2CYZB

Photo-activation state of fe-type nhase in anaerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title photo-activation state of Fe-type NHase in anaerobic condition
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cyzB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cyzB02
3A8OB 2CZ0B 4OB2B 2PVOB 2WSEE 2ZCFB 3X24B 2DXBB 3A8MB 3X25B 3X20B 2DXBA 2ZPEB 4RKUE 1GXIE 2PU9B 4ZGDB 2DD4B 1AHJB 1V29B 2DD5B 2DPPB 2PUOB 3WVDB 3WVEB 2WSFE 2ZPBB 2D0QB 4OB1B 2DD4A 1UGQB 3A8GB 1JB0E 5L8RE 1PSFA 2PUKB 3A8LB 2CZ1B 3A8HB 1DJ7B 2ZPHB 3VYGA 3QZ9B 3VYHB 2ZZDA 3HHTB 1QP3A 3QYGB 2DXCB 2DXCA 4FM4B 2ZZDB 4KT0E 1QP2A 2WSCE 2AHJB 2ZPFB 1UGSB 3X28B 3QYHB 1UGRB 2CZ7B 2ZPIB 3QZ5B 4ZGEB 4OB3B 4L6V5 2ZPGB 3VYGB 1PSEA 3LW5E 2CYZB 3X26B 2DD5A 2PVDB 4Y28E 1IREB 2QDYB 3QXEB 2O01E 2CZ6B 4XK8E 2PVGB 4OB0B 1UGPB 4ZGJB
chains in the Genus database with same CATH superfamily
4OMFB 1O9KB 3QIIA 1YJNQ 1SSFA 2LJ0A 2PQWA 4NL3A 5D6YA 2JUFA 1TSFA 3JCMd 3RMQA 2X4JA 1QLBA 3I56Q 2ESWA 2QQSA 3I5RA 4QVCA 4EOKB 4KH1B 5A2QE 5KE2A 5FRMA 3CCUQ 2RD1A 5HQ0B 2CP3A 4CFVB 1PCXA 4BB7A 2GNCA 1VQ7A 1V29B 5LMKB 1P5EB 2DK3A 2LCCA 2LX9A 3BE3A 2NLUA 1RLPC 3OS1A 1ZQ1A 3B57A 3OYEA 1RUWA 4Z88A 4OB1B 4MZPA 4J9EA 4C8QE 4M77C 2E64A 3L2RA 2F2VA 2O4XA 2W96A 1UB4A 3SWNB 3BG3A 2M51A 1VQ8A 4BBSM 2KMGA 4EOPB 1T0HA 2CJMB 1FWZA 1U1TA 2WMBB 3CMAQ 3TREA 2K79A 1W1FA 2QQRA 4NL2A 2EYYA 2E5KA 4MMLA 4ZN3A 1QWFA 1V76A 4FCYA 2K9GA 2DEUA 3HO8A 3DTOA 1RAFB 1VOLA 2E70A 2MOXA 4RUGA 4M78D 2E3HA 4J6YA 3QYGB 4E6RA 5GANg 1B34B 3WXMB 1U1SA 2DJZA 4EC8B 1N9SA 2DRMA 1H3ZA 1FX7A 1G3SA 3TNHB 4RTUA 1VYVA 1VQ5T 1HK9A 2RHYA 2NUPB 3EFOA 1ABOA 1TUCA 4EOIB 4JJBA 1MV0B 2HAXA 2LQWA 4M7DB 2RQRA 1QMCA 2RPNA 3VKHA 2J6FA 1VQMQ 1HJDA 2QEXQ 3JAME 5LQFB 3EHQA 2VUBA 5LJ3j 5GAMe 2F2XA 1AVZC 4C92E 2HMAA 2D0NA 2CCIB 3R6NA 2FRYA 2DL5A 1OEBA 2DILA 4C8QC 5ECAA 1SKUB 2VC8A 3FJ5A 1JU5C 1G3TA 3OYLA 4ZGJB 1OYXA 2DZCA 1VQ9T 3OYAA 2O9SA 2GTJA 1LNXA 3OW2A 4BXXX 2GF7A 3QDRB 2P4TA 3QYBA 1FINB 3OA6A 3JCMX 1UTIA 4KULA 1NG2A 4LNPA 2L5QA 3I5SA 5GAMj 3CXCP 3AHUA 3JCMV 5DY9A 4JUVA 3VS1A 2DD5B 2UZBB 2DA9A 5FRNA 3EG2A 5M9OA 2KRMA 4J9FA 3M54A 2K5FA 5DLQE 5EFQB 2KT8A 5KYWA 1JKWA 1M1KU 1QVFA 2AKKA 3DDQB 4KUDK 2BE7D 2DF6A 3EH2A 5KYUB 5LJ5f 1C6VX 3G6ET 3UF4A 2MCNA 1AZEA 1H3HA 1NPPA 3MKDA 1K9MR 3VS0A 3H8ZA 3MIAB 1S72Q 2KY9A 2K6DA 5CKBA 1QCOA 1MV3A 3CBOA 1KD1C 3QJ6A 5I11A 3GF5A 4J9CA 1CKBA 1NBEB 4QQ6A 1VQ5Q 2H3JA 4X9DA 3M59A 2YWWA 3A1PA 2CGHA 3TU4K 1GBQA 1OGUB 3M4GA 2P4RA 2EYXA 5EG2A 4XTVA 2QTVA 3J7AF 4CFWB 2GQVA 3I55A 2F2CA 1D1AA 1YI2Q 3CCLQ 3CPFA 1VQ7T 3QZ5B 5GJWB 2WXVB 1H4LD 1KXUA 1YIJA 1M8VA 3NDQA 1TUDA 2YSQA 2QDYB 3OMGA 1M3BA 3H9NA 1JXMA 1GCPA 2EJGA 2W9ZA 4OMMA 4FYWB 4XU2A 1M27C 4FW1A 2RI3A 5GAN6 1KG1A 1VQ6A 2QAZA 2HNIA 4JPBW 3DDPB 1WHKA 1U3OA 2YLBA 3A8MB 3PIOA 4LDXA 2EWNA 4C8QB 3EG1A 5LJ5g 1KSWA 4CC4B 3BW1A 3E2UA 2DVEA 2DD4B 1RAHB 1VQ5A 1AWXA 4D8KA 1ZBJA 1YJNT 1H92A 3VV0A 4CC3A 2RNAA 5KYNA 3A8GB 3J81E 5FU7C 1W4SA 1RAEB 1AZGB 2EUFA 2RJEA 3QO3A 1Q82U 4FYVB 4IKFA 4PJOD 3RNJA 2DETA 1KHIA 3CCVA 1YHQQ 3FDRA 3QZ9B 4ZTJA 4BCMB 2JTEA 3EGXA 4WF2A 1TG0A 4M75D 2PK9B 2AK5A 2E10A 3VS2A 2L3PA 4M78C 3LQ5B 2CUDA 1H1PB 1J3TA 2XD0A 3L2UA 2WIPB 5CKEA 2G3RA 1UGSB 1UGVA 4AMCA 4PL6A 4JS4A 1X2KA 3MPUB 3F70A 3QSUA 2QK0A 3OQ5A 2WHBB 1FKMA 1PC0A 3M57A 3OYIA 2ECZA 5I21A 1Z9QA 5IHKA 1D3BB 3CD6A 3OYGA 1XO2A 2QF7A 4BBRM 2OAUA 2P0PA 3JB9F 2L8DA 4EPCA 2LQ8A 3TN8B 4MZTA 1Q86C 4LD6A 3CCVT 4Z02A 2P0QA 1G2BA 1KQSA 4CFUB 3MHXA 4MZMA 2I53A 3BDUA 2V8KA 3MJXA 2IW9B 3I56T 3FEOA 1UGPB 3CC2Q 1VQOT 1K0XA 1YHQA 3QHSA 1UHCA 2WSEE 1UFFA 4J7IA 2B86A 2D6FA 3MP1A 3META 3H0FA 2K3YA 2D1XA 1T0JA 2VWFA 1ENWA 3OYCA 2AZVA 4MMKA 1O75A 2QQ8A 4ZTFA 2KDSA 1VQNQ 3UT1A 3POMA 2CUBA 4J9DA 1D1CA 1OX9A 1MGQA 4JJNK 3EOCB 1O9KA 4M7DG 5LJ5j 4OF1A 3BHUB 2DAQA 2HCKA 3EG3A 5I2SA 2BKDN 1FMKA 3PO3S 2Y4XA 3SD4A 3E19A 4F7NB 4CRLB 1NJIR 1C9BA 1D0YA 3JRZA 3CD6Q 3RKYA 2ZPHB 5J3BA 1OI9B 2RJFA 1NLOC 4YOZA 1M90C 1VQLQ 1VINA 2OJ2A 5FGKB 3LGFA 5FU7B 5KYWB 3JCMe 2QEXT 3OW2S 3EG9B 2MIOA 2C0TA 2CSIA 2DXCA 2DXTA 2FVUA 5HK3A 5C0MA 2ZZDB 3QJYA 4XU3A 1YJNA 1SPKA 4TTHA 4EOSB 2C5VB 1K1ZA 4QQGA 4F6WB 3TEEA 1VQKT 2DTOA 4EMHA 4AG2C 1Y07A 1HXDA 3LYIA 4A4EA 4PFPA 5LJ3h 2ZPIB 2FPDA 3KUFA 2EPDA 1WIEA 3EIDB 2KEAA 1WA7A 3BHTB 1QLYA 4OGCA 2A7YA 2F1LA 5GAN2 3TVTA 1T3LA 1QVFP 2EJ9A 4PJJA 5IHIA 4ELLA 1YJ9A 1E7PA 2FPFA 5LL6S 2PTKA 1K73C 4YOSA 2PZ1A 2CZ0B 1Q7YR 4E7JA 4JX6A 3BDLA 5I22A 3JCMW 1VQPT 1WQWA 3MP8A 4BI4A 3BG9A 4DA4A 2BKZB 2DXBA 1GL5A 1OKVB 1BKBA 1PM3A 2EYWA 5KCHA 5EJCA 4AFUC 8AT1B 3WVDB 1YN8A 4MIMA 5D6WA 2K3BA 1IHWA 2E4HA 2FRWA 2HL3A 3LX7A 5CR2A 1RABB 2AKLA 1X2QA 2BE9B 4MDWA 3CPWA 4GLMA 2J6OA 2ZGWA 4JZ3A 2CH4A 2DM1A 4HCBA 3GPLA 3VYGA 3HSBA 3OYHA 4BE0A 1M2VA 3CCQT 4M7DF 4EOQB 2V8JA 4N4IA 1W98B 2JN0A 2GGRA 3SWNA 1YJWQ 4M77E 2ROTA 2AT1B 2H8HA 4F14A 4CFMB 2HL5C 1I5OB 2M0YA 4C92D 4DBFA 4HNUA 4EIKA 1IRXA 1B07A 2KYMA 5CAIA 1M5Q1 2QGFB 4HA8A 2X9HA 3HB9A 4DEXA 1VA7A 4M4ZA 3JV3A 2KT1A 3DLLA 1K73R 3O8VA 2DL4A 2OTJT 2CYZB 3FRNA 4M78F 4ATOA 3BFMA 2DBKA 2F69A 4XTUA 4KUIA 2V22B 4K11A 2QTXA 2A08A 2BZXA 2LJ3A 1OIYB 2PNIA 2DIGA 1M90U 2DMEA 1D3UB 3TSWA 4OB2B 1H26B 5HBHB 2RI2A 1BI0A 1ZP2A 4E47A 4DEYA 4Y91A 2OTLT 4RCBA 2ROLA 4II1A 1VQ4A 3X24B 2B9RA 4M75A 3HZJA 3SB2A 2L2PA 3FJPA 2HDAA 1H8KA 4LN2A 5A0GA 2YXYA 2JJ9A 3CCUT 1OULA 4GY5A 2CS7A 1OU8A 2HZYA 1UGQB 4BCFB 4M78B 2RQVA 4C0DB 3CCSQ 2JVVA 1WHMA 2HQXA 2LTOA 3CC4A 4A4KA 2RH2A 4ZN1A 1JRIA 4CC2A 3MO8A 2OTLA 4YC3B 1H28B 2G77A 2XI9A 2E3IA 3THKA 2IG0A 1SF9A 4X1VA 1N8RU 2VGNA 2R57A 4C92B 1BK2A 3VS6A 1OKWB 1QW1A 2ZZDA 1H1RB 2DYIA 2A36A 5KYYB 1VYUA 4WTOB 2J7IA 4EOMB 2X3XD 2EQJA 5CCAA 2VXEA 4FM4B 3VS5A 4FU6A 4M75G 2CREA 2LMJA 2FL7A 3VJPA 4HVWA 3MEUA 5ACBA 3RESA 2JM8A 3PMTA 4FIBA 1KIKA 4PJMA 1M4ZA 1VYWB 5EC7A 4M75C 5GAN7 1WXTA 4FSXA 1KC8C 2MWPA 1SG5A 3I35A 4FX3B 4ME7A 4PFZA 1FMWA 3JCMc 4E7IA 1YBYA 1GFCA 4A4FA 2PVDB 3CC7A 2XKOC 1IREB 1AISB 1PNJA 4M78E 2CP0A 5C6SA 2O01E 2C5OB 1ZUUA 4OGRB 2KK4A 2PVGB 4M78A 1WJRA 3CCQQ 2DNUA 1Q82R 1Y7XA 4BCGB 2FZCB 3G6EA 3VKGA 4OMNA 4PLIA 4D8DA 4L5GA 3SHWA 1MMGA 4DOWA 1IO6A 1HSQA 3HBLA 4A4GA 5L2WB 1R8OB 2DFUA 4C8QD 2WEVB 4BY7X 1KK7A 3HTRA 3TQ7P 3TW7A 4BCOB 2A3LA 2E6ZA 4PK4A 3URGA 2X51A 4A54A 3CCET 3NFCA 3M53A 2QA4Q 3OS2A 4CFUD 2PUOB 1OZ2A 3FB9A 1M3CA 4AKIA 2MK5A 4ORZA 2JNGA 4M6VA 2FYKA 1EIFA 3VUBA 1PSFA 4IUTA 3JCMP 2QDLA 2QEXA 2PUKB 3CC2T 2IVXA 2GQIA 2CZ1B 1XJWB 3OYFA 3QPHA 5HVYB 1K4US 2IN3A 2L3RA 1BB9A 4A53A 1WPYA 1YITA 2W2HA 2HBWA 3CC7Q 3C94A 4F7UG 4RTXA 2JW4A 4LD9K 5LJ3e 1G3NC 2W0ZA 4RTVA 4HCKA 2GFUA 1B3QA 3MEAA 1WJSA 2KXCA 3NMZC 3OW2P 2CH4W 2QG9B 4PJOC 4AKGA 1KHCA 2KVQG 3L2ZA 3KBGA 4XTWA 1X6OA 3QKJA 3VS3A 1UGRB 3DOGB 2BZYA 1KJWA 2YHTA 4JDSA 3UATA 5GAMg 2QQAA 4RCCA 2L3QA 2O2OA 3TNIB 1Q82C 4IUUA 3G4SQ 4C0GA 2CP6A 2VKNA 2K5LA 2DMOA 2HQHA 4KRDB 1GCQA 5GJVB 4HVUA 1KD1R 3A8OB 2QQ9A 3M9QA 4CFXB 3BG5A 2F5TX 1PRMC 2LZ6B 3V8LA 1OZ3A 1YITQ 2WPAB 1Q81C 2LCSA 2NUTA 1VQLA 4HCCA 3MI9B 