ A;  3RMS A;  2HQX A;  1C0M A;  4M77 B;  4M77 G;  3EH1 A;  1SG5 A;  2DVE A;  2OI3 A;  4ANJ A;  4MZP A;  2KI7 A;  4AFS C;  4XU3 A;  4ZGJ B;  3CC7 A;  4FYY B;  4OGR B;  5FLX E;  4JLG A;  3L42 A;  1QVP A;  1PKD B;  1VQ9 A;  1AEY A;  2X3X D;  2CRE A;  5J26 A;  5KH6 A;  3TEE A;  5FGK B;  4BCM B;  4QQD A;  2CP0 A;  4ELL A;  3QUI A;  4C0F A;  2RB6 A;  4JJB A;  5L8R E;  1TUD A;  3MI9 B;  2KRO A;  1IO6 A;  2CCI B;  2CP3 A;  1GL5 A;  2ENM A;  3OYL A;  3MHX A;  4FL6 A;  3A8L B;  1RAA B;  3EG1 A;  4Z89 A;  1PNJ A;  4M78 A;  5KYU A;  1MHN A;  2JGZ B;  4MFD A;  4D6W A;  1NLO C;  3MY5 B;  5GAN h;  3CCJ Q;  3U23 A;  3J7A F;  1M8M A;  2WHB B;  4OMP A;  3X28 B;  1QVF S;  2DTO A;  2ED0 A;  2JZ2 A;  2QQ9 A;  3VS3 A;  5EFQ B;  1BU1 A;  3EG0 A;  2NYS A;  3OYD A;  4F6S B;  4BBR M;  3NDQ A;  2M51 A;  1CKA A;  3VS4 A;  5BNJ B;  1W6X A;  1I5O B;  4AKG A;  5FW9 A;  3VS5 A;  2EWN A;  2XIC A;  4FX3 B;  1X6G A;  1X01 A;  4ATO A;  3LX7 A;  4HCK A;  4Z8A A;  1TH7 A;  1YIJ A;  4OVA A;  1FX7 A;  1WDX A;  2RN8 A;  4BCM D;  3OB9 A;  1OI9 B;  4ZTF A;  3PO3 S;  2RD1 A;  1U8R A;  2QA4 T;  2YXY A;  5LJ5 h;  2M16 A;  1Z9Z A;  4BD3 A;  2L0A A;  2F2X A;  4BUG A;  1QCO A;  2QQR A;  1Q86 C;  1ZQ1 A;  5C0M A;  2CZ0 B;  5GAN j;  4M7A A;  2A36 A;  4L6V 5;  4C92 G;  3QZ9 B;  4X9D A;  4BAC A;  2V26 A;  3TNW B;  4FM4 B;  2RA2 A;  3H0F A;  3M0U A;  1X27 A;  3WVE B;  1Q81 R;  2LW4 A;  5LJ3 e;  1BBZ A;  1UJ0 A;  2I53 A;  1ABO A;  1IB8 A;  2DE0 X;  1K0X A;  3MP8 A;  1N6A A;  2DBM A;  4XU0 A;  1BU2 A;  2QEX Q;  3H6Z A;  2FPE A;  4E2F B;  3JB9 D;  1VIN A;  5I2M A;  1H24 B;  3M0T A;  1GFC A;  4DOV A;  5GAM g;  5CVI A;  1W70 A;  4JPB W;  3HL8 A;  4YTL A;  3QHS A;  1UGV A;  3C94 A;  2BKD N;  1N8R R;  2XDP A;  4HVW A;  5GAN 4;  5GJW B;  4XU2 A;  3QO3 A;  2M02 A;  1U1T A;  3CC4 A;  1Y71 A;  2FEI A;  1B7T A;  2B8A A;  3G71 Q;  2CDT A;  2IW6 B;  2HKQ B;  1RAG B;  3TW7 A;  2R57 A;  4BY1 X;  1LCK A;  4E7Z A;  1UNL D;  1K76 A;  1V29 B;  1TOV A;  4J9G A;  4ELY C;  3PIP A;  3OW2 A;  1RAF B;  4EOK B;  2YLB A;  2HQE A;  1OKW B;  1H1P B;  2LVM A;  4RUG A;  1H64 1;  3EH2 A;  4EOJ B;  2FPD A;  1ZA2 B;  4C92 A;  1OX9 A;  5DQW A;  3E1S A;  2SEM A;  4XTY A;  3QHW B;  