2CYZB

Photo-activation state of fe-type nhase in anaerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase in anaerobic condition
rcsb
molecule tags Lyase
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cyzB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cyzB02
2ZPGB 2D0QB 2DD4B 2ZPFB 1QP3A 2ZPHB 1UGSB 1PSEA 3A8LB 4ZGJB 2CYZB 3QYGB 2ZZDA 2PVGB 2DXBB 1JB0E 3WVEB 1DJ7B 3VYGA 2PUOB 2DPPB 4OB0B 3X26B 1UGRB 3VYGB 2DXCB 2ZPEB 2ZPBB 2AHJB 3HHTB 4FM4B 3X20B 2ZPIB 4RKUE 2O01E 2PU9B 4Y28E 3WVDB 2ZZDB 2PUKB 3VYHB 1UGPB 3A8OB 1QP2A 2WSCE 1IREB 4XK8E 1V29B 3A8HB 4L6V5 2DD5A 3QXEB 2WSEE 3A8GB 2CZ1B 3X25B 1PSFA 2DD5B 2ZCFB 4ZGDB 4OB3B 4OB1B 2WSFE 2CZ0B 3QYHB 4OB2B 2DXBA 3QZ9B 2CZ7B 3A8MB 4ZGEB 5L8RE 3X24B 4KT0E 3LW5E 1GXIE 2CZ6B 3QZ5B 2QDYB 2DD4A 1AHJB 2DXCA 2PVOB 2PVDB 3X28B 1UGQB
chains in the Genus database with same CATH superfamily
1PM3A 4HCBA 2BPMB 2CP7A 1KHIA 3EGDA 1ZLMA 4EORB 2RJFA 1RLQC 4M78C 4OMPA 1VQ6Q 5GAOl 1FMVA 2AKKA 2PQWA 2P4RA 4RTYA 3OYFA 4FYWB 2FPFA 3H0IA 3OY9A 1S72Q 1KK7A 3ULRB 2PNIA 1RADB 4BY1X 5CEIB 3MKDA 2EYYA 3T9NA 2A7YA 2DIQA 3OYCA 3CQTA 3CPWS 1U1SA 2DL5A 1QCOA 1PRLC 1PKTA 2QQ8A 4DEXA 2XKOC 4CI0C 3CCST 3JCMd 2GQIA 4M4ZA 2FB7A 5GANe 2DYIA 5GMKe 3OSSC 1UJYA 3M57A 1K9AA 2DEQA 2HKNA 2MMPA 3QDFA 2OTLT 2HZYA 4UC4A 2YLBA 2LJ3A 4OMOA 3CC2Q 1VQ8T 3PNWC 1W98B 2MOXA 1W2BS 1VQOT 2JVVA 5GAN2 2COYA 4LN2A 1X2KA 4RUGA 3CCRT 4K11A 3O8VA 4XTUA 3M0RA 2C5NB 4JRQA 5IN1A 3I5RA 1EX4A 1X6GA 2PTKA 2KRNA 3E9FA 2I40B 2L0AA 3K7AM 3MY1B 1YHQA 1GCQA 2J06A 4QW2A 3JB9J 4MDXA 1WQ7A 3PT9A 1MNDA 3CMET 4D8KA 1VQKT 1UTIA 1F1BB 1ZBJA 1PD1A 3JCMh 4M6VA 3OYMA 1D1AA 4OB3B 5GAOp 3ZFJA 5GAMg 5IF1B 1M8VA 2K5IA 4HLQA 2EGEA 2KMGA 1YP5A 3A8MB 2EGCA 4MFDA 3V7SA 4C92B 1JOWA 3CCSQ 3QWXX 4FX3B 5I11A 1P92A 1AWJA 3LW5E 5HQ0B 4ZN1A 1QW1A 2YRDA 1WHLA 2QQAA 4ROEA 2CP2A 4ROCA 1D09B 5KYYA 4QVDA 1LCKA 1QCNA 3VKGA 1VQOQ 1UGQB 1YJNA 1IGUA 4ZNXA 5LJ3h 1K4US 1NBEB 2CSQA 5LJ5f 4M7DD 4PNOA 4XU0A 4PK4A 1UGSB 2GCXA 5FRNA 1QKXA 4HNUA 1OEBA 2JS0A 2EWNA 2DXBB 2OTJQ 2ECZA 1R8OB 2RN8A 2Y90A 3S6WA 2DPPB 4F7UE 5DY9A 2DEUA 4OP0A 3CMEQ 1VQKQ 2ESWA 5KYUA 2Y4XA 2ABLA 4RTXA 4A4KA 2LT4A 1NE8A 1WXBA 2W10A 5FU6B 4O5VA 4RODA 3TVTA 1YN8A 1B3QA 3URGA 4LDVA 4C0GA 4FM4B 2DX1A 1X69A 3VS3A 3QJ6A 2HL5C 3LH5A 1OPKA 2GTJA 1RAEB 2FL7A 1CKAA 5KH6A 2DETA 3D7SB 3DJBA 2QTXA 1KJWA 2DK3A 2K5FA 2FZGB 2P0QA 2F2CA 1JO8A 1V1CA 2B9RA 2H3JA 1ZP2A 3QHSA 2QEXA 1NEGA 3R6OA 3EFSA 4FYYB 1AT1B 1UHCA 1K9MC 2XDBA 1VQNT 4BCIB 5KCOA 1FX7A 3CC4A 5LJ5g 4EOQB 1BU1A 2BS3A 3GP8A 4I3ZB 2WACA 3RKWA 2Z0WA 7AT1B 1FVVB 1YCSB 4A4GA 3CCQT 2IVWA 3VRZA 3MEAA 3RMSA 4PJJA 1TTHB 3MY5B 1WX6A 2FZCB 1I81A 2JMAA 1GCQC 3DLLA 3EFOA 2YT6A 2QQRA 4BB7A 1KFZA 4LDUA 3CCMT 2GFUA 3M0TA 2NUPA 3MHXA 1WYXA 1IZ6A 1WHKA 2GF7A 1KC8C 2QQSA 1BI0A 3H6ZA 1BCMA 3I56Q 4DBQA 3HL8A 1KD1C 2OTLA 4CFUD 3FJ5A 1OX8A 4MMLA 2EYXA 4AKHA 4X9DA 1VQ8A 1GH6B 1ZX6A 2JOYA 4TVRA 2QA4Q 2KK4A 3VS2A 3A8LB 1RL2A 4PJOA 2A08A 3FDRA 3M55A 4RTZA 5D6YA 3H41A 1I0CA 1VA7A 2V22B 2LX9A 3VKIA 2VC8A 4NS5A 3VS5A 1YJWT 4C8QA 2LCSA 1OULA 4BCNB 3OYBA 4OGEA 2W96A 4KRCB 3RUXA 1U06A 2V1RA 4XTVA 1FMWA 4BBSM 3TEEA 1U8RA 2LCCA 3M53A 2BKZB 3QUIA 2J6OA 3CCMQ 3BHVB 1OI1A 2BS4A 5EC7A 5CKDA 3JB9H 2X1NB 3CXCP 2GTOA 4Z89A 5HKCA 4C5GA 4OMMA 3UATA 2MPXC 4M75A 4O6JA 4HL4A 2AZSA 4OMLA 2HEQA 1I8FA 3OS5A 1FWZA 3HZJA 4M77A 1MMAA 3MO8A 2RHXA 4QQGA 3BG9A 1D0YA 2FPEA 3FJPA 2LW4A 4M75E 1BCOA 2NYSA 4F7UG 4PJNA 2EBPA 1PG5B 2YUQA 1RAAB 4J9DA 4BE1A 9ATCB 1HYOA 3LQ5B 1Z9ZA 1WXUA 1NJIU 1ZBXA 1Q86C 1YJWQ 1MV0B 3QBYA 3TN8B 2IPOB 2QASA 3MPUB 5J3BA 2A0FB 1JXMA 4KULA 2GGRA 2DMOA 4BBRM 2E65A 1RACB 2KXDA 4F16A 2VWFA 3KFVA 3O5ZA 3QZ5B 1SRMA 3V7RA 5LJ3j 1Y96B 3BHUB 1WJRA 4C5IA 2OI3A 2UZEB 4N4IA 2KBTA 4FYVB 2DERA 3H0HA 4F14A 1PSEA 4HT8A 4M7DF 3QWYA 4HVVA 5CR2A 5HBEB 4M7DB 3L42A 3RIRA 3LGLA 2PUOB 4DA4A 3OYJA 1QMCA 5AT1B 1K1ZA 3QHWB 2CREA 1M1GA 2K4YA 4GLKA 2CP0A 2EYZA 4XTZA 4GY5A 3CCUT 4PJOC 4J9GA 3CMAT 5DLOA 2IW6B 3G1JA 3ME9A 3X20B 1K76A 2RQTA 3CCQA 4C8QC 4CXAB 3EGUA 2K9GA 5HK0A 6AT1B 5J26A 1UUEA 1VQLT 5AYFA 1M8MA 2B8AA 2ZZDB 1SF9A 2DLPA 2VXFA 1TUCA 1M2VA 4QQDA 1H92A 1JRIA 5M9OA 5A0GA 4J9CA 1M1KC 2V26A 2XU8A 3OYLA 4DBRA 1TU0B 2I0NA 2BUDA 2KT1A 1VQ7Q 1HK9A 5GANh 5GMKh 1N5ZA 1G3SA 2DL4A 1GBRA 3PVQA 1M4ZA 2L3RA 3LYIA 1QVGP 4L6V5 1VQ5A 2FO0A 4OVAA 5HVYB 4CC4B 3QIIA 3QJYA 1WXTA 5CVIA 5CKEA 2VYTA 4BCOB 2IVXA 5L23A 1UNHD 3CXCS 1I07A 4J7IA 4A54A 1XQHA 2PMIB 4RCBA 1UG1A 4C8QG 2DJZA 4QSHA 3CCUQ 2P0PA 4JZ4A 2XDDA 2JUFA 3CMAQ 4KT0E 2F5TX 4CC3A 1AHJB 4IUPA 3I55A 2BKDN 3KHIA 1K8AU 2M9UA 2W2HA 1Q81C 4BY6B 2XD0A 2ROLA 5GAN6 4C5HA 4XU1A 3L2RA 1QP3A 2ZPHB 4LDWA 1G5VA 3M03A 4M75G 4Y92A 4EIKA 5FU7C 3L2UA 3G6ET 4BE0A 2DJQA 4CFUB 1D0XA 3OYYA 4RCCA 1JB0E 3CD6A 4M77G 5IT9E 4OB0B 4OF1A 2R58A 2RO0A 1UJ0A 5EJCA 2E5KA 5IXFA 2YUPA 3QYBA 4JRPA 2KAFA 2PZ1A 1AOJA 3RERA 4M78E 1YHQT 4EMKA 2VVKA 4MZMA 3RKYA 1UNGD 4BD3A 2AHJB 1NJIR 2HDAA 4IUUA 1BU2A 2J7IA 4VUBA 2BE7D 1RAGB 2F2WA 1WJSA 1Q81U 2O01E 5FRMA 4Y28E 3MIAB 1O9SA 1RI0A 1NG2A 2QG9B 3KUFA 3NTIA 3TNIB 5D6WA 2E10A 3BW1A 5A0DA 1N4MA 2MIOA 4YOZA 3A8HB 1KQSP 1QQJA 1R77A 5BNJB 1YJNT 4JLIA 1F5QB 2JMCA 1M27C 3ZEHA 3M54A 2VGNA 4A4EA 1H27B 1GFCA 1RABB 4EOSB 1IRXA 3DOGB 5GAN7 2R57A 3P8DA 4KUIA 3OMCA 3HFNA 3REBB 3H8ZA 5IHKA 1ZSZB 2YSQA 1ZUKA 3EH2A 4C0ZA 1BBZA 2NUTB 1YHQQ 4M7AC 2EKHA 4KGZB 5L8RE 3BLQB 2NLUA 2IW8B 3V8JA 2C5XB 1X6BA 2P4TA 3L1AA 4B6MA 3OW2P 3OSVA 1WHGA 2RJCA 1N8RU 4BXXX 4X34A 2JJ9A 4YTLA 5CCAA 2R7GA 3L2WA 1S1NA 2V8JA 4JX6A 2QQ9A 4KH0B 2ATCB 3EG1A 3TCJA 3TSWA 2L3PA 4LOCA 4E7SA 5ECAA 3EG9B 3EGXA 2E12A 4AKGA 3TNWB 1VQLA 4PJOD 4IIOA 4ELZC 2I53A 4ZGJB 1ZA1B 2RHIA 4F17A 5IHNA 1BI1A 3G4SA 3JCMP 1YJNQ 4C8QD 1TS9A 1AZEA 3TU4K 3ASKA 1HD3A 2LNVA 1ZA2B 2XICA 5CQXA 3CC4T 3M58A 4B9WA 2K6DA 3VS6A 2ED1A 1Q7YC 2QDLA 2EJ9A 4ELJA 1V76A 3JCMX 2G3RA 1JJ2A 3TQ7P 4OMNA 3CBPA 1NYGA 3PTAA 5GAMf 4HNVA 4LE9A 1QVGA 1JEGA 3GLXA 3OYIA 2E1HA 2F5KA 3S3NA 2CT3A 4J9HA 5LJ5d 4M75D 4NL2A 1RUWA 4EMKC 1GUXB 1NPPA 5GANj 1TXQA 2C0OA 2LQKA 3MP6A 3VUBA 1G3NC 4M77D 4ME7A 3BG5A 2DL7A 1OV3A 3OYGA 4BY7X 4NC6A 1K8AR 2LDMA 5C0MA 1C1AA 3C0CA 2KYMA 1TUGB 2QGGA 2RQWA 3C95A 1AWWA 4EC9B 4E7KA 1OGUB 4E2FB 2AK5A 4EOIB 1QVPA 2ED0A 4ELYC 3JCMW 2YLCA 1PSFA 2PHGA 3G6EA 2QEXQ 4M78G 1NZ9A 2IN3A 2EQMA 3INZA 2OJ2A 1SSHA 1Q95G 3QZ9B 3BE3A 2CZ7B 3QPHA 4PKCC 2QXFA 1D3BB 2HQXA 3TSZA 1UE9A 4J9FA 3GF5A 5GAOn 3JCMQ 2YWWA 4LUDA 2DD4A 1RI9A 4Z8AA 2R5MA 3I5SA 2D8HA 3E1SA 2G9XB 3VKHA 2DRMA 5KYYB 4FSSA 1WHJA 4FU6A 2JZ2A 4AI6A 4KRTA 4F7UF 1K73R 2EQKA 2NUZA 3CCJA 1ZUUA 4F7UB 2F69A 4JRIA 2OTLQ 3CCVA 1NLPC 2DBMA 1VQ8Q 2KXCA 2EAYA 4MFEA 4L59A 4EDUA 3CCRQ 1LNXA 4QQ6A 2DYBA 3VS1A 2DL8A 1AVZC 1J3TA 1O9KA 1KQSA 4LD6A 1GRIA 4BCHB 1G3YA 2YRCA 2BZXA 3ZBDA 4FCYA 5CKFA 1E7OA 4C92A 2W99A 4CFVB 4JJBA 4KH1B 3Q1JA 2WSCE 1VQ9A 1M5Q1 3PMTA 2FPDA 1QKWA 2VASA 1V29B 3QSUA 3B57A 2X4YA 4XQ3A 3QWLA 3TNHB 3A1PA 4EOOB 1VQ4A 1VQ6A 3OYHA 2X35A 1HSQA 2BE9B 1LJOA 3M0SA 2IIMA 3JAME 4A63B 