5GAOp 2KRSA 3NTHA 2EKOA 4BDYA 4JX4A 2ZPEB 1X6BA 1BI2A 1WLPB 3S3OA 4OMOA 3CCMQ 2KR6A 2JS0A 1F5QB 5IT9E 4M7DD 4BCMD 1YCYA 4M7AA 1U5SA 2DERA 5LJ5h 1RACB 3JSCA 2M9UA 4RODA 4BACA 5IAYA 3V7SA 3OYMA 1VQLT 1QMZB 3REAB 1VOMA 4DOVA 4QSHA 4BCIB 2DXUA 3HRSA 4KBMB 1G3WA 3QWLA 1VQOA 3CBMA 2FO0A 4J9IA 4IUPA 1ABQA 4HVVA 4BDZA 4F6SB 1MUZA 4LUDA 3GIBA 1IHVA 2MYSA 4PFOA 1ZSGA 3H6ZA 3GP8A 3RMSA 2J05A 1WHLA 1RL2A 1LVKA 2R5MA 2YRDA 1M1GA 4F17A 3IQLA 4F7UA 1U06A 3L1AA 1VQ7Q 3G1JA 1KQSP 2V1RA 1XNIA 4C92C 3CEYA 1LCKA 4Y92A 4XTXA 3H0IA 3X28B 2CP5A 4JLGA 1GCQC 1UJYA 2KE9A 3GTMS 2M16A 1FMVA 3EH1A 3M5AA 1M1KC 1VQ8Q 3OYKA 5GMKh 2GCXA 1R77A 3HRUA 4J9GA 4O5VA 5IDNB 2RQUA 1CKAA 3CCMA 3LH5A 3N5BB 1BBZA 4C5GA 3LWHA 5J26A 4I3ZB 4RTWA 3GNGA 4FYYB 3CCRA 5HKCA 2B8AA 5HBEB 2UZLB 4R56A 2RN8A 3PVLA 4F7UE 1HYOA 1KC8U 3OMCA 4BCQB 1Q81R 4J8OA 3QDFA 2M02A 3CC7T 4M75B 5GAMd 2RHIA 5CK9A 2YDLA 2JTMA 4C8QF 4C0DC 3CCVQ 1Q86U 4JJDA 2XICA 3NHNA 1E7OA 2DLPA 1YITT 4BI8B 4JZ4A 1XTDA 2EQUA 3P8BB 2I40B 2DL7A 1YIJT 4BI3A 4P5NA 1URCB 1AWOA 2RO0A 1K76A 1QVPA 1E6HA 1N5ZA 2GFAA 1KD1U 3QHWB 1X27A 4RKUE 5J39A 3VUZA 4IMYB 3NPFA 4XAXB 2OTJA 4QW2A 3CMEA 1VQPQ 1N6AA 2MI6A 2JGZB 4PJLA 2RA2A 4B6MA 3CCLT 3EJ1B 1I4K1 3HRTA 1Y71A 4IIMA 5A0DA 1XQHA 5AYFA 3H4CA 2FPEA 4JLIA 3UWNA 5A0LA 2KYBA 4F7UF 3M0UA 2PK2A 2QXFA 1Q86R 1QCFA 2KI7A 1PKSA 2XDPA 2I2LA 1V1CA 1YHQT 1R0BG 3ER0A 3JB9I 2K2MA 4M78G 1I07A 4M77A 3JB9J 5HBJB 4N4HA 5ICPB 4XU0A 3CPWP 1P92A 3OYBA 3PTAA 5CYIB 2UUEB 1M3AA 2EVRA 3R6OA 5GAOn 1KFZA 1VQNA 2VYTA 2WJ9A 1G83A 3M0TA 4UN0A 2RF0A 3HPWA 3MEVA 1NPRA 5GMKl 3DB3A 2LNHB 1D0ZA 3VRZA 4F7LB 3OSVA 3DL1A 4Q5WA 4M7DE 2JM9A 2QASA 3DKMA 3I55T 1JQQA 1VIEA 3GBQA 3UA7A 4PLLA 2CT3A 2OX7A 1N8RR 1H1SB 4QQDA 2DBMA 1GRIA 3OYDA 2NYSA 1Y96A 2I0NA 5IH2A 4PJOB 1NEGA 2WFYB 1WJQA 2K4YA 2K7AA 2VB6A 3RIRA 2G6FX 1UNGD 1NYFA 3G4ST 4ROEA 1GY3B 4J83A 1OL2B 1WDXA 1EZZB 2CZ6B 4E7KA 1YJWA 4OB0B 4M7AB 1QQJA 1LOJA 5GAOm 3LH0A 4M77B 3SWNC 4ANJA 1YCSB 2JZ2A 4IIOA 7AT1B 4XQ3A 2C4GB 5IN1A 2V1QA 4CC7A 1WHGA 4B9WA 4C8QA 2OAWA 3X20B 1X01A 1JOWA 3VU3C 1YI2A 3CMET 2QQBA 3RUXA 1ZSZC 2CT4A 4JX5A 5GANh 5FU6B 2O88A 4E7ZA 2YRCA 4OMQA 2EGEA 1QVGA 1K9AA 5GAN3 1EX4A 1Y96B 2DX1A 1PKDB 1YNZA 1TH7A 1IZ6A 1X75C 3RKXA 1OI1A 2ZAEA 2EFIA 2IIMA 1RLQC 2P0KA 4RTTA 1UJ0A 4NSTB 1K9MC 2A37A 2QYZA 4OVAA 4AKHA 1DJ7B 5GAMh 1ZA1B 2HSEB 3AT1B 2NWMA 3VKIA 1VQKQ 3L2VA 4F16A 1MHNA 3VYHB 2X3WD 4YTLA 4E7HA 3C0CA 4PJOG 5GMKe 1BCMA 2LP5A 2D8HA 3QWXX 1X43A 5FWCA 1YJ9Q 3A5ZB 1PHTA 4BCJB 2BUDA 3CCEQ 5IDPB 2LVMA 3GNFB 2LW4A 2DVJA 2AHJB 1B7TA 1IXDA 3G71A 4NC6A 3NTKA 2UZDB 2WIHB 3EHRA 3NTIA 2CZ7B 1LPLA 2KBTA 2XHCA 4QVDA 1IGUA 3G7ZA 4HNTA 1D1BA 2XIDA 3S3MA 4EMKC 4NOYA 2YUQA 2ABLA 1JSTB 2DO3A 3PFSA 4EOOB 2RJDA 4RMOA 3OY9A 2NUZA 3RDVA 1OPKA 1QKWA 2ED0A 1ACMB 1IB8A 4Y28E 1K8AU 1AD6A 3QXEB 2J6KA 4HXJA 3EAEA 3L2WA 3Q1JA 2DTHA 2NUTB 3C95A 2RHZA 1TWBA 3CCJA 1ZX6A 3CMAT 2KGTA 2PVOB 1VQOQ 3BLRB 1ZUKA 3JCMg 3M0QA 5GAN8 2ZCFB 2DL3A 2CCHB 4DQ2A 3KXTA 2HKQB 4KGZB 1NZ9A 1UNHD 2RK1A 3ZFJA 3WVEB 2KRNA 4JRPA 1AT1B 5GAOr 3EG0A 3CCRQ 5DQVA 2GBQA 5DM7R 1JJ2P 2EGAA 2RB6A 1M9SA 2ATCB 3I55Q 4FSSA 4PNOA 1U8RA 4BY1X 2JS2A 4MDXA 3CCQA 4M77G 1E9HB 2E65A 2EW3A 2E1HA 1I8FA 3HFOA 1RAIB 3G4SA 2IVWA 4J7FA 2JOYA 3OYYA 5FLXE 2DXCB 1YJWT 1VIFA 3UPUA 4JRQA 3TNWB 2FHDA 2QA4A 3SEMA 2MPXC 1I81A 3QYHB 3CC4Q 2BS3A 3JCMh 4EMKA 2EAYA 2FG0A 4EMGA 3QYEA 3OSSC 4OB3B 2EJFA 2ZPGB 3JCMQ 1KQSS 3JCMf 1NE8A 1AWJA 4ELJA 1OX8A 1OQKA 4LUEA 3X26B 4RG8A 3S3NA 4CI0C 2LDMA 2XU8A 2KR3A 1QKXA 3V8KA 2YUNA 2KSSA 5CKDA 1OU9A 2F2WA 4LXCA 1WZOA 1BU2A 3CMAA 3CCJT 4E7LA 4AI6A 1Y57A 2RI5A 5LJ3d 4C92A 1M1KR 1UE9A 1K8AR 1BYMA 1WXBA 2DXBB 5IF1B 4GLKA 3RR6A 1W6XA 2C0IA 5FROA 1KQ2A 3P8HA 1E6GA 4KGVB 4X9CA 4BD3A 1AHJB 4VUBA 4PJNA 3M58A 3PIPA 2DPPB 2E41A 4LDWA 4IUVA 1KC8R 4HLQA 1TUGB 1VYTA 4O6JA 2L3SA 4PJOF 4DBQA 1YFNA 1JB0E 5L8RE 1I5LA 1VQ9A 4C5IA 5GMKi 5KYXB 4II5B 3DB4A 3L42A 5GANj 1M90R 5FU6C 4C0FA 1VQNT 2XDDA 3G6EQ 2VXFA 1W2BA 2KQWA 4F6UB 4D6WA 1F1BB 1H25B 2QDJA 1K9MU 3HHTB 1NJIC 1KQ1A 1SRMA 3HFNA 4LE9A 1BCOA 1GUXA 2KXDA 1BU1A 2M1HA 3FLGA 3OS5A 4N0AC 2V26A 3V7RA 3CC2A 1S72T 4JJCA 4KT0E 4JRIA 2WSCE 4C8QG 1ZLMA 2ZPFB 5IHYA 4QVZA 3CD6T 2BIVA 2FB7A 5GANe 2MAMA 2PMIB 3EG9A 4IURA 3CCUA 2WMAB 5I2MA 3HP9A 4LOCA 3CCST 1S1NA 3UDCA 4C92F 1ARKA 4AFZC 4AT1B 3INZA 3UA6A 1BI1A 2CSQA 2DIQA 4CRIA 2HEQA 2BS2A 5LJ3f 4J6WA 3MEWA 5AT1B 2AZSA 1EFNA 2DL8A 2JTFA 5CIUA 2DD5A 2XG8D 1SRLA 2R58A 4PKCC 1XOVA 2VGMA 1S72A 3LGLA 4EORB 2JMCA 1VQ9Q 3BHVB 1UHFA 1K0SA 3JCMJ 4ZNXA 1FXXA 1ZSZA 1RAGB 3C4SA 1WI7A 2ENMA 4AFSC 3NGPA 1PD0A 5CKHA 2QGSA 4PJOA 3S6WA 1WHJA 4ESRA 1N8RC 1D09B 1GFDA 3M0PA 1H24B 3G71Q 3ULRB 2EQMA 1AD5A 2HD0A 2LJ1A 4R55A 3TCJA 2K2VA 4C0ZA 1Q7YC 3A98A 1Y0MA 4HT9A 5CVIA 2Z0WA 3CCLA 1GXIE 1GBRA 2KMTA 2LT4A 4XTYA 5IXBA 2L89A 3EFSA 4N4GA 1YIJQ 2QA4T 4OR5B 3H41A 4M77F 1MMDA 1NLPC 3OB9A 4GBQA 2LRQA 4M7AF 2JXBA 2D0QB 1SHGA 1ZHIA 2C5XB 4N0AA 3H0HA 3VRYA 2XDBA 1PKTA 2O9VA 2DJQA 4HT8A 4F7JB 2DRKA 4Y72B 2NUPA 3EFOB 1NM7A 3F5XB 3KFVA 1N9RA 1PD1A 1QCNA 4KH0B 2MWOA 2QFZA 3I56A 3QWYA 1JEGA 3CCRT 2EYQA 4ROCA 3MP6A 4EMKB 1RAAB 2XMFA 4BY6C 4Z8AA 4V2SA 4HL4A 4J9BA 4M7AE 1LJOA 5KYYA 4ELYC 4E7SA 2PHGA 2QGGA 1SEMA 4JS5A 5KE3A 1JBMA 4X34A 3CXCA 4M7AC 4ELZC 3EGDB 2O31A 2YLCA 4OMPA 2JMAA 4DBRA 2IW6B 3M55A 4EC9B 1X69A 2RMOA 3EGXB 2X4WA 3FIFA 5DQWA 1OL1B 5GMKj 4M7AG 1C0MA 3JCMb 3FC3A 1JSUB 1N4MA 1ZSZB 4F7UB 4AFQC 1H27B 3D7SB 1WXUA 2RJCA 1OIUB 1G3YA 2LQNA 2RM4A 4BCQD 2MMPA 2RQTA 1NJIU 4LDYA 1BIBA 1O9SA 1VQ8T 1SHFA 2EBPA 2LQKA 3E9GA 4KRTA 3SDZA 3CPWS 3TSZA 1Q81U 2DYBA 5LJ5d 4YOOA 1WFWA 3BLHB 5DLOA 3EFRA 1M2OA 3X25B 1Q95G 1W2BP 1R0CB 5HNBB 5FWBA 2E12A 5CQXA 2GTOA 2C06A 1MNEA 1UNLD 4ZGDB 2A28A 3CCEA 2EGCA 3CCMT 1H1QB 1MMNA 2Y4YA 4OP0A 3OYNA 5IHNA 4TVRA 2WSFE 2RQWA 2C6TB 5GAOq 2ZPBB 3DLMA 2HQEA 1W2BS 2D9TA 3PMIA 4A4HA 1AOJA 2R7GA 3E1SA 5I5ZB 1ZUYA 1K73U 3I9QA 1NYGA 3EGUA 1CSKA 1QWEA 1D3BA 2YRVA 4G6LB 3BLQB 2XK0A 1VQ6T 4E2FB 4PJOE 2DZ9A 5CO7A 4BY6B 1JJ2S 1QP3A 6AT1B 4BE1A 1W70A 4OGEA 2LCLA 1WYXA 4AG1C 9ATCB 1WQ7A 3QHRB 4QT7A 3ZBDA 1TS9A 4C92G 3CC4T 1ZBXA 2KROA 4B9XA 2DE0X 5LJ5e 4HKEA 3E9FA 1M2VB 5D7UA 3LWIA 4KGXB 5HCKA 2X35A 2HSPA 4C5EA 3GLXA 2RHUA 4QKUA 2WACA 5CEIB 1NEBA 4J9HA 2BPMB 1GH6B 1RI0A 3PE0A 1VQ4Q 1D0XA 1WGSA 3G33B 2K5IA 4MFDA 4F70B 2K57A 3CMEQ 4BCKB 1VQPA 2M0OA 2CP7A 2FZKB 2JT4A 2BTTA 1PSEA 3MY5B 1I0CA 2LNVA 4FT2A 1AWWA 1VQMT 4EDUA 2OI3A 3RGFB 1TD6A 1M1FA 1WX6A 2FEIA 4FL6A 2D8JA 3SFMA 1WHHA 2AIRB 4Z6YA 1M30A 1M8MA 1UUEA 3T9NA 5L23A 2CDTA 2LC4A 1QVGP 2DKGA 2OTLQ 1G8XA 3MCAB 1ZA2B 1G5VA 1MNDA 1PRLC 1VUBA 4IUQA 2ED1A 4KRCB 3V8JA 4HNVA 3P8DA 3PVQA 2KAFA 3OBWA 1A0NB 1VQMA 2RHXA 4M75F 5D6XA 4XU1A 2HKNA 1PWTA 1WNLA 2LT1A 1BI3A 4MFEA 1OOTA 3ZEHA 1QVFS 1UECA 3OS0A 5GAN4 3CQTA 2BZ8A 3L2QA 4RG2A 3RKWA 2RK2A 2X4YA 1RI9A 4JRKA 3G71T 4M75E 3O5ZA 1UG1A 2G9XB 4EOJB 1K8AC 3A8LB 1IGQA 3BY7A 5KCOA 2C5NB 3OYJA 3GOXA 2X1NB 4FW2A 2SEMA 4J6XA 2CP2A 4LDVA 3J80E 2YT6A 1C1AA 1I1JA 3PGGA 