2CYZB

Photo-activation state of fe-type nhase in anaerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase in anaerobic condition
rcsb
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cyzB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cyzB02
3VYGA 2DD5B 1V29B 3X28B 2ZPFB 3HHTB 2D0QB 3VYGB 2CYZB 3A8GB 3X24B 3LW5E 2ZPGB 2PUOB 3X26B 2CZ6B 3QYGB 3A8LB 4ZGJB 1IREB 1PSFA 2DXCA 4XK8E 2QDYB 1UGPB 4RKUE 3VYHB 1AHJB 2AHJB 4OB1B 2WSEE 2CZ0B 3A8OB 3X20B 2DXCB 2DXBA 2ZPBB 2CZ1B 2PUKB 3QZ9B 4FM4B 3X25B 2DXBB 2DPPB 4ZGEB 4OB0B 2DD4A 1UGSB 2PVGB 2PVDB 2WSCE 1DJ7B 3A8MB 4KT0E 2PVOB 4OB2B 1UGQB 4Y28E 2CZ7B 3QZ5B 2ZPIB 2O01E 2DD4B 1QP2A 2ZZDA 2PU9B 2ZPHB 2ZPEB 2ZCFB 3WVDB 1GXIE 4L6V5 4OB3B 4ZGDB 2WSFE 3QXEB 3WVEB 1UGRB 1JB0E 2DD5A 2ZZDB 5L8RE 1PSEA 1QP3A 3QYHB 3A8HB
chains in the Genus database with same CATH superfamily
1QVGP 2V1RA 1H25B 5D7UA 4PFZA 3HRSA 1Y96A 1URCB 3BG9A 5GAMd 1Y57A 2P0PA 1Q81C 1ZSZC 2KAFA 1K0XA 4F7UF 4A63B 3DJBA 2RQRA 5LJ3h 2KK4A 2LW4A 1K9MU 2KDSA 1OIUB 2XMFA 2DL7A 1D1AA 2BZ8A 1N5ZA 2O4XB 2LQKA 5FRMA 1U5SA 2UZEB 2HKNA 3EGXB 4RTVA 1BYMA 1JO8A 4FSXA 3EGUA 2EQIA 3A98A 1AHJB 5M9OA 3G6EA 2BIVA 2VC8A 4BCKB 1H24B 2VWFA 2L89A 3VKIA 1YITQ 4OVAA 2AZSA 4DBQA 2WHBB 4EMKC 4BCND 1RL2A 4OMLA 3EFOA 1LVKA 3UA6A 3B57A 4BUGA 1VQMQ 4QT7A 2H3JA 2LNHB 3CXCS 1VQNQ 3CCMT 2R5MA 2K9GA 2K5FA 2YHTA 2PK2A 4A53A 5CR2A 3UPUA 1NPPA 5GAN5 2W9ZA 4CC4B 3OYEA 1JRIA 4HNTA 4C92D 2J7IA 2V26A 2K2VA 2O01E 3CC4Q 2FZCB 2EGEA 1BIBA 2PZ1A 1WGSA 5D6WA 2E6ZA 2K2MA 3O5ZA 1VQ5A 2FPFA 1YCSB 3VS1A 1K8AR 2H3EB 4LUEA 4JLIA 2XDDA 3HPWA 4F7SB 4NSTB 5LJ3f 4B9XA 2RQVA 1EFNA 2DRMA 3E9FA 1QVFA 2Y4YA 2EW3A 4LDYA 2COYA 3C4SA 5GAN3 2EYWA 4M77C 3UATA 4M4ZA 1UUEA 2O4XA 4M7AE 3OW2S 2EYXA 4BE1A 2M51A 3EGXA 5I11A 1FXXA 1GY3B 3A8GB 5LQFB 5LJ5g 1TU0B 1AISB 2RF0A 4RUGA 2P4RA 2WIPB 4OF1A 3MCAB 1IREB 4M75E 3CQTA 2LQ8A 3GF5A 1NEBA 3CCJQ 2BE9B 4BCFB 4BDZA 3J7AF 1YWPA 3I9QA 1RLQC 2DAQA 2KY9A 5LJ5e 1YWOA 2SEMA 3MEWA 3I55A 3CCUQ 3HTRA 4MZTA 3QDFA 2DBMA 4L5GA 1X6BA 2HNIA 3EH2A 4ELYC 4BI3A 3JCMQ 1UFFA 2E1HA 3JB9D 1SPKA 2BPMB 2K4YA 1V1CA 1K73R 1KD1C 4Z02A 3L2RA 4JZ4A 1GBRA 1M1KU 1TG0A 3IQLA 4CFMB 2DL8A 5LJ3j 1NJIR 4M6VA 2VYTA 1R77A 2CT3A 3G6ET 2DYBA 1UG1A 2QG9B 4II5B 2LQWA 3SDZA 4LE9A 4PJOE 2WSCE 2I2LA 3CC2Q 4BCQB 5GAOl 1BI2A 3CXCA 1FINB 4C5HA 4JPBW 4OB2B 2O9VA 2LTOA 2ZPIB 1M30A 3KUFA 4GLMA 2A08A 2PU9B 4M78C 5CQXA 1PD0A 3OQ5A 3NTIA 3RNJA 4L6V5 3CCVT 1VQ6A 2DEUA 3C94A 4KH0B 5IN1A 3TNWB 1JSUB 3N5BB 4OMFB 2X1NB 4YOZA 4YOOA 3ZBDA 4QVZA 3VS6A 4BI4A 4JJCA 2ZZDB 1Q81U 5GJVB 3JB9H 4EOJB 2X9HA 3QYHB 3MI9B 2WMAB 3CCET 5HY6A 2DLPA 1BCMA 2WEVB 2AT1B 2FL7A 2MYSA 1Q86C 3CD6A 3CC4A 3VS7A 2KMTA 1YJ9A 4N0AA 2D0QB 1QCNA 1G2BA 3JCMg 5CKFA 4PLIA 2M16A 1NEGA 3G71Q 5FRNA 2E12A 2LJ3A 3OW2A 1N9RA 3NTKA 1AZGB 1GCQA 1SRLA 2DL5A 3P8HA 3OSSC 1LNXA 3NMZC 5CCAA 3V8JA 1NLOC 4OGCA 3TEEA 2HQXA 4JUVA 3V7RA 1IHVA 1HXDA 4YOSA 2DF6A 2RQTA 5FGKB 2AZVA 3T9NA 2QEXA 3O8VA 3GOXA 1S72Q 4OGRB 3R6OA 5CVIA 1D3UB 3MPUB 4JJBA 1K9MR 3LWHA 4QW2A 1I5OB 2Y4XA 2L0AA 6AT1B 4JS4A 1K0SA 4NC6A 2MF2A 1UTIA 3EG9B 2GFUA 3UA7A 4JDSA 2KGTA 3ASKA 4C0DC 4JS5A 1ZA1B 3LX7A 2KT8A 1OYXA 2HMAA 1Q7YU 2B86A 2QDLA 3INZA 3CCRQ 4E2FB 2DD4B 2ZZDA 2DL3A 2FRWA 1M5Q1 4M7AB 3M0UA 2ZPEB 5HNBB 5KYWB 3RMQA 3RMSA 4M77D 2XHCA 3QXEB 2EKHA 1H8KA 3OYJA 3S3OA 1YHQA 4XTXA 3RUXA 1VQ9A 3VS3A 4M75B 1YITT 1KFZA 3OYYA 1VOMA 1ACMB 4IUVA 5KE3A 1WHGA 1YJNQ 3CC2A 1R8OB 4MDWA 3CBOA 3CCSQ 1GUXB 2RJEA 3H0IA 1M8VA 2CSQA 1M90U 2AKKA 3TNHB 1VQMT 5AT1B 1VQNT 1OPKA 4FW2A 2JTFA 3F70A 1QWEA 4F7UE 1ZQ1A 5J26A 3GP8A 3HB9A 4CFVB 4FYVB 3V8KA 1V76A 4CFNB 2ATCB 3CD6T 4M75G 5GAMh 3CC4T 4M7AF 5HBHB 2X4XA 1JSTB 4BCPB 1C9BA 1WXTA 4PJOB 4AT1B 1KD1U 2CGHA 3OYBA 3BHUB 1LCKA 3VS2A 3DLLA 1NG2A 3VRZA 2WSEE 3LH5A 4C8QE 5GAOn 3JCMb 4MZPA 3H6ZA 3BLHB 1X2KA 3TQ7P 4MMKA 2HQHA 2EAYA 4EPCA 4XQ3A 3ULRB 3RGFB 3QBYA 4RTZA 4DBRA 4HT8A 1VQ4Q 3M59A 4ME7A 1KQ2A 4LDVA 3EG9A 4MZMA 5EC7A 5ACBA 1QVFP 4M78D 4CFUB 2MK5A 2KROA 1N27A 2DD4A 2J05A 4C5EA 3OYKA 1MV0B 3BDLA 2LC4A 5KYWA 3FIFA 5KYYB 4DQ2A 2NWMA 2M1HA 3CC7Q 2DIGA 1BI1A 1WXUA 2ED1A 1I07A 4M75A 1HJDA 3TCJA 1IZ6A 4XTYA 2CSIA 2ZCFB 3TW6A 3UWNA 1GXIE 3CCJT 2WIHB 1ZBJA 2PK9B 3OSVA 3NFCA 2F5TX 1OU8A 2VXEA 2E41A 3I56A 5GAN7 5GAOq 1GUXA 2C6TB 1YNZA 3CCUT 1Q86U 1M1KR 5L8RE 3DDQB 3HZJA 1PSEA 1JOWA 2CH4A 3PIOA 4ESRA 1ZBXA 3L1AA 1FX7A 3G4SQ 1WFWA 3CMAQ 4RTYA 4IUTA 1AVZC 2X51A 1UEBA 5GMKe 1TOVA 2I53A 3QYBA 3CCRA 1YIJQ 3PO3S 5GAMf 2WJ9A 4DEYA 2F2VA 3VYGB 1H28B 2LJ0A 3L2UA 3QIIA 1M2OA 2CYZB 4PJOA 1RACB 5FU6B 3CC2T 3OY9A 2YUPA 3EHQA 3CXCP 2G6FX 3BG3A 4BDYA 1OEBA 4J8OA 3KBGA 2FEIA 3RBBB 4HNUA 1VQPQ 4LOCA 2EQKA 4DA4A 3J81E 1D3BB 1Q81R 2FYKA 2JS0A 1UHFA 1C6VX 1BI0A 2AHJB 4ZN1A 2R5AA 1CSKA 2DRKA 3SWNB 1OL1B 2RJCA 1WNLA 1OL2B 3I35A 1OOTA 4KBMB 3M54A 2LCSA 3HRUA 5KYYA 1UJ0A 2HZYA 5DQVA 2QDJA 3HSBA 2F2CA 4GY5A 4ZGEB 2RHIA 4C0ZA 3CCMA 5A2QE 3CCQQ 2D0NA 1AWJA 1U06A 3SHWA 3M53A 1C1AA 2YT6A 4BY1X 5GAN2 4C5GA 4JX4A 2EQUA 4C92F 5GANe 3G71T 3OW2P 4Z8AA 5CO7A 5GJWB 1MMGA 1FMVA 4AG2C 4OB3B 5GANj 4RG8A 1TXQA 4F7UB 4XU2A 2KYMA 4ZN3A 1WQ7A 4BY6B 4GLKA 3LWIA 1W2BS 3QJYA 4QQ6A 1FWZA 3SD4A 5CAIA 3OYCA 1Y0MA 3VYGA 4KUDK 4BXXX 1G3NC 1NPRA 1WQWA 3TSWA 2P0QA 1S72T 2E5KA 4F6SB 4C8QB 1ZA2B 2ZPFB 3LYIA 1ARKA 3C12A 1Q7YR 2YSQA 2QA4Q 4LDXA 2L3SA 4IIOA 2JTEA 4YTLA 2WFYB 1D3BA 2NLUA 2XICA 1FMKA 4JJNK 1K76A 2UZBB 1UB4A 1WI7A 2FG0A 1VQKA 2KRNA 4D8DA 3VUZA 2PUOB 1RI9A 2EYZA 4F7UG 3A8LB 2EJFA 2QGGA 3SWNA 2DMEA 3TU4K 1PNJA 3PE0A 4XTWA 3QJ6A 3CCRT 3JCMP 3VJPA 3G4SA 4J6XA 2QDYB 3DB3A 3FC3A 3CMAA 2K7AA 4EORB 3OYFA 2GTJA 5FWBA 1H3HA 2L3QA 4OB1B 2C5NB 4PNOA 4EC8B 5CKBA 1OI9B 2ENMA 2MAMA 2OJ2A 5CEIB 4HCZA 4HL4A 4C0FA 3M0TA 3DOGB 1M90R 3JB9F 1AZEA 2CP7A 5GANd 1ZHIA 5AYFA 1YJNT 3I5SA 4VUBA 3M0QA 1ZLMA 1IGUA 2L8DA 1AWXA 2EFIA 2K5LA 4C8QF 3MHXA 4QSHA 2EJ9A 1SG5A 2GFAA 3CCST 2PNIA 1VQPA 4X1VA 4LDUA 3M0SA 4RTTA 4EMHA 2KR3A 2CCIB 1F5QB 4OMMA 4PJJA 2HDAA 1PD1A 2DO3A 1B07A 3DLMA 3OB9A 4XTUA 3A8MB 1OZ2A 1G3SA 2JOYA 1KD1R 4F7UA 5A0GA 2P84A 1YBYA 2VVKA 4E7IA 1WPYA 4PJNA 1YJWQ 1D09B 1OX8A 2HEQA 1YN8A 2CDTA 4J9CA 1KQSS 4LXCA 3NDQA 4II1A 5KCHA 5C0MA 1GRIA 3SFMA 1MNEA 4HVWA 3CCVA 3MEVA 4C8QA 3FDRA 3MKDA 3JAME 1CKBA 1UNLD 2UZLB 2JJ9A 2EPDA 4BCMB 1BU2A 2V8IA 1VQ4T 2WXVB 1RAEB 2RH2A 3CCEA 1W2BA 1JKWA 1FVVB 2KE9A 2HL3A 3OYIA 3MY1B 1GFCA 2HKQB 1OX9A 2E65A 1OZ3A 4EIKA 5LJ5f 1S1NA 2V8KA 5DLOA 4FT4A 4X9CA 1G3TA 1LOJA 2UUEB 4ZGJB 1T0HA 3CC7T 2ZAEA 4E7HA 2QQBA 2F1LA 1Q86R 3GBQA 2JS2A 2LVMA 2GQVA 4RTUA 3G7ZA 3O0GD 1SHGA 4AMCA 1VQKT 4O6JA 3DDPB 1JBMA 4P5NA 4FCYA 2D1XA 3K7AM 1OU9A 2X4JA 3CCLQ 3WXMB 1D1BA 2LQNA 1G5VA 2PUKB 3G4ST 2KSSA 3CMAT 2YXYA 1OULA 2DXBB 5EFQB 3MEAA 1QWFA 4QQGA 1YIJT 5GAN8 5HQ0B 2QQRA 2PVDB 4FU6A 2E3IA 1VQ8Q 5IHIA 1FMWA 4G6LB 2M0YA 2ZGWA 4EOMB 4FL6A 5LJ5j 4EC9B 1QLBA 4XTZA 2MCNA 4N0AC 3URGA 1WLPB 5LJ3g 2CUBA 2EIFA 5HKCA 3PNWC 5GMKm 3L42A 1VQPT 1BKBA 4PL6A 4I3ZB 4KH1B 1KSWA 4M77F 3REAB 2DETA 1WZOA 2RK2A 1GCQC 