2L3QA 5CAIA 3OW2A 4QT7A 2JN0A 1S72A 2C0IA 2QGFB 2LQ8A 3TW7A 3NDQA 3UT1A 2RK2A 2YRVA 2FVUA 3P8HA 2X3XD 1AD6A 3RMQA 1N6AA 2DXBA 2O9VA 2DAQA 4EC8B 1ARKA 2JTFA 2CDTA 3QKJA 5J39A 2D1XA 3A98A 3L2QA 1M3BA 5CO7A 4Y91A 4OR5B 5IHIA 2F1LA 5GMKl 5LJ3f 1CKBA 3HTRA 4MIMA 1AWOA 5GAMe 4KBMB 4PFOA 3UDCA 5HK3A 2E70A 2X4JA 1VINA 4IIMA 5KYXB 2RHUA 2DA9A 3HRTA 4BCKB 2V8IA 4J83A 1YJ9A 3P8BB 1M3CA 1OU8A 4II5B 1NEBA 4WTOB 2LP5A 4M78D 1I4K1 1GL5A 2HQEA 2UZLB 1JQQA 3NHNA 1Q82C 1G8XA 4JZ3A 3OQ5A 2CGHA 3JCMg 3OYNA 4C8QF 2W0ZA 2RF0A 2KR3A 1WPYA 1UFFA 1VQ5T 1K9MU 4C8QB 2MCNA 3UA7A 3M4YA 1TH7A 1H1RB 3H9NA 1B7TA 4FW2A 2A3LA 2C4GB 1GBQA 1AWXA 2HBPA 3RKXA 5FROA 1VQNQ 3AHUA 2HD0A 3C94A 5EFQB 1QWEA 2LMJA 1ZQ1A 2PUKB 5ICPB 4D8DA 4PJOE 3OBWA 2LT1A 4OMFB 4M75F 3M56A 5LJ3g 2YUOA 3CCQQ 5FWCA 1PD0A 1SKUB 1H8KA 3NTHA 4M75B 1WA7A 3I55T 4C8QE 1Q82U 3QG1A 4M77F 1ZUYA 2UZBB 1KC8U 5D7UA 1H1PB 4F6WB 1RLPC 2RB6A 1KG1A 4M77B 1HXDA 3QXEB 4XAXB 2EQUA 5HY6A 4C92C 2EJFA 3SDZA 1KD1U 2QGSA 2D6FA 3VUZA 2KYBA 3C12A 4F70B 2HAXA 4OB1B 3OS0A 3J7AF 3CD6T 2OAWA 4DOWA 1VQ5Q 1YWPA 3M5AA 2HSEB 3SWNB 5LJ5e 1SPKA 2WPAB 1W1FA 3GPLA 3UA6A 1PHTA 1YFNA 4M77E 1YIJA 5GAOm 1ENWA 3PE0A 2EKOA 1I5LA 1M30A 3IQLA 4EONB 2CT4A 4WF2A 2C06A 4EOKB 3DDQB 1H4LD 1W4SA 3SHWA 2KR6A 2FRYA 3G71A 3I55Q 3OB9A 1Y0MA 5FU6C 4CRLB 3EAEA 3VYGA 2RJEA 2L5QA 2HNIA 1UGRB 1OIUB 1TUDA 1HJDA 1JSUB 2EYQA 4AG1C 4CC2A 1YBYA 2DM1A 1QVFP 4RTTA 1QCFA 3HRSA 4JJCA 1NPRA 3EHRA 2G6FX 2DXCB 2DILA 4JS5A 2A37A 3CD6Q 3THKA 5A2QE 4E6RA 4JJDA 3UWNA 2KNBB 4HVWA 1LOJA 2RMOA 1M90C 1Q86U 2RI2A 3R6NA 2XMFA 2RM4A 4E7IA 3WVDB 2E3HA 3H4CA 5GAN4 2FZKB 3M0UA 2YHTA 1IREB 3EIDB 3CCET 2E6ZA 2E6NA 3RESA 1X43A 2W9FA 1WIEA 2RI3A 2WHBB 3KBGA 4PJMA 4C0DB 2LJ0A 3S3OA 1TFBA 1VYWB 1Y96A 2MWPA 4DEYA 1OI9B 3O0GD 2DD5A 3L2ZA 1B34A 5A0LA 4J5YA 1PNJA 3A8GB 4J9EA 1D1CA 2MK5A 1VQMT 4HXJA 2ZCFB 4XU2A 2KVQG 1OZ2A 1M3AA 5KE3A 2O4XA 4UN0A 1FYNA 3FLGA 1Z9QA 5IDNB 1SEMA 2M0OA 3G4ST 2COZA 2DTHA 4M7DA 4V2SA 1JJ2P 5HNBB 4HCKA 1M90U 2E3IA 1FINB 1NYFA 2HL3A 2UUEB 2DF6A 3FIFA 3CPFA 2COWA 3OS2A 2UZDB 1K9MR 2NWMA 4M7AA 2K2VA 1KSWA 5KYNA 1SHGA 1WHMA 1MMNA 4PJOG 5CQYA 2WMAB 1OL1B 4HT9A 4AFQC 2LCLA 4G6LB 2FG0A 2WIHB 2D0QB 2ZPFB 3SEMA 4A4HA 3VRYA 1UNLD 2AKLA 4M7AE 1D0ZA 2DE0X 1Y07A 1VQPA 5GAN3 4EMGA 2KEAA 4Q5WA 2RJDA 4RG2A 4HA8A 2ZZDA 3E9GA 1Y7XA 2C5OB 4A53A 1YITT 1WDXA 2KRMA 4M78F 5HBHB 1BIBA 3MEUA 3JB9G 1M1KU 4HVUA 4JPBW 1X2QA 4M78B 2IW9B 1VQLQ 5CIUA 5GJWB 1KC8R 1MHNA 4JS4A 2BZYA 3CEYA 2EQIA 2CP5A 2HCKA 1LVKA 1WFWA 3CC7A 1XO2A 1H1SB 3LWIA 2VKNA 2DRKA 4ZTFA 2RQUA 5ACBA 4CFMB 1OKVB 2EGAA 2GBQA 1KHCA 4R56A 4C92D 4N0AA 4J9BA 2K2MA 4CRIA 5GANf 2CCIB 4HCZA 1OPLA 1H641 4XTYA 1RAHB 1XJWB 1VUBA 3EG2A 4F6SB 1MV3A 4LXCA 4RTWA 1EFNA 5CK9A 3M0QA 1T3SA 1IGQA 1AD5A 3CCJT 3QYHB 1WHHA 1GCPA 4Y72B 2M1HA 1R0BG 4R55A 3C4SA 2LVMA 5GAMd 3CCVT 1H1QB 3EFRA 2JS2A 4LDXA 4JUVA 3MP1A 3G6EQ 5FWBA 1W2BP 4JDSA 3G7ZA 3NGPA 1MMDA 2XK0A 3JV3A 1U1TA 4GBQA 2K79A 4M7DC 5IHYA 2DZ9A 2PK9B 4IMYB 2RHZA 4BCPB 1Q86R 4AT1B 1QVFA 5GANg 1JJ2S 1BIAA 1JU5C 4BI8B 2K3XA 2PVGB 1VQ7A 2QI2A 1VQ9T 3CCEA 1QVGS 1DJ7B 5KYWB 3PMIA 5EG2A 1KQ2A 4C0FA 3HB9A 1O75A 4J6XA 5GAMh 1EIFA 2QQBA 1VQ4T 1VQ6T 5IH2A 4EOLB 1VOMA 3CCJQ 1W70A 2ZPEB 1VQMA 1S72T 2BIVA 3LLRA 3VS4A 2CCHB 4J6YA 3CCVQ 2R5AA 3EGDB 3VU3C 2O88A 2RH2A 1ZSZA 4BI3A 1N9RA 3BFMA 3BDLA 1W6XA 3A8OB 4M7AG 1QWFA 1P5EB 3DB4A 1WLPB 2P84A 2WFYB 2QTVA 3SFMA 1Y57A 1YI2A 3JB9D 1NLOC 3V8KA 3CC2T 3RDVA 3E19A 1H24B 3NTKA 5KCHA 4N0AC 2C0TA 3REAB 5IAYA 1AZGB 3X25B 4MMKA 1YJ9T 4OMQA 3GNFB 2CUBA 3SB2A 4ZGDB 4JX4A 5GMKj 4RMOA 1YITA 1WZOA 1VQ4Q 1M1KR 4RTUA 4BY6C 1E9HB 1KXUA 4BCND 2ENMA 2QK0A 2RPNA 1H26B 1TWBA 2JTMA 1GXIE 2L8DA 1TD6A 3RBBB 2PVDB 3AT1B 3CCLA 4AFUC 2LC4A 2ZPGB 2DD4B 1Q7YU 2LTOA 2KQWA 2DL3A 3NMZC 4EMHA 5DQWA 3CC4Q 3I35A 1YWOA 1XTDA 3E2UA 4BCFB 2ZGWA 5HCKA 1KQSS 1JBMA 5LJ5h 4Z88A 2EIFA 1GUXA 2DNUA 1M2OA 4LDYA 3WVEB 4QKUA 2ROTA 4QVCA 5FW9A 1ACMB 2RD1A 3OYDA 2JW4A 1MMGA 2CKKA 1YJ9Q 2DFUA 2L3SA 4KGVB 1Q81R 3OYAA 2OAUA 2VXEA 4X1VA 2EQJA 3A5ZB 2OTJT 2O2OA 5LJ3d 1Y71A 1K0SA 5GAN8 5GAOr 2FRWA 2KSSA 2DXUA 2J05A 4PLIA 2RHYA 3OW2S 2X9HA 1B07A 1X27A 1O9KB 2M02A 4BCMD 1D3BA 2MYSA 2K3YA 1UECA 4ZN3A 3CPWA 1EZZB 2JM8A 1OYXA 1TG0A 3F5XB 4C92F 4F6UB 1BK2A 2O9SA 4IUVA 3M4GA 4XU3A 5KYUB 3M59A 3RNJA 1YIJT 1A0NB 3UPUA 2XG8D 3JSCA 1ZSZC 2WSEE 1IXDA 2BTTA 2CUDA 4DBFA 1W2BA 4C5EA 2QFZA 4FSXA 3I9QA 3MI9B 1OL2B 1X01A 3G71T 1SHFA 4ELLA 4F7UA 4IUQA 1G83A 1IHWA 1IO6A 4A4FA 4ATOA 1E7PA 1TOVA 1N8RR 4E7LA 3F70A 2EUFA 4C92E 4BACA 4AG2C 2DIGA 3OYKA 2YXYA 3JCMf 2CH4A 1YNZA 2YUNA 4M7AD 2KDSA 2RNAA 3EOCB 3BHTB 2VB6A 1UGVA 4EPCA 4RG8A 3PIPA 3VV0A 1LPLA 3BLHB 1VYTA 2C5VB 3H0FA 4NOYA 4BE2A 1IB8A 5LQFB 3BLRB 2WIPB 2AIRB 2P0KA 2CSIA 1YIJQ 3DDPB 4F7NB 2K3BA 4KUDK 2HBWA 5GAMj 4LNPA 2DZCA 3S3MA 1TSFA 4P5NA 1G2BA 3I56T 2WMBB 3X26B 2EW3A 1BI2A 2SRCA 3EFOB 2L2PA 3SD4A 2NUPB 5LL6S 3CC2A 2WXVB 4MZTA 2QA4T 1ZSGA 4BDYA 2H8HA 3G71Q 1I5OB 1T3LA 2ZPBB 2M16A 4EOMB 2F2VA 2JGZB 3EG0A 5I2SA 2A28A 1AEYA 2V1QA 3UF4A 4PJOF 1H25B 4PJOB 1VIFA 3JCMJ 2AZVA 3FRNA 2DBKA 3J80E 3JCMc 4FIBA 4FL6A 4AKIA 2HMAA 2D9TA 1PCXA 4Z02A 4JLGA 3GNGA 2W9ZA 3PVLA 5I21A 3V7CA 2J6FA 1Q7YR 2X3WD 2GFAA 3JB9F 3CCSA 2O31A 1VQPT 3PFSA 5KYXA 3ZL7C 1KIKA 4PFZA 2MF2A 3EHQA 4N4HA 1E6HA 4J6WA 2E41A 1BKBA 3M0PA 1VQOA 2LX7A 3CCRA 4EOJB 4D6WA 5GAN5 1IHVA 2VV5A 5DM7R 1FMKA 3HBLA 4CFNB 3CC7T 2X4XA 1RAIB 2OTJA 3HFOA 4JRKA 3QYEA 1BYMA 3HKSA 2DMEA 4II1A 2YDLA 3QDRB 4NL3A 2HKQB 2WJ9A 3CMEA 1NJIC 1VQKA 1I1JA 2QDJA 4ANJA 5LJ5j 5GJVB 1T0HA 2D8JA 2KMTA 4LD9K 1OQKA 3EJ1B 1GFDA 3RGFB 4FT2A 4PJLA 4JX5A 1D1BA 1UEBA 2ZAEA 2G77A 1VQPQ 1PRMC 4BUGA 3VYGB 1ABQA 1H28B 5FU7B 4BCQD 3JCMb 3FC3A 2F2XA 1YCYA 3NFCA 4E7HA 1R0CB 5C6SA 4C92G 1RAFB 1CSKA 2EPDA 1NM7A 4PLLA 4F04B 1BI3A 2LZ6B 5FLXE 2VUBA 2ZPIB 1G3TA 2CP3A 1VYVA 4CFWB 1AISB 2PU9B 3PIOA 2RI5A 3JCMe 2EYWA 3JCMV 4ZTJA 3SWNA 4IURA 3N5BB 3CC7Q 5CKHA 1WJQA 4J7FA 3GIBA 2SEMA 1T0JA 2PJQA 1U3OA 1SG5A 4OGRB 1VIEA 2RA2A 4HCCA 1FXXA 1OIYB 3FB9A 3POMA 4BCMB 4E7JA 4FT4A 3MEWA 2C6TB 4OGCA 4F7JB 2QAZA 4IKFA 1PC0A 2JM9A 4RTVA 2K7AA 2XI9A 4AFSC 4YC3B 3LWHA 3WXMB 1XNIA 2DD5B 3DB3A 5DLQE 3MEVA 4DOVA 2E5QA 1B34B 5LJ3e 1VQ7T 1MGQA 1GY3B 2CZ0B 2DVEA 3CBMA 3I56A 2FYKA 1M2VB 2GQVA 1G3WA 1VYUA 2O4XB 4L5GA 2JTEA 4BCGB 4GLMA 3VJPA 2QA4A 2QF7A 2QDYB 5GANd 2M0YA 1D3UB 2K5LA 4M7AF 2DXCA 4BDZA 1VQNA 4Z6YA 3X28B 2KRSA 1JKWA 2A36A 2L89A 4M7AB 3J81E 1OKWB 4ESRA 2DTOA 3OS1A 3V8LA 3L2VA 2IG0A 4CFXB 3OBYA 5KE2A 1JSTB 1C6VX 1PWTA 4B9XA 2DO3A 2CYZB 3DKMA 3MP8A 3GTMS 1X75C 5IXBA 2EVRA 2LJ1A 2M51A 3LX7A 1WQWA 1H3ZA 4PL6A 3QHRB 2JXBA 2B86A 4M7DE 2FEIA 4DBHA 1YI2T 2DVJA 2RQVA 3CCMA 4BI4A 4AMCA 2X4WA 1K8AC 4HKEA 4TTHA 2LRQA 3CCEQ 2BZ8A 3DL1A 3HHTB 4RKUE 5IDPB 4KRDB 2OX7A 4J8OA 3PGGA 4MDWA 3U23A 4M75C 1N27A 2Y4YA 3VYHB 4ORZA 1Q82R 4M77C 4R0KA 1PKSA 5I22A 2KROA 5GAOq 1VQMQ 2PK2A 4YOOA 2D0NA 2FHDA 4FW1A 4XK8E 2KT8A 2H3EB 2KE9A 1YJWA 1JXOA 3M9QA 2J6KA 1KD1R 2JT4A 3G4SQ 3CCLT 3PO3S 5HBJB 