1GUXB 1YP5A 1MMAA 2PJQA 3VS7A 1BIAA 3DJBA 4NS5A 3JB9D 5BNJB 4BCNB 4F7SB 4EOLB 2FZGB 1SSHA 3CXCS 4HCZA 2COYA 2J06A 1B34A 1OPLA 4LDUA 1AEYA 2CKKA 2P84A 4A63B 3QBYA 1TU0B 2W10A 4BUGA 3RBBB 2C0OA 2DEQA 1Z9ZA 4F04B 3ME9A 2X4XA 3REBB 1X6GA 3PNWC 1VQKA 1YI2T 4L59A 5HK0A 4BCPB 4CXAB 2SRCA 2QI2A 4Z89A 3MY1B 3LLRA 5GAMf 3RERA 2W99A 3HL8A 4BCND 1JO8A 1JXOA 2F5KA 4EONB 3HKSA 5HY6A 3OBYA 4XTZA 1YWOA 1JJ2A 3M03A 2K3XA 2R5AA 2KNBB 2YUPA 1TOVA 5LJ3g 2MF2A 5CKFA 1Q7YU 2HBPA 3M56A 5GANf 3VS4A 2IW8B 2W9FA 4M7DA 3JB9H 4R0KA 2PU9B 4C5HA 4FT4A 1VQ4T 3JB9G 4UC4A 2H3EB 2DD4A 3CBPA 1T3SA 5GANd 2LX7A 1N27A 1UDLA 3A8HB 2COWA 5GMKm 4DBHA 2E6NA 3ZL7C 5KH6A 4WCIA 4BCHB 2EIFA 1VQ6Q 3KHIA 1UEBA 2EYZA 4OMLA 5KYUA 5GAN5 1YJ9T 2EQKA 2A0FB 2COZA 1PG5B 1TTHB 2UZEB 3EGDA 2OTJQ 2VASA 3CCJQ 2DTIA 8ATCB 1QP2A 1QVGS 3TW6A 3QUIA 1FVVB 2V8IA 2YUOA 1OV3A 3QG1A 1YWPA 2E5QA 5CQYA 1H641 3M0RA 4RTYA 3CCSA 4J5YA 5GAOl 3M4YA 5FW9A 1TXQA 2VV5A 4CFNB 4FYXB 4ZGEB 4L6V5 3O0GD 4M7DC 3VYGB 4BE2A 2IPOB 3LW5E 3K7AM 1FYNA 3PT9A 2BS4A 3U23A 3M0SA 3V7CA 2Y90A 3ASKA 5KYXA 1RADB 3C12A 2EQIA 2L0AA 5IXFA 4M7AD 2O4XB 4XK8E 1TFBA 4M77D 1HD3A 2VVKA 4RTZA 2EKHA
chains in the Genus database with same CATH topology
4OMFB 4C0DC 3QIIA 1SSFA 5CKHA 1Q86U 4PJOA 2CZ0B 2PQWA 2XICA 4NL3A 5D6YA 3S6WA 2JUFA 4E7JA 3JCMd 1YITT 4BI8B 3RMQA 1N8RC 2X4JA 4JX6A 3BDLA 3JCMW 1VQPT 1XTDA 2EQUA 3P8BB 1QLBA 1WQWA 2QQSA 1YIJT 3MP8A 4P5NA 4BI3A 2EQMA 2HD0A 2RO0A 4QVCA 4R55A 4BI4A 5A2QE 5KE2A 5FRMA 3BG9A 3TCJA 4DA4A 2K2VA 4C0ZA 1Q7YC 2DXBA 1QVPA 4HT9A 2GFAA 2RD1A 5CVIA 1KD1U 4RKUE 5J39A 3CCLA 3VUZA 1GXIE 2KMTA 2LT4A 4XAXB 4XTYA 2OTJA 4QW2A 4BB7A 2L89A 3CMEA 4C8QF 1N6AA 2MI6A 1BKBA 1V29B 1VQ7A 3EFSA 4N4GA 2DK3A 2RA2A 2LCCA 5KCHA 2QA4T 5EJCA 3CCLT 1I4K1 2LX9A 1Y71A 2NLUA 3HRTA 3WVDB 3OB9A 4M77F 1XQHA 5A0DA 3OS1A 1ZQ1A 2LRQA 5AYFA 4M7AF 3OYEA 4MIMA 3H4CA 2D0QB 5D6WA 1ZHIA 4OB1B 4MZPA 4JLIA 3UWNA 4C8QE 4M77C 2E64A 3L2RA 3C4SA 2O4XA 3SWNB 1UB4A 4N0AA 5A0LA 3BG3A 3LX7A 4F7UF 5CR2A 2XDBA 1VQ8A 4BBSM 2KMGA 2QXFA 1FWZA 3CPWA 4MDWA 1U1TA 2XDPA 2ZGWA 3TREA 2I2LA 2QQRA 4HT8A 4NL2A 1YHQT 4MMLA 4ZN3A 3GPLA 3VYGA 4HCBA 3HSBA 1N9RA 2MWOA 3HO8A 2QFZA 3ER0A 3JB9I 3OYHA 3I56A 3CCRT 2EYQA 4M78G 4M77A 4BE0A 2E70A 3JB9J 4M78D 3CCQT 3MP6A 4M7DF 2V8JA 4EMKB 4N4HA 4J6YA 3QYGB 4N4IA 4XU0A 1P92A 3OYBA 3PTAA 2JN0A 3SWNA 5GANg 1B34B 3R6OA 4M77E 4BY6C 3WXMB 1U1SA 5GAOn 2DJZA 1N9SA 4V2SA 4HL4A 4M7AE 1VQNA 1LJOA 1H3ZA 1FX7A 4ELYC 1G3SA 2VYTA 2WJ9A 4JS5A 5KE3A 1VQ5T 1JBMA 3HPWA 3MEVA 1NPRA 4X34A 1HK9A 3DB3A 5GMKl 3CXCA 2RHYA 4M7AC 4C92D 4ELZC 4HNUA 2HAXA 3OSVA 3DL1A 2YLCA 4Q5WA 4M7DE 3DKMA 4M7DB 3M55A 3I55T 5CAIA 1VIEA 1M5Q1 4PLLA 3VKHA 4HA8A 3HB9A 4QQDA 3JAME 2X4WA 3FIFA 3OYDA 5GMKj 3DLLA 1Y96A 2VUBA 4M7AG 3O8VA 2OTJT 5LJ3j 2CYZB 3FRNA 4M78F 4C92E 3BFMA 5GAMe 3JCMb 4ATOA 4PJOB 3FC3A 2F69A 1WJQA 2K4YA 3RIRA 4XTUA 4KUIA 4F7UB 3G4ST 2QTXA 4J83A 4C8QC 2RJCA 1G3YA 2RM4A 2VC8A 2CZ6B 2MMPA 4E7KA 4OB0B 4M7AB 5GAOm 1LOJA 1YJWA 3LH0A 2DIGA 1G3TA 1NJIU 1M90U 4M77B 3OYLA 4LDYA 1BIBA 1O9SA 4ZGJB 3SWNC 1OYXA 1VQ8T 2DZCA 2LQKA 3E9GA 3SDZA 3OYAA 3CPWS 1VQ9T 4OB2B 1LNXA 2JZ2A 3G71T 2RI2A 4XQ3A 1BI0A 5IN1A 3OW2A 1Q81U 4E47A 2GF7A 3QDRB 2P4TA 3QYBA 4Y91A 2OTLT 4RCBA 5LJ5d 4II1A 4B9WA 3X24B 4C8QA 3EFRA 5DLOA 3JCMX 3OA6A 1VQ4A 4KULA 3X25B 4M75A 3HZJA 3X20B 1X01A 2L5QA 3SB2A 3VU3C 5GAMj 2E12A 5CQXA 3CMET 1YI2A 2C06A 3AHUA 3JCMV 2QQBA 4ZGDB 3RUXA 3CCEA 4JX5A 3FJPA 3CCMT 5GANh 5DY9A 5FU6B 5A0GA 4JUVA 2DD5B 2Y4YA 4OP0A 3OYNA 3CCUT 1QVGA 5FRNA 4TVRA 2WSFE 5GAOq 2ZPBB 5GAN3 1Y96B 4GY5A 2CS7A 4M78B 5M9OA 1UGQB 3DLMA 4C0DB 1TH7A 1IZ6A 1X75C 2HQEA 2JVVA 2K5FA 3M54A 5DLQE 2D9TA 3PMIA 2LTOA 2HQXA 1OI1A 2EFIA 4A4HA 1W2BS 3CC4A 4A4KA 2RH2A 4ZN1A 1M1KU 1QVFA 1JRIA 2P0KA 3E1SA 3MO8A 4KUDK 2OTLA 1K73U 2G77A 1K9MC 5LJ5f 2XI9A 4OVAA 4AKHA 2IG0A 1DJ7B 1D3BA 2YRVA 5GAMh 3G6ET 3VKIA 1N8RU 2VGNA 2XK0A 2R57A 4C92B 1NPPA 3L2VA 1VQ6T 4PJOE 2DZ9A 5CO7A 4BY6B 1MHNA 3VYHB 4YTLA 4E7HA 1QW1A 2ZZDA 3H8ZA 4PJOG 5GMKe 1JJ2S 1QP3A 2KY9A 5CKBA 4BE1A 3CBOA 4OGEA 2LCLA 1WQ7A 1KD1C 3ZBDA 3QJ6A 3A5ZB 2EQJA 4C92G 3GF5A 5CCAA 2VXEA 3CC4T 4FM4B 1ZBXA 4B9XA 5LJ5e 2BUDA 4HKEA 3E9FA 4FU6A 4M75G 2LVMA 3LWIA 4QQ6A 3GNFB 2H3JA 4X9DA 2AHJB 2X35A 3M59A 4C5EA 2FL7A 2CGHA 3GLXA 3TU4K 3M4GA 2RHUA 3VJPA 2WACA 3MEUA 5EG2A 3G71A 4XTVA 4NC6A 3NTKA 3RESA 1RI0A 3PMTA 4FIBA 3J7AF 2GQVA 1WGSA 1M4ZA 3NTIA 2K5IA 3I55A 2CZ7B 2XHCA 4MFDA 3CPFA 1VQ7T 3QZ5B 2K57A 4M75C 5GAN7 4QVDA 1VQPA 2M0OA 3G7ZA 4FSXA 4HNTA 2MWPA 2XIDA 3S3MA 1KC8C 4EMKC 1YIJA 4NOYA 1PSEA 4ME7A 2LNVA 2DO3A 3PFSA 4FT2A 3JCMc 1M8VA 4E7IA 1VQMT 1YBYA 2RJDA 4RMOA 3OY9A 4A4FA 2PVDB 4EDUA 1M1FA 4FL6A 4Y28E 3CC7A 1K8AU 2XKOC 3SFMA 1IREB 4M78E 5C6SA 2QDYB 3QXEB 3OMGA 4Z6YA 3T9NA 2O01E 2EJGA 2LC4A 2KK4A 2PVGB 2DKGA 3EAEA 4M78A 1WJRA 3MCAB 3L2WA 3Q1JA 1G5VA 1VUBA 2DTHA 4IUQA 4XU2A 3C95A 2RHZA 3CCJA 1Y7XA 3CMAT 2PVOB 3G6EA 3VKGA 4PLIA 2RI3A 4L5GA 5GAN6 1KG1A 1VQ6A 2HNIA 3V8JA 4DOWA 4HNVA 3P8DA 3JCMg 5GAN8 3HBLA 2YLBA 4A4GA 2ZCFB 1R8OB 2KAFA 3OBWA 4C8QD 3A8MB 3PIOA 4LDXA 2EWNA 4C8QB 5LJ5g 1VQMA 2RHXA 3BW1A 4M75F 5D6XA 3TW7A 4XU1A 2DVEA 4DQ2A 2A3LA 2E6ZA 3URGA 3KXTA 1WNLA 2DD4B 2LT1A 4A54A 1BI3A 3CCET 4MFEA 3M53A 3NFCA 1VQ5A 1NZ9A 3OS2A 2PUOB 3ZEHA 1YJNT 1QVFS 2RK1A 3ZFJA 4JRPA 3WVEB 3OS0A 5GAN4 1OZ2A 5GAOr 3FB9A 3VV0A 3L2QA 4AKIA 4RG2A 3RKWA 3A8GB 2RK2A 5DM7R 3J81E 2X4YA 2JNGA 4JRKA 4M6VA 1W4SA 2FYKA 1EIFA 2RB6A 1M9SA 5FU7C 4PNOA 3VUBA 1U8RA 4M75E 1PSFA 4IUTA 3JCMP 2RJEA 2QEXA 4MDXA 3QO3A 2PUKB 1Q82U 1K8AC 3A8LB 3CC2T 4IKFA 4PJOD 2CZ1B 3OYFA 3CCQA 3BY7A 3QPHA 4M77G 1KHIA 2L3RA 3CCVA 5KCOA 3FDRA 4A53A 2E65A 1WPYA 3OYJA 1YITA 3GOXA 2E1HA 3QZ9B 4ZTJA 1I8FA 3HFOA 4WF2A 3C94A 3G4SA 2IVWA 4J6XA 4M75D 4F7UG 4LDVA 4LD9K 4J7FA 2JOYA 5LJ3e 3OYYA 5FLXE 3J80E 2DXCB 2E10A 1YJWT 3PGGA 2GFUA 1VIFA 3UPUA 3MEAA 4JRQA 4M78C 1WJSA 1BIAA 2FHDA 4NS5A 3JB9D 2QA4A 2XD0A 3L2UA 5CKEA 3CXCS 2G3RA 4PJOC 1UGSB 4AKGA 1KHCA 2KVQG 4HCZA 3L2ZA 4PL6A 1I81A 1B34A 3KBGA 4LDUA 4XTWA 4JS4A 3QSUA 2CKKA 3F70A 3QYHB 1X6OA 2BS3A 3QKJA 3QBYA 1UGRB 3OQ5A 3JCMh 4EMKA 2EAYA 4BUGA 1FKMA 2YHTA 4JDSA 2DEQA 4EMGA 5GAMg 3QYEA 2QQAA 3M57A 3OSSC 4OB3B 3OYIA 3ME9A 5I21A 2X4XA 4RCCA 2EJFA 2ZPGB 3JCMQ 1KQSS 3JCMf 1NE8A 1D3BB 3CD6A 3OYGA 3PNWC 4ELJA 1VQKA 1YI2T 4RG8A 3X26B 4L59A 5HK0A 4IUUA 1Q82C 3S3NA 2QF7A 4CI0C 2LDMA 2QI2A 2XU8A 4BBRM 2OAUA 2P0PA 3LLRA 2L8DA 3V8KA 4EPCA 5GAMf 2LQ8A 3JB9F 3HL8A 3RERA 4C0GA 4MZTA 1Q86C 4LD6A 2KSSA 3CCVT 2F5KA 4Z02A 2P0QA 2K5LA 3HKSA 5CKDA 1KQSA 3MHXA 4MZMA 5HY6A 3BDUA 2V8KA 3OBYA 4XTZA 3I56T 3FEOA 1UGPB 3CMAA 3CCJT 4E7LA 1JJ2A 4AI6A 3A8OB 2QQ9A 2RI5A 3M9QA 1VQOT 1YHQA 3QHSA 5LJ3d 4C92A 3BG5A 2F5TX 2K3XA 3V8LA 1OZ3A 2WSEE 2R5AA 4J7IA 1Q81C 2D6FA 3MP1A 3META 1VQLA 5LJ3g 2MF2A 4HCCA 1BYMA 5CKFA 2K3YA 2DXBB 2HBPA 5GAOp 1Q7YU 3NTHA 3M56A 5GANf 2EKOA 4BDYA 4GLKA 3OYCA 5FROA 4JX4A 2ZPEB 1KQ2A 4M7DA 3P8HA 1O75A 4MMKA 3JB9H 1BI2A 2PU9B 2QQ8A 4C5HA 2KDSA 4ZTFA 4X9CA 4FT4A 4BD3A 3S3OA 3UT1A 