3A8MB

Crystal structure of nitrile hydratase mutant y72f complexed with trimethylacetonitrile
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPFYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 57
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8mB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8mB02
2D0QB 2DD5B 4ZGDB 1UGRB 3A8GB 2DXBB 2WSFE 3VYGB 2DD4A 3WVEB 4XK8E 2PUOB 3A8HB 2DPPB 3VYHB 1AHJB 2ZPFB 1UGSB 2DXCB 1V29B 2ZZDA 3A8MB 3WVDB 2CZ1B 5L8RE 2CZ7B 2WSCE 3X20B 3LW5E 3QYGB 1UGPB 2ZPIB 4OB2B 4L6V5 2PVOB 2ZPEB 1DJ7B 1PSFA 2CYZB 2DD4B 4ZGJB 3A8OB 4Y28E 4ZGEB 2DD5A 2DXBA 2ZCFB 4RKUE 3QYHB 4OB0B 3QZ9B 3QXEB 3X25B 1GXIE 1QP2A 2CZ6B 2WSEE 2ZZDB 2ZPBB 3A8LB 2AHJB 4KT0E 2O01E 4OB3B 1JB0E 3X28B 2PU9B 4OB1B 3HHTB 2CZ0B 2QDYB 1QP3A 3QZ5B 2PVDB 2DXCA 1PSEA 2PUKB 4FM4B 1UGQB 2ZPHB 3VYGA 2ZPGB 2PVGB 3X24B 1IREB 3X26B
chains in the Genus database with same CATH superfamily
3CXCP 1IGUA 4M77G 4DBHA 1AWOA 3VKGA 2QF7A 1M90R 2KEAA 4FT4A 2W96A 4II1A 4ZGDB 1M9SA 2E1HA 3RNJA 2KRMA 5A0LA 2C4GB 5FRNA 1RL2A 4M7AF 3JV3A 4LOCA 2XDPA 1WQ7A 2YXYA 5LJ5f 1B7TA 1N9RA 2A36A 5GANd 1YBYA 4OMQA 5DY9A 4L5GA 4J9IA 3CCLA 1K0XA 4E7KA 4PL6A 3CPWA 4J9FA 4F70B 1EX4A 2ZAEA 1BIAA 3QWLA 2KT1A 1JSUB 2VASA 2KNBB 5CK9A 1RABB 3JB9D 1KJWA 3VJPA 1XJWB 2HCKA 2WSCE 1YJWA 3LW5E 4DQ2A 1VQ7A 3V8KA 4N4HA 4HVVA 2HAXA 3MP1A 4OMMA 3L2QA 2DXUA 2Y4YA 4BXXX 1NLPC 3CCEA 2W9FA 1QW1A 3G6EQ 1YIJA 4KUIA 4LDXA 2GQIA 2VUBA 3EHQA 4FYXB 2RD1A 5KYYB 1Q7YR 4HVWA 3JRZA 4MZPA 3M53A 4CXAB 1M8VA 2EQIA 1U06A 4PJNA 1QP2A 2MCNA 3I55T 3FIFA 5GAMf 3JB9J 3QIIA 2FYKA 5J3BA 3ME9A 4BI4A 1OULA 1FMVA 1K9MR 1VYTA 1F5QB 4KUDK 2E6ZA 2HKQB 2DTHA 2F2WA 1UTIA 3V7CA 2PHGA 3G71T 1FWZA 1E6HA 1H8KA 4XU3A 5CR2A 4EOMB 5IXBA 1Y71A 3THKA 2WPAB 3TNHB 2D8HA 4PJLA 4C0DB 3PIOA 4VUBA 1TD6A 1FXXA 3RMQA 4QSHA 2JM9A 1VQ8Q 1WZOA 3O8VA 4WCIA 4MFDA 2JNGA 2HKNA 4EOSB 4DEXA 4FU6A 3I5SA 4GLMA 2AIRB 4YC3B 3A1PA 2DPPB 4P5NA 4JX4A 5KYYA 2C6TB 4O6JA 5GAOn 4M77D 4X9CA 1H1RB 2K7AA 4PJOG 2JOYA 3VV0A 2K5IA 1UGVA 3E9GA 4LDVA 3DDQB 4FX3B 3CCVA 4F7JB 2K2MA 4OMPA 9ATCB 4RODA 5CKHA 4DEYA 2FRYA 1O9SA 3C4SA 1OX8A 1OGUB 2VKNA 1UHFA 1SF9A 1FMKA 2CYZB 2GQVA 2XK0A 1BYMA 3QDFA 2BTTA 2YUQA 2DD4B 4CFUD 2JMCA 4FCYA 1VQLQ 1YJNA 2OTJQ 4EONB 3CC7T 3TREA 2CH4A 4F7LB 2F5KA 1Q7YU 2QQRA 3G6ET 3TSWA 1UJYA 1I5LA 1X75C 3Q1JA 4E7LA 1ZUKA 4YOZA 1MMAA 1E7OA 2DEQA 3UT1A 3JCMQ 2DJQA 4NL2A 4N0AA 2QYZA 3MCAB 5KYXA 2KE9A 4BCNB 3QHSA 4M77C 3MIAB 1U3OA 2JUFA 1PWTA 2QQSA 3N5BB 1AD6A 2BS3A 1VQPT 2LCCA 3TSZA 1K9MU 4EDUA 2KQWA 2ROTA 2QDYB 1W6XA 3RMSA 4BCJB 2DLPA 2ENMA 1ZBJA 3R6OA 1YITA 5GAOq 2RJDA 3RGFB 2LNHB 3H41A 3MEAA 2ZPGB 1QVFS 4Y92A 2OTLA 5I5ZB 5KYWB 2VC8A 4M75G 3OYBA 3REBB 3MP6A 2X4YA 1YJ9A 1FX7A 3P8BB 4C92F 5J39A 1T3LA 3CD6Q 4EMGA 3OYAA 3CCMQ 2DD4A 1TTHB 2K79A 4M7DG 3OBWA 4IIMA 4A54A 3SFMA 2EKOA 3P8HA 3HFNA 4WTOB 5A0GA 3OW2A 3BG5A 2ZPFB 1K76A 4RTTA 1PCXA 1E6GA 1WXTA 3H4CA 4XTYA 2CREA 2QEXQ 3RUXA 1WIEA 4KULA 3A8MB 3WVDB 2L3SA 2B86A 3NGPA 2PK9B 3GP8A 1K8AU 2DTOA 4JJDA 2XIDA 3ZFJA 4F7UG 1VQ4Q 4Y91A 2G77A 2EYWA 1RAAB 2E5KA 4E7HA 1PD0A 4BCGB 2XU8A 4A4FA 3OQ5A 2MOXA 4PJOD 4JX5A 2HMAA 2DEUA 1ZUUA 4OMFB 2BS2A 3V8LA 3CPWS 5KYWA 5IHYA 4D6WA 4BBSM 4M78B 3VKHA 1VQKQ 2GFAA 3JCMb 1VQLT 3G4SQ 1ZUYA 2OTJT 4PK4A 4A63B 2O9SA 1K9AA 4A4EA 2XG8D 1A0NB 1SSFA 4BCFB 3CCRT 1X6OA 1VQ7Q 5IHNA 1VOMA 4BUGA 3JCMW 4XU0A 5ICPB 1PRLC 4HKEA 1BI3A 1JEGA 2K57A 3S6WA 1K73C 1MV3A 4M77F 2KXCA 1CKBA 2DYIA 1KD1C 2W99A 2DRMA 4J5YA 2CDTA 1WJQA 4OMOA 3G1JA 2CP5A 2PMIB 1BCMA 1M3BA 3EGUA 5CQYA 1X6GA 2HEQA 1NPPA 2K5FA 3RKXA 4PJOC 1H25B 1TSFA 4RTVA 3OYJA 3HPWA 1VQOA 2V26A 3CBPA 3HSBA 3G7ZA 5GANj 4FW2A 3QWYA 2F5TX 4OMNA 4DOWA 4DBQA 1VQMQ 4AG2C 1G2BA 1Q86U 3JSCA 4IURA 2XMFA 3M0SA 2AKKA 3AT1B 4IUUA 1SSHA 1TUGB 3EHRA 3CD6T 3FLGA 4M78A 2YUNA 1XQHA 2KMGA 1RAIB 4M75D 2LNVA 2KGTA 1Y96B 3QWXX 3PIPA 1NJIC 1G83A 1PG5B 2L3RA 1Q82R 2JTMA 2CZ7B 1LCKA 2QEXT 5GAN3 4M7DD 1SRLA 3QYGB 1NG2A 1VQ9A 4M7AE 1HK9A 2SRCA 4QQ6A 3M4GA 2BZ8A 2DL4A 3FJ5A 5FU7C 2H3JA 3QYBA 2JZ2A 2X4WA 4JUVA 1VQ4T 4E47A 4EC8B 4EPCA 4J6WA 3A8OB 4BI3A 5LJ5g 2JS2A 4KBMB 4F6WB 1BI1A 3M57A 1AWXA 2VYTA 2X3WD 4BACA 2JMAA 3QJ6A 1U8RA 2WEVB 5LQFB 2EGAA 4GLKA 3OYFA 3QZ9B 4MZMA 1VQKT 1GXIE 4A4KA 4A4HA 3G4ST 4M75C 3CXCA 4JLIA 1KK7A 2DL7A 2KYBA 4ORZA 1VQ7T 1IB8A 2YSQA 1Y57A 5FU6C 4ANJA 1QKWA 3M59A 4MMKA 1R77A 1M3CA 2E4HA 1YJNQ 1Y96A 2QAZA 4XTWA 4CC3A 5LMKB 1M30A 2LQ8A 1UNLD 2J06A 4JX6A 4PNOA 3CEYA 3FEOA 3VYGA 3HP9A 4PFOA 4F7NB 1I0CA 2ED0A 1LJOA 3VS6A 2F2VA 3LWIA 2ECZA 2GTJA 2V1QA 4J9DA 3OS1A 1M1KR 1BCOA 1LVKA 1ARKA 4AFUC 2YRVA 4PJOF 3V8JA 4XU1A 4EORB 4JPBW 4BI8B 1M3AA 2M1HA 2X35A 1SEMA 2E10A 4XK8E 2CS7A 1VQMT 4KH0B 2YUOA 1D0YA 3I56A 5HCKA 4HA8A 3BG3A 2X9HA 4M7AC 3JCMh 2OTLQ 1WHGA 1M2VB 1Q82U 4EMHA 5KCOA 1Q81C 5FU6B 3U23A 4C5GA 3MEVA 2KR3A 4G6LB 4CFVB 1VQNA 1I4K1 3NPFA 3CBMA 4BY6C 2LCLA 4NS5A 2DXTA 3AHUA 2GF7A 2A7YA 5CEIB 2CP2A 2V22B 5KE2A 2COWA 2VGNA 2FHDA 1NBEB 3UDCA 1OOTA 3OW2S 4ZGJB 2L89A 1I07A 4Y28E 3OS0A 1OI9B 2LW4A 1PKDB 1M4ZA 3M56A 4BCHB 3CMEA 1VYUA 4J8OA 3JB9I 4HCCA 3CCJA 5CQXA 3WXMB 2FVUA 5FRMA 3TNWB 4JS4A 1I81A 1OKWB 2CUDA 2L0AA 4ZTJA 2L3PA 2M51A 2ZZDB 3LQ5B 3O0GD 2EQUA 4M7AB 1LPLA 2EVRA 5CKBA 1AZEA 2CSIA 2DF6A 1HXDA 4V2SA 5LJ5h 3BHTB 3UA6A 4M75F 4FYYB 3QDRB 1KSWA 1M2VA 4HT8A 2XDBA 5IN1A 1D1AA 1YJNT 4M7DF 2PVGB 3HRSA 5CCAA 2KVQG 1M1KU 2I40B 2SEMA 4J9EA 2AK5A 1WHLA 3PMIA 2DXBB 3QHRB 5CO7A 1WX6A 4EMKA 2D6FA 3F70A 2EYXA 3HRTA 2K9GA 2M02A 1G3TA 2WMBB 2EYZA 3VKIA 4HT9A 1GRIA 1RAGB 2RHYA 4C8QE 4FW1A 2FRWA 2C0OA 3PE0A 2LJ1A 5GANf 4F7UF 3S3MA 4RTUA 1G5VA 2DO3A 3PFSA 3M9QA 2DAQA 2W0ZA 2IW8B 2YLBA 2RMOA 3KFVA 2A28A 2ZZDA 3JCMc 3SEMA 1H4LD 2HSPA 1BIBA 5DQVA 3TU4K 3DJBA 2OTLT 5C0MA 2IN3A 2RA2A 2P84A 5I2MA 3OSVA 4C92E 1UGPB 2UZDB 2RI5A 3OYHA 4L6V5 5IH2A 2RQVA 4JJCA 4OGEA 4HVUA 2PNIA 3CCSQ 2JXBA 3RR6A 4BDZA 1N8RC 3MEWA 1V1CA 2FZGB 4C5EA 4C8QD 1GFCA 1GUXB 1S72Q 2KK4A 3L42A 3BLHB 4JRKA 1F1BB 1YNZA 2C5OB 4NSTB 2DXBA 2ZCFB 2QI2A 4RTZA 3HB9A 1OX9A 1WI7A 3TW6A 4C92D 3CC7Q 3EG3A 1SHGA 5GAOm 3PT9A 1RLQC 5LJ5d 2C06A 1RUWA 3M0PA 3CCUA 2EWNA 4NL3A 4JRQA 4BBRM 3C0CA 4HXJA 4M78G 2PVDB 5CAIA 3GIBA 3META 4BCKB 4Z8AA 1QVGS 1I8FA 1QMCA 3EG9B 5HBJB 1UGQB 1D0XA 1IHWA 3NTIA 1VQPQ 2VWFA 5I2SA 4CFWB 1QMZB 3H0HA 1PHTA 4C8QC 3LX7A 4XTUA 1OIUB 3CXCS 3EG1A 5GAN5 1G3NC 8ATCB 4N0AC 4ROCA 2DRKA 2QXFA 2LZ6B 1GUXA 3L1AA 2ESWA 2EJGA 4M77E 4BE0A 1IRXA 3JCMX 2CSQA 2DMOA 2QQAA 3OMCA 4C92C 2JM8A 2R58A 1WLPB 3OYLA 2WIPB 3HZJA 4IMYB 4E2FB 1O9KB 2HBWA 3CPFA 3PMTA 2K5LA 1MNEA 1TFBA 1VQ6A 1VQOT 4OF1A 5GAN4 4PLLA 4N4IA 2I0NA 3JAME 4OB2B 2ZPEB 2VB6A 5IDPB 3BHUB 5HNBB 4HNTA 1XOVA 4HNVA 4AI6A 2RPNA 3EG9A 3ULRB 5EFQB 1HD3A 2NYSA 2ZGWA 3MI9B 3HFOA 3NFCA 1MNDA 1KHCA 3CC4A 3CCST 4DBRA 4II5B 4F16A 4PFPA 2KY9A 2RJCA 1N6AA 5CYIB 1VQNQ 4ZNXA 2GFUA 1UJ0A 1S72T 5LL6S 2RO0A 1K8AR 3E9FA 5AYFA 5GAOp 1M90C 3NMZC 3E2UA 3OYGA 4XQ3A 2YLCA 1R8OB 1S1NA 2QA4Q 3H9NA 4BCOB 1JQQA 4NC6A 1EIFA 2ABLA 1VQ9T 5GMKl 3OYYA 