1QMZB 3TW6A 4EMKB 4JJNK 4DQ2A 3NPFA 4WCIA 4E7ZA 2KY9A 3OMGA 4MZPA 1QLYA 1H3HA 2LNHB 3SWNC 1ABOA 4HNTA 3DLMA 1SSFA 1YI2Q 2WSFE 2VGMA 3HPWA 1C9BA 4OB2B 5GMKm 2GNCA 1QVFS 1K73C 2LQNA 2EFIA 3LGFA 3OYEA 1SRLA 2RK1A 2XIDA 3GOXA 4M78A 5CYIB 1KQ1A 2CZ6B 1WNLA 2CP6A 2DXTA 2QYZA 1URCB 2I2LA 1M9SA 2DTIA 3CPWP 1MNEA 1YITQ 4F7SB 3CXCA 5L2WB 3HRUA 2BS2A 3FEOA 5I5ZB 2DKGA 5LMKB 3GBQA 2CJMB 1MUZA 2KI7A 3QYGB 4AFZC 4X9CA 3RR6A 1UHFA 1M1FA 1WI7A 3CCLQ 3BY7A 4N4GA 1K0XA 1U5SA 4IUTA 5I2MA 2MAMA 1K73U 2EJGA 2HSPA 2E4HA 1N8RC 3G33B 3EH1A 2XDPA 4FYXB 3VS7A 1WGSA 3HP9A 3MJXA 4NSTB 4KGXB 8AT1B 4BCQB 2MWOA 3HSBA 3EGXB 3TREA 5D6XA 3OA6A 4J9IA 1OU9A 2AT1B 3BDUA 3ER0A 3DTOA 4C0DC 1N9SA 1E6GA 1UGPB 4QVZA 1QP2A 3MCAB 4E47A 5CKBA 2KGTA 1QLBA 3HO8A 2RQRA 2HQHA 3BG3A 4CC7A 1UB4A 5GMKi 4XTXA 1BB9A 3CBOA 3CCUA 2X51A 4M7DG 1VOLA 1UDLA 1X6OA 4F7LB 2JNGA 1OOTA 2MI6A 3CMAA 2CZ1B 5FGKB 3QO3A 2LQWA 2WEVB 2NUTA 2K57A 1M90R 8ATCB 4EOPB 1OX9A 1PKDB 3LH0A 2V8KA 4XTWA 1C0MA 1ZHIA 4LUEA 4BCJB 3JRZA 5KYWA 5DQVA 4ZGEB 2E64A 1XOVA 3X24B 2CH4W 4PFPA 3EG3A 3VS0A 3KXTA 2QEXT 1FKMA 1OZ3A 4YOSA 1VQ9Q 2PVOB 3META 3EG9A 3JB9I 2XHCA 2CS7A
chains in the Genus database with same CATH topology
2EKOA 4HCBA 1I5LA 4WF2A 1KHIA 5GAN6 4C5HA 2C06A 4XU1A 3L2RA 1QP3A 2ZPHB 4NOYA 2RJFA 4LDWA 4BE2A 1G5VA 1W4SA 2KR6A 4M78C 1Q81C 4M75G 4BY6B 5GAOl 3L2UA 3G6ET 5FU7C 4BE0A 3G71A 3OYYA 4RCCA 2P0KA 2PQWA 3OB9A 1JB0E 3CD6A 3OYFA 5FU6C 3OY9A 4M77G 5IT9E 4KUDK 3EAEA 5GAMj 3VYGA 2DZCA 3S3MA 2RJEA 4P5NA 3I56T 2L5QA 4OB0B 3X26B 4OF1A 2R58A 1BI2A 2RO0A 2HNIA 3T9NA 5EJCA 1UGRB 3SD4A 2A7YA 3QYBA 2DIQA 2KAFA 5LL6S 2EYQA 1U1SA 3OYCA 3CPWS 4JRPA 3CC2A 1YBYA 3RERA 4MZTA 2QA4T 4BDYA 4M78E 1YHQT 3HRSA 2QQ8A 1NPRA 4EMKA 2DXCB 2XKOC 4CI0C 3PIPA 3CCST 3JCMd 4JS5A 4MZMA 3RKYA 2FB7A 5GANe 5GMKe 2ZPBB 4BD3A 2M16A 3OSSC 2AHJB 5A2QE 3M57A 2DEQA 2MMPA 5I2SA 4IUUA 3UWNA 2OTLT 4VUBA 4UC4A 1LOJA 2YLBA 4PJOF 1WJSA 1Q81U 1M90C 2O01E 1Q86U 1VQ8T 4Y28E 5FRMA 3PNWC 2RI2A 4E7IA 2RM4A 1O9SA 1RI0A 1VQOT 3WVDB 2JVVA 5GAN2 1W2BS 1VIFA 3KUFA 3NTIA 3JCMJ 3H4CA 4PJOB 3FRNA 5GAN4 3CCRT 3O8VA 4XTUA 4JRQA 5IN1A 5D6WA 2E10A 2YHTA 3J80E 1IREB 3BW1A 4FIBA 4FL6A 3JCMc 3CCET 2E6ZA 4AKIA 2E6NA 3RESA 5A0DA 2D9TA 4Z02A 2RI3A 3KBGA 3A8HB 3E9FA 3GNGA 4JLGA 4C0DB 3S3OA 2MWPA 1Y96A 5I21A 1YJNT 1YHQA 3V7CA 4QW2A 2DD5A 3L2ZA 3JB9J 4JLIA 4MDXA 2GFAA 3JB9F 1B34A 1WQ7A 3PT9A 3CCSA 5A0LA 4J5YA 3CMET 1VQKT 1VQPT 3PFSA 3ZEHA 3A8GB 3M54A 2VGNA 4A4EA 3JCMh 1VQMT 2MF2A 4M6VA 3OYMA 2ZCFB 4XU2A 2KVQG 1OZ2A 5GAN7 2R57A 4OB3B 5GAOp 3ZFJA 3P8DA 4N4HA 5GAMg 1M8VA 5KE3A 2K5IA 2O4XA 4J6WA 4KUIA 2E41A 1BKBA 3OMCA 3HFNA 4HLQA 3FLGA 3H8ZA 2M0OA 2KMGA 3G4ST 2DTHA 4C0ZA 1VQOA 4M7DA 3A8MB 3V7SA 4MFDA 4C92B 4V2SA 1M90U 3CCRA 4M7AC 5L8RE 4D6WA 2NLUA 5GAN5 3FIFA 3CPFA 3V8JA 3OS2A 2P4TA 1P92A 2VV5A 3L1AA 3LW5E 5DM7R 4ZN1A 3OSVA 4M7AA 2K2VA 1QW1A 2QQAA 3HBLA 2RJCA 1N8RU 4X34A 4YTLA 4PJOG 5CQYA 5CCAA 3L2WA 2X4XA 2V8JA 3CC7T 4QVDA 2OTJA 3HFOA 4JRKA 4HT9A 3VKGA 3QYEA 1UGQB 4JX6A 2LCLA 2QQ9A 1YJNA 1BYMA 3HKSA 2D0QB 2ZPFB 4II1A 4A4HA 5LJ3h 3QDRB 3TCJA 4NL3A 4M7AE 4LOCA 2WJ9A 5LJ5f 3CMEA 1NJIC 1Y07A 1VQPA 1VQKA 4M7DD 2E12A 4PNOA 2QDJA 4AKGA 5LJ5j 5GAN3 4XU0A 4EMGA 1VQLA 4Q5WA 4PJOD 1UGSB 2RJDA 2GCXA 4ELZC 4RG2A 5FRNA 4HA8A 4ZGJB 4HNUA 2ZZDA 2RHIA 2KMTA 4LD9K 2EWNA 2DXBB 1BI1A 3E9GA 4FT2A 1Y7XA 1R8OB 3G4SA 4JX5A 2Y90A 3S6WA 4A53A 3JCMP 1YITT 2DPPB 4C8QD 1UEBA 4M78F 4F7UE 5DY9A 4PJOE 1BIBA 3MEUA 3JB9G 1M1KU 4OP0A 3TU4K 2G77A 3ASKA 4M78B 4BUGA 2Y4XA 3VYGB 5FU7B 2LNVA 5CIUA 3JCMb 2XICA 3FC3A 5CQXA 3CC4T 4A4KA 2LT4A 1NE8A 1YCYA 3NFCA 1MHNA 3M58A 5FU6B 4B9WA 4O5VA 4JS4A 3CEYA 4E7HA 5C6SA 4C92G 3CC7A 1Q7YC 3LWIA 4PLLA 2EJ9A 4LDVA 1BI3A 3URGA 4C0GA 4ELJA 4ZTFA 4FM4B 2G3RA 2VUBA 5FLXE 3JCMX 2ZPIB 1JJ2A 1G3TA 3CBPA 3PTAA 3QJ6A 5GAMf 4HNVA 1QVGA 2PU9B 3PIOA 2FL7A 2RI5A 3GLXA 5KH6A 3OYIA 1KHCA 2E1HA 2F5KA 3JCMe 4C92D 4R56A 3S3NA 2QTXA 4N0AA 5LJ5d 2DK3A 4M75D 2K5FA 3JCMV 4NL2A 4ZTJA 4CRIA 4EMKC 5GANf 3SWNA 4IURA 1NPPA 3N5BB 4HCZA 2LQKA 1WJQA 2P0QA 4J7FA 3MP6A 5CKHA 5GANj 3GIBA 3VUBA 4M77D 2H3JA 4ME7A 3BG5A 3QHSA 1VIEA 2RA2A 2QEXA 4HCCA 1FXXA 3R6OA 3EFSA 3OYGA 3FB9A 4NC6A 1K9MC 4E7JA 4FT4A 1VQNT 3MEWA 4OGCA 2XDBA 2LDMA 5KCOA 5C0MA 4IKFA 1H641 1FX7A 4XTYA 3CC4A 3C95A 4E7KA 5LJ5g 1VUBA 1QVPA 2BS3A 3GP8A 2XI9A 4ELYC 3JCMW 2WACA 2YLCA 3RKWA 3LWHA 3WXMB 1XNIA 5CK9A 1PSFA 3G6EA 2DD5B 3DB3A 5DLQE 4M78G 3MEVA 4DOVA 1NZ9A 2E5QA 1B34B 2EQMA 3INZA 5LJ3e 4A4GA 3CCJT 1MGQA 2CZ0B 3CCQT 2IVWA 1VQ7T 3QYHB 2DVEA 3MEAA 3CBMA 3RMSA 3I56A 3QZ9B 2FYKA 2M1HA 2CZ7B 3QPHA 4PKCC 2QXFA 1I81A 3C4SA 1D3BB 2LVMA 4R55A 2HQXA 5GAMd 2GQVA 3CCVT 3DLLA 3GF5A 1G3WA 2O4XB 3EFRA 5GAOn 4L5GA 4LDXA 2QQRA 4BB7A 4LDUA 4JUVA 2GFUA 3JCMQ 3CCMT 3MP1A 3VJPA 2QA4A 3MHXA 2QF7A 4JDSA 1IZ6A 2QDYB 2DD4A 5GANd 2GF7A 3G7ZA 1KC8C 2K5LA 4M7AF 2DXCA 2XK0A 4BDZA 2QQSA 1VQNA 4Z6YA 3X28B 1BI0A 2R5MA 3H6ZA 2L89A 1U1TA 4M7AB 3J81E 3HL8A 1KD1C 2OTLA 4M7DC 2DZ9A 3E1SA 2DTOA 2RHZA 4AKHA 4MMLA 3VKHA 4X9DA 3V8LA 3OS1A 3L2VA 1VQ8A 2IG0A 3OBYA 2JOYA 1QVFA 4TVRA 4FU6A 5KE2A 2JZ2A 2KK4A 3A8LB 4AI6A 4B9XA 4F7UF 1RL2A 2CYZB 2DO3A 3DKMA 1BIAA 3MP8A 3FDRA 4BI8B 5GANg 3M55A 2EQKA 2K3XA 2PVGB 3CCJA 1VQ7A 1X75C 2QI2A 5D6YA 1VQ9T 4F7UB 3CCEA 1QVGS 3LX7A 1DJ7B 2F69A 1WQWA 1H3ZA 2LX9A 3VKIA 4JRIA 4PL6A 2VC8A 3PMIA 4NS5A 4M7DE 5EG2A 3CCVA 1YJWT 4C8QA 1KQ2A 4C0FA 1YI2T 3HB9A 1O75A 4J6XA 5GAMh 3CCMA 2EAYA 3OYBA 3CCUA 4BI4A 4OGEA 4MFEA 4L59A 1EIFA 4EDUA 2QQBA 3RUXA 1VQ4T 1VQ6T 4XTVA 2X4WA 1K8AC 4HKEA 4BBSM 1LNXA 3TEEA 2LCCA 2LRQA 3M53A 4QQ6A 1U8RA 2ZPEB 1VQMA 1JJ2S 1S72T 3DL1A 2BIVA 3LLRA 3HHTB 4J6YA 2R5AA 3VU3C 4RKUE 1KQSA 3QUIA 4LD6A 2RH2A 1OI1A 4J8OA 3PGGA 4MDWA 2BS4A 4M75C 1G3YA 1N27A 4BI3A 2Y4YA 3ZBDA 5CKDA 1N9RA 3JB9H 3VYHB 3BFMA 3BDLA 5CKFA 4C92A 5HKCA 4C5GA 3A8OB 3Q1JA 4M7AG 4M77C 4M75A 3DB4A 2WSCE 1VQ9A 1M5Q1 5GAOq 3PMTA 2FHDA 4O6JA 4HL4A 4XK8E 1I8FA 3OS5A 1FWZA 3SFMA 3HZJA 1V29B 4M77A 1YJWA 3M9QA 1YI2A 3QSUA 2X4YA 3MO8A 3JB9D 2RHXA 4QQGA 4XQ3A 3V8KA 3BG9A 3QWLA 3CCLT 3CC2T 4M75E 3FJPA 3E19A 3NTKA 1VQ4A 3TW6A 4EMKB 4F7UG 2X35A 5KCHA 4DQ2A 4N0AC 1LJOA 3OYHA 4JJNK 1VQ6A 3JAME 2KY9A 3OMGA 4MZPA 5CAIA 5IAYA 3OW2A 2JN0A 3SWNC 3X25B 4MMKA 4BE1A 1S72A 1YJ9T 3GNFB 2LQ8A 3SB2A 1NJIU 3TW7A 1ZBXA 3UT1A 4ZGDB 2RK2A 2YRVA 3QBYA 1Q86C 2FVUA 4JX4A 4HNTA 1SSFA 3DLMA 5J3BA 3P8HA 2WSFE 3RMQA 2VGMA 3HPWA 4KULA 4OB2B 1N6AA 5GMKj 2DXBA 4RMOA 2DAQA 5GMKm 1YITA 1QVFS 4BBRM 2E65A 2JTFA 1K73C 2EFIA 3LGFA 4BY6C 3QKJA 3OYEA 2RK1A 5J39A 2XIDA 3GOXA 3L2QA 4M78A 5CO7A 4Y91A 2JTMA 1KQ1A 1GXIE 2CZ6B 1WNLA 3QZ5B 2L8DA 5GMKl 2DXTA 5LJ3f 2I2LA 3V7RA 1M9SA 2DTIA 1Y96B 5LJ3j 4MIMA 1WJRA 2PVDB 4C5IA 5GAMe 3CCLA 4KBMB 3UDCA 5HK3A 2E70A 2X4JA 4N4IA 2LC4A 3CXCA 2ZPGB 2DD4B 1Q7YU 3HRUA 2LTOA 2BS2A 3FEOA 2KQWA 2RHUA 4EMHA 2DKGA 3HRTA 2V8IA 4J83A 1YJ9A 1PSEA 4HT8A 3P8BB 4PJOA 1XTDA 3QYGB 4M7DF 2ZGWA 4X9CA 4M78D 1KQSS 1JBMA 1I4K1 5LJ5h 5CR2A 1M1FA 2EIFA 2HQEA 4LDYA 3WVEB 4M7DB 3L42A 3RIRA 3LGLA 