1AHJB 4VUBA 2KR6A 3M58A 1MGQA 5IT9E 4JJNK 3PIPA 2DPPB 2E41A 4LDWA 3JB9G 1VQ4T 4M7DD 4IUVA 1YCYA 4HLQA 4O6JA 4UC4A 4M7DG 5LJ5j 4OF1A 4PJOF 2DD4A 2DAQA 3RKXA 4M7AA 3CBPA 1JB0E 5LJ5h 5L8RE 5I2SA 3JSCA 1I5LA 1VQ9A 2BKDN 4C5IA 2M9UA 4BACA 2Y4XA 5IAYA 5GMKi 3V7SA 5GANd 3SD4A 3OYMA 3E19A 3DB4A 1N27A 3L42A 5GANj 1VQLT 3A8HB 5GMKm 5FU6C 4C0FA 2E6NA 4QSHA 2DXUA 3HRSA 4KBMB 4DOVA 1VQNT 3JRZA 1G3WA 3QWLA 2VXFA 3RKYA 2ZPHB 5KH6A 2XDDA 1VQOA 5J3BA 2KQWA 3CBMA 2EIFA 1W2BA 3KHIA 1UEBA 4D6WA 2RJFA 2QDJA 4IUPA 1K9MU 3HHTB 1NJIC 4BDZA 1M90C 1KQ1A 3GIBA 5GAN5 3HFNA 3LGFA 3H6ZA 5FU7B 3GP8A 3JCMe 2QEXT 3OW2S 3RMSA 1YJ9T 2EQKA 1RL2A 2R5MA 2DXCA 2M1HA 3FLGA 1M1GA 3OS5A 4N0AC 2DXTA 2FVUA 3V7RA 5HK3A 3CC2A 4F7UA 1S72T 5C0MA 3L1AA 2ZZDB 3QJYA 4XU3A 2DTIA 4KT0E 1QP2A 1YJNA 1QVGS 4JRIA 3TW6A 2WSCE 3QUIA 1XNIA 2V8IA 4C8QG 3QG1A 3TEEA 4C92C 2ZPFB 4QQGA 4QVZA 3CEYA 2E5QA 5CQYA 1VQKT 1H641 3CD6T 4XTXA 2DTOA 2BIVA 2FB7A 5GANe 4EMHA 3CCSA 3X28B 4J5YA 4JLGA 2MAMA 5GAOl 1Y07A 1HXDA 3M4YA 4IURA 3LYIA 3CCUA 2M16A 3M5AA 4A4EA 1M1KC 5I2MA 5LJ3h 3HP9A 2ZPIB 4LOCA 2VV5A 3CCST 3OYKA 3UDCA 5GMKh 4C92F 2GCXA 4ZGEB 3HRUA 4O5VA 3INZA 4L6V5 4M7DC 1BI1A 3CCMA 2DIQA 3KUFA 3VYGB 4CRIA 4BE2A 3LW5E 2BS2A 3N5BB 5LJ3f 4J6WA 4C5GA 3MEWA 3PT9A 2BS4A 5J26A 3LWHA 3GNGA 2JTFA 3V7CA 2Y90A 5CIUA 3CCRA 2DD5A 2B8AA 2XG8D 5HKCA 4R56A 3ASKA 4OGCA 2A7YA 2R58A 4PKCC 3C12A 1XOVA 2VGMA 5GAN2 4F7UE 1S72A 3LGLA 1KC8U 3OMCA 2EJ9A 4J8OA 4M7AD 2O4XB 4XK8E 4M77D 1YJ9A 3JCMJ 3CC7T 4M75B 1E7PA 5GAMd 2RHIA 5LL6S 1FXXA 5CK9A 1K73C 2JTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8O B;  2CZ0 B;  4OB2 B;  2PVO B;  2WSE E;  2ZCF B;  3X24 B;  2DXB B;  3A8M B;  3X25 B;  3X20 B;  2DXB A;  2ZPE B;  4RKU E;  1GXI E;  2PU9 B;  4ZGD B;  2DD4 B;  1AHJ B;  1V29 B;  2DD5 B;  2DPP B;  2PUO B;  3WVD B;  3WVE B;  2WSF E;  2ZPB B;  2D0Q B;  4OB1 B;  2DD4 A;  1UGQ B;  3A8G B;  1JB0 E;  5L8R E;  1PSF A;  2PUK B;  3A8L B;  2CZ1 B;  3A8H B;  1DJ7 B;  2ZPH B;  3VYG A;  3QZ9 B;  3VYH B;  2ZZD A;  3HHT B;  1QP3 A;  3QYG B;  2DXC B;  2DXC A;  4FM4 B;  2ZZD B;  4KT0 E;  1QP2 A;  2WSC E;  2AHJ B;  2ZPF B;  1UGS B;  3X28 B;  3QYH B;  1UGR B;  2CZ7 B;  2ZPI B;  3QZ5 B;  4ZGE B;  4OB3 B;  4L6V 5;  2ZPG B;  3VYG B;  1PSE A;  3LW5 E;  2CYZ B;  3X26 B;  2DD5 A;  2PVD B;  4Y28 E;  1IRE B;  2QDY B;  3QXE B;  2O01 E;  2CZ6 B;  4XK8 E;  2PVG B;  4OB0 B;  1UGP B;  4ZGJ B; 
#chains in the Genus database with same CATH topology
 4OMF B;  1O9K B;  3QII A;  1YJN Q;  1SSF A;  2LJ0 A;  2PQW A;  4NL3 A;  5D6Y A;  2JUF A;  1TSF A;  3JCM d;  3RMQ A;  2X4J A;  1QLB A;  3I56 Q;  2ESW A;  2QQS A;  3I5R A;  4QVC A;  4EOK B;  4KH1 B;  5A2Q E;  5KE2 A;  5FRM A;  3CCU Q;  2RD1 A;  5HQ0 B;  2CP3 A;  4CFV B;  1PCX A;  4BB7 A;  2GNC A;  1VQ7 A;  1V29 B;  5LMK B;  1P5E B;  2DK3 A;  2LCC A;  2LX9 A;  3BE3 A;  2NLU A;  1RLP C;  3OS1 A;  1ZQ1 A;  3B57 A;  3OYE A;  1RUW A;  4Z88 A;  4OB1 B;  4MZP A;  4J9E A;  4C8Q E;  4M77 C;  2E64 A;  3L2R A;  2F2V A;  2O4X A;  2W96 A;  1UB4 A;  3SWN B;  3BG3 A;  2M51 A;  1VQ8 A;  4BBS M;  2KMG A;  4EOP B;  1T0H A;  2CJM B;  1FWZ A;  1U1T A;  2WMB B;  3CMA Q;  3TRE A;  2K79 A;  1W1F A;  2QQR A;  4NL2 A;  2EYY A;  2E5K A;  4MML A;  4ZN3 A;  1QWF A;  1V76 A;  4FCY A;  2K9G A;  2DEU A;  3HO8 A;  3DTO A;  1RAF B;  1VOL A;  2E70 A;  2MOX A;  4RUG A;  4M78 D;  2E3H A;  4J6Y A;  3QYG B;  4E6R A;  5GAN g;  1B34 B;  3WXM B;  1U1S A;  2DJZ A;  4EC8 B;  1N9S A;  2DRM A;  1H3Z A;  1FX7 A;  1G3S A;  3TNH B;  4RTU A;  1VYV A;  1VQ5 T;  1HK9 A;  2RHY A;  2NUP B;  3EFO A;  1ABO A;  1TUC A;  4EOI B;  4JJB A;  1MV0 B;  2HAX A;  2LQW A;  4M7D B;  2RQR A;  1QMC A;  2RPN A;  3VKH A;  2J6F A;  1VQM Q;  1HJD A;  2QEX Q;  3JAM E;  5LQF B;  3EHQ A;  2VUB A;  5LJ3 j;  5GAM e;  2F2X A;  1AVZ C;  4C92 E;  2HMA A;  2D0N A;  2CCI B;  3R6N A;  2FRY A;  2DL5 A;  1OEB A;  2DIL A;  4C8Q C;  5ECA A;  1SKU B;  2VC8 A;  3FJ5 A;  1JU5 C;  1G3T A;  3OYL A;  4ZGJ B;  1OYX A;  2DZC A;  1VQ9 T;  3OYA A;  2O9S A;  2GTJ A;  1LNX A;  3OW2 A;  4BXX X;  2GF7 A;  3QDR B;  2P4T A;  3QYB A;  1FIN B;  3OA6 A;  3JCM X;  1UTI A;  4KUL A;  1NG2 A;  4LNP A;  2L5Q A;  3I5S A;  5GAM j;  3CXC P;  3AHU A;  3JCM V;  5DY9 A;  4JUV A;  3VS1 A;  2DD5 B;  2UZB B;  2DA9 A;  5FRN A;  3EG2 A;  5M9O A;  2KRM A;  4J9F A;  3M54 A;  2K5F A;  5DLQ E;  5EFQ B;  2KT8 A;  5KYW A;  1JKW A;  1M1K U;  1QVF A;  2AKK A;  3DDQ B;  4KUD K;  2BE7 D;  2DF6 A;  3EH2 A;  5KYU B;  5LJ5 f;  1C6V X;  3G6E T;  3UF4 A;  2MCN A;  1AZE A;  1H3H A;  1NPP A;  3MKD A;  1K9M R;  3VS0 A;  3H8Z A;  3MIA B;  1S72 Q;  2KY9 A;  2K6D A;  5CKB A;  1QCO A;  1MV3 A;  3CBO A;  1KD1 C;  3QJ6 A;  5I11 A;  3GF5 A;  4J9C A;  1CKB A;  1NBE B;  4QQ6 A;  1VQ5 Q;  2H3J A;  4X9D A;  3M59 A;  2YWW A;  3A1P A;  2CGH A;  3TU4 K;  1GBQ A;  1OGU B;  3M4G A;  2P4R A;  2EYX A;  5EG2 A;  4XTV A;  2QTV A;  3J7A F;  4CFW B;  2GQV A;  3I55 A;  2F2C A;  1D1A A;  1YI2 Q;  3CCL Q;  3CPF A;  1VQ7 T;  3QZ5 B;  5GJW B;  2WXV B;  1H4L D;  1KXU A;  1YIJ A;  1M8V A;  3NDQ A;  1TUD A;  2YSQ A;  2QDY B;  3OMG A;  1M3B A;  3H9N A;  1JXM A;  1GCP A;  2EJG A;  2W9Z A;  4OMM A;  4FYW B;  4XU2 A;  1M27 C;  4FW1 A;  2RI3 A;  5GAN 6;  1KG1 A;  1VQ6 A;  2QAZ A;  2HNI A;  4JPB W;  3DDP B;  1WHK A;  1U3O A;  2YLB A;  3A8M B;  3PIO A;  4LDX A;  2EWN A;  4C8Q B;  3EG1 A;  5LJ5 g;  1KSW A;  4CC4 B;  3BW1 A;  3E2U A;  2DVE A;  2DD4 B;  1RAH B;  1VQ5 A;  1AWX A;  4D8K A;  1ZBJ A;  1YJN T;  1H92 A;  3VV0 A;  4CC3 A;  2RNA A;  5KYN A;  3A8G B;  3J81 E;  5FU7 C;  1W4S A;  1RAE B;  1AZG B;  2EUF A;  2RJE A;  3QO3 A;  1Q82 U;  4FYV B;  4IKF A;  4PJO D;  3RNJ A;  2DET A;  1KHI A;  3CCV A;  1YHQ Q;  3FDR A;  3QZ9 B;  4ZTJ A;  4BCM B;  2JTE A;  3EGX A;  4WF2 A;  1TG0 A;  4M75 D;  2PK9 B;  2AK5 A;  2E10 A;  3VS2 A;  2L3P A;  4M78 C;  3LQ5 B;  2CUD A;  1H1P B;  1J3T A;  2XD0 A;  3L2U A;  2WIP B;  5CKE A;  2G3R A;  1UGS B;  1UGV A;  4AMC A;  4PL6 A;  4JS4 A;  1X2K A;  3MPU B;  3F70 A;  3QSU A;  2QK0 A;  3OQ5 A;  2WHB B;  1FKM A;  1PC0 A;  3M57 A;  3OYI A;  2ECZ A;  5I21 A;  1Z9Q A;  5IHK A;  1D3B B;  3CD6 A;  3OYG A;  1XO2 A;  2QF7 A;  4BBR M;  2OAU A;  2P0P A;  3JB9 F;  2L8D A;  4EPC A;  2LQ8 A;  3TN8 B;  4MZT A;  1Q86 C;  4LD6 A;  3CCV T;  4Z02 A;  2P0Q A;  1G2B A;  1KQS A;  4CFU B;  3MHX A;  4MZM A;  2I53 A;  3BDU A;  2V8K A;  3MJX A;  2IW9 B;  3I56 T;  3FEO A;  1UGP B;  3CC2 Q;  1VQO T;  1K0X A;  1YHQ A;  3QHS A;  1UHC A;  2WSE E;  1UFF A;  4J7I A;  2B86 A;  2D6F A;  3MP1 A;  3MET A;  3H0F A;  2K3Y A;  2D1X A;  1T0J A;  2VWF A;  1ENW A;  3OYC A;  2AZV A;  4MMK A;  1O75 A;  2QQ8 A;  4ZTF A;  2KDS A;  1VQN Q;  3UT1 A;  3POM A;  2CUB A;  4J9D A;  1D1C A;  1OX9 A;  1MGQ A;  4JJN K;  3EOC B;  1O9K A;  4M7D G;  5LJ5 j;  4OF1 A;  3BHU B;  2DAQ A;  2HCK A;  3EG3 A;  5I2S A;  2BKD N;  1FMK A;  3PO3 S;  2Y4X A;  3SD4 A;  3E19 A;  4F7N B;  4CRL B;  1NJI R;  1C9B A;  