2PJQ A;  4ZGD B;  1J3T A;  1OKV B;  1BCM A;  4BDY A;  4FCY A;  1IRE B;  3QG1 A;  4M7A C;  1WIE A;  2HSE B;  3I55 Q;  3CCE T;  1NE8 A;  1YJW Q;  5GAN g;  2RJF A;  2B9R A;  4A54 A;  1Y07 A;  5GMK l;  2OTJ T;  4C92 D;  2R7G A;  2WSE E;  3FB9 A;  3DDQ B;  2EQU A;  1MUZ A;  2ROL A;  4ROC A;  5IT9 E;  5KYX B;  1YWO A;  2O4X B;  4K11 A;  4KGV B;  2FZG B;  4QQG A;  1K1Z A;  1VQ5 Q;  2HKN A;  5EJC A;  3FC3 A;  4Z6Y A;  2BIV A;  4BI3 A;  3DLM A;  4PLI A;  2C06 A;  2OAW A;  1KQ1 A;  3O0G D;  2RHY A;  1Q86 U;  3ULR B;  1MV3 A;  1Y7X A;  3MP1 A;  4AFZ C;  1WHJ A;  1YJW A;  1M8V A;  3EID B;  1G83 A;  3TN8 B;  1AOJ A;  4ORZ A;  4HNT A;  1LVK A;  2F5K A;  4BCF B;  1QVF A;  4CXA B;  3J80 E;  1MMD A;  2RPN A;  4J9F A;  5D6W A;  2Y90 A;  4PK4 A;  1KG1 A;  3BG9 A;  4DA4 A;  1YJN T;  3HHT B;  2DL5 A;  2FRW A;  1IXD A;  2HAX A;  3DTO A;  1ZP2 A;  4RG2 A;  5GAO n;  2J6F A;  4TTH A;  2RJD A;  2AHJ B;  3EGX B;  3M53 A;  4HVU A;  2DD4 A;  1HSQ A;  4C92 B;  4DOW A;  1NEB A;  2X35 A;  4E6R A;  1KQS S;  3SWN B;  1IHW A;  3M0Q A;  2IW9 B;  2JM8 A;  2DXB A;  5CCA A;  1F1B B;  3C0C A;  3I56 T;  1FKM A;  3A8O B;  4YOZ A;  2IG0 A;  4ROE A;  4YC3 B;  5GAN 2;  3CCR T;  1VYT A;  1PWT A;  4C92 E;  3P8D A;  2CP2 A;  5J39 A;  4ROD A;  2E6Z A;  3OS2 A;  3H0H A;  1ZUK A;  1ABQ A;  3S6W A;  1V1C A;  3CMA A;  5KYW A;  1XO2 A;  1YCS B;  4V2S A;  2RQV A;  4X1V A;  1RAE B;  6AT1 B;  1VQM T;  2LCS A;  2QA4 Q;  2E70 A;  2KQW A;  4A4G A;  4HL4 A;  4EC9 B;  2M0O A;  2DEQ A;  2VUB A;  2MK5 A;  1Y96 A;  1PG5 B;  3JV3 A;  5A0G A;  4CFX B;  1NYF A;  2EJ9 A;  1VQ7 A;  2RHX A;  3EGD B;  4A53 A;  4EPC A;  3ME9 A;  1D0Y A;  1TG0 A;  2MWP A;  4AG1 C;  1I5L A;  1GUX B;  4Z02 A;  4EOM B;  2L3R A;  1EIF A;  5ECA A;  4J6Y A;  3VS7 A;  4C92 C;  3I56 A;  4M75 A;  3OBW A;  1RAH B;  3CC2 T;  3CCV Q;  1U1S A;  4QQ6 A;  3MIA B;  2LJ3 A;  2EQI A;  3SDZ A;  4FT4 A;  1TS9 A;  3UA7 A;  3M0P A;  2HNI A;  1NJI R;  4B9W A;  3CCM Q;  3CPW P;  1VQO Q;  4E7I A;  3TCJ A;  4M7D B;  4OMQ A;  3JCM P;  2RMO A;  3VYH B;  1WHG A;  1I8F A;  3O8V A;  4Q5W A;  1SPK A;  1D0Z A;  4M75 B;  2QGS A;  4EMH A;  8ATC B;  1NPP A;  2BE7 D;  5J3B A;  4AFQ C;  3MEU A;  1SRM A;  1GUX A;  3QII A;  5GAN 5;  4JDS A;  4BCQ B;  1PM3 A;  5DY9 A;  1H8K A;  1UEB A;  4JJN K;  1K8A C;  1JEG A;  2EKH A;  1VQ8 A;  2LDM A; 