1RAHB 2EGCA 4JRQA 1LPLA 1W70A 2XU8A 3H9NA 3EG2A 2YDLA 1E6GA 5HBEB 1KQSA 1SKUB 3TN8B 2O2OA 2C0OA 5IH2A 1YITA 1JJ2S 2PTKA 1K1ZA 4M7DE 2BKZB 3KHIA 1O9SA 2X4YA 1WJSA 5IDNB 3JCMW 5BNJB 4ZTJA 1H1QB 1ZUUA 1VQMA 2EKOA 3LGFA 1VQNA 1KIKA 3CCQT 3VV0A 2DTHA 1N8RC 3OS2A 5DY9A 3X26B 2J6OA 2RQUA 3POMA 2HSPA 4XK8E 3RKYA 1E7PA 3Q1JA 3RKWA 1TUDA 2FZKB 2R58A 1YP5A 3VRYA 1B7TA 1OKWB 3M03A 2EWNA 8ATCB 4QQDA 5LJ5d 4NL3A 4BCIB 4TTHA 3GIBA 5EJCA 3X20B 3M56A 2J6KA 1RAFB 2D9TA 5HK3A 2DXBA 2RO0A 2CJMB 3DTOA 1KJWA 3BDUA 3ZFJA 5A0DA 1HSQA 2QQAA 4EDUA 2F2XA 1PKDB 1JXMA 4K11A 4M78F 3GNGA 4R56A 4UN0A 4FM4B 2YLCA 3L2ZA 2COZA 3JCMe 4HA8A 3HL8A 2CUDA 3OMGA 4HT9A 2QA4T 2DVEA 1E6HA 4HCBA 3CEYA 3C95A 2EQMA 3H8ZA 3OS5A 1HD3A 3CPWS 2XDBA 3MP6A 3V7CA 5IHYA 3WVDB 2LCLA 1X27A 4C92E 1VA7A 2NUPB 3JCMJ 2OTJQ 2I0NA 3CCJA 2J06A 2EJGA 4FIBA 5CQYA 3OYHA 3PTAA 1GFDA 3GLXA 1KHIA 5HCKA 3CCUA 2G3RA 3H41A 5LMKB 1VQ8A 1SF9A 3JCMc 1MGQA 1VINA 4RMOA 4OGEA 2BTTA 2W96A 2EQJA 5IF1B 1PWTA 2RQWA 1EZZB 1JJ2A 2XIDA 1TWBA 4CFWB 4A4GA 2BZXA 4EOPB 1WA7A 3VU3C 5GAN4 2QI2A 2HCKA 1TUCA 2CCHB 3QYGB 2LT1A 2Z0WA 3QO3A 2E64A 2ROTA 4M7AC 2P0KA 1TSFA 2QGSA 1Z9QA 2CH4W 3V8LA 1YJWT 3RIRA 3JCMd 4RCBA 1H1RB 4LNPA 4CRLB 1ZUYA 3U23A 4PJLA 4M7AG 4M75C 5CYIB 2IVXA 1C0MA 2IPOB 4AFQC 3TSZA 3GTMS 1NZ9A 1BU1A 2GQIA 2V1QA 4PJMA 3M57A 4Z88A 3REBB 2DPPB 3VS5A 1W2BP 3OYLA 4DOVA 4BE2A 1PHTA 2CP5A 3A5ZB 3EOCB 5IHKA 2LRQA 2RMOA 2MWPA 1K9AA 4E7SA 2NUPA 4KT0E 2RI5A 5GANh 5J3BA 4M7DB 2QQ9A 2W99A 3QG1A 3QZ5B 1JXOA 2QASA 2LT4A 5GMKi 2E5QA 3OBWA 1GBQA 1T3SA 4PJOC 3NHNA 4FT2A 1NBEB 2JZ2A 3G71A 1IXDA 1NYGA 3PVLA 2MIOA 2XDPA 2NUTB 2RD1A 5KYUB 4PLLA 4V2SA 1Q82C 4J7IA 3EG3A 2C5VB 1QLYA 3ZEHA 4BCQD 5C6SA 3CPWA 4CC7A 3C0CA 2RHZA 4M7AA 2OI3A 2COWA 1QW1A 4PJOG 2MI6A 1OPLA 1UECA 1VYTA 2L3PA 3RERA 4A54A 4JLGA 2GBQA 4B9WA 3TVTA 3CCLT 3RR6A 2YUNA 2G77A 4OMPA 1V29B 2HL5C 2BUDA 3UT1A 1U3OA 1R0CB 1N8RU 2RHUA 1N6AA 1S72A 3P8DA 3HBLA 1UGVA 5D6YA 3P8BB 2OX7A 2VASA 1KHCA 2DIQA 2VV5A 2E4HA 3E19A 3X24B 2DYIA 1VQ8T 2Y90A 1MNDA 2QGFB 4IKFA 3BFMA 4ROEA 4ANJA 1QMZB 3F5XB 4M7DF 2P4TA 2QK0A 3AHUA 3FRNA 2W9FA 1VQ7Q 2EUFA 4BCNB 2EBPA 2YRDA 2SRCA 1A0NB 4RKUE 5ECAA 1I5LA 3L2WA 2VB6A 3A8OB 2FVUA 2RM4A 3M4YA 1TS9A 4OMQA 1RUWA 3JB9I 2I40B 4E7JA 3G1JA 5GMKj 2E3HA 2QF7A 2A37A 4EMGA 2ZPBB 2F2WA 4LD9K 3S3NA 1KQSP 2AK5A 4C92B 2CZ1B 1PKTA 2KQWA 3QWYA 5GANf 2DILA 5DLQE 1YJNA 4EOIB 4M7DA 1VQOQ 1WHLA 3X25B 3BLRB 5L2WB 5GAOr 1VOLA 2BKDN 2DKGA 4RODA 5GMKl 3CCSA 3EFRA 5FU6C 3CBMA 3M0PA 2NUTA 2IW9B 1CKAA 4J9DA 5KYUA 4XAXB 1I0CA 1HK9A 2OAWA 1SRMA 1BB9A 3HFOA 2RB6A 4BBRM 1VQLQ 1H4LD 3PT9A 1I4K1 2LX9A 2CP0A 4CC2A 4C92G 2GNCA 4Y72B 3SWNC 4MIMA 1KC8C 1G8XA 1W1FA 2YRCA 5GAMg 1TH7A 3QUIA 2IVWA 4E7LA 4M77E 4KRCB 2QXFA 2X3WD 3A8HB 4E47A 1FKMA 1M3AA 1WHJA 2D8HA 3MP8A 1OGUB 2KBTA 1RAAB 4Z6YA 2LJ1A 4RTXA 4HLQA 4F7JB 1OIYB 4J9BA 3J80E 4EOSB 3FJPA 3EHRA 4LDWA 1D1CA 2M02A 1VQ4A 2C06A 5HVYB 4F6UB 4EOQB 2JM9A 4HNVA 2YRVA 2JN0A 4PFPA 3KXTA 3EJ1B 4M75D 1TTHB 2DMOA 1VIFA 1KXUA 2VUBA 2V8JA 4KRDB 2BS4A 3LLRA 4XTVA 4MFDA 2GTOA 1UHCA 1VQ5Q 2IN3A 1ZUKA 1AEYA 1M27C 1JU5C 5FU7B 3CC7A 2C5XB 2O88A 4J6WA 2DE0X 1MUZA 2E70A 2HQEA 3VYHB 1OI1A 4C92A 2CP2A 1X69A 2RNAA 1M1GA 2OTJT 1W6XA 4BY6C 3PGGA 4QVCA 2BS3A 3S6WA 1D0YA 2OTLQ 2X3XD 1AD6A 3EIDB 2EYQA 4XU0A 5GAN6 3G33B 2W0ZA 3VS0A 4HVUA 1VYUA 4C8QC 4CI0C 4J7FA 4PJOD 3H4CA 4EOLB 3JB9G 2AKLA 2XK0A 5LJ5h 2DNUA 4IUPA 4F70B 2PVGB 1ZSZB 1M9SA 4M78E 1RLPC 1JJ2P 3HP9A 4J9GA 1WJRA 1YIJA 2J6FA 4C8QG 4PFOA 4BCHB 1BBZA 1I8FA 1Q82U 1UGQB 4Y28E 3SEMA 2CZ7B 4FX3B 2MMPA 2RK1A 3MO8A 2PJQA 4CFUD 1RAIB 1GCPA 4OMOA 1ZP2A 5I2SA 3I55Q 3H0FA 2LP5A 1MMNA 2G9XB 2OAUA 5HBJB 3FJ5A 4LD6A 2JNGA 2ESWA 1VQOA 1YI2Q 2KRMA 2DM1A 3JB9J 3L2QA 2LX7A 3JSCA 3EGDB 2NYSA 4DBHA 2ED0A 1QKXA 4XU3A 4IURA 2H8HA 4EMKB 1WX6A 2O31A 2DD5B 4DBFA 5DQWA 2FHDA 4ORZA 4J9FA 1RADB 1VQLA 1TD6A 1WIEA 2VGNA 2YWWA 4ELZC 5FLXE 1WHKA 1QMCA 3BHVB 4KGVB 1WDXA 2QQ8A 1T3LA 1NE8A 2JT4A 4EOOB 2DTOA 2DZ9A 2JUFA 1H26B 3EG1A 4N4IA 4HVVA 3CCQA 3THKA 1UJYA 1VQ6Q 4JRKA 2DK3A 2DX1A 1VIEA 5IAYA 1UGPB 2FPEA 2XG8D 4D6WA 1N9SA 2A3LA 3EH1A 4J6YA 2K3BA 3CPWP 4A4KA 2DXCB 1TFBA 4CFXB 3PVQA 4OMNA 4WCIA 4UC4A 3CMEQ 1N8RR 3DKMA 4X9DA 5EG2A 3CD6Q 4JJDA 1M2VB 1E7OA 1ZSZA 5A0LA 3M0RA 1BIAA 2RA2A 1YJ9Q 4FYYB 2FB7A 4MDXA 4AKGA 3ER0A 3JCMh 1Q7YC 1B34B 4M77B 9ATCB 4JRIA 2KNBB 4KGZB 4EONB 1TUGB 2QA4A 1H27B 1BI3A 1ABOA 4AI6A 1KC8U 2GGRA 2CP3A 2LMJA 1UNHD 3V7SA 3EGDA 3OYGA 2OTLA 1VQ7T 1KQ1A 4CC3A 4IUUA 2VXFA 3NGPA 4ZGDB 4J9EA 2A0FB 4EMKA 4F16A 1UGRB 5HK0A 1JB0E 2C0TA 5FW9A 2DD5A 3M58A 2QEXQ 4D8KA 2D6FA 1M90C 4M77G 4PK4A 1JEGA 4BD3A 4FYWB 4DEXA 1GH6B 1M3BA 4HXJA 4HCCA 3TW7A 2X4WA 1F1BB 1ABQA 4X34A 3PMIA 1VQOT 4ELJA 3OS1A 2LNVA 3HHTB 4F6WB 3HKSA 2KI7A 2HSEB 4JX6A 3E2UA 4PKCC 4FYXB 5LJ3e 1YI2A 1PRMC 2C0IA 1U1SA 2IG0A 2RHYA 2CZ6B 1O9KB 1SHFA 4RG2A 5GAOp 2DXCA 1PM3A 4C8QD 3QHSA 1YHQQ 2L2PA 2VGMA 1VQLT 4M78B 1AWOA 1M2VA 2KYBA 1QVGS 3VKHA 1VQ9Q 2JMAA 1YJWA 1D0ZA 3JCMf 2CZ0B 1B34A 1U8RA 4M77A 1X6OA 2CP6A 4GBQA 5ICPB 2FRYA 1XQHA 3UF4A 1QQJA 1X6GA 2M9UA 2XKOC 4OB0B 1UGSB 2QTXA 1K8AC 4M78G 1DJ7B 1XNIA 4AKIA 3VKGA 4OP0A 2RN8A 3KFVA 1X43A 2CT4A 4NOYA 3CMEA 4MMLA 3JV3A 3QWXX 2DJZA 1QP2A 1IRXA 1VQ5T 3HRTA 2F69A 1B3QA 1H1PB 1PG5B 3H0HA 1J3TA 1I81A 4WF2A 2HBWA 2KXCA 4HKEA 3S3MA 5IT9E 3ZL7C 4KULA 5KYNA 4Y92A 3BW1A 1Z9ZA 3EG0A 5LJ3d 1EX4A 1O75A 5FROA 1QP3A 4MFEA 3CBPA 1K4US 2E10A 1VYVA 2DVJA 1H641 4BCJB 2OTLT 4ROCA 3LGLA 1XJWB 2BZYA 2D8JA 2QYZA 4FW1A 3QDRB 3CCLA 1W98B 3BY7A 2XD0A 1O9KA 1Q82R 3VS4A 4F14A 1T0JA 2JMCA 1G3YA 5KE2A 5I22A 3RKXA 1NYFA 2XI9A 4KGXB 4M78A 5KYXB 5D6XA 1H3ZA 3A1PA 4EOKB 2QQSA 3QYEA 4BB7A 2KVQG 1WJQA 3ME9A 2ZPGB 4BCMD 3TREA 3DB4A 3QPHA 4C0DB 3OYAA 1K73C 2ABLA 3QWLA 4N4HA 2DZCA 1WHHA 2DEQA 2MOXA 5GMKh 1PKSA 4YC3B 3I55T 3I56Q 3NPFA 1NJIC 1XOVA 1Y7XA 2L5QA 4BCGB 1PRLC 1YI2T 2JXBA 3BHTB 1G3WA 1IB8A 3MJXA 5I21A 1QVGA 1BCOA 4A4HA 1R0BG 2UZDB 2W2HA 3FEOA 5L23A 3L2VA 3HFNA 4OR5B 1OV3A 3OA6A 1D0XA 1NLPC 3JRZA 1FYNA 2K5IA 1SEMA 1AD5A 2CREA 5CKHA 1QVPA 1QCOA 2AIRB 8AT1B 4WTOB 4LUDA 2B9RA 2EVRA 2IIMA 2JM8A 2PVOB 2DXUA 1AWWA 4XU1A 3OYDA 4CXAB 1X2QA 2O9SA 3PIPA 4AFUC 2R7GA 1SSFA 2BE7D 1X01A 2DBKA 1VQ6T 2A28A 3MEUA 4TVRA 5KH6A 4F17A 3BG5A 1P92A 2RJFA 1VYWB 3QHRB 1LJOA 2JW4A 4B6MA 1ZX6A 3AT1B 3D7SB 3CMET 5IDPB 2LCCA 5KYXA 4ZNXA 5I2MA 2JVVA 2QAZA 3MP1A 3OYNA 3CCMQ 3GNFB 5FWCA 1YJ9T 5LL6S 3GPLA 1QKWA 3RDVA 1KC8R 1YFNA 2CS7A 1RABB 1W4SA 3LH0A 2W10A 2K57A 1M4ZA 2RI2A 4JZ3A 4M75F 4M7DC 4LN2A 2A36A 1Y07A 4NS5A 2IW8B 3EFSA 3E9GA 2LZ6B 3QHWB 2A7YA 2DFUA 1PSFA 3M5AA 2PHGA 4M7DG 1K9MC 2WPAB 1NM7A 1EIFA 3JCMX 2VKNA 2K3YA 3UDCA 1M8MA 2B8AA 3RESA 2RI3A 2FO0A 4IUQA 4AFSC 2OTJA 2NUZA 2QEXT 4Y91A 1E9HB 4F7LB 1PCXA 2DA9A 4BI8B 5DM7R 1K8AU 4A4EA 4J83A 1H1SB 2C5OB 1G83A 3M4GA 4PJOF 4BBSM 3PMTA 3FB9A 4QVDA 4AG1C 1ZSGA 2RHXA 1VQKQ 3QKJA 4E6RA 4RTWA 2V22B 4IMYB 4IIMA 1XTDA 3OMCA 4KRTA 3MIAB 2KMGA 1M1FA 2GF7A 4DOWA 4BACA 2HD0A 2EYYA 2KXDA 1OKVB 2MWOA 3VUBA 4O5VA 