1D0Y A;  3JRZ A;  3CD6 Q;  3RKY A;  2ZPH B;  5J3B A;  1OI9 B;  2RJF A;  1NLO C;  4YOZ A;  1M90 C;  1VQL Q;  1VIN A;  2OJ2 A;  5FGK B;  3LGF A;  5FU7 B;  5KYW B;  3JCM e;  2QEX T;  3OW2 S;  3EG9 B;  2MIO A;  2C0T A;  2CSI A;  2DXC A;  2DXT A;  2FVU A;  5HK3 A;  5C0M A;  2ZZD B;  3QJY A;  4XU3 A;  1YJN A;  1SPK A;  4TTH A;  4EOS B;  2C5V B;  1K1Z A;  4QQG A;  4F6W B;  3TEE A;  1VQK T;  2DTO A;  4EMH A;  4AG2 C;  1Y07 A;  1HXD A;  3LYI A;  4A4E A;  4PFP A;  5LJ3 h;  2ZPI B;  2FPD A;  3KUF A;  2EPD A;  1WIE A;  3EID B;  2KEA A;  1WA7 A;  3BHT B;  1QLY A;  4OGC A;  2A7Y A;  2F1L A;  5GAN 2;  3TVT A;  1T3L A;  1QVF P;  2EJ9 A;  4PJJ A;  5IHI A;  4ELL A;  1YJ9 A;  1E7P A;  2FPF A;  5LL6 S;  2PTK A;  1K73 C;  4YOS A;  2PZ1 A;  2CZ0 B;  1Q7Y R;  4E7J A;  4JX6 A;  3BDL A;  5I22 A;  3JCM W;  1VQP T;  1WQW A;  3MP8 A;  4BI4 A;  3BG9 A;  4DA4 A;  2BKZ B;  2DXB A;  1GL5 A;  1OKV B;  1BKB A;  1PM3 A;  2EYW A;  5KCH A;  5EJC A;  4AFU C;  8AT1 B;  3WVD B;  1YN8 A;  4MIM A;  5D6W A;  2K3B A;  1IHW A;  2E4H A;  2FRW A;  2HL3 A;  3LX7 A;  5CR2 A;  1RAB B;  2AKL A;  1X2Q A;  2BE9 B;  4MDW A;  3CPW A;  4GLM A;  2J6O A;  2ZGW A;  4JZ3 A;  2CH4 A;  2DM1 A;  4HCB A;  3GPL A;  3VYG A;  3HSB A;  3OYH A;  4BE0 A;  1M2V A;  3CCQ T;  4M7D F;  4EOQ B;  2V8J A;  4N4I A;  1W98 B;  2JN0 A;  2GGR A;  3SWN A;  1YJW Q;  4M77 E;  2ROT A;  2AT1 B;  2H8H A;  4F14 A;  4CFM B;  2HL5 C;  1I5O B;  2M0Y A;  4C92 D;  4DBF A;  4HNU A;  4EIK A;  1IRX A;  1B07 A;  2KYM A;  5CAI A;  1M5Q 1;  2QGF B;  4HA8 A;  2X9H A;  3HB9 A;  4DEX A;  1VA7 A;  4M4Z A;  3JV3 A;  2KT1 A;  3DLL A;  1K73 R;  3O8V A;  2DL4 A;  2OTJ T;  2CYZ B;  3FRN A;  4M78 F;  4ATO A;  3BFM A;  2DBK A;  2F69 A;  4XTU A;  4KUI A;  2V22 B;  4K11 A;  2QTX A;  2A08 A;  2BZX A;  2LJ3 A;  1OIY B;  2PNI A;  2DIG A;  1M90 U;  2DME A;  1D3U B;  3TSW A;  4OB2 B;  1H26 B;  5HBH B;  2RI2 A;  1BI0 A;  1ZP2 A;  4E47 A;  4DEY A;  4Y91 A;  2OTL T;  4RCB A;  2ROL A;  4II1 A;  1VQ4 A;  3X24 B;  2B9R A;  4M75 A;  3HZJ A;  3SB2 A;  2L2P A;  3FJP A;  2HDA A;  1H8K A;  4LN2 A;  5A0G A;  2YXY A;  2JJ9 A;  3CCU T;  1OUL A;  4GY5 A;  2CS7 A;  1OU8 A;  2HZY A;  1UGQ B;  4BCF B;  4M78 B;  2RQV A;  4C0D B;  3CCS Q;  2JVV A;  1WHM A;  2HQX A;  2LTO A;  3CC4 A;  4A4K A;  2RH2 A;  4ZN1 A;  1JRI A;  4CC2 A;  3MO8 A;  2OTL A;  4YC3 B;  1H28 B;  2G77 A;  2XI9 A;  2E3I A;  3THK A;  2IG0 A;  1SF9 A;  4X1V A;  1N8R U;  2VGN A;  2R57 A;  4C92 B;  1BK2 A;  3VS6 A;  1OKW B;  1QW1 A;  2ZZD A;  1H1R B;  2DYI A;  2A36 A;  5KYY B;  1VYU A;  4WTO B;  2J7I A;  4EOM B;  2X3X D;  2EQJ A;  5CCA A;  2VXE A;  4FM4 B;  3VS5 A;  4FU6 A;  4M75 G;  2CRE A;  2LMJ A;  2FL7 A;  3VJP A;  4HVW A;  3MEU A;  5ACB A;  3RES A;  2JM8 A;  3PMT A;  4FIB A;  1KIK A;  4PJM A;  1M4Z A;  1VYW B;  5EC7 A;  4M75 C;  5GAN 7;  1WXT A;  4FSX A;  1KC8 C;  2MWP A;  1SG5 A;  3I35 A;  4FX3 B;  4ME7 A;  4PFZ A;  1FMW A;  3JCM c;  4E7I A;  1YBY A;  1GFC A;  4A4F A;  2PVD B;  3CC7 A;  2XKO C;  1IRE B;  1AIS B;  1PNJ A;  4M78 E;  2CP0 A;  5C6S A;  2O01 E;  2C5O B;  1ZUU A;  4OGR B;  2KK4 A;  2PVG B;  4M78 A;  1WJR A;  3CCQ Q;  2DNU A;  1Q82 R;  1Y7X A;  4BCG B;  2FZC B;  3G6E A;  3VKG A;  4OMN A;  4PLI A;  4D8D A;  4L5G A;  3SHW A;  1MMG A;  4DOW A;  1IO6 A;  1HSQ A;  3HBL A;  4A4G A;  5L2W B;  1R8O B;  2DFU A;  4C8Q D;  2WEV B;  4BY7 X;  1KK7 A;  3HTR A;  3TQ7 P;  3TW7 A;  4BCO B;  2A3L A;  2E6Z A;  4PK4 A;  3URG A;  2X51 A;  4A54 A;  3CCE T;  3NFC A;  3M53 A;  2QA4 Q;  3OS2 A;  4CFU D;  2PUO B;  1OZ2 A;  3FB9 A;  1M3C A;  4AKI A;  2MK5 A;  4ORZ A;  2JNG A;  4M6V A;  2FYK A;  1EIF A;  3VUB A;  1PSF A;  4IUT A;  3JCM P;  2QDL A;  2QEX A;  2PUK B;  3CC2 T;  2IVX A;  2GQI A;  2CZ1 B;  1XJW B;  3OYF A;  3QPH A;  5HVY B;  1K4U S;  2IN3 A;  2L3R A;  1BB9 A;  4A53 A;  1WPY A;  1YIT A;  2W2H A;  2HBW A;  3CC7 Q;  3C94 A;  4F7U G;  4RTX A;  2JW4 A;  4LD9 K;  5LJ3 e;  1G3N C;  2W0Z A;  4RTV A;  4HCK A;  2GFU A;  1B3Q A;  3MEA A;  1WJS A;  2KXC A;  3NMZ C;  3OW2 P;  2CH4 W;  2QG9 B;  4PJO C;  4AKG A;  1KHC A;  2KVQ G;  3L2Z A;  3KBG A;  4XTW A;  1X6O A;  3QKJ A;  3VS3 A;  1UGR B;  3DOG B;  2BZY A;  1KJW A;  2YHT A;  4JDS A;  3UAT A;  5GAM g;  2QQA A;  4RCC A;  2L3Q A;  2O2O A;  3TNI B;  1Q82 C;  4IUU A;  3G4S Q;  4C0G A;  2CP6 A;  2VKN A;  2K5L A;  2DMO A;  2HQH A;  4KRD B;  1GCQ A;  5GJV B;  4HVU A;  1KD1 R;  3A8O B;  2QQ9 A;  3M9Q A;  4CFX B;  3BG5 A;  2F5T X;  1PRM C;  2LZ6 B;  3V8L A;  1OZ3 A;  1YIT Q;  2WPA B;  1Q81 C;  2LCS A;  2NUT A;  1VQL A;  4HCC A;  3MI9 B;  5GAO p;  2KRS A;  3NTH A;  2EKO A;  4BDY A;  4JX4 A;  2ZPE B;  1X6B A;  1BI2 A;  1WLP B;  3S3O A;  4OMO A;  3CCM Q;  2KR6 A;  2JS0 A;  1F5Q B;  5IT9 E;  4M7D D;  4BCM D;  1YCY A;  4M7A A;  1U5S A;  2DER A;  5LJ5 h;  1RAC B;  3JSC A;  2M9U A;  4ROD A;  4BAC A;  5IAY A;  3V7S A;  3OYM A;  1VQL T;  1QMZ B;  3REA B;  1VOM A;  4DOV A;  4QSH A;  4BCI B;  2DXU A;  3HRS A;  4KBM B;  1G3W A;  3QWL A;  1VQO A;  3CBM A;  2FO0 A;  4J9I A;  4IUP A;  1ABQ A;  4HVV A;  4BDZ A;  4F6S B;  1MUZ A;  4LUD A;  3GIB A;  1IHV A;  2MYS A;  4PFO A;  1ZSG A;  3H6Z A;  3GP8 A;  3RMS A;  2J05 A;  1WHL A;  1RL2 A;  1LVK A;  2R5M A;  2YRD A;  1M1G A;  4F17 A;  3IQL A;  4F7U A;  1U06 A;  3L1A A;  1VQ7 Q;  3G1J A;  1KQS P;  2V1R A;  1XNI A;  4C92 C;  3CEY A;  1LCK A;  4Y92 A;  4XTX A;  3H0I A;  3X28 B;  2CP5 A;  4JLG A;  1GCQ C;  1UJY A;  2KE9 A;  3GTM S;  2M16 A;  1FMV A;  3EH1 A;  3M5A A;  1M1K C;  1VQ8 Q;  3OYK A;  5GMK h;  2GCX A;  1R77 A;  3HRU A;  4J9G A;  4O5V A;  5IDN B;  2RQU A;  1CKA A;  3CCM A;  3LH5 A;  3N5B B;  1BBZ A;  4C5G A;  3LWH A;  5J26 A;  4I3Z B;  4RTW A;  3GNG A;  4FYY B;  3CCR A;  5HKC A;  2B8A A;  5HBE B;  2UZL B;  4R56 A;  2RN8 A;  3PVL A;  4F7U E;  1HYO A;  1KC8 U;  3OMC A;  4BCQ B;  1Q81 R;  4J8O A;  3QDF A;  2M02 A;  3CC7 T;  4M75 B;  5GAM d;  2RHI A;  5CK9 A;  2YDL A;  2JTM A;  4C8Q F;  4C0D C;  3CCV Q;  1Q86 U;  4JJD A;  2XIC A;  3NHN A;  1E7O A;  2DLP A;  1YIT T;  4BI8 B;  4JZ4 A;  1XTD A;  2EQU A;  3P8B B;  2I40 B;  2DL7 A;  1YIJ T;  4BI3 A;  4P5N A;  1URC B;  1AWO A;  2RO0 A;  1K76 A;  1QVP A;  1E6H A;  1N5Z A;  2GFA A;  1KD1 U;  3QHW B;  1X27 A;  4RKU E;  5J39 A;  3VUZ A;  4IMY B;  3NPF A;  4XAX B;  2OTJ A;  4QW2 A;  3CME A;  1VQP Q;  1N6A A;  2MI6 A;  2JGZ B;  4PJL A;  2RA2 A;  4B6M A;  3CCL T;  3EJ1 B;  1I4K 1;  3HRT A;  1Y71 A;  4IIM A;  5A0D A;  1XQH A;  5AYF A;  3H4C A;  2FPE A;  4JLI A;  3UWN A;  5A0L A;  2KYB A;  4F7U F;  3M0U A;  2PK2 A;  2QXF A;  1Q86 R;  1QCF A;  2KI7 A;  1PKS A;  2XDP A;  2I2L A;  1V1C A;  1YHQ T;  1R0B G;  3ER0 A;  3JB9 I;  2K2M A;  4M78 G;  1I07 A;  4M77 A;  3JB9 J;  5HBJ B;  4N4H A;  5ICP B;  4XU0 A;  3CPW P;  1P92 A;  3OYB A;  3PTA A;  5CYI B;  2UUE B;  1M3A A;  2EVR A;  3R6O A;  5GAO n;  1KFZ A;  1VQN A;  2VYT A;  2WJ9 A;  1G83 A;  3M0T A;  4UN0 A;  2RF0 A;  3HPW A;  3MEV A;  