2PUOB 4DA4A 1Q82C 4QVCA 3OYJA 3BY7A 3OQ5A 4N4GA 2RD1A 2CGHA 5I2MA 4IUTA 3JCMg 1M1GA 2MAMA 2K4YA 3OYDA 3OYNA 1K73U 2CKKA 4C8QF 2EJGA 4GLKA 1WPYA 4XTZA 1N8RC 1VQ5T 4GY5A 1K9MU 3CCUT 4C8QB 2XDPA 4PJOC 3OYAA 3M4YA 2OAUA 2VXEA 1TH7A 1WGSA 3HP9A 3CMAT 2EQJA 5DLOA 3A5ZB 2OTJT 5LJ3d 2A3LA 3ME9A 1Y71A 3X20B 5GAN8 2MWOA 5GAOr 3CCQA 2HBPA 3RKXA 5FROA 3HSBA 2KSSA 2DXUA 4PLIA 5D6XA 3TREA 2RHYA 4C8QC 3OA6A 3AHUA 5HK0A 5J26A 2HD0A 3BDUA 3ER0A 3C94A 3OW2S 4C0DC 1VQLT 5AYFA 1N9SA 1ZQ1A 2B8AA 2ZZDB 2PUKB 2VXFA 1D3BA 4QQDA 1UGPB 1JRIA 2K3YA 4ZN3A 4QVZA 5M9OA 1QP2A 3MCAB 4E47A 3CPWA 1OYXA 5CKBA 5A0GA 3OBWA 4C92F 1QLBA 1M1KC 2LT1A 4OMFB 3HO8A 4M75F 3M56A 2XU8A 5LJ3g 3OYLA 4IUVA 3BG3A 2BUDA 3M4GA 1HK9A 1UB4A 4XU3A 3NTHA 4M75B 5GANh 3M59A 4C8QE 5GMKh 5GMKi 1G3SA 3I55T 3QG1A 4M77F 2XG8D 3UPUA 1YIJT 1Q82U 1M4ZA 2L3RA 3LYIA 4L6V5 4XTXA 1KC8U 1VQ5A 3CBOA 4OVAA 1KG1A 2RB6A 3JSCA 3QIIA 1HXDA 3QXEB 2WSEE 3QJYA 4M77B 4XAXB 5CVIA 1X6OA 2EQUA 2JNGA 5HY6A 4C92C 5CKEA 2MI6A 2EJFA 2VYTA 3SDZA 3CMAA 1KD1U 2D6FA 2CZ1B 3QO3A 3VUZA 4C5EA 1W2BA 2QFZA 4FSXA 2K57A 3C12A 3CXCS 4J7IA 2HAXA 4OB1B 1X01A 3G71T 4A54A 1XQHA 3OS0A 3J7AF 3CD6T 3LH0A 2V8KA 4RCBA 4XTWA 4C8QG 4F7UA 2DJZA 4IUQA 1ZHIA 4DOWA 4QSHA 4M7DG 4A4FA 4ATOA 1E7PA 2P0PA 3M5AA 3JRZA 4ZGEB 2E64A 2XDDA 3SWNB 3F70A 4E7LA 4C92E 4BACA 5LJ5e 2JUFA 2DIGA 3OYKA 1XOVA 3X24B 4KT0E 3JCMf 4M7AD 2KDSA 2F5TX 3GPLA 1AHJB 3KXTA 2QEXT 1FKMA 1OZ3A 4IUPA 2PVOB 3META 4M77E 4RG8A 4EPCA 5GAOm 3I55A 1YIJA 2BKDN 3KHIA 3JB9I 2M9UA 1K8AU 2XHCA 2CS7A 3VV0A 2XD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPG B;  2D0Q B;  2DD4 B;  2ZPF B;  1QP3 A;  2ZPH B;  1UGS B;  1PSE A;  3A8L B;  4ZGJ B;  2CYZ B;  3QYG B;  2ZZD A;  2PVG B;  2DXB B;  1JB0 E;  3WVE B;  1DJ7 B;  3VYG A;  2PUO B;  2DPP B;  4OB0 B;  3X26 B;  1UGR B;  3VYG B;  2DXC B;  2ZPE B;  2ZPB B;  2AHJ B;  3HHT B;  4FM4 B;  3X20 B;  2ZPI B;  4RKU E;  2O01 E;  2PU9 B;  4Y28 E;  3WVD B;  2ZZD B;  2PUK B;  3VYH B;  1UGP B;  3A8O B;  1QP2 A;  2WSC E;  1IRE B;  4XK8 E;  1V29 B;  3A8H B;  4L6V 5;  2DD5 A;  3QXE B;  2WSE E;  3A8G B;  2CZ1 B;  3X25 B;  1PSF A;  2DD5 B;  2ZCF B;  4ZGD B;  4OB3 B;  4OB1 B;  2WSF E;  2CZ0 B;  3QYH B;  4OB2 B;  2DXB A;  3QZ9 B;  2CZ7 B;  3A8M B;  4ZGE B;  5L8R E;  3X24 B;  4KT0 E;  3LW5 E;  1GXI E;  2CZ6 B;  3QZ5 B;  2QDY B;  2DD4 A;  1AHJ B;  2DXC A;  2PVO B;  2PVD B;  3X28 B;  1UGQ B; 
#chains in the Genus database with same CATH topology
 1PM3 A;  4HCB A;  2BPM B;  2CP7 A;  1KHI A;  3EGD A;  1ZLM A;  4EOR B;  2RJF A;  1RLQ C;  4M78 C;  4OMP A;  1VQ6 Q;  5GAO l;  1FMV A;  2AKK A;  2PQW A;  2P4R A;  4RTY A;  3OYF A;  4FYW B;  2FPF A;  3H0I A;  3OY9 A;  1S72 Q;  1KK7 A;  3ULR B;  2PNI A;  1RAD B;  4BY1 X;  5CEI B;  3MKD A;  2EYY A;  3T9N A;  2A7Y A;  2DIQ A;  3OYC A;  3CQT A;  3CPW S;  1U1S A;  2DL5 A;  1QCO A;  1PRL C;  1PKT A;  2QQ8 A;  4DEX A;  2XKO C;  4CI0 C;  3CCS T;  3JCM d;  2GQI A;  4M4Z A;  2FB7 A;  5GAN e;  2DYI A;  5GMK e;  3OSS C;  1UJY A;  3M57 A;  1K9A A;  2DEQ A;  2HKN A;  2MMP A;  3QDF A;  2OTL T;  2HZY A;  4UC4 A;  2YLB A;  2LJ3 A;  4OMO A;  3CC2 Q;  1VQ8 T;  3PNW C;  1W98 B;  2MOX A;  1W2B S;  1VQO T;  2JVV A;  5GAN 2;  2COY A;  4LN2 A;  1X2K A;  4RUG A;  3CCR T;  4K11 A;  3O8V A;  4XTU A;  3M0R A;  2C5N B;  4JRQ A;  5IN1 A;  3I5R A;  1EX4 A;  1X6G A;  2PTK A;  2KRN A;  3E9F A;  2I40 B;  2L0A A;  3K7A M;  3MY1 B;  1YHQ A;  1GCQ A;  2J06 A;  4QW2 A;  3JB9 J;  4MDX A;  1WQ7 A;  3PT9 A;  1MND A;  3CME T;  4D8K A;  1VQK T;  1UTI A;  1F1B B;  1ZBJ A;  1PD1 A;  3JCM h;  4M6V A;  3OYM A;  1D1A A;  4OB3 B;  5GAO p;  3ZFJ A;  5GAM g;  5IF1 B;  1M8V A;  2K5I A;  4HLQ A;  2EGE A;  2KMG A;  1YP5 A;  3A8M B;  2EGC A;  4MFD A;  3V7S A;  4C92 B;  1JOW A;  3CCS Q;  3QWX X;  4FX3 B;  5I11 A;  1P92 A;  1AWJ A;  3LW5 E;  5HQ0 B;  4ZN1 A;  1QW1 A;  2YRD A;  1WHL A;  2QQA A;  4ROE A;  2CP2 A;  4ROC A;  1D09 B;  5KYY A;  4QVD A;  1LCK A;  1QCN A;  3VKG A;  1VQO Q;  1UGQ B;  1YJN A;  1IGU A;  4ZNX A;  5LJ3 h;  1K4U S;  1NBE B;  2CSQ A;  5LJ5 f;  4M7D D;  4PNO A;  4XU0 A;  4PK4 A;  1UGS B;  2GCX A;  5FRN A;  1QKX A;  4HNU A;  1OEB A;  2JS0 A;  2EWN A;  2DXB B;  2OTJ Q;  2ECZ A;  1R8O B;  2RN8 A;  2Y90 A;  3S6W A;  2DPP B;  4F7U E;  5DY9 A;  2DEU A;  4OP0 A;  3CME Q;  1VQK Q;  2ESW A;  5KYU A;  2Y4X A;  2ABL A;  4RTX A;  4A4K A;  2LT4 A;  1NE8 A;  1WXB A;  2W10 A;  5FU6 B;  4O5V A;  4ROD A;  3TVT A;  1YN8 A;  1B3Q A;  3URG A;  4LDV A;  4C0G A;  4FM4 B;  2DX1 A;  1X69 A;  3VS3 A;  3QJ6 A;  2HL5 C;  3LH5 A;  1OPK A;  2GTJ A;  1RAE B;  2FL7 A;  1CKA A;  5KH6 A;  2DET A;  3D7S B;  3DJB A;  2QTX A;  1KJW A;  2DK3 A;  2K5F A;  2FZG B;  2P0Q A;  2F2C A;  1JO8 A;  1V1C A;  2B9R A;  2H3J A;  1ZP2 A;  3QHS A;  2QEX A;  1NEG A;  3R6O A;  3EFS A;  4FYY B;  1AT1 B;  1UHC A;  1K9M C;  2XDB A;  1VQN T;  4BCI B;  5KCO A;  1FX7 A;  3CC4 A;  5LJ5 g;  4EOQ B;  1BU1 A;  2BS3 A;  3GP8 A;  4I3Z B;  2WAC A;  3RKW A;  2Z0W A;  7AT1 B;  1FVV B;  1YCS B;  4A4G A;  3CCQ T;  2IVW A;  3VRZ A;  3MEA A;  3RMS A;  4PJJ A;  1TTH B;  3MY5 B;  1WX6 A;  2FZC B;  1I81 A;  2JMA A;  1GCQ C;  3DLL A;  3EFO A;  2YT6 A;  2QQR A;  4BB7 A;  1KFZ A;  4LDU A;  3CCM T;  2GFU A;  3M0T A;  2NUP A;  3MHX A;  1WYX A;  1IZ6 A;  1WHK A;  2GF7 A;  1KC8 C;  2QQS A;  1BI0 A;  3H6Z A;  1BCM A;  3I56 Q;  4DBQ A;  3HL8 A;  1KD1 C;  2OTL A;  4CFU D;  3FJ5 A;  1OX8 A;  4MML A;  2EYX A;  4AKH A;  4X9D A;  1VQ8 A;  1GH6 B;  1ZX6 A;  2JOY A;  4TVR A;  2QA4 Q;  2KK4 A;  3VS2 A;  3A8L B;  1RL2 A;  4PJO A;  2A08 A;  3FDR A;  3M55 A;  4RTZ A;  5D6Y A;  3H41 A;  1I0C A;  1VA7 A;  2V22 B;  2LX9 A;  3VKI A;  2VC8 A;  4NS5 A;  3VS5 A;  1YJW T;  4C8Q A;  2LCS A;  1OUL A;  4BCN B;  3OYB A;  4OGE A;  2W96 A;  4KRC B;  3RUX A;  1U06 A;  2V1R A;  4XTV A;  1FMW A;  4BBS M;  3TEE A;  1U8R A;  2LCC A;  3M53 A;  2BKZ B;  3QUI A;  2J6O A;  3CCM Q;  3BHV B;  1OI1 A;  2BS4 A;  5EC7 A;  5CKD A;  3JB9 H;  2X1N B;  3CXC P;  2GTO A;  4Z89 A;  5HKC A;  4C5G A;  4OMM A;  3UAT A;  2MPX C;  4M75 A;  4O6J A;  4HL4 A;  2AZS A;  4OML A;  2HEQ A;  1I8F A;  3OS5 A;  1FWZ A;  3HZJ A;  4M77 A;  1MMA A;  3MO8 A;  2RHX A;  4QQG A;  3BG9 A;  1D0Y A;  2FPE A;  3FJP A;  2LW4 A;  4M75 E;  1BCO A;  2NYS A;  4F7U G;  4PJN A;  2EBP A;  1PG5 B;  2YUQ A;  1RAA B;  4J9D A;  4BE1 A;  9ATC B;  1HYO A;  3LQ5 B;  1Z9Z A;  1WXU A;  1NJI U;  1ZBX A;  1Q86 C;  1YJW Q;  1MV0 B;  3QBY A;  3TN8 B;  2IPO B;  2QAS A;  3MPU B;  5J3B A;  2A0F B;  1JXM A;  4KUL A;  2GGR A;  2DMO A;  4BBR M;  2E65 A;  1RAC B;  2KXD A;  4F16 A;  2VWF A;  3KFV A;  3O5Z A;  3QZ5 B;  1SRM A;  3V7R A;  5LJ3 j;  1Y96 B;  3BHU B;  1WJR A;  4C5I A;  2OI3 A;  2UZE B;  4N4I A;  2KBT A;  4FYV B;  2DER A;  3H0H A;  4F14 A;  1PSE A;  4HT8 A;  4M7D F;  3QWY A;  4HVV A;  5CR2 A;  5HBE B;  4M7D B;  3L42 A;  3RIR A;  3LGL A;  2PUO B;  4DA4 A;  3OYJ A;  1QMC A;  5AT1 B;  1K1Z A;  3QHW B;  2CRE A;  