2CYZB

Photo-activation state of fe-type nhase in anaerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase in anaerobic condition
rcsb
molecule tags Lyase
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cyzB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cyzB02
2CZ1B 4OB2B 4ZGJB 2CZ0B 3WVEB 2ZZDB 3A8MB 2DD5B 2CZ6B 3QXEB 2PUKB 4KT0E 3QYGB 4Y28E 2O01E 1DJ7B 1PSFA 2PVGB 2AHJB 1UGPB 3X24B 1IREB 2ZPBB 3LW5E 2ZPHB 2WSFE 3A8OB 2DXCA 1V29B 1UGRB 2ZZDA 2CZ7B 4RKUE 1QP2A 2DD5A 2D0QB 3HHTB 2DD4B 1AHJB 2ZPFB 1GXIE 1JB0E 1UGSB 1UGQB 4OB1B 2PU9B 2DPPB 3X25B 2PUOB 3X20B 3VYGB 3X28B 2DXBB 4OB3B 3QZ9B 1PSEA 2CYZB 5L8RE 4OB0B 2ZPEB 2ZPIB 2QDYB 2PVOB 3WVDB 2ZCFB 3QYHB 2DXCB 2DD4A 3A8LB 4ZGDB 2WSEE 3QZ5B 4XK8E 2ZPGB 4ZGEB 4L6V5 4FM4B 3A8HB 3X26B 1QP3A 2WSCE 2PVDB 3A8GB 3VYGA 2DXBA 3VYHB
chains in the Genus database with same CATH superfamily
1D3BB 5AT1B 3MP8A 4QSHA 4EOIB 1NPPA 1U1SA 3QSUA 4UN0A 3NGPA 1MNEA 1RAGB 1XTDA 1ZSGA 1TD6A 2JTEA 1KJWA 4HCZA 3CCVT 1QCNA 4FX3B 3RKXA 4M7DD 2CS7A 2RK2A 2RQUA 3G71T 1YNZA 1NE8A 1T0HA 3F70A 4DBHA 1WXUA 2IIMA 2RHUA 1UGVA 3CCUQ 3Q1JA 1OIUB 5GAMg 3OBWA 1Q7YC 3JCMV 3QYEA 3UATA 3S3MA 2XDPA 3QJYA 4JS4A 2FHDA 4EC9B 3KUFA 1V29B 3GOXA 1UGRB 2W96A 2I0NA 4ZN1A 3PIOA 2EW3A 2KNBB 2X4WA 3R6NA 2DX1A 2DD5A 2YUNA 4FL6A 4J9BA 2B9RA 3JCMQ 2QGFB 5GANe 3H6ZA 1HJDA 3E9GA 1GXIE 1F5QB 2DM1A 1IZ6A 1UHCA 2W9FA 4EMHA 1UGQB 3FJ5A 2QAZA 2HNIA 3J81E 2IPOB 4M78A 1T0JA 1BK2A 3QBYA 2PK9B 5GAN2 2KDSA 2RK1A 2MCNA 5CO7A 3CC2T 3VS5A 2E3HA 1UFFA 3NHNA 3H8ZA 4NL2A 2DA9A 4EPCA 2VVKA 1Q82U 4BBSM 2WMBB 1SEMA 4C8QE 2KT1A 2MAMA 1NJIR 2QQ8A 1I4K1 4IUPA 3BE3A 3GLXA 4XK8E 1TUCA 4L6V5 4J83A 2KEAA 3OYCA 4KULA 2ZGWA 3TNWB 3OBYA 4WTOB 3KHIA 4KH0B 2C5XB 1HD3A 3GIBA 4N4HA 2KYBA 1YJWA 5IF1B 3OYDA 3BDLA 2K57A 2HBPA 2F5KA 2BTTA 2W0ZA 2JMCA 3JCMX 2DD5B 5D7UA 4RTYA 5DM7R 2DAQA 3HBLA 4N0AA 4YTLA 4D8KA 3G6ET 2EKOA 3VJPA 3QDFA 1K9MU 1G3WA 1KC8C 1H1SB 2EVRA 4FCYA 1Q81U 2YXYA 5LJ5g 2NUPA 4C92F 2MK5A 4FW1A 1R0CB 4M78B 1NEGA 1JXOA 3V7RA 5J39A 2B86A 2KMGA 1ZSZA 2F2XA 2JZ2A 4WF2A 3GP8A 2DTIA 2BKZB 2CZ7B 2O4XA 