4JX5A 2QTVA 2DL4A 2ZPHB 4QKUA 2YLBA 2K6DA 5CIUA 1YHQT 5GAOm 2WMBB 3FLGA 4Z89A 3MY5B 4ELLA 1VUBA 1X75C 2RJDA 3CPFA 2HAXA 3BE3A 1VQ9T 2PQWA 2GCXA 5CK9A 1MMAA 4C0GA 1IHWA 4AKHA 4ATOA 1RI0A 4C92C 3SB2A 3OS0A 1IO6A 2X35A 4E7ZA 5IXFA 4R0KA 3BLQB 1KK7A 1SSHA 2DJQA 2F5KA 4A4FA 2YUOA 3G6EQ 3PFSA 1YCYA 3X28B 2YUQA 1AT1B 1K73U 3M55A 1U1TA 1PC0A 4C5IA 2HBPA 1H92A 1Q95G 1Y96B 1NJIU 3LW5E 3OBYA 4JRPA 1OQKA 3NTHA 3TNIB 3HO8A 2KEAA 3DL1A 5CKEA 4E7KA 4M7AD 4J5YA 4J9IA 5GAMe 5GANg 5J39A 3CCVQ 1HYOA 2ECZA 2L3RA 1WXBA 1MHNA 3LQ5B 2K3XA 4HCKA 4Q5WA 4R55A 1XO2A 1Y71A 2JTMA 1N4MA 5GAMj 2K79A 3JCMV 4J9HA 2R57A 2BS2A 3EAEA 2KT1A 2QFZA 3CCEQ 2JGZB 5I5ZB 4ZTFA 1RAGB 1WYXA 1QCFA 3I5RA 3QZ9B 5IXBA 2KRSA 2ROLA 4CRIA 2KR6A 3R6NA 1GL5A 5CKDA 4BE0A 2FZGB 4BCOB 3E1SA 4L59A 3META 4F7NB 2CKKA 1UDLA 3QSUA 2EGAA 1MMDA 2IW6B 2FPDA 2WACA 4BY7X 2RPNA 2M0OA 3EFOB 1M1KC 1AOJA 4AFZC 2DERA 5IHNA 2LDMA 1P5EB 4KUIA 5FU7C 1UE9A 2DTIA 4FSSA 2DXTA 4N4GA 5KCOA 4F04B 2PMIB 1KG1A 1VQ7A 4RCCA 1IGQA 1M3CA 2E6NA 3M9QA 2MPXC 3I56T 2WSFE 3WVEB 2C4GB 1JQQA 1MV3A 1WHMA 1QVFS 4NL2A 1BK2A 1I1JA 1UNGD 3OYMA 4M7DD 1ENWA 7AT1B
chains in the Genus database with same CATH topology
3JCMc 1MGQA 4BD3A 4RMOA 4IUTA 3HRSA 4OGEA 1Y96A 3BG9A 5GAMd 2EQJA 1UEBA 5GMKe 4HCCA 3QYBA 3TW7A 2P0PA 3CCRA 2X4WA 1Q81C 4X34A 5GAMf 3PMIA 2KAFA 1VQOT 2WJ9A 4ELJA 3OS1A 1JJ2A 4F7UF 2XIDA 2LNVA 3HHTB 3HKSA 4JX6A 4A4GA 3VYGB 3L2UA 3QIIA 5LJ3h 2KK4A 2CYZB 4PJOA 4PKCC 1K9MU 2KDSA 5FU6B 3CC2T 3VU3C 5LJ3e 3OY9A 5GAN4 1YI2A 2QI2A 1U1SA 2IG0A 2RHYA 3BG3A 2CZ6B 3QYGB 2LT1A 3QO3A 4BDYA 2E64A 4M7AC 4RG2A 2P0KA 2DXCA 2O4XB 3KBGA 4J8OA 2LQKA 4HNUA 5GAOp 4C8QD 3QHSA 5FRMA 1BYMA 4LOCA 2EQKA 2VGMA 4DA4A 1VQLT 3J81E 1D3BB 4M78B 3V8LA 1YJWT 2FYKA 4FSXA 3RIRA 3JCMd 3VKHA 1QVGS 4RCBA 1AHJB 2AHJB 1BI0A 4ZN1A 5M9OA 2R5AA 1YJWA 3G6EA 2BIVA 3JCMf 2CZ0B 2VC8A 4M7AG 3SWNB 4M75C 2L89A 3VKIA 4OVAA 2RJCA 1WNLA 1B34A 1U8RA 4M77A 4EMKC 1NZ9A 1X6OA 4KBMB 1RL2A 3M54A 3HRUA 1XQHA 4BUGA 3M57A 2H3JA 3CXCS 2QDJA 3HSBA 3CCMT 4GY5A 2DPPB 4ZGEB 2R5MA 2M9UA 2XKOC 4OB0B 2RHIA 3OYLA 4DOVA 4BE2A 1UGSB 2K5FA 2QTXA 4C0ZA 3A5ZB 3CCMA 2YHTA 5CR2A 4A53A 1K8AC 4M78G 3UPUA 2LRQA 1DJ7B 1XNIA 5A2QE 2MWPA 1NPPA 5GAN5 4AKIA 1JRIA 2RI5A 3M53A 3VKGA 4KT0E 4OP0A 5GANh 5J3BA 3OYEA 2QQ9A 4M7DB 4HNTA 3QG1A 4C92D 5GAN2 4C5GA 2K2VA 4JX4A 2EQUA 3QZ5B 4C92F 5GANe 3G71T 1VQ7A 4NOYA 2LT4A 5GMKi 2E5QA 2O01E 3OBWA 4MMLA 3CMEA 2DJZA 1QP2A 5CO7A 1BIBA 4PJOC 1WGSA 4FT2A 3G71A 2JZ2A 3HRTA 5D6WA 1VQ5T 2E6ZA 2F69A 2XDPA 2RD1A 4PLLA 4OB3B 1I81A 1VQ5A 4WF2A 4V2SA 1Q82C 5GANj 4J7IA 4HKEA 4RG8A 3ZEHA 5IT9E 3S3MA 4F7UB 5C6SA 3CPWA 4XU2A 4KULA 2RHZA 4M7AA 3BW1A 4ZN3A 4JLIA 1QW1A 1WQ7A 4PJOG 2MI6A 5LJ3d 4BY6B 2XDDA 1O75A 5FROA 4GLKA 3LWIA 1QP3A 4MFEA 3RERA 1W2BS 3CBPA 3HPWA 2E10A 3QJYA 5LJ3f 4QQ6A 1H641 1FWZA 4B9XA 4A54A 4JLGA 3E9FA 3SD4A 5CAIA 4B9WA 2Y4YA 3VYGA 3OYCA 2OTLT 1QVFA 3CCLT 3LGLA 4KUDK 4LDYA 3C4SA 5GAN3 2G77A 1NPRA 1WQWA 2P0QA 1V29B 1S72T 3QDRB 2BUDA 3UT1A 4C8QB 3CCLA 3BY7A 1N8RU 2XD0A 2RHUA 2ZPFB 1N6AA 3LYIA 4M77C 3C12A 1S72A 3P8DA 3HBLA 4LDXA 2O4XA 5D6YA 3OW2S 4M7AE 1G3YA 3P8BB 5KE2A 4BE1A 4YTLA 1FXXA 1KHCA 3RKXA 2XI9A 1D3BA 4M78A 2NLUA 5D6XA 2DIQA 2VV5A 1H3ZA 2QQSA 2XICA 3A8GB 3QYEA 1UB4A 3E19A 4BB7A 4JJNK 3X24B 2KVQG 1VQ8T 1VQKA 2Y90A 1KG1A 1WJQA 3ME9A 3VUZA 2ZPGB 2PUOB 3BFMA 3TREA 5LJ5g 4IKFA 3DB4A 4F7UG 4M7DF 3QPHA 2P4TA 4C0DB 3A8LB 3AHUA 3OYAA 2EJFA 1K73C 4OF1A 3QWLA 3FRNA 3SWNA 3MCAB 1IREB 4M75E 2DZCA 4N4HA 3TU4K 2LQ8A 3GF5A 4XTWA 3QJ6A 3CCRT 3JCMP 2DEQA 5GMKh 3VJPA 3G4SA 4J6XA 2QDYB 3DB3A 4BDZA 3I55T 3J7AF 3FC3A 3CMAA 1NJIC 4RKUE 3OYFA 2DAQA 1I5LA 1XOVA 1Y7XA 2KY9A 5LJ5e 2L5QA 3MEWA 3I55A 4OB1B 3L2WA 4MZTA 4PNOA 3A8OB 5CKBA 2FVUA 2RM4A 3M4YA 3JB9I 1YI2T 4L5GA 2HNIA 2MAMA 4ELYC 4BI3A 4E7JA 1G3WA 5I21A 5GMKj 2E1HA 4HCZA 3JCMQ 4HL4A 2QF7A 4C0FA 4A4HA 3JB9D 4EMGA 2ZPBB 1QVGA 4LD9K 2K4YA 3JB9F 5GANd 3S3NA 1ZHIA 1KD1C 5AYFA 4Z02A 3FEOA 3L2RA 3L2VA 3HFNA 2CZ1B 2KQWA 4C92B 1YJNT 4VUBA 5GANf 2L8DA 1M1KU 2EFIA 5DLQE 3OA6A 2K5LA 4C8QF 1YJNA 4M7DA 5LJ3j 3MHXA 4QSHA 4M6VA 3X25B 2EJ9A 2GFAA 2VYTA 3JRZA 3CCST 2K5IA 3G6ET 1VQPA 3SDZA 4LDUA 5GAOr 2BKDN 2DKGA 5CKHA 4EMHA 5GMKl 1QVPA 3CCSA 3EFRA 4PJOE 5FU6C 2WSCE 2I2LA 5GAOl 2DO3A 3CBMA 1BI2A 3OB9A 3DLMA 4XTUA 3A8MB 3CXCA 1OZ2A 4XAXB 4C5HA 2JOYA 1G3SA 1HK9A 4OB2B 2DXUA 2PVOB 4F7UA 4XU1A 2LTOA 3OYDA 3HFOA 2ZPIB 3KUFA 5A0GA 3PIPA 1YBYA 2RB6A 4BBRM 2PU9B 4M78C 3PT9A 1SSFA 1I4K1 1WPYA 1X01A 5CQXA 4E7IA 2LX9A 1GXIE 3OQ5A 1VQ6T 3NTIA 3MEUA 4L6V5 4TVRA 1KQSS 4C92G 5KH6A 3CCVT 1VQ6A 3SWNC 3BG5A 4MIMA 1P92A 4II1A 5KCHA 1KC8C 5C0MA 3C94A 2RJFA 5IN1A 3SFMA 5GAMg 3N5BB 4OMFB 1LJOA 3CCVA 1TH7A 3MEVA 3ZBDA 4C8QA 3FDRA 4QVZA 3QUIA 2IVWA 4BI4A 2ZZDB 4E7LA 3JAME 1Q81U 3JB9H 4M77E 2QXFA 3QYHB 3A8HB 3CMET 4E47A 1FKMA 2LCCA 3MP8A 2V8IA 3CCET 5HY6A 4Z6YA 1VQ4T 4HLQA 5I2MA 2FL7A 2JVVA 2RH2A 3J80E 3MP1A 3OYNA 3CCEA 1Q86C 3CD6A 3GNFB 3FJPA 4LDWA 1VQ4A 1W2BA 2C06A 1YJ9T 3CC4A 5LL6S 3GPLA 3OYIA 4HNVA 2CS7A 1W4SA 2YRVA 3LH0A 2E65A 1OZ3A 2KMTA 1YJ9A 4N0AA 2K57A 5LJ5f 2D0QB 1M4ZA 2JN0A 3KXTA 4M75D 2RI2A 4M75F 4M7DC 1VIFA 3JCMg 2V8KA 5CKFA 5DLOA 4PLIA 2M16A 4FT4A 1Y07A 4NS5A 1G3TA 1LOJA 2VUBA 4X9CA 5FRNA 2V8JA 2E12A 3EFSA 2BS4A 3E9GA 3LLRA 4XTVA 3OW2A 4ZGJB 1N9RA 4MFDA 2A7YA 3CC7T 4E7HA 3NTKA 1PSFA 3M5AA 2QQBA 3P8HA 5FU7B 3CC7A 3OSSC 4M7DG 1LNXA 4J6WA 1K9MC 2LVMA 5CCAA 2GQVA 3V8JA 2E70A 2HQEA 3VYHB 1EIFA 1OI1A 4C92A 3JCMX 3G7ZA 4OGCA 2K3YA 3UDCA 1M1GA 2OTJT 3TEEA 2HQXA 4BY6C 4O6JA 2B8AA 3PGGA 3RESA 1VQKT 2RI3A 4QVCA 4JUVA 4IUQA 2BS3A 1JBMA 4P5NA 3V7RA 2OTJA 1HXDA 3S6WA 2QEXT 4Y91A 2X4JA 2EYQA 3WXMB 4XU0A 5GAN6 1G5VA 4BI8B 3T9NA 5DM7R 1K8AU 4A4EA 4J83A 2PUKB 3O8VA 3GOXA 2QEXA 3G4ST 2KSSA 3R6OA 4C8QC 5CVIA 4CI0C 4J7FA 4PJOD 3CMAT 3H4CA 3M4GA 4PJOF 4BBSM 3PMTA 3FB9A 4QVDA 2XK0A 3JB9G 2RHXA 3LWHA 4QW2A 2DXBB 5LJ5h 2Y4XA 3MEAA 3QKJA 4IUPA 4QQGA 1YIJT 5GAN8 2PVGB 4M78E 1M9SA 2QQRA 4JS4A 1XTDA 2PVDB 3HP9A 4NC6A 1WJRA 2MF2A 4FU6A 3OMCA 1YIJA 4C8QG 2GFUA 4JDSA 3ASKA 2ZGWA 4C0DC 4JS5A 2KMGA 2GF7A 1M1FA 1I8FA 4DOWA 1Q82U 4BACA 2HD0A 3LX7A 1UGQB 1OYXA 2MWOA 4FL6A 3VUBA 1Q7YU 4Y28E 2CZ7B 1QLBA 2MMPA 2RK1A 3INZA 3MO8A 4O5VA 4N0AC 4XTZA 4JX5A 3URGA 5LJ3g 2DD4B 2EIFA 2ZZDA 5I2SA 1M5Q1 2ZPHB 5HKCA 3PNWC 4M7AB 5GMKm 2ZPEB 2YLBA 3L42A 1VQPT 5CIUA 3RMQA 1BKBA 1YHQT 5GAOm 3RMSA 4M77D 3FLGA 4PL6A 1X75C 1VUBA 4M77F 2OAUA 2XHCA 2RJDA 3QXEB 3CPFA 2JNGA 4LD6A 3OYJA 2RK2A 3S3OA 1VQ9T 1YHQA 1VQOA 2PQWA 2GCXA 3JB9J 5CK9A 4JRQA 3L2QA 3JSCA 2XU8A 4XTXA 4C0GA 3RUXA 1VQ9A 4M75B 1YITT 4AKHA 3OYYA 4ATOA 1KQSA 1RI0A 4IUVA 5KE3A 4XU3A 4C92C 5LJ5j 3CC2A 4IURA 1R8OB 3SB2A 3OS0A 1YITA 1JJ2S 4EMKB 2X35A 4MDWA 4M7DE 3CBOA 2DD5B 2F5KA 4A4FA 3KHIA 2RJEA 3PFSA 1O9SA 1YCYA 2FHDA 2X4YA 3X28B 1M90U 1M8VA 1WJSA 1K73U 1VQMT 1VQLA 2VGNA 4ELZC 3M55A 1U1TA 3JCMW 5FLXE 1VQNT 4C5IA 2JTFA 4ZTJA 3F70A 1VQMA 2QQ8A 2EKOA 2HBPA 3LGFA 1VQNA 1Y96B 1NE8A 1NJIU 2DTOA 2DZ9A 2JUFA 3LW5E 3OBYA 4F7UE 3VV0A 2DTHA 