1YI2A 1QLYA 2P0KA 2P0PA 1I1JA 3QZ5B 1NEBA 3TVTA 3EAEA 3CCRQ 5I22A 2PZ1A 2UZEB 1X01A 3CCQQ 2CUBA 1KD1R 4AMCA 2ZPHB 1O9KA 1YHQA 1JJ2P 2DMEA 5CIUA 1MMNA 5KH6A 3E19A 1K1ZA 3X26B 2LX9A 2A3LA 2EAYA 2MI6A 3C94A 2KSSA 3M0UA 2DVJA 3INZA 4LD9K 2CP0A 3I35A 3TN8B 2KDSA 2RI2A 3DLMA 1OPKA 1WXUA 1C9BA 4C8QF 2X1NB 2RHZA 3KHIA 2YT6A 1JRIA 5LJ3f 4F17A 1JKWA 3RERA 1VYWB 3LLRA 4CFNB 4AT1B 3BG9A 1G3SA 1RI9A 1G3WA 2DBKA 1KIKA 3EOCB 3REAB 3LGFA 4Z88A 3CC2Q 1ZSZC 1NPRA 3EIDB 3M4YA 2DIQA 1NZ9A 2Y4XA 4AG1C 3B57A 5D6WA 2ATCB 1MGQA 1NJIR 3M54A 3M0TA 1B34B 3EFOB 2LQNA 1Q86R 4PJOE 1VUBA 4KGVB 3TNIB 2RF0A 1JO8A 5HVYB 4Z02A 1DJ7B 4MDXA 1UFFA 4M77B 1VQ5Q 1Z9ZA 1D1CA 2DZ9A 2FEIA 3HKSA 4LDWA 2DFUA 4BCMD 2NWMA 2X4XA 3PGGA 1G3YA 1WA7A 2LP5A 4LNPA 4LDUA 4X34A 1GCQC 2RQUA 3HBLA 5IT9E 1UEBA 4CC7A 3SB2A 3LGLA 2CZ6B 1Y7XA 1VQNT 2QTXA 4KT0E 2EGCA 2O01E 3CCLQ 2C0TA 4CFUB 2QDJA 3QSUA 5ACBA 2R7GA 2QA4T 2L5QA 1Y07A 1K73U 1WNLA 3RIRA 1PSEA 3HRUA 1KD1U 4FYWB 3J81E 2RHIA 4RG8A 1YJWQ 2RK1A 5GAOr 1B34A 2QASA 3EFOA 1JXMA 3CCQT 3CMAA 2QGFB 3POMA 3TCJA 2I53A 4UC4A 4OR5B 2WMAB 3OYKA 1KG1A 4F6SB 2IG0A 3MPUB 3A8GB 3I55A 3CCEQ 5DLOA 3K7AM 1YIJQ 1ZP2A 5IHIA 3GBQA 3CCUQ 1SRMA 1WGSA 4ESRA 1VINA 4M75E 5FLXE 1UNGD 1KC8C 1NEGA 3RDVA 4E7SA 4JJNK 2RHXA 4PLIA 3L2ZA 2KROA 2DE0X 2RJEA 1GBRA 2OJ2A 3JCMg 2D1XA 1W2BP 4M7DE 1GH6B 1NLOC 3GPLA 1NJIU 1UUEA 2GTOA 1GL5A 2NLUA 1KQSA 1WHKA 4FYVB 2LVMA 3DTOA 3CC2T 4OGRB 4AKIA 1D09B 3DLLA 4JS5A 3M5AA 1PC0A 3MHXA 1JXOA 3UPUA 3QKJA 4LD6A 1N9SA 1PSFA 4E7JA 2COYA 3CBOA 3L2VA 1W4SA 2LX7A 1OQKA 4F7UE 2J05A 3LYIA 5EG2A 1M1GA 1VQ5T 1G8XA 3ZEHA 3CQTA 2FG0A 2DTIA 2DETA 1ZX6A 4EOKB 4J7FA 1AZGB 2G3RA 7AT1B 5LJ5j 1NE8A 3M0QA 4M78F 1WJRA 4JRPA 2IW9B 2L8DA 2MYSA 1VQ6Q 2E12A 3SDZA 3S3OA 3VU3C 2QQ9A 1I5OB 4PJOB 2JT4A 2EGEA 3BE3A 3EFRA 1T0HA 1M5Q1 3QBYA 4QKUA 3HHTB 2E6NA 2GGRA 3O5ZA 1QP3A 1AISB 4M6VA 3CCLT 3QYEA 2ROLA 3RKYA 3CCVQ 1N27A 1B07A 4K11A 3JCMe 4MMLA 3M58A 5L23A 5ECAA 4F6UB 2G6FX 3JCMJ 3OY9A 2BKZB 4F14A 1QLBA 1YJWT 2A08A 4BCPB 1UGRB 4HNUA 1OYXA 2DA9A 1BU1A 4N4GA 5HQ0B 2WSFE 1H24B 3M03A 1TUCA 2OAUA 2FZKB 1Z9QA 1QCNA 4M7DC 3FJPA 3R6NA 2DL3A 1WQWA 3J80E 3CCET 1H3HA 1YIJT 2P0QA 1LOJA 3CCUT 2LJ3A 2O88A 4A53A 5FU7B 1M1FA 1WDXA 3VS2A 1BI2A 4IUVA 2FO0A 1URCB 4JZ3A 3BLRB 4BCQD 1Q81U 5FW9A 2DM1A 3SWNC 3PO3S 3VS5A 4ME7A 2MWPA 5FROA 3VS4A 4MZTA 5D6XA 3VS7A 1J3TA 1YITQ 5LJ5e 5DM7R 5GAMg 4JRIA 2GCXA 1CSKA 2KYMA 2L2PA 4M75B 3GOXA 1VQ8A 4KH1B 2HNIA 3DB3A 4IUPA 2DVEA 1LNXA 4X9DA 2KI7A 4F04B 1ABOA 5FWCA 3L2WA 1R0CB 3C95A 3EGXB 1YJ9Q 2CKKA 3BFMA 4M7DB 1KQ1A 4OB0B 2WSEE 4R0KA 2E64A 4WF2A 2RN8A 2EKHA 2PQWA 2F1LA 3D7SB 1YCSB 1JSTB 3GTMS 2YDLA 1VQ6T 3E1SA 1MV0B 4L59A 4BB7A 3JB9G 1T3SA 2PJQA 2KMTA 1KQSP 4EOJB 1KQ2A 2C0IA 2RNAA 2VXFA 4RTWA 3UF4A 5FWBA 1XNIA 4F7UB 1OL1B 1OU9A 1PRMC 4IUTA 4FSSA 2MMPA 5A0DA 4KRCB 1FKMA 2L3QA 3CCVT 1VQLA 2D0QB 1Q82C 2OTJA 1JBMA 2XKOC 2HDAA 1KHIA 4FL6A 2RB6A 2W2HA 4DA4A 2KXDA 3DOGB 2JTEA 4ROEA 2LDMA 2CGHA 5GAMe 4AFZC 4Q5WA 2EJFA 4JDSA 1NYGA 3VUBA 5IXFA 2NUPB 4F7SB 2M9UA 4BY6B 1U1TA 5CKEA 3FRNA 3EGXA 3A8HB 2NUTB 1YI2T 1YN8A 2CH4W 3ZBDA 3PVQA 4B9XA 1SG5A 2MK5A 3TEEA 3CMAQ 1IGQA 2VXEA 2QDLA 1Q95G 4AKHA 2RM4A 2CP6A 4OVAA 2VV5A 5DQWA 3PTAA 2V8JA 6AT1B 2KRSA 1X6BA 4E7ZA 1SKUB 1WHJA 3A98A 4QQDA 4F7UA 3OYIA 3JCMd 3CD6A 2P4RA 1QCFA 1YITT 3CCMA 1ZA2B 1ENWA 2JS0A 3OS5A 1VA7A 1VQOQ 1QVGP 4C5HA 5LJ3g 1QWFA 4GY5A 4M7AA 2QGSA 4MDWA 4RMOA 1VOLA 3BY7A 1RACB 4C5IA 2R5MA 1PKSA 2EUFA 1MMDA 3BLQB 3P8DA 1JJ2A 1ZHIA 2RQWA 1YJ9T 2QEXA 2KR6A 2NUPA 1M1KC 5GAMh 2ZPBB 2LQKA 2BS4A 1UNHD 1C6VX 4PFZA 1N4MA 1QCOA 2NUTA 4XTVA 4KGXB 2EQJA 1XTDA 2CZ0B 2GBQA 1VQ4A 1MUZA 2LJ0A 3LH0A 4KGZB 4IKFA 2BPMB 2PUKB 4FM4B 2GNCA 3BDUA 1H92A 2JTFA 1YWOA 1E9HB 4KRDB 2CT3A 1PD1A 3X24B 1VQ9Q 1C0MA 2COZA 2EJ9A 4UN0A 2QQBA 4ELYC 2UZBB 1GY3B 4Z6YA 1H1PB 1PM3A 2JW4A 1VQKA 4DOVA 2DBMA 3G4SA 3UA7A 2D9TA 5HY6A 1AWWA 3OSSC 3RKWA 5KCHA 5EJCA 2OI3A 2QGGA 2DX1A 2J6KA 4JLGA 4BE2A 2EQKA 1X43A 2OX7A 2PUOB 3GNFB 2KRNA 4J9CA 5LJ3e 1OPLA 1WJSA 5D6YA 1FVVB 3SHWA 4C0DC 5GMKh 5D7UA 4BY7X 4BY1X 4HCZA 4C0GA 4AFSC 1RI0A 2RJFA 1BK2A 2IIMA 3OMGA 4ZN3A 3JCMV 3H0FA 4OMLA 1W1FA 3X20B 1UECA 2AZSA 3IQLA 3PVLA 2H8HA 2EFIA 1X27A 2DL8A 2O4XB 2D0NA 3CMAT 2LCSA 4QVZA 1YCYA 2QK0A 1FYNA 2PVOB 2B9RA 2MAMA 2MF2A 1OU8A 4BCND 3T9NA 5CVIA 3C12A 2KAFA 4LDYA 1EFNA 2F69A 1VQMA 4GBQA 4CC2A 4D8KA 2DERA 2D8JA 4IIOA 1ZLMA 4C0ZA 4BDYA 2CT4A 4EOPB 2LC4A 4RTXA 2BZXA 5I11A 3M0RA 5IAYA 3JCMP 2W10A 1TOVA 4KRTA 1UHCA 4CFMB 5GAMd 4A4GA 1M90U 2KT8A 4Y72B 3EG2A 4XTZA 3OYNA 4YOOA 1H26B 2CP3A 4C8QB 3I56Q 3X28B 1MMGA 5LJ3h 1ACMB 1OEBA 3RESA 5KYXB 1AEYA 2PK2A 1QVFP 1QQJA 2JGZB 2C5NB 1TS9A 4EOOB 2R5AA 3H6ZA 3HL8A 4ELLA 2O4XA 3H0IA 5HK0A 2HL5C 2DYBA 1C1AA 4M78E 1K0SA 4C92B 1W2BA 2V1RA 3OYEA 1UB4A 4R55A 4PJJA 5J26A 3MY1B 3ASKA 4BCIB 3QHWB 2K3BA 1W70A 3MP8A 2AKLA 2EYQA 3EGDB 1K73R 1RLPC 1FMWA 4EIKA 1U5SA 1D3UB 3CMEQ 3ZL7C 1AHJB 4TTHA 3CCJQ 1X2KA 1KC8R 1WYXA 1ABQA 3NDQA 2VGMA 3NTHA 1GCPA 1OL2B 2Z0WA 4J83A 3JB9H 1X2QA 1BBZA 4XU2A 3QG1A 1BKBA 4M78D 4YTLA 4C8QA 2A37A 4LUEA 2HQXA 4TVRA 2B8AA 4ZTFA 1NM7A 2DL5A 5BNJB 2WFYB 1W98B 3CPWP 4ELJA 5KE3A 1AT1B 2RHUA 2HZYA 4XTXA 2V8KA 2OAWA 2DNUA 4LXCA 3OYMA 1T0JA 4JJBA 1H641 2P4TA 1Q7YC 4C92A 3UATA 4R56A 1GFDA 2ED1A 4EOLB 5CKFA 5HK3A 2PTKA 1EZZB 1ZQ1A 3JB9F 1WXBA 1TU0B 4J6XA 4FSXA 2C5VB 1BI0A 1UG1A 1H28B 1KFZA 3EGDA 2MWOA 3A8LB 1FINB 1CKAA 2AT1B 1K9MC 1M27C 1KXUA 5HKCA 4HLQA 1Y0MA 5LJ3d 2K2VA 1YWPA 2DJZA 4M78C 1RAEB 1OKVB 3OS2A 1YP5A 3MY5B 3DB4A 3I56T 2HSEB 3OYDA 3KUFA 1VQ8T 2QG9B 4CI0C 1XO2A 1WHHA 2O9VA 2WIHB 5GMKi 2EBPA 2J6FA 4LN2A 1B3QA 2RH2A 4OGCA 1YFNA 2KBTA 1JJ2S 2WJ9A 2DD5B 1QWEA 3GLXA 1ZSZB 3I5RA 5GAN7 4IUQA 3VS1A 4D8DA 2R57A 2FPFA 1JOWA 2JVVA 1H1QB 3VRYA 5KYNA 3WVEB 1O75A 1KC8U 3VYHB 1RADB 3FDRA 2UZLB 2WHBB 2E3HA 2M0YA 4RTYA 4M7AG 1UGSB 3CMET 1MHNA 4QQGA 3OYCA 3CCJT 5HBHB 2IVXA 2DKGA 2F2XA 3NHNA 3L2RA 5L8RE 4XAXB 4PKCC 4M77A 1K8AC 2AZVA 3SD4A 5GMKm 1D3BB 5AT1B 2F2CA 5C6SA 2X51A 4RG2A 1WFWA 3EJ1B 1UE9A 2E5QA 2DK3A 2YRCA 3BW1A 4RUGA 3EG0A 2M16A 1HSQA 3HO8A 3G71A 3LWHA 2MPXC 1TUDA 1OZ3A 1IHVA 4LUDA 2X4JA 3MO8A 2DD5A 2QTVA 5I21A 1TXQA 1Q81R 1ZSZA 5A2QE 1H1SB 1HJDA 1BB9A 3BDLA 3RBBB 3GNGA 1X69A 1P92A 3KBGA 4BD3A 5CKDA 5IDNB 4ELZC 2CCHB 1JU5C 3DKMA 3VRZA 5HBEB 1TH7A 1OV3A 3J7AF 2FZCB 1WPYA 4BCMB 2NUZA 4LE9A 2O2OA 4RCCA 2K3YA 2LT4A 3EH1A 5L2WB 2I2LA 5GANg 3CCMT 3CCSA 2RK2A 4J9BA 2E70A 2EPDA 1D3BA 4AKGA 3QPHA 2EIFA 1IREB 2ZPIB 2CP7A 3H8ZA 4E7IA 1K4US 1D1BA 1GCQA 1S72A 2HQHA 5EC7A 2HD0A 4AFQC 5IF1B 4CFXB 1D0ZA 4NOYA 3S3NA 1Q86C 3TQ7P 2BKDN 4BE1A 1IXDA 4CRLB 3VYGB 2EYYA 3NTKA 3CC4Q 4HCBA 5GAN6 2LQWA 2RQTA 5GAN2 4JZ4A 2E3IA 2W9ZA 3CC7A 2FB7A 1VIFA 4O5VA 2XD0A 2K3XA 3G6EA 1P5EB 2DXCB 1V29B 1RAFB 4QW2A 2HL3A 2YRDA 1OZ2A 1QVGA 4ZN1A 2CZ1B 3QJYA 1W2BS 4CC4B 1YI2Q 1SHFA 2WACA 5GJVB 1VQPA 1N5ZA 2YHTA 4HL4A 1M8MA 5GJWB 1AVZC 8AT1B 3M55A 2K6DA 3OW2P 4YOSA 1U1SA 1YHQQ 2HBPA 3EH2A 4M7AD 4RCBA 1H27B 2HQEA 3EFSA 1IO6A 2QFZA 5GANe 3ER0A 