3OSSC 4AT1B 3RERA 2LQ8A 3HFNA 2G3RA 4HNVA 2ED0A 2LRQA 4PJJA 2DNUA 4JRKA 1ABQA 1B34A 3DB4A 4ROEA 4C92C 1M1KC 1VQ7T 4EONB 1ZLMA 3CC7T 3P8HA 4MMLA 2RHIA 1YJWQ 4F6UB 2ABLA 2PK2A 4M75G 2E10A 4MZTA 1V1CA 5GANh 1K8AU 2VASA 1Y71A 3PNWC 3VV0A 2GNCA 2L2PA 4ZN3A 4RODA 3RESA 1Y57A 1YBYA 1X2KA 2XDDA 3A8LB 1SF9A 1PRLC 3A1PA 2ZPGB 2P0QA 1JBMA 4F7LB 2G6FX 3X26B 1AZEA 4XU1A 3VS4A 4QQ6A 4BCNB 4EOKB 3INZA 2VB6A 4JUVA 2V8IA 1G83A 2UZLB 2NUPB 4PJNA 3FC3A 1M5Q1 1YHQT 1YWOA 4MDWA 1Y07A 4J9GA 3JCMJ 4AKGA 3LWIA 1XOVA 1ZSZB 4QVCA 3I55A 3MI9B 5GAOl 2GF7A 4IKFA 4M77E 2RHYA 3DB3A 4II1A 2O4XB 2DMOA 4LD9K 2H8HA 2Z0WA 4DBRA 1WNLA 2RHZA 5GANg 2HQEA 3URGA 2VUBA 1E6GA 2DMEA 3CMAT 2O01E 2G77A 2QTXA 1C6VX 1VQMT 4C0DB 4C92D 1B34B 2PHGA 2WJ9A 4HA8A 5HK3A 1QCFA 2CT3A 3X24B 1GFCA 3H9NA 5GANd 5FWCA 4HCKA 4CI0C 1QKXA 5HKCA 2C5NB 2KVQG 2BS2A 1VQ9Q 2PMIB 1E7OA 4E7LA 1D3UB 2GCXA 3DTOA 1O75A 1VQ6T 4C8QF 4LDVA 5HNBB 1Q82R 4GY5A 1X6GA 4V2SA 4M78C 1SHFA 3VUZA 4J6YA 2LVMA 3OB9A 4PLIA 4X9DA 1JB0E 5ACBA 4YOSA 4M7AF 1KQ1A 5EJCA 1YITA 5CK9A 2COWA 2I2LA 1WHLA 2PU9B 4F6WB 2E3IA 1FMWA 2DL7A 2QDLA 2OTJA 2RI2A 4HNUA 4X1VA 3I55Q 2QQ9A 3M58A 3LWHA 4RCBA 4P5NA 2OTLT 4JRIA 2ZPEB 1ACMB 2XKOC 2K5IA 3SB2A 2DTHA 4CC2A 2LX9A 1I81A 4E47A 4M7AC 1G3SA 1K9MR 3CC4A 2YHTA 2O2OA 2CP7A 3HRTA 3NTKA 2QA4T 1YI2A 2ECZA 3VS7A 4OF1A 4XAXB 1Q81R 4M7DA 2KY9A 2L0AA 4BY6B 1WPYA 2VWFA 3RR6A 2X1NB 2FB7A 3CCST 1H4LD 4N0AC 3CCLQ 4CRLB 4HXJA 2QGSA 1M3AA 1UECA 3QDRB 4BY7X 3NTIA 2EQUA 5EFQB 3MEUA 3HKSA 4FYXB 4L5GA 1M1KR 1BI2A 1E6HA 3EHRA 4MZPA 3EIDB 5GMKi 1LNXA 3PTAA 4IIOA 4HT8A 2HL3A 3RBBB 1XO2A 1YITQ 1IHVA 3DOGB 1IRXA 2GTJA 4CFVB 3JB9I 4PFOA 4CRIA 1VQ8Q 2OTJQ 4BCMD 1W98B 4RTUA 4C92G 3UA7A 1UGPB 5KE3A 3M56A 3CBOA 4RG2A 2DXUA 1AD6A 1V76A 4C8QD 5HBEB 2WSFE 1MV0B 3RIRA 5FU7C 1K73U 5I11A 2ESWA 2DETA 1YJNT 2BIVA 1OPKA 4IMYB 1ZUKA 4ELLA 2DIGA 3JRZA 4EOPB 3PIPA 1VQPA 4JLIA 2R5AA 4M7AD 2NYSA 4RTTA 2EQIA 4IURA 2EJ9A 2JOYA 1VUBA 1YI2Q 1P92A 4EOMB 3SWNC 2HDAA 4QT7A 2DYIA 1QVPA 3OYKA 3TEEA 3JCMc 5IN1A 1BIBA 3PO3S 5IHYA 1AD5A 2FZKB 4M7DB 1X01A 3X25B 2ROLA 4X9CA 2JT4A 2EPDA 2GQVA 