1M1G A;  2K4Y A;  4GLK A;  2CP0 A;  2EYZ A;  4XTZ A;  4GY5 A;  3CCU T;  4PJO C;  4J9G A;  3CMA T;  5DLO A;  2IW6 B;  3G1J A;  3ME9 A;  3X20 B;  1K76 A;  2RQT A;  3CCQ A;  4C8Q C;  4CXA B;  3EGU A;  2K9G A;  5HK0 A;  6AT1 B;  5J26 A;  1UUE A;  1VQL T;  5AYF A;  1M8M A;  2B8A A;  2ZZD B;  1SF9 A;  2DLP A;  2VXF A;  1TUC A;  1M2V A;  4QQD A;  1H92 A;  1JRI A;  5M9O A;  5A0G A;  4J9C A;  1M1K C;  2V26 A;  2XU8 A;  3OYL A;  4DBR A;  1TU0 B;  2I0N A;  2BUD A;  2KT1 A;  1VQ7 Q;  1HK9 A;  5GAN h;  5GMK h;  1N5Z A;  1G3S A;  2DL4 A;  1GBR A;  3PVQ A;  1M4Z A;  2L3R A;  3LYI A;  1QVG P;  4L6V 5;  1VQ5 A;  2FO0 A;  4OVA A;  5HVY B;  4CC4 B;  3QII A;  3QJY A;  1WXT A;  5CVI A;  5CKE A;  2VYT A;  4BCO B;  2IVX A;  5L23 A;  1UNH D;  3CXC S;  1I07 A;  4J7I A;  4A54 A;  1XQH A;  2PMI B;  4RCB A;  1UG1 A;  4C8Q G;  2DJZ A;  4QSH A;  3CCU Q;  2P0P A;  4JZ4 A;  2XDD A;  2JUF A;  3CMA Q;  4KT0 E;  2F5T X;  4CC3 A;  1AHJ B;  4IUP A;  3I55 A;  2BKD N;  3KHI A;  1K8A U;  2M9U A;  2W2H A;  1Q81 C;  4BY6 B;  2XD0 A;  2ROL A;  5GAN 6;  4C5H A;  4XU1 A;  3L2R A;  1QP3 A;  2ZPH B;  4LDW A;  1G5V A;  3M03 A;  4M75 G;  4Y92 A;  4EIK A;  5FU7 C;  3L2U A;  3G6E T;  4BE0 A;  2DJQ A;  4CFU B;  1D0X A;  3OYY A;  4RCC A;  1JB0 E;  3CD6 A;  4M77 G;  5IT9 E;  4OB0 B;  4OF1 A;  2R58 A;  2RO0 A;  1UJ0 A;  5EJC A;  2E5K A;  5IXF A;  2YUP A;  3QYB A;  4JRP A;  2KAF A;  2PZ1 A;  1AOJ A;  3RER A;  4M78 E;  1YHQ T;  4EMK A;  2VVK A;  4MZM A;  3RKY A;  1UNG D;  4BD3 A;  2AHJ B;  1NJI R;  2HDA A;  4IUU A;  1BU2 A;  2J7I A;  4VUB A;  2BE7 D;  1RAG B;  2F2W A;  1WJS A;  1Q81 U;  2O01 E;  5FRM A;  4Y28 E;  3MIA B;  1O9S A;  1RI0 A;  1NG2 A;  2QG9 B;  3KUF A;  3NTI A;  3TNI B;  5D6W A;  2E10 A;  3BW1 A;  5A0D A;  1N4M A;  2MIO A;  4YOZ A;  3A8H B;  1KQS P;  1QQJ A;  1R77 A;  5BNJ B;  1YJN T;  4JLI A;  1F5Q B;  2JMC A;  1M27 C;  3ZEH A;  3M54 A;  2VGN A;  4A4E A;  1H27 B;  1GFC A;  1RAB B;  4EOS B;  1IRX A;  3DOG B;  5GAN 7;  2R57 A;  3P8D A;  4KUI A;  3OMC A;  3HFN A;  3REB B;  3H8Z A;  5IHK A;  1ZSZ B;  2YSQ A;  1ZUK A;  3EH2 A;  4C0Z A;  1BBZ A;  2NUT B;  1YHQ Q;  4M7A C;  2EKH A;  4KGZ B;  5L8R E;  3BLQ B;  2NLU A;  2IW8 B;  3V8J A;  2C5X B;  1X6B A;  2P4T A;  3L1A A;  4B6M A;  3OW2 P;  3OSV A;  1WHG A;  2RJC A;  1N8R U;  4BXX X;  4X34 A;  2JJ9 A;  4YTL A;  5CCA A;  2R7G A;  3L2W A;  1S1N A;  2V8J A;  4JX6 A;  2QQ9 A;  4KH0 B;  2ATC B;  3EG1 A;  3TCJ A;  3TSW A;  2L3P A;  4LOC A;  4E7S A;  5ECA A;  3EG9 B;  3EGX A;  2E12 A;  4AKG A;  3TNW B;  1VQL A;  4PJO D;  4IIO A;  4ELZ C;  2I53 A;  4ZGJ B;  1ZA1 B;  2RHI A;  4F17 A;  5IHN A;  1BI1 A;  3G4S A;  3JCM P;  1YJN Q;  4C8Q D;  1TS9 A;  1AZE A;  3TU4 K;  3ASK A;  1HD3 A;  2LNV A;  1ZA2 B;  2XIC A;  5CQX A;  3CC4 T;  3M58 A;  4B9W A;  2K6D A;  3VS6 A;  2ED1 A;  1Q7Y C;  2QDL A;  2EJ9 A;  4ELJ A;  1V76 A;  3JCM X;  2G3R A;  1JJ2 A;  3TQ7 P;  4OMN A;  3CBP A;  1NYG A;  3PTA A;  5GAM f;  4HNV A;  4LE9 A;  1QVG A;  1JEG A;  3GLX A;  3OYI A;  2E1H A;  2F5K A;  3S3N A;  2CT3 A;  4J9H A;  5LJ5 d;  4M75 D;  4NL2 A;  1RUW A;  4EMK C;  1GUX B;  1NPP A;  5GAN j;  1TXQ A;  2C0O A;  2LQK A;  3MP6 A;  3VUB A;  1G3N C;  4M77 D;  4ME7 A;  3BG5 A;  2DL7 A;  1OV3 A;  3OYG A;  4BY7 X;  4NC6 A;  1K8A R;  2LDM A;  5C0M A;  1C1A A;  3C0C A;  2KYM A;  1TUG B;  2QGG A;  2RQW A;  3C95 A;  1AWW A;  4EC9 B;  4E7K A;  1OGU B;  4E2F B;  2AK5 A;  4EOI B;  1QVP A;  2ED0 A;  4ELY C;  3JCM W;  2YLC A;  1PSF A;  2PHG A;  3G6E A;  2QEX Q;  4M78 G;  1NZ9 A;  2IN3 A;  2EQM A;  3INZ A;  2OJ2 A;  1SSH A;  1Q95 G;  3QZ9 B;  3BE3 A;  2CZ7 B;  3QPH A;  4PKC C;  2QXF A;  1D3B B;  2HQX A;  3TSZ A;  1UE9 A;  4J9F A;  3GF5 A;  5GAO n;  3JCM Q;  2YWW A;  4LUD A;  2DD4 A;  1RI9 A;  4Z8A A;  2R5M A;  3I5S A;  2D8H A;  3E1S A;  2G9X B;  3VKH A;  2DRM A;  5KYY B;  4FSS A;  1WHJ A;  4FU6 A;  2JZ2 A;  4AI6 A;  4KRT A;  4F7U F;  1K73 R;  2EQK A;  2NUZ A;  3CCJ A;  1ZUU A;  4F7U B;  2F69 A;  4JRI A;  2OTL Q;  3CCV A;  1NLP C;  2DBM A;  1VQ8 Q;  2KXC A;  2EAY A;  4MFE A;  4L59 A;  4EDU A;  3CCR Q;  1LNX A;  4QQ6 A;  2DYB A;  3VS1 A;  2DL8 A;  1AVZ C;  1J3T A;  1O9K A;  1KQS A;  4LD6 A;  1GRI A;  4BCH B;  1G3Y A;  2YRC A;  2BZX A;  3ZBD A;  4FCY A;  5CKF A;  1E7O A;  4C92 A;  2W99 A;  4CFV B;  4JJB A;  4KH1 B;  3Q1J A;  2WSC E;  1VQ9 A;  1M5Q 1;  3PMT A;  2FPD A;  1QKW A;  2VAS A;  1V29 B;  3QSU A;  3B57 A;  2X4Y A;  4XQ3 A;  3QWL A;  3TNH B;  3A1P A;  4EOO B;  1VQ4 A;  1VQ6 A;  3OYH A;  2X35 A;  1HSQ A;  2BE9 B;  1LJO A;  3M0S A;  2IIM A;  3JAM E;  4A63 B;  2L3Q A;  5CAI A;  3OW2 A;  4QT7 A;  2JN0 A;  1S72 A;  2C0I A;  2QGF B;  2LQ8 A;  3TW7 A;  3NDQ A;  3UT1 A;  2RK2 A;  2YRV A;  2FVU A;  3P8H A;  2X3X D;  1AD6 A;  3RMQ A;  1N6A A;  2DXB A;  2O9V A;  2DAQ A;  4EC8 B;  1ARK A;  2JTF A;  2CDT A;  3QKJ A;  5J39 A;  2D1X A;  3A98 A;  3L2Q A;  1M3B A;  5CO7 A;  4Y91 A;  4OR5 B;  5IHI A;  2F1L A;  5GMK l;  5LJ3 f;  1CKB A;  3HTR A;  4MIM A;  1AWO A;  5GAM e;  4KBM B;  4PFO A;  3UDC A;  5HK3 A;  2E70 A;  2X4J A;  1VIN A;  4IIM A;  5KYX B;  2RHU A;  2DA9 A;  3HRT A;  4BCK B;  2V8I A;  4J83 A;  1YJ9 A;  3P8B B;  1M3C A;  1OU8 A;  4II5 B;  1NEB A;  4WTO B;  2LP5 A;  4M78 D;  1I4K 1;  1GL5 A;  2HQE A;  2UZL B;  1JQQ A;  3NHN A;  1Q82 C;  1G8X A;  4JZ3 A;  3OQ5 A;  2CGH A;  3JCM g;  3OYN A;  4C8Q F;  2W0Z A;  2RF0 A;  2KR3 A;  1WPY A;  1UFF A;  1VQ5 T;  1K9M U;  4C8Q B;  2MCN A;  3UA7 A;  3M4Y A;  1TH7 A;  1H1R B;  3H9N A;  1B7T A;  4FW2 A;  2A3L A;  2C4G B;  1GBQ A;  1AWX A;  2HBP A;  3RKX A;  5FRO A;  1VQN Q;  3AHU A;  2HD0 A;  3C94 A;  5EFQ B;  1QWE A;  2LMJ A;  1ZQ1 A;  2PUK B;  5ICP B;  4D8D A;  4PJO E;  3OBW A;  2LT1 A;  4OMF B;  4M75 F;  3M56 A;  5LJ3 g;  2YUO A;  3CCQ Q;  5FWC A;  1PD0 A;  1SKU B;  1H8K A;  3NTH A;  4M75 B;  1WA7 A;  3I55 T;  4C8Q E;  1Q82 U;  3QG1 A;  4M77 F;  1ZUY A;  2UZB B;  1KC8 U;  5D7U A;  1H1P B;  4F6W B;  1RLP C;  2RB6 A;  1KG1 A;  4M77 B;  1HXD A;  3QXE B;  4XAX B;  2EQU A;  5HY6 A;  4C92 C;  2EJF A;  3SDZ A;  1KD1 U;  2QGS A;  2D6F A;  3VUZ A;  2KYB A;  3C12 A;  4F70 B;  2HAX A;  4OB1 B;  3OS0 A;  3J7A F;  3CD6 T;  2OAW A;  4DOW A;  1VQ5 Q;  1YWP A;  3M5A A;  2HSE B;  3SWN B;  5LJ5 e;  1SPK A;  2WPA B;  1W1F A;  3GPL A;  3UA6 A;  1PHT A;  1YFN A;  4M77 E;  1YIJ A;  5GAO m;  1ENW A;  3PE0 A;  2EKO A;  1I5L A;  1M30 A;  3IQL A;  4EON B;  2CT4 A;  4WF2 A;  2C06 A;  4EOK B;  3DDQ B;  1H4L D;  1W4S A;  3SHW A;  2KR6 A;  2FRY A;  3G71 A;  3I55 Q;  3OB9 A;  1Y0M A;  5FU6 C;  4CRL B;  3EAE A;  3VYG A;  2RJE A;  2L5Q A;  2HNI A;  1UGR B;  1OIU B;  1TUD A;  1HJD A;  1JSU B;  2EYQ A;  4AG1 C;  4CC2 A;  1YBY A;  2DM1 A;  1QVF P;  4RTT A;  1QCF A;  3HRS A;  4JJC A;  1NPR A;  3EHR A;  2G6F X;  2DXC B;  2DIL A;  4JS5 A;  2A37 A;  3CD6 Q;  3THK A;  5A2Q E;  4E6R A;  4JJD A;  3UWN A;  2KNB B;  4HVW A;  1LOJ A;  2RMO A;  1M90 C;  1Q86 U;  2RI2 A;  