1NPR A;  5GMK l;  3DB3 A;  2LNH B;  1D0Z A;  3VRZ A;  4F7L B;  3OSV A;  3DL1 A;  4Q5W A;  4M7D E;  2JM9 A;  2QAS A;  3DKM A;  3I55 T;  1JQQ A;  1VIE A;  3GBQ A;  3UA7 A;  4PLL A;  2CT3 A;  2OX7 A;  1N8R R;  1H1S B;  4QQD A;  2DBM A;  1GRI A;  3OYD A;  2NYS A;  1Y96 A;  2I0N A;  5IH2 A;  4PJO B;  1NEG A;  2WFY B;  1WJQ A;  2K4Y A;  2K7A A;  2VB6 A;  3RIR A;  2G6F X;  1UNG D;  1NYF A;  3G4S T;  4ROE A;  1GY3 B;  4J83 A;  1OL2 B;  1WDX A;  1EZZ B;  2CZ6 B;  4E7K A;  1YJW A;  4OB0 B;  4M7A B;  1QQJ A;  1LOJ A;  5GAO m;  3LH0 A;  4M77 B;  3SWN C;  4ANJ A;  1YCS B;  2JZ2 A;  4IIO A;  7AT1 B;  4XQ3 A;  2C4G B;  5IN1 A;  2V1Q A;  4CC7 A;  1WHG A;  4B9W A;  4C8Q A;  2OAW A;  3X20 B;  1X01 A;  1JOW A;  3VU3 C;  1YI2 A;  3CME T;  2QQB A;  3RUX A;  1ZSZ C;  2CT4 A;  4JX5 A;  5GAN h;  5FU6 B;  2O88 A;  4E7Z A;  2YRC A;  4OMQ A;  2EGE A;  1QVG A;  1K9A A;  5GAN 3;  1EX4 A;  1Y96 B;  2DX1 A;  1PKD B;  1YNZ A;  1TH7 A;  1IZ6 A;  1X75 C;  3RKX A;  1OI1 A;  2ZAE A;  2EFI A;  2IIM A;  1RLQ C;  2P0K A;  4RTT A;  1UJ0 A;  4NST B;  1K9M C;  2A37 A;  2QYZ A;  4OVA A;  4AKH A;  1DJ7 B;  5GAM h;  1ZA1 B;  2HSE B;  3AT1 B;  2NWM A;  3VKI A;  1VQK Q;  3L2V A;  4F16 A;  1MHN A;  3VYH B;  2X3W D;  4YTL A;  4E7H A;  3C0C A;  4PJO G;  5GMK e;  1BCM A;  2LP5 A;  2D8H A;  3QWX X;  1X43 A;  5FWC A;  1YJ9 Q;  3A5Z B;  1PHT A;  4BCJ B;  2BUD A;  3CCE Q;  5IDP B;  2LVM A;  3GNF B;  2LW4 A;  2DVJ A;  2AHJ B;  1B7T A;  1IXD A;  3G71 A;  4NC6 A;  3NTK A;  2UZD B;  2WIH B;  3EHR A;  3NTI A;  2CZ7 B;  1LPL A;  2KBT A;  2XHC A;  4QVD A;  1IGU A;  3G7Z A;  4HNT A;  1D1B A;  2XID A;  3S3M A;  4EMK C;  4NOY A;  2YUQ A;  2ABL A;  1JST B;  2DO3 A;  3PFS A;  4EOO B;  2RJD A;  4RMO A;  3OY9 A;  2NUZ A;  3RDV A;  1OPK A;  1QKW A;  2ED0 A;  1ACM B;  1IB8 A;  4Y28 E;  1K8A U;  1AD6 A;  3QXE B;  2J6K A;  4HXJ A;  3EAE A;  3L2W A;  3Q1J A;  2DTH A;  2NUT B;  3C95 A;  2RHZ A;  1TWB A;  3CCJ A;  1ZX6 A;  3CMA T;  2KGT A;  2PVO B;  1VQO Q;  3BLR B;  1ZUK A;  3JCM g;  3M0Q A;  5GAN 8;  2ZCF B;  2DL3 A;  2CCH B;  4DQ2 A;  3KXT A;  2HKQ B;  4KGZ B;  1NZ9 A;  1UNH D;  2RK1 A;  3ZFJ A;  3WVE B;  2KRN A;  4JRP A;  1AT1 B;  5GAO r;  3EG0 A;  3CCR Q;  5DQV A;  2GBQ A;  5DM7 R;  1JJ2 P;  2EGA A;  2RB6 A;  1M9S A;  2ATC B;  3I55 Q;  4FSS A;  4PNO A;  1U8R A;  4BY1 X;  2JS2 A;  4MDX A;  3CCQ A;  4M77 G;  1E9H B;  2E65 A;  2EW3 A;  2E1H A;  1I8F A;  3HFO A;  1RAI B;  3G4S A;  2IVW A;  4J7F A;  2JOY A;  3OYY A;  5FLX E;  2DXC B;  1YJW T;  1VIF A;  3UPU A;  4JRQ A;  3TNW B;  2FHD A;  2QA4 A;  3SEM A;  2MPX C;  1I81 A;  3QYH B;  3CC4 Q;  2BS3 A;  3JCM h;  4EMK A;  2EAY A;  2FG0 A;  4EMG A;  3QYE A;  3OSS C;  4OB3 B;  2EJF A;  2ZPG B;  3JCM Q;  1KQS S;  3JCM f;  1NE8 A;  1AWJ A;  4ELJ A;  1OX8 A;  1OQK A;  4LUE A;  3X26 B;  4RG8 A;  3S3N A;  4CI0 C;  2LDM A;  2XU8 A;  2KR3 A;  1QKX A;  3V8K A;  2YUN A;  2KSS A;  5CKD A;  1OU9 A;  2F2W A;  4LXC A;  1WZO A;  1BU2 A;  3CMA A;  3CCJ T;  4E7L A;  4AI6 A;  1Y57 A;  2RI5 A;  5LJ3 d;  4C92 A;  1M1K R;  1UE9 A;  1K8A R;  1BYM A;  1WXB A;  2DXB B;  5IF1 B;  4GLK A;  3RR6 A;  1W6X A;  2C0I A;  5FRO A;  1KQ2 A;  3P8H A;  1E6G A;  4KGV B;  4X9C A;  4BD3 A;  1AHJ B;  4VUB A;  4PJN A;  3M58 A;  3PIP A;  2DPP B;  2E41 A;  4LDW A;  4IUV A;  1KC8 R;  4HLQ A;  1TUG B;  1VYT A;  4O6J A;  2L3S A;  4PJO F;  4DBQ A;  1YFN A;  1JB0 E;  5L8R E;  1I5L A;  1VQ9 A;  4C5I A;  5GMK i;  5KYX B;  4II5 B;  3DB4 A;  3L42 A;  5GAN j;  1M90 R;  5FU6 C;  4C0F A;  1VQN T;  2XDD A;  3G6E Q;  2VXF A;  1W2B A;  2KQW A;  4F6U B;  4D6W A;  1F1B B;  1H25 B;  2QDJ A;  1K9M U;  3HHT B;  1NJI C;  1KQ1 A;  1SRM A;  3HFN A;  4LE9 A;  1BCO A;  1GUX A;  2KXD A;  1BU1 A;  2M1H A;  3FLG A;  3OS5 A;  4N0A C;  2V26 A;  3V7R A;  3CC2 A;  1S72 T;  4JJC A;  4KT0 E;  4JRI A;  2WSC E;  4C8Q G;  1ZLM A;  2ZPF B;  5IHY A;  4QVZ A;  3CD6 T;  2BIV A;  2FB7 A;  5GAN e;  2MAM A;  2PMI B;  3EG9 A;  4IUR A;  3CCU A;  2WMA B;  5I2M A;  3HP9 A;  4LOC A;  3CCS T;  1S1N A;  3UDC A;  4C92 F;  1ARK A;  4AFZ C;  4AT1 B;  3INZ A;  3UA6 A;  1BI1 A;  2CSQ A;  2DIQ A;  4CRI A;  2HEQ A;  2BS2 A;  5LJ3 f;  4J6W A;  3MEW A;  5AT1 B;  2AZS A;  1EFN A;  2DL8 A;  2JTF A;  5CIU A;  2DD5 A;  2XG8 D;  1SRL A;  2R58 A;  4PKC C;  1XOV A;  2VGM A;  1S72 A;  3LGL A;  4EOR B;  2JMC A;  1VQ9 Q;  3BHV B;  1UHF A;  1K0S A;  3JCM J;  4ZNX A;  1FXX A;  1ZSZ A;  1RAG B;  3C4S A;  1WI7 A;  2ENM A;  4AFS C;  3NGP A;  1PD0 A;  5CKH A;  2QGS A;  4PJO A;  3S6W A;  1WHJ A;  4ESR A;  1N8R C;  1D09 B;  1GFD A;  3M0P A;  1H24 B;  3G71 Q;  3ULR B;  2EQM A;  1AD5 A;  2HD0 A;  2LJ1 A;  4R55 A;  3TCJ A;  2K2V A;  4C0Z A;  1Q7Y C;  3A98 A;  1Y0M A;  4HT9 A;  5CVI A;  2Z0W A;  3CCL A;  1GXI E;  1GBR A;  2KMT A;  2LT4 A;  4XTY A;  5IXB A;  2L89 A;  3EFS A;  4N4G A;  1YIJ Q;  2QA4 T;  4OR5 B;  3H41 A;  4M77 F;  1MMD A;  1NLP C;  3OB9 A;  4GBQ A;  2LRQ A;  4M7A F;  2JXB A;  2D0Q B;  1SHG A;  1ZHI A;  2C5X B;  4N0A A;  3H0H A;  3VRY A;  2XDB A;  1PKT A;  2O9V A;  2DJQ A;  4HT8 A;  4F7J B;  2DRK A;  4Y72 B;  2NUP A;  3EFO B;  1NM7 A;  3F5X B;  3KFV A;  1N9R A;  1PD1 A;  1QCN A;  4KH0 B;  2MWO A;  2QFZ A;  3I56 A;  3QWY A;  1JEG A;  3CCR T;  2EYQ A;  4ROC A;  3MP6 A;  4EMK B;  1RAA B;  2XMF A;  4BY6 C;  4Z8A A;  4V2S A;  4HL4 A;  4J9B A;  4M7A E;  1LJO A;  5KYY A;  4ELY C;  4E7S A;  2PHG A;  2QGG A;  1SEM A;  4JS5 A;  5KE3 A;  1JBM A;  4X34 A;  3CXC A;  4M7A C;  4ELZ C;  3EGD B;  2O31 A;  2YLC A;  4OMP A;  2JMA A;  4DBR A;  2IW6 B;  3M55 A;  4EC9 B;  1X69 A;  2RMO A;  3EGX B;  2X4W A;  3FIF A;  5DQW A;  1OL1 B;  5GMK j;  4M7A G;  1C0M A;  3JCM b;  3FC3 A;  1JSU B;  1N4M A;  1ZSZ B;  4F7U B;  4AFQ C;  1H27 B;  3D7S B;  1WXU A;  2RJC A;  1OIU B;  1G3Y A;  2LQN A;  2RM4 A;  4BCQ D;  2MMP A;  2RQT A;  1NJI U;  4LDY A;  1BIB A;  1O9S A;  1VQ8 T;  1SHF A;  2EBP A;  2LQK A;  3E9G A;  4KRT A;  3SDZ A;  3CPW S;  3TSZ A;  1Q81 U;  2DYB A;  5LJ5 d;  4YOO A;  1WFW A;  3BLH B;  5DLO A;  3EFR A;  1M2O A;  3X25 B;  1Q95 G;  1W2B P;  1R0C B;  5HNB B;  5FWB A;  2E12 A;  5CQX A;  2GTO A;  2C06 A;  1MNE A;  1UNL D;  4ZGD B;  2A28 A;  3CCE A;  2EGC A;  3CCM T;  1H1Q B;  1MMN A;  2Y4Y A;  4OP0 A;  3OYN A;  5IHN A;  4TVR A;  2WSF E;  2RQW A;  2C6T B;  5GAO q;  2ZPB B;  3DLM A;  2HQE A;  1W2B S;  2D9T A;  3PMI A;  4A4H A;  1AOJ A;  2R7G A;  3E1S A;  5I5Z B;  1ZUY A;  1K73 U;  3I9Q A;  1NYG A;  3EGU A;  1CSK A;  1QWE A;  1D3B A;  2YRV A;  4G6L B;  3BLQ B;  2XK0 A;  1VQ6 T;  4E2F B;  4PJO E;  2DZ9 A;  5CO7 A;  4BY6 B;  1JJ2 S;  1QP3 A;  6AT1 B;  4BE1 A;  1W70 A;  4OGE A;  2LCL A;  1WYX A;  4AG1 C;  9ATC B;  1WQ7 A;  3QHR B;  4QT7 A;  3ZBD A;  1TS9 A;  4C92 G;  3CC4 T;  1ZBX A;  2KRO A;  4B9X A;  2DE0 X;  5LJ5 e;  4HKE A;  3E9F A;  1M2V B;  5D7U A;  3LWI A;  4KGX B;  5HCK A;  2X35 A;  2HSP A;  4C5E A;  3GLX A;  2RHU A;  4QKU A;  2WAC A;  5CEI B;  1NEB A;  4J9H A;  