2YUQA 3JCMf 4MZMA 3MPUB 5IH2A 2K9GA 4J6WA 2LJ3A 5FROA 2JNGA 1BB9A 1GRIA 1PC0A 2HBWA 3LGFA 1K0XA 3S3NA 4CC3A 3CCUT 2CP5A 3CCJT 3QWLA 2IVXA 2DVEA 4EMKC 4RTXA 4BCPB 3A8HB 2QI2A 1KD1R 1KQSA 2VV5A 4AFZC 1WZOA 2XIDA 5LJ3j 3OS1A 1VQOT 1YN8A 2QK0A 3JCMb 3MEVA 4PK4A 2DBKA 2BPMB 1QWEA 2XU8A 4B9WA 1BI3A 2FRWA 1M2VA 2KMTA 2JMAA 3NTHA 1WXTA 5KCHA 1ZBXA 3EGDA 2WMAB 1VQPQ 2P4TA 3WVEB 1OZ3A 4KRCB 1PG5B 2P0KA 1UEBA 2DL8A 4L59A 1KQSS 1UNHD 4M78G 1SRMA 3M59A 3OYHA 3EH1A 8AT1B 5L23A 5CKEA 3HRSA 4RUGA 1D0XA 4K11A 3OYBA 2VGNA 3L2WA 2P84A 3VU3C 1OI9B 1TG0A 1BCOA 3CD6A 3M55A 5IAYA 2GTOA 4F6SB 3LYIA 2E6NA 5DLOA 1OEBA 1VQNT 4F7SB 2QTVA 2AZSA 2A3LA 2QEXQ 3MEAA 1MV3A 2VYTA 1QCOA 2QASA 2RI3A 1GBRA 1JEGA 1MGQA 4E7KA 5GAN8 4M7AG 3M0TA 2RO0A 3MP1A 5HY6A 1NJIC 5CQXA 1GCPA 1U06A 4E7IA 1YIJQ 3X20B 3G4ST 2YRDA 1M2VB 3LH0A 2Y90A 2VC8A 2CYZB 4Z88A 1N9RA 5GAMj 1Z9QA 4BB7A 1FMVA 3EGDB 1RAAB 2V1QA 1SPKA 5KE2A 4BCIB 4M7DC 2MWOA 1CSKA 4C5IA 3P8BB 1KQSP 2W9ZA 2Y4XA 1IGQA 4EORB 3O0GD 4YOZA 2X51A 3QHSA 2RQRA 4HCBA 4OMQA 2RD1A 3CD6Q 2H3JA 2HZYA 2X4XA 5CIUA 4E2FB 2YT6A 5LJ3f 5CEIB 5KYWA 4Z89A 5C6SA 4NL3A 2YRVA 3HB9A 5HK0A 1GY3B 4NOYA 1AZGB 2DXBA 3RKYA 1K73R 4C92A 4PFPA 2E6ZA 5GAMh 1VYVA 4A63B 1MMGA 4AKHA 3GTMS 4HKEA 3K7AM 2LMJA 3G7ZA 1Z9ZA 4BD3A 4CFUD 4EOQB 3RGFB 2LCCA 1FXXA 4X34A 4BACA 3H0HA 2DERA 1WQ7A 1WA7A 1VQKA 2VXEA 2AKLA 1E7PA 4JZ4A 3FB9A 4Y28E 3VKIA 1MMDA 3HSBA 4J5YA 3I9QA 2PVGB 2EBPA 1X69A 4RG8A 2DXTA 2LTOA 3BDUA 3EFOA 5FRNA 1N6AA 1U3OA 2KSSA 3LW5E 1OPLA 2MYSA 3CCET 4F7UG 4HVVA 3META 3BLQB 3OYGA 3QWYA 1PWTA 1RABB 2KI7A 4PJOF 1PHTA 2DFUA 2VXFA 2FRYA 1WJQA 2RJFA 2LP5A 1ARKA 2QQBA 1ZX6A 3CEYA 1HSQA 2LDMA 2KK4A 3EG9A 2EQKA 2XK0A 1LCKA 5KYWB 1GBQA 1S1NA 5GMKe 1I5OB 2K6DA 4BE0A 5GAMd 1RLQC 2DXBB 2NUTA 3SEMA 4Q5WA 1N4MA 4C92B 5A0LA 1H27B 5GAMf 3O8VA 1TH7A 1ZA1B 2L3PA 5LJ5j 4RCCA 4PJOC 2CJMB 2EGAA 3PGGA 4OMFB 1VQKQ 4HL4A 2DXCB 1JOWA 2X3XD 3EG1A 3ULRB 4FM4B 2P0PA 3GBQA 1VQ9T 4KBMB 2K3YA 2COYA 4R0KA 2D1XA 1OKWB 4JX4A 2E65A 3CXCP 1VA7A 1SSFA 3TNHB 3TW7A 5GAOm 3EFOB 2BZXA 5FW9A 3ZFJA 4ESRA 4BDYA 2I40B 5LJ5h 2EQMA 5IXBA 2V8JA 