3R6N A;  2XMF A;  2RM4 A;  4E7I A;  3WVD B;  2E3H A;  3H4C A;  5GAN 4;  2FZK B;  3M0U A;  2YHT A;  1IRE B;  3EID B;  3CCE T;  2E6Z A;  2E6N A;  3RES A;  1X43 A;  2W9F A;  1WIE A;  2RI3 A;  2WHB B;  3KBG A;  4PJM A;  4C0D B;  2LJ0 A;  3S3O A;  1TFB A;  1VYW B;  1Y96 A;  2MWP A;  4DEY A;  1OI9 B;  3O0G D;  2DD5 A;  3L2Z A;  1B34 A;  5A0L A;  4J5Y A;  1PNJ A;  3A8G B;  4J9E A;  1D1C A;  2MK5 A;  1VQM T;  4HXJ A;  2ZCF B;  4XU2 A;  2KVQ G;  1OZ2 A;  1M3A A;  5KE3 A;  2O4X A;  4UN0 A;  1FYN A;  3FLG A;  1Z9Q A;  5IDN B;  1SEM A;  2M0O A;  3G4S T;  2COZ A;  2DTH A;  4M7D A;  4V2S A;  1JJ2 P;  5HNB B;  4HCK A;  1M90 U;  2E3I A;  1FIN B;  1NYF A;  2HL3 A;  2UUE B;  2DF6 A;  3FIF A;  3CPF A;  2COW A;  3OS2 A;  2UZD B;  1K9M R;  2NWM A;  4M7A A;  2K2V A;  1KSW A;  5KYN A;  1SHG A;  1WHM A;  1MMN A;  4PJO G;  5CQY A;  2WMA B;  1OL1 B;  4HT9 A;  4AFQ C;  2LCL A;  4G6L B;  2FG0 A;  2WIH B;  2D0Q B;  2ZPF B;  3SEM A;  4A4H A;  3VRY A;  1UNL D;  2AKL A;  4M7A E;  1D0Z A;  2DE0 X;  1Y07 A;  1VQP A;  5GAN 3;  4EMG A;  2KEA A;  4Q5W A;  2RJD A;  4RG2 A;  4HA8 A;  2ZZD A;  3E9G A;  1Y7X A;  2C5O B;  4A53 A;  1YIT T;  1WDX A;  2KRM A;  4M78 F;  5HBH B;  1BIB A;  3MEU A;  3JB9 G;  1M1K U;  4HVU A;  4JPB W;  1X2Q A;  4M78 B;  2IW9 B;  1VQL Q;  5CIU A;  5GJW B;  1KC8 R;  1MHN A;  4JS4 A;  2BZY A;  3CEY A;  2EQI A;  2CP5 A;  2HCK A;  1LVK A;  1WFW A;  3CC7 A;  1XO2 A;  1H1S B;  3LWI A;  2VKN A;  2DRK A;  4ZTF A;  2RQU A;  5ACB A;  4CFM B;  1OKV B;  2EGA A;  2GBQ A;  1KHC A;  4R56 A;  4C92 D;  4N0A A;  4J9B A;  2K2M A;  4CRI A;  5GAN f;  2CCI B;  4HCZ A;  1OPL A;  1H64 1;  4XTY A;  1RAH B;  1XJW B;  1VUB A;  3EG2 A;  4F6S B;  1MV3 A;  4LXC A;  4RTW A;  1EFN A;  5CK9 A;  3M0Q A;  1T3S A;  1IGQ A;  1AD5 A;  3CCJ T;  3QYH B;  1WHH A;  1GCP A;  4Y72 B;  2M1H A;  1R0B G;  4R55 A;  3C4S A;  2LVM A;  5GAM d;  3CCV T;  1H1Q B;  3EFR A;  2JS2 A;  4LDX A;  4JUV A;  3MP1 A;  3G6E Q;  5FWB A;  1W2B P;  4JDS A;  3G7Z A;  3NGP A;  1MMD A;  2XK0 A;  3JV3 A;  1U1T A;  4GBQ A;  2K79 A;  4M7D C;  5IHY A;  2DZ9 A;  2PK9 B;  4IMY B;  2RHZ A;  4BCP B;  1Q86 R;  4AT1 B;  1QVF A;  5GAN g;  1JJ2 S;  1BIA A;  1JU5 C;  4BI8 B;  2K3X A;  2PVG B;  1VQ7 A;  2QI2 A;  1VQ9 T;  3CCE A;  1QVG S;  1DJ7 B;  5KYW B;  3PMI A;  5EG2 A;  1KQ2 A;  4C0F A;  3HB9 A;  1O75 A;  4J6X A;  5GAM h;  1EIF A;  2QQB A;  1VQ4 T;  1VQ6 T;  5IH2 A;  4EOL B;  1VOM A;  3CCJ Q;  1W70 A;  2ZPE B;  1VQM A;  1S72 T;  2BIV A;  3LLR A;  3VS4 A;  2CCH B;  4J6Y A;  3CCV Q;  2R5A A;  3EGD B;  3VU3 C;  2O88 A;  2RH2 A;  1ZSZ A;  4BI3 A;  1N9R A;  3BFM A;  3BDL A;  1W6X A;  3A8O B;  4M7A G;  1QWF A;  1P5E B;  3DB4 A;  1WLP B;  2P84 A;  2WFY B;  2QTV A;  3SFM A;  1Y57 A;  1YI2 A;  3JB9 D;  1NLO C;  3V8K A;  3CC2 T;  3RDV A;  3E19 A;  1H24 B;  3NTK A;  5KCH A;  4N0A C;  2C0T A;  3REA B;  5IAY A;  1AZG B;  3X25 B;  4MMK A;  1YJ9 T;  4OMQ A;  3GNF B;  2CUB A;  3SB2 A;  4ZGD B;  4JX4 A;  5GMK j;  4RMO A;  1YIT A;  1WZO A;  1VQ4 Q;  1M1K R;  4RTU A;  4BY6 C;  1E9H B;  1KXU A;  4BCN D;  2ENM A;  2QK0 A;  2RPN A;  1H26 B;  1TWB A;  2JTM A;  1GXI E;  2L8D A;  1TD6 A;  3RBB B;  2PVD B;  3AT1 B;  3CCL A;  4AFU C;  2LC4 A;  2ZPG B;  2DD4 B;  1Q7Y U;  2LTO A;  2KQW A;  2DL3 A;  3NMZ C;  4EMH A;  5DQW A;  3CC4 Q;  3I35 A;  1YWO A;  1XTD A;  3E2U A;  4BCF B;  2ZGW A;  5HCK A;  1KQS S;  1JBM A;  5LJ5 h;  4Z88 A;  2EIF A;  1GUX A;  2DNU A;  1M2O A;  4LDY A;  3WVE B;  4QKU A;  2ROT A;  4QVC A;  5FW9 A;  1ACM B;  2RD1 A;  3OYD A;  2JW4 A;  1MMG A;  2CKK A;  1YJ9 Q;  2DFU A;  2L3S A;  4KGV B;  1Q81 R;  3OYA A;  2OAU A;  2VXE A;  4X1V A;  2EQJ A;  3A5Z B;  2OTJ T;  2O2O A;  5LJ3 d;  1Y71 A;  1K0S A;  5GAN 8;  5GAO r;  2FRW A;  2KSS A;  2DXU A;  2J05 A;  4PLI A;  2RHY A;  3OW2 S;  2X9H A;  1B07 A;  1X27 A;  1O9K B;  2M02 A;  4BCM D;  1D3B A;  2MYS A;  2K3Y A;  1UEC A;  4ZN3 A;  3CPW A;  1EZZ B;  2JM8 A;  1OYX A;  1TG0 A;  3F5X B;  4C92 F;  4F6U B;  1BK2 A;  2O9S A;  4IUV A;  3M4G A;  4XU3 A;  5KYU B;  3M59 A;  3RNJ A;  1YIJ T;  1A0N B;  3UPU A;  2XG8 D;  3JSC A;  1ZSZ C;  2WSE E;  1IXD A;  2BTT A;  2CUD A;  4DBF A;  1W2B A;  4C5E A;  2QFZ A;  4FSX A;  3I9Q A;  3MI9 B;  1OL2 B;  1X01 A;  3G71 T;  1SHF A;  4ELL A;  4F7U A;  4IUQ A;  1G83 A;  1IHW A;  1IO6 A;  4A4F A;  4ATO A;  1E7P A;  1TOV A;  1N8R R;  4E7L A;  3F70 A;  2EUF A;  4C92 E;  4BAC A;  4AG2 C;  2DIG A;  3OYK A;  2YXY A;  3JCM f;  2CH4 A;  1YNZ A;  2YUN A;  4M7A D;  2KDS A;  2RNA A;  3EOC B;  3BHT B;  2VB6 A;  1UGV A;  4EPC A;  4RG8 A;  3PIP A;  3VV0 A;  1LPL A;  3BLH B;  1VYT A;  2C5V B;  3H0F A;  4NOY A;  4BE2 A;  1IB8 A;  5LQF B;  3BLR B;  2WIP B;  2AIR B;  2P0K A;  2CSI A;  1YIJ Q;  3DDP B;  4F7N B;  2K3B A;  4KUD K;  2HBW A;  5GAM j;  4LNP A;  2DZC A;  3S3M A;  1TSF A;  4P5N A;  1G2B A;  3I56 T;  2WMB B;  3X26 B;  2EW3 A;  1BI2 A;  2SRC A;  3EFO B;  2L2P A;  3SD4 A;  2NUP B;  5LL6 S;  3CC2 A;  2WXV B;  4MZT A;  2QA4 T;  1ZSG A;  4BDY A;  2H8H A;  3G71 Q;  1I5O B;  1T3L A;  2ZPB B;  2M16 A;  4EOM B;  2F2V A;  2JGZ B;  3EG0 A;  5I2S A;  2A28 A;  1AEY A;  2V1Q A;  3UF4 A;  4PJO F;  1H25 B;  4PJO B;  1VIF A;  3JCM J;  2AZV A;  3FRN A;  2DBK A;  3J80 E;  3JCM c;  4FIB A;  4FL6 A;  4AKI A;  2HMA A;  2D9T A;  1PCX A;  4Z02 A;  4JLG A;  3GNG A;  2W9Z A;  3PVL A;  5I21 A;  3V7C A;  2J6F A;  1Q7Y R;  2X3W D;  2GFA A;  3JB9 F;  3CCS A;  2O31 A;  1VQP T;  3PFS A;  5KYX A;  3ZL7 C;  1KIK A;  4PFZ A;  2MF2 A;  3EHQ A;  4N4H A;  1E6H A;  4J6W A;  2E41 A;  1BKB A;  3M0P A;  1VQO A;  2LX7 A;  3CCR A;  4EOJ B;  4D6W A;  5GAN 5;  1IHV A;  2VV5 A;  5DM7 R;  1FMK A;  3HBL A;  4CFN B;  3CC7 T;  2X4X A;  1RAI B;  2OTJ A;  3HFO A;  4JRK A;  3QYE A;  1BYM A;  3HKS A;  2DME A;  4II1 A;  2YDL A;  3QDR B;  4NL3 A;  2HKQ B;  2WJ9 A;  3CME A;  1NJI C;  1VQK A;  1I1J A;  2QDJ A;  4ANJ A;  5LJ5 j;  5GJV B;  1T0H A;  2D8J A;  2KMT A;  4LD9 K;  1OQK A;  3EJ1 B;  1GFD A;  3RGF B;  4FT2 A;  4PJL A;  4JX5 A;  1D1B A;  1UEB A;  2ZAE A;  2G77 A;  1VQP Q;  1PRM C;  4BUG A;  3VYG B;  1ABQ A;  1H28 B;  5FU7 B;  4BCQ D;  3JCM b;  3FC3 A;  2F2X A;  1YCY A;  3NFC A;  4E7H A;  1R0C B;  5C6S A;  4C92 G;  1RAF B;  1CSK A;  2EPD A;  1NM7 A;  4PLL A;  4F04 B;  1BI3 A;  2LZ6 B;  5FLX E;  2VUB A;  2ZPI B;  1G3T A;  2CP3 A;  1VYV A;  4CFW B;  1AIS B;  2PU9 B;  3PIO A;  2RI5 A;  3JCM e;  2EYW A;  3JCM V;  4ZTJ A;  3SWN A;  4IUR A;  3N5B B;  3CC7 Q;  5CKH A;  1WJQ A;  4J7F A;  3GIB A;  2SEM A;  1T0J A;  2PJQ A;  1U3O A;  1SG5 A;  4OGR B;  1VIE A;  2RA2 A;  4HCC A;  1FXX A;  1OIY B;  3FB9 A;  3POM A;  4BCM B;  4E7J A;  4FT4 A;  3MEW A;  2C6T B;  4OGC A;  4F7J B;  2QAZ A;  4IKF A;  1PC0 A;  2JM9 A;  4RTV A;  2K7A A;  2XI9 A;  4AFS C;  4YC3 B;  3LWH A;  3WXM B;  1XNI A;  2DD5 B;  3DB3 A;  5DLQ E;  3MEV A;  4DOV A;  2E5Q A;  1B34 B;  5LJ3 e;  1VQ7 T;  1MGQ A;  1GY3 B;  2CZ0 B;  2DVE A;  3CBM A;  3I56 