3CCQT 4JRPA 1N8RC 3NTHA 4N4IA 3X26B 5DY9A 1ZQ1A 5J26A 3OS2A 3GP8A 3HO8A 3HB9A 3V8KA 3DL1A 5CKEA 3CCQA 4E7KA 4XK8E 3RKYA 3RKWA 1E7PA 3Q1JA 3CD6T 4M75G 5GAMh 4J5YA 4M7AD 4JRKA 3CC4T 2R58A 4M7AF 2X4XA 2DK3A 5GAMe 1VIEA 5GANg 5IAYA 5J39A 1UGPB 4PJOB 2XG8D 4D6WA 1KD1U 1N9SA 2EWNA 2CGHA 3OYBA 2L3RA 4QQDA 5LJ5d 1MHNA 2A3LA 2K3XA 4NL3A 3DLLA 4Q5WA 2WSEE 4R55A 3GIBA 4C8QE 5GAOn 3JCMb 4MZPA 3H6ZA 5EJCA 3X20B 4J6YA 1Y71A 2JTMA 3M56A 2D9TA 4MMKA 4A4KA 2DXCB 5HK3A 5GAMj 2EAYA 3JCMV 4EPCA 4XQ3A 2DXBA 2RO0A 2R57A 2BS2A 4UC4A 3BDUA 3DKMA 3EAEA 2QFZA 4X9DA 3QBYA 3ZFJA 5EG2A 4HT8A 5A0DA 3M59A 5A0LA 4ZTFA 4ME7A 2QQAA 1BIAA 4EDUA 1KQ2A 4LDVA 4MZMA 3QZ9B 4M78D 2RA2A 4M78F 4CRIA 3GNGA 2FB7A 4MDXA 2KR6A 4R56A 4AKGA 4FM4B 2YLCA 3ER0A 3JCMh 5CKDA 3L2ZA 4BE0A 1N27A 3JCMe 3E1SA 1Q7YC 2DD4A 1B34B 3HL8A 3META 4HA8A 4L59A 4M77B 3OMGA 4JRIA 2CKKA 4C5EA 3OYKA 3QSUA 2QA4T 2DVEA 3BDLA 4HT9A 2LC4A 2WACA 4HCBA 2M0OA 3CEYA 3FIFA 3C95A 1M1KC 2QA4A 2EQMA 3H8ZA 1BI3A 4DQ2A 3OS5A 4AI6A 2M1HA 2DIGA 1KC8U 2LDMA 1BI1A 4KUIA 5FU7C 3V7SA 2DTIA 3OYGA 2DXTA 4N4GA 3CPWS 2OTLA 1VQ7T 5KCOA 4M75A 1KQ1A 2XDBA 3TCJA 1IZ6A 3MP6A 4XTYA 3V7CA 2ZCFB 3TW6A 3WVDB 2LCLA 3UWNA 4IUUA 4C92E 2VXFA 3CCJT 4RCCA 2E6NA 3JCMJ 3OSVA 3M9QA 4ZGDB 3NFCA 2F5TX 3I56T 4EMKA 2WSFE 2HAXA 3WVEB 1UGRB 5HK0A 1JB0E 2E41A 2VXEA 3CCJA 1QVFS 2DD5A 3M58A 4NL2A 3I56A 2EJGA 4FIBA 5GAN7 5GAOq 3CCUT 1Q86U 5CQYA 3OYHA 3PTAA 3OYMA 2D6FA 5L8RE 4M7DD 3HZJA 1PSEA 1KHIA 3GLXA 3CCUA 1M90C 2G3RA 4M77G 3PIOA 1ZBXA 3L1AA 1FX7A 1VQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYG A;  2DD5 B;  1V29 B;  3X28 B;  2ZPF B;  3HHT B;  2D0Q B;  3VYG B;  2CYZ B;  3A8G B;  3X24 B;  3LW5 E;  2ZPG B;  2PUO B;  3X26 B;  2CZ6 B;  3QYG B;  3A8L B;  4ZGJ B;  1IRE B;  1PSF A;  2DXC A;  4XK8 E;  2QDY B;  1UGP B;  4RKU E;  3VYH B;  1AHJ B;  2AHJ B;  4OB1 B;  2WSE E;  2CZ0 B;  3A8O B;  3X20 B;  2DXC B;  2DXB A;  2ZPB B;  2CZ1 B;  2PUK B;  3QZ9 B;  4FM4 B;  3X25 B;  2DXB B;  2DPP B;  4ZGE B;  4OB0 B;  2DD4 A;  1UGS B;  2PVG B;  2PVD B;  2WSC E;  1DJ7 B;  3A8M B;  4KT0 E;  2PVO B;  4OB2 B;  1UGQ B;  4Y28 E;  2CZ7 B;  3QZ5 B;  2ZPI B;  2O01 E;  2DD4 B;  1QP2 A;  2ZZD A;  2PU9 B;  2ZPH B;  2ZPE B;  2ZCF B;  3WVD B;  1GXI E;  4L6V 5;  4OB3 B;  4ZGD B;  2WSF E;  3QXE B;  3WVE B;  1UGR B;  1JB0 E;  2DD5 A;  2ZZD B;  5L8R E;  1PSE A;  1QP3 A;  3QYH B;  3A8H B; 
#chains in the Genus database with same CATH topology
 1QVG P;  2V1R A;  1H25 B;  5D7U A;  4PFZ A;  3HRS A;  1Y96 A;  1URC B;  3BG9 A;  5GAM d;  1Y57 A;  2P0P A;  1Q81 C;  1ZSZ C;  2KAF A;  1K0X A;  4F7U F;  4A63 B;  3DJB A;  2RQR A;  5LJ3 h;  2KK4 A;  2LW4 A;  1K9M U;  2KDS A;  1OIU B;  2XMF A;  2DL7 A;  1D1A A;  2BZ8 A;  1N5Z A;  2O4X B;  2LQK A;  5FRM A;  1U5S A;  2UZE B;  2HKN A;  3EGX B;  4RTV A;  1BYM A;  1JO8 A;  4FSX A;  3EGU A;  2EQI A;  3A98 A;  1AHJ B;  5M9O A;  3G6E A;  2BIV A;  2VC8 A;  4BCK B;  1H24 B;  2VWF A;  2L89 A;  3VKI A;  1YIT Q;  4OVA A;  2AZS A;  4DBQ A;  2WHB B;  4EMK C;  4BCN D;  1RL2 A;  4OML A;  3EFO A;  1LVK A;  3UA6 A;  3B57 A;  4BUG A;  1VQM Q;  4QT7 A;  2H3J A;  2LNH B;  3CXC S;  1VQN Q;  3CCM T;  2R5M A;  2K9G A;  2K5F A;  2YHT A;  2PK2 A;  4A53 A;  5CR2 A;  3UPU A;  1NPP A;  5GAN 5;  2W9Z A;  4CC4 B;  3OYE A;  1JRI A;  4HNT A;  4C92 D;  2J7I A;  2V26 A;  2K2V A;  2O01 E;  3CC4 Q;  2FZC B;  2EGE A;  1BIB A;  2PZ1 A;  1WGS A;  5D6W A;  2E6Z A;  2K2M A;  3O5Z A;  1VQ5 A;  2FPF A;  1YCS B;  3VS1 A;  1K8A R;  2H3E B;  4LUE A;  4JLI A;  2XDD A;  3HPW A;  4F7S B;  4NST B;  5LJ3 f;  4B9X A;  2RQV A;  1EFN A;  2DRM A;  3E9F A;  1QVF A;  2Y4Y A;  2EW3 A;  4LDY A;  2COY A;  3C4S A;  5GAN 3;  2EYW A;  4M77 C;  3UAT A;  4M4Z A;  1UUE A;  2O4X A;  4M7A E;  3OW2 S;  2EYX A;  4BE1 A;  2M51 A;  3EGX A;  5I11 A;  1FXX A;  1GY3 B;  3A8G B;  5LQF B;  5LJ5 g;  1TU0 B;  1AIS B;  2RF0 A;  4RUG A;  2P4R A;  2WIP B;  4OF1 A;  3MCA B;  1IRE B;  4M75 E;  3CQT A;  2LQ8 A;  3GF5 A;  1NEB A;  3CCJ Q;  2BE9 B;  4BCF B;  4BDZ A;  3J7A F;  1YWP A;  3I9Q A;  1RLQ C;  2DAQ A;  2KY9 A;  5LJ5 e;  1YWO A;  2SEM A;  3MEW A;  3I55 A;  3CCU Q;  3HTR A;  4MZT A;  3QDF A;  2DBM A;  4L5G A;  1X6B A;  2HNI A;  3EH2 A;  4ELY C;  4BI3 A;  3JCM Q;  1UFF A;  2E1H A;  3JB9 D;  1SPK A;  2BPM B;  2K4Y A;  1V1C A;  1K73 R;  1KD1 C;  4Z02 A;  3L2R A;  4JZ4 A;  1GBR A;  1M1K U;  1TG0 A;  3IQL A;  4CFM B;  2DL8 A;  5LJ3 j;  1NJI R;  4M6V A;  2VYT A;  1R77 A;  2CT3 A;  3G6E T;  2DYB A;  1UG1 A;  2QG9 B;  4II5 B;  2LQW A;  3SDZ A;  4LE9 A;  4PJO E;  2WSC E;  2I2L A;  3CC2 Q;  4BCQ B;  5GAO l;  1BI2 A;  3CXC A;  1FIN B;  4C5H A;  4JPB W;  4OB2 B;  2O9V A;  2LTO A;  2ZPI B;  1M30 A;  3KUF A;  4GLM A;  2A08 A;  2PU9 B;  4M78 C;  5CQX A;  1PD0 A;  3OQ5 A;  3NTI A;  3RNJ A;  4L6V 5;  3CCV T;  1VQ6 A;  2DEU A;  3C94 A;  4KH0 B;  5IN1 A;  3TNW B;  1JSU B;  3N5B B;  4OMF B;  2X1N B;  4YOZ A;  4YOO A;  3ZBD A;  4QVZ A;  3VS6 A;  4BI4 A;  4JJC A;  2ZZD B;  1Q81 U;  5GJV B;  3JB9 H;  4EOJ B;  2X9H A;  3QYH B;  3MI9 B;  2WMA B;  3CCE T;  5HY6 A;  2DLP A;  1BCM A;  2WEV B;  2AT1 B;  2FL7 A;  2MYS A;  1Q86 C;  3CD6 A;  3CC4 A;  3VS7 A;  2KMT A;  1YJ9 A;  4N0A A;  2D0Q B;  1QCN A;  1G2B A;  3JCM g;  5CKF A;  4PLI A;  2M16 A;  1NEG A;  3G71 Q;  5FRN A;  2E12 A;  2LJ3 A;  3OW2 A;  1N9R A;  3NTK A;  1AZG B;  1GCQ A;  1SRL A;  2DL5 A;  3P8H A;  3OSS C;  1LNX A;  3NMZ C;  5CCA A;  3V8J A;  1NLO C;  4OGC A;  3TEE A;  2HQX A;  4JUV A;  3V7R A;  1IHV A;  1HXD A;  4YOS A;  2DF6 A;  2RQT A;  5FGK B;  2AZV A;  3T9N A;  2QEX A;  3O8V A;  3GOX A;  1S72 Q;  4OGR B;  3R6O A;  5CVI A;  1D3U B;  3MPU B;  4JJB A;  1K9M R;  3LWH A;  4QW2 A;  1I5O B;  2Y4X A;  2L0A A;  6AT1 B;  4JS4 A;  1K0S A;  4NC6 A;  2MF2 A;  1UTI A;  3EG9 B;  2GFU A;  3UA7 A;  4JDS A;  2KGT A;  3ASK A;  4C0D C;  4JS5 A;  1ZA1 B;  3LX7 A;  2KT8 A;  1OYX A;  2HMA A;  1Q7Y U;  2B86 A;  2QDL A;  3INZ A;  3CCR Q;  4E2F B;  2DD4 B;  2ZZD A;  2DL3 A;  2FRW A;  1M5Q 1;  4M7A B;  3M0U A;  2ZPE B;  5HNB B;  5KYW B;  3RMQ A;  3RMS A;  4M77 D;  2XHC A;  3QXE B;  2EKH A;  1H8K A;  3OYJ A;  3S3O A;  1YHQ A;  4XTX A;  3RUX A;  1VQ9 A;  3VS3 A;  4M75 B;  1YIT T;  1KFZ A;  3OYY A;  1VOM A;  1ACM B;  4IUV A;  5KE3 A;  1WHG A;  1YJN Q;  3CC2 A;  1R8O B;  4MDW A;  3CBO A;  3CCS Q;  1GUX B;  2RJE A;  3H0I A;  1M8V A;  2CSQ A;  1M90 U;  2AKK A;  3TNH B;  1VQM T;  5AT1 B;  1VQN T;  1OPK A;  4FW2 A;  2JTF A;  3F70 A;  1QWE A;  4F7U E;  1ZQ1 A;  5J26 A;  3GP8 A;  3HB9 A;  4CFV B;  4FYV B;  3V8K A;  1V76 A;  4CFN B;  2ATC B;  3CD6 T;  4M75 G;  5GAM h;  3CC4 T;  4M7A F;  5HBH B;  2X4X A;  1JST B;  4BCP B;  1C9B A;  1WXT A;  4PJO B;  4AT1 B;  1KD1 U;  2CGH A;  3OYB A;  3BHU B;  1LCK A;  3VS2 A;  3DLL A;  1NG2 A;  3VRZ A;  2WSE E;  3LH5 A;  4C8Q E;  5GAO n;  3JCM b;  4MZP A;  3H6Z A;  3BLH B;  1X2K A;  3TQ7 P;  4MMK A;  2HQH A;  2EAY A;  4EPC A;  4XQ3 A;  3ULR B;  3RGF B;  