#chains in the Genus database with same CATH homology
 1K8A U;  3HO8 A;  4IUR A;  3OSS C;  5GAO q;  1YJW T;  1OYX A;  4QW2 A;  2E6N A;  2XD0 A;  1S72 A;  1PSF A;  4IKF A;  4LDX A;  1VQL A;  2QI2 A;  3HKS A;  4TVR A;  2QFZ A;  5LJ5 f;  2XU8 A;  4XAX B;  4MMK A;  5GAN e;  3ZEH A;  5I2S A;  3V8J A;  2E41 A;  1BKB A;  3H8Z A;  4C0G A;  2VXE A;  3E9G A;  3OYK A;  3MEW A;  2DTH A;  3QJ6 A;  4NS5 A;  1VQM A;  2DXT A;  3JB9 J;  1LJO A;  3CD6 T;  1E7P A;  1B34 A;  5GMK e;  4MDW A;  3CXC S;  3CCE A;  1RL2 A;  1UGS B;  4AKH A;  2Y4Y A;  3VV0 A;  5D6Y A;  3S3O A;  5FU6 B;  1M1K U;  1VQ5 T;  3HP9 A;  3VU3 C;  2OTL A;  2P0K A;  3LWH A;  1KC8 C;  3JCM J;  1KHI A;  3V7C A;  1M1K C;  5LL6 S;  1NPR A;  4M7A D;  4OP0 A;  4C5H A;  2FL7 A;  3NFC A;  1VQ7 T;  3HPW A;  1JBM A;  4OMF B;  4M78 D;  3L2Q A;  1JJ2 S;  3E9F A;  1VQ6 A;  4KBM B;  2ZPE B;  3VKG A;  2V8J A;  4QVC A;  4CI0 C;  4HLQ A;  3TW6 A;  4DQ2 A;  4XK8 E;  2P0P A;  1K73 C;  3OW2 S;  2JTM A;  4IUU A;  2M1H A;  2ZPG B;  3CPW S;  4KUL A;  5DLQ E;  3M55 A;  3I55 A;  2D6F A;  3Q1J A;  3LGL A;  3CCM A;  2GCX A;  3OYE A;  3HRU A;  4C0D B;  4OB0 B;  3CCR A;  3CCJ T;  1XQH A;  2CYZ B;  5LJ3 f;  2HBP A;  2OAU A;  4PJO A;  3A5Z B;  4M75 E;  2BS2 A;  2NLU A;  1UB4 A;  2E1H A;  3VJP A;  3F70 A;  3TU4 K;  2CGH A;  1N9R A;  2E12 A;  5DLO A;  2VGM A;  3S3N A;  3CEY A;  4JUV A;  2KY9 A;  3GP8 A;  5A0L A;  3FJP A;  4FSX A;  4PJO B;  3JCM d;  3OS0 A;  3RMS A;  4UC4 A;  2HQX A;  4M77 B;  2LT4 A;  3WXM B;  2OTL T;  4M77 G;  2ZCF B;  5GAN 3;  1M9S A;  4PJO D;  3EFR A;  2DVE A;  4RMO A;  2DPP B;  4HT9 A;  4MZP A;  3OYC A;  1VQ8 T;  4N0A A;  1YBY A;  2GF7 A;  2A3L A;  2P0Q A;  3FLG A;  2DD5 B;  4J6X A;  4ZGJ B;  4XU3 A;  5FU6 C;  3CC7 A;  1VIE A;  4C8Q B;  1DJ7 B;  5FLX E;  1Q81 U;  4MML A;  4JRK A;  3BG5 A;  3CC2 A;  1G3T A;  4II1 A;  4JLG A;  4O6J A;  3JAM E;  2JN0 A;  1QVP A;  3L42 A;  4IUV A;  2RM4 A;  4F7U A;  1Q81 C;  3DLL A;  3SFM A;  1VQ9 A;  4M78 B;  3CMA T;  2BS4 A;  3DKM A;  5CO7 A;  4PL6 A;  5J26 A;  5LJ3 d;  3ZFJ A;  2WSF E;  3TEE A;  5KH6 A;  