3A8MB

Crystal structure of nitrile hydratase mutant y72f complexed with trimethylacetonitrile
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPFYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
molecule tags Lyase
source organism Rhodococcus erythropolis
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
total genus 57
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8mB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8mB02
1QP2A 3X20B 2ZPHB 2O01E 2ZPBB 4FM4B 4XK8E 3X25B 2PVOB 3A8GB 5L8RE 2CZ6B 1QP3A 2CZ1B 2DD5A 4ZGEB 1DJ7B 2D0QB 2ZZDB 3X24B 2DD5B 4ZGJB 2DXCA 1GXIE 4Y28E 3QZ9B 1IREB 2DD4B 2CZ7B 3WVDB 3VYGA 4RKUE 2ZPIB 2QDYB 4KT0E 4OB3B 3QXEB 2WSFE 4OB0B 2ZPFB 2PUKB 4L6V5 1JB0E 3QYHB 3A8MB 2AHJB 3A8OB 3VYHB 2CZ0B 1PSFA 2PU9B 1UGSB 2DD4A 2DXBA 3QZ5B 2WSEE 2ZPGB 4ZGDB 2PVDB 3HHTB 2CYZB 1UGQB 2DPPB 1PSEA 1UGRB 1AHJB 3VYGB 3QYGB 4OB2B 3A8HB 2PUOB 1UGPB 3WVEB 3A8LB 2ZZDA 2PVGB 2ZPEB 2ZCFB 3LW5E 3X26B 1V29B 2DXBB 3X28B 4OB1B 2WSCE 2DXCB
chains in the Genus database with same CATH superfamily
3RKYA 2LNHB 4FSXA 1N8RC 3SB2A 1BBZA 1VQ4A 4OR5B 1Y07A 3E1SA 1YITA 1M2VA 3VS7A 2LTOA 1D3UB 3L2VA 2CSQA 4G6LB 5GAN8 4BCHB 2CCIB 1K9MC 2COZA 1Q81R 4XTXA 1IHWA 5IT9E 1K0SA 1NLOC 4DBRA 2EPDA 2GTOA 2ENMA 1TH7A 1MV0B 2DD5B 1ZUYA 4Y28E 4V2SA 4ORZA 4PFOA 2UZEB 2W9ZA 3EG2A 1QVGS 1N8RR 1JKWA 2MIOA 1WHMA 2YRDA 1VYUA 2L2PA 1IGQA 4OB3B 3M0TA 3QXEB 1B07A 3VS3A 3RKXA 3G6EA 4DA4A 4L6V5 1RAAB 2CT3A 3JCMf 2RB6A 2OTLT 4LE9A 5GAMd 3CMET 4JUVA 2DBMA 4C0ZA 2VGMA 3CC4T 2CUDA 2FYKA 1OI1A 3M03A 4II1A 2FPFA 1Q82R 4C8QE 2YDLA 1U5SA 5KYUA 4BCQD 3OW2P 1W98B 2LRQA 3QDRB 2BZYA 1KD1R 4D6WA 3MJXA 3FIFA 5GAOp 3JAME 1OV3A 1OYXA 4E7KA 1EX4A 1R8OB 2JXBA 2C5NB 4O6JA 1H28B 5KYWB 2KYBA 3GIBA 2MK5A 4FIBA 3VS4A 3TSZA 2DVJA 4BBSM 1IO6A 1HYOA 2L8DA 2L3RA 4JJDA 1GUXB 1QWEA 2YSQA 1T3SA 4IUQA 2LJ0A 4M77E 1HK9A 2JS0A 2GQVA 2O4XB 1G3WA 2MF2A 4A4KA 2QEXT 1QQJA 2LQKA 4DEXA 1MMAA 1KXUA 1QMZB 5IXBA 2K9GA 4RTXA 3M0SA 1TG0A 4MMKA 3I56Q 6AT1B 4HCCA 2QQSA 2PVOB 1WZOA 3H4CA 4M7DD 1OIUB 4HT8A 1UHCA 3EAEA 3S6WA 1EZZB 3EGDA 3CCMT 4M78E 1GXIE 1VQNA 4M78D 3CC4A 2CP3A 1Y57A 4RG2A 4AT1B 2M16A 3CCVQ 2NUPB 3RUXA 3ME9A 4KULA 4XU1A 4KT0E 2XHCA 2LQ8A 5LJ3j 5CKDA 4M75F 4I3ZB 2XDDA 3OYMA 2IW8B 7AT1B 1SG5A 4PJOE 2HQEA 5FU6B 4JJCA 4CFWB 5D7UA 2QYZA 4JX5A 4FYVB 2KQWA 2AHJB 2KR3A 1IGUA 2HBWA 1G3NC 5KYYB 5GAMg 1FKMA 1KJWA 1GCPA 4B9XA 1FX7A 2KRSA 1KC8C 4BCMD 3CPWP 1K76A 2NUPA 3R6NA 2IVXA 1AT1B 1UGVA 2PVDB 4BBRM 5CO7A 3PIPA 3V8LA 3VS2A 3BG3A 1VQ6A 1W6XA 1AZEA 2FB7A 1H24B 1VQOA 1O9KA 2EQMA 2O9SA 2DM1A 3V7CA 2BPMB 1BI2A 4F6WB 3DDPB 4OGEA 3A8LB 2WHBB 5GMKe 2PVGB 5GAOm 1WQWA 1VQ4Q 2JW4A 1H1QB 3RERA 1B3QA 1U8RA 3V7RA 4AG2C 4C92D 1VQ5T 4Z8AA 2LDMA 1RAEB 5GANh 2CH4A 2GNCA 2DJQA 3OS0A 3M54A 4BDYA 2LT4A 2AKKA 5GAMe 4Y72B 2E12A 4C0FA 4IUVA 1VIEA 1YJNT 2V1RA 1M8VA 3HRSA 4CC3A 1X43A 2K3BA 1K0XA 4F7JB 4XK8E 2X35A 4J8OA 2QGGA 1RADB 4GLKA 2WIPB 2CZ6B 5GAN5 2DD5A 1HJDA 5I11A 1VQ9A 3CCJA 4E7LA 4XQ3A 1O75A 2MAMA 5IDNB 2DL8A 1YITT 1JU5C 2EYQA 3E9FA 2E1HA 2KK4A 3QWXX 3RIRA 3E9GA 2O9VA 1R0BG 3SDZA 1M2VB 4FCYA 4AKGA 1Z9ZA 2F2VA 4C92E 2F5TX 4EMKC 2HKQB 1ARKA 2F5KA 2MI6A 4X9CA 3VUZA 1WHJA 2GCXA 2JJ9A 3PFSA 3J81E 4CFNB 3A8MB 3MI9B 3JCMW 3JCMQ 2RA2A 3A8OB 1WDXA 3VYHB 4DBFA 3M9QA 3DJBA 4M78C 1FYNA 4RTZA 4EMKB 4YOZA 3AT1B 5FRNA 2WMAB 4NSTB 3GNFB 3O8VA 2DXBA 5AYFA 1YJWT 4MDXA 2WSEE 4E6RA 1AZGB 2EYZA 3SWNA 1LJOA 1N27A 1RAGB 3DKMA 1PKDB 4C0GA 5LJ5f 2GFAA 4M7AA 2CH4W 2RNAA 4YOSA 2RI3A 1E6GA 4JX6A 4ROEA 3G1JA 4Y92A 2EQIA 1Y0MA 3MO8A 1Q82U 2KROA 1OQKA 5KCHA 2KR6A 1M90C 5FROA 1ZBJA 3QWLA 3INZA 2DXBB 2XDBA 5DM7R 2DO3A 1IRXA 3V8KA 2RQWA 3C0CA 1S72A 1NJIR 4C92A 1K9MU 3KHIA 4F6SB 4XTZA 1MGQA 1OZ2A 4A4HA 4BI4A 1YHQA 3OYDA 2DZCA 1TUGB 2XD0A 5L8RE 1BU1A 1PKTA 2D0NA 2QG9B 3M56A 4JJNK 1D3BB 4RTTA 1RAHB 1ZHIA 3LLRA 4C5IA 2VUBA 2EKOA 1SKUB 4F16A 2HCKA 3GNGA 1E7PA 2DD4B 2CZ7B 3CC2Q 3HFOA 2DNUA 1TOVA 4BCND 3MHXA 2A36A 4J9CA 3OS1A 4M6VA 5FU6C 3OW2S 3QKJA 1JO8A 4M7AE 1RAIB 4DBQA 4AI6A 4QVDA 4BDZA 1ZSZB 4OF1A 4IUUA 4BCQB 2HBPA 2RQVA 1FMWA 1XJWB 4NL2A 3BG5A 2YUOA 3CCLQ 1QWFA 4QKUA 3JB9D 4BCPB 2XU8A 1SF9A 2BUDA 1GY3B 2CREA 3P8BB 3OYKA 2HQXA 1H641 4XTYA 4J9GA 3CC7A 1M27C 3H8ZA 2NUTA 1PD0A 1WLPB 2K79A 1QVGP 1AISB 2LJ3A 2FO0A 1VQMA 1JJ2P 2K6DA 1LNXA 3VUBA 2PTKA 2EW3A 1NE8A 1ZQ1A 3DDQB 4R56A 2L3PA 3CCSA 1G3TA 1RLPC 2RHUA 4B6MA 4M7AD 1QLYA 5C0MA 1AVZC 3BHUB 3LW5E 2EGCA 3JCMh 2WACA 1X69A 2DZ9A 3HP9A 4FW2A 3MP1A 4J9HA 1WJSA 2CJMB 3JB9F 4BCKB 1G2BA 2EQUA 1M2OA 2PHGA 4FW1A 1H1PB 3CCQQ 2P84A 1K73R 1C6VX 1SSHA 2VWFA 3CCJQ 3EIDB 4FM4B 4C8QD 1RUWA 3FJ5A 2KVQG 3RNJA 3OYNA 1X75C 3EFOA 2I40B 2K3XA 3TNHB 2AK5A 1VQ7Q 4J7FA 5GAN4 4IUPA 2JT4A 1UFFA 4F7UB 1GL5A 2QASA 4PFZA 3TREA 3MY5B 3CD6A 4DBHA 3K7AM 1O9KB 5EJCA 3I5RA 5CR2A 2CP5A 2QDYB 3HSBA 3HFNA 4OB0B 2C4GB 3GTMS 2B8AA 5M9OA 1PD1A 2RH2A 3BLQB 5HK3A 3HB9A 2E3IA 1YP5A 3OA6A 1OU8A 4RG8A 3LGFA 2JMAA 1PG5B 3ZBDA 3DLLA 3L2QA 5KYYA 1SEMA 1YNZA 2MWPA 3T9NA 3ER0A 2AZSA 2O31A 4F7UG 2KY9A 1KK7A 2H3JA 1X6OA 1GRIA 2RI5A 1Q7YR 1T3LA 4M7DF 2CP6A 4OMFB 4F7UF 2BS2A 2GF7A 1C9BA 2EYYA 2RHZA 1QW1A 4KGZB 4EMHA 1YHQT 2B9RA 1UGRB 3VV0A 5DQVA 3FC3A 4X9DA 2KRMA 4OB2B 3I56A 5HBHB 1ZLMA 2DERA 2FZGB 3VKIA 4LD6A 3B57A 2BE7D 4O5VA 3NMZC 5I21A 2RHIA 4BB7A 4M75D 2VGNA 1I07A 4C8QB 4CFVB 4GY5A 1KG1A 1BIAA 1K9MR 2NLUA 4OB1B 1M1GA 3G71Q 1AOJA 2J6OA 3M4GA 2K5IA 4ROCA 4BD3A 4C8QC 1FINB 2OTLA 2D9TA 1JSUB 2ZPHB 2WFYB 1ZSZC 2HEQA 4E7HA 1YJ9Q 1HXDA 3G7ZA 1UNHD 4M7DB 1G5VA 4JRQA 2X9HA 5FGKB 2COYA 3UATA 3TCJA 4J5YA 2K7AA 2X1NB 5IN1A 3CCLT 1OKWB 3OYIA 4M7AC 3M55A 4FT4A 1IREB 3EH2A 1BK2A 4LDYA 1TUDA 4OGRB 3CCVA 1IHVA 1Q82C 5AT1B 1VQMT 3EG0A 1VQ6Q 3VS6A 1AWOA 1Q95G 4X34A 2UZBB 1C0MA 1H25B 3TNWB 3JCMJ 1XOVA 1G8XA 3M0RA 5J26A 1VQLQ 4R0KA 4NOYA 3PMTA 3DL1A 2MMPA 4TVRA 2G6FX 3MY1B 4C5EA 4CC4B 2LJ1A 2MCNA 5GAOq 1PSFA 2LCLA 2MWOA 2JVVA 3CMAQ 3P8DA 1VQKQ 3GBQA 2WJ9A 4QVZA 1UHFA 4RTYA 2PK2A 3DB4A 1RAFB 2HNIA 4DQ2A 1I81A 4JS4A 2QEXQ 2FEIA 4NS5A 1QKXA 2IVWA 5FWCA 5C6SA 1AWXA 3S3OA 3U23A 2E5QA 4L59A 2ED0A 3M57A 3CCRA 2KT8A 3PE0A 4E7IA 2DYBA 5GAOn 2A3LA 1VUBA 1VYTA 1A0NB 1Z9QA 4M7DA 1NJIU 3EG3A 1YBYA 3MEAA 2A0FB 4CFMB 2EGEA 2JMCA 2FPEA 2UZDB 3LQ5B 3OS2A 3BDUA 1K8AU 4YTLA 3FLGA 2QDJA 3M4YA 4IURA 2C0IA 2O01E 5CKFA 3BW1A 3CBOA 5GJWB 3O0GD 2WXVB 1P5EB 2X3XD 2DAQA 5CCAA 5LJ3g 4N4GA 5LJ5e 2CZ1B 3QO3A 3URGA 1W2BS 2FZCB 1H26B 2KGTA 2MOXA 2D0QB 2ZZDB 3X24B 1LVKA 2FHDA 2G3RA 3CBMA 3JCMe 1M1KR 2DJZA 3QZ9B 3KFVA 4LNPA 2C5VB 1H1RB 1OX8A 3WVDB 4M77D 1VOLA 3PGGA 4F7NB 3OYJA 3CC7Q 3GPLA 1PRLC 4XTVA 2KXDA 1UB4A 1ZA2B 1IB8A 4MZTA 3NPFA 1VQ7A 2LQNA 2DE0X 1Q7YU 2O4XA 3G4SQ 4J9EA 4BACA 3A98A 3OW2A 4F04B 2CS7A 3GLXA 2OX7A 4C92F 3UDCA 4E7ZA 5KH6A 1W2BA 2FVUA 2DXUA 3I35A 4F14A 5EFQB 1NZ9A 5L2WB 1WJRA 2BZ8A 1ABQA 2LCSA 1BKBA 8AT1B 4EPCA 2YUPA 5DLQE 1WHLA 5GAOl 3NTHA 4JS5A 4NC6A 1UGSB 1AD6A 3RMQA 1D0YA 1YI2T 2ED1A 2JM9A 3JCMP 5LJ3e 1XTDA 3EGDB 3EJ1B 5LJ5g 1BCMA 4A4EA 3E2UA 3TW6A 3G4SA 2Y4YA 4MDWA 