3QBY A;  4RTZ A;  4DBR A;  4HT8 A;  1VQ4 Q;  3M59 A;  4ME7 A;  1KQ2 A;  4LDV A;  3EG9 A;  4MZM A;  5EC7 A;  5ACB A;  1QVF P;  4M78 D;  4CFU B;  2MK5 A;  2KRO A;  1N27 A;  2DD4 A;  2J05 A;  4C5E A;  3OYK A;  1MV0 B;  3BDL A;  2LC4 A;  5KYW A;  3FIF A;  5KYY B;  4DQ2 A;  2NWM A;  2M1H A;  3CC7 Q;  2DIG A;  1BI1 A;  1WXU A;  2ED1 A;  1I07 A;  4M75 A;  1HJD A;  3TCJ A;  1IZ6 A;  4XTY A;  2CSI A;  2ZCF B;  3TW6 A;  3UWN A;  1GXI E;  3CCJ T;  2WIH B;  1ZBJ A;  2PK9 B;  3OSV A;  3NFC A;  2F5T X;  1OU8 A;  2VXE A;  2E41 A;  3I56 A;  5GAN 7;  5GAO q;  1GUX A;  2C6T B;  1YNZ A;  3CCU T;  1Q86 U;  1M1K R;  5L8R E;  3DDQ B;  3HZJ A;  1PSE A;  1JOW A;  2CH4 A;  3PIO A;  4ESR A;  1ZBX A;  3L1A A;  1FX7 A;  3G4S Q;  1WFW A;  3CMA Q;  4RTY A;  4IUT A;  1AVZ C;  2X51 A;  1UEB A;  5GMK e;  1TOV A;  2I53 A;  3QYB A;  3CCR A;  1YIJ Q;  3PO3 S;  5GAM f;  2WJ9 A;  4DEY A;  2F2V A;  3VYG B;  1H28 B;  2LJ0 A;  3L2U A;  3QII A;  1M2O A;  2CYZ B;  4PJO A;  1RAC B;  5FU6 B;  3CC2 T;  3OY9 A;  2YUP A;  3EHQ A;  3CXC P;  2G6F X;  3BG3 A;  4BDY A;  1OEB A;  4J8O A;  3KBG A;  2FEI A;  3RBB B;  4HNU A;  1VQP Q;  4LOC A;  2EQK A;  4DA4 A;  3J81 E;  1D3B B;  1Q81 R;  2FYK A;  2JS0 A;  1UHF A;  1C6V X;  1BI0 A;  2AHJ B;  4ZN1 A;  2R5A A;  1CSK A;  2DRK A;  3SWN B;  1OL1 B;  2RJC A;  1WNL A;  1OL2 B;  3I35 A;  1OOT A;  4KBM B;  3M54 A;  2LCS A;  3HRU A;  5KYY A;  1UJ0 A;  2HZY A;  5DQV A;  2QDJ A;  3HSB A;  2F2C A;  4GY5 A;  4ZGE B;  2RHI A;  4C0Z A;  3CCM A;  5A2Q E;  3CCQ Q;  2D0N A;  1AWJ A;  1U06 A;  3SHW A;  3M53 A;  1C1A A;  2YT6 A;  4BY1 X;  5GAN 2;  4C5G A;  4JX4 A;  2EQU A;  4C92 F;  5GAN e;  3G71 T;  3OW2 P;  4Z8A A;  5CO7 A;  5GJW B;  1MMG A;  1FMV A;  4AG2 C;  4OB3 B;  5GAN j;  4RG8 A;  1TXQ A;  4F7U B;  4XU2 A;  2KYM A;  4ZN3 A;  1WQ7 A;  4BY6 B;  4GLK A;  3LWI A;  1W2B S;  3QJY A;  4QQ6 A;  1FWZ A;  3SD4 A;  5CAI A;  3OYC A;  1Y0M A;  3VYG A;  4KUD K;  4BXX X;  1G3N C;  1NPR A;  1WQW A;  3TSW A;  2P0Q A;  1S72 T;  2E5K A;  4F6S B;  4C8Q B;  1ZA2 B;  2ZPF B;  3LYI A;  1ARK A;  3C12 A;  1Q7Y R;  2YSQ A;  2QA4 Q;  4LDX A;  2L3S A;  4IIO A;  2JTE A;  4YTL A;  2WFY B;  1D3B A;  2NLU A;  2XIC A;  1FMK A;  4JJN K;  1K76 A;  2UZB B;  1UB4 A;  1WI7 A;  2FG0 A;  1VQK A;  2KRN A;  4D8D A;  3VUZ A;  2PUO B;  1RI9 A;  2EYZ A;  4F7U G;  3A8L B;  2EJF A;  2QGG A;  3SWN A;  2DME A;  3TU4 K;  1PNJ A;  3PE0 A;  4XTW A;  3QJ6 A;  3CCR T;  3JCM P;  3VJP A;  3G4S A;  4J6X A;  2QDY B;  3DB3 A;  3FC3 A;  3CMA A;  2K7A A;  4EOR B;  3OYF A;  2GTJ A;  5FWB A;  1H3H A;  2L3Q A;  4OB1 B;  2C5N B;  4PNO A;  4EC8 B;  5CKB A;  1OI9 B;  2ENM A;  2MAM A;  2OJ2 A;  5CEI B;  4HCZ A;  4HL4 A;  4C0F A;  3M0T A;  3DOG B;  1M90 R;  3JB9 F;  1AZE A;  2CP7 A;  5GAN d;  1ZHI A;  5AYF A;  1YJN T;  3I5S A;  4VUB A;  3M0Q A;  1ZLM A;  1IGU A;  2L8D A;  1AWX A;  2EFI A;  2K5L A;  4C8Q F;  3MHX A;  4QSH A;  2EJ9 A;  1SG5 A;  2GFA A;  3CCS T;  2PNI A;  1VQP A;  4X1V A;  4LDU A;  3M0S A;  4RTT A;  4EMH A;  2KR3 A;  2CCI B;  1F5Q B;  4OMM A;  4PJJ A;  2HDA A;  1PD1 A;  2DO3 A;  1B07 A;  3DLM A;  3OB9 A;  4XTU A;  3A8M B;  1OZ2 A;  1G3S A;  2JOY A;  1KD1 R;  4F7U A;  5A0G A;  2P84 A;  1YBY A;  2VVK A;  4E7I A;  1WPY A;  4PJN A;  1YJW Q;  1D09 B;  1OX8 A;  2HEQ A;  1YN8 A;  2CDT A;  4J9C A;  1KQS S;  4LXC A;  3NDQ A;  4II1 A;  5KCH A;  5C0M A;  1GRI A;  3SFM A;  1MNE A;  4HVW A;  3CCV A;  3MEV A;  4C8Q A;  3FDR A;  3MKD A;  3JAM E;  1CKB A;  1UNL D;  2UZL B;  2JJ9 A;  2EPD A;  4BCM B;  1BU2 A;  2V8I A;  1VQ4 T;  2WXV B;  1RAE B;  2RH2 A;  3CCE A;  1W2B A;  1JKW A;  1FVV B;  2KE9 A;  2HL3 A;  3OYI A;  3MY1 B;  1GFC A;  2HKQ B;  1OX9 A;  2E65 A;  1OZ3 A;  4EIK A;  5LJ5 f;  1S1N A;  2V8K A;  5DLO A;  4FT4 A;  4X9C A;  1G3T A;  1LOJ A;  2UUE B;  4ZGJ B;  1T0H A;  3CC7 T;  2ZAE A;  4E7H A;  2QQB A;  2F1L A;  1Q86 R;  3GBQ A;  2JS2 A;  2LVM A;  2GQV A;  4RTU A;  3G7Z A;  3O0G D;  1SHG A;  4AMC A;  1VQK T;  4O6J A;  3DDP B;  1JBM A;  4P5N A;  4FCY A;  2D1X A;  3K7A M;  1OU9 A;  2X4J A;  3CCL Q;  3WXM B;  1D1B A;  2LQN A;  1G5V A;  2PUK B;  3G4S T;  2KSS A;  3CMA T;  2YXY A;  1OUL A;  2DXB B;  5EFQ B;  3MEA A;  1QWF A;  4QQG A;  1YIJ T;  5GAN 8;  5HQ0 B;  2QQR A;  2PVD B;  4FU6 A;  2E3I A;  1VQ8 Q;  5IHI A;  1FMW A;  4G6L B;  2M0Y A;  2ZGW A;  4EOM B;  4FL6 A;  5LJ5 j;  4EC9 B;  1QLB A;  4XTZ A;  2MCN A;  4N0A C;  3URG A;  1WLP B;  5LJ3 g;  2CUB A;  2EIF A;  5HKC A;  3PNW C;  5GMK m;  3L42 A;  1VQP T;  1BKB A;  4PL6 A;  4I3Z B;  4KH1 B;  1KSW A;  4M77 F;  3REA B;  2DET A;  1WZO A;  2RK2 A;  1GCQ C;  1RAH B;  2EGC A;  4JRQ A;  1LPL A;  1W70 A;  2XU8 A;  3H9N A;  3EG2 A;  2YDL A;  1E6G A;  5HBE B;  1KQS A;  1SKU B;  3TN8 B;  2O2O A;  2C0O A;  5IH2 A;  1YIT A;  1JJ2 S;  2PTK A;  1K1Z A;  4M7D E;  2BKZ B;  3KHI A;  1O9S A;  2X4Y A;  1WJS A;  5IDN B;  3JCM W;  5BNJ B;  4ZTJ A;  1H1Q B;  1ZUU A;  1VQM A;  2EKO A;  3LGF A;  1VQN A;  1KIK A;  3CCQ T;  3VV0 A;  2DTH A;  1N8R C;  3OS2 A;  5DY9 A;  3X26 B;  2J6O A;  2RQU A;  3POM A;  2HSP A;  4XK8 E;  3RKY A;  1E7P A;  3Q1J A;  3RKW A;  1TUD A;  2FZK B;  2R58 A;  1YP5 A;  3VRY A;  1B7T A;  1OKW B;  3M03 A;  2EWN A;  8ATC B;  4QQD A;  5LJ5 d;  4NL3 A;  4BCI B;  4TTH A;  3GIB A;  5EJC A;  3X20 B;  3M56 A;  2J6K A;  1RAF B;  2D9T A;  5HK3 A;  2DXB A;  2RO0 A;  2CJM B;  3DTO A;  1KJW A;  3BDU A;  3ZFJ A;  5A0D A;  1HSQ A;  2QQA A;  4EDU A;  2F2X A;  1PKD B;  1JXM A;  4K11 A;  4M78 F;  3GNG A;  4R56 A;  4UN0 A;  4FM4 B;  2YLC A;  3L2Z A;  2COZ A;  3JCM e;  4HA8 A;  3HL8 A;  2CUD A;  3OMG A;  4HT9 A;  2QA4 T;  2DVE A;  1E6H A;  4HCB A;  3CEY A;  3C95 A;  2EQM A;  3H8Z A;  3OS5 A;  1HD3 A;  3CPW S;  2XDB A;  3MP6 A;  3V7C A;  5IHY A;  3WVD B;  2LCL A;  1X27 A;  4C92 E;  1VA7 A;  2NUP B;  3JCM J;  2OTJ Q;  2I0N A;  3CCJ A;  2J06 A;  2EJG A;  4FIB A;  5CQY A;  3OYH A;  3PTA A;  1GFD A;  3GLX A;  1KHI A;  5HCK A;  3CCU A;  2G3R A;  3H41 A;  5LMK B;  1VQ8 A;  1SF9 A;  3JCM c;  1MGQ A;  1VIN A;  4RMO A;  4OGE A;  2BTT A;  2W96 A;  2EQJ A;  5IF1 B;  1PWT A;  2RQW A;  1EZZ B;  1JJ2 A;  2XID A;  1TWB A;  4CFW B;  4A4G A;  2BZX A;  4EOP B;  1WA7 A;  3VU3 C;  5GAN 4;  2QI2 A;  2HCK A;  1TUC A;  2CCH B;  3QYG B;  2LT1 A;  2Z0W A;  3QO3 A;  2E64 A;  2ROT A;  4M7A C;  2P0K A;  1TSF A;  2QGS A;  1Z9Q A;  2CH4 W;  3V8L A;  1YJW T;  3RIR A;  3JCM d;  4RCB A;  1H1R B;  4LNP A;  4CRL B;  1ZUY A;  3U23 A;  4PJL A;  4M7A G;  4M75 C;  5CYI B;  2IVX A;  1C0M A;  2IPO B;  4AFQ C;  3TSZ A;  3GTM S;  1NZ9 A;  1BU1 A;  2GQI A;  2V1Q A;  4PJM A;  3M57 A;  4Z88 A;  3REB B;  2DPP B;  3VS5 A;  1W2B P;  3OYL A;  4DOV A;  4BE2 A;  1PHT A;  2CP5 A;  3A5Z B;  3EOC B;  5IHK A;  2LRQ A;  2RMO A;  2MWP A;  1K9A A;  4E7S A;  2NUP A;  4KT0 E;  2RI5 A;  5GAN h;  5J3B A;  4M7D B;  2QQ9 A;  2W99 A;  3QG1 A;  3QZ5 B;  1JXO A;  2QAS A;  2LT4 A;  5GMK i;  2E5Q A;  3OBW A;  1GBQ A;  1T3S