4OGE A;  4XTX A;  4OB3 B;  4E7J A;  3L2V A;  1LOJ A;  3OYM A;  3I55 T;  1P92 A;  4M7A B;  4JRI A;  5GAM f;  3L2W A;  1VQ9 T;  3GNF B;  2VC8 A;  1YJ9 T;  4GLK A;  4XU1 A;  4QQD A;  5GAN j;  2D9T A;  2RJE A;  3QUI A;  4JS5 A;  3X20 B;  4C0F A;  1VQK T;  3BW1 A;  2RB6 A;  3CBO A;  2PU9 B;  4J8O A;  2V8K A;  5L8R E;  1VQ6 T;  4AI6 A;  5CIU A;  3CCQ T;  1KHC A;  3T9N A;  2XID A;  2K3X A;  3CCS A;  1YIT A;  2DD4 B;  1N8R U;  2F69 A;  3OYL A;  3HB9 A;  2EJF A;  2M9U A;  3A8L B;  2ZZD A;  3GNG A;  3MHX A;  4FL6 A;  4M78 A;  4D6W A;  4LD9 K;  1MHN A;  4MFD A;  5GAN h;  2JOY A;  5LJ3 h;  4RG8 A;  1N8R C;  1JRI A;  3BY7 A;  4O5V A;  4C92 F;  3LYI A;  1O75 A;  4EDU A;  3J7A F;  3OMG A;  4M7D F;  1O9S A;  1KC8 U;  2DKG A;  1JJ2 A;  3OS5 A;  2DXB B;  5I21 A;  5GAO p;  3X28 B;  3G7Z A;  1QVF S;  2DTO A;  2JZ2 A;  2F5T X;  4OB1 B;  2QQ9 A;  5FRO A;  3QBY A;  4M7D C;  4N4I A;  3JCM V;  2GQV A;  4BI4 A;  2L89 A;  3FIF A;  4R55 A;  3SWN A;  3OYD A;  1VQP T;  4FIB A;  4M75 F;  4LDU A;  4BBR M;  4JX5 A;  2RI3 A;  3MEA A;  3KXT A;  2MMP A;  5LJ3 j;  3CXC A;  4RKU E;  4AKG A;  3OYG A;  2EWN A;  2RHU A;  2XIC A;  1BI3 A;  2GFU A;  1X01 A;  4F7U F;  4ATO A;  3LX7 A;  3CCL A;  3S3M A;  2CZ6 B;  1TH7 A;  1YIJ A;  4OVA A;  1KQS A;  4F7U G;  2Y4X A;  4BDZ A;  1HXD A;  3EAE A;  1WQW A;  5D6X A;  5GMK m;  1FX7 A;  3OS1 A;  1GXI E;  2I2L A;  3OB9 A;  3G71 A;  3SB2 A;  4ZTF A;  2RD1 A;  4M77 E;  4ZN3 A;  3BG3 A;  3LW5 E;  1QP3 A;  2QA4 T;  1YIJ T;  1U8R A;  3M57 A;  5LJ5 h;  2M16 A;  4BD3 A;  4X9C A;  3CCL T;  3RMQ A;  1I4K 1;  1W4S A;  1OZ2 A;  3WVD B;  2O01 E;  4PJO E;  4J6W A;  4BUG A;  4JX6 A;  2DD5 A;  2YRV A;  3CPW A;  2QQR A;  3NTI A;  2QA4 A;  1Q86 C;  4L59 A;  1ZQ1 A;  5C0M A;  2CZ0 B;  4XTZ A;  2QXF A;  3M4Y A;  2PQW A;  4L6V 5;  3VYG A;  3RKW A;  4M7A A;  3URG A;  3M59 A;  1VIF A;  5HY6 A;  3JCM Q;  2PUO B;  4C92 G;  5IN1 A;  3QZ9 B;  1XTD A;  4MIM A;  2EAY A;  4IUQ A;  1VQL T;  4X9D A;  3C12 A;  4BAC A;  3JCM f;  3PIO A;  5GMK j;  2EQM A;  1YIT T;  4FM4 B;  2RA2 A;  3HFO A;  2X4W A;  1VQ8 A;  1X6O A;  5GAN 8;  5HKC A;  3WVE B;  4RCB A;  1D3B B;  4FU6 A;  5LJ3 e;  2QF7 A;  2KDS A;  4OF1 A;  1QVG S;  1JB0 E;  3RES