5KYUB 5FGKB 2XICA 5GAMj 1QKXA 3DDPB 4ZGEB 3PNWC 4PJOA 3G33B 3I9QA 2LMJA 1GBQA 1R0BG 1H3ZA 3QYHB 4EOIB 1UDLA 5DLQE 1ZA1B 2BUDA 4EMKC 1WHMA 1AOJA 2AHJB 4OB3B 2IPOB 2C5XB 4QVCA 2DIGA 1VIEA 1IZ6A 2FPEA 3GF5A 4Z89A 1N8RR 2FPDA 2X3XD 2DXCA 2LRQA 2LT1A 2XDDA 2BE9B 2IVWA 4MIMA 2G9XB 2CCIB 1TWBA 2K4YA 3UWNA 2M0OA 2CJMB 1PKTA 3L2UA 4FIBA 3LH5A 2A0FB 4C8QG 4EOQB 4OP0A 2BE7D 2RQRA 1HYOA 5IHKA 1OI1A 2H3EB 2QQ8A 4I3ZB 1V76A 5GMKj 4B9WA 5KYUA 3DL1A 3SWNB 2QA4A 2RI3A 2JN0A 4B6MA 5GANh 1AWJA 2YWWA 5GAOl 3V7RA 2WXVB 3KXTA 3CC4T 4EMKB 2JJ9A 5M9OA 4C92G 3A5ZB 2FL7A 4X1VA 1ZBXA 3MEUA 3OB9A 2UUEB 4DBFA 1AD5A 3QUIA 3CCRA 4ATOA 4M75A 3CCQA 3OBYA 2J6OA 2BIVA 2E65A 2Y90A 2BZYA 2IW6B 3HTRA 3QO3A 3BHVB 3TW7A 2XI9A 1VYVA 3OA6A 4M7DA 1QVPA 2E41A 4C0FA 1BU2A 4HCKA 1E7PA 2DILA 3VS0A 3JCMf 4BCQB 2YUPA 3MKDA 1TG0A 1YHQT 4J7IA 2XHCA 2MIOA 3I55Q 1NYFA 1QVFA 2J7IA 3MJXA 4RKUE 2V8IA 2DZCA 5LJ3j 3QXEB 3X25B 1RAHB 3VS3A 4EC9B 3F5XB 4E6RA 3SWNA 3CC2A 1M2OA 1PNJA 4M4ZA 4J9HA 2EQMA 4J9GA 4J6YA 1JB0E 1N8RU 2PU9B 4OB1B 2VVKA 1SPKA 2LTOA 5GAN8 3URGA 2EW3A 3G71Q 1ZSGA 3VUZA 4MFEA 2O31A 4QVDA 3FC3A 1OIYB 5GMKe 4FT2A 3FB9A 4QT7A 1KQSS 4PJMA 1VQ5A 3V7SA 4CRIA
chains in the Genus database with same CATH topology
4M78E 3CCQT 4C92B 3CMAA 4M77G 1W2BA 3VKGA 2QF7A 3TCJA 3OYEA 1UB4A 4FT4A 4R55A 4UC4A 3OS1A 4II1A 4ZGDB 3OYKA 1KG1A 2IG0A 5J26A 1M9SA 3A8GB 2E1HA 5A0LA 2YRVA 4PJOF 3ASKA 3I55A 5FRNA 1RL2A 4M7AF 5DLOA 4LOCA 3MP8A 2XDPA 1WQ7A 4XU1A 3V8JA 4BI8B 5LJ5f 2EYQA 2M1HA 2X35A 1N9RA 1WGSA 4M75E 2E10A 5FLXE 1YBYA 4XK8E 5DY9A 5GANd 2CS7A 4L5GA 1VQMT 1KC8C 3CCLA 4JJNK 1AHJB 2RHXA 4PLIA 4PL6A 3L2ZA 3CPWA 4E7KA 3I56A 4HA8A 2RJEA 3BG3A 1BIAA 4M7AC 2VGMA 3JCMh 3JCMg 3NTHA 3QWLA 4M7DE 1Q82U 4J83A 3GPLA 3JB9H 4EMHA 5KCOA 1Q81C 5CK9A 5FU6B 1NJIU 3JB9D 2NLUA 3VJPA 3MEVA 4C5GA 4XU2A 3QG1A 1KQSA 1I4K1 2WSCE 1VQNA 1BKBA 4M78D 1YJWA 3LW5E 4YTLA 3CBMA 4C8QA 4BY6C 2LCLA 2LVMA 4NS5A 2DXTA 2HQXA 3CC2T 4DQ2A 4AKIA 3DLLA 3AHUA 4JS5A 2GF7A 1VQ7A 3M5AA 2A7YA 4TVRA 2B8AA 3MHXA 4N4HA 3V8KA 2HAXA 4ZTFA 5KE2A 3MP1A 3QKJA 3UPUA 4LD6A 1N9SA 2VGNA 3L2QA 2DXUA 2Y4YA 1PSFA 4ELJA 2FHDA 5KE3A 4E7JA 2RHUA 3CBOA 3L2VA 1W4SA 4XTXA 3UDCA 3CCEA 3OW2S 1QW1A 2V8KA 1YIJA 4ZGJB 2L89A 4KUIA 4Y28E 4F7UE 3OS0A 3OYMA 1H641 3LYIA 5EG2A 2P4TA 4LDXA 1Q7YC 1M1GA 4C92A 4R56A 1M4ZA 2VUBA 1VQ5T 3M56A 5CKFA 3ZEHA 5HK3A 1ZQ1A 3CMEA 2DTIA 4J8OA 3JB9I 2RD1A 4HCCA 3JB9F 4J7FA 2G3RA 5CQXA 3WXMB 3CCJA 2FVUA 5FRMA 5LJ5j 1NE8A 3JRZA 4M78F 1WJRA 3M53A 4J6XA 4MZPA 4JRPA 4FSXA 2L8DA 1BI0A 4JS4A 2E12A 1I81A 3SDZA 4ZTJA 1M8VA 1QP2A 2ZZDB 3S3OA 2MWOA 3VU3C 3I55T 2QQ9A 3FIFA 3A8LB 4PJOB 2EQUA 4M7AB 5GAMf 3EFRA 5CKBA 3QIIA 3JB9J 1K9MC 1M5Q1 2FYKA 5J3BA 3ME9A 1HXDA 3QBYA 5HKCA 4HLQA 4V2SA 4BI4A 3HHTB 2E6NA 5LJ5h 4M75F 5LJ3d 2K2VA 1QP3A 2DJZA 4M78C 4M6VA 3CCLT 3QYEA 3QDRB 3OS2A 4KUDK 3DB4A 2E6ZA 3RKYA 4HT8A 3I56T 1N27A 5IN1A 2XDBA 3OYDA 2DTHA 3KUFA 1VQ8T 3JCMe 4MMLA 4CI0C 3M58A 3V7CA 1YJNT 3G71T 1FWZA 4M7DF 2PVGB 4XU3A 5GMKi 5CR2A 3HRSA 3JCMJ 2RH2A 4OGCA 5CCAA 2KVQG 3OY9A 1Y71A 1M1KU 1QLBA 1YJWT 1JJ2S 2WJ9A 2DD5B 4C0DB 3PIOA 3GLXA 4VUBA 1FXXA 3RMQA 1UGRB 4QSHA 3PMIA 2DXBB 4HNUA 1OYXA 5CO7A 4EMKA 4N4GA 2WSFE 2D6FA 5GAN7 2OAUA 3F70A 3O8VA 4IUQA 4MFDA 2R57A 2JNGA 3FJPA 4M7DC 3HRTA 4FU6A 1G3TA 1WQWA 2JVVA 3VKIA 3J80E 3WVEB 3CCET 1O75A 4HT9A 2RHYA 4C8QE 1YIJT 2DPPB 3VYHB 2P0QA 1LOJA 3CCUT 1KC8U 4P5NA 4JX4A 4A53A 3FDRA 4F7UF 5GANf 5FU7B 4O6JA 5GAOn 1M1FA 3S3MA 1G5VA 4M77D 4X9CA 2DO3A 3PFSA 3M9QA 4PJOG 2JOYA 1BI2A 2DAQA 1UGSB 2K5IA 4IUVA 3VV0A 3CMET 4M7AG 2YLBA 3E9GA 1MHNA 4QQGA 2ZZDA 4LDVA 3JCMc 3OYCA 3CCJT 3CCVA 2DKGA 3L2RA 5L8RE 4XAXB 1Q81U 1BIBA 4PKCC 4M77A 1K8AC 5CKHA 3TU4K 2OTLT 3SD4A 5GMKm 5C0MA 1O9SA 1D3BB 2RA2A 3C4SA 3SWNC 5I2MA 3OSVA 4C92E 4ME7A 1UGPB 2RI5A 2MWPA 4L6V5 5FROA 3OYHA 5C6SA 4MZTA 5D6XA 5LJ5e 5DM7R 5GAMg 4RG2A 4JRIA 2E5QA 2DK3A 4OGEA 2GCXA 4M75B 3BW1A 2CYZB 2GQVA 2XK0A 3GOXA 4BDZA 1N8RC 3MEWA 1VQ8A 1BYMA 2M16A 2HNIA 2DD4B 3DB3A 4IUPA 4C5EA 2DVEA 4C8QD 3HO8A 1YJNA 3G71A 3LWHA 1LNXA 4X9DA 1OZ3A 2KK4A 3CC7T 3L42A 3TREA 3L2WA 2X4JA 4JRKA 3MO8A 2F5KA 3C95A 2DD5A 5I21A 1Q7YU 2CKKA 2QQRA 3BFMA 3G6ET 4M7DB 1I5LA 1X75C 2DXBA 2ZCFB 1KQ1A 5A2QE 3Q1JA 4E7LA 2QI2A 3BDLA 2DEQA 3JCMQ 3UT1A 4OB0B 3HB9A 4NL2A 3GNGA 4N0AA 3TW6A 3MCAB 2WSEE 2E64A 3KBGA 1P92A 3QHSA 4WF2A 4BD3A 4M77C 5CKDA 2JUFA 2PQWA 4ELZC 2QQSA 4C92D 3N5BB 5GAOm 3PT9A 3DKMA 2BS3A 1VQ6T 1VQPT 3E1SA 2LCCA 5LJ5d 1K9MU 1TH7A 4EDUA 2C06A 2KQWA 4L59A 3J7AF 3CCUA 2EWNA 4BB7A 3JB9G 1WPYA 2QDYB 4NL3A 4JRQA 4BBRM 3RMSA 4M78G 2KMTA 2PVDB 5CAIA 1KQ2A 2VXFA 3R6OA 4RCCA 1YITA 2K3YA 5GAOq 2RJDA 3GIBA 3META 1XNIA 4F7UB 1QVGS 2LT4A 1I8FA 2I2LA 1UGQB 5GANg 3CCMT 3CCSA 2RK2A 4IUTA 3MEAA 3NTIA 2E70A 2ZPGB 2MMPA 1D3BA 5A0DA 1QVFS 1FKMA 3CCVT 1VQLA 2OTLA 4AKGA 3QPHA 2EIFA 1IREB 2ZPIB 2D0QB 3H8ZA 5I2SA 4E7IA 1JBMA 2VC8A 2XKOC 4M75G 1S72A 1Q82C 2OTJA 1KHIA 2HD0A 4C8QC 3LX7A 4FL6A 3OYBA 2RB6A 3MP6A 4XTUA 2X4YA 4NOYA 3S3NA 1FX7A 3P8BB 3CXCS 4DA4A 1YJ9A 5GAN5 1Q86C 4C92F 5J39A 2BKDN 4BE1A 2LDMA 2CGHA 5GAMe 4N0AC 3VYGB 4EMGA 4Q5WA 2EJFA 4JDSA 2QXFA 3VUBA 2DD4A 3OYAA 3NTKA 4M7DG 3OBWA 2M9UA 3L1AA 4BY6B 2EJGA 4A54A 1U1TA 4HCBA 4M77E 5CKEA 5GAN6 3SFMA 4BE0A 5GAN2 3FRNA 2EKOA 3P8HA 3CC7A 3HFNA 3A8HB 2FB7A 1VIFA 5A0GA 3OW2A 1YI2T 3JCMX 4O5VA 3BG5A 2ZPFB 2XD0A 2K3XA 2QQAA 3OMCA 4C92C 3G6EA 3ZBDA 3H4CA 2R58A 4XTYA 4B9XA 3OYLA 3RUXA 2DXCB 1V29B 3HZJA 4QW2A 4KULA 3TEEA 3A8MB 3WVDB 1OZ2A 1QVGA 4ZN1A 2VXEA 2CZ1B 3QJYA 1W2BS 4AKHA 3CPFA 2RM4A 3PMTA 3GP8A 2K5LA 1K8AU 2DTOA 2WACA 1VQ6A 1VQOT 4OF1A 5GAN4 1VQPA 2YHTA 4HL4A 2XIDA 3ZFJA 4F7UG 4OVAA 4N4IA 4PLLA 2VV5A 3JAME 4OB2B 4Y91A 3PTAA 2V8JA 2G77A 2ZPEB 4E7HA 2XU8A 3M55A 4A4FA 4HNTA 1XOVA 4HNVA 3OQ5A 4QQDA 4F7UA 4AI6A 3OYIA 4JX5A 1U1SA 4PJOD 2HBPA 4M7AD 3JCMd 3CD6A 4RCBA 1YITT 2HQEA 2ZGWA 2BS2A 4OMFB 3EFSA 3V8LA 3CCMA 3CPWS 2QFZA 5GANe 3HFOA 3ER0A 3NFCA 2XICA 3OS5A 1KHCA 5GAMj 3CC4A 4C5HA 5LJ3g 4ZGEB 3PNWC 3CCST 4PJOA 4D6WA 4GY5A 4BBSM 2KY9A 3VKHA 2RJCA 4M78B 4M7AA 2GFAA 1N6AA 4MDWA 3JCMb 4RMOA 1VQLT 3BY7A 4C5IA 2OTJT 2R5MA 2GFUA 1S72T 5LL6S 2RO0A 4A4EA 1H3ZA 2XG8D 3QYHB 3P8DA 3E9FA 5DLQE 5AYFA 1ZHIA 1JJ2A 5GAOp 1SSFA 1M90C 3CCRT 1X6OA 2KR6A 2BUDA 3OYGA 2QEXA 5GAMh 4XQ3A 1YJ9T 1M1KC 2YLCA 2ZPBB 1R8OB 4BUGA 4EMKC 2LQKA 3JCMW 4XU0A 2AHJB 2BS4A 4NC6A 4HKEA 4OB3B 1EIFA 1VQ9T 4QVCA 4XTVA 5GMKl 3OYYA 2EQJA 2DIGA 1BI3A 1VIEA 1XTDA 1YI2A 2CZ0B 2K57A 2P0KA 3S6WA 1K73C 2P0PA 1IZ6A 4M77F 3QZ5B 3GF5A 1KD1C 1VQ4A 4IKFA 3LH0A 2DXCA 2LRQA 2LT1A 2PUKB 4J5YA 3EAEA 4FM4B 2XDDA 1WJQA 2IVWA 3BDUA 4MIMA 1X01A 2JTFA 5CQYA 2ZPHB 2K4YA 1YHQA 5KH6A 1NPPA 3X24B 5CIUA 3E19A 2EJ9A 2K5FA 3RKXA 2M0OA 2QQBA 3UWNA 4ELYC 4PJOC 3X26B 2LX9A 2A3LA 2EAYA 2MI6A 3HPWA 3OYJA 1VQOA 3L2UA 4Z6YA 3C94A 2KSSA 4FIBA 3CBPA 3HSBA 3G7ZA 5GANj 4C8QG 1VQKA 3INZA 4OP0A 4DOVA 1OI1A 2F5TX 4LD9K 3G4SA 2QQ8A 2D9TA 2KDSA 2RI2A 5HY6A 4DOWA 3OSSC 3RKWA 5KCHA 1Q86U 5EJCA 3JSCA 3DLMA 4IURA 4C8QF 5GMKj 2RHZA 3KHIA 4IUUA 