2BPM B;  1GH6 B;  1RI0 A;  3PE0 A;  1VQ4 Q;  1D0X A;  1WGS A;  3G33 B;  2K5I A;  4MFD A;  4F70 B;  2K57 A;  3CME Q;  4BCK B;  1VQP A;  2M0O A;  2CP7 A;  2FZK B;  2JT4 A;  2BTT A;  1PSE A;  3MY5 B;  1I0C A;  2LNV A;  4FT2 A;  1AWW A;  1VQM T;  4EDU A;  2OI3 A;  3RGF B;  1TD6 A;  1M1F A;  1WX6 A;  2FEI A;  4FL6 A;  2D8J A;  3SFM A;  1WHH A;  2AIR B;  4Z6Y A;  1M30 A;  1M8M A;  1UUE A;  3T9N A;  5L23 A;  2CDT A;  2LC4 A;  1QVG P;  2DKG A;  2OTL Q;  1G8X A;  3MCA B;  1ZA2 B;  1G5V A;  1MND A;  1PRL C;  1VUB A;  4IUQ A;  2ED1 A;  4KRC B;  3V8J A;  4HNV A;  3P8D A;  3PVQ A;  2KAF A;  3OBW A;  1A0N B;  1VQM A;  2RHX A;  4M75 F;  5D6X A;  4XU1 A;  2HKN A;  1PWT A;  1WNL A;  2LT1 A;  1BI3 A;  4MFE A;  1OOT A;  3ZEH A;  1QVF S;  1UEC A;  3OS0 A;  5GAN 4;  3CQT A;  2BZ8 A;  3L2Q A;  4RG2 A;  3RKW A;  2RK2 A;  2X4Y A;  1RI9 A;  4JRK A;  3G71 T;  4M75 E;  3O5Z A;  1UG1 A;  2G9X B;  4EOJ B;  1K8A C;  3A8L B;  1IGQ A;  3BY7 A;  5KCO A;  2C5N B;  3OYJ A;  3GOX A;  2X1N B;  4FW2 A;  2SEM A;  4J6X A;  2CP2 A;  4LDV A;  3J80 E;  2YT6 A;  1C1A A;  1I1J A;  3PGG A;  1GUX B;  1YP5 A;  1MMA A;  2PJQ A;  3VS7 A;  1BIA A;  3DJB A;  4NS5 A;  3JB9 D;  5BNJ B;  4BCN B;  4F7S B;  4EOL B;  2FZG B;  1SSH A;  3CXC S;  4HCZ A;  2COY A;  2J06 A;  1B34 A;  1OPL A;  4LDU A;  1AEY A;  2CKK A;  2P84 A;  4A63 B;  3QBY A;  1TU0 B;  2W10 A;  4BUG A;  3RBB B;  2C0O A;  2DEQ A;  1Z9Z A;  4F04 B;  3ME9 A;  2X4X A;  3REB B;  1X6G A;  3PNW C;  1VQK A;  1YI2 T;  4L59 A;  5HK0 A;  4BCP B;  4CXA B;  2SRC A;  2QI2 A;  4Z89 A;  3MY1 B;  3LLR A;  5GAM f;  3RER A;  2W99 A;  3HL8 A;  4BCN D;  1JO8 A;  1JXO A;  2F5K A;  4EON B;  3HKS A;  5HY6 A;  3OBY A;  4XTZ A;  1YWO A;  1JJ2 A;  3M03 A;  2K3X A;  2R5A A;  2KNB B;  2YUP A;  1TOV A;  5LJ3 g;  2MF2 A;  5CKF A;  1Q7Y U;  2HBP A;  3M56 A;  5GAN f;  3VS4 A;  2IW8 B;  2W9F A;  4M7D A;  3JB9 H;  4R0K A;  2PU9 B;  4C5H A;  4FT4 A;  1VQ4 T;  3JB9 G;  4UC4 A;  2H3E B;  2DD4 A;  3CBP A;  1T3S A;  5GAN d;  2LX7 A;  1N27 A;  1UDL A;  3A8H B;  2COW A;  5GMK m;  4DBH A;  2E6N A;  3ZL7 C;  5KH6 A;  4WCI A;  4BCH B;  2EIF A;  1VQ6 Q;  3KHI A;  1UEB A;  2EYZ A;  4OML A;  5KYU A;  5GAN 5;  1YJ9 T;  2EQK A;  2A0F B;  2COZ A;  1PG5 B;  1TTH B;  2UZE B;  3EGD A;  2OTJ Q;  2VAS A;  3CCJ Q;  2DTI A;  8ATC B;  1QP2 A;  1QVG S;  3TW6 A;  3QUI A;  1FVV B;  2V8I A;  2YUO A;  1OV3 A;  3QG1 A;  1YWP A;  2E5Q A;  5CQY A;  1H64 1;  3M0R A;  4RTY A;  3CCS A;  4J5Y A;  5GAO l;  3M4Y A;  5FW9 A;  1TXQ A;  2VV5 A;  4CFN B;  4FYX B;  4ZGE B;  4L6V 5;  3O0G D;  4M7D C;  3VYG B;  4BE2 A;  2IPO B;  3LW5 E;  3K7A M;  1FYN A;  3PT9 A;  2BS4 A;  3U23 A;  3M0S A;  3V7C A;  2Y90 A;  3ASK A;  5KYX A;  1RAD B;  3C12 A;  2EQI A;  2L0A A;  5IXF A;  4M7A D;  2O4X B;  4XK8 E;  1TFB A;  4M77 D;  1HD3 A;  2VVK A;  4RTZ A;  2EKH A; 
#chains in the Genus database with same CATH homology
 4OMF B;  4C0D C;  3QII A;  1SSF A;  5CKH A;  1Q86 U;  4PJO A;  2CZ0 B;  2PQW A;  2XIC A;  4NL3 A;  5D6Y A;  3S6W A;  2JUF A;  4E7J A;  3JCM d;  1YIT T;  4BI8 B;  3RMQ A;  1N8R C;  2X4J A;  4JX6 A;  3BDL A;  3JCM W;  1VQP T;  1XTD A;  2EQU A;  3P8B B;  1QLB A;  1WQW A;  2QQS A;  1YIJ T;  3MP8 A;  4P5N A;  4BI3 A;  2EQM A;  2HD0 A;  2RO0 A;  4QVC A;  4R55 A;  4BI4 A;  5A2Q E;  5KE2 A;  5FRM A;  3BG9 A;  3TCJ A;  4DA4 A;  2K2V A;  4C0Z A;  1Q7Y C;  2DXB A;  1QVP A;  4HT9 A;  2GFA A;  2RD1 A;  5CVI A;  1KD1 U;  4RKU E;  5J39 A;  3CCL A;  3VUZ A;  1GXI E;  2KMT A;  2LT4 A;  4XAX B;  4XTY A;  2OTJ A;  4QW2 A;  4BB7 A;  2L89 A;  3CME A;  4C8Q F;  1N6A A;  2MI6 A;  1BKB A;  1V29 B;  1VQ7 A;  3EFS A;  4N4G A;  2DK3 A;  2RA2 A;  2LCC A;  5KCH A;  2QA4 T;  5EJC A;  3CCL T;  1I4K 1;  2LX9 A;  1Y71 A;  2NLU A;  3HRT A;  3WVD B;  3OB9 A;  4M77 F;  1XQH A;  5A0D A;  3OS1 A;  1ZQ1 A;  2LRQ A;  5AYF A;  4M7A F;  3OYE A;  4MIM A;  3H4C A;  2D0Q B;  5D6W A;  1ZHI A;  4OB1 B;  4MZP A;  4JLI A;  3UWN A;  4C8Q E;  4M77 C;  2E64 A;  3L2R A;  3C4S A;  2O4X A;  3SWN B;  1UB4 A;  4N0A A;  5A0L A;  3BG3 A;  3LX7 A;  4F7U F;  5CR2 A;  2XDB A;  1VQ8 A;  4BBS M;  2KMG A;  2QXF A;  1FWZ A;  3CPW A;  4MDW A;  1U1T A;  2XDP A;  2ZGW A;  3TRE A;  2I2L A;  2QQR A;  4HT8 A;  4NL2 A;  1YHQ T;  4MML A;  4ZN3 A;  3GPL A;  3VYG A;  4HCB A;  3HSB A;  1N9R A;  2MWO A;  3HO8 A;  2QFZ A;  3ER0 A;  3JB9 I;  3OYH A;  3I56 A;  3CCR T;  2EYQ A;  4M78 G;  4M77 A;  4BE0 A;  2E70 A;  3JB9 J;  4M78 D;  3CCQ T;  3MP6 A;  4M7D F;  2V8J A;  4EMK B;  4N4H A;  4J6Y A;  3QYG B;  4N4I A;  4XU0 A;  1P92 A;  3OYB A;  3PTA A;  2JN0 A;  3SWN A;  5GAN g;  1B34 B;  3R6O A;  4M77 E;  4BY6 C;  3WXM B;  1U1S A;  5GAO n;  2DJZ A;  1N9S A;  4V2S A;  4HL4 A;  4M7A E;  1VQN A;  1LJO A;  1H3Z A;  1FX7 A;  4ELY C;  1G3S A;  2VYT A;  2WJ9 A;  4JS5 A;  5KE3 A;  1VQ5 T;  1JBM A;  3HPW A;  3MEV A;  1NPR A;  4X34 A;  1HK9 A;  3DB3 A;  5GMK l;  3CXC A;  2RHY A;  4M7A C;  4C92 D;  4ELZ C;  4HNU A;  2HAX A;  3OSV A;  3DL1 A;  2YLC A;  4Q5W A;  4M7D E;  3DKM A;  4M7D B;  3M55 A;  3I55 T;  5CAI A;  1VIE A;  1M5Q 1;  4PLL A;  3VKH A;  4HA8 A;  3HB9 A;  4QQD A;  3JAM E;  2X4W A;  3FIF A;  3OYD A;  5GMK j;  3DLL A;  1Y96 A;  2VUB A;  4M7A G;  3O8V A;  2OTJ T;  5LJ3 j;  2CYZ B;  3FRN A;  4M78 F;  4C92 E;  3BFM A;  5GAM e;  3JCM b;  4ATO A;  4PJO B;  3FC3 A;  2F69 A;  1WJQ A;  2K4Y A;  3RIR A;  4XTU A;  4KUI A;  4F7U B;  3G4S T;  2QTX A;  4J83 A;  4C8Q C;  2RJC A;  1G3Y A;  2RM4 A;  2VC8 A;  2CZ6 B;  2MMP A;  4E7K A;  4OB0 B;  4M7A B;  5GAO m;  1LOJ A;  1YJW A;  3LH0 A;  2DIG A;  1G3T A;  1NJI U;  1M90 U;  4M77 B;  3OYL A;  4LDY A;  1BIB A;  1O9S A;  4ZGJ B;  3SWN C;  1OYX A;  1VQ8 T;  2DZC A;  2LQK A;  3E9G A;  3SDZ A;  3OYA A;  3CPW S;  1VQ9 T;  4OB2 B;  1LNX A;  2JZ2 A;  3G71 T;  2RI2 A;  4XQ3 A;  1BI0 A;  5IN1 A;  3OW2 A;  1Q81 U;  4E47 A;  2GF7 A;  3QDR B;  2P4T A;  3QYB A;  4Y91 A;  2OTL T;  4RCB A;  5LJ5 d;  4II1 A;  4B9W A;  3X24 B;  4C8Q A;  3EFR A;  5DLO A;  3JCM X;  3OA6 A;  1VQ4 A;  4KUL A;  3X25 B;  4M75 A;  3HZJ A;  3X20 B;  1X01 A;  2L5Q A;  3SB2 A;  3VU3 C;  5GAM j;  2E12 A;  5CQX A;  3CME T;  1YI2 A;  2C06 A;  3AHU A;  3JCM V;  2QQB A;  4ZGD B;  3RUX A;  3CCE A;  4JX5 A;  3FJP A;  3CCM T;  5GAN h;  5DY9 A;  5FU6 B;  5A0G A;  4JUV A;  2DD5 B;  2Y4Y A;  4OP0 A;  3OYN A;  3CCU T;  1QVG A;  5FRN A;  4TVR A;  2WSF E;  5GAO q;  2ZPB B;  5GAN 3;  1Y96 B;  4GY5 A;  2CS7 A;  4M78 B;  5M9O A;  1UGQ B;  3DLM A;  4C0D B;  1TH7 A;  1IZ6 A;  1X75 C;  2HQE A;  2JVV A;  2K5F A;  3M54 A;  5DLQ E;  2D9T A;  3PMI A;  2LTO A;  2HQX A;  1OI1 A;  2EFI A;  4A4H A;  1W2B S;  3CC4 A;  4A4K A;  2RH2 A;  4ZN1 A;  1M1K U;  1QVF A;  1JRI A;  2P0K A;  3E1S A;  3MO8 A;  4KUD K;  2OTL A;  1K73 U;  2G77 A;  1K9M C;  5LJ5 f;  2XI9 A;  4OVA A;  4AKH A;  2IG0 A;  1DJ7 B;  1D3B A;  2YRV A;  5GAM h;  3G6E T;  3VKI A;  1N8R U;  2VGN A;  2XK0 A;  2R57 A;  4C92 B;  1NPP A;  3L2V A;  1VQ6 