1G83A 3OSSC 4RUGA 3RESA 3OMCA 1N9RA 2O88A 4ZTFA 1BI1A 3VYGB 2M9UA 3I55A 2YWWA 4OMMA 4E7JA 1MNEA 2LX7A 1ZP2A 4PJOF 5GMKj 2OTLQ 2R57A 3CMEQ 4EOIB 2AKLA 3BLHB 3M5AA 4EOSB 3QHWB 1U1SA 3TW7A 4PNOA 1K73U 2KYMA 1HSQA 4JLGA 2VYTA 4PJLA 2QEXA 3JV3A 3CEYA 2WSCE 4J9FA 2R58A 3OYFA 3CD6Q 3QYEA 2M1HA 3PTAA 4HA8A 1H1SB 1VQPT 4FYXB 2EJFA 5A0LA 5FU7B 3SD4A 2V26A 3EFRA 4M77C 2XMFA 1NYFA 2FL7A 3CCQA 1RLQC 1M3AA 1GBQA 3M59A 4XU2A 2YXYA 1G3YA 2D1XA 4PKCC 4QSHA 2QAZA 4ELZC 3VRZA 5GANj 1GBRA 1S1NA 3GP8A 2YRVA 5IHKA 2DXCA 4CRIA 1K9AA 2C5XB 1G3SA 4M7AG 2QTXA 1X01A 4LDWA 4C5HA 1OGUB 3MCAB 1KQ1A 4CRLB 4OMLA 4EOQB 5GANf 2A28A 3BG9A 1YJWQ 5KCOA 5J39A 2DFUA 3REBB 2Z0WA 1JEGA 3TQ7P 2PUKB 2VC8A 3QWYA 5GAN6 3JCMX 2DKGA 3HO8A 3M0PA 2EGAA 4BCNB 1SHFA 3EFSA 3V8JA 2DX1A 4HVVA 2LQWA 2F1LA 2E41A 2CCHB 3OS5A 3OYYA 1JRIA 1KHCA 3EGXA 1VA7A 2Y90A 2CT4A 1UJ0A 3L1AA 3CCVT 5CVIA 4WF2A 3O5ZA 1M4ZA 4C5GA 3HRTA 1OU9A 1WFWA 1VYVA 3VJPA 2GGRA 2LP5A 3NTIA 1V1CA 4HL4A 1D0XA 2COWA 2J6FA 1X6GA 3EOCB 1WXTA 3OYCA 2KMTA 2ZZDA 5ICPB 3FDRA 2W0ZA 4BI3A 2EWNA 4KUDK 2D8HA 3CC2A 3CCMQ 4EONB 3MEVA 3X28B 2HL3A 3EH1A 3C12A 1K1ZA 3TVTA 4ZN1A 4JZ4A 3G6ET 5ACBA 2R5AA 4LDVA 2RK2A 4JRPA 1VYWB 3HPWA 3X20B 2XG8D 1TD6A 3GF5A 2JTFA 3CC2T 2YUQA 2XDPA 2J05A 1D0ZA 4RCBA 3OYLA 3RBBB 1Y96A 5LJ3d 1T0HA 4C0DC 1C1AA 4EOMB 2DILA 1SHGA 2KDSA 5IHYA 2G77A 1AEYA 2KSSA 4PJMA 1KD1C 3R6OA 2LCCA 1ABOA 3OYGA 3S3MA 3TU4K 1W4SA 4FX3B 2ATCB 4KRCB 3SWNB 4YOOA 4OMOA 4RKUE 1YJNA 4C92G 3OY9A 2OTJQ 3CCEQ 1X2KA 2K5FA 4EIKA 4LD9K 1E9HB 2KNBB 2X4YA 1M5Q1 1RI0A 3HKSA 4EOLB 3VU3C 4OVAA 1KSWA 4ZTJA 2DETA 1VQ8Q 2DEQA 2GBQA 1WI7A 1NJIC 4PJOB 4CFUB 5I5ZB 1YIJA 5HNBB 1K4US 4PLLA 1ENWA 1NPRA 1YIJT 4EMGA 4Z89A 3QZ5B 3VKGA 4FYWB 4PLIA 2W99A 1R77A 4JLIA 1YITQ 4PJOA 1NM7A 2PZ1A 4CC2A 2SEMA 5CQXA 3QBYA 2C6TB 5LJ5j 2BKZB 5GAOr 1PSEA 3CD6T 2PQWA 3QYGB 1E7OA 3OYEA 4AKIA 3CCQT 2P0QA 5LJ5d 1UGPB 2VXFA 2W10A 2WIHB 3CCUT 3CPWA 3QJ6A 4CFUD 1ZSGA 1K73C 3RMSA 1RABB 2ZPEB 3NDQA 3EG1A 5I2MA 1OX9A 3M58A 1MNDA 1W1FA 2WPAB 1WJQA 3MKDA 2DL5A 1H3ZA 3LGLA 3J7AF 3DB3A 2KRNA 2RJEA 4HKEA 4JJBA 1N4MA 4XTUA 2X51A 3OYHA 3NGPA 1UG1A 1XO2A 1D3BA 1Q7YC 3LWHA 2C0TA 2GTJA 1I5LA 3A8GB 2RI2A 1NEBA 3QHSA 2HKNA 2IPOB 1TTHB 4F17A 2KMGA 4ZGEB 2K57A 3MP6A 4M4ZA 2LW4A 4BE1A 1T0JA 1VQNQ 2RQTA 3EG9B 2CP2A 1TFBA 3FJPA 5GANe 3M0QA 3JCMV 3PMIA 2WMBB 4IIOA 5IHIA 4A4FA 2SRCA 3NTKA 5I2SA 2JGZB 4UC4A 2WSFE 2FRYA 3C95A 2HMAA 2ZGWA 4J9IA 4M7DE 2LVMA 4M78A 2ZPFB 3VS1A 4ESRA 2PMIB 1N8RU 1JJ2S 3FEOA 2MYSA 2GFUA 3KXTA 1W70A 4GBQA 1QLBA 5EG2A 2EIFA 4CFXB 1Q86C 5GAN3 3PO3S 1OI9B 2QQRA 3QDFA 2PU9B 1OPLA 4RODA 5HCKA 3I55T 1I5OB 1BYMA 5CYIB 1MMNA 1YJ9A 2EYXA 5HQ0B 5KYWA 2G9XB 1WHKA 5LQFB 2QFZA 1MMGA 2I53A 4AFSC 3UA6A 2RQUA 9ATCB 3CCRT 3MIAB 5FLXE 3G6EQ 3J80E 2D6FA 4ZN3A 5CKBA 2IG0A 1UGQB 2DPPB 2X4XA 2YLBA 2JZ2A 1YCSB 4ELYC 4J83A 4KRDB 2RJDA 5FRMA 4XU0A 1SRLA 5HKCA 1RL2A 4JPBW 3TSWA 1FXXA 1KC8R 1ZA1B 1QMCA 5KYXA 1JXOA 1PRMC 3JB9G 1V76A 1OKVB 4IUTA 5FWBA 1Y7XA 2M0OA 1PNJA 3FB9A 1M1FA 3LYIA 2D8JA 4EOPB 2CUBA 2NWMA 1OULA 2ECZA 1E6HA 3QJYA 2HL5C 2IW6B 4J9BA 2OI3A 1QKWA 3N5BB 3PVLA 2P4RA 3X25B 2C0OA 4QQGA 3OSVA 3SEMA 4P5NA 1BB9A 1UDLA 4IKFA 1Y71A 2QGSA 3CC4Q 5HVYB 4KUIA 3F70A 3CCUA 1VQ9Q 1WX6A 2RHXA 2HSPA 2GQIA 2PJQA 3M53A 3L2UA 1M90U 2AT1B 1YIJQ 2QQ8A 2PK9B 1H92A 3UA7A 4FU6A 2DRKA 4C92C 3JCMg 1N9SA 3OYBA 3RR6A 4N4HA 2V8JA 1KQSP 1UTIA 4GLMA 1QCNA 3DOGB 1YWPA 5CKHA 3SFMA 1UE9A 4D8KA 1AD5A 5GMKh 4LUDA 4C92B 4BXXX 2EUFA 3TNIB 3JRZA 4M75A 1S72T 2CZ0B 2A7YA 1N6AA 2XIDA 3WXMB 1WHHA 2DVEA 2EBPA 3HHTB 4MIMA 4C8QG 4QQ6A 2DTOA 3E19A 3I56T 1J3TA 3PIOA 3M0UA 4M77B 4IMYB 1AHJB 4BCIB 4RTWA 3H41A 2DIGA 1LPLA 2QQAA 5LMKB 2K3YA 4Z02A 1N5ZA 2YRCA 3WVEB 2X4WA 3FRNA 1WIEA 1VQ7T 4ATOA 1X6BA 2P0PA 2HQHA 2H8HA 1UEBA 4EOOB 4A54A 2ZCFB 2B86A 1GH6B 1VQPA 5CAIA 4EORB 2DYIA 4YC3B 1IZ6A 2QXFA 1TWBA 4WCIA 4EMKA 1HD3A 3CCMA 4JX4A 1I0CA 4N4IA 3QG1A 1VQNT 2BIVA 4BE2A 2MPXC 4LUEA 4MFEA 1CKBA 3CC7T 2M51A 3RDVA 2E3HA 2K2MA 3G4ST 1D09B 1UNGD 2L3QA 3Q1JA 2J7IA 2X3WD 4M7DC 1SPKA 1NPPA 1BI0A 4CXAB 1NG2A 1W2BP 1DJ7B 2KBTA 1NBEB 2VB6A 2CSIA 1VQ5Q 2KI7A 3H0IA 2VASA 4M7AB 3G71T 4AKHA 4KRTA 1NEGA 2E10A 3I55Q 4HNTA 1X27A 4JRIA 4II5B 1YJ9T 1YJNQ 4E2FB 5GAMf 2ZAEA 5A2QE 2UUEB 2QF7A 2YUNA 2EFIA 1OL2B 3MPUB 5IHNA 1CSKA 1R0CB 3QYHB 3ZFJA 3KUFA 1FMVA 1UECA 1VQ4T 2E4HA 5CIUA 2V22B 5LJ3h 2L3SA 5DQWA 4BY6B 4F6UB 2EJ9A 1NYGA 1M3CA 4EC8B 1KC8U 1XNIA 2IIMA 4ELLA 2KEAA 5KYXB 2OJ2A 5GAN2 2DIQA 1JQQA 2NUTB 1IXDA 1H4LD 1FMKA 2QTVA 1VQMQ 4HCBA 5CKEA 4C0DB 1VQ6T 4FYYB 2YLCA 3A5ZB 2DEUA 2FRWA 3HZJA 4Z6YA 1KIKA 4WTOB 4Q5WA 4QW2A 2VVKA 1WXUA 3EGUA 1EFNA 4E7SA 1ZSZA 3X26B 1YFNA 3MEWA 2JNGA 3SWNC 4ANJA 2R7GA 4LXCA 2A08A 1VQ9T 3HBLA 1TSFA 4KH0B 3BHTB 2Y4XA 3HTRA 3UF4A 3A1PA 3ZEHA 2F2CA 2RD1A 2DRMA 4E47A 3THKA 5A0GA 3OQ5A 2KE9A 2BTTA 3CMAA 1QVGA 5HBJB 2KAFA 1PC0A 5GJVB 3CQTA 2ABLA 2H3EB 4M75E 4CI0C 2DTHA 4OGCA 1Q81C 1QCOA 1RI9A 2C06A 1SRMA 2JUFA 1Q86U 3H6ZA 4MFDA 3L2WA 5LJ3f 2JTEA 3OBWA 2EQJA 2EQKA 2QGFB 4ZNXA 4PL6A 3MP8A 1QVFS 1S72Q 1FVVB 3OB9A 4R55A 2LZ6B 2JN0A 1VQKA 1QVFA 1O9SA 2OTJA 2E6NA 3H0FA 4Y91A 3VKHA 5GAMh 2DMEA 2QI2A 1QCFA 5D6XA 2FZKB 3L42A 5GMKi 2QK0A 4JDSA 5GMKl 4HT9A 5FU7C 1RACB 1JJ2A 2PNIA 2OAUA 1URCB 1M90R 2VKNA 1YJWA 2KXCA 4C8QF 2DD4A 4ELJA 4DOVA 2QA4A 1GUXA 2XICA 4AFZC 3JCMd 1SSFA 4OP0A 2CYZB 4MMLA 2P0KA 5HY6A 4XAXB 3CCSQ 4M7DG 2BS3A 2L0AA 2L5QA 3NFCA 3A8HB 3LH0A 1GFCA 2PUOB 2WEVB 1P92A 2XI9A 4M78F 4XU3A 2LMJA 4IIMA 3VS0A 5D6YA 2K4YA 3EHRA 3JB9H 3IQLA 3CPFA 1D1AA 2VV5A 4HCKA 3QIIA 3JB9I 5KYUB 1EIFA 2W2HA 1PM3A 1YWOA 4OMQA 1PWTA 1X2QA 4LDUA 4FT2A 1I1JA 4EDUA 4BY7X 2HDAA 2DXCB 2EYWA 5GAMj 1QP2A 3C94A 1TU0B 4J6XA 2YHTA 3F5XB 1YN8A 5HBEB 1VQ8A 2E65A 1M9SA 1JSTB 1F1BB 3HL8A 2M0YA 3ULRB 2VXEA 1QVFP 2AZVA 2FG0A 3VS5A 2HZYA 1BCOA 4UN0A 2DF6A 2E64A 3I5SA 1PKSA 3CXCS 1VQOQ 3BLRB 3I9QA 1ZUKA 4L5GA 2ROTA 4JZ3A 1GFDA 1JXMA 1VQ8T 3UT1A 4EC9B 1I8FA 4HNUA 2J06A 3HRUA 2ROLA 3UPUA 3PVQA 1YI2Q 1Q81U 1M3BA 4BCMB 2BE9B 2QDLA 4BCFB 3AHUA 4M75B 4OMPA 1D1CA 2P4TA 2HSEB 4M78G 2LC4A 2CP7A 4X1VA 3QHRB 4J9DA 4LN2A 4Z88A 4DOWA 1B7TA 2HAXA 1VQPQ 1TXQA 1Y96B 5GANg 2UZLB 4M75C 5BNJB 4ME7A 1VQLA 2CKKA 1ZUUA 2DXTA 4HLQA 4HCZA 1OL1B 2E70A 3VRYA 4VUBA 2XK0A 4LOCA 1I4K1 1MUZA 1LOJA 5J3BA 3OYAA 1LCKA 1YI2A 5L23A 2JTMA 1OPKA 4A63B 2DL7A 2F69A 4PJNA 2KT1A 4ZGDB 2ZPGB 1KQSA 2ESWA 2RQRA 1KHIA 4CC7A 2CP0A 2RO0A 3S3NA 2QQBA 4KGXB 1WXBA 3CCJT 2K5LA 2RF0A 4XTWA 1M30A 4NL3A 4HVWA 2NYSA 4DEYA 3DTOA 2YT6A 3EHQA 1M1KC 2V1QA 4AFUC 2EKHA 2QA4Q 2OAWA 3CBPA 4AFQC 2BKDN 1V29B 5IDPB 1U1TA 2O2OA 1MV3A 4PK4A 2C5OB 2RHYA 1NLPC 3PT9A 1Q86R 3BFMA 5CEIB 2RMOA 1VQ5A 4RTVA 2RK1A 1WNLA 4FL6A 4KGVB 1PCXA 3JSCA 3LX7A 4M77G 2DK3A 3CXCP 4PJOG 3LWIA 4A53A 3KBGA 2I2LA 4N0AC 4OMNA 1QP3A 4RTUA 4KBMB 5GMKm 2V8IA 4JRKA 2IW9B 2JOYA 5IH2A 4F7UA 3NHNA 2FPDA 2EJGA 2RJFA 5I22A 1UUEA 3CCLA 3CMEA 4ZGJB 5LJ5h 3SHWA 1GCQC 2J6KA 1F5QB 4QT7A 4RMOA 3EFOB 3L2RA 2DTIA 3OBYA 3JCMc 2ZPIB 4J6YA 3V7SA 3RKWA 4BI8B 1U06A 3L2ZA 4BUGA 4PJOC 3TN8B 