4JLGA 3DL1A 1JRIA 5LJ3f 3SWNB 4B9WA 4BE2A 2QA4A 3RERA 2EQKA 2RI3A 2PUOB 2JN0A 3FLGA 5GANh 3CD6T 4M78A 3LLRA 5GAOl 1XQHA 3GNFB 3V7RA 2KMGA 5LJ3e 3BG9A 1G3SA 1WJSA 5D6YA 4EMKB 3KXTA 3CC4T 5M9OA 1G3WA 4M75D 4C92G 3A5ZB 2FL7A 2LNVA 4C0DC 1ZBXA 3MEUA 3LGFA 5GMKh 1Y96B 4HCZA 4C0GA 3PIPA 1NJIC 3OB9A 1RI0A 1NPRA 2RJFA 3M4YA 2DIQA 1NZ9A 2Y4XA 3OMGA 2L3RA 3QUIA 4ZN3A 3CCRA 5D6WA 3JCMV 4ATOA 4M75A 2JTMA 2CZ7B 3CCQA 1MGQA 3X20B 3OBYA 3M54A 2QEXT 5GAN3 4M7DD 2EFIA 2BIVA 3QYGB 1B34B 2O4XB 2E65A 1VQ9A 3CMAT 4PJOE 1VUBA 2Y90A 4M7AE 4QVZA 1YCYA 3QO3A 2PVOB 2MAMA 1HK9A 4QQ6A 3TW7A 3M4GA 2MF2A 2XI9A 3OA6A 5FU7C 4M7DA 1QVPA 2H3JA 4Z02A 3QYBA 1DJ7B 2E41A 2JZ2A 3C12A 2X4WA 5CVIA 3T9NA 4C0FA 2KAFA 4LDYA 4M77B 2F69A 4MDXA 4JUVA 1VQ4T 4E47A 4EPCA 4J6WA 1VQMA 2DZ9A 1E7PA 3A8OB 4BI3A 5LJ5g 3HKSA 4KBMB 4LDWA 4BDYA 4C0ZA 3JCMf 1BI1A 3M57A 2X4XA 1YHQT 2LC4A 2VYTA 4J7IA 3PGGA 2XHCA 1G3YA 4BACA 5IAYA 3JCMP 4LDUA 1QVFA 3QJ6A 1U8RA 4X34A 3HBLA 5IT9E 4RKUE 4GLKA 1UEBA 2V8IA 3OYFA 2DZCA 3QZ9B 5LJ3j 3QXEB 3X25B 4MZMA 5GAMd 1VQKT 3SB2A 1GXIE 3LGLA 2CZ6B 4A4KA 4A4GA 4A4HA 3G4ST 1Y7XA 4M75C 3SWNA 4JLIA 3CXCA 1M90U 3CC2A 1VQNT 2QTXA 4KT0E 4XTZA 2O01E 3OYNA 2EQMA 4J6YA 4C8QB 2QDJA 1JB0E 1VQ7T 3QSUA 3X28B 1N8RU 2PU9B 4OB1B 5FU6C 2QA4T 2LTOA 2L5QA 5GAN8 3URGA 1Y07A 3M59A 5LJ3h 4MMKA 1K73U 1WNLA 3RIRA 1Y96A 3RESA 1PSEA 4XTWA 3VUZA 3HRUA 1KD1U 4MFEA 4QVDA 3J81E 2RHIA 3FC3A 2LQ8A 5GMKe 4RG8A 4FT2A 3FB9A 4JX6A 1KQSS 4PNOA 3CEYA 3FEOA 1VQ5A 3VYGA 2RK1A 2R5AA 3H6ZA 3HL8A 3HP9A 5GAOr 1B34A 1LJOA 2O4XA 5HK0A 3LWIA 3V7SA 4CRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0Q B;  2DD5 B;  4ZGD B;  1UGR B;  3A8G B;  2DXB B;  2WSF E;  3VYG B;  2DD4 A;  3WVE B;  4XK8 E;  2PUO B;  3A8H B;  2DPP B;  3VYH B;  1AHJ B;  2ZPF B;  1UGS B;  2DXC B;  1V29 B;  2ZZD A;  3A8M B;  3WVD B;  2CZ1 B;  5L8R E;  2CZ7 B;  2WSC E;  3X20 B;  3LW5 E;  3QYG B;  1UGP B;  2ZPI B;  4OB2 B;  4L6V 5;  2PVO B;  2ZPE B;  1DJ7 B;  1PSF A;  2CYZ B;  2DD4 B;  4ZGJ B;  3A8O B;  4Y28 E;  4ZGE B;  2DD5 A;  2DXB A;  2ZCF B;  4RKU E;  3QYH B;  4OB0 B;  3QZ9 B;  3QXE B;  3X25 B;  1GXI E;  1QP2 A;  2CZ6 B;  2WSE E;  2ZZD B;  2ZPB B;  3A8L B;  2AHJ B;  4KT0 E;  2O01 E;  4OB3 B;  1JB0 E;  3X28 B;  2PU9 B;  4OB1 B;  3HHT B;  2CZ0 B;  2QDY B;  1QP3 A;  3QZ5 B;  2PVD B;  2DXC A;  1PSE A;  2PUK B;  4FM4 B;  1UGQ B;  2ZPH B;  3VYG A;  2ZPG B;  2PVG B;  3X24 B;  1IRE B;  3X26 B; 
#chains in the Genus database with same CATH topology
 3CXC P;  1IGU A;  4M77 G;  4DBH A;  1AWO A;  3VKG A;  2QF7 A;  1M90 R;  2KEA A;  4FT4 A;  2W96 A;  4II1 A;  4ZGD B;  1M9S A;  2E1H A;  3RNJ A;  2KRM A;  5A0L A;  2C4G B;  5FRN A;  1RL2 A;  4M7A F;  3JV3 A;  4LOC A;  2XDP A;  1WQ7 A;  2YXY A;  5LJ5 f;  1B7T A;  1N9R A;  2A36 A;  5GAN d;  1YBY A;  4OMQ A;  5DY9 A;  4L5G A;  4J9I A;  3CCL A;  1K0X A;  4E7K A;  4PL6 A;  3CPW A;  4J9F A;  4F70 B;  1EX4 A;  2ZAE A;  1BIA A;  3QWL A;  2KT1 A;  1JSU B;  2VAS A;  2KNB B;  5CK9 A;  1RAB B;  3JB9 D;  1KJW A;  3VJP A;  1XJW B;  2HCK A;  2WSC E;  1YJW A;  3LW5 E;  4DQ2 A;  1VQ7 A;  3V8K A;  4N4H A;  4HVV A;  2HAX A;  3MP1 A;  4OMM A;  3L2Q A;  2DXU A;  2Y4Y A;  4BXX X;  1NLP C;  3CCE A;  2W9F A;  1QW1 A;  3G6E Q;  1YIJ A;  4KUI A;  4LDX A;  2GQI A;  2VUB A;  3EHQ A;  4FYX B;  2RD1 A;  5KYY B;  1Q7Y R;  4HVW A;  3JRZ A;  4MZP A;  3M53 A;  4CXA B;  1M8V A;  2EQI A;  1U06 A;  4PJN A;  1QP2 A;  2MCN A;  3I55 T;  3FIF A;  5GAM f;  3JB9 J;  3QII A;  2FYK A;  5J3B A;  3ME9 A;  4BI4 A;  1OUL A;  1FMV A;  1K9M R;  1VYT A;  1F5Q B;  4KUD K;  2E6Z A;  2HKQ B;  2DTH A;  2F2W A;  1UTI A;  3V7C A;  2PHG A;  3G71 T;  1FWZ A;  1E6H A;  1H8K A;  4XU3 A;  5CR2 A;  4EOM B;  5IXB A;  1Y71 A;  3THK A;  2WPA B;  3TNH B;  2D8H A;  4PJL A;  4C0D B;  3PIO A;  4VUB A;  1TD6 A;  1FXX A;  3RMQ A;  4QSH A;  2JM9 A;  1VQ8 Q;  1WZO A;  3O8V A;  4WCI A;  4MFD A;  2JNG A;  2HKN A;  4EOS B;  4DEX A;  4FU6 A;  3I5S A;  4GLM A;  2AIR B;  4YC3 B;  3A1P A;  2DPP B;  4P5N A;  4JX4 A;  5KYY A;  2C6T B;  4O6J A;  5GAO n;  4M77 D;  4X9C A;  1H1R B;  2K7A A;  4PJO G;  2JOY A;  3VV0 A;  2K5I A;  1UGV A;  3E9G A;  4LDV A;  3DDQ B;  4FX3 B;  3CCV A;  4F7J B;  2K2M A;  4OMP A;  9ATC B;  4ROD A;  5CKH A;  4DEY A;  2FRY A;  1O9S A;  3C4S A;  1OX8 A;  1OGU B;  2VKN A;  1UHF A;  1SF9 A;  1FMK A;  2CYZ B;  2GQV A;  2XK0 A;  1BYM A;  3QDF A;  2BTT A;  2YUQ A;  2DD4 B;  4CFU D;  2JMC A;  4FCY A;  1VQL Q;  1YJN A;  2OTJ Q;  4EON B;  3CC7 T;  3TRE A;  2CH4 A;  4F7L B;  2F5K A;  1Q7Y U;  2QQR A;  3G6E T;  3TSW A;  1UJY A;  1I5L A;  1X75 C;  3Q1J A;  4E7L A;  1ZUK A;  4YOZ A;  1MMA A;  1E7O A;  2DEQ A;  3UT1 A;  3JCM Q;  2DJQ A;  4NL2 A;  4N0A A;  2QYZ A;  3MCA B;  5KYX A;  2KE9 A;  4BCN B;  3QHS A;  4M77 C;  3MIA B;  1U3O A;  2JUF A;  1PWT A;  2QQS A;  3N5B B;  1AD6 A;  2BS3 A;  1VQP T;  2LCC A;  3TSZ A;  1K9M U;  4EDU A;  2KQW A;  2ROT A;  2QDY B;  1W6X A;  3RMS A;  4BCJ B;  2DLP A;  2ENM A;  1ZBJ A;  3R6O A;  1YIT A;  5GAO q;  2RJD A;  3RGF B;  2LNH B;  3H41 A;  3MEA A;  2ZPG B;  1QVF S;  4Y92 A;  2OTL A;  5I5Z B;  5KYW B;  2VC8 A;  4M75 G;  3OYB A;  3REB B;  3MP6 A;  2X4Y A;  1YJ9 A;  1FX7 A;  3P8B B;  4C92 F;  5J39 A;  1T3L A;  3CD6 Q;  4EMG A;  3OYA A;  3CCM Q;  2DD4 A;  1TTH B;  2K79 A;  4M7D G;  3OBW A;  4IIM A;  4A54 A;  3SFM A;  2EKO A;  3P8H A;  3HFN A;  4WTO B;  5A0G A;  3OW2 A;  3BG5 A;  2ZPF B;  1K76 A;  4RTT A;  1PCX A;  1E6G A;  1WXT A;  3H4C A;  4XTY A;  2CRE A;  2QEX Q;  3RUX A;  1WIE A;  4KUL A;  3A8M B;  3WVD B;  2L3S A;  2B86 A;  3NGP A;  2PK9 B;  3GP8 A;  1K8A U;  2DTO A;  4JJD A;  2XID A;  3ZFJ A;  4F7U G;  1VQ4 Q;  4Y91 A;  2G77 A;  2EYW A;  1RAA B;  2E5K A;  4E7H A;  1PD0 A;  4BCG B;  2XU8 A;  4A4F A;  3OQ5 A;  2MOX A;  4PJO D;  4JX5 A;  2HMA A;  2DEU A;  1ZUU A;  4OMF B;  2BS2 A;  3V8L A;  3CPW S;  5KYW A;  5IHY A;  4D6W A;  4BBS M;  4M78 B;  3VKH A;  1VQK Q;  2GFA A;  3JCM b;  1VQL T;  3G4S Q;  1ZUY A;  2OTJ T;  4PK4 A;  4A63 B;  2O9S A;  1K9A A;  4A4E A;  2XG8 D;  1A0N B;  1SSF A;  4BCF B;  3CCR T;  1X6O A;  1VQ7 Q;  5IHN A;  1VOM A;  4BUG A;  3JCM W;  4XU0 A;  5ICP B;  1PRL C;  4HKE A;  1BI3 A;  1JEG A;  2K57 A;  3S6W A;  1K73 C;  1MV3 A;  4M77 F;  2KXC A;  1CKB A;  2DYI A;  1KD1 C;  2W99 A;  2DRM A;  4J5Y A;  2CDT A;  1WJQ A;  4OMO A;  3G1J A;  2CP5 A;  2PMI B;  1BCM A;  1M3B A;  3EGU A;  5CQY A;  1X6G A;  2HEQ A;  1NPP A;  2K5F A;  3RKX A;  4PJO C;  1H25 B;  1TSF A;  4RTV A;  3OYJ A;  3HPW A;  1VQO A;  2V26 A;  3CBP A;  3HSB A;  3G7Z A;  5GAN j;  4FW2 A;  3QWY A;  2F5T X;  4OMN A;  4DOW A;  4DBQ A;  1VQM Q;  4AG2 C;  1G2B A;  1Q86 U;  3JSC A;  4IUR A;  2XMF A;  3M0S A;  2AKK A;  3AT1 B;  4IUU A;  1SSH A;  1TUG B;  3EHR A;  3CD6 T;  3FLG A;  4M78 A;  2YUN A;  1XQH A;  2KMG A;  1RAI B;  4M75 D;  2LNV A;  2KGT A;  1Y96 B;  3QWX X;  3PIP A;  1NJI C;  1G83 A;  1PG5 B;  2L3R A;  1Q82 R;  2JTM A;  2CZ7 B;  1LCK A;  