1EZZB 2RH2A 1OOTA 4C8QA 2CZ6B 1Q82C 1H3HA 2K7AA 3JSCA 2AT1B 4BE2A 4BCOB 3JB9J 2EAYA 5J26A 4KUIA 5CKBA 1DJ7B 5KYNA 3L2VA 1AEYA 3JB9H 4VUBA 3EG9B 3THKA 5A0GA 3CCQA 3QYBA 1YJ9A 2KRNA 2ENMA 4HCCA 4M7AA 4XU0A 2AZVA 1ABOA 2ZPBB 2E41A 1OULA 1MNDA 1ZHIA 2EYZA 2NUTB 3E1SA 2HD0A 4HT9A 5LMKB 4PJOD 1NYGA 1GUXA 3VS2A 1HK9A 4M7DG 3LGLA 3QUIA 1BU1A 4F17A 4WCIA 2B8AA 1H1PB 3CCLT 4CFXB 1I8FA 2VKNA 1TUGB 3CCMT 3VRZA 4JS5A 1WFWA 2WFYB 4C0ZA 2HCKA 4OB1B 3VS3A 1K9MC 3BHUB 5GANj 1QMCA 4BI4A 1Q81C 3NMZC 4OB3B 3CCVA 5LJ5d 2IN3A 2JGZB 3AT1B 1TWBA 3RUXA 3D7SB 4BCMB 1S72T 2AIRB 1CKAA 2DF6A 5LJ5f 1WDXA 3TVTA 1H3ZA 2EJGA 2GBQA 1VQ8T 1ZP2A 4GBQA 3QHWB 5HQ0B 2CSIA 2HMAA 4B9XA 4C8QB 4HLQA 3CCQQ 2MI6A 1R0BG 1YJ9Q 1H1RB 4AG2C 3MIAB 5CQYA 4C5EA 2HKNA 2WSCE 2YUOA 3MHXA 4FIBA 5GAOq 1OL2B 4A53A 2HQXA 4M7AB 3GPLA 3SWNA 4KGVB 2CUBA 3VUBA 2MF2A 4XTWA 1R77A 4J9FA 3LH5A 5I5ZB 4OB2B 2HSPA 1GUXB 1PKDB 2X9HA 4F7UA 1SSHA 1TXQA 3QYGB 3UA6A 3OYJA 2JM8A 1I5LA 2KROA 4MFEA 3EOCB 4JDSA 3HTRA 1TUDA 3CC2A 4KRDB 3RMSA 2YWWA 4EMKA 3CCVQ 2KAFA 1TU0B 5GAOp 2M1HA 2JN0A 4ME7A 2OI3A 1OX9A 5I22A 4Y91A 4A4GA 4C0GA 1TS9A 4QVZA 4PJOG 2JUFA 3RKWA 4HVWA 5FU7B 1KK7A 2DL5A 3CMEA 2ZPFB 1YWPA 1I1JA 2CSQA 2ATCB 2PTKA 2QQSA 3ER0A 2CP2A 5GANf 2G9XB 1KD1C 3SWNB 1UJYA 1N8RU 2WIPB 2V8KA 1N27A 4DA4A 2H3EB 4OMNA 1K4US 1D0ZA 2C5VB 3GNGA 2M0YA 4JJDA 2R58A 3VRYA 3G6EA 2AKKA 2ZCFB 2D6FA 3TNIB 2IG0A 3S6WA 4NC6A 5ICPB 3EG0A 4F7UB 1WLPB 1SG5A 4F7JB 1WJSA 1WI7A 3WXMB 1FX7A 2DILA 2RA2A 1SRLA 3CC2Q 1G3YA 4EOOB 2OAUA 2O9SA 2XHCA 3BHTB 1Q86U 2C5OB 3OYNA 2QEXT 2PVDB 4MMKA 4C8QC 4ELJA 2YUPA 4EMKB 2JTFA 3EFRA 3C12A 3V8JA 4OMPA 3ZL7C 2FG0A 1PNJA 3SHWA 4B6MA 3H41A 3CMEQ 1H8KA 1WX6A 4AFQC 4DEXA 1W6XA 4KT0E 1BKBA 5HBHB 2V26A 2WPAB 2CH4W 2KYMA 2FPEA 3OMGA 1TOVA 3CC7A 5KH6A 1YIJT 2UZEB 1VQ4A 5KYYA 2YSQA 1K1ZA 2AHJB 1PKSA 4J7IA 3OA6A 2D9TA 4OVAA 1PM3A 1SKUB 2BE9B 1UNLD 2JVVA 2PQWA 1TSFA 1RADB 4XU3A 3G6EQ 2RNAA 4YC3B 3OQ5A 4LN2A 2RQVA 5D6WA 2A36A 5FLXE 1WXBA 2DO3A 5FWBA 2DL4A 1AWOA 2XMFA 2CCHB 1RUWA 4QW2A 3M57A 3HHTB 2DL3A 1AHJB 4LUEA 3TSWA 1ZUYA 4BXXX 2LT4A 5LJ3e 1MMNA 