1D1BA 2DA9A 2LX9A 3CCRQ 4M77A 3QUIA 4BCGB 1M8MA 1UNLD 4MZMA 4EOJB 3BY7A 5KYNA 4M78B 3CCST 1QVPA 2RN8A 5IAYA 5KE3A 3CXCA 4B9WA 5DLOA 1ACMB 4LDXA 4BCOB 3BE3A 5DY9A 4TTHA 3GOXA 3H9NA 1WYXA 8ATCB 2W9FA 3EG9A 2K2VA 4F7SB 2BS4A 4K11A 3BHVB 2EVRA 1AWWA 4D8DA 4PJJA 4F7UE 1VIFA 2OTJT 4FSSA 5CK9A 1H8KA 2LT1A 2E5KA 1TUCA 2L89A 2IN3A 1WQ7A 1WPYA 1BI3A 1KD1U 5LL6S 4M77F 1OOTA 1GCQA 1VQLT 1FWZA 3UWNA 4F70B 1BIBA 2F2XA 2F2WA 5HK0A 3D7SB 1VQOT 3BDLA 1BU2A 3CMAT 1H3HA 3C4SA 1ZBXA 2XKOC 5GAN7 5KE2A 3QSUA 2LNVA 1KQSS 3CCET 2DL3A 3MEUA 1UJYA 4J7IA 2DMOA 2JS2A 1OEBA 3TEEA 2ZPBB 4HVUA 5A0DA 2CGHA 1KQ2A 1U3OA 1VOMA 1JOWA 1MHNA 2DL4A 1TS9A 3DLMA 5CQYA 1OZ3A 3QPHA 4BY6C 2R5MA 4AMCA 3P8HA 2RPNA 3G33B 2X4JA 3JB9J 1VQKT 4N0AA 1VINA 2M02A 3LH5A 4MZPA 3REAB 3VYGA 4QVCA 4PJOD 4PFPA 2NUZA 4C8QA 2W96A 4M7AF 1WA7A 2DLPA 4F7LB 1M1KU 4AG1C 1WHGA 3PNWC 3CCUQ 1JB0E 3ZL7C 4RCCA 5IXFA 4BCJB 2I0NA 4M75G 1K8AR 3RGFB 1KFZA 2CDTA 4BY1X 1JBMA 5EC7A 2QA4T 1ZX6A 1WGSA 1YCYA 4KH1B 4HNVA 4A4GA 2EAYA 4EOKB 3QYBA 2AIRB 1CKAA 1B34A 2JM8A 1OIYB 1B34B 1MMDA 5ECAA 3ASKA 2DBKA 3EGXB 5D6WA 4HXJA 3G71A 3H0HA 3META 3CCEA 5FW9A 5GANd 4QQDA 5IF1B 2RJCA 1XQHA 3CPWS 4J6WA 1AWJA 1H27B 2QQ9A 4BE0A 2E6ZA 3OMGA 3POMA 2RM4A 2BZXA 1K8AC 1PHTA 2A37A 2V8KA 3JCMb 1YHQQ 2HD0A
chains in the Genus database with same CATH topology
3RKYA 4FSXA 1N8RC 3X20B 2XG8D 3ZEHA 3GF5A 3CC2T 2JTFA 2RD1A 3SB2A 4E47A 1VQ4A 5A0GA 1Y07A 3OQ5A 3E1SA 1YITA 2XDPA 2LTOA 4FM4B 4C8QD 3L2VA 2KVQG 3CMAA 4RCBA 3OYLA 2KAFA 3OYNA 1QVGA 1Y96A 1X75C 5LJ3d 5GAN8 4C0DC 1K9MC 4XTXA 4M75E 2K3XA 4CI0C 2KDSA 5IT9E 2DTHA 4OGCA 4J7FA 1Q81C 5GAN4 2G77A 2C06A 2KSSA 1KD1C 2JUFA 4IUPA 3R6OA 1Q86U 3H6ZA 1TH7A 2LCCA 4F7UB 2DD5B 4MFDA 3L2WA 5LJ3f 3OYGA 3OBWA 3TREA 3S3MA 3TU4K 4Y28E 2EQJA 2EQKA 4V2SA 1W4SA 4PL6A 3MP8A 3CD6A 1QVFS 1QVGS 5EJCA 3OB9A 4R55A 3SWNB 5CR2A 4RKUE 1YJNA 2JN0A 4C92G 3OY9A 1VQKA 2QDYB 1QVFA 1O9SA 2OTJA 2E6NA 4Y91A 4OB3B 3VKHA 5GAMh 3QXEB 2QI2A 3HFNA 2K5FA 3HSBA 1H3ZA 5D6XA 4OB0B 4LD9K 3L42A 3RKXA 2B8AA 3G6EA 5M9OA 5GMKi 4DA4A 2RH2A 2X4YA 1M5Q1 1RI0A 3HKSA 4L6V5 4JDSA 5HK3A 3HB9A 3VU3C 4OVAA 5GMKl 3JCMf 2RB6A 3OA6A 4ZTJA 2DEQA 2OTLT 5GAMd 5FU7C 3CMET 4RG8A 4JUVA 1NJIC 4HT9A 4PJOB 3LGFA 3ZBDA 3DLLA 1YIJA 1JJ2A 4C0ZA 2VGMA 3L2QA 3CC4T 2FYKA 4PLLA 1OI1A 2OAUA 2MWPA 3T9NA 4II1A 3ER0A 1YJWA 1NPRA 4C8QF 4C8QE 2KY9A 4F7UG 2H3JA 2DD4A 1X6OA 4ELJA 1YIJT 2RI5A 4EMGA 4DOVA 3QZ5B 2QA4A 3VKGA 2XICA 4PLIA 4JLIA 3JCMd 1SSFA 4M7DF 2LRQA 4PJOA 4OMFB 4F7UF 3QDRB 2BS2A 4OP0A 2GF7A 2CYZB 4MMLA 2P0KA 5CQXA 3FIFA 3QBYA 5HY6A 4D6WA 2RHZA 5GAOp 1QW1A 4XAXB 5LJ5j 1OYXA 4E7KA 4EMHA 5GAOr 4M7DG 2BS3A 1YHQT 1PSEA 1UGRB 1R8OB 3VV0A 3CD6T 2L5QA 2PQWA 3QYGB 4X9DA 3OYEA 4OB2B 3NFCA 3I56A 4O6JA 4AKIA 3A8HB 2PUOB 3LH0A 1P92A 2P0QA 4M78F 1UGPB 2VXFA 2XI9A 5LJ5d 3CCQT 3GIBA 3CCUT 4FIBA 4XU3A 3CPWA 3QJ6A 5D6YA 2K4YA 3VKIA 4LD6A 4BBSM 1K73C 4O5VA 3RMSA 5I21A 2L8DA 2RHIA 4BB7A 2L3RA 2ZPEB 4M75D 2VGNA 3M58A 5I2MA 3JB9H 4C8QB 3CPFA 2VV5A 1WJQA 4GY5A 3QIIA 4IUQA 3JB9I 1KG1A 1BIAA 1EIFA 3LGLA 2NLUA 1HK9A 3DB3A 4OB1B 4M77E 3J7AF 3J81E 1M1GA 2GQVA 2O4XB 2RJEA 1G3WA 4LDUA 2MF2A 4FT2A 4HKEA 4EDUA 4A4KA 3M4GA 2DXCB 2QEXT 2K5IA 4BD3A 1QP2A 2LQKA 4C8QC 2D9TA 5GAMj 3C94A 4XTUA 4J6XA 2OTLA 2ZPHB 2YHTA 3OYHA 4E7HA 1HXDA 1VQ8A 2E65A 3G7ZA 1D3BA 1M9SA 4MMKA 1Q7YC 4M7DB 3HL8A 1G5VA 2VXEA 4JRQA 4HCCA 2QQSA 2PVOB 3H4CA 3LWHA 2E64A 3CXCS 1I5LA 3A8GB 4M7DD 3TCJA 4J5YA 4HT8A 2RI2A 4L5GA 3QHSA 3EAEA 5IN1A 3S6WA 3CCLT 2KMGA 3OYIA 1VQ8T 4ZGEB 2K57A 3UT1A 4M7AC 1I8FA 3CCMT 4HNUA 3M55A 3MP6A 4BE1A 3HRUA 4M78E 3UPUA 4FT4A 1GXIE 1IREB 1Q81U 1VQNA 4M78D 3CC4A 4LDYA 4RG2A 3FJPA 5GANe 3AHUA 2M16A 4M75B 3JCMV 3PMIA 2P4TA 4A4FA 4M78G 3NTKA 5I2SA 2LC4A 3RUXA 3CCVA 3ME9A 4KULA 4XU1A 4KT0E 1Q82C 2XHCA 2LQ8A 2WSFE 4UC4A 5LJ3j 5CKDA 4M75F 1VQMT 3C95A 2ZGWA 4DOWA 2HAXA 4M7DE 2LVMA 4M78A 2ZPFB 2XDDA 3OYMA 1Y96B 4PJOE 2HQEA 4X34A 5FU6B 5GANg 1N8RU 4M75C 4ME7A 4JX5A 3JCMJ 1XOVA 5J26A 1VQLA 2CKKA 1JJ2S 2DXTA 3FEOA 3KXTA 2GFUA 4NOYA 3DL1A 4HLQA 2AHJB 2KQWA 2E70A 1QLBA 3PMTA 2MMPA 4HCZA 2EIFA 4TVRA 5EG2A 1FKMA 5GAMg 4VUBA 2XK0A 1Q86C 4LOCA 5GAN3 4C5EA 1I4K1 1LOJA 5GAOq 1PSFA 2LCLA 2MWOA 2QQRA 5J3BA 1FX7A 4B9XA 3OYAA 1KC8C 1YI2A 2PU9B 2JVVA 3P8DA 2JTMA 3I55T 2F69A 1BYMA 2ZPGB 2WJ9A 4ZGDB 1YJ9A 4QVZA 1KQSA 1KHIA 2QFZA 2PVDB 4BBRM 5CO7A 2RO0A 3PIPA 3CCRT 3DB4A 3V8LA 2QQBA 3S3NA 2HNIA 3BG3A 5FLXE 3J80E 4DQ2A 2D6FA 4ZN3A 3CCJT 5CKBA 1I81A 2IG0A 1VQ6A 4JS4A 1UGQB 2DPPB 2FB7A 2K5LA 2X4XA 4XTWA 4NL3A 2YLBA 2JZ2A 1VQOA 2EQMA 4NS5A 3V7CA 2IVWA 1BI2A 4ELYC 4J83A 5C6SA 2RJDA 5FRMA 4XU0A 3S3OA 1M1KC 4OGEA 2E5QA 3A8LB 4L59A 3CCRA 3M57A 5HKCA 5GMKe 2PVGB 1RL2A 4E7IA 5GAOm 1WQWA 1FXXA 2A3LA 1VUBA 5GAOn 3CBPA 4M7DA 2BKDN 1NJIU 3JB9G 1V29B 3RERA 1U8RA 1YBYA 1U1TA 3V7RA 4C92D 4IUTA 1VQ5T 1Y7XA 3MEAA 2LDMA 2RHYA 2M0OA 5GANh 3PT9A 1M1FA 3FB9A 3LYIA 3BDUA 3BFMA 3OS0A 3OS2A 3M54A 3FLGA 4YTLA 4BDYA 1K8AU 2LT4A 2QDJA 1VQ5A 5GAMe 3M4YA 4IURA 2RK1A 1WNLA 4FL6A 2E12A 4C0FA 3QJYA 1VIEA 2O01E 3JSCA 3LX7A 4IUVA 1YJNT 5CKFA 3HRSA 1M8VA 3BW1A 3CBOA 4M77G 2DK3A 3N5BB 4PJOG 4XK8E 3X25B 2X35A 4J8OA 3KBGA 4A53A 3LWIA 2I2LA 2DAQA 4GLKA 4N0AC 5CCAA 4QQGA 5LJ3g 2CZ6B 3OSVA 4N4GA 1QP3A 5LJ5e 2CZ1B 4P5NA 5GAN5 3QO3A 4KBMB 5GMKm 4IKFA 1Y71A 3URGA 1W2BS 2V8IA 2DD5A 4JRKA 2JOYA 4KUIA 4F7UA 2EJGA 2RJFA 3F70A 3CCUA 2D0QB 2ZZDB 3X24B 2RHXA 3CCJA 4E7LA 1VQ9A 3CCLA 3CMEA 4ZGJB 2FHDA 2G3RA 3CBMA 3JCMe 2DJZA 5LJ5h 3QZ9B 4XQ3A 1O75A 4RMOA 3M53A 2MAMA 3WVDB 4M77D 3L2RA 2DTIA 3PGGA 3L2UA 3OBYA 1YITT 1M90U 3JCMc 2ZPIB 4J6YA 3OYJA 2EYQA 3GPLA 3E9FA 4XTVA 2QQ8A 2E1HA 2KK4A 3RIRA 3RKWA 1UB4A 3V7SA 3E9GA 4MZTA 3L2ZA 3SDZA 4BI8B 4BUGA 4FU6A 1VQ7A 4C92C 3JCMg 1Q7YU 4PJOC 1N9SA 2O4XA 4BACA 3OYBA 2LX9A 4N4HA 3OW2A 4AKGA 2V8JA 4M77A 2CS7A 3GLXA 4C92E 4C92F 3QUIA 2F5TX 3UDCA 5KH6A 3JAME 4EMKC 1W2BA 4MZMA 2FVUA 3BY7A 5CKHA 2DXUA 2F5KA 3SFMA 3CCST 4M78B 5GMKh 1QVPA 2MI6A 4X9CA 3PFSA 2GCXA 3VUZA 5IAYA 1NZ9A 4B9WA 4C92B 5KE3A 3A8MB 1WJRA 5DLOA 3CXCA 3JCMW 4LDXA 3JCMQ 1BKBA 2RA2A 3A8OB 5DY9A 3VYHB 3JRZA 3M9QA 4EPCA 4M78C 4M75A 1S72T 5DLQE 3GOXA 4EMKB 2CZ0B 2A7YA 1N6AA 5GAOl 3NTHA 4JS5A 5FRNA 2XIDA 3WXMB 4NC6A 1UGSB 3GNFB 2K2VA 3O8VA 2DXBA 5AYFA 1YJWT 3RMQA 4MDXA 1YI2T 2WSEE 2BS4A 3JCMP 2DVEA 5LJ3e 1XTDA 3SWNA 5LJ5g 3HHTB 4MIMA 1LJOA 1N27A 4C8QG 1VIFA 4A4EA 4F7UE 2OTJT 3TW6A 4QQ6A 2LT1A 5CK9A 2DTOA 2Y4YA 3E19A 4MDWA 3G4SA 2L89A 3OSSC 3I56T 3DKMA 3PIOA 4M77B 3RESA 3OMCA 1N9RA 4C0GA 4ZTFA 5LJ5f 2GFAA 1AHJB 2M9UA 3VYGB 1BI1A 1WQ7A 3I55A 4E7JA 2DIGA 4M7AA 1WPYA 2QQAA 2RI3A 2K3YA 4Z02A 1BI3A 1KD1U 4JX6A 4M77F 5LL6S 4PJOF 3WVEB 2X4WA 1VQLT 3FRNA 3MO8A 5GMKj 1FWZA 1VQ7T 4ATOA 3UWNA 1Q82U 2R57A 2P0PA 1BIBA 1UEBA 5KCHA 2KR6A 5HK0A 1M90C 4A54A 3M5AA 5FROA 2ZCFB 1VQPA 1U1SA 1VQOT 3QWLA 3TW7A 3BDLA 3INZA 4PNOA 5CAIA 1K73U 2DXBB 1IZ6A 4JLGA 3CMAT 2XDBA 2VYTA 5DM7R 3C4SA 2QXFA 2DO3A 1ZBXA 2XKOC 2QEXA 3CEYA 4EMKA 5GAN7 2WSCE 3CCMA 4JX4A 5KE2A 2R58A 2LNVA 1KQSS 3CCET 3V8KA 4N4IA 3QSUA 3QG1A 