A;  2XDD A;  2E5Q A;  5M9O A;  5GAO m;  2LCL A;  4HNU A;  3HZJ A;  3MP8 A;  1N6A A;  2MAM A;  4XU0 A;  3OYN A;  2LTO A;  4LOC A;  3L2R A;  3DB3 A;  3H6Z A;  5GAO l;  1MGQ A;  1Y96 B;  1VQO A;  3JB9 D;  2EJG A;  1VQN T;  2RHI A;  4JS4 A;  2DK3 A;  3RUX A;  2EQJ A;  5I2M A;  2QEX T;  1VQ4 A;  4M7D A;  4DOV A;  5GAM g;  5CVI A;  3SWN C;  2K57 A;  1VQP A;  4LDY A;  1OZ3 A;  2WJ9 A;  3HL8 A;  4YTL A;  3QHS A;  3C94 A;  1M4Z A;  1XOV A;  4QSH A;  3CBP A;  3MET A;  2X4Y A;  1W2B A;  3MO8 A;  4ZTJ A;  3VUB A;  1UGR B;  2BKD N;  4BI8 B;  4EMG A;  3CC7 T;  2QDY B;  3PTA A;  3LH0 A;  4ELJ A;  4M6V A;  2XDP A;  3UDC A;  3VUZ A;  5CKD A;  3CC4 T;  3OA6 A;  3G4S T;  2R58 A;  3CBM A;  3M54 A;  3VKH A;  5GAN 4;  4JLI A;  2CZ1 B;  4XU2 A;  1VUB A;  4NL2 A;  3QO3 A;  4C5G A;  3SD4 A;  4BBS M;  1U1T A;  3N5B B;  2QQ8 A;  5LJ5 g;  3CC4 A;  4PJO C;  4NC6 A;  1X75 C;  1Y71 A;  2K5F A;  3M5A A;  4X34 A;  4EMK A;  1M90 U;  4HCC A;  2DJZ A;  4NOY A;  4C8Q F;  2B8A A;  4E7H A;  4PKC C;  3M56 A;  4JRQ A;  4JRP A;  4HNV A;  1G3W A;  3C95 A;  3TW7 A;  2E10 A;  1G5V A;  2R57 A;  3GF5 A;  1WNL A;  4Y28 E;  4M78 F;  4M7A G;  1V29 B;  3OW2 A;  1XNI A;  2XK0 A;  3DL1 A;  4ELY C;  2QQB A;  3PIP A;  1BYM A;  1LNX A;  4M77 D;  3VYG B;  2YLB A;  2KR6 A;  3OYB A;  2HQE A;  3AHU A;  3PGG A;  1Q7Y U;  4E7L A;  4A4F A;  5CQY A;  1B34 B;  2H3J A;  2K4Y A;  3FEO A;  2LVM A;  3RKY A;  2EKO A;  1H64 1;  3UPU A;  4HT8 A;  4BE1 A;  4C8Q G;  5C6S A;  4KUI A;  4JX4 A;  2ZPF B;  2K5I A;  2DIG A;  5KE3 A;  4MZT A;  4C92 A;  3OYJ A;  5FU7 C;  3E1S A;  4XTY A;  5AYF A;  3QSU A;  4ZGD B;  2A7Y A;  4N4G A;  2KVQ G;  4M77 A;  2LCC A;  4BDY A;  1IRE B;  2QQS A;  3QG1 A;  3QWL A;  5GAM d;  1D3B A;  2VV5 A;  3HRS A;  1RI0 A;  3NTH A;  3G4S A;  1VQ4 T;  2KSS A;  4M7A C;  2XG8 D;  2LRQ A;  3CD6 A;  2QDJ A;  1NE8 A;  3CCE T;  5GMK h;  5GAN g;  1VQN A;  2RJF A;  4A54 A;  3CCM T;  1Y07 A;  3V7R A;  5GMK l;  1WPY A;  2RHZ A;  2P4T A;  2OTJ T;  3H4C A;  2WSE E;  3P8H A;  4M78 C;  4C92 D;  2DXC B;  4FT2 A;  4C5I A;  2MF2 A;  3KUF A;  3JCM e;  3FB9 A;  4LD6 A;  3JCM c;  2EQU A;  3V8K A;  4E47 A;  4ELZ C;  3QJY A;  5DM7 R;  3CCU T;  5IT9 E;  2JNG A;  4M7D D;  3UWN