1YHQA 4CFUB 2X4JA 3SD4A 2HKQB 1K8AR 2IW6B 2IW8B 2HEQA 4YOOA 1U1TA 2J7IA 4Z6YA 2DK3A 1M4ZA 3H0FA 3TREA 3M5AA 3CC4Q 4A54A 2FPDA 1K73C 1VQLT 2KE9A 3I56T 3CMAA 2LZ6B 3EHQA 1VQMA 3HO8A 2F2WA 1WHGA 3FLGA 5IHNA 1OGUB 3R6OA 1VQ4Q 4M75E 1Y96A 4A4EA 1IO6A 1T3SA 4FYVB 4DOWA 1QVGA 4PLLA 5KYYB 9ATCB 6AT1B 4ELYC 3DDQB 3VKHA 2J6OA 2W99A 4JX5A 3EG2A 2JTMA 2O9VA 2QQAA 3LLRA 3M0QA 1IB8A 1UDLA 4M77F 1RL2A 2WACA 1C1AA 1VQ6A 2PJQA 3NDQA 3VYGA 4IUQA 4BI8B 2KRMA 4PJMA 1E9HB 4M4ZA 4OGRB 1LOJA 2F2VA 1M8VA 3FRNA 4ANJA 1JJ2A 2EJFA 2RB6A 1QVGS 1VYWB 3GNFB 3JV3A 1ZA2B 1YHQQ 4BCQD 2DJZA 2UZDB 4PJOA 2VGMA 2EYXA 4M77C 5KYXA 2E1HA 2RI5A 1ZQ1A 4JJCA 2QQRA 1N8RR 4RMOA 2OTLA 1X75C 2CP6A 1IREB 4BY1X 4BCHB 1JJ2S 1QQJA 3CMAQ 2MPXC 4II5B 2OAWA 1VQMQ 1H92A 2DEUA 2ZZDA 1RI9A 4BI3A 3E19A 4AG1C 3KFVA 2QA4A 1FWZA 2D0QB 5HBJB 1KG1A 5CAIA 3AHUA 2BKDN 2K79A 4XTYA 1QKWA 3A5ZB 1JSUB 1Y96B 3M4GA 4E7HA 2DEQA 2C0TA 3CCSA 3UF4A 3OW2A 1Q86R 4FYWB 3EG3A 1UUEA 4N4GA 2ED1A 1VQ6Q 4JZ3A 2M0OA 2J6FA 4C8QG 3DL1A 4PKCC 5GAOr 2EKHA 3S3OA 1K0SA 3VYGB 3X28B 4CFWB 2MOXA 3QZ9B 4MFDA 2UUEB 2DTOA 2J06A 3M0SA 2L8DA 1NEBA 1VINA 3EJ1B 5I2SA 4HNTA 1BYMA 3TQ7P 4KRTA 3OW2S 1QVGP 2E70A 1WHMA 1BCMA 1Y7XA 2DZCA 2WSEE 1MHNA 4PFZA 4OMLA 3T9NA 4M77D 4PJOB 1UG1A 2A37A 1IHWA 2OTLQ 5KYXB 1I0CA 2HQHA 4LXCA 2EIFA 4FSSA 3KXTA 2QDJA 1M90U 1YJNA 1I07A 1JJ2P 1WHKA 2YDLA 3QHRB 2RN8A 2X3WD 2PNIA 4QVDA 1BI1A 2LQKA 2D0NA 1IXDA 2DJQA 2GFAA 2LC4A 2ZZDB 3L1AA 3A8MB 4KUDK 1QVFA 3OY9A 2RMOA 3FEOA 3QXEB 4Z02A 5EC7A 1KIKA 1H24B 4C0FA 5EG2A 4EDUA 5LJ3g 5GAN7 5LL6S 1VQ5A 4XQ3A 3UWNA 1TTHB 2E12A 1D1BA 1GFDA 4Z8AA 3BFMA 2F5TX 2FEIA 3CXCA 2XDBA 2L5QA 4F16A 3PVLA 2EGCA 2FYKA 4E7SA 1QVFS 1JXMA 1MUZA 1W70A 4JPBW 3VS0A 7AT1B 3CCJA 2BUDA 2DXCA 3V7SA 3I5SA 2BZYA 4M75F 4QQGA 5CKHA 4C92E 1YJWT 1WGSA 3OW2P 2KT8A 1YCSB 3DJBA 1B3QA 3ME9A 3LQ5B 1VQOA 4ATOA 3CXCS 2KGTA 2C4GB 1LVKA 1YP5A 1QWFA 1WHJA 1SHGA 4J9EA 3DDPB 1EIFA 2CH4A 4BCGB 4TVRA 5GAN6 1ZBJA 1ZUUA 2CKKA 1JRIA 4G6LB 5CVIA 1GH6B 2RJCA 1KHIA 5GMKm 4AMCA 3UT1A 1LJOA 2QYZA 2CDTA 2BS4A 1U8RA 5J3BA 4ROCA 2R57A 1H26B 2RF0A 2A08A 3OYMA 3POMA 