3OYFA 3MEUA 1VQNT 1S72A 2BIVA 3QYEA 4J7IA 2M1HA 3PTAA 4HA8A 4C92A 4BE2A 1VQPT 1K9MU 3KHIA 2EJFA 2ZPBB 3TEEA 5FU7B 4MFEA 5A0LA 3CC7T 4XTZA 5A0DA 1MGQA 2CGHA 3SD4A 1OZ2A 4A4HA 4BI4A 3EFRA 1YHQA 1KQ2A 3OYDA 2DZCA 4M77C 2XD0A 1MHNA 2FL7A 3G4ST 3CCQA 3Q1JA 5L8RE 4JJNK 3M56A 3M59A 4M7DC 4XU2A 1D3BB 1G3YA 3DLMA 4PKCC 5CQYA 1ZHIA 1OZ3A 3QPHA 4BY6C 4QSHA 4ELZC 1NPPA 3LLRA 1BI0A 2R5MA 4C5IA 2VUBA 5GANj 3P8HA 1DJ7B 2EKOA 3GP8A 2X4JA 2YRVA 3JB9J 1VQKT 2DXCA 3GNGA 4N0AA 1E7PA 4CRIA 2DD4B 2CZ7B 1G3SA 4M7AG 2QTXA 4MZPA 1X01A 4LDWA 4C5HA 4M7AB 3HFOA 3MCAB 3VYGA 4QVCA 3G71T 4PJOD 4AKHA 1KQ1A 5GANf 3MHXA 2E10A 3OS1A 4HNTA 3BG9A 4M6VA 4C8QA 5FU6C 3OW2S 4M7AF 3QKJA 4M7AE 5KCOA 5J39A 4JRIA 1M1KU 4AI6A 1YJ9T 4QVDA 3FC3A 4BDZA 5GAMf 5A2QE 4OF1A 2PUKB 4IUUA 2VC8A 3PNWC 2HBPA 4NL2A 3BG5A 1JB0E 2QF7A 5GAN6 2EFIA 4RCCA 3JCMX 2DKGA 3HO8A 3JB9D 3QYHB 4M75G 3ZFJA 3KUFA 2XU8A 1VQ4T 2BUDA 3EFSA 5CIUA 3V8JA 5LJ3h 3P8BB 3OYKA 2HQXA 4BY6B 1JBMA 1H641 2EJ9A 2QA4T 4XTYA 1WGSA 1YCYA 3CC7A 2E41A 3OS5A 4HNVA 1JRIA 1XNIA 3OYYA 4A4GA 1KC8U 1KHCA 2EAYA 3H8ZA 3QYBA 1B34A 5GAN2 1B34B 2DIQA 2Y90A 3L1AA 3CCVT 3ASKA 5CVIA 4WF2A 5D6WA 1M4ZA 4C5GA 3HRTA 3G71A 1VQMA 3VJPA 5CKEA 3NTIA 4HCBA 3META 4C0DB 1VQ6T 3CCEA 1LNXA 4HL4A 3VUBA 5GANd 2YLCA 1NE8A 3A5ZB 4QQDA 3HZJA 1ZQ1A 4R56A 4Z6YA 2RJCA 1XQHA 3CPWS 3OYCA 3CCSA 2KMTA 1G3TA 2ZZDA 4Q5WA 4QW2A 4J6WA 3FDRA 2QQ9A 2RHUA 4BE0A 4BI3A 2EWNA 5C0MA 4KUDK 2E6ZA 4M7AD 3CC2A 3OMGA 3LW5E 3JCMh 2WACA 3X26B 2DZ9A 2RM4A 3MEVA 3X28B 3MEWA 2JNGA 3SWNC 3HP9A 3C12A 4ZN1A 3G6ET 1K8AC 2R5AA 3MP1A 1VQ9T 3HBLA 1WJSA 4LDVA 2V8KA 3JCMb 2RK2A 2Y4XA 4JRPA 3JB9F 2EQUA 2HD0A 3HPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QP2 A;  3X20 B;  2ZPH B;  2O01 E;  2ZPB B;  4FM4 B;  4XK8 E;  3X25 B;  2PVO B;  3A8G B;  5L8R E;  2CZ6 B;  1QP3 A;  2CZ1 B;  2DD5 A;  4ZGE B;  1DJ7 B;  2D0Q B;  2ZZD B;  3X24 B;  2DD5 B;  4ZGJ B;  2DXC A;  1GXI E;  4Y28 E;  3QZ9 B;  1IRE B;  2DD4 B;  2CZ7 B;  3WVD B;  3VYG A;  4RKU E;  2ZPI B;  2QDY B;  4KT0 E;  4OB3 B;  3QXE B;  2WSF E;  4OB0 B;  2ZPF B;  2PUK B;  4L6V 5;  1JB0 E;  3QYH B;  3A8M B;  2AHJ B;  3A8O B;  3VYH B;  2CZ0 B;  1PSF A;  2PU9 B;  1UGS B;  2DD4 A;  2DXB A;  3QZ5 B;  2WSE E;  2ZPG B;  4ZGD B;  2PVD B;  3HHT B;  2CYZ B;  1UGQ B;  2DPP B;  1PSE A;  1UGR B;  1AHJ B;  3VYG B;  3QYG B;  4OB2 B;  3A8H B;  2PUO B;  1UGP B;  3WVE B;  3A8L B;  2ZZD A;  2PVG B;  2ZPE B;  2ZCF B;  3LW5 E;  3X26 B;  1V29 B;  2DXB B;  3X28 B;  4OB1 B;  2WSC E;  2DXC B; 
#chains in the Genus database with same CATH topology
 3RKY A;  2LNH B;  4FSX A;  1N8R C;  3SB2 A;  1BBZ A;  1VQ4 A;  4OR5 B;  1Y07 A;  3E1S A;  1YIT A;  1M2V A;  3VS7 A;  2LTO A;  1D3U B;  3L2V A;  2CSQ A;  4G6L B;  5GAN 8;  4BCH B;  2CCI B;  1K9M C;  2COZ A;  1Q81 R;  4XTX A;  1IHW A;  5IT9 E;  1K0S A;  1NLO C;  4DBR A;  2EPD A;  2GTO A;  2ENM A;  1TH7 A;  1MV0 B;  2DD5 B;  1ZUY A;  4Y28 E;  4V2S A;  4ORZ A;  4PFO A;  2UZE B;  2W9Z A;  3EG2 A;  1QVG S;  1N8R R;  1JKW A;  2MIO A;  1WHM A;  2YRD A;  1VYU A;  2L2P A;  1IGQ A;  4OB3 B;  3M0T A;  3QXE B;  1B07 A;  3VS3 A;  3RKX A;  3G6E A;  4DA4 A;  4L6V 5;  1RAA B;  2CT3 A;  3JCM f;  2RB6 A;  2OTL T;  4LE9 A;  5GAM d;  3CME T;  4JUV A;  2DBM A;  4C0Z A;  2VGM A;  3CC4 T;  2CUD A;  2FYK A;  1OI1 A;  3M03 A;  4II1 A;  2FPF A;  1Q82 R;  4C8Q E;  2YDL A;  1U5S A;  5KYU A;  4BCQ D;  3OW2 P;  1W98 B;  2LRQ A;  3QDR B;  2BZY A;  1KD1 R;  4D6W A;  3MJX A;  3FIF A;  5GAO p;  3JAM E;  1OV3 A;  1OYX A;  4E7K A;  1EX4 A;  1R8O B;  2JXB A;  2C5N B;  4O6J A;  1H28 B;  5KYW B;  2KYB A;  3GIB A;  2MK5 A;  4FIB A;  3VS4 A;  3TSZ A;  2DVJ A;  4BBS M;  1IO6 A;  1HYO A;  2L8D A;  2L3R A;  4JJD A;  1GUX B;  1QWE A;  2YSQ A;  1T3S A;  4IUQ A;  2LJ0 A;  4M77 E;  1HK9 A;  2JS0 A;  2GQV A;  2O4X B;  1G3W A;  2MF2 A;  4A4K A;  2QEX T;  1QQJ A;  2LQK A;  4DEX A;  1MMA A;  1KXU A;  1QMZ B;  5IXB A;  2K9G A;  4RTX A;  3M0S A;  1TG0 A;  4MMK A;  3I56 Q;  6AT1 B;  4HCC A;  2QQS A;  2PVO B;  1WZO A;  3H4C A;  4M7D D;  1OIU B;  4HT8 A;  1UHC A;  3EAE A;  3S6W A;  1EZZ B;  3EGD A;  3CCM T;  4M78 E;  1GXI E;  1VQN A;  4M78 D;  3CC4 A;  2CP3 A;  1Y57 A;  4RG2 A;  4AT1 B;  2M16 A;  3CCV Q;  2NUP B;  3RUX A;  3ME9 A;  4KUL A;  4XU1 A;  4KT0 E;  2XHC A;  2LQ8 A;  5LJ3 j;  5CKD A;  4M75 F;  4I3Z B;  2XDD A;  3OYM A;  2IW8 B;  7AT1 B;  1SG5 A;  4PJO E;  2HQE A;  5FU6 B;  4JJC A;  4CFW B;  5D7U A;  2QYZ A;  4JX5 A;  4FYV B;  2KQW A;  2AHJ B;  2KR3 A;  1IGU A;  2HBW A;  1G3N C;  5KYY B;  5GAM g;  1FKM A;  1KJW A;  1GCP A;  4B9X A;  1FX7 A;  2KRS A;  1KC8 C;  4BCM D;  3CPW P;  1K76 A;  2NUP A;  3R6N A;  2IVX A;  1AT1 B;  1UGV A;  2PVD B;  4BBR M;  5CO7 A;  3PIP A;  3V8L A;  3VS2 A;  3BG3 A;  1VQ6 A;  1W6X A;  1AZE A;  2FB7 A;  1H24 B;  1VQO A;  1O9K A;  2EQM A;  2O9S A;  2DM1 A;  3V7C A;  2BPM B;  1BI2 A;  4F6W B;  3DDP B;  4OGE A;  3A8L B;  2WHB B;  5GMK e;  2PVG B;  5GAO m;  1WQW A;  1VQ4 Q;  2JW4 A;  1H1Q B;  3RER A;  1B3Q A;  1U8R A;  3V7R A;  4AG2 C;  4C92 D;  1VQ5 T;  4Z8A A;  2LDM A;  1RAE B;  5GAN h;  2CH4 A;  2GNC A;  2DJQ A;  3OS0 A;  3M54 A;  4BDY A;  2LT4 A;  2AKK A;  5GAM e;  4Y72 B;  2E12 A;  4C0F A;  4IUV A;  1VIE A;  1YJN T;  2V1R A;  1M8V A;  3HRS A;  4CC3 A;  1X43 A;  2K3B A;  1K0X A;  4F7J B;  4XK8 E;  2X35 A;  4J8O A;  2QGG A;  1RAD B;  4GLK A;  2WIP B;  2CZ6 B;  5GAN 5;  2DD5 A;  1HJD A;  5I11 A;  1VQ9 A;  3CCJ A;  4E7L A;  4XQ3 A;  1O75 A;  2MAM A;  5IDN B;  2DL8 A;  1YIT T;  1JU5 C;  2EYQ A;  3E9F A;  2E1H A;  2KK4 A;  3QWX X;  3RIR A;  3E9G A;  2O9V A;  1R0B G;  3SDZ A;  1M2V B;  4FCY A;  4AKG A;  1Z9Z A;  2F2V A;  4C92 E;  2F5T X;  4EMK C;  2HKQ B;  1ARK A;  2F5K A;  2MI6 A;  4X9C A;  3VUZ A;  1WHJ A;  2GCX A;  2JJ9 A;  3PFS A;  3J81 E;  4CFN B;  3A8M B;  3MI9 B;  3JCM W;  3JCM Q;  2RA2 A;  3A8O B;  1WDX A;  3VYH B;  4DBF A;  3M9Q A;  3DJB A;  4M78 C;  1FYN A;  4RTZ A;  4EMK B;  4YOZ A;  3AT1 B;  5FRN A;  2WMA B;  4NST B;  3GNF B;  3O8V A;  2DXB A;  5AYF A;  1YJW T;  4MDX A;  2WSE E;  4E6R A;  1AZG B;  2EYZ A;  3SWN A;  1LJO A;  1N27 A;  1RAG B;  3DKM A;  1PKD B;  4C0G A;  5LJ5 f;  2GFA A;  4M7A A;  2CH4 W;  2RNA A;  4YOS A;  2RI3 A;  1E6G A;  4JX6 A;  4ROE A;  3G1J A;  4Y92 A;  2EQI A;  1Y0M A;  3MO8 A;  1Q82 U;  2KRO A;  1OQK A;  5KCH A;  2KR6 A;  1M90 C;  5FRO A;  1ZBJ A;  3QWL A;  3INZ A;  2DXB B;  2XDB A;  5DM7 R;  2DO3 A;  1IRX A;  3V8K A;  2RQW A;  3C0C A;  1S72 A;  1NJI R;  4C92 A;  1K9M U;  3KHI A;  4F6S B;  4XTZ A;  1MGQ A;  1OZ2 A;  4A4H A;  4BI4 A;  1YHQ A;  3OYD A;  2DZC A;  1TUG B;  2XD0 A;  5L8R E;  1BU1 A;  1PKT A;  2D0N A;  2QG9 B;  3M56 A;  4JJN K;  1D3B B;  4RTT A;  1RAH B;  1ZHI A;  3LLR A;  4C5I A;  2VUB A;  2EKO A;  1SKU B;  4F16 A;  2HCK A;  3GNG A;  1E7P A;  2DD4 B;  2CZ7 B;  3CC2 Q;  3HFO A;  2DNU A;  1TOV A;  4BCN D;  3MHX A;  2A36 A;  4J9C A;  3OS1 A;  4M6V A;  5FU6 C;  3OW2 S;  3QKJ A;  1JO8 A;  4M7A E;  