A;  2OTJ A;  4C8Q C;  4NL3 A;  3DB4 A;  4P5N A;  1WJS A;  5CR2 A;  4MDX A;  4J7F A;  3X25 B;  2FYK A;  3QKJ A;  2D0Q B;  2O4X B;  4PLL A;  1WQ7 A;  3MEV A;  3V7S A;  4M75 D;  4A4H A;  5A2Q E;  4BB7 A;  4CRI A;  4QQG A;  5FU7 B;  3PNW C;  3CPF A;  5EJC A;  3JSC A;  4HKE A;  3JB9 G;  4OB2 B;  5A0D A;  3FC3 A;  4Z6Y A;  3A8H B;  2BIV A;  3DLM A;  3EFS A;  4PLI A;  3V8L A;  2LC4 A;  4BI3 A;  2DZ9 A;  5GAO r;  2C06 A;  1KQ1 A;  4AKI A;  3ZBD A;  4RCC A;  3E19 A;  5LJ3 g;  3CCQ A;  2RHY A;  3ER0 A;  4M78 G;  2XKO C;  4VUB A;  1K9M U;  4BY6 C;  3A8G B;  5HK0 A;  1Q86 U;  4B9X A;  3JCM h;  1Y7X A;  3MP1 A;  5GAM j;  4C0Z A;  1YJW A;  4IUP A;  1M8V A;  4XQ3 A;  2DAQ A;  1H3Z A;  3X26 B;  3GOX A;  4KT0 E;  4ZGE B;  4GY5 A;  5IAY A;  4C0D C;  1YHQ A;  4HNT A;  2F5K A;  3M9Q A;  2JUF A;  4QVZ A;  4KUD K;  3FDR A;  1QVF A;  3QYH B;  5KE2 A;  2FHD A;  3QYG B;  5GAN 7;  3J80 E;  1QLB A;  5D6W A;  2Y90 A;  2R5A A;  1KG1 A;  2RI2 A;  2FVU A;  1SSF A;  2KMG A;  3BG9 A;  3M4G A;  4DA4 A;  3JCM X;  3HHT B;  5CQX A;  4J83 A;  3C4S A;  1YI2 A;  1YJN T;  1G3Y A;  2HAX A;  4J5Y A;  2E65 A;  4C8Q A;  4RG2 A;  3JB9 H;  5GAN d;  5GAO n;  3G6E T;  1UGQ B;  2RJD A;  3BDL A;  2AHJ B;  4WF2 A;  1YCY A;  3VKI A;  3M53 A;  4R56 A;  3HSB A;  3R6O A;  2ZZD B;  4F7U E;  2CKK A;  2DD4 A;  4M78 E;  4C92 B;  3CCS T;  4N4H A;  4DOW A;  3QZ5 B;  3CCJ A;  3PFS A;  1NJI U;  3QYE A;  2X35 A;  1KQS S;  3SWN B;  1I81 A;  2RK1 A;  5CKE A;  2G77 A;  2DXC A;  2LQK A;  2EFI A;  3BDU A;  4M75 G;  2MI6 A;  1NJI C;  3L2U A;  2DXB A;  5CCA A;  4M7A F;  3I56 T;  2RJC A;  1FKM A;  3A8O B;  3PMT A;  4LDV A;  4HCZ A;  3RER A;  3TRE A;  2KK4 A;  3ASK A;  2IG0 A;  5GAN 2;  4M7D G;  3CCR T;  4MFE A;  3OSV A;  3P8B B;  1VQO T;  2FB7 A;  3HFN A;  3X24 B;  4C92 E;  1WGS A;  3JB9 I;  3MCA B;  4F7U B;  3GLX A;  4MZM A;  3BFM A;  3JCM W;  1M90 C;  1YHQ T;  2BUD A;  3OYF A;  1KQ2 A;  1BI2 A;  3P8D A;  2RK2 A;  2X4J A;  1FWZ A;  2IVW A;  2MWO A;  2ZGW A;  4EMK B;  1M1G A;  2WSC E;  3JCM g;  5J39 A;  2K2V A;  4XTW A;  5HK3 A;  3J81 E;  2E6Z A;  2XDB A;  4PJO G;  2CS7 A;  2PVO B;  2LX9 A;  3S6W A;  3OS2 A;  3FRN A;  2DIQ A;  4BE2 A;  2LNV A;  3CMA A;  1VQK A;  