4IUUA 4J7FA 3QZ5B 3RDVA 1VQ5Q 1FMKA 1Q7YU 4M77G 2KQWA 1J3TA 1VQNA 1U5SA 3IQLA 5FU6C 1K9AA 2KRSA 1AOJA 4FU6A 4OMOA 4RTZA 5A0DA 4EIKA 2LX7A 1OV3A 4IUTA 4LDYA 4EOLB 3CCJQ 3VYHB 1QVFP 5I2MA 2OJ2A 4ZNXA 1WYXA 2HSEB 2LT1A 3E2UA 3UDCA 1ENWA 2V1RA 3JB9F 2M51A 1F1BB 1FINB 1VQOQ 4ZTJA 3SDZA 3PE0A 2K2MA 2WIHB 1X6BA 2WXVB 5DY9A 3L2QA 1OYXA 1X6OA 3QWXX 1KXUA 1WIEA 3G4SA 1OQKA 1WQWA 2O88A 2K3XA 1BU2A 1B07A 1G3TA 3BW1A 2C0IA 4OR5B 3QG1A 4OGCA 1A0NB 1B7TA 2BZ8A 4M78E 3GF5A 4M75D 2DRKA 1VYUA 1AVZC 2CUDA 2K3BA 3A8OB 3HL8A 3QO3A 3OS0A 3ZEHA 3KBGA 2GGRA 1YFNA 4RKUE 4BDZA 1NPRA 1TFBA 4LOCA 3CPFA 3I55T 1FVVB 4FW2A 1VQNQ 4O5VA 3JCMP 1GL5A 4TTHA 2ROTA 1XNIA 1QMZB 4KH1B 3U23A 3C4SA 3MY1B 1M3BA 1M90R 3PFSA 4FSXA 4EOSB 3PT9A 4UC4A 3CMET 3L2RA 2L89A 4AFUC 1PD1A 5CCAA 3M0UA 4M7AE 5GMKj 3TU4K 1NM7A 3BY7A 5GJWB 1M27C 4F7NB 3HZJA 2YLBA 3WVDB 3QPHA 2QGGA 2DKGA 3C95A 3QYHB 2HL5C 2DD4A 3A98A 1GCQC 2DE0X 1X43A 1RACB 2FPFA 3CCRA 1KC8U 2AK5A 4OP0A 3G4SQ 2E64A 4C5GA 5KCOA 2X35A 1OL1B 3FIFA 3TW6A 1QP3A 3CCEA 1KFZA 3QKJA 3H0IA 1G2BA 1AT1B 1YITT 1D1AA 5CKDA 3JB9D 3G71A 4KGXB 5GMKh 2OTJT 5GMKl 3M0PA 3MCAB 1OU8A 2GQIA 1O9KA 4N4IA 4E7JA 3OYAA 2WHBB 4ORZA 2PUKB 4XTXA 2D8HA 2RJDA 1M3CA 1M1KU 5I21A 3ZBDA 2GFUA 2CGHA 1BI0A 2F69A 5CKFA 1VIFA 1JKWA 4IIMA 3CC4T 3EH2A 1G5VA 2CT4A 4QQDA 1KSWA 5D6XA 4D6WA 4DEYA 1K8AC 2O31A 4OMMA 1YI2T 3MY5B 2NUZA 1QLBA 5FRMA 2RQWA 1VQ4T 3EGUA 4Y92A 2KXCA 1H641 3OMCA 1VQ9A 3CCRQ 1XJWB 5KYUA 3TCJA 5GAOn 1H1QB 2DD4B 3UPUA 2A7YA 1H28B 1NLPC 3REAB 3QIIA 3CBPA 4E6RA 1Q7YR 3CCEQ 3JCMe 4F7UE 2A28A 4XTUA 1BBZA 4CXAB 1VOMA 2DPPB 2KR3A 1VIEA 3G71Q 2PUOB 1D1CA 2W2HA 1NYFA 4J9HA 4BCQB 1OX8A 4M77A 1UJ0A 3BHVB 1KHCA 1AWJA 4OB0B 3BG3A 5GAN3 3PVQA 3CBMA 2DIQA 4KGZB 3O5ZA 2QDYB 1UB4A 5CR2A 4HVUA 4NSTB 3OYIA 2EYQA 1O9KB 2MMPA 2KR6A 3CPWA 2FO0A 4BE1A 4ZGDB 2CREA 2FZCB 1MMAA 3NPFA 4FT4A 1RLPC 1M8MA 1VQPT 2L3SA 1PKTA 2NWMA 4M78F 3MP6A 2COZA 1Q95G 2EYYA 3A8GB 2Y4YA 2C0OA 4J9IA 1FYNA 4A4HA 1KD1U 2CP0A 3RNJA 1W4SA 1PRMC 3F5XB 1N8RC 2M02A 2W10A 2EFIA 2EQJA 4DBFA 3M53A 3JB9G 3CPWS 1K76A 3M4YA 2CZ1B 4F04B 1PCXA 1JSTB 1G3NC 