A;  2FYK A;  1M2V B;  2GQV A;  1G3W A;  1VYU A;  2O4X B;  4L5G A;  2JTE A;  4BCG B;  4GLM A;  3VJP A;  2QA4 A;  2QF7 A;  2QDY B;  5GAN d;  2M0Y A;  1D3U B;  2K5L A;  4M7A F;  2DXC A;  4BDZ A;  1VQN A;  4Z6Y A;  3X28 B;  2KRS A;  1JKW A;  2A36 A;  2L89 A;  4M7A B;  3J81 E;  1OKW B;  4ESR A;  2DTO A;  3OS1 A;  3V8L A;  3L2V A;  2IG0 A;  4CFX B;  3OBY A;  5KE2 A;  1JST B;  1C6V X;  1PWT A;  4B9X A;  2DO3 A;  2CYZ B;  3DKM A;  3MP8 A;  3GTM S;  1X75 C;  5IXB A;  2EVR A;  2LJ1 A;  2M51 A;  3LX7 A;  1WQW A;  1H3Z A;  4PL6 A;  3QHR B;  2JXB A;  2B86 A;  4M7D E;  2FEI A;  4DBH A;  1YI2 T;  2DVJ A;  2RQV A;  3CCM A;  4BI4 A;  4AMC A;  2X4W A;  1K8A C;  4HKE A;  4TTH A;  2LRQ A;  3CCE Q;  2BZ8 A;  3DL1 A;  3HHT B;  4RKU E;  5IDP B;  4KRD B;  2OX7 A;  4J8O A;  3PGG A;  4MDW A;  3U23 A;  4M75 C;  1N27 A;  2Y4Y A;  3VYH B;  4ORZ A;  1Q82 R;  4M77 C;  4R0K A;  1PKS A;  5I22 A;  2KRO A;  5GAO q;  1VQM Q;  2PK2 A;  4YOO A;  2D0N A;  2FHD A;  4FW1 A;  4XK8 E;  2KT8 A;  2H3E B;  2KE9 A;  1YJW A;  1JXO A;  3M9Q A;  2J6K A;  1KD1 R;  2JT4 A;  3G4S Q;  3CCL T;  3PO3 S;  5HBJ B;  1QMZ B;  3TW6 A;  4EMK B;  4JJN K;  4DQ2 A;  3NPF A;  4WCI A;  4E7Z A;  2KY9 A;  3OMG A;  4MZP A;  1QLY A;  1H3H A;  2LNH B;  3SWN C;  1ABO A;  4HNT A;  3DLM A;  1SSF A;  1YI2 Q;  2WSF E;  2VGM A;  3HPW A;  1C9B A;  4OB2 B;  5GMK m;  2GNC A;  1QVF S;  1K73 C;  2LQN A;  2EFI A;  3LGF A;  3OYE A;  1SRL A;  2RK1 A;  2XID A;  3GOX A;  4M78 A;  5CYI B;  1KQ1 A;  2CZ6 B;  1WNL A;  2CP6 A;  2DXT A;  2QYZ A;  1URC B;  2I2L A;  1M9S A;  2DTI A;  3CPW P;  1MNE A;  1YIT Q;  4F7S B;  3CXC A;  5L2W B;  3HRU A;  2BS2 A;  3FEO A;  5I5Z B;  2DKG A;  5LMK B;  3GBQ A;  2CJM B;  1MUZ A;  2KI7 A;  3QYG B;  4AFZ C;  4X9C A;  3RR6 A;  1UHF A;  1M1F A;  1WI7 A;  3CCL Q;  3BY7 A;  4N4G A;  1K0X A;  1U5S A;  4IUT A;  5I2M A;  2MAM A;  1K73 U;  2EJG A;  2HSP A;  2E4H A;  1N8R C;  3G33 B;  3EH1 A;  2XDP A;  4FYX B;  3VS7 A;  1WGS A;  3HP9 A;  3MJX A;  4NST B;  4KGX B;  8AT1 B;  4BCQ B;  2MWO A;  3HSB A;  3EGX B;  3TRE A;  5D6X A;  3OA6 A;  4J9I A;  1OU9 A;  2AT1 B;  3BDU A;  3ER0 A;  3DTO A;  4C0D C;  1N9S A;  1E6G A;  1UGP B;  4QVZ A;  1QP2 A;  3MCA B;  4E47 A;  5CKB A;  2KGT A;  1QLB A;  3HO8 A;  2RQR A;  2HQH A;  3BG3 A;  4CC7 A;  1UB4 A;  5GMK i;  4XTX A;  1BB9 A;  3CBO A;  3CCU A;  2X51 A;  4M7D G;  1VOL A;  1UDL A;  1X6O A;  4F7L B;  2JNG A;  1OOT A;  2MI6 A;  3CMA A;  2CZ1 B;  5FGK B;  3QO3 A;  2LQW A;  2WEV B;  2NUT A;  2K57 A;  1M90 R;  8ATC B;  4EOP B;  1OX9 A;  1PKD B;  3LH0 A;  2V8K A;  4XTW A;  1C0M A;  1ZHI A;  4LUE A;  4BCJ B;  3JRZ A;  5KYW A;  5DQV A;  4ZGE B;  2E64 A;  1XOV A;  3X24 B;  2CH4 W;  4PFP A;  3EG3 A;  3VS0 A;  3KXT A;  2QEX T;  1FKM A;  1OZ3 A;  4YOS A;  1VQ9 Q;  2PVO B;  3MET A;  3EG9 A;  3JB9 I;  2XHC A;  2CS7 A; 
#chains in the Genus database with same CATH homology
 2EKO A;  4HCB A;  1I5L A;  4WF2 A;  1KHI A;  5GAN 6;  4C5H A;  2C06 A;  4XU1 A;  3L2R A;  1QP3 A;  2ZPH B;  4NOY A;  2RJF A;  4LDW A;  4BE2 A;  1G5V A;  1W4S A;  2KR6 A;  4M78 C;  1Q81 C;  4M75 G;  4BY6 B;  5GAO l;  3L2U A;  3G6E T;  5FU7 C;  4BE0 A;  3G71 A;  3OYY A;  4RCC A;  2P0K A;  2PQW A;  3OB9 A;  1JB0 E;  3CD6 A;  3OYF A;  5FU6 C;  3OY9 A;  4M77 G;  5IT9 E;  4KUD K;  3EAE A;  5GAM j;  3VYG A;  2DZC A;  3S3M A;  2RJE A;  4P5N A;  3I56 T;  2L5Q A;  4OB0 B;  3X26 B;  4OF1 A;  2R58 A;  1BI2 A;  2RO0 A;  2HNI A;  3T9N A;  5EJC A;  1UGR B;  3SD4 A;  2A7Y A;  3QYB A;  2DIQ A;  2KAF A;  5LL6 S;  2EYQ A;  1U1S A;  3OYC A;  3CPW S;  4JRP A;  3CC2 A;  1YBY A;  3RER A;  4MZT A;  2QA4 T;  4BDY A;  4M78 E;  1YHQ T;  3HRS A;  2QQ8 A;  1NPR A;  4EMK A;  2DXC B;  2XKO C;  4CI0 C;  3PIP A;  3CCS T;  3JCM d;  4JS5 A;  4MZM A;  3RKY A;  2FB7 A;  5GAN e;  5GMK e;  2ZPB B;  4BD3 A;  2M16 A;  3OSS C;  2AHJ B;  5A2Q E;  3M57 A;  2DEQ A;  2MMP A;  5I2S A;  4IUU A;  3UWN A;  2OTL T;  4VUB A;  4UC4 A;  1LOJ A;  2YLB A;  4PJO F;  1WJS A;  1Q81 U;  1M90 C;  2O01 E;  1Q86 U;  1VQ8 T;  4Y28 E;  5FRM A;  3PNW C;  2RI2 A;  4E7I A;  2RM4 A;  1O9S A;  1RI0 A;  1VQO T;  3WVD B;  2JVV A;  5GAN 2;  1W2B S;  1VIF A;  3KUF A;  3NTI A;  3JCM J;  3H4C A;  4PJO B;  3FRN A;  5GAN 4;  3CCR T;  3O8V A;  4XTU A;  4JRQ A;  5IN1 A;  5D6W A;  2E10 A;  2YHT A;  3J80 E;  1IRE B;  3BW1 A;  4FIB A;  4FL6 A;  3JCM c;  3CCE T;  2E6Z A;  4AKI A;  2E6N A;  3RES A;  5A0D A;  2D9T A;  4Z02 A;  2RI3 A;  3KBG A;  3A8H B;  3E9F A;  3GNG A;  4JLG A;  4C0D B;  3S3O A;  2MWP A;  1Y96 A;  5I21 A;  1YJN T;  1YHQ A;  3V7C A;  4QW2 A;  2DD5 A;  3L2Z A;  3JB9 J;  4JLI A;  4MDX A;  2GFA A;  3JB9 F;  1B34 A;  1WQ7 A;  3PT9 A;  3CCS A;  5A0L A;  4J5Y A;  3CME T;  1VQK T;  1VQP T;  3PFS A;  3ZEH A;  3A8G B;  3M54 A;  2VGN A;  4A4E A;  3JCM h;  1VQM T;  2MF2 A;  4M6V A;  3OYM A;  2ZCF B;  4XU2 A;  2KVQ G;  1OZ2 A;  5GAN 7;  2R57 A;  4OB3 B;  5GAO p;  3ZFJ A;  3P8D A;  4N4H A;  5GAM g;  1M8V A;  5KE3 A;  2K5I A;  2O4X A;  4J6W A;  4KUI A;  2E41 A;  1BKB A;  3OMC A;  3HFN A;  4HLQ A;  3FLG A;  3H8Z A;  2M0O A;  2KMG A;  3G4S T;  2DTH A;  4C0Z A;  1VQO A;  4M7D A;  3A8M B;  3V7S A;  4MFD A;  4C92 B;  4V2S A;  1M90 U;  3CCR A;  4M7A C;  5L8R E;  4D6W A;  2NLU A;  5GAN 5;  3FIF A;  3CPF A;  3V8J A;  3OS2 A;  2P4T A;  1P92 A;  2VV5 A;  3L1A A;  3LW5 E;  5DM7 R;  4ZN1 A;  3OSV A;  4M7A A;  2K2V A;  1QW1 A;  2QQA A;  3HBL A;  2RJC A;  1N8R U;  4X34 A;  4YTL A;  4PJO G;  5CQY A;  5CCA A;  3L2W A;  2X4X A;  2V8J A;  3CC7 T;  4QVD A;  2OTJ A;  3HFO A;  4JRK A;  4HT9 A;  3VKG A;  3QYE A;  1UGQ B;  4JX6 A;  2LCL A;  2QQ9 A;  1YJN A;  1BYM A;  3HKS A;  2D0Q B;  2ZPF B;  4II1 A;  4A4H A;  5LJ3 h;  3QDR B;  3TCJ A;  4NL3 A;  4M7A E;  4LOC A;  2WJ9 A;  5LJ5 f;  3CME A;  1NJI C;  1Y07 A;  1VQP A;  1VQK A;  4M7D D;  2E12 A;  4PNO A;  2QDJ A;  4AKG A;  5LJ5 j;  5GAN 3;  4XU0 A;  4EMG A;  1VQL A;  4Q5W A;  4PJO D;  1UGS B;  2RJD A;  2GCX A;  4ELZ C;  4RG2 A;  5FRN A;  4HA8 A;  4ZGJ B;  4HNU A;  2ZZD A;  2RHI A;  2KMT A;  4LD9 K;  2EWN A;  2DXB B;  1BI1 A;  3E9G A;  4FT2 A;  1Y7X A;  1R8O B;  3G4S A;  4JX5 A;  2Y90 A;  3S6W A;  4A53 A;  3JCM P;  1YIT T;  2DPP B;  4C8Q D;  1UEB A;  4M78 F;  4F7U E;  5DY9 A;  4PJO E;  1BIB A;  3MEU A;  3JB9 G;  1M1K U;  4OP0 A;  3TU4 K;  2G77 A;  3ASK A;  4M78 B;  4BUG A;  2Y4X A;  3VYG B;  5FU7 B;  2LNV A;  5CIU A;  3JCM b;  2XIC A;  3FC3 A;  5CQX A;  3CC4 T;  4A4K A;  2LT4 A;  1NE8 A;  1YCY A;  3NFC A;  1MHN A;  3M58 A;  5FU6 B;  4B9W A;  4O5V A;  4JS4 A;  3CEY A;  4E7H A;  5C6S A;  4C92 G;  3CC7 A;  1Q7Y C;  3LWI A;  4PLL A;  2EJ9 A;  4LDV A;  1BI3 A;  3URG A;  4C0G A;  4ELJ A;  4ZTF A;  4FM4 B;  2G3R A;  2VUB A;  5FLX E;  3JCM X;  2ZPI B;  1JJ2 A;  1G3T A;  3CBP A;  3PTA A;  3QJ6 A;  5GAM f;  4HNV A;  1QVG A;  2PU9 B;  3PIO A;  2FL7 A;  2RI5 A;  3GLX A;  5KH6 A;  3OYI A;  1KHC A;  2E1H A;  2F5K A;  3JCM e;  4C92 D;  4R56 A;  3S3N