2QEX T;  5GAN 3;  4M7D D;  1SRL A;  3QYG B;  1NG2 A;  1VQ9 A;  4M7A E;  1HK9 A;  2SRC A;  4QQ6 A;  3M4G A;  2BZ8 A;  2DL4 A;  3FJ5 A;  5FU7 C;  2H3J A;  3QYB A;  2JZ2 A;  2X4W A;  4JUV A;  1VQ4 T;  4E47 A;  4EC8 B;  4EPC A;  4J6W A;  3A8O B;  4BI3 A;  5LJ5 g;  2JS2 A;  4KBM B;  4F6W B;  1BI1 A;  3M57 A;  1AWX A;  2VYT A;  2X3W D;  4BAC A;  2JMA A;  3QJ6 A;  1U8R A;  2WEV B;  5LQF B;  2EGA A;  4GLK A;  3OYF A;  3QZ9 B;  4MZM A;  1VQK T;  1GXI E;  4A4K A;  4A4H A;  3G4S T;  4M75 C;  3CXC A;  4JLI A;  1KK7 A;  2DL7 A;  2KYB A;  4ORZ A;  1VQ7 T;  1IB8 A;  2YSQ A;  1Y57 A;  5FU6 C;  4ANJ A;  1QKW A;  3M59 A;  4MMK A;  1R77 A;  1M3C A;  2E4H A;  1YJN Q;  1Y96 A;  2QAZ A;  4XTW A;  4CC3 A;  5LMK B;  1M30 A;  2LQ8 A;  1UNL D;  2J06 A;  4JX6 A;  4PNO A;  3CEY A;  3FEO A;  3VYG A;  3HP9 A;  4PFO A;  4F7N B;  1I0C A;  2ED0 A;  1LJO A;  3VS6 A;  2F2V A;  3LWI A;  2ECZ A;  2GTJ A;  2V1Q A;  4J9D A;  3OS1 A;  1M1K R;  1BCO A;  1LVK A;  1ARK A;  4AFU C;  2YRV A;  4PJO F;  3V8J A;  4XU1 A;  4EOR B;  4JPB W;  4BI8 B;  1M3A A;  2M1H A;  2X35 A;  1SEM A;  2E10 A;  4XK8 E;  2CS7 A;  1VQM T;  4KH0 B;  2YUO A;  1D0Y A;  3I56 A;  5HCK A;  4HA8 A;  3BG3 A;  2X9H A;  4M7A C;  3JCM h;  2OTL Q;  1WHG A;  1M2V B;  1Q82 U;  4EMH A;  5KCO A;  1Q81 C;  5FU6 B;  3U23 A;  4C5G A;  3MEV A;  2KR3 A;  4G6L B;  4CFV B;  1VQN A;  1I4K 1;  3NPF A;  3CBM A;  4BY6 C;  2LCL A;  4NS5 A;  2DXT A;  3AHU A;  2GF7 A;  2A7Y A;  5CEI B;  2CP2 A;  2V22 B;  5KE2 A;  2COW A;  2VGN A;  2FHD A;  1NBE B;  3UDC A;  1OOT A;  3OW2 S;  4ZGJ B;  2L89 A;  1I07 A;  4Y28 E;  3OS0 A;  1OI9 B;  2LW4 A;  1PKD B;  1M4Z A;  3M56 A;  4BCH B;  3CME A;  1VYU A;  4J8O A;  3JB9 I;  4HCC A;  3CCJ A;  5CQX A;  3WXM B;  2FVU A;  5FRM A;  3TNW B;  4JS4 A;  1I81 A;  1OKW B;  2CUD A;  2L0A A;  4ZTJ A;  2L3P A;  2M51 A;  2ZZD B;  3LQ5 B;  3O0G D;  2EQU A;  4M7A B;  1LPL A;  2EVR A;  5CKB A;  1AZE A;  2CSI A;  2DF6 A;  1HXD A;  4V2S A;  5LJ5 h;  3BHT B;  3UA6 A;  4M75 F;  4FYY B;  3QDR B;  1KSW A;  1M2V A;  4HT8 A;  2XDB A;  5IN1 A;  1D1A A;  1YJN T;  4M7D F;  2PVG B;  3HRS A;  5CCA A;  2KVQ G;  1M1K U;  2I40 B;  2SEM A;  4J9E A;  2AK5 A;  1WHL A;  3PMI A;  2DXB B;  3QHR B;  5CO7 A;  1WX6 A;  4EMK A;  2D6F A;  3F70 A;  2EYX A;  3HRT A;  2K9G A;  2M02 A;  1G3T A;  2WMB B;  2EYZ A;  3VKI A;  4HT9 A;  1GRI A;  1RAG B;  2RHY A;  4C8Q E;  4FW1 A;  2FRW A;  2C0O A;  3PE0 A;  2LJ1 A;  5GAN f;  4F7U F;  3S3M A;  4RTU A;  1G5V A;  2DO3 A;  3PFS A;  3M9Q A;  2DAQ A;  2W0Z A;  2IW8 B;  2YLB A;  2RMO A;  3KFV A;  2A28 A;  2ZZD A;  3JCM c;  3SEM A;  1H4L D;  2HSP A;  1BIB A;  5DQV A;  3TU4 K;  3DJB A;  2OTL T;  5C0M A;  2IN3 A;  2RA2 A;  2P84 A;  5I2M A;  3OSV A;  4C92 E;  1UGP B;  2UZD B;  2RI5 A;  3OYH A;  4L6V 5;  5IH2 A;  2RQV A;  4JJC A;  4OGE A;  4HVU A;  2PNI A;  3CCS Q;  2JXB A;  3RR6 A;  4BDZ A;  1N8R C;  3MEW A;  1V1C A;  2FZG B;  4C5E A;  4C8Q D;  1GFC A;  1GUX B;  1S72 Q;  2KK4 A;  3L42 A;  3BLH B;  4JRK A;  1F1B B;  1YNZ A;  2C5O B;  4NST B;  2DXB A;  2ZCF B;  2QI2 A;  4RTZ A;  3HB9 A;  1OX9 A;  1WI7 A;  3TW6 A;  4C92 D;  3CC7 Q;  3EG3 A;  1SHG A;  5GAO m;  3PT9 A;  1RLQ C;  5LJ5 d;  2C06 A;  1RUW A;  3M0P A;  3CCU A;  2EWN A;  4NL3 A;  4JRQ A;  4BBR M;  3C0C A;  4HXJ A;  4M78 G;  2PVD B;  5CAI A;  3GIB A;  3MET A;  4BCK B;  4Z8A A;  1QVG S;  1I8F A;  1QMC A;  3EG9 B;  5HBJ B;  1UGQ B;  1D0X A;  1IHW A;  3NTI A;  1VQP Q;  2VWF A;  5I2S A;  4CFW B;  1QMZ B;  3H0H A;  1PHT A;  4C8Q C;  3LX7 A;  4XTU A;  1OIU B;  3CXC S;  3EG1 A;  5GAN 5;  1G3N C;  8ATC B;  4N0A C;  4ROC A;  2DRK A;  2QXF A;  2LZ6 B;  1GUX A;  3L1A A;  2ESW A;  2EJG A;  4M77 E;  4BE0 A;  1IRX A;  3JCM X;  2CSQ A;  2DMO A;  2QQA A;  3OMC A;  4C92 C;  2JM8 A;  2R58 A;  1WLP B;  3OYL A;  2WIP B;  3HZJ A;  4IMY B;  4E2F B;  1O9K B;  2HBW A;  3CPF A;  3PMT A;  2K5L A;  1MNE A;  1TFB A;  1VQ6 A;  1VQO T;  4OF1 A;  5GAN 4;  4PLL A;  4N4I A;  2I0N A;  3JAM E;  4OB2 B;  2ZPE B;  2VB6 A;  5IDP B;  3BHU B;  5HNB B;  4HNT A;  1XOV A;  4HNV A;  4AI6 A;  2RPN A;  3EG9 A;  3ULR B;  5EFQ B;  1HD3 A;  2NYS A;  2ZGW A;  3MI9 B;  3HFO A;  3NFC A;  1MND A;  1KHC A;  3CC4 A;  3CCS T;  4DBR A;  4II5 B;  4F16 A;  4PFP A;  2KY9 A;  2RJC A;  1N6A A;  5CYI B;  1VQN Q;  4ZNX A;  2GFU A;  1UJ0 A;  1S72 T;  5LL6 S;  2RO0 A;  1K8A R;  3E9F A;  5AYF A;  5GAO p;  1M90 C;  3NMZ C;  3E2U A;  3OYG A;  4XQ3 A;  2YLC A;  1R8O B;  1S1N A;  2QA4 Q;  3H9N A;  4BCO B;  1JQQ A;  4NC6 A;  1EIF A;  2ABL A;  1VQ9 T;  5GMK l;  3OYY A;  1YI2 A;  1QLY A;  2P0K A;  2P0P A;  1I1J A;  3QZ5 B;  1NEB A;  3TVT A;  3EAE A;  3CCR Q;  5I22 A;  2PZ1 A;  2UZE B;  1X01 A;  3CCQ Q;  2CUB A;  1KD1 R;  4AMC A;  2ZPH B;  1O9K A;  1YHQ A;  1JJ2 P;  2DME A;  5CIU A;  1MMN A;  5KH6 A;  3E19 A;  1K1Z A;  3X26 B;  2LX9 A;  2A3L A;  2EAY A;  2MI6 A;  3C94 A;  2KSS A;  3M0U A;  2DVJ A;  3INZ A;  4LD9 K;  2CP0 A;  3I35 A;  3TN8 B;  2KDS A;  2RI2 A;  3DLM A;  1OPK A;  1WXU A;  1C9B A;  4C8Q F;  2X1N B;  2RHZ A;  3KHI A;  2YT6 A;  1JRI A;  5LJ3 f;  4F17 A;  1JKW A;  3RER A;  1VYW B;  3LLR A;  4CFN B;  4AT1 B;  3BG9 A;  1G3S A;  1RI9 A;  1G3W A;  2DBK A;  1KIK A;  3EOC B;  3REA B;  3LGF A;  4Z88 A;  3CC2 Q;  1ZSZ C;  1NPR A;  3EID B;  3M4Y A;  2DIQ A;  1NZ9 A;  2Y4X A;  4AG1 C;  3B57 A;  5D6W A;  2ATC B;  1MGQ A;  1NJI R;  3M54 A;  3M0T A;  1B34 B;  3EFO B;  2LQN A;  1Q86 R;  4PJO E;  1VUB A;  4KGV B;  3TNI B;  2RF0 A;  1JO8 A;  5HVY B;  4Z02 A;  1DJ7 B;  4MDX A;  1UFF A;  4M77 B;  1VQ5 Q;  1Z9Z A;  1D1C A;  2DZ9 A;  2FEI A;  3HKS A;  4LDW A;  2DFU A;  4BCM D;  2NWM A;  2X4X A;  3PGG A;  1G3Y A;  1WA7 A;  2LP5 A;  4LNP A;  4LDU A;  4X34 A;  1GCQ C;  2RQU A;  3HBL A;  5IT9 E;  1UEB A;  4CC7 A;  3SB2 A;  3LGL A;  2CZ6 B;  1Y7X A;  1VQN T;  2QTX A;  4KT0 E;  2EGC A;  2O01 E;  3CCL Q;  2C0T A;  4CFU B;  2QDJ A;  3QSU A;  5ACB A;  2R7G A;  2QA4 T;  2L5Q A;  1Y07 A;  1K73 U;  1WNL A;  3RIR A;  1PSE A;  3HRU A;  1KD1 U;  4FYW B;  3J81 E;  2RHI A;  4RG8 A;  1YJW Q;  2RK1 A;  5GAO r;  1B34 A;  2QAS A;  3EFO A;  1JXM A;  3CCQ T;  3CMA A;  2QGF B;  3POM A;  3TCJ A;  2I53 A;  4UC4 A;  4OR5 B;  2WMA B;  3OYK A;  1KG1 A;  4F6S B;  2IG0 A;  3MPU B;  3A8G B;  3I55 A;  3CCE Q;  5DLO A;  3K7A M;  1YIJ Q;  1ZP2 A;  5IHI A;  3GBQ A;  3CCU Q;  1SRM A;  1WGS A;  4ESR A;  1VIN A;  4M75 E;  5FLX E;  1UNG D;  1KC8 C;  1NEG A;  3RDV A;  4E7S A;  4JJN K;  2RHX A;  4PLI A;  3L2Z A;  2KRO A;  2DE0 X;  2RJE A;  1GBR A;  2OJ2 A;  3JCM g;  2D1X A;  1W2B P;  4M7D E;  1GH6 B;  1NLO C;  3GPL A;  1NJI U;  1UUE A;  2GTO A;  1GL5 A;  2NLU A;  1KQS A;  1WHK A;  4FYV B;  2LVM A;  3DTO A;  3CC2 T;  4OGR B;  4AKI A;  1D09 B;  3DLL A;  4JS5 A;  3M5A A;  1PC0 A;  3MHX A;  1JXO A;  3UPU A;  3QKJ A;  4LD6 A;  1N9S A;  1PSF A;  4E7J A;  2COY A;  3CBO A;  3L2V A;  1W4S A;  2LX7 A;  1OQK A;  4F7U E;  2J05 A;  3LYI A;  5EG2 A;  1M1G A;  1VQ5 T;  