1AWXA 1D0YA 2LNVA 2P4RA 3MJXA 3BLHB 4JJBA 3CCLA 3CCMA 5A2QE 5KYUB 3HPWA 3TN8B 1HYOA 3M54A 1M9SA 2CP3A 1N9SA 2K2VA 2EUFA 2M16A 1IGUA 3HP9A 5HVYB 3I35A 3RMQA 5IHIA 2A0FB 1OIYB 1S72A 4EC8B 1Q86C 2F2CA 2F1LA 5IT9E 2E4HA 4M77B 2JJ9A 2JM9A 3H4CA 5L2WB 1VQ8A 5IDNB 2XICA 2K5LA 4DOVA 2K4YA 1CKBA 1QLYA 4JLGA 2SRCA 1VQ7A 3N5BB 1R8OB 2DBMA 5BNJB 2L3QA 2MWPA 3JCMW 3NFCA 1KC8R 1YCYA 4R55A 1OZ2A 3VS1A 2RQTA 2D8JA 3I5RA 4AI6A 1RI0A 4M7DE 3J80E 3C0CA 3C94A 3CD6T 1PSEA 1NBEB 5L8RE 5GAN4 3JCMh 3CPWP 4RTWA 3DKMA 3CCMQ 2PVOB 5IXFA 1VOLA 2WEVB 3EGXA 2C06A 4ELZC 3OYYA 2IW9B 3P8DA 2UZBB 1URCB 4M78D 2LQNA 4ZGEB 1RAIB 1UHFA 3HFOA 2LNHB 4CC4B 1S72Q 3BG5A 8ATCB 1H25B 1ZSZC 3FJPA 3MEWA 1NLOC 4AKIA 3L2ZA 2XI9A 1JQQA 2EYWA 3TSZA 4QKUA 1VQ7Q 1OI1A 3CC7Q 4ZGJB 5IDPB 2CZ0B 1RAEB 4C0DC 4E7ZA 1C0MA 1C9BA 2DVJA 4M75A 4F14A 4F7UF 2FL7A 4I3ZB 1OU9A 3JCMg 4JX6A 2E5QA 1PSFA 1QW1A 1UTIA 4XTVA 4MIMA 4EOJB 3G33B 2CCIB 2PZ1A 3OS5A 1UNGD 3JCMd 2ZPHB 5GAN5 5D6YA 2R5MA 3G1JA 3M9QA 2LQWA 2DYBA 2YRCA 4J9CA 4A4KA 1VQ5T 4RTVA 1G8XA 2JS2A 5DQVA 1M1FA 1VYTA 4J9DA 3EGXB 4BCND 1BIAA 5DLQE 2QEXA 4DQ2A 4JJNK 1RAHB 5GJVB 5DQWA 1WJRA 2EGEA 3DLMA 4OGEA 4FT2A 2LCLA 1VQKT 2X4YA 3OYLA 4J8OA 3OSVA 5GAMe 4PJOE 2I53A 1W2BA 3B57A 2DLPA 4GLKA 2XG8D 1EX4A 4CFNB 3SFMA 1M30A 5M9OA 4A4FA 4JRQA 4LDWA 2JXBA 4LD6A 2BS3A 3VKGA 4LDUA 4AFSC 3PMIA 3REBB 1X2QA 1YIJA 2QF7A 5C0MA 3L2UA 4BCJB 2R7GA 2HAXA 1T3LA 1Y0MA 2RPNA 4M75B 3JAME 4BY6C 2SEMA 1W2BS 3L42A 2JS0A 2KBTA 4LE9A 1WHHA 5FGKB 4FYYB 5LJ3h 1W1FA 4NS5A 3MO8A 1RAFB 4JRPA 5FU6B 1UE9A 4M6VA 4LUDA 3FDRA 5ECAA 1JU5C 5IHKA 2K5FA 2NLUA 4BBRM 2IVWA 1NJIU 1XQHA 4M7DF 1OKVB 1HXDA 3M03A 1X27A 2RM4A 1GCQA 2YLCA 3OS2A 4Y72B 2LCSA 4PL6A 3ASKA 2DRMA 3OYFA 1EFNA 5LQFB 4LDXA 1PD0A 1P5EB 3V8KA 1VQLA 2QA4Q 4PJLA 3BG9A 3I56A 4MDXA 1M90C 1NG2A 2LW4A 2DZ9A 2MIOA 1D3BA 2XD0A 3CCSQ 2JW4A 4DBQA 2FVUA 1QP2A 2L3RA 4BCFB 3EAEA 3V7CA 2C6TB 1JO8A 4EMGA 1W2BP 1UGSB 1LPLA 5HCKA 2EWNA 2J6KA 4BUGA 2KXDA 3LX7A 5LJ3d 3EFSA 4GLMA 5LJ5e 3CCUA 1D09B 2RJEA 3MKDA 3CCQT 2M9UA 3PMTA 1AISB 4IUVA 2LJ0A 2ZAEA 1YJ9T 2LJ1A 3OYEA 3HRUA 2QFZA 4LNPA 1FKMA 2ZPIB 3J7AF 2E5KA 1KQ2A 3M0RA 4C5HA 1AWWA 3V8LA 4PNOA 2QXFA 2J05A 1M2OA 2BE7D 1N5ZA 4CC7A 4D8DA 3QJ6A 1M1GA 2FZGB 2V22B 1YJNQ 5AYFA 2QG9B 3BLRB 3DLLA 3CQTA 4F70B 4BCKB 4J6XA 1VQLQ 3I56Q 4XTZA 1NZ9A 4O6JA 4ZTFA 4M75C 4XU2A 3VS6A 2RHXA 3CCRT 2OX7A 1O9SA 4CFMB 3E9FA 4R56A 5CYIB