A;  4PJO C;  3NHN A;  4FT2 A;  1NBE B;  2JZ2 A;  3G71 A;  1IXD A;  1NYG A;  3PVL A;  2MIO A;  2XDP A;  2NUT B;  2RD1 A;  5KYU B;  4PLL A;  4V2S A;  1Q82 C;  4J7I A;  3EG3 A;  2C5V B;  1QLY A;  3ZEH A;  4BCQ D;  5C6S A;  3CPW A;  4CC7 A;  3C0C A;  2RHZ A;  4M7A A;  2OI3 A;  2COW A;  1QW1 A;  4PJO G;  2MI6 A;  1OPL A;  1UEC A;  1VYT A;  2L3P A;  3RER A;  4A54 A;  4JLG A;  2GBQ A;  4B9W A;  3TVT A;  3CCL T;  3RR6 A;  2YUN A;  2G77 A;  4OMP A;  1V29 B;  2HL5 C;  2BUD A;  3UT1 A;  1U3O A;  1R0C B;  1N8R U;  2RHU A;  1N6A A;  1S72 A;  3P8D A;  3HBL A;  1UGV A;  5D6Y A;  3P8B B;  2OX7 A;  2VAS A;  1KHC A;  2DIQ A;  2VV5 A;  2E4H A;  3E19 A;  3X24 B;  2DYI A;  1VQ8 T;  2Y90 A;  1MND A;  2QGF B;  4IKF A;  3BFM A;  4ROE A;  4ANJ A;  1QMZ B;  3F5X B;  4M7D F;  2P4T A;  2QK0 A;  3AHU A;  3FRN A;  2W9F A;  1VQ7 Q;  2EUF A;  4BCN B;  2EBP A;  2YRD A;  2SRC A;  1A0N B;  4RKU E;  5ECA A;  1I5L A;  3L2W A;  2VB6 A;  3A8O B;  2FVU A;  2RM4 A;  3M4Y A;  1TS9 A;  4OMQ A;  1RUW A;  3JB9 I;  2I40 B;  4E7J A;  3G1J A;  5GMK j;  2E3H A;  2QF7 A;  2A37 A;  4EMG A;  2ZPB B;  2F2W A;  4LD9 K;  3S3N A;  1KQS P;  2AK5 A;  4C92 B;  2CZ1 B;  1PKT A;  2KQW A;  3QWY A;  5GAN f;  2DIL A;  5DLQ E;  1YJN A;  4EOI B;  4M7D A;  1VQO Q;  1WHL A;  3X25 B;  3BLR B;  5L2W B;  5GAO r;  1VOL A;  2BKD N;  2DKG A;  4ROD A;  5GMK l;  3CCS A;  3EFR A;  5FU6 C;  3CBM A;  3M0P A;  2NUT A;  2IW9 B;  1CKA A;  4J9D A;  5KYU A;  4XAX B;  1I0C A;  1HK9 A;  2OAW A;  1SRM A;  1BB9 A;  3HFO A;  2RB6 A;  4BBR M;  1VQL Q;  1H4L D;  3PT9 A;  1I4K 1;  2LX9 A;  2CP0 A;  4CC2 A;  4C92 G;  2GNC A;  4Y72 B;  3SWN C;  4MIM A;  1KC8 C;  1G8X A;  1W1F A;  2YRC A;  5GAM g;  1TH7 A;  3QUI A;  2IVW A;  4E7L A;  4M77 E;  4KRC B;  2QXF A;  2X3W D;  3A8H B;  4E47 A;  1FKM A;  1M3A A;  1WHJ A;  2D8H A;  3MP8 A;  1OGU B;  2KBT A;  1RAA B;  4Z6Y A;  2LJ1 A;  4RTX A;  4HLQ A;  4F7J B;  1OIY B;  4J9B A;  3J80 E;  4EOS B;  3FJP A;  3EHR A;  4LDW A;  1D1C A;  2M02 A;  1VQ4 A;  2C06 A;  5HVY B;  4F6U B;  4EOQ B;  2JM9 A;  4HNV A;  2YRV A;  2JN0 A;  4PFP A;  3KXT A;  3EJ1 B;  4M75 D;  1TTH B;  2DMO A;  1VIF A;  1KXU A;  2VUB A;  2V8J A;  4KRD B;  2BS4 A;  3LLR A;  4XTV A;  4MFD A;  2GTO A;  1UHC A;  1VQ5 Q;  2IN3 A;  1ZUK A;  1AEY A;  1M27 C;  1JU5 C;  5FU7 B;  3CC7 A;  2C5X B;  2O88 A;  4J6W A;  2DE0 X;  1MUZ A;  2E70 A;  2HQE A;  3VYH B;  1OI1 A;  4C92 A;  2CP2 A;  1X69 A;  2RNA A;  1M1G A;  2OTJ T;  1W6X A;  4BY6 C;  3PGG A;  4QVC A;  2BS3 A;  3S6W A;  1D0Y A;  2OTL Q;  2X3X D;  1AD6 A;  3EID B;  2EYQ A;  4XU0 A;  5GAN 6;  3G33 B;  2W0Z A;  3VS0 A;  4HVU A;  1VYU A;  4C8Q C;  4CI0 C;  4J7F A;  4PJO D;  3H4C A;  4EOL B;  3JB9 G;  2AKL A;  2XK0 A;  5LJ5 h;  2DNU A;  4IUP A;  4F70 B;  2PVG B;  1ZSZ B;  1M9S A;  4M78 E;  1RLP C;  1JJ2 P;  3HP9 A;  4J9G A;  1WJR A;  1YIJ A;  2J6F A;  4C8Q G;  4PFO A;  4BCH B;  1BBZ A;  1I8F A;  1Q82 U;  1UGQ B;  4Y28 E;  3SEM A;  2CZ7 B;  4FX3 B;  2MMP A;  2RK1 A;  3MO8 A;  2PJQ A;  4CFU D;  1RAI B;  1GCP A;  4OMO A;  1ZP2 A;  5I2S A;  3I55 Q;  3H0F A;  2LP5 A;  1MMN A;  2G9X B;  2OAU A;  5HBJ B;  3FJ5 A;  4LD6 A;  2JNG A;  2ESW A;  1VQO A;  1YI2 Q;  2KRM A;  2DM1 A;  3JB9 J;  3L2Q A;  2LX7 A;  3JSC A;  3EGD B;  2NYS A;  4DBH A;  2ED0 A;  1QKX A;  4XU3 A;  4IUR A;  2H8H A;  4EMK B;  1WX6 A;  2O31 A;  2DD5 B;  4DBF A;  5DQW A;  2FHD A;  4ORZ A;  4J9F A;  1RAD B;  1VQL A;  1TD6 A;  1WIE A;  2VGN A;  2YWW A;  4ELZ C;  5FLX E;  1WHK A;  1QMC A;  3BHV B;  4KGV B;  1WDX A;  2QQ8 A;  1T3L A;  1NE8 A;  2JT4 A;  4EOO B;  2DTO A;  2DZ9 A;  2JUF A;  1H26 B;  3EG1 A;  4N4I A;  4HVV A;  3CCQ A;  3THK A;  1UJY A;  1VQ6 Q;  4JRK A;  2DK3 A;  2DX1 A;  1VIE A;  5IAY A;  1UGP B;  2FPE A;  2XG8 D;  4D6W A;  1N9S A;  2A3L A;  3EH1 A;  4J6Y A;  2K3B A;  3CPW P;  4A4K A;  2DXC B;  1TFB A;  4CFX B;  3PVQ A;  4OMN A;  4WCI A;  4UC4 A;  3CME Q;  1N8R R;  3DKM A;  4X9D A;  5EG2 A;  3CD6 Q;  4JJD A;  1M2V B;  1E7O A;  1ZSZ A;  5A0L A;  3M0R A;  1BIA A;  2RA2 A;  1YJ9 Q;  4FYY B;  2FB7 A;  4MDX A;  4AKG A;  3ER0 A;  3JCM h;  1Q7Y C;  1B34 B;  4M77 B;  9ATC B;  4JRI A;  2KNB B;  4KGZ B;  4EON B;  1TUG B;  2QA4 A;  1H27 B;  1BI3 A;  1ABO A;  4AI6 A;  1KC8 U;  2GGR A;  2CP3 A;  2LMJ A;  1UNH D;  3V7S A;  3EGD A;  3OYG A;  2OTL A;  1VQ7 T;  1KQ1 A;  4CC3 A;  4IUU A;  2VXF A;  3NGP A;  4ZGD B;  4J9E A;  2A0F B;  4EMK A;  4F16 A;  1UGR B;  5HK0 A;  1JB0 E;  2C0T A;  5FW9 A;  2DD5 A;  3M58 A;  2QEX Q;  4D8K A;  2D6F A;  1M90 C;  4M77 G;  4PK4 A;  1JEG A;  4BD3 A;  4FYW B;  4DEX A;  1GH6 B;  1M3B A;  4HXJ A;  4HCC A;  3TW7 A;  2X4W A;  1F1B B;  1ABQ A;  4X34 A;  3PMI A;  1VQO T;  4ELJ A;  3OS1 A;  2LNV A;  3HHT B;  4F6W B;  3HKS A;  2KI7 A;  2HSE B;  4JX6 A;  3E2U A;  4PKC C;  4FYX B;  5LJ3 e;  1YI2 A;  1PRM C;  2C0I A;  1U1S A;  2IG0 A;  2RHY A;  2CZ6 B;  1O9K B;  1SHF A;  4RG2 A;  5GAO p;  2DXC A;  1PM3 A;  4C8Q D;  3QHS A;  1YHQ Q;  2L2P A;  2VGM A;  1VQL T;  4M78 B;  1AWO A;  1M2V A;  2KYB A;  1QVG S;  3VKH A;  1VQ9 Q;  2JMA A;  1YJW A;  1D0Z A;  3JCM f;  2CZ0 B;  1B34 A;  1U8R A;  4M77 A;  1X6O A;  2CP6 A;  4GBQ A;  5ICP B;  2FRY A;  1XQH A;  3UF4 A;  1QQJ A;  1X6G A;  2M9U A;  2XKO C;  4OB0 B;  1UGS B;  2QTX A;  1K8A C;  4M78 G;  1DJ7 B;  1XNI A;  4AKI A;  3VKG A;  4OP0 A;  2RN8 A;  3KFV A;  1X43 A;  2CT4 A;  4NOY A;  3CME A;  4MML A;  3JV3 A;  3QWX X;  2DJZ A;  1QP2 A;  1IRX A;  1VQ5 T;  3HRT A;  2F69 A;  1B3Q A;  1H1P B;  1PG5 B;  3H0H A;  1J3T A;  1I81 A;  4WF2 A;  2HBW A;  2KXC A;  4HKE A;  3S3M A;  5IT9 E;  3ZL7 C;  4KUL A;  5KYN A;  4Y92 A;  3BW1 A;  1Z9Z A;  3EG0 A;  5LJ3 d;  1EX4 A;  1O75 A;  5FRO A;  1QP3 A;  4MFE A;  3CBP A;  1K4U S;  2E10 A;  1VYV A;  2DVJ A;  1H64 1;  4BCJ B;  2OTL T;  4ROC A;  3LGL A;  1XJW B;  2BZY A;  2D8J A;  2QYZ A;  4FW1 A;  3QDR B;  3CCL A;  1W98 B;  3BY7 A;  2XD0 A;  1O9K A;  1Q82 R;  3VS4 A;  4F14 A;  1T0J A;  2JMC A;  1G3Y A;  5KE2 A;  5I22 A;  3RKX A;  1NYF A;  2XI9 A;  4KGX B;  4M78 A;  5KYX B;  5D6X A;  1H3Z A;  3A1P A;  4EOK B;  2QQS A;  3QYE A;  4BB7 A;  2KVQ G;  1WJQ A;  3ME9 A;  2ZPG B;  4BCM D;  3TRE A;  3DB4 A;  3QPH A;  4C0D B;  3OYA A;  1K73 C;  2ABL A;  3QWL A;  4N4H A;  2DZC A;  1WHH A;  2DEQ A;  2MOX A;  5GMK h;  1PKS A;  4YC3 B;  3I55 T;  3I56 Q;  3NPF A;  1NJI C;  1XOV A;  1Y7X A;  2L5Q A;  4BCG B;  1PRL C;  1YI2 T;  2JXB A;  3BHT B;  1G3W A;  1IB8 A;  3MJX A;  5I21 A;  1QVG A;  1BCO A;  4A4H A;  1R0B G;  2UZD B;  2W2H A;  3FEO A;  5L23 A;  3L2V A;  3HFN A;  4OR5 B;  1OV3 A;  3OA6 A;  1D0X A;  1NLP C;  3JRZ A;  1FYN A;  2K5I A;  1SEM A;  1AD5 A;  2CRE A;  5CKH A;  1QVP A;  1QCO A;  2AIR B;  8AT1 B;  4WTO B;  4LUD A;  2B9R A;  2EVR A;  2IIM A;  2JM8 A;  2PVO B;  2DXU A;  1AWW A;  4XU1 A;  3OYD A;  4CXA B;  1X2Q A;  2O9S A;  3PIP A;  4AFU C;  2R7G A;  1SSF A;  2BE7 D;  1X01 A;  2DBK A;  1VQ6 T;  2A28 A;  3MEU A;  4TVR A;  5KH6 