1G8X A;  3ZEH A;  3CQT A;  2FG0 A;  2DTI A;  2DET A;  1ZX6 A;  4EOK B;  4J7F A;  1AZG B;  2G3R A;  7AT1 B;  5LJ5 j;  1NE8 A;  3M0Q A;  4M78 F;  1WJR A;  4JRP A;  2IW9 B;  2L8D A;  2MYS A;  1VQ6 Q;  2E12 A;  3SDZ A;  3S3O A;  3VU3 C;  2QQ9 A;  1I5O B;  4PJO B;  2JT4 A;  2EGE A;  3BE3 A;  3EFR A;  1T0H A;  1M5Q 1;  3QBY A;  4QKU A;  3HHT B;  2E6N A;  2GGR A;  3O5Z A;  1QP3 A;  1AIS B;  4M6V A;  3CCL T;  3QYE A;  2ROL A;  3RKY A;  3CCV Q;  1N27 A;  1B07 A;  4K11 A;  3JCM e;  4MML A;  3M58 A;  5L23 A;  5ECA A;  4F6U B;  2G6F X;  3JCM J;  3OY9 A;  2BKZ B;  4F14 A;  1QLB A;  1YJW T;  2A08 A;  4BCP B;  1UGR B;  4HNU A;  1OYX A;  2DA9 A;  1BU1 A;  4N4G A;  5HQ0 B;  2WSF E;  1H24 B;  3M03 A;  1TUC A;  2OAU A;  2FZK B;  1Z9Q A;  1QCN A;  4M7D C;  3FJP A;  3R6N A;  2DL3 A;  1WQW A;  3J80 E;  3CCE T;  1H3H A;  1YIJ T;  2P0Q A;  1LOJ A;  3CCU T;  2LJ3 A;  2O88 A;  4A53 A;  5FU7 B;  1M1F A;  1WDX A;  3VS2 A;  1BI2 A;  4IUV A;  2FO0 A;  1URC B;  4JZ3 A;  3BLR B;  4BCQ D;  1Q81 U;  5FW9 A;  2DM1 A;  3SWN C;  3PO3 S;  3VS5 A;  4ME7 A;  2MWP A;  5FRO A;  3VS4 A;  4MZT A;  5D6X A;  3VS7 A;  1J3T A;  1YIT Q;  5LJ5 e;  5DM7 R;  5GAM g;  4JRI A;  2GCX A;  1CSK A;  2KYM A;  2L2P A;  4M75 B;  3GOX A;  1VQ8 A;  4KH1 B;  2HNI A;  3DB3 A;  4IUP A;  2DVE A;  1LNX A;  4X9D A;  2KI7 A;  4F04 B;  1ABO A;  5FWC A;  3L2W A;  1R0C B;  3C95 A;  3EGX B;  1YJ9 Q;  2CKK A;  3BFM A;  4M7D B;  1KQ1 A;  4OB0 B;  2WSE E;  4R0K A;  2E64 A;  4WF2 A;  2RN8 A;  2EKH A;  2PQW A;  2F1L A;  3D7S B;  1YCS B;  1JST B;  3GTM S;  2YDL A;  1VQ6 T;  3E1S A;  1MV0 B;  4L59 A;  4BB7 A;  3JB9 G;  1T3S A;  2PJQ A;  2KMT A;  1KQS P;  4EOJ B;  1KQ2 A;  2C0I A;  2RNA A;  2VXF A;  4RTW A;  3UF4 A;  5FWB A;  1XNI A;  4F7U B;  1OL1 B;  1OU9 A;  1PRM C;  4IUT A;  4FSS A;  2MMP A;  5A0D A;  4KRC B;  1FKM A;  2L3Q A;  3CCV T;  1VQL A;  2D0Q B;  1Q82 C;  2OTJ A;  1JBM A;  2XKO C;  2HDA A;  1KHI A;  4FL6 A;  2RB6 A;  2W2H A;  4DA4 A;  2KXD A;  3DOG B;  2JTE A;  4ROE A;  2LDM A;  2CGH A;  5GAM e;  4AFZ C;  4Q5W A;  2EJF A;  4JDS A;  1NYG A;  3VUB A;  5IXF A;  2NUP B;  4F7S B;  2M9U A;  4BY6 B;  1U1T A;  5CKE A;  3FRN A;  3EGX A;  3A8H B;  2NUT B;  1YI2 T;  1YN8 A;  2CH4 W;  3ZBD A;  3PVQ A;  4B9X A;  1SG5 A;  2MK5 A;  3TEE A;  3CMA Q;  1IGQ A;  2VXE A;  2QDL A;  1Q95 G;  4AKH A;  2RM4 A;  2CP6 A;  4OVA A;  2VV5 A;  5DQW A;  3PTA A;  2V8J A;  6AT1 B;  2KRS A;  1X6B A;  4E7Z A;  1SKU B;  1WHJ A;  3A98 A;  4QQD A;  4F7U A;  3OYI A;  3JCM d;  3CD6 A;  2P4R A;  1QCF A;  1YIT T;  3CCM A;  1ZA2 B;  1ENW A;  2JS0 A;  3OS5 A;  1VA7 A;  1VQO Q;  1QVG P;  4C5H A;  5LJ3 g;  1QWF A;  4GY5 A;  4M7A A;  2QGS A;  4MDW A;  4RMO A;  1VOL A;  3BY7 A;  1RAC B;  4C5I A;  2R5M A;  1PKS A;  2EUF A;  1MMD A;  3BLQ B;  3P8D A;  1JJ2 A;  1ZHI A;  2RQW A;  1YJ9 T;  2QEX A;  2KR6 A;  2NUP A;  1M1K C;  5GAM h;  2ZPB B;  2LQK A;  2BS4 A;  1UNH D;  1C6V X;  4PFZ A;  1N4M A;  1QCO A;  2NUT A;  4XTV A;  4KGX B;  2EQJ A;  1XTD A;  2CZ0 B;  2GBQ A;  1VQ4 A;  1MUZ A;  2LJ0 A;  3LH0 A;  4KGZ B;  4IKF A;  2BPM B;  2PUK B;  4FM4 B;  2GNC A;  3BDU A;  1H92 A;  2JTF A;  1YWO A;  1E9H B;  4KRD B;  2CT3 A;  1PD1 A;  3X24 B;  1VQ9 Q;  1C0M A;  2COZ A;  2EJ9 A;  4UN0 A;  2QQB A;  4ELY C;  2UZB B;  1GY3 B;  4Z6Y A;  1H1P B;  1PM3 A;  2JW4 A;  1VQK A;  4DOV A;  2DBM A;  3G4S A;  3UA7 A;  2D9T A;  5HY6 A;  1AWW A;  3OSS C;  3RKW A;  5KCH A;  5EJC A;  2OI3 A;  2QGG A;  2DX1 A;  2J6K A;  4JLG A;  4BE2 A;  2EQK A;  1X43 A;  2OX7 A;  2PUO B;  3GNF B;  2KRN A;  4J9C A;  5LJ3 e;  1OPL A;  1WJS A;  5D6Y A;  1FVV B;  3SHW A;  4C0D C;  5GMK h;  5D7U A;  4BY7 X;  4BY1 X;  4HCZ A;  4C0G A;  4AFS C;  1RI0 A;  2RJF A;  1BK2 A;  2IIM A;  3OMG A;  4ZN3 A;  3JCM V;  3H0F A;  4OML A;  1W1F A;  3X20 B;  1UEC A;  2AZS A;  3IQL A;  3PVL A;  2H8H A;  2EFI A;  1X27 A;  2DL8 A;  2O4X B;  2D0N A;  3CMA T;  2LCS A;  4QVZ A;  1YCY A;  2QK0 A;  1FYN A;  2PVO B;  2B9R A;  2MAM A;  2MF2 A;  1OU8 A;  4BCN D;  3T9N A;  5CVI A;  3C12 A;  2KAF A;  4LDY A;  1EFN A;  2F69 A;  1VQM A;  4GBQ A;  4CC2 A;  4D8K A;  2DER A;  2D8J A;  4IIO A;  1ZLM A;  4C0Z A;  4BDY A;  2CT4 A;  4EOP B;  2LC4 A;  4RTX A;  2BZX A;  5I11 A;  3M0R A;  5IAY A;  3JCM P;  2W10 A;  1TOV A;  4KRT A;  1UHC A;  4CFM B;  5GAM d;  4A4G A;  1M90 U;  2KT8 A;  4Y72 B;  3EG2 A;  4XTZ A;  3OYN A;  4YOO A;  1H26 B;  2CP3 A;  4C8Q B;  3I56 Q;  3X28 B;  1MMG A;  5LJ3 h;  1ACM B;  1OEB A;  3RES A;  5KYX B;  1AEY A;  2PK2 A;  1QVF P;  1QQJ A;  2JGZ B;  2C5N B;  1TS9 A;  4EOO B;  2R5A A;  3H6Z A;  3HL8 A;  4ELL A;  2O4X A;  3H0I A;  5HK0 A;  2HL5 C;  2DYB A;  1C1A A;  4M78 E;  1K0S A;  4C92 B;  1W2B A;  2V1R A;  3OYE A;  1UB4 A;  4R55 A;  4PJJ A;  5J26 A;  3MY1 B;  3ASK A;  4BCI B;  3QHW B;  2K3B A;  1W70 A;  3MP8 A;  2AKL A;  2EYQ A;  3EGD B;  1K73 R;  1RLP C;  1FMW A;  4EIK A;  1U5S A;  1D3U B;  3CME Q;  3ZL7 C;  1AHJ B;  4TTH A;  3CCJ Q;  1X2K A;  1KC8 R;  1WYX A;  1ABQ A;  3NDQ A;  2VGM A;  3NTH A;  1GCP A;  1OL2 B;  2Z0W A;  4J83 A;  3JB9 H;  1X2Q A;  1BBZ A;  4XU2 A;  3QG1 A;  1BKB A;  4M78 D;  4YTL A;  4C8Q A;  2A37 A;  4LUE A;  2HQX A;  4TVR A;  2B8A A;  4ZTF A;  1NM7 A;  2DL5 A;  5BNJ B;  2WFY B;  1W98 B;  3CPW P;  4ELJ A;  5KE3 A;  1AT1 B;  2RHU A;  2HZY A;  4XTX A;  2V8K A;  2OAW A;  2DNU A;  4LXC A;  3OYM A;  1T0J A;  4JJB A;  1H64 1;  2P4T A;  1Q7Y C;  4C92 A;  3UAT A;  4R56 A;  1GFD A;  2ED1 A;  4EOL B;  5CKF A;  5HK3 A;  2PTK A;  1EZZ B;  1ZQ1 A;  3JB9 F;  1WXB A;  1TU0 B;  4J6X A;  4FSX A;  2C5V B;  1BI0 A;  1UG1 A;  1H28 B;  1KFZ A;  3EGD A;  2MWO A;  3A8L B;  1FIN B;  1CKA A;  2AT1 B;  1K9M C;  1M27 C;  1KXU A;  5HKC A;  4HLQ A;  1Y0M A;  5LJ3 d;  2K2V A;  1YWP A;  2DJZ A;  4M78 C;  1RAE B;  1OKV B;  3OS2 A;  1YP5 A;  3MY5 B;  3DB4 A;  3I56 T;  2HSE B;  3OYD A;  3KUF A;  1VQ8 T;  2QG9 B;  4CI0 C;  1XO2 A;  1WHH A;  2O9V A;  2WIH B;  5GMK i;  2EBP A;  2J6F A;  4LN2 A;  1B3Q A;  2RH2 A;  4OGC A;  1YFN A;  2KBT A;  1JJ2 S;  2WJ9 A;  2DD5 B;  1QWE A;  3GLX A;  1ZSZ B;  3I5R A;  5GAN 7;  4IUQ A;  3VS1 A;  4D8D A;  2R57 A;  2FPF A;  1JOW A;  2JVV A;  1H1Q B;  3VRY A;  5KYN A;  3WVE B;  1O75 A;  1KC8 U;  3VYH B;  1RAD B;  3FDR A;  2UZL B;  2WHB B;  2E3H A;  2M0Y A;  4RTY A;  4M7A G;  1UGS B;  3CME T;  1MHN A;  4QQG A;  3OYC A;  3CCJ T;  5HBH B;  2IVX A;  2DKG A;  2F2X A;  3NHN A;  3L2R A;  5L8R E;  4XAX B;  4PKC C;  4M77 A;  1K8A C;  2AZV A;  3SD4 A;  5GMK m;  1D3B B;  5AT1 B;  2F2C A;  5C6S A;  2X51 A;  4RG2 A;  1WFW A;  3EJ1 B;  1UE9 A;  2E5Q A;  2DK3 A;  2YRC A;  3BW1 A;  4RUG A;  3EG0 A;  2M16 A;  1HSQ A;  3HO8 A;  3G71 A;  3LWH A;  2MPX C;  1TUD A;  1OZ3 A;  1IHV A;  4LUD A;  2X4J A;  3MO8 A;  2DD5 A;  2QTV A;  5I21 A;  1TXQ A;  1Q81 R;  1ZSZ A;  5A2Q E;  1H1S B;  1HJD A;  1BB9 A;  3BDL A;  3RBB B;  3GNG A;  1X69 A;  1P92 A;  3KBG A;  4BD3 A;  5CKD A;  5IDN B;  4ELZ C;  2CCH B;  1JU5 