1RAI B;  4DBQ A;  4AI6 A;  4QVD A;  4BDZ A;  1ZSZ B;  4OF1 A;  4IUU A;  4BCQ B;  2HBP A;  2RQV A;  1FMW A;  1XJW B;  4NL2 A;  3BG5 A;  2YUO A;  3CCL Q;  1QWF A;  4QKU A;  3JB9 D;  4BCP B;  2XU8 A;  1SF9 A;  2BUD A;  1GY3 B;  2CRE A;  3P8B B;  3OYK A;  2HQX A;  1H64 1;  4XTY A;  4J9G A;  3CC7 A;  1M27 C;  3H8Z A;  2NUT A;  1PD0 A;  1WLP B;  2K79 A;  1QVG P;  1AIS B;  2LJ3 A;  2FO0 A;  1VQM A;  1JJ2 P;  2K6D A;  1LNX A;  3VUB A;  2PTK A;  2EW3 A;  1NE8 A;  1ZQ1 A;  3DDQ B;  4R56 A;  2L3P A;  3CCS A;  1G3T A;  1RLP C;  2RHU A;  4B6M A;  4M7A D;  1QLY A;  5C0M A;  1AVZ C;  3BHU B;  3LW5 E;  2EGC A;  3JCM h;  2WAC A;  1X69 A;  2DZ9 A;  3HP9 A;  4FW2 A;  3MP1 A;  4J9H A;  1WJS A;  2CJM B;  3JB9 F;  4BCK B;  1G2B A;  2EQU A;  1M2O A;  2PHG A;  4FW1 A;  1H1P B;  3CCQ Q;  2P84 A;  1K73 R;  1C6V X;  1SSH A;  2VWF A;  3CCJ Q;  3EID B;  4FM4 B;  4C8Q D;  1RUW A;  3FJ5 A;  2KVQ G;  3RNJ A;  3OYN A;  1X75 C;  3EFO A;  2I40 B;  2K3X A;  3TNH B;  2AK5 A;  1VQ7 Q;  4J7F A;  5GAN 4;  4IUP A;  2JT4 A;  1UFF A;  4F7U B;  1GL5 A;  2QAS A;  4PFZ A;  3TRE A;  3MY5 B;  3CD6 A;  4DBH A;  3K7A M;  1O9K B;  5EJC A;  3I5R A;  5CR2 A;  2CP5 A;  2QDY B;  3HSB A;  3HFN A;  4OB0 B;  2C4G B;  3GTM S;  2B8A A;  5M9O A;  1PD1 A;  2RH2 A;  3BLQ B;  5HK3 A;  3HB9 A;  2E3I A;  1YP5 A;  3OA6 A;  1OU8 A;  4RG8 A;  3LGF A;  2JMA A;  1PG5 B;  3ZBD A;  3DLL A;  3L2Q A;  5KYY A;  1SEM A;  1YNZ A;  2MWP A;  3T9N A;  3ER0 A;  2AZS A;  2O31 A;  4F7U G;  2KY9 A;  1KK7 A;  2H3J A;  1X6O A;  1GRI A;  2RI5 A;  1Q7Y R;  1T3L A;  4M7D F;  2CP6 A;  4OMF B;  4F7U F;  2BS2 A;  2GF7 A;  1C9B A;  2EYY A;  2RHZ A;  1QW1 A;  4KGZ B;  4EMH A;  1YHQ T;  2B9R A;  1UGR B;  3VV0 A;  5DQV A;  3FC3 A;  4X9D A;  2KRM A;  4OB2 B;  3I56 A;  5HBH B;  1ZLM A;  2DER A;  2FZG B;  3VKI A;  4LD6 A;  3B57 A;  2BE7 D;  4O5V A;  3NMZ C;  5I21 A;  2RHI A;  4BB7 A;  4M75 D;  2VGN A;  1I07 A;  4C8Q B;  4CFV B;  4GY5 A;  1KG1 A;  1BIA A;  1K9M R;  2NLU A;  4OB1 B;  1M1G A;  3G71 Q;  1AOJ A;  2J6O A;  3M4G A;  2K5I A;  4ROC A;  4BD3 A;  4C8Q C;  1FIN B;  2OTL A;  2D9T A;  1JSU B;  2ZPH B;  2WFY B;  1ZSZ C;  2HEQ A;  4E7H A;  1YJ9 Q;  1HXD A;  3G7Z A;  1UNH D;  4M7D B;  1G5V A;  4JRQ A;  2X9H A;  5FGK B;  2COY A;  3UAT A;  3TCJ A;  4J5Y A;  2K7A A;  2X1N B;  5IN1 A;  3CCL T;  1OKW B;  3OYI A;  4M7A C;  3M55 A;  4FT4 A;  1IRE B;  3EH2 A;  1BK2 A;  4LDY A;  1TUD A;  4OGR B;  3CCV A;  1IHV A;  1Q82 C;  5AT1 B;  1VQM T;  3EG0 A;  1VQ6 Q;  3VS6 A;  1AWO A;  1Q95 G;  4X34 A;  2UZB B;  1C0M A;  1H25 B;  3TNW B;  3JCM J;  1XOV A;  1G8X A;  3M0R A;  5J26 A;  1VQL Q;  4R0K A;  4NOY A;  3PMT A;  3DL1 A;  2MMP A;  4TVR A;  2G6F X;  3MY1 B;  4C5E A;  4CC4 B;  2LJ1 A;  2MCN A;  5GAO q;  1PSF A;  2LCL A;  2MWO A;  2JVV A;  3CMA Q;  3P8D A;  1VQK Q;  3GBQ A;  2WJ9 A;  4QVZ A;  1UHF A;  4RTY A;  2PK2 A;  3DB4 A;  1RAF B;  2HNI A;  4DQ2 A;  1I81 A;  4JS4 A;  2QEX Q;  2FEI A;  4NS5 A;  1QKX A;  2IVW A;  5FWC A;  5C6S A;  1AWX A;  3S3O A;  3U23 A;  2E5Q A;  4L59 A;  2ED0 A;  3M57 A;  3CCR A;  2KT8 A;  3PE0 A;  4E7I A;  2DYB A;  5GAO n;  2A3L A;  1VUB A;  1VYT A;  1A0N B;  1Z9Q A;  4M7D A;  1NJI U;  3EG3 A;  1YBY A;  3MEA A;  2A0F B;  4CFM B;  2EGE A;  2JMC A;  2FPE A;  2UZD B;  3LQ5 B;  3OS2 A;  3BDU A;  1K8A U;  4YTL A;  3FLG A;  2QDJ A;  3M4Y A;  4IUR A;  2C0I A;  2O01 E;  5CKF A;  3BW1 A;  3CBO A;  5GJW B;  3O0G D;  2WXV B;  1P5E B;  2X3X D;  2DAQ A;  5CCA A;  5LJ3 g;  4N4G A;  5LJ5 e;  2CZ1 B;  3QO3 A;  3URG A;  1W2B S;  2FZC B;  1H26 B;  2KGT A;  2MOX A;  2D0Q B;  2ZZD B;  3X24 B;  1LVK A;  2FHD A;  2G3R A;  3CBM A;  3JCM e;  1M1K R;  2DJZ A;  3QZ9 B;  3KFV A;  4LNP A;  2C5V B;  1H1R B;  1OX8 A;  3WVD B;  4M77 D;  1VOL A;  3PGG A;  4F7N B;  3OYJ A;  3CC7 Q;  3GPL A;  1PRL C;  4XTV A;  2KXD A;  1UB4 A;  1ZA2 B;  1IB8 A;  4MZT A;  3NPF A;  1VQ7 A;  2LQN A;  2DE0 X;  1Q7Y U;  2O4X A;  3G4S Q;  4J9E A;  4BAC A;  3A98 A;  3OW2 A;  4F04 B;  2CS7 A;  3GLX A;  2OX7 A;  4C92 F;  3UDC A;  4E7Z A;  5KH6 A;  1W2B A;  2FVU A;  2DXU A;  3I35 A;  4F14 A;  5EFQ B;  1NZ9 A;  5L2W B;  1WJR A;  2BZ8 A;  1ABQ A;  2LCS A;  1BKB A;  8AT1 B;  4EPC A;  2YUP A;  5DLQ E;  1WHL A;  5GAO l;  3NTH A;  4JS5 A;  4NC6 A;  1UGS B;  1AD6 A;  3RMQ A;  1D0Y A;  1YI2 T;  2ED1 A;  2JM9 A;  3JCM P;  5LJ3 e;  1XTD A;  3EGD B;  3EJ1 B;  5LJ5 g;  1BCM A;  4A4E A;  3E2U A;  3TW6 A;  3G4S A;  2Y4Y A;  4MDW A;  1G83 A;  3OSS C;  4RUG A;  3RES A;  3OMC A;  1N9R A;  2O88 A;  4ZTF A;  1BI1 A;  3VYG B;  2M9U A;  3I55 A;  2YWW A;  4OMM A;  4E7J A;  1MNE A;  2LX7 A;  1ZP2 A;  4PJO F;  5GMK j;  2OTL Q;  2R57 A;  3CME Q;  4EOI B;  2AKL A;  3BLH B;  3M5A A;  4EOS B;  3QHW B;  1U1S A;  3TW7 A;  4PNO A;  1K73 U;  2KYM A;  1HSQ A;  4JLG A;  2VYT A;  4PJL A;  2QEX A;  3JV3 A;  3CEY A;  2WSC E;  4J9F A;  2R58 A;  3OYF A;  3CD6 Q;  3QYE A;  2M1H A;  3PTA A;  4HA8 A;  1H1S B;  1VQP T;  4FYX B;  2EJF A;  5A0L A;  5FU7 B;  3SD4 A;  2V26 A;  3EFR A;  4M77 C;  2XMF A;  1NYF A;  2FL7 A;  3CCQ A;  1RLQ C;  1M3A A;  1GBQ A;  3M59 A;  4XU2 A;  2YXY A;  1G3Y A;  2D1X A;  4PKC C;  4QSH A;  2QAZ A;  4ELZ C;  3VRZ A;  5GAN j;  1GBR A;  1S1N A;  3GP8 A;  2YRV A;  5IHK A;  2DXC A;  4CRI A;  1K9A A;  2C5X B;  1G3S A;  4M7A G;  2QTX A;  1X01 A;  4LDW A;  4C5H A;  1OGU B;  3MCA B;  1KQ1 A;  4CRL B;  4OML A;  4EOQ B;  5GAN f;  2A28 A;  3BG9 A;  1YJW Q;  5KCO A;  5J39 A;  2DFU A;  3REB B;  2Z0W A;  1JEG A;  3TQ7 P;  2PUK B;  2VC8 A;  3QWY A;  5GAN 6;  3JCM X;  2DKG A;  3HO8 A;  3M0P A;  2EGA A;  4BCN B;  1SHF A;  3EFS A;  3V8J A;  2DX1 A;  4HVV A;  2LQW A;  2F1L A;  2E41 A;  2CCH B;  3OS5 A;  3OYY A;  1JRI A;  1KHC A;  3EGX A;  1VA7 A;  2Y90 A;  2CT4 A;  1UJ0 A;  3L1A A;  3CCV T;  5CVI A;  4WF2 A;  3O5Z A;  1M4Z A;  4C5G A;  3HRT A;  1OU9 A;  1WFW A;  1VYV A;  3VJP A;  2GGR A;  2LP5 A;  3NTI A;  1V1C A;  4HL4 A;  1D0X A;  2COW A;  2J6F A;  1X6G A;  3EOC B;  1WXT A;  3OYC A;  2KMT A;  2ZZD A;  5ICP B;  3FDR A;  2W0Z A;  4BI3 A;  2EWN A;  4KUD K;  2D8H A;  3CC2 A;  3CCM Q;  4EON B;  3MEV A;  3X28 B;  2HL3 A;  3EH1 A;  3C12 A;  1K1Z A;  3TVT A;  4ZN1 A;  4JZ4 A;  3G6E T;  5ACB A;  2R5A A;  4LDV A;  2RK2 A;  4JRP A;  1VYW B;  3HPW A;  3X20 B;  2XG8 D;  1TD6 A;  3GF5 A;  2JTF A;  3CC2 T;  2YUQ A;  2XDP A;  2J05 A;  1D0Z A;  4RCB A;  3OYL A;  3RBB B;  1Y96 A;  5LJ3 d;  1T0H A;  4C0D C;  1C1A A;  4EOM B;  2DIL A;  1SHG A;  2KDS A;  5IHY A;  2G77 A;  1AEY A;  2KSS A;  4PJM A;  1KD1 C;  3R6O A;  2LCC A;  1ABO A;  3OYG A;  3S3M A;  3TU4 K;  1W4S A;  4FX3 B;  2ATC B;  4KRC B;  3SWN B;  4YOO A;  4OMO A;  4RKU E;  1YJN A;  4C92 G;  3OY9 A;  2OTJ Q;  3CCE Q;  1X2K A;  2K5F A;  4EIK A;  4LD9 K;  1E9H B;  2KNB B;  2X4Y A;  1M5Q 1;  1RI0 A;  3HKS A;  4EOL B;  3VU3 C;  4OVA A;  1KSW A;  4ZTJ A;  2DET A;  1VQ8 Q;  2DEQ A;  2GBQ A;  1WI7 A;  1NJI C;  4PJO B;  4CFU B;  5I5Z B;  1YIJ A;  5HNB B;  1K4U S;  4PLL A;  1ENW