A;  4F17 A;  3BG5 A;  1P92 A;  2RJF A;  1VYW B;  3QHR B;  1LJO A;  2JW4 A;  4B6M A;  1ZX6 A;  3AT1 B;  3D7S B;  3CME T;  5IDP B;  2LCC A;  5KYX A;  4ZNX A;  5I2M A;  2JVV A;  2QAZ A;  3MP1 A;  3OYN A;  3CCM Q;  3GNF B;  5FWC A;  1YJ9 T;  5LL6 S;  3GPL A;  1QKW A;  3RDV A;  1KC8 R;  1YFN A;  2CS7 A;  1RAB B;  1W4S A;  3LH0 A;  2W10 A;  2K57 A;  1M4Z A;  2RI2 A;  4JZ3 A;  4M75 F;  4M7D C;  4LN2 A;  2A36 A;  1Y07 A;  4NS5 A;  2IW8 B;  3EFS A;  3E9G A;  2LZ6 B;  3QHW B;  2A7Y A;  2DFU A;  1PSF A;  3M5A A;  2PHG A;  4M7D G;  1K9M C;  2WPA B;  1NM7 A;  1EIF A;  3JCM X;  2VKN A;  2K3Y A;  3UDC A;  1M8M A;  2B8A A;  3RES A;  2RI3 A;  2FO0 A;  4IUQ A;  4AFS C;  2OTJ A;  2NUZ A;  2QEX T;  4Y91 A;  1E9H B;  4F7L B;  1PCX A;  2DA9 A;  4BI8 B;  5DM7 R;  1K8A U;  4A4E A;  4J83 A;  1H1S B;  2C5O B;  1G83 A;  3M4G A;  4PJO F;  4BBS M;  3PMT A;  3FB9 A;  4QVD A;  4AG1 C;  1ZSG A;  2RHX A;  1VQK Q;  3QKJ A;  4E6R A;  4RTW A;  2V22 B;  4IMY B;  4IIM A;  1XTD A;  3OMC A;  4KRT A;  3MIA B;  2KMG A;  1M1F A;  2GF7 A;  4DOW A;  4BAC A;  2HD0 A;  2EYY A;  2KXD A;  1OKV B;  2MWO A;  3VUB A;  4O5V A;  4JX5 A;  2QTV A;  2DL4 A;  2ZPH B;  4QKU A;  2YLB A;  2K6D A;  5CIU A;  1YHQ T;  5GAO m;  2WMB B;  3FLG A;  4Z89 A;  3MY5 B;  4ELL A;  1VUB A;  1X75 C;  2RJD A;  3CPF A;  2HAX A;  3BE3 A;  1VQ9 T;  2PQW A;  2GCX A;  5CK9 A;  1MMA A;  4C0G A;  1IHW A;  4AKH A;  4ATO A;  1RI0 A;  4C92 C;  3SB2 A;  3OS0 A;  1IO6 A;  2X35 A;  4E7Z A;  5IXF A;  4R0K A;  3BLQ B;  1KK7 A;  1SSH A;  2DJQ A;  2F5K A;  4A4F A;  2YUO A;  3G6E Q;  3PFS A;  1YCY A;  3X28 B;  2YUQ A;  1AT1 B;  1K73 U;  3M55 A;  1U1T A;  1PC0 A;  4C5I A;  2HBP A;  1H92 A;  1Q95 G;  1Y96 B;  1NJI U;  3LW5 E;  3OBY A;  4JRP A;  1OQK A;  3NTH A;  3TNI B;  3HO8 A;  2KEA A;  3DL1 A;  5CKE A;  4E7K A;  4M7A D;  4J5Y A;  4J9I A;  5GAM e;  5GAN g;  5J39 A;  3CCV Q;  1HYO A;  2ECZ A;  2L3R A;  1WXB A;  1MHN A;  3LQ5 B;  2K3X A;  4HCK A;  4Q5W A;  4R55 A;  1XO2 A;  1Y71 A;  2JTM A;  1N4M A;  5GAM j;  2K79 A;  3JCM V;  4J9H A;  2R57 A;  2BS2 A;  3EAE A;  2KT1 A;  2QFZ A;  3CCE Q;  2JGZ B;  5I5Z B;  4ZTF A;  1RAG B;  1WYX A;  1QCF A;  3I5R A;  3QZ9 B;  5IXB A;  2KRS A;  2ROL A;  4CRI A;  2KR6 A;  3R6N A;  1GL5 A;  5CKD A;  4BE0 A;  2FZG B;  4BCO B;  3E1S A;  4L59 A;  3MET A;  4F7N B;  2CKK A;  1UDL A;  3QSU A;  2EGA A;  1MMD A;  2IW6 B;  2FPD A;  2WAC A;  4BY7 X;  2RPN A;  2M0O A;  3EFO B;  1M1K C;  1AOJ A;  4AFZ C;  2DER A;  5IHN A;  2LDM A;  1P5E B;  4KUI A;  5FU7 C;  1UE9 A;  2DTI A;  4FSS A;  2DXT A;  4N4G A;  5KCO A;  4F04 B;  2PMI B;  1KG1 A;  1VQ7 A;  4RCC A;  1IGQ A;  1M3C A;  2E6N A;  3M9Q A;  2MPX C;  3I56 T;  2WSF E;  3WVE B;  2C4G B;  1JQQ A;  1MV3 A;  1WHM A;  1QVF S;  4NL2 A;  1BK2 A;  1I1J A;  1UNG D;  3OYM A;  4M7D D;  1ENW A;  7AT1 B; 
#chains in the Genus database with same CATH homology
 3JCM c;  1MGQ A;  4BD3 A;  4RMO A;  4IUT A;  3HRS A;  4OGE A;  1Y96 A;  3BG9 A;  5GAM d;  2EQJ A;  1UEB A;  5GMK e;  4HCC A;  3QYB A;  3TW7 A;  2P0P A;  3CCR A;  2X4W A;  1Q81 C;  4X34 A;  5GAM f;  3PMI A;  2KAF A;  1VQO T;  2WJ9 A;  4ELJ A;  3OS1 A;  1JJ2 A;  4F7U F;  2XID A;  2LNV A;  3HHT B;  3HKS A;  4JX6 A;  4A4G A;  3VYG B;  3L2U A;  3QII A;  5LJ3 h;  2KK4 A;  2CYZ B;  4PJO A;  4PKC C;  1K9M U;  2KDS A;  5FU6 B;  3CC2 T;  3VU3 C;  5LJ3 e;  3OY9 A;  5GAN 4;  1YI2 A;  2QI2 A;  1U1S A;  2IG0 A;  2RHY A;  3BG3 A;  2CZ6 B;  3QYG B;  2LT1 A;  3QO3 A;  4BDY A;  2E64 A;  4M7A C;  4RG2 A;  2P0K A;  2DXC A;  2O4X B;  3KBG A;  4J8O A;  2LQK A;  4HNU A;  5GAO p;  4C8Q D;  3QHS A;  5FRM A;  1BYM A;  4LOC A;  2EQK A;  2VGM A;  4DA4 A;  1VQL T;  3J81 E;  1D3B B;  4M78 B;  3V8L A;  1YJW T;  2FYK A;  4FSX A;  3RIR A;  3JCM d;  3VKH A;  1QVG S;  4RCB A;  1AHJ B;  2AHJ B;  1BI0 A;  4ZN1 A;  5M9O A;  2R5A A;  1YJW A;  3G6E A;  2BIV A;  3JCM f;  2CZ0 B;  2VC8 A;  4M7A G;  3SWN B;  4M75 C;  2L89 A;  3VKI A;  4OVA A;  2RJC A;  1WNL A;  1B34 A;  1U8R A;  4M77 A;  4EMK C;  1NZ9 A;  1X6O A;  4KBM B;  1RL2 A;  3M54 A;  3HRU A;  1XQH A;  4BUG A;  3M57 A;  2H3J A;  3CXC S;  2QDJ A;  3HSB A;  3CCM T;  4GY5 A;  2DPP B;  4ZGE B;  2R5M A;  2M9U A;  2XKO C;  4OB0 B;  2RHI A;  3OYL A;  4DOV A;  4BE2 A;  1UGS B;  2K5F A;  2QTX A;  4C0Z A;  3A5Z B;  3CCM A;  2YHT A;  5CR2 A;  4A53 A;  1K8A C;  4M78 G;  3UPU A;  2LRQ A;  1DJ7 B;  1XNI A;  5A2Q E;  2MWP A;  1NPP A;  5GAN 5;  4AKI A;  1JRI A;  2RI5 A;  3M53 A;  3VKG A;  4KT0 E;  4OP0 A;  5GAN h;  5J3B A;  3OYE A;  2QQ9 A;  4M7D B;  4HNT A;  3QG1 A;  4C92 D;  5GAN 2;  4C5G A;  2K2V A;  4JX4 A;  2EQU A;  3QZ5 B;  4C92 F;  5GAN e;  3G71 T;  1VQ7 A;  4NOY A;  2LT4 A;  5GMK i;  2E5Q A;  2O01 E;  3OBW A;  4MML A;  3CME A;  2DJZ A;  1QP2 A;  5CO7 A;  1BIB A;  4PJO C;  1WGS A;  4FT2 A;  3G71 A;  2JZ2 A;  3HRT A;  5D6W A;  1VQ5 T;  2E6Z A;  2F69 A;  2XDP A;  2RD1 A;  4PLL A;  4OB3 B;  1I81 A;  1VQ5 A;  4WF2 A;  4V2S A;  1Q82 C;  5GAN j;  4J7I A;  4HKE A;  4RG8 A;  3ZEH A;  5IT9 E;  3S3M A;  4F7U B;  5C6S A;  3CPW A;  4XU2 A;  4KUL A;  2RHZ A;  4M7A A;  3BW1 A;  4ZN3 A;  4JLI A;  1QW1 A;  1WQ7 A;  4PJO G;  2MI6 A;  5LJ3 d;  4BY6 B;  2XDD A;  1O75 A;  5FRO A;  4GLK A;  3LWI A;  1QP3 A;  4MFE A;  3RER A;  1W2B S;  3CBP A;  3HPW A;  2E10 A;  3QJY A;  5LJ3 f;  4QQ6 A;  1H64 1;  1FWZ A;  4B9X A;  4A54 A;  4JLG A;  3E9F A;  3SD4 A;  5CAI A;  4B9W A;  2Y4Y A;  3VYG A;  3OYC A;  2OTL T;  1QVF A;  3CCL T;  3LGL A;  4KUD K;  4LDY A;  3C4S A;  5GAN 3;  2G77 A;  1NPR A;  1WQW A;  2P0Q A;  1V29 B;  1S72 T;  3QDR B;  2BUD A;  3UT1 A;  4C8Q B;  3CCL A;  3BY7 A;  1N8R U;  2XD0 A;  2RHU A;  2ZPF B;  1N6A A;  3LYI A;  4M77 C;  3C12 A;  1S72 A;  3P8D A;  3HBL A;  4LDX A;  2O4X A;  5D6Y A;  3OW2 S;  4M7A E;  1G3Y A;  3P8B B;  5KE2 A;  4BE1 A;  4YTL A;  1FXX A;  1KHC A;  3RKX A;  2XI9 A;  1D3B A;  4M78 A;  2NLU A;  5D6X A;  2DIQ A;  2VV5 A;  1H3Z A;  2QQS A;  2XIC A;  3A8G B;  3QYE A;  1UB4 A;  3E19 A;  4BB7 A;  4JJN K;  3X24 B;  2KVQ G;  1VQ8 T;  1VQK A;  2Y90 A;  1KG1 A;  1WJQ A;  3ME9 A;  3VUZ A;  2ZPG B;  2PUO B;  3BFM A;  3TRE A;  5LJ5 g;  4IKF A;  3DB4 A;  4F7U G;  4M7D F;  3QPH A;  2P4T A;  4C0D B;  3A8L B;  3AHU A;  3OYA A;  2EJF A;  1K73 C;  4OF1 A;  3QWL A;  3FRN A;  3SWN A;  3MCA B;  1IRE B;  4M75 E;  2DZC A;  4N4H A;  3TU4 K;  2LQ8 A;  3GF5 A;  4XTW A;  3QJ6 A;  3CCR T;  3JCM P;  2DEQ A;  5GMK h;  3VJP A;  3G4S A;  4J6X A;  2QDY B;  3DB3 A;  4BDZ A;  3I55 T;  3J7A F;  3FC3 A;  3CMA A;  1NJI C;  4RKU E;  3OYF A;  2DAQ A;  1I5L A;  1XOV A;  1Y7X A;  2KY9 A;  5LJ5 e;  2L5Q A;  3MEW A;  3I55 A;  4OB1 B;  3L2W A;  4MZT A;  4PNO A;  3A8O B;  5CKB A;  2FVU A;  2RM4 A;  3M4Y A;  3JB9 I;  1YI2 T;  4L5G A;  2HNI A;  2MAM A;  4ELY C;  4BI3 A;  4E7J A;  1G3W A;  5I21 A;  5GMK j;  2E1H A;  4HCZ A;  3JCM Q;  4HL4 A;  2QF7 A;  4C0F A;  4A4H A;  3JB9 D;  4EMG A;  2ZPB B;  1QVG A;  4LD9 K;  2K4Y A;  