1PSE A;  4M75 C;  1OI1 A;  2DO3 A;  2JTF A;  4HCB A;  4V2S A;  1Q7Y C;  1WJR A;  2V8I A;  4N0A C;  3OQ5 A;  3GIB A;  1NZ9 A;  2GFA A;  3HBL A;  4BE0 A;  1VQM T;  2EYQ A;  3NTK A;  4QVD A;  5GMK i;  2E70 A;  2KQW A;  2RH2 A;  4A4G A;  2JVV A;  2LQ8 A;  3OY9 A;  2O4X A;  2RO0 A;  4HL4 A;  4PJO F;  1QW1 A;  4EMK C;  5LJ5 j;  5CKF A;  2PUK B;  5FRM A;  1R8O B;  2RI5 A;  4IUT A;  4E7K A;  3LWI A;  2M0O A;  2X4X A;  1VQ5 A;  2DEQ A;  2VUB A;  4M77 F;  2YHT A;  3PMI A;  1Y96 A;  5CKH A;  5KCO A;  4ZN1 A;  1YI2 T;  1YJN A;  1W2B S;  1K9M C;  3CCV T;  3LLR A;  2VXF A;  1BIA A;  5A0G A;  4J7I A;  3HRT A;  2DTI A;  2EJ9 A;  2VGN A;  3OYA A;  3G71 T;  1VQ7 A;  2RHX A;  3L1A A;  1HK9 A;  4A53 A;  4EPC A;  4XTV A;  5EG2 A;  2YLC A;  4A4E A;  5KCH A;  3ME9 A;  1Q82 C;  1FXX A;  3QDR B;  3JCM b;  2QTX A;  3MP6 A;  2BS3 A;  2DZC A;  2K3Y A;  3OMC A;  4XTU A;  2MWP A;  1Q82 U;  1I5L A;  2E64 A;  4Z02 A;  4Y91 A;  3UT1 A;  4M7A E;  2DXU A;  2L3R A;  1EIF A;  4LDW A;  5CK9 A;  3A8M B;  2KAF A;  4J6Y A;  1ZHI A;  4C92 C;  2HD0 A;  1WJQ A;  2XHC A;  3INZ A;  2CZ7 B;  2ZPB B;  2EQK A;  2G3R A;  2XI9 A;  3OBW A;  3PT9 A;  1ZBX A;  4M75 A;  3I56 A;  3GPL A;  1BI0 A;  1M1F A;  3CC2 T;  1G3S A;  3RKX A;  1U1S A;  4C8Q D;  3JRZ A;  2EIF A;  3KBG A;  4QQ6 A;  1M5Q 1;  2PVD B;  4C8Q E;  2L8D A;  2ZPI B;  3QYB A;  1N9S A;  3OYI A;  2L5Q A;  1BIB A;  1BI1 A;  4C5E A;  3OYH A;  5GAN f;  1AHJ B;  3SDZ A;  4L5G A;  4FT4 A;  5LJ5 e;  3M58 A;  5CAI A;  1KD1 C;  1YJ9 A;  2HNI A;  4B9W A;  2QEX A;  4OGC A;  5FRN A;  4E7I A;  3TCJ A;  1QVG A;  1N27 A;  1KD1 U;  4M7D B;  3QXE B;  4M7D E;  3JCM P;  1IZ6 A;  3L2Z A;  3CME T;  3VYH B;  1UGP B;  2VYT A;  4ME7 A;  3QPH A;  3LGF A;  1I8F A;  3O8V A;  4HA8 A;  4Q5W A;  4BY6 B;  3G6E A;  2K5L A;  4M75 B;  4EMH A;  3CME A;  4PNO A;  2PVG B;  1NPP A;  5J3B A;  3OYY A;  5GAM e;  3MEU A;  1QP2 A;  1K73 U;  2ZPH B;  5LJ5 d;  3QII A;  5GAN 5;  4JDS A;  3CCV A;  3JB9 F;  5GAN 6;  3CCU A;  3KHI A;  4A4K A;  2WAC A;  5DY9 A;  5CKB A;  2LT1 A;  2QQA A;  3OBY A;  1S72 T;  1UEB A;  5GAM h;  4JJN K;  3RIR A;  1K8A C;  4M77 C;  2KMT A;  2R5M A;  2LDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...