A;  1NPR A;  1YIJ T;  4EMG A;  4Z89 A;  3QZ5 B;  3VKG A;  4FYW B;  4PLI A;  2W99 A;  1R77 A;  4JLI A;  1YIT Q;  4PJO A;  1NM7 A;  2PZ1 A;  4CC2 A;  2SEM A;  5CQX A;  3QBY A;  2C6T B;  5LJ5 j;  2BKZ B;  5GAO r;  1PSE A;  3CD6 T;  2PQW A;  3QYG B;  1E7O A;  3OYE A;  4AKI A;  3CCQ T;  2P0Q A;  5LJ5 d;  1UGP B;  2VXF A;  2W10 A;  2WIH B;  3CCU T;  3CPW A;  3QJ6 A;  4CFU D;  1ZSG A;  1K73 C;  3RMS A;  1RAB B;  2ZPE B;  3NDQ A;  3EG1 A;  5I2M A;  1OX9 A;  3M58 A;  1MND A;  1W1F A;  2WPA B;  1WJQ A;  3MKD A;  2DL5 A;  1H3Z A;  3LGL A;  3J7A F;  3DB3 A;  2KRN A;  2RJE A;  4HKE A;  4JJB A;  1N4M A;  4XTU A;  2X51 A;  3OYH A;  3NGP A;  1UG1 A;  1XO2 A;  1D3B A;  1Q7Y C;  3LWH A;  2C0T A;  2GTJ A;  1I5L A;  3A8G B;  2RI2 A;  1NEB A;  3QHS A;  2HKN A;  2IPO B;  1TTH B;  4F17 A;  2KMG A;  4ZGE B;  2K57 A;  3MP6 A;  4M4Z A;  2LW4 A;  4BE1 A;  1T0J A;  1VQN Q;  2RQT A;  3EG9 B;  2CP2 A;  1TFB A;  3FJP A;  5GAN e;  3M0Q A;  3JCM V;  3PMI A;  2WMB B;  4IIO A;  5IHI A;  4A4F A;  2SRC A;  3NTK A;  5I2S A;  2JGZ B;  4UC4 A;  2WSF E;  2FRY A;  3C95 A;  2HMA A;  2ZGW A;  4J9I A;  4M7D E;  2LVM A;  4M78 A;  2ZPF B;  3VS1 A;  4ESR A;  2PMI B;  1N8R U;  1JJ2 S;  3FEO A;  2MYS A;  2GFU A;  3KXT A;  1W70 A;  4GBQ A;  1QLB A;  5EG2 A;  2EIF A;  4CFX B;  1Q86 C;  5GAN 3;  3PO3 S;  1OI9 B;  2QQR A;  3QDF A;  2PU9 B;  1OPL A;  4ROD A;  5HCK A;  3I55 T;  1I5O B;  1BYM A;  5CYI B;  1MMN A;  1YJ9 A;  2EYX A;  5HQ0 B;  5KYW A;  2G9X B;  1WHK A;  5LQF B;  2QFZ A;  1MMG A;  2I53 A;  4AFS C;  3UA6 A;  2RQU A;  9ATC B;  3CCR T;  3MIA B;  5FLX E;  3G6E Q;  3J80 E;  2D6F A;  4ZN3 A;  5CKB A;  2IG0 A;  1UGQ B;  2DPP B;  2X4X A;  2YLB A;  2JZ2 A;  1YCS B;  4ELY C;  4J83 A;  4KRD B;  2RJD A;  5FRM A;  4XU0 A;  1SRL A;  5HKC A;  1RL2 A;  4JPB W;  3TSW A;  1FXX A;  1KC8 R;  1ZA1 B;  1QMC A;  5KYX A;  1JXO A;  1PRM C;  3JB9 G;  1V76 A;  1OKV B;  4IUT A;  5FWB A;  1Y7X A;  2M0O A;  1PNJ A;  3FB9 A;  1M1F A;  3LYI A;  2D8J A;  4EOP B;  2CUB A;  2NWM A;  1OUL A;  2ECZ A;  1E6H A;  3QJY A;  2HL5 C;  2IW6 B;  4J9B A;  2OI3 A;  1QKW A;  3N5B B;  3PVL A;  2P4R A;  3X25 B;  2C0O A;  4QQG A;  3OSV A;  3SEM A;  4P5N A;  1BB9 A;  1UDL A;  4IKF A;  1Y71 A;  2QGS A;  3CC4 Q;  5HVY B;  4KUI A;  3F70 A;  3CCU A;  1VQ9 Q;  1WX6 A;  2RHX A;  2HSP A;  2GQI A;  2PJQ A;  3M53 A;  3L2U A;  1M90 U;  2AT1 B;  1YIJ Q;  2QQ8 A;  2PK9 B;  1H92 A;  3UA7 A;  4FU6 A;  2DRK A;  4C92 C;  3JCM g;  1N9S A;  3OYB A;  3RR6 A;  4N4H A;  2V8J A;  1KQS P;  1UTI A;  4GLM A;  1QCN A;  3DOG B;  1YWP A;  5CKH A;  3SFM A;  1UE9 A;  4D8K A;  1AD5 A;  5GMK h;  4LUD A;  4C92 B;  4BXX X;  2EUF A;  3TNI B;  3JRZ A;  4M75 A;  1S72 T;  2CZ0 B;  2A7Y A;  1N6A A;  2XID A;  3WXM B;  1WHH A;  2DVE A;  2EBP A;  3HHT B;  4MIM A;  4C8Q G;  4QQ6 A;  2DTO A;  3E19 A;  3I56 T;  1J3T A;  3PIO A;  3M0U A;  4M77 B;  4IMY B;  1AHJ B;  4BCI B;  4RTW A;  3H41 A;  2DIG A;  1LPL A;  2QQA A;  5LMK B;  2K3Y A;  4Z02 A;  1N5Z A;  2YRC A;  3WVE B;  2X4W A;  3FRN A;  1WIE A;  1VQ7 T;  4ATO A;  1X6B A;  2P0P A;  2HQH A;  2H8H A;  1UEB A;  4EOO B;  4A54 A;  2ZCF B;  2B86 A;  1GH6 B;  1VQP A;  5CAI A;  4EOR B;  2DYI A;  4YC3 B;  1IZ6 A;  2QXF A;  1TWB A;  4WCI A;  4EMK A;  1HD3 A;  3CCM A;  4JX4 A;  1I0C A;  4N4I A;  3QG1 A;  1VQN T;  2BIV A;  4BE2 A;  2MPX C;  4LUE A;  4MFE A;  1CKB A;  3CC7 T;  2M51 A;  3RDV A;  2E3H A;  2K2M A;  3G4S T;  1D09 B;  1UNG D;  2L3Q A;  3Q1J A;  2J7I A;  2X3W D;  4M7D C;  1SPK A;  1NPP A;  1BI0 A;  4CXA B;  1NG2 A;  1W2B P;  1DJ7 B;  2KBT A;  1NBE B;  2VB6 A;  2CSI A;  1VQ5 Q;  2KI7 A;  3H0I A;  2VAS A;  4M7A B;  3G71 T;  4AKH A;  4KRT A;  1NEG A;  2E10 A;  3I55 Q;  4HNT A;  1X27 A;  4JRI A;  4II5 B;  1YJ9 T;  1YJN Q;  4E2F B;  5GAM f;  2ZAE A;  5A2Q E;  2UUE B;  2QF7 A;  2YUN A;  2EFI A;  1OL2 B;  3MPU B;  5IHN A;  1CSK A;  1R0C B;  3QYH B;  3ZFJ A;  3KUF A;  1FMV A;  1UEC A;  1VQ4 T;  2E4H A;  5CIU A;  2V22 B;  5LJ3 h;  2L3S A;  5DQW A;  4BY6 B;  4F6U B;  2EJ9 A;  1NYG A;  1M3C A;  4EC8 B;  1KC8 U;  1XNI A;  2IIM A;  4ELL A;  2KEA A;  5KYX B;  2OJ2 A;  5GAN 2;  2DIQ A;  1JQQ A;  2NUT B;  1IXD A;  1H4L D;  1FMK A;  2QTV A;  1VQM Q;  4HCB A;  5CKE A;  4C0D B;  1VQ6 T;  4FYY B;  2YLC A;  3A5Z B;  2DEU A;  2FRW A;  3HZJ A;  4Z6Y A;  1KIK A;  4WTO B;  4Q5W A;  4QW2 A;  2VVK A;  1WXU A;  3EGU A;  1EFN A;  4E7S A;  1ZSZ A;  3X26 B;  1YFN A;  3MEW A;  2JNG A;  3SWN C;  4ANJ A;  2R7G A;  4LXC A;  2A08 A;  1VQ9 T;  3HBL A;  1TSF A;  4KH0 B;  3BHT B;  2Y4X A;  3HTR A;  3UF4 A;  3A1P A;  3ZEH A;  2F2C A;  2RD1 A;  2DRM A;  4E47 A;  3THK A;  5A0G A;  3OQ5 A;  2KE9 A;  2BTT A;  3CMA A;  1QVG A;  5HBJ B;  2KAF A;  1PC0 A;  5GJV B;  3CQT A;  2ABL A;  2H3E B;  4M75 E;  4CI0 C;  2DTH A;  4OGC A;  1Q81 C;  1QCO A;  1RI9 A;  2C06 A;  1SRM A;  2JUF A;  1Q86 U;  3H6Z A;  4MFD A;  3L2W A;  5LJ3 f;  2JTE A;  3OBW A;  2EQJ A;  2EQK A;  2QGF B;  4ZNX A;  4PL6 A;  3MP8 A;  1QVF S;  1S72 Q;  1FVV B;  3OB9 A;  4R55 A;  2LZ6 B;  2JN0 A;  1VQK A;  1QVF A;  1O9S A;  2OTJ A;  2E6N A;  3H0F A;  4Y91 A;  3VKH A;  5GAM h;  2DME A;  2QI2 A;  1QCF A;  5D6X A;  2FZK B;  3L42 A;  5GMK i;  2QK0 A;  4JDS A;  5GMK l;  4HT9 A;  5FU7 C;  1RAC B;  1JJ2 A;  2PNI A;  2OAU A;  1URC B;  1M90 R;  2VKN A;  1YJW A;  2KXC A;  4C8Q F;  2DD4 A;  4ELJ A;  4DOV A;  2QA4 A;  1GUX A;  2XIC A;  4AFZ C;  3JCM d;  1SSF A;  4OP0 A;  2CYZ B;  4MML A;  2P0K A;  5HY6 A;  4XAX B;  3CCS Q;  4M7D G;  2BS3 A;  2L0A A;  2L5Q A;  3NFC A;  3A8H B;  3LH0 A;  1GFC A;  2PUO B;  2WEV B;  1P92 A;  2XI9 A;  4M78 F;  4XU3 A;  2LMJ A;  4IIM A;  3VS0 A;  5D6Y A;  2K4Y A;  3EHR A;  3JB9 H;  3IQL A;  3CPF A;  1D1A A;  2VV5 A;  4HCK A;  3QII A;  3JB9 I;  5KYU B;  1EIF A;  2W2H A;  1PM3 A;  1YWO A;  4OMQ A;  1PWT A;  1X2Q A;  4LDU A;  4FT2 A;  1I1J A;  4EDU A;  4BY7 X;  2HDA A;  2DXC B;  2EYW A;  5GAM j;  1QP2 A;  3C94 A;  1TU0 B;  4J6X A;  2YHT A;  3F5X B;  1YN8 A;  5HBE B;  1VQ8 A;  2E65 A;  1M9S A;  1JST B;  1F1B B;  3HL8 A;  2M0Y A;  3ULR B;  2VXE A;  1QVF P;  2AZV A;  2FG0 A;  3VS5 A;  2HZY A;  1BCO A;  4UN0 A;  2DF6 A;  2E64 A;  3I5S A;  1PKS A;  3CXC S;  1VQO Q;  3BLR B;  3I9Q A;  1ZUK A;  4L5G A;  2ROT A;  4JZ3 A;  1GFD A;  1JXM A;  1VQ8 T;  3UT1 A;  4EC9 B;  1I8F A;  4HNU A;  2J06 A;  3HRU A;  2ROL A;  3UPU A;  3PVQ A;  1YI2 Q;  1Q81 U;  1M3B A;  4BCM B;  2BE9 B;  2QDL A;  4BCF B;  3AHU A;  4M75 B;  4OMP A;  1D1C A;  2P4T A;  2HSE B;  4M78 G;  2LC4 A;  2CP7 A;  4X1V A;  3QHR B;  4J9D A;  4LN2 A;  4Z88 A;  4DOW A;  1B7T A;  2HAX A;  1VQP Q;  1TXQ A;  1Y96 B;  5GAN g;  2UZL B;  4M75 C;  5BNJ B;  4ME7 A;  1VQL A;  2CKK A;  1ZUU A;  2DXT A;  4HLQ A;  4HCZ A;  1OL1 B;  2E70 A;  3VRY A;  4VUB A;  2XK0 A;  4LOC A;  1I4K 1;  1MUZ A;  1LOJ A;  5J3B A;  3OYA A;  1LCK A;  1YI2 A;  5L23 A;  2JTM A;  1OPK A;  4A63 B;  2DL7 A;  2F69 A;  4PJN A;  2KT1 A;  4ZGD B;  2ZPG B;  1KQS A;  2ESW A;  2RQR A;  