C;  3DKM A;  3VRZ A;  5HBE B;  1TH7 A;  1OV3 A;  3J7A F;  2FZC B;  1WPY A;  4BCM B;  2NUZ A;  4LE9 A;  2O2O A;  4RCC A;  2K3Y A;  2LT4 A;  3EH1 A;  5L2W B;  2I2L A;  5GAN g;  3CCM T;  3CCS A;  2RK2 A;  4J9B A;  2E70 A;  2EPD A;  1D3B A;  4AKG A;  3QPH A;  2EIF A;  1IRE B;  2ZPI B;  2CP7 A;  3H8Z A;  4E7I A;  1K4U S;  1D1B A;  1GCQ A;  1S72 A;  2HQH A;  5EC7 A;  2HD0 A;  4AFQ C;  5IF1 B;  4CFX B;  1D0Z A;  4NOY A;  3S3N A;  1Q86 C;  3TQ7 P;  2BKD N;  4BE1 A;  1IXD A;  4CRL B;  3VYG B;  2EYY A;  3NTK A;  3CC4 Q;  4HCB A;  5GAN 6;  2LQW A;  2RQT A;  5GAN 2;  4JZ4 A;  2E3I A;  2W9Z A;  3CC7 A;  2FB7 A;  1VIF A;  4O5V A;  2XD0 A;  2K3X A;  3G6E A;  1P5E B;  2DXC B;  1V29 B;  1RAF B;  4QW2 A;  2HL3 A;  2YRD A;  1OZ2 A;  1QVG A;  4ZN1 A;  2CZ1 B;  3QJY A;  1W2B S;  4CC4 B;  1YI2 Q;  1SHF A;  2WAC A;  5GJV B;  1VQP A;  1N5Z A;  2YHT A;  4HL4 A;  1M8M A;  5GJW B;  1AVZ C;  8AT1 B;  3M55 A;  2K6D A;  3OW2 P;  4YOS A;  1U1S A;  1YHQ Q;  2HBP A;  3EH2 A;  4M7A D;  4RCB A;  1H27 B;  2HQE A;  3EFS A;  1IO6 A;  2QFZ A;  5GAN e;  3ER0 A;  5KYU B;  5FGK B;  2XIC A;  5GAM j;  1QKX A;  3DDP B;  4ZGE B;  3PNW C;  4PJO A;  3G33 B;  3I9Q A;  2LMJ A;  1GBQ A;  1R0B G;  1H3Z A;  3QYH B;  4EOI B;  1UDL A;  5DLQ E;  1ZA1 B;  2BUD A;  4EMK C;  1WHM A;  1AOJ A;  2AHJ B;  4OB3 B;  2IPO B;  2C5X B;  4QVC A;  2DIG A;  1VIE A;  1IZ6 A;  2FPE A;  3GF5 A;  4Z89 A;  1N8R R;  2FPD A;  2X3X D;  2DXC A;  2LRQ A;  2LT1 A;  2XDD A;  2BE9 B;  2IVW A;  4MIM A;  2G9X B;  2CCI B;  1TWB A;  2K4Y A;  3UWN A;  2M0O A;  2CJM B;  1PKT A;  3L2U A;  4FIB A;  3LH5 A;  2A0F B;  4C8Q G;  4EOQ B;  4OP0 A;  2BE7 D;  2RQR A;  1HYO A;  5IHK A;  1OI1 A;  2H3E B;  2QQ8 A;  4I3Z B;  1V76 A;  5GMK j;  4B9W A;  5KYU A;  3DL1 A;  3SWN B;  2QA4 A;  2RI3 A;  2JN0 A;  4B6M A;  5GAN h;  1AWJ A;  2YWW A;  5GAO l;  3V7R A;  2WXV B;  3KXT A;  3CC4 T;  4EMK B;  2JJ9 A;  5M9O A;  4C92 G;  3A5Z B;  2FL7 A;  4X1V A;  1ZBX A;  3MEU A;  3OB9 A;  2UUE B;  4DBF A;  1AD5 A;  3QUI A;  3CCR A;  4ATO A;  4M75 A;  3CCQ A;  3OBY A;  2J6O A;  2BIV A;  2E65 A;  2Y90 A;  2BZY A;  2IW6 B;  3HTR A;  3QO3 A;  3BHV B;  3TW7 A;  2XI9 A;  1VYV A;  3OA6 A;  4M7D A;  1QVP A;  2E41 A;  4C0F A;  1BU2 A;  4HCK A;  1E7P A;  2DIL A;  3VS0 A;  3JCM f;  4BCQ B;  2YUP A;  3MKD A;  1TG0 A;  1YHQ T;  4J7I A;  2XHC A;  2MIO A;  3I55 Q;  1NYF A;  1QVF A;  2J7I A;  3MJX A;  4RKU E;  2V8I A;  2DZC A;  5LJ3 j;  3QXE B;  3X25 B;  1RAH B;  3VS3 A;  4EC9 B;  3F5X B;  4E6R A;  3SWN A;  3CC2 A;  1M2O A;  1PNJ A;  4M4Z A;  4J9H A;  2EQM A;  4J9G A;  4J6Y A;  1JB0 E;  1N8R U;  2PU9 B;  4OB1 B;  2VVK A;  1SPK A;  2LTO A;  5GAN 8;  3URG A;  2EW3 A;  3G71 Q;  1ZSG A;  3VUZ A;  4MFE A;  2O31 A;  4QVD A;  3FC3 A;  1OIY B;  5GMK e;  4FT2 A;  3FB9 A;  4QT7 A;  1KQS S;  4PJM A;  1VQ5 A;  3V7S A;  4CRI A; 
#chains in the Genus database with same CATH homology
 4M78 E;  3CCQ T;  4C92 B;  3CMA A;  4M77 G;  1W2B A;  3VKG A;  2QF7 A;  3TCJ A;  3OYE A;  1UB4 A;  4FT4 A;  4R55 A;  4UC4 A;  3OS1 A;  4II1 A;  4ZGD B;  3OYK A;  1KG1 A;  2IG0 A;  5J26 A;  1M9S A;  3A8G B;  2E1H A;  5A0L A;  2YRV A;  4PJO F;  3ASK A;  3I55 A;  5FRN A;  1RL2 A;  4M7A F;  5DLO A;  4LOC A;  3MP8 A;  2XDP A;  1WQ7 A;  4XU1 A;  3V8J A;  4BI8 B;  5LJ5 f;  2EYQ A;  2M1H A;  2X35 A;  1N9R A;  1WGS A;  4M75 E;  2E10 A;  5FLX E;  1YBY A;  4XK8 E;  5DY9 A;  5GAN d;  2CS7 A;  4L5G A;  1VQM T;  1KC8 C;  3CCL A;  4JJN K;  1AHJ B;  2RHX A;  4PLI A;  4PL6 A;  3L2Z A;  3CPW A;  4E7K A;  3I56 A;  4HA8 A;  2RJE A;  3BG3 A;  1BIA A;  4M7A C;  2VGM A;  3JCM h;  3JCM g;  3NTH A;  3QWL A;  4M7D E;  1Q82 U;  4J83 A;  3GPL A;  3JB9 H;  4EMH A;  5KCO A;  1Q81 C;  5CK9 A;  5FU6 B;  1NJI U;  3JB9 D;  2NLU A;  3VJP A;  3MEV A;  4C5G A;  4XU2 A;  3QG1 A;  1KQS A;  1I4K 1;  2WSC E;  1VQN A;  1BKB A;  4M78 D;  1YJW A;  3LW5 E;  4YTL A;  3CBM A;  4C8Q A;  4BY6 C;  2LCL A;  2LVM A;  4NS5 A;  2DXT A;  2HQX A;  3CC2 T;  4DQ2 A;  4AKI A;  3DLL A;  3AHU A;  4JS5 A;  2GF7 A;  1VQ7 A;  3M5A A;  2A7Y A;  4TVR A;  2B8A A;  3MHX A;  4N4H A;  3V8K A;  2HAX A;  4ZTF A;  5KE2 A;  3MP1 A;  3QKJ A;  3UPU A;  4LD6 A;  1N9S A;  2VGN A;  3L2Q A;  2DXU A;  2Y4Y A;  1PSF A;  4ELJ A;  2FHD A;  5KE3 A;  4E7J A;  2RHU A;  3CBO A;  3L2V A;  1W4S A;  4XTX A;  3UDC A;  3CCE A;  3OW2 S;  1QW1 A;  2V8K A;  1YIJ A;  4ZGJ B;  2L89 A;  4KUI A;  4Y28 E;  4F7U E;  3OS0 A;  3OYM A;  1H64 1;  3LYI A;  5EG2 A;  2P4T A;  4LDX A;  1Q7Y C;  1M1G A;  4C92 A;  4R56 A;  1M4Z A;  2VUB A;  1VQ5 T;  3M56 A;  5CKF A;  3ZEH A;  5HK3 A;  1ZQ1 A;  3CME A;  2DTI A;  4J8O A;  3JB9 I;  2RD1 A;  4HCC A;  3JB9 F;  4J7F A;  2G3R A;  5CQX A;  3WXM B;  3CCJ A;  2FVU A;  5FRM A;  5LJ5 j;  1NE8 A;  3JRZ A;  4M78 F;  1WJR A;  3M53 A;  4J6X A;  4MZP A;  4JRP A;  4FSX A;  2L8D A;  1BI0 A;  4JS4 A;  2E12 A;  1I81 A;  3SDZ A;  4ZTJ A;  1M8V A;  1QP2 A;  2ZZD B;  3S3O A;  2MWO A;  3VU3 C;  3I55 T;  2QQ9 A;  3FIF A;  3A8L B;  4PJO B;  2EQU A;  4M7A B;  5GAM f;  3EFR A;  5CKB A;  3QII A;  3JB9 J;  1K9M C;  1M5Q 1;  2FYK A;  5J3B A;  3ME9 A;  1HXD A;  3QBY A;  5HKC A;  4HLQ A;  4V2S A;  4BI4 A;  3HHT B;  2E6N A;  5LJ5 h;  4M75 F;  5LJ3 d;  2K2V A;  1QP3 A;  2DJZ A;  4M78 C;  4M6V A;  3CCL T;  3QYE A;  3QDR B;  3OS2 A;  4KUD K;  3DB4 A;  2E6Z A;  3RKY A;  4HT8 A;  3I56 T;  1N27 A;  5IN1 A;  2XDB A;  3OYD A;  2DTH A;  3KUF A;  1VQ8 T;  3JCM e;  4MML A;  4CI0 C;  3M58 A;  3V7C A;  1YJN T;  3G71 T;  1FWZ A;  4M7D F;  2PVG B;  4XU3 A;  5GMK i;  5CR2 A;  3HRS A;  3JCM J;  2RH2 A;  4OGC A;  5CCA A;  2KVQ G;  3OY9 A;  1Y71 A;  1M1K U;  1QLB A;  1YJW T;  1JJ2 S;  2WJ9 A;  2DD5 B;  4C0D B;  3PIO A;  3GLX A;  4VUB A;  1FXX A;  3RMQ A;  1UGR B;  4QSH A;  3PMI A;  2DXB B;  4HNU A;  1OYX A;  5CO7 A;  4EMK A;  4N4G A;  2WSF E;  2D6F A;  5GAN 7;  2OAU A;  3F70 A;  3O8V A;  4IUQ A;  4MFD A;  2R57 A;  2JNG A;  3FJP A;  4M7D C;  3HRT A;  4FU6 A;  1G3T A;  1WQW A;  2JVV A;  3VKI A;  3J80 E;  3WVE B;  3CCE T;  1O75 A;  4HT9 A;  2RHY A;  4C8Q E;  1YIJ T;  2DPP B;  3VYH B;  2P0Q A;  1LOJ A;  3CCU T;  1KC8 U;  4P5N A;  4JX4 A;  4A53 A;  3FDR A;  4F7U F;  5GAN f;  5FU7 B;  4O6J A;  5GAO n;  1M1F A;  3S3M A;  1G5V A;  4M77 D;  4X9C A;  2DO3 A;  3PFS A;  3M9Q A;  4PJO G;  2JOY A;  1BI2 A;  2DAQ A;  1UGS B;  2K5I A;  4IUV A;  3VV0 A;  3CME T;  4M7A G;  2YLB A;  3E9G A;  1MHN A;  4QQG A;  2ZZD A;  4LDV A;  3JCM c;  3OYC A;  3CCJ T;  3CCV A;  2DKG A;  3L2R A;  5L8R E;  4XAX B;  1Q81 U;  1BIB A;  4PKC C;  4M77 A;  1K8A C;  5CKH A;  3TU4 K;  2OTL T;  3SD4 A;  5GMK m;  5C0M A;  1O9S A;  1D3B B;  2RA2 A;  3C4S A;  3SWN C;  5I2M A;  3OSV A;  4C92 E;  4ME7 A;  1UGP B;  2RI5 A;  2MWP A;  4L6V 5;  5FRO A;  3OYH A;  5C6S A;  4MZT A;  5D6X A;  5LJ5 e;  5DM7 R;  5GAM g;  4RG2 A;  4JRI A;  2E5Q A;  2DK3 A;  4OGE A;  2GCX A;  4M75 B;  3BW1 A;  2CYZ B;  2GQV A;  2XK0 A;  3GOX A;  4BDZ A;  1N8R C;  