3JB9 F;  5GAN d;  3S3N A;  1ZHI A;  1KD1 C;  5AYF A;  4Z02 A;  3FEO A;  3L2R A;  3L2V A;  3HFN A;  2CZ1 B;  2KQW A;  4C92 B;  1YJN T;  4VUB A;  5GAN f;  2L8D A;  1M1K U;  2EFI A;  5DLQ E;  3OA6 A;  2K5L A;  4C8Q F;  1YJN A;  4M7D A;  5LJ3 j;  3MHX A;  4QSH A;  4M6V A;  3X25 B;  2EJ9 A;  2GFA A;  2VYT A;  3JRZ A;  3CCS T;  2K5I A;  3G6E T;  1VQP A;  3SDZ A;  4LDU A;  5GAO r;  2BKD N;  2DKG A;  5CKH A;  4EMH A;  5GMK l;  1QVP A;  3CCS A;  3EFR A;  4PJO E;  5FU6 C;  2WSC E;  2I2L A;  5GAO l;  2DO3 A;  3CBM A;  1BI2 A;  3OB9 A;  3DLM A;  4XTU A;  3A8M B;  3CXC A;  1OZ2 A;  4XAX B;  4C5H A;  2JOY A;  1G3S A;  1HK9 A;  4OB2 B;  2DXU A;  2PVO B;  4F7U A;  4XU1 A;  2LTO A;  3OYD A;  3HFO A;  2ZPI B;  3KUF A;  5A0G A;  3PIP A;  1YBY A;  2RB6 A;  4BBR M;  2PU9 B;  4M78 C;  3PT9 A;  1SSF A;  1I4K 1;  1WPY A;  1X01 A;  5CQX A;  4E7I A;  2LX9 A;  1GXI E;  3OQ5 A;  1VQ6 T;  3NTI A;  3MEU A;  4L6V 5;  4TVR A;  1KQS S;  4C92 G;  5KH6 A;  3CCV T;  1VQ6 A;  3SWN C;  3BG5 A;  4MIM A;  1P92 A;  4II1 A;  5KCH A;  1KC8 C;  5C0M A;  3C94 A;  2RJF A;  5IN1 A;  3SFM A;  5GAM g;  3N5B B;  4OMF B;  1LJO A;  3CCV A;  1TH7 A;  3MEV A;  3ZBD A;  4C8Q A;  3FDR A;  4QVZ A;  3QUI A;  2IVW A;  4BI4 A;  2ZZD B;  4E7L A;  3JAM E;  1Q81 U;  3JB9 H;  4M77 E;  2QXF A;  3QYH B;  3A8H B;  3CME T;  4E47 A;  1FKM A;  2LCC A;  3MP8 A;  2V8I A;  3CCE T;  5HY6 A;  4Z6Y A;  1VQ4 T;  4HLQ A;  5I2M A;  2FL7 A;  2JVV A;  2RH2 A;  3J80 E;  3MP1 A;  3OYN A;  3CCE A;  1Q86 C;  3CD6 A;  3GNF B;  3FJP A;  4LDW A;  1VQ4 A;  1W2B A;  2C06 A;  1YJ9 T;  3CC4 A;  5LL6 S;  3GPL A;  3OYI A;  4HNV A;  2CS7 A;  1W4S A;  2YRV A;  3LH0 A;  2E65 A;  1OZ3 A;  2KMT A;  1YJ9 A;  4N0A A;  2K57 A;  5LJ5 f;  2D0Q B;  1M4Z A;  2JN0 A;  3KXT A;  4M75 D;  2RI2 A;  4M75 F;  4M7D C;  1VIF A;  3JCM g;  2V8K A;  5CKF A;  5DLO A;  4PLI A;  2M16 A;  4FT4 A;  1Y07 A;  4NS5 A;  1G3T A;  1LOJ A;  2VUB A;  4X9C A;  5FRN A;  2V8J A;  2E12 A;  3EFS A;  2BS4 A;  3E9G A;  3LLR A;  4XTV A;  3OW2 A;  4ZGJ B;  1N9R A;  4MFD A;  2A7Y A;  3CC7 T;  4E7H A;  3NTK A;  1PSF A;  3M5A A;  2QQB A;  3P8H A;  5FU7 B;  3CC7 A;  3OSS C;  4M7D G;  1LNX A;  4J6W A;  1K9M C;  2LVM A;  5CCA A;  2GQV A;  3V8J A;  2E70 A;  2HQE A;  3VYH B;  1EIF A;  1OI1 A;  4C92 A;  3JCM X;  3G7Z A;  4OGC A;  2K3Y A;  3UDC A;  1M1G A;  2OTJ T;  3TEE A;  2HQX A;  4BY6 C;  4O6J A;  2B8A A;  3PGG A;  3RES A;  1VQK T;  2RI3 A;  4QVC A;  4JUV A;  4IUQ A;  2BS3 A;  1JBM A;  4P5N A;  3V7R A;  2OTJ A;  1HXD A;  3S6W A;  2QEX T;  4Y91 A;  2X4J A;  2EYQ A;  3WXM B;  4XU0 A;  5GAN 6;  1G5V A;  4BI8 B;  3T9N A;  5DM7 R;  1K8A U;  4A4E A;  4J83 A;  2PUK B;  3O8V A;  3GOX A;  2QEX A;  3G4S T;  2KSS A;  3R6O A;  4C8Q C;  5CVI A;  4CI0 C;  4J7F A;  4PJO D;  3CMA T;  3H4C A;  3M4G A;  4PJO F;  4BBS M;  3PMT A;  3FB9 A;  4QVD A;  2XK0 A;  3JB9 G;  2RHX A;  3LWH A;  4QW2 A;  2DXB B;  5LJ5 h;  2Y4X A;  3MEA A;  3QKJ A;  4IUP A;  4QQG A;  1YIJ T;  5GAN 8;  2PVG B;  4M78 E;  1M9S A;  2QQR A;  4JS4 A;  1XTD A;  2PVD B;  3HP9 A;  4NC6 A;  1WJR A;  2MF2 A;  4FU6 A;  3OMC A;  1YIJ A;  4C8Q G;  2GFU A;  4JDS A;  3ASK A;  2ZGW A;  4C0D C;  4JS5 A;  2KMG A;  2GF7 A;  1M1F A;  1I8F A;  4DOW A;  1Q82 U;  4BAC A;  2HD0 A;  3LX7 A;  1UGQ B;  1OYX A;  2MWO A;  4FL6 A;  3VUB A;  1Q7Y U;  4Y28 E;  2CZ7 B;  1QLB A;  2MMP A;  2RK1 A;  3INZ A;  3MO8 A;  4O5V A;  4N0A C;  4XTZ A;  4JX5 A;  3URG A;  5LJ3 g;  2DD4 B;  2EIF A;  2ZZD A;  5I2S A;  1M5Q 1;  2ZPH B;  5HKC A;  3PNW C;  4M7A B;  5GMK m;  2ZPE B;  2YLB A;  3L42 A;  1VQP T;  5CIU A;  3RMQ A;  1BKB A;  1YHQ T;  5GAO m;  3RMS A;  4M77 D;  3FLG A;  4PL6 A;  1X75 C;  1VUB A;  4M77 F;  2OAU A;  2XHC A;  2RJD A;  3QXE B;  3CPF A;  2JNG A;  4LD6 A;  3OYJ A;  2RK2 A;  3S3O A;  1VQ9 T;  1YHQ A;  1VQO A;  2PQW A;  2GCX A;  3JB9 J;  5CK9 A;  4JRQ A;  3L2Q A;  3JSC A;  2XU8 A;  4XTX A;  4C0G A;  3RUX A;  1VQ9 A;  4M75 B;  1YIT T;  4AKH A;  3OYY A;  4ATO A;  1KQS A;  1RI0 A;  4IUV A;  5KE3 A;  4XU3 A;  4C92 C;  5LJ5 j;  3CC2 A;  4IUR A;  1R8O B;  3SB2 A;  3OS0 A;  1YIT A;  1JJ2 S;  4EMK B;  2X35 A;  4MDW A;  4M7D E;  3CBO A;  2DD5 B;  2F5K A;  4A4F A;  3KHI A;  2RJE A;  3PFS A;  1O9S A;  1YCY A;  2FHD A;  2X4Y A;  3X28 B;  1M90 U;  1M8V A;  1WJS A;  1K73 U;  1VQM T;  1VQL A;  2VGN A;  4ELZ C;  3M55 A;  1U1T A;  3JCM W;  5FLX E;  1VQN T;  4C5I A;  2JTF A;  4ZTJ A;  3F70 A;  1VQM A;  2QQ8 A;  2EKO A;  2HBP A;  3LGF A;  1VQN A;  1Y96 B;  1NE8 A;  1NJI U;  2DTO A;  2DZ9 A;  2JUF A;  3LW5 E;  3OBY A;  4F7U E;  3VV0 A;  2DTH A;  3CCQ T;  4JRP A;  1N8R C;  3NTH A;  4N4I A;  3X26 B;  5DY9 A;  1ZQ1 A;  5J26 A;  3OS2 A;  3GP8 A;  3HO8 A;  3HB9 A;  3V8K A;  3DL1 A;  5CKE A;  3CCQ A;  4E7K A;  4XK8 E;  3RKY A;  3RKW A;  1E7P A;  3Q1J A;  3CD6 T;  4M75 G;  5GAM h;  4J5Y A;  4M7A D;  4JRK A;  3CC4 T;  2R58 A;  4M7A F;  2X4X A;  2DK3 A;  5GAM e;  1VIE A;  5GAN g;  5IAY A;  5J39 A;  1UGP B;  4PJO B;  2XG8 D;  4D6W A;  1KD1 U;  1N9S A;  2EWN A;  2CGH A;  3OYB A;  2L3R A;  4QQD A;  5LJ5 d;  1MHN A;  2A3L A;  2K3X A;  4NL3 A;  3DLL A;  4Q5W A;  2WSE E;  4R55 A;  3GIB A;  4C8Q E;  5GAO n;  3JCM b;  4MZP A;  3H6Z A;  5EJC A;  3X20 B;  4J6Y A;  1Y71 A;  2JTM A;  3M56 A;  2D9T A;  4MMK A;  4A4K A;  2DXC B;  5HK3 A;  5GAM j;  2EAY A;  3JCM V;  4EPC A;  4XQ3 A;  2DXB A;  2RO0 A;  2R57 A;  2BS2 A;  4UC4 A;  3BDU A;  3DKM A;  3EAE A;  2QFZ A;  4X9D A;  3QBY A;  3ZFJ A;  5EG2 A;  4HT8 A;  5A0D A;  3M59 A;  5A0L A;  4ZTF A;  4ME7 A;  2QQA A;  1BIA A;  4EDU A;  1KQ2 A;  4LDV A;  4MZM A;  3QZ9 B;  4M78 D;  2RA2 A;  4M78 F;  4CRI A;  3GNG A;  2FB7 A;  4MDX A;  2KR6 A;  4R56 A;  4AKG A;  4FM4 B;  2YLC A;  3ER0 A;  3JCM h;  5CKD A;  3L2Z A;  4BE0 A;  1N27 A;  3JCM e;  3E1S A;  1Q7Y C;  2DD4 A;  1B34 B;  3HL8 A;  3MET A;  4HA8 A;  4L59 A;  4M77 B;  3OMG A;  4JRI A;  2CKK A;  4C5E A;  3OYK A;  3QSU A;  2QA4 T;  2DVE A;  3BDL A;  4HT9 A;  2LC4 A;  2WAC A;  4HCB A;  2M0O A;  3CEY A;  3FIF A;  3C95 A;  1M1K C;  2QA4 A;  2EQM A;  3H8Z A;  1BI3 A;  4DQ2 A;  3OS5 A;  4AI6 A;  2M1H A;  2DIG A;  1KC8 U;  2LDM A;  1BI1 A;  4KUI A;  5FU7 C;  3V7S A;  2DTI A;  3OYG A;  2DXT A;  4N4G A;  3CPW S;  2OTL A;  1VQ7 T;  5KCO A;  4M75 A;  1KQ1 A;  2XDB A;  3TCJ A;  1IZ6 A;  3MP6 A;  4XTY A;  3V7C A;  2ZCF B;  3TW6 A;  3WVD B;  2LCL A;  3UWN A;  4IUU A;  4C92 E;  2VXF A;  3CCJ T;  4RCC A;  2E6N A;  3JCM J;  3OSV A;  3M9Q A;  4ZGD B;  3NFC A;  2F5T X;  3I56 T;  4EMK A;  2WSF E;  2HAX A;  3WVE B;  1UGR B;  5HK0 A;  1JB0 E;  2E41 A;  2VXE A;  3CCJ A;  1QVF S;  2DD5 A;  3M58 A;  4NL2 A;  3I56 A;  2EJG A;  4FIB A;  5GAN 7;  5GAO q;  3CCU T;  1Q86 U;  5CQY A;  3OYH A;  3PTA A;  3OYM A;  2D6F A;  5L8R E;  4M7D D;  3HZJ A;  1PSE A;  1KHI A;  3GLX A;  3CCU A;  1M90 C;  2G3R A;  4M77 G;  3PIO A;  1ZBX A;  3L1A A;  1FX7 A;  1VQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...