1KHI A;  4CC7 A;  2CP0 A;  2RO0 A;  3S3N A;  2QQB A;  4KGX B;  1WXB A;  3CCJ T;  2K5L A;  2RF0 A;  4XTW A;  1M30 A;  4NL3 A;  4HVW A;  2NYS A;  4DEY A;  3DTO A;  2YT6 A;  3EHQ A;  1M1K C;  2V1Q A;  4AFU C;  2EKH A;  2QA4 Q;  2OAW A;  3CBP A;  4AFQ C;  2BKD N;  1V29 B;  5IDP B;  1U1T A;  2O2O A;  1MV3 A;  4PK4 A;  2C5O B;  2RHY A;  1NLP C;  3PT9 A;  1Q86 R;  3BFM A;  5CEI B;  2RMO A;  1VQ5 A;  4RTV A;  2RK1 A;  1WNL A;  4FL6 A;  4KGV B;  1PCX A;  3JSC A;  3LX7 A;  4M77 G;  2DK3 A;  3CXC P;  4PJO G;  3LWI A;  4A53 A;  3KBG A;  2I2L A;  4N0A C;  4OMN A;  1QP3 A;  4RTU A;  4KBM B;  5GMK m;  2V8I A;  4JRK A;  2IW9 B;  2JOY A;  5IH2 A;  4F7U A;  3NHN A;  2FPD A;  2EJG A;  2RJF A;  5I22 A;  1UUE A;  3CCL A;  3CME A;  4ZGJ B;  5LJ5 h;  3SHW A;  1GCQ C;  2J6K A;  1F5Q B;  4QT7 A;  4RMO A;  3EFO B;  3L2R A;  2DTI A;  3OBY A;  3JCM c;  2ZPI B;  4J6Y A;  3V7S A;  3RKW A;  4BI8 B;  1U06 A;  3L2Z A;  4BUG A;  4PJO C;  3TN8 B;  1D1B A;  2DA9 A;  2LX9 A;  3CCR Q;  4M77 A;  3QUI A;  4BCG B;  1M8M A;  1UNL D;  4MZM A;  4EOJ B;  3BY7 A;  5KYN A;  4M78 B;  3CCS T;  1QVP A;  2RN8 A;  5IAY A;  5KE3 A;  3CXC A;  4B9W A;  5DLO A;  1ACM B;  4LDX A;  4BCO B;  3BE3 A;  5DY9 A;  4TTH A;  3GOX A;  3H9N A;  1WYX A;  8ATC B;  2W9F A;  3EG9 A;  2K2V A;  4F7S B;  2BS4 A;  4K11 A;  3BHV B;  2EVR A;  1AWW A;  4D8D A;  4PJJ A;  4F7U E;  1VIF A;  2OTJ T;  4FSS A;  5CK9 A;  1H8K A;  2LT1 A;  2E5K A;  1TUC A;  2L89 A;  2IN3 A;  1WQ7 A;  1WPY A;  1BI3 A;  1KD1 U;  5LL6 S;  4M77 F;  1OOT A;  1GCQ A;  1VQL T;  1FWZ A;  3UWN A;  4F70 B;  1BIB A;  2F2X A;  2F2W A;  5HK0 A;  3D7S B;  1VQO T;  3BDL A;  1BU2 A;  3CMA T;  1H3H A;  3C4S A;  1ZBX A;  2XKO C;  5GAN 7;  5KE2 A;  3QSU A;  2LNV A;  1KQS S;  3CCE T;  2DL3 A;  3MEU A;  1UJY A;  4J7I A;  2DMO A;  2JS2 A;  1OEB A;  3TEE A;  2ZPB B;  4HVU A;  5A0D A;  2CGH A;  1KQ2 A;  1U3O A;  1VOM A;  1JOW A;  1MHN A;  2DL4 A;  1TS9 A;  3DLM A;  5CQY A;  1OZ3 A;  3QPH A;  4BY6 C;  2R5M A;  4AMC A;  3P8H A;  2RPN A;  3G33 B;  2X4J A;  3JB9 J;  1VQK T;  4N0A A;  1VIN A;  2M02 A;  3LH5 A;  4MZP A;  3REA B;  3VYG A;  4QVC A;  4PJO D;  4PFP A;  2NUZ A;  4C8Q A;  2W96 A;  4M7A F;  1WA7 A;  2DLP A;  4F7L B;  1M1K U;  4AG1 C;  1WHG A;  3PNW C;  3CCU Q;  1JB0 E;  3ZL7 C;  4RCC A;  5IXF A;  4BCJ B;  2I0N A;  4M75 G;  1K8A R;  3RGF B;  1KFZ A;  2CDT A;  4BY1 X;  1JBM A;  5EC7 A;  2QA4 T;  1ZX6 A;  1WGS A;  1YCY A;  4KH1 B;  4HNV A;  4A4G A;  2EAY A;  4EOK B;  3QYB A;  2AIR B;  1CKA A;  1B34 A;  2JM8 A;  1OIY B;  1B34 B;  1MMD A;  5ECA A;  3ASK A;  2DBK A;  3EGX B;  5D6W A;  4HXJ A;  3G71 A;  3H0H A;  3MET A;  3CCE A;  5FW9 A;  5GAN d;  4QQD A;  5IF1 B;  2RJC A;  1XQH A;  3CPW S;  4J6W A;  1AWJ A;  1H27 B;  2QQ9 A;  4BE0 A;  2E6Z A;  3OMG A;  3POM A;  2RM4 A;  2BZX A;  1K8A C;  1PHT A;  2A37 A;  2V8K A;  3JCM b;  1YHQ Q;  2HD0 A; 
#chains in the Genus database with same CATH homology
 3RKY A;  4FSX A;  1N8R C;  3X20 B;  2XG8 D;  3ZEH A;  3GF5 A;  3CC2 T;  2JTF A;  2RD1 A;  3SB2 A;  4E47 A;  1VQ4 A;  5A0G A;  1Y07 A;  3OQ5 A;  3E1S A;  1YIT A;  2XDP A;  2LTO A;  4FM4 B;  4C8Q D;  3L2V A;  2KVQ G;  3CMA A;  4RCB A;  3OYL A;  2KAF A;  3OYN A;  1QVG A;  1Y96 A;  1X75 C;  5LJ3 d;  5GAN 8;  4C0D C;  1K9M C;  4XTX A;  4M75 E;  2K3X A;  4CI0 C;  2KDS A;  5IT9 E;  2DTH A;  4OGC A;  4J7F A;  1Q81 C;  5GAN 4;  2G77 A;  2C06 A;  2KSS A;  1KD1 C;  2JUF A;  4IUP A;  3R6O A;  1Q86 U;  3H6Z A;  1TH7 A;  2LCC A;  4F7U B;  2DD5 B;  4MFD A;  3L2W A;  5LJ3 f;  3OYG A;  3OBW A;  3TRE A;  3S3M A;  3TU4 K;  4Y28 E;  2EQJ A;  2EQK A;  4V2S A;  1W4S A;  4PL6 A;  3MP8 A;  3CD6 A;  1QVF S;  1QVG S;  5EJC A;  3OB9 A;  4R55 A;  3SWN B;  5CR2 A;  4RKU E;  1YJN A;  2JN0 A;  4C92 G;  3OY9 A;  1VQK A;  2QDY B;  1QVF A;  1O9S A;  2OTJ A;  2E6N A;  4Y91 A;  4OB3 B;  3VKH A;  5GAM h;  3QXE B;  2QI2 A;  3HFN A;  2K5F A;  3HSB A;  1H3Z A;  5D6X A;  4OB0 B;  4LD9 K;  3L42 A;  3RKX A;  2B8A A;  3G6E A;  5M9O A;  5GMK i;  4DA4 A;  2RH2 A;  2X4Y A;  1M5Q 1;  1RI0 A;  3HKS A;  4L6V 5;  4JDS A;  5HK3 A;  3HB9 A;  3VU3 C;  4OVA A;  5GMK l;  3JCM f;  2RB6 A;  3OA6 A;  4ZTJ A;  2DEQ A;  2OTL T;  5GAM d;  5FU7 C;  3CME T;  4RG8 A;  4JUV A;  1NJI C;  4HT9 A;  4PJO B;  3LGF A;  3ZBD A;  3DLL A;  1YIJ A;  1JJ2 A;  4C0Z A;  2VGM A;  3L2Q A;  3CC4 T;  2FYK A;  4PLL A;  1OI1 A;  2OAU A;  2MWP A;  3T9N A;  4II1 A;  3ER0 A;  1YJW A;  1NPR A;  4C8Q F;  4C8Q E;  2KY9 A;  4F7U G;  2H3J A;  2DD4 A;  1X6O A;  4ELJ A;  1YIJ T;  2RI5 A;  4EMG A;  4DOV A;  3QZ5 B;  2QA4 A;  3VKG A;  2XIC A;  4PLI A;  4JLI A;  3JCM d;  1SSF A;  4M7D F;  2LRQ A;  4PJO A;  4OMF B;  4F7U F;  3QDR B;  2BS2 A;  4OP0 A;  2GF7 A;  2CYZ B;  4MML A;  2P0K A;  5CQX A;  3FIF A;  3QBY A;  5HY6 A;  4D6W A;  2RHZ A;  5GAO p;  1QW1 A;  4XAX B;  5LJ5 j;  1OYX A;  4E7K A;  4EMH A;  5GAO r;  4M7D G;  2BS3 A;  1YHQ T;  1PSE A;  1UGR B;  1R8O B;  3VV0 A;  3CD6 T;  2L5Q A;  2PQW A;  3QYG B;  4X9D A;  3OYE A;  4OB2 B;  3NFC A;  3I56 A;  4O6J A;  4AKI A;  3A8H B;  2PUO B;  3LH0 A;  1P92 A;  2P0Q A;  4M78 F;  1UGP B;  2VXF A;  2XI9 A;  5LJ5 d;  3CCQ T;  3GIB A;  3CCU T;  4FIB A;  4XU3 A;  3CPW A;  3QJ6 A;  5D6Y A;  2K4Y A;  3VKI A;  4LD6 A;  4BBS M;  1K73 C;  4O5V A;  3RMS A;  5I21 A;  2L8D A;  2RHI A;  4BB7 A;  2L3R A;  2ZPE B;  4M75 D;  2VGN A;  3M58 A;  5I2M A;  3JB9 H;  4C8Q B;  3CPF A;  2VV5 A;  1WJQ A;  4GY5 A;  3QII A;  4IUQ A;  3JB9 I;  1KG1 A;  1BIA A;  1EIF A;  3LGL A;  2NLU A;  1HK9 A;  3DB3 A;  4OB1 B;  4M77 E;  3J7A F;  3J81 E;  1M1G A;  2GQV A;  2O4X B;  2RJE A;  1G3W A;  4LDU A;  2MF2 A;  4FT2 A;  4HKE A;  4EDU A;  4A4K A;  3M4G A;  2DXC B;  2QEX T;  2K5I A;  4BD3 A;  1QP2 A;  2LQK A;  4C8Q C;  2D9T A;  5GAM j;  3C94 A;  4XTU A;  4J6X A;  2OTL A;  2ZPH B;  2YHT A;  3OYH A;  4E7H A;  1HXD A;  1VQ8 A;  2E65 A;  3G7Z A;  1D3B A;  1M9S A;  4MMK A;  1Q7Y C;  4M7D B;  3HL8 A;  1G5V A;  2VXE A;  4JRQ A;  4HCC A;  2QQS A;  2PVO B;  3H4C A;  3LWH A;  2E64 A;  3CXC S;  1I5L A;  3A8G B;  4M7D D;  3TCJ A;  4J5Y A;  4HT8 A;  2RI2 A;  4L5G A;  3QHS A;  3EAE A;  5IN1 A;  3S6W A;  3CCL T;  2KMG A;  3OYI A;  1VQ8 T;  4ZGE B;  2K57 A;  3UT1 A;  4M7A C;  1I8F A;  3CCM T;  4HNU A;  3M55 A;  3MP6 A;  4BE1 A;  3HRU A;  4M78 E;  3UPU A;  4FT4 A;  1GXI E;  1IRE B;  1Q81 U;  1VQN A;  4M78 D;  3CC4 A;  4LDY A;  4RG2 A;  3FJP A;  5GAN e;  3AHU A;  2M16 A;  4M75 B;  3JCM V;  3PMI A;  2P4T A;  4A4F A;  4M78 G;  3NTK A;  5I2S A;  2LC4 A;  3RUX A;  3CCV A;  3ME9 A;  4KUL A;  4XU1 A;  4KT0 E;  1Q82 C;  2XHC A;  2LQ8 A;  2WSF E;  4UC4 A;  5LJ3 j;  5CKD A;  4M75 F;  1VQM T;  3C95 A;  2ZGW A;  4DOW A;  2HAX A;  4M7D E;  2LVM A;  4M78 A;  2ZPF B;  2XDD A;  3OYM A;  1Y96 B;  4PJO E;  2HQE A;  4X34 A;  5FU6 B;  5GAN g;  1N8R U;  4M75 C;  4ME7 A;  4JX5 A;  3JCM J;  1XOV A;  5J26 A;  1VQL A;  2CKK A;  1JJ2 S;  2DXT A;  3FEO A;  3KXT A;  2GFU A;  4NOY A;  3DL1 A;  