3MEW A;  1VQ8 A;  1BYM A;  2M16 A;  2HNI A;  2DD4 B;  3DB3 A;  4IUP A;  4C5E A;  2DVE A;  4C8Q D;  3HO8 A;  1YJN A;  3G71 A;  3LWH A;  1LNX A;  4X9D A;  1OZ3 A;  2KK4 A;  3CC7 T;  3L42 A;  3TRE A;  3L2W A;  2X4J A;  4JRK A;  3MO8 A;  2F5K A;  3C95 A;  2DD5 A;  5I21 A;  1Q7Y U;  2CKK A;  2QQR A;  3BFM A;  3G6E T;  4M7D B;  1I5L A;  1X75 C;  2DXB A;  2ZCF B;  1KQ1 A;  5A2Q E;  3Q1J A;  4E7L A;  2QI2 A;  3BDL A;  2DEQ A;  3JCM Q;  3UT1 A;  4OB0 B;  3HB9 A;  4NL2 A;  3GNG A;  4N0A A;  3TW6 A;  3MCA B;  2WSE E;  2E64 A;  3KBG A;  1P92 A;  3QHS A;  4WF2 A;  4BD3 A;  4M77 C;  5CKD A;  2JUF A;  2PQW A;  4ELZ C;  2QQS A;  4C92 D;  3N5B B;  5GAO m;  3PT9 A;  3DKM A;  2BS3 A;  1VQ6 T;  1VQP T;  3E1S A;  2LCC A;  5LJ5 d;  1K9M U;  1TH7 A;  4EDU A;  2C06 A;  2KQW A;  4L59 A;  3J7A F;  3CCU A;  2EWN A;  4BB7 A;  3JB9 G;  1WPY A;  2QDY B;  4NL3 A;  4JRQ A;  4BBR M;  3RMS A;  4M78 G;  2KMT A;  2PVD B;  5CAI A;  1KQ2 A;  2VXF A;  3R6O A;  4RCC A;  1YIT A;  2K3Y A;  5GAO q;  2RJD A;  3GIB A;  3MET A;  1XNI A;  4F7U B;  1QVG S;  2LT4 A;  1I8F A;  2I2L A;  1UGQ B;  5GAN g;  3CCM T;  3CCS A;  2RK2 A;  4IUT A;  3MEA A;  3NTI A;  2E70 A;  2ZPG B;  2MMP A;  1D3B A;  5A0D A;  1QVF S;  1FKM A;  3CCV T;  1VQL A;  2OTL A;  4AKG A;  3QPH A;  2EIF A;  1IRE B;  2ZPI B;  2D0Q B;  3H8Z A;  5I2S A;  4E7I A;  1JBM A;  2VC8 A;  2XKO C;  4M75 G;  1S72 A;  1Q82 C;  2OTJ A;  1KHI A;  2HD0 A;  4C8Q C;  3LX7 A;  4FL6 A;  3OYB A;  2RB6 A;  3MP6 A;  4XTU A;  2X4Y A;  4NOY A;  3S3N A;  1FX7 A;  3P8B B;  3CXC S;  4DA4 A;  1YJ9 A;  5GAN 5;  1Q86 C;  4C92 F;  5J39 A;  2BKD N;  4BE1 A;  2LDM A;  2CGH A;  5GAM e;  4N0A C;  3VYG B;  4EMG A;  4Q5W A;  2EJF A;  4JDS A;  2QXF A;  3VUB A;  2DD4 A;  3OYA A;  3NTK A;  4M7D G;  3OBW A;  2M9U A;  3L1A A;  4BY6 B;  2EJG A;  4A54 A;  1U1T A;  4HCB A;  4M77 E;  5CKE A;  5GAN 6;  3SFM A;  4BE0 A;  5GAN 2;  3FRN A;  2EKO A;  3P8H A;  3CC7 A;  3HFN A;  3A8H B;  2FB7 A;  1VIF A;  5A0G A;  3OW2 A;  1YI2 T;  3JCM X;  4O5V A;  3BG5 A;  2ZPF B;  2XD0 A;  2K3X A;  2QQA A;  3OMC A;  4C92 C;  3G6E A;  3ZBD A;  3H4C A;  2R58 A;  4XTY A;  4B9X A;  3OYL A;  3RUX A;  2DXC B;  1V29 B;  3HZJ A;  4QW2 A;  4KUL A;  3TEE A;  3A8M B;  3WVD B;  1OZ2 A;  1QVG A;  4ZN1 A;  2VXE A;  2CZ1 B;  3QJY A;  1W2B S;  4AKH A;  3CPF A;  2RM4 A;  3PMT A;  3GP8 A;  2K5L A;  1K8A U;  2DTO A;  2WAC A;  1VQ6 A;  1VQO T;  4OF1 A;  5GAN 4;  1VQP A;  2YHT A;  4HL4 A;  2XID A;  3ZFJ A;  4F7U G;  4OVA A;  4N4I A;  4PLL A;  2VV5 A;  3JAM E;  4OB2 B;  4Y91 A;  3PTA A;  2V8J A;  2G77 A;  2ZPE B;  4E7H A;  2XU8 A;  3M55 A;  4A4F A;  4HNT A;  1XOV A;  4HNV A;  3OQ5 A;  4QQD A;  4F7U A;  4AI6 A;  3OYI A;  4JX5 A;  1U1S A;  4PJO D;  2HBP A;  4M7A D;  3JCM d;  3CD6 A;  4RCB A;  1YIT T;  2HQE A;  2ZGW A;  2BS2 A;  4OMF B;  3EFS A;  3V8L A;  3CCM A;  3CPW S;  2QFZ A;  5GAN e;  3HFO A;  3ER0 A;  3NFC A;  2XIC A;  3OS5 A;  1KHC A;  5GAM j;  3CC4 A;  4C5H A;  5LJ3 g;  4ZGE B;  3PNW C;  3CCS T;  4PJO A;  4D6W A;  4GY5 A;  4BBS M;  2KY9 A;  3VKH A;  2RJC A;  4M78 B;  4M7A A;  2GFA A;  1N6A A;  4MDW A;  3JCM b;  4RMO A;  1VQL T;  3BY7 A;  4C5I A;  2OTJ T;  2R5M A;  2GFU A;  1S72 T;  5LL6 S;  2RO0 A;  4A4E A;  1H3Z A;  2XG8 D;  3QYH B;  3P8D A;  3E9F A;  5DLQ E;  5AYF A;  1ZHI A;  1JJ2 A;  5GAO p;  1SSF A;  1M90 C;  3CCR T;  1X6O A;  2KR6 A;  2BUD A;  3OYG A;  2QEX A;  5GAM h;  4XQ3 A;  1YJ9 T;  1M1K C;  2YLC A;  2ZPB B;  1R8O B;  4BUG A;  4EMK C;  2LQK A;  3JCM W;  4XU0 A;  2AHJ B;  2BS4 A;  4NC6 A;  4HKE A;  4OB3 B;  1EIF A;  1VQ9 T;  4QVC A;  4XTV A;  5GMK l;  3OYY A;  2EQJ A;  2DIG A;  1BI3 A;  1VIE A;  1XTD A;  1YI2 A;  2CZ0 B;  2K57 A;  2P0K A;  3S6W A;  1K73 C;  2P0P A;  1IZ6 A;  4M77 F;  3QZ5 B;  3GF5 A;  1KD1 C;  1VQ4 A;  4IKF A;  3LH0 A;  2DXC A;  2LRQ A;  2LT1 A;  2PUK B;  4J5Y A;  3EAE A;  4FM4 B;  2XDD A;  1WJQ A;  2IVW A;  3BDU A;  4MIM A;  1X01 A;  2JTF A;  5CQY A;  2ZPH B;  2K4Y A;  1YHQ A;  5KH6 A;  1NPP A;  3X24 B;  5CIU A;  3E19 A;  2EJ9 A;  2K5F A;  3RKX A;  2M0O A;  2QQB A;  3UWN A;  4ELY C;  4PJO C;  3X26 B;  2LX9 A;  2A3L A;  2EAY A;  2MI6 A;  3HPW A;  3OYJ A;  1VQO A;  3L2U A;  4Z6Y A;  3C94 A;  2KSS A;  4FIB A;  3CBP A;  3HSB A;  3G7Z A;  5GAN j;  4C8Q G;  1VQK A;  3INZ A;  4OP0 A;  4DOV A;  1OI1 A;  2F5T X;  4LD9 K;  3G4S A;  2QQ8 A;  2D9T A;  2KDS A;  2RI2 A;  5HY6 A;  4DOW A;  3OSS C;  3RKW A;  5KCH A;  1Q86 U;  5EJC A;  3JSC A;  3DLM A;  4IUR A;  4C8Q F;  5GMK j;  2RHZ A;  3KHI A;  4IUU A;  4JLG A;  3DL1 A;  1JRI A;  5LJ3 f;  3SWN B;  4B9W A;  4BE2 A;  2QA4 A;  3RER A;  2EQK A;  2RI3 A;  2PUO B;  2JN0 A;  3FLG A;  5GAN h;  3CD6 T;  4M78 A;  3LLR A;  5GAO l;  1XQH A;  3GNF B;  3V7R A;  2KMG A;  5LJ3 e;  3BG9 A;  1G3S A;  1WJS A;  5D6Y A;  4EMK B;  3KXT A;  3CC4 T;  5M9O A;  1G3W A;  4M75 D;  4C92 G;  3A5Z B;  2FL7 A;  2LNV A;  4C0D C;  1ZBX A;  3MEU A;  3LGF A;  5GMK h;  1Y96 B;  4HCZ A;  4C0G A;  3PIP A;  1NJI C;  3OB9 A;  1RI0 A;  1NPR A;  2RJF A;  3M4Y A;  2DIQ A;  1NZ9 A;  2Y4X A;  3OMG A;  2L3R A;  3QUI A;  4ZN3 A;  3CCR A;  5D6W A;  3JCM V;  4ATO A;  4M75 A;  2JTM A;  2CZ7 B;  3CCQ A;  1MGQ A;  3X20 B;  3OBY A;  3M54 A;  2QEX T;  5GAN 3;  4M7D D;  2EFI A;  2BIV A;  3QYG B;  1B34 B;  2O4X B;  2E65 A;  1VQ9 A;  3CMA T;  4PJO E;  1VUB A;  2Y90 A;  4M7A E;  4QVZ A;  1YCY A;  3QO3 A;  2PVO B;  2MAM A;  1HK9 A;  4QQ6 A;  3TW7 A;  3M4G A;  2MF2 A;  2XI9 A;  3OA6 A;  5FU7 C;  4M7D A;  1QVP A;  2H3J A;  4Z02 A;  3QYB A;  1DJ7 B;  2E41 A;  2JZ2 A;  3C12 A;  2X4W A;  5CVI A;  3T9N A;  4C0F A;  2KAF A;  4LDY A;  4M77 B;  2F69 A;  4MDX A;  4JUV A;  1VQ4 T;  4E47 A;  4EPC A;  4J6W A;  1VQM A;  2DZ9 A;  1E7P A;  3A8O B;  4BI3 A;  5LJ5 g;  3HKS A;  4KBM B;  4LDW A;  4BDY A;  4C0Z A;  3JCM f;  1BI1 A;  3M57 A;  2X4X A;  1YHQ T;  2LC4 A;  2VYT A;  4J7I A;  3PGG A;  2XHC A;  1G3Y A;  4BAC A;  5IAY A;  3JCM P;  4LDU A;  1QVF A;  3QJ6 A;  1U8R A;  4X34 A;  3HBL A;  5IT9 E;  4RKU E;  4GLK A;  1UEB A;  2V8I A;  3OYF A;  2DZC A;  3QZ9 B;  5LJ3 j;  3QXE B;  3X25 B;  4MZM A;  5GAM d;  1VQK T;  3SB2 A;  1GXI E;  3LGL A;  2CZ6 B;  4A4K A;  4A4G A;  4A4H A;  3G4S T;  1Y7X A;  4M75 C;  3SWN A;  4JLI A;  3CXC A;  1M90 U;  3CC2 A;  1VQN T;  2QTX A;  4KT0 E;  4XTZ A;  2O01 E;  3OYN A;  2EQM A;  4J6Y A;  4C8Q B;  2QDJ A;  1JB0 E;  1VQ7 T;  3QSU A;  3X28 B;  1N8R U;  2PU9 B;  4OB1 B;  5FU6 C;  2QA4 T;  2LTO A;  2L5Q A;  5GAN 8;  3URG A;  1Y07 A;  3M59 A;  5LJ3 h;  4MMK A;  1K73 U;  1WNL A;  3RIR A;  1Y96 A;  3RES A;  1PSE A;  4XTW A;  3VUZ A;  3HRU A;  1KD1 U;  4MFE A;  4QVD A;  3J81 E;  2RHI A;  3FC3 A;  2LQ8 A;  5GMK e;  4RG8 A;  4FT2 A;  3FB9 A;  4JX6 A;  1KQS S;  4PNO A;  3CEY A;  3FEO A;  1VQ5 A;  3VYG A;  2RK1 A;  2R5A A;  3H6Z A;  3HL8 A;  3HP9 A;  5GAO r;  1B34 A;  1LJO A;  2O4X A;  5HK0 A;  3LWI A;  3V7S A;  4CRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...