A;  2QTX A;  4N0A A;  5LJ5 d;  2DK3 A;  4M75 D;  2K5F A;  3JCM V;  4NL2 A;  4ZTJ A;  4CRI A;  4EMK C;  5GAN f;  3SWN A;  4IUR A;  1NPP A;  3N5B B;  4HCZ A;  2LQK A;  1WJQ A;  2P0Q A;  4J7F A;  3MP6 A;  5CKH A;  5GAN j;  3GIB A;  3VUB A;  4M77 D;  2H3J A;  4ME7 A;  3BG5 A;  3QHS A;  1VIE A;  2RA2 A;  2QEX A;  4HCC A;  1FXX A;  3R6O A;  3EFS A;  3OYG A;  3FB9 A;  4NC6 A;  1K9M C;  4E7J A;  4FT4 A;  1VQN T;  3MEW A;  4OGC A;  2XDB A;  2LDM A;  5KCO A;  5C0M A;  4IKF A;  1H64 1;  1FX7 A;  4XTY A;  3CC4 A;  3C95 A;  4E7K A;  5LJ5 g;  1VUB A;  1QVP A;  2BS3 A;  3GP8 A;  2XI9 A;  4ELY C;  3JCM W;  2WAC A;  2YLC A;  3RKW A;  3LWH A;  3WXM B;  1XNI A;  5CK9 A;  1PSF A;  3G6E A;  2DD5 B;  3DB3 A;  5DLQ E;  4M78 G;  3MEV A;  4DOV A;  1NZ9 A;  2E5Q A;  1B34 B;  2EQM A;  3INZ A;  5LJ3 e;  4A4G A;  3CCJ T;  1MGQ A;  2CZ0 B;  3CCQ T;  2IVW A;  1VQ7 T;  3QYH B;  2DVE A;  3MEA A;  3CBM A;  3RMS A;  3I56 A;  3QZ9 B;  2FYK A;  2M1H A;  2CZ7 B;  3QPH A;  4PKC C;  2QXF A;  1I81 A;  3C4S A;  1D3B B;  2LVM A;  4R55 A;  2HQX A;  5GAM d;  2GQV A;  3CCV T;  3DLL A;  3GF5 A;  1G3W A;  2O4X B;  3EFR A;  5GAO n;  4L5G A;  4LDX A;  2QQR A;  4BB7 A;  4LDU A;  4JUV A;  2GFU A;  3JCM Q;  3CCM T;  3MP1 A;  3VJP A;  2QA4 A;  3MHX A;  2QF7 A;  4JDS A;  1IZ6 A;  2QDY B;  2DD4 A;  5GAN d;  2GF7 A;  3G7Z A;  1KC8 C;  2K5L A;  4M7A F;  2DXC A;  2XK0 A;  4BDZ A;  2QQS A;  1VQN A;  4Z6Y A;  3X28 B;  1BI0 A;  2R5M A;  3H6Z A;  2L89 A;  1U1T A;  4M7A B;  3J81 E;  3HL8 A;  1KD1 C;  2OTL A;  4M7D C;  2DZ9 A;  3E1S A;  2DTO A;  2RHZ A;  4AKH A;  4MML A;  3VKH A;  4X9D A;  3V8L A;  3OS1 A;  3L2V A;  1VQ8 A;  2IG0 A;  3OBY A;  2JOY A;  1QVF A;  4TVR A;  4FU6 A;  5KE2 A;  2JZ2 A;  2KK4 A;  3A8L B;  4AI6 A;  4B9X A;  4F7U F;  1RL2 A;  2CYZ B;  2DO3 A;  3DKM A;  1BIA A;  3MP8 A;  3FDR A;  4BI8 B;  5GAN g;  3M55 A;  2EQK A;  2K3X A;  2PVG B;  3CCJ A;  1VQ7 A;  1X75 C;  2QI2 A;  5D6Y A;  1VQ9 T;  4F7U B;  3CCE A;  1QVG S;  3LX7 A;  1DJ7 B;  2F69 A;  1WQW A;  1H3Z A;  2LX9 A;  3VKI A;  4JRI A;  4PL6 A;  2VC8 A;  3PMI A;  4NS5 A;  4M7D E;  5EG2 A;  3CCV A;  1YJW T;  4C8Q A;  1KQ2 A;  4C0F A;  1YI2 T;  3HB9 A;  1O75 A;  4J6X A;  5GAM h;  3CCM A;  2EAY A;  3OYB A;  3CCU A;  4BI4 A;  4OGE A;  4MFE A;  4L59 A;  1EIF A;  4EDU A;  2QQB A;  3RUX A;  1VQ4 T;  1VQ6 T;  4XTV A;  2X4W A;  1K8A C;  4HKE A;  4BBS M;  1LNX A;  3TEE A;  2LCC A;  2LRQ A;  3M53 A;  4QQ6 A;  1U8R A;  2ZPE B;  1VQM A;  1JJ2 S;  1S72 T;  3DL1 A;  2BIV A;  3LLR A;  3HHT B;  4J6Y A;  2R5A A;  3VU3 C;  4RKU E;  1KQS A;  3QUI A;  4LD6 A;  2RH2 A;  1OI1 A;  4J8O A;  3PGG A;  4MDW A;  2BS4 A;  4M75 C;  1G3Y A;  1N27 A;  4BI3 A;  2Y4Y A;  3ZBD A;  5CKD A;  1N9R A;  3JB9 H;  3VYH B;  3BFM A;  3BDL A;  5CKF A;  4C92 A;  5HKC A;  4C5G A;  3A8O B;  3Q1J A;  4M7A G;  4M77 C;  4M75 A;  3DB4 A;  2WSC E;  1VQ9 A;  1M5Q 1;  5GAO q;  3PMT A;  2FHD A;  4O6J A;  4HL4 A;  4XK8 E;  1I8F A;  3OS5 A;  1FWZ A;  3SFM A;  3HZJ A;  1V29 B;  4M77 A;  1YJW A;  3M9Q A;  1YI2 A;  3QSU A;  2X4Y A;  3MO8 A;  3JB9 D;  2RHX A;  4QQG A;  4XQ3 A;  3V8K A;  3BG9 A;  3QWL A;  3CCL T;  3CC2 T;  4M75 E;  3FJP A;  3E19 A;  3NTK A;  1VQ4 A;  3TW6 A;  4EMK B;  4F7U G;  2X35 A;  5KCH A;  4DQ2 A;  4N0A C;  1LJO A;  3OYH A;  4JJN K;  1VQ6 A;  3JAM E;  2KY9 A;  3OMG A;  4MZP A;  5CAI A;  5IAY A;  3OW2 A;  2JN0 A;  3SWN C;  3X25 B;  4MMK A;  4BE1 A;  1S72 A;  1YJ9 T;  3GNF B;  2LQ8 A;  3SB2 A;  1NJI U;  3TW7 A;  1ZBX A;  3UT1 A;  4ZGD B;  2RK2 A;  2YRV A;  3QBY A;  1Q86 C;  2FVU A;  4JX4 A;  4HNT A;  1SSF A;  3DLM A;  5J3B A;  3P8H A;  2WSF E;  3RMQ A;  2VGM A;  3HPW A;  4KUL A;  4OB2 B;  1N6A A;  5GMK j;  2DXB A;  4RMO A;  2DAQ A;  5GMK m;  1YIT A;  1QVF S;  4BBR M;  2E65 A;  2JTF A;  1K73 C;  2EFI A;  3LGF A;  4BY6 C;  3QKJ A;  3OYE A;  2RK1 A;  5J39 A;  2XID A;  3GOX A;  3L2Q A;  4M78 A;  5CO7 A;  4Y91 A;  2JTM A;  1KQ1 A;  1GXI E;  2CZ6 B;  1WNL A;  3QZ5 B;  2L8D A;  5GMK l;  2DXT A;  5LJ3 f;  2I2L A;  3V7R A;  1M9S A;  2DTI A;  1Y96 B;  5LJ3 j;  4MIM A;  1WJR A;  2PVD B;  4C5I A;  5GAM e;  3CCL A;  4KBM B;  3UDC A;  5HK3 A;  2E70 A;  2X4J A;  4N4I A;  2LC4 A;  3CXC A;  2ZPG B;  2DD4 B;  1Q7Y U;  3HRU A;  2LTO A;  2BS2 A;  3FEO A;  2KQW A;  2RHU A;  4EMH A;  2DKG A;  3HRT A;  2V8I A;  4J83 A;  1YJ9 A;  1PSE A;  4HT8 A;  3P8B B;  4PJO A;  1XTD A;  3QYG B;  4M7D F;  2ZGW A;  4X9C A;  4M78 D;  1KQS S;  1JBM A;  1I4K 1;  5LJ5 h;  5CR2 A;  1M1F A;  2EIF A;  2HQE A;  4LDY A;  3WVE B;  4M7D B;  3L42 A;  3RIR A;  3LGL A;  2PUO B;  4DA4 A;  1Q82 C;  4QVC A;  3OYJ A;  3BY7 A;  3OQ5 A;  4N4G A;  2RD1 A;  2CGH A;  5I2M A;  4IUT A;  3JCM g;  1M1G A;  2MAM A;  2K4Y A;  3OYD A;  3OYN A;  1K73 U;  2CKK A;  4C8Q F;  2EJG A;  4GLK A;  1WPY A;  4XTZ A;  1N8R C;  1VQ5 T;  4GY5 A;  1K9M U;  3CCU T;  4C8Q B;  2XDP A;  4PJO C;  3OYA A;  3M4Y A;  2OAU A;  2VXE A;  1TH7 A;  1WGS A;  3HP9 A;  3CMA T;  2EQJ A;  5DLO A;  3A5Z B;  2OTJ T;  5LJ3 d;  2A3L A;  3ME9 A;  1Y71 A;  3X20 B;  5GAN 8;  2MWO A;  5GAO r;  3CCQ A;  2HBP A;  3RKX A;  5FRO A;  3HSB A;  2KSS A;  2DXU A;  4PLI A;  5D6X A;  3TRE A;  2RHY A;  4C8Q C;  3OA6 A;  3AHU A;  5HK0 A;  5J26 A;  2HD0 A;  3BDU A;  3ER0 A;  3C94 A;  3OW2 S;  4C0D C;  1VQL T;  5AYF A;  1N9S A;  1ZQ1 A;  2B8A A;  2ZZD B;  2PUK B;  2VXF A;  1D3B A;  4QQD A;  1UGP B;  1JRI A;  2K3Y A;  4ZN3 A;  4QVZ A;  5M9O A;  1QP2 A;  3MCA B;  4E47 A;  3CPW A;  1OYX A;  5CKB A;  5A0G A;  3OBW A;  4C92 F;  1QLB A;  1M1K C;  2LT1 A;  4OMF B;  3HO8 A;  4M75 F;  3M56 A;  2XU8 A;  5LJ3 g;  3OYL A;  4IUV A;  3BG3 A;  2BUD A;  3M4G A;  1HK9 A;  1UB4 A;  4XU3 A;  3NTH A;  4M75 B;  5GAN h;  3M59 A;  4C8Q E;  5GMK h;  5GMK i;  1G3S A;  3I55 T;  3QG1 A;  4M77 F;  2XG8 D;  3UPU A;  1YIJ T;  1Q82 U;  1M4Z A;  2L3R A;  3LYI A;  4L6V 5;  4XTX A;  1KC8 U;  1VQ5 A;  3CBO A;  4OVA A;  1KG1 A;  2RB6 A;  3JSC A;  3QII A;  1HXD A;  3QXE B;  2WSE E;  3QJY A;  4M77 B;  4XAX B;  5CVI A;  1X6O A;  2EQU A;  2JNG A;  5HY6 A;  4C92 C;  5CKE A;  2MI6 A;  2EJF A;  2VYT A;  3SDZ A;  3CMA A;  1KD1 U;  2D6F A;  2CZ1 B;  3QO3 A;  3VUZ A;  4C5E A;  1W2B A;  2QFZ A;  4FSX A;  2K57 A;  3C12 A;  3CXC S;  4J7I A;  2HAX A;  4OB1 B;  1X01 A;  3G71 T;  4A54 A;  1XQH A;  3OS0 A;  3J7A F;  3CD6 T;  3LH0 A;  2V8K A;  4RCB A;  4XTW A;  4C8Q G;  4F7U A;  2DJZ A;  4IUQ A;  1ZHI A;  4DOW A;  4QSH A;  4M7D G;  4A4F A;  4ATO A;  1E7P A;  2P0P A;  3M5A A;  3JRZ A;  4ZGE B;  2E64 A;  2XDD A;  3SWN B;  3F70 A;  4E7L A;  4C92 E;  4BAC A;  5LJ5 e;  2JUF A;  2DIG A;  3OYK A;  1XOV A;  3X24 B;  4KT0 E;  3JCM f;  4M7A D;  2KDS A;  2F5T X;  3GPL A;  1AHJ B;  3KXT A;  2QEX T;  1FKM A;  1OZ3 A;  4IUP A;  2PVO B;  3MET A;  4M77 E;  4RG8 A;  4EPC A;  5GAO m;  3I55 A;  1YIJ A;  2BKD N;  3KHI A;  3JB9 I;  2M9U A;  1K8A U;  2XHC A;  2CS7 A;  3VV0 A;  2XD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...