4HLQ A;  2AHJ B;  2KQW A;  2E70 A;  1QLB A;  3PMT A;  2MMP A;  4HCZ A;  2EIF A;  4TVR A;  5EG2 A;  1FKM A;  5GAM g;  4VUB A;  2XK0 A;  1Q86 C;  4LOC A;  5GAN 3;  4C5E A;  1I4K 1;  1LOJ A;  5GAO q;  1PSF A;  2LCL A;  2MWO A;  2QQR A;  5J3B A;  1FX7 A;  4B9X A;  3OYA A;  1KC8 C;  1YI2 A;  2PU9 B;  2JVV A;  3P8D A;  2JTM A;  3I55 T;  2F69 A;  1BYM A;  2ZPG B;  2WJ9 A;  4ZGD B;  1YJ9 A;  4QVZ A;  1KQS A;  1KHI A;  2QFZ A;  2PVD B;  4BBR M;  5CO7 A;  2RO0 A;  3PIP A;  3CCR T;  3DB4 A;  3V8L A;  2QQB A;  3S3N A;  2HNI A;  3BG3 A;  5FLX E;  3J80 E;  4DQ2 A;  2D6F A;  4ZN3 A;  3CCJ T;  5CKB A;  1I81 A;  2IG0 A;  1VQ6 A;  4JS4 A;  1UGQ B;  2DPP B;  2FB7 A;  2K5L A;  2X4X A;  4XTW A;  4NL3 A;  2YLB A;  2JZ2 A;  1VQO A;  2EQM A;  4NS5 A;  3V7C A;  2IVW A;  1BI2 A;  4ELY C;  4J83 A;  5C6S A;  2RJD A;  5FRM A;  4XU0 A;  3S3O A;  1M1K C;  4OGE A;  2E5Q A;  3A8L B;  4L59 A;  3CCR A;  3M57 A;  5HKC A;  5GMK e;  2PVG B;  1RL2 A;  4E7I A;  5GAO m;  1WQW A;  1FXX A;  2A3L A;  1VUB A;  5GAO n;  3CBP A;  4M7D A;  2BKD N;  1NJI U;  3JB9 G;  1V29 B;  3RER A;  1U8R A;  1YBY A;  1U1T A;  3V7R A;  4C92 D;  4IUT A;  1VQ5 T;  1Y7X A;  3MEA A;  2LDM A;  2RHY A;  2M0O A;  5GAN h;  3PT9 A;  1M1F A;  3FB9 A;  3LYI A;  3BDU A;  3BFM A;  3OS0 A;  3OS2 A;  3M54 A;  3FLG A;  4YTL A;  4BDY A;  1K8A U;  2LT4 A;  2QDJ A;  1VQ5 A;  5GAM e;  3M4Y A;  4IUR A;  2RK1 A;  1WNL A;  4FL6 A;  2E12 A;  4C0F A;  3QJY A;  1VIE A;  2O01 E;  3JSC A;  3LX7 A;  4IUV A;  1YJN T;  5CKF A;  3HRS A;  1M8V A;  3BW1 A;  3CBO A;  4M77 G;  2DK3 A;  3N5B B;  4PJO G;  4XK8 E;  3X25 B;  2X35 A;  4J8O A;  3KBG A;  4A53 A;  3LWI A;  2I2L A;  2DAQ A;  4GLK A;  4N0A C;  5CCA A;  4QQG A;  5LJ3 g;  2CZ6 B;  3OSV A;  4N4G A;  1QP3 A;  5LJ5 e;  2CZ1 B;  4P5N A;  5GAN 5;  3QO3 A;  4KBM B;  5GMK m;  4IKF A;  1Y71 A;  3URG A;  1W2B S;  2V8I A;  2DD5 A;  4JRK A;  2JOY A;  4KUI A;  4F7U A;  2EJG A;  2RJF A;  3F70 A;  3CCU A;  2D0Q B;  2ZZD B;  3X24 B;  2RHX A;  3CCJ A;  4E7L A;  1VQ9 A;  3CCL A;  3CME A;  4ZGJ B;  2FHD A;  2G3R A;  3CBM A;  3JCM e;  2DJZ A;  5LJ5 h;  3QZ9 B;  4XQ3 A;  1O75 A;  4RMO A;  3M53 A;  2MAM A;  3WVD B;  4M77 D;  3L2R A;  2DTI A;  3PGG A;  3L2U A;  3OBY A;  1YIT T;  1M90 U;  3JCM c;  2ZPI B;  4J6Y A;  3OYJ A;  2EYQ A;  3GPL A;  3E9F A;  4XTV A;  2QQ8 A;  2E1H A;  2KK4 A;  3RIR A;  3RKW A;  1UB4 A;  3V7S A;  3E9G A;  4MZT A;  3L2Z A;  3SDZ A;  4BI8 B;  4BUG A;  4FU6 A;  1VQ7 A;  4C92 C;  3JCM g;  1Q7Y U;  4PJO C;  1N9S A;  2O4X A;  4BAC A;  3OYB A;  2LX9 A;  4N4H A;  3OW2 A;  4AKG A;  2V8J A;  4M77 A;  2CS7 A;  3GLX A;  4C92 E;  4C92 F;  3QUI A;  2F5T X;  3UDC A;  5KH6 A;  3JAM E;  4EMK C;  1W2B A;  4MZM A;  2FVU A;  3BY7 A;  5CKH A;  2DXU A;  2F5K A;  3SFM A;  3CCS T;  4M78 B;  5GMK h;  1QVP A;  2MI6 A;  4X9C A;  3PFS A;  2GCX A;  3VUZ A;  5IAY A;  1NZ9 A;  4B9W A;  4C92 B;  5KE3 A;  3A8M B;  1WJR A;  5DLO A;  3CXC A;  3JCM W;  4LDX A;  3JCM Q;  1BKB A;  2RA2 A;  3A8O B;  5DY9 A;  3VYH B;  3JRZ A;  3M9Q A;  4EPC A;  4M78 C;  4M75 A;  1S72 T;  5DLQ E;  3GOX A;  4EMK B;  2CZ0 B;  2A7Y A;  1N6A A;  5GAO l;  3NTH A;  4JS5 A;  5FRN A;  2XID A;  3WXM B;  4NC6 A;  1UGS B;  3GNF B;  2K2V A;  3O8V A;  2DXB A;  5AYF A;  1YJW T;  3RMQ A;  4MDX A;  1YI2 T;  2WSE E;  2BS4 A;  3JCM P;  2DVE A;  5LJ3 e;  1XTD A;  3SWN A;  5LJ5 g;  3HHT B;  4MIM A;  1LJO A;  1N27 A;  4C8Q G;  1VIF A;  4A4E A;  4F7U E;  2OTJ T;  3TW6 A;  4QQ6 A;  2LT1 A;  5CK9 A;  2DTO A;  2Y4Y A;  3E19 A;  4MDW A;  3G4S A;  2L89 A;  3OSS C;  3I56 T;  3DKM A;  3PIO A;  4M77 B;  3RES A;  3OMC A;  1N9R A;  4C0G A;  4ZTF A;  5LJ5 f;  2GFA A;  1AHJ B;  2M9U A;  3VYG B;  1BI1 A;  1WQ7 A;  3I55 A;  4E7J A;  2DIG A;  4M7A A;  1WPY A;  2QQA A;  2RI3 A;  2K3Y A;  4Z02 A;  1BI3 A;  1KD1 U;  4JX6 A;  4M77 F;  5LL6 S;  4PJO F;  3WVE B;  2X4W A;  1VQL T;  3FRN A;  3MO8 A;  5GMK j;  1FWZ A;  1VQ7 T;  4ATO A;  3UWN A;  1Q82 U;  2R57 A;  2P0P A;  1BIB A;  1UEB A;  5KCH A;  2KR6 A;  5HK0 A;  1M90 C;  4A54 A;  3M5A A;  5FRO A;  2ZCF B;  1VQP A;  1U1S A;  1VQO T;  3QWL A;  3TW7 A;  3BDL A;  3INZ A;  4PNO A;  5CAI A;  1K73 U;  2DXB B;  1IZ6 A;  4JLG A;  3CMA T;  2XDB A;  2VYT A;  5DM7 R;  3C4S A;  2QXF A;  2DO3 A;  1ZBX A;  2XKO C;  2QEX A;  3CEY A;  4EMK A;  5GAN 7;  2WSC E;  3CCM A;  4JX4 A;  5KE2 A;  2R58 A;  2LNV A;  1KQS S;  3CCE T;  3V8K A;  4N4I A;  3QSU A;  3QG1 A;  3OYF A;  3MEU A;  1VQN T;  1S72 A;  2BIV A;  3QYE A;  4J7I A;  2M1H A;  3PTA A;  4HA8 A;  4C92 A;  4BE2 A;  1VQP T;  1K9M U;  3KHI A;  2EJF A;  2ZPB B;  3TEE A;  5FU7 B;  4MFE A;  5A0L A;  3CC7 T;  4XTZ A;  5A0D A;  1MGQ A;  2CGH A;  3SD4 A;  1OZ2 A;  4A4H A;  4BI4 A;  3EFR A;  1YHQ A;  1KQ2 A;  3OYD A;  2DZC A;  4M77 C;  2XD0 A;  1MHN A;  2FL7 A;  3G4S T;  3CCQ A;  3Q1J A;  5L8R E;  4JJN K;  3M56 A;  3M59 A;  4M7D C;  4XU2 A;  1D3B B;  1G3Y A;  3DLM A;  4PKC C;  5CQY A;  1ZHI A;  1OZ3 A;  3QPH A;  4BY6 C;  4QSH A;  4ELZ C;  1NPP A;  3LLR A;  1BI0 A;  2R5M A;  4C5I A;  2VUB A;  5GAN j;  3P8H A;  1DJ7 B;  2EKO A;  3GP8 A;  2X4J A;  2YRV A;  3JB9 J;  1VQK T;  2DXC A;  3GNG A;  4N0A A;  1E7P A;  4CRI A;  2DD4 B;  2CZ7 B;  1G3S A;  4M7A G;  2QTX A;  4MZP A;  1X01 A;  4LDW A;  4C5H A;  4M7A B;  3HFO A;  3MCA B;  3VYG A;  4QVC A;  3G71 T;  4PJO D;  4AKH A;  1KQ1 A;  5GAN f;  3MHX A;  2E10 A;  3OS1 A;  4HNT A;  3BG9 A;  4M6V A;  4C8Q A;  5FU6 C;  3OW2 S;  4M7A F;  3QKJ A;  4M7A E;  5KCO A;  5J39 A;  4JRI A;  1M1K U;  4AI6 A;  1YJ9 T;  4QVD A;  3FC3 A;  4BDZ A;  5GAM f;  5A2Q E;  4OF1 A;  2PUK B;  4IUU A;  2VC8 A;  3PNW C;  2HBP A;  4NL2 A;  3BG5 A;  1JB0 E;  2QF7 A;  5GAN 6;  2EFI A;  4RCC A;  3JCM X;  2DKG A;  3HO8 A;  3JB9 D;  3QYH B;  4M75 G;  3ZFJ A;  3KUF A;  2XU8 A;  1VQ4 T;  2BUD A;  3EFS A;  5CIU A;  3V8J A;  5LJ3 h;  3P8B B;  3OYK A;  2HQX A;  4BY6 B;  1JBM A;  1H64 1;  2EJ9 A;  2QA4 T;  4XTY A;  1WGS A;  1YCY A;  3CC7 A;  2E41 A;  3OS5 A;  4HNV A;  1JRI A;  1XNI A;  3OYY A;  4A4G A;  1KC8 U;  1KHC A;  2EAY A;  3H8Z A;  3QYB A;  1B34 A;  5GAN 2;  1B34 B;  2DIQ A;  2Y90 A;  3L1A A;  3CCV T;  3ASK A;  5CVI A;  4WF2 A;  5D6W A;  1M4Z A;  4C5G A;  3HRT A;  3G71 A;  1VQM A;  3VJP A;  5CKE A;  3NTI A;  4HCB A;  3MET A;  4C0D B;  1VQ6 T;  3CCE A;  1LNX A;  4HL4 A;  3VUB A;  5GAN d;  2YLC A;  1NE8 A;  3A5Z B;  4QQD A;  3HZJ A;  1ZQ1 A;  4R56 A;  4Z6Y A;  2RJC A;  1XQH A;  3CPW S;  3OYC A;  3CCS A;  2KMT A;  1G3T A;  2ZZD A;  4Q5W A;  4QW2 A;  4J6W A;  3FDR A;  2QQ9 A;  2RHU A;  4BE0 A;  4BI3 A;  2EWN A;  5C0M A;  4KUD K;  2E6Z A;  4M7A D;  3CC2 A;  3OMG A;  3LW5 E;  3JCM h;  2WAC A;  3X26 B;  2DZ9 A;  2RM4 A;  3MEV A;  3X28 B;  3MEW A;  2JNG A;  3SWN C;  3HP9 A;  3C12 A;  4ZN1 A;  3G6E T;  1K8A C;  2R5A A;  3MP1 A;  1VQ9 T;  3HBL A;  1WJS A;  4LDV A;  2V8K A;  3JCM b;  2RK2 A;  2Y4X A;  4JRP A;  3JB9 F;  2EQU A;  2HD0 A;  3HPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...