T;  4PJO E;  2DZ9 A;  5CO7 A;  4BY6 B;  1MHN A;  3VYH B;  4YTL A;  4E7H A;  1QW1 A;  2ZZD A;  3H8Z A;  4PJO G;  5GMK e;  1JJ2 S;  1QP3 A;  2KY9 A;  5CKB A;  4BE1 A;  3CBO A;  4OGE A;  2LCL A;  1WQ7 A;  1KD1 C;  3ZBD A;  3QJ6 A;  3A5Z B;  2EQJ A;  4C92 G;  3GF5 A;  5CCA A;  2VXE A;  3CC4 T;  4FM4 B;  1ZBX A;  4B9X A;  5LJ5 e;  2BUD A;  4HKE A;  3E9F A;  4FU6 A;  4M75 G;  2LVM A;  3LWI A;  4QQ6 A;  3GNF B;  2H3J A;  4X9D A;  2AHJ B;  2X35 A;  3M59 A;  4C5E A;  2FL7 A;  2CGH A;  3GLX A;  3TU4 K;  3M4G A;  2RHU A;  3VJP A;  2WAC A;  3MEU A;  5EG2 A;  3G71 A;  4XTV A;  4NC6 A;  3NTK A;  3RES A;  1RI0 A;  3PMT A;  4FIB A;  3J7A F;  2GQV A;  1WGS A;  1M4Z A;  3NTI A;  2K5I A;  3I55 A;  2CZ7 B;  2XHC A;  4MFD A;  3CPF A;  1VQ7 T;  3QZ5 B;  2K57 A;  4M75 C;  5GAN 7;  4QVD A;  1VQP A;  2M0O A;  3G7Z A;  4FSX A;  4HNT A;  2MWP A;  2XID A;  3S3M A;  1KC8 C;  4EMK C;  1YIJ A;  4NOY A;  1PSE A;  4ME7 A;  2LNV A;  2DO3 A;  3PFS A;  4FT2 A;  3JCM c;  1M8V A;  4E7I A;  1VQM T;  1YBY A;  2RJD A;  4RMO A;  3OY9 A;  4A4F A;  2PVD B;  4EDU A;  1M1F A;  4FL6 A;  4Y28 E;  3CC7 A;  1K8A U;  2XKO C;  3SFM A;  1IRE B;  4M78 E;  5C6S A;  2QDY B;  3QXE B;  3OMG A;  4Z6Y A;  3T9N A;  2O01 E;  2EJG A;  2LC4 A;  2KK4 A;  2PVG B;  2DKG A;  3EAE A;  4M78 A;  1WJR A;  3MCA B;  3L2W A;  3Q1J A;  1G5V A;  1VUB A;  2DTH A;  4IUQ A;  4XU2 A;  3C95 A;  2RHZ A;  3CCJ A;  1Y7X A;  3CMA T;  2PVO B;  3G6E A;  3VKG A;  4PLI A;  2RI3 A;  4L5G A;  5GAN 6;  1KG1 A;  1VQ6 A;  2HNI A;  3V8J A;  4DOW A;  4HNV A;  3P8D A;  3JCM g;  5GAN 8;  3HBL A;  2YLB A;  4A4G A;  2ZCF B;  1R8O B;  2KAF A;  3OBW A;  4C8Q D;  3A8M B;  3PIO A;  4LDX A;  2EWN A;  4C8Q B;  5LJ5 g;  1VQM A;  2RHX A;  3BW1 A;  4M75 F;  5D6X A;  3TW7 A;  4XU1 A;  2DVE A;  4DQ2 A;  2A3L A;  2E6Z A;  3URG A;  3KXT A;  1WNL A;  2DD4 B;  2LT1 A;  4A54 A;  1BI3 A;  3CCE T;  4MFE A;  3M53 A;  3NFC A;  1VQ5 A;  1NZ9 A;  3OS2 A;  2PUO B;  3ZEH A;  1YJN T;  1QVF S;  2RK1 A;  3ZFJ A;  4JRP A;  3WVE B;  3OS0 A;  5GAN 4;  1OZ2 A;  5GAO r;  3FB9 A;  3VV0 A;  3L2Q A;  4AKI A;  4RG2 A;  3RKW A;  3A8G B;  2RK2 A;  5DM7 R;  3J81 E;  2X4Y A;  2JNG A;  4JRK A;  4M6V A;  1W4S A;  2FYK A;  1EIF A;  2RB6 A;  1M9S A;  5FU7 C;  4PNO A;  3VUB A;  1U8R A;  4M75 E;  1PSF A;  4IUT A;  3JCM P;  2RJE A;  2QEX A;  4MDX A;  3QO3 A;  2PUK B;  1Q82 U;  1K8A C;  3A8L B;  3CC2 T;  4IKF A;  4PJO D;  2CZ1 B;  3OYF A;  3CCQ A;  3BY7 A;  3QPH A;  4M77 G;  1KHI A;  2L3R A;  3CCV A;  5KCO A;  3FDR A;  4A53 A;  2E65 A;  1WPY A;  3OYJ A;  1YIT A;  3GOX A;  2E1H A;  3QZ9 B;  4ZTJ A;  1I8F A;  3HFO A;  4WF2 A;  3C94 A;  3G4S A;  2IVW A;  4J6X A;  4M75 D;  4F7U G;  4LDV A;  4LD9 K;  4J7F A;  2JOY A;  5LJ3 e;  3OYY A;  5FLX E;  3J80 E;  2DXC B;  2E10 A;  1YJW T;  3PGG A;  2GFU A;  1VIF A;  3UPU A;  3MEA A;  4JRQ A;  4M78 C;  1WJS A;  1BIA A;  2FHD A;  4NS5 A;  3JB9 D;  2QA4 A;  2XD0 A;  3L2U A;  5CKE A;  3CXC S;  2G3R A;  4PJO C;  1UGS B;  4AKG A;  1KHC A;  2KVQ G;  4HCZ A;  3L2Z A;  4PL6 A;  1I81 A;  1B34 A;  3KBG A;  4LDU A;  4XTW A;  4JS4 A;  3QSU A;  2CKK A;  3F70 A;  3QYH B;  1X6O A;  2BS3 A;  3QKJ A;  3QBY A;  1UGR B;  3OQ5 A;  3JCM h;  4EMK A;  2EAY A;  4BUG A;  1FKM A;  2YHT A;  4JDS A;  2DEQ A;  4EMG A;  5GAM g;  3QYE A;  2QQA A;  3M57 A;  3OSS C;  4OB3 B;  3OYI A;  3ME9 A;  5I21 A;  2X4X A;  4RCC A;  2EJF A;  2ZPG B;  3JCM Q;  1KQS S;  3JCM f;  1NE8 A;  1D3B B;  3CD6 A;  3OYG A;  3PNW C;  4ELJ A;  1VQK A;  1YI2 T;  4RG8 A;  3X26 B;  4L59 A;  5HK0 A;  4IUU A;  1Q82 C;  3S3N A;  2QF7 A;  4CI0 C;  2LDM A;  2QI2 A;  2XU8 A;  4BBR M;  2OAU A;  2P0P A;  3LLR A;  2L8D A;  3V8K A;  4EPC A;  5GAM f;  2LQ8 A;  3JB9 F;  3HL8 A;  3RER A;  4C0G A;  4MZT A;  1Q86 C;  4LD6 A;  2KSS A;  3CCV T;  2F5K A;  4Z02 A;  2P0Q A;  2K5L A;  3HKS A;  5CKD A;  1KQS A;  3MHX A;  4MZM A;  5HY6 A;  3BDU A;  2V8K A;  3OBY A;  4XTZ A;  3I56 T;  3FEO A;  1UGP B;  3CMA A;  3CCJ T;  4E7L A;  1JJ2 A;  4AI6 A;  3A8O B;  2QQ9 A;  2RI5 A;  3M9Q A;  1VQO T;  1YHQ A;  3QHS A;  5LJ3 d;  4C92 A;  3BG5 A;  2F5T X;  2K3X A;  3V8L A;  1OZ3 A;  2WSE E;  2R5A A;  4J7I A;  1Q81 C;  2D6F A;  3MP1 A;  3MET A;  1VQL A;  5LJ3 g;  2MF2 A;  4HCC A;  1BYM A;  5CKF A;  2K3Y A;  2DXB B;  2HBP A;  5GAO p;  1Q7Y U;  3NTH A;  3M56 A;  5GAN f;  2EKO A;  4BDY A;  4GLK A;  3OYC A;  5FRO A;  4JX4 A;  2ZPE B;  1KQ2 A;  4M7D A;  3P8H A;  1O75 A;  4MMK A;  3JB9 H;  1BI2 A;  2PU9 B;  2QQ8 A;  4C5H A;  2KDS A;  4ZTF A;  4X9C A;  4FT4 A;  4BD3 A;  3S3O A;  3UT1 A;  1AHJ B;  4VUB A;  2KR6 A;  3M58 A;  1MGQ A;  5IT9 E;  4JJN K;  3PIP A;  2DPP B;  2E41 A;  4LDW A;  3JB9 G;  1VQ4 T;  4M7D D;  4IUV A;  1YCY A;  4HLQ A;  4O6J A;  4UC4 A;  4M7D G;  5LJ5 j;  4OF1 A;  4PJO F;  2DD4 A;  2DAQ A;  3RKX A;  4M7A A;  3CBP A;  1JB0 E;  5LJ5 h;  5L8R E;  5I2S A;  3JSC A;  1I5L A;  1VQ9 A;  2BKD N;  4C5I A;  2M9U A;  4BAC A;  2Y4X A;  5IAY A;  5GMK i;  3V7S A;  5GAN d;  3SD4 A;  3OYM A;  3E19 A;  3DB4 A;  1N27 A;  3L42 A;  5GAN j;  1VQL T;  3A8H B;  5GMK m;  5FU6 C;  4C0F A;  2E6N A;  4QSH A;  2DXU A;  3HRS A;  4KBM B;  4DOV A;  1VQN T;  3JRZ A;  1G3W A;  3QWL A;  2VXF A;  3RKY A;  2ZPH B;  5KH6 A;  2XDD A;  1VQO A;  5J3B A;  2KQW A;  3CBM A;  2EIF A;  1W2B A;  3KHI A;  1UEB A;  4D6W A;  2RJF A;  2QDJ A;  4IUP A;  1K9M U;  3HHT B;  1NJI C;  4BDZ A;  1M90 C;  1KQ1 A;  3GIB A;  5GAN 5;  3HFN A;  3LGF A;  3H6Z A;  5FU7 B;  3GP8 A;  3JCM e;  2QEX T;  3OW2 S;  3RMS A;  1YJ9 T;  2EQK A;  1RL2 A;  2R5M A;  2DXC A;  2M1H A;  3FLG A;  1M1G A;  3OS5 A;  4N0A C;  2DXT A;  2FVU A;  3V7R A;  5HK3 A;  3CC2 A;  4F7U A;  1S72 T;  5C0M A;  3L1A A;  2ZZD B;  3QJY A;  4XU3 A;  2DTI A;  4KT0 E;  1QP2 A;  1YJN A;  1QVG S;  4JRI A;  3TW6 A;  2WSC E;  3QUI A;  1XNI A;  2V8I A;  4C8Q G;  3QG1 A;  3TEE A;  4C92 C;  2ZPF B;  4QQG A;  4QVZ A;  3CEY A;  2E5Q A;  5CQY A;  1VQK T;  1H64 1;  3CD6 T;  4XTX A;  2DTO A;  2BIV A;  2FB7 A;  5GAN e;  4EMH A;  3CCS A;  3X28 B;  4J5Y A;  4JLG A;  2MAM A;  5GAO l;  1Y07 A;  1HXD A;  3M4Y A;  4IUR A;  3LYI A;  3CCU A;  2M16 A;  3M5A A;  4A4E A;  1M1K C;  5I2M A;  5LJ3 h;  3HP9 A;  2ZPI B;  4LOC A;  2VV5 A;  3CCS T;  3OYK A;  3UDC A;  5GMK h;  4C92 F;  2GCX A;  4ZGE B;  3HRU A;  4O5V A;  3INZ A;  4L6V 5;  4M7D C;  1BI1 A;  3CCM A;  2DIQ A;  3KUF A;  3VYG B;  4CRI A;  4BE2 A;  3LW5 E;  2BS2 A;  3N5B B;  5LJ3 f;  4J6W A;  4C5G A;  3MEW A;  3PT9 A;  2BS4 A;  5J26 A;  3LWH A;  3GNG A;  2JTF A;  3V7C A;  2Y90 A;  5CIU A;  3CCR A;  2DD5 A;  2B8A A;  2XG8 D;  5HKC A;  4R56 A;  3ASK A;  4OGC A;  2A7Y A;  2R58 A;  4PKC C;  3C12 A;  1XOV A;  2VGM A;  5GAN 2;  4F7U E;  1S72 A;  3LGL A;  1KC8 U;  3OMC A;  2EJ9 A;  4J8O A;  4M7A D;  2O4X B;  4XK8 E;  4M77 D;  1YJ9 A;  3JCM J;  3CC7 T;  4M75 B;  1E7P A;  5GAM d;  2RHI A;  5LL6 S;  1FXX A;  5CK9 A;  1K73 C;  2JTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...