chains in the Genus database with same CATH topology
5KCHA 2OTJT 1D3BB 5GMKl 1ZBXA 3MP8A 4QSHA 1NPPA 3MCAB 1U1SA 2P4TA 3QSUA 3WVEB 3NTHA 1XTDA 1OZ3A 2P0KA 4HCZA 3CCVT 1UEBA 4N4IA 4L59A 3OYAA 4E7JA 1KQSS 3RKXA 4M78G 4M7DD 3M59A 3OYHA 3JB9H 2CS7A 2PUKB 2RK2A 4KT0E 1BKBA 4XTXA 5CKEA 3HRSA 3OMGA 2RJDA 3G71T 3CC7A 5KH6A 1NE8A 1YIJT 3F70A 1M1KU 5I21A 1VQ4A 3OYBA 2RHUA 2VGNA 2GFUA 3ZBDA 3L2WA 2CGHA 1BI0A 2F69A 3VU3C 3Q1JA 5CKFA 1VIFA 2AHJB 5GAMg 3OBWA 4J7IA 3OA6A 2D9TA 3M55A 4OVAA 5IAYA 3CC4T 1Q7YC 3CD6A 3JCMV 1G5VA 3LYIA 4QQDA 5D6XA 2JVVA 3QYEA 2PQWA 2E6NA 4D6WA 5DLOA 3S3MA 2XDPA 1YI2T 1K8AC 3QJYA 4JS4A 1VQNT 1QLBA 5FRMA 2FHDA 4XU3A 3OQ5A 2A3LA 5D6WA 1VQ4T 3KUFA 5FLXE 3MEAA 1V29B 3GOXA 1UGRB 4ZN1A 3PIOA 2DO3A 2X4WA 2VYTA 1H641 2DD5A 3OMCA 1VQ9A 4QW2A 3M57A 2RI3A 4FL6A 3HHTB 3TCJA 5GAOn 2DD4B 3UPUA 2A7YA 1MGQA 4E7KA 3QIIA 3JCMQ 1AHJB 5GAN8 4M7AG 5GANe 3CBPA 3H6ZA 3E9GA 1GXIE 2LT4A 1IZ6A 3JCMe 2RO0A 5LJ3e 3MP1A 5HY6A 4F7UE 1YHQA 2X4JA 1UGQB 4XTUA 3SD4A 4EMHA 1NJIC 5CQXA 2DPPB 1U1TA 2HNIA 3J81E 4E7IA 1VIEA 2PUOB 4Z6YA 4M78A 3X20B 4M77A 3G4ST 3QBYA 5GAN2 2DK3A 2KDSA 2RK1A 3LH0A 2Y90A 5CO7A 2VC8A 1M4ZA 2CYZB 3CC2T 1N9RA 5GAMj 1KHCA 4OB0B 3TREA 3BG3A 3M5AA 4BB7A 3CBMA 5GAN3 2DIQA 3H8ZA 4NL2A 4A54A 2QDYB 1UB4A 5CR2A 1K73C 5KE2A 4EPCA 3OYIA 1VQLT 4M7DC 2MWOA 3I56T 2EYQA 4C5IA 3CMAA 1Q82U 3P8BB 2MMPA 1VQMA 4BBSM 3HO8A 2KR6A 2Y4XA 3CPWA 3FLGA 4C8QE 4BE1A 4ZGDB 2MAMA 3R6OA 2QQ8A 1I4K1 4IUPA 4M75E 1Y96A 4A4EA 3GLXA 4XK8E 4L6V5 4J83A 3QHSA 4FT4A 4HCBA 2RD1A 1VQPT 2H3JA 2X4XA 4DOWA 4PLLA 5CIUA 4KULA 3OYCA 2ZGWA 1QVGA 4ELYC 5LJ3f 3OBYA 3VKHA 4JX5A 4M78F 2JTMA 2QQAA 3MP6A 3LLRA 4M77F 3A8GB 1RL2A 2Y4YA 5C6SA 3KHIA 2WACA 4NL3A 4A4HA 1KD1U 2YRVA 3HB9A 5HK0A 1VQ6A 3VYGA 4IUQA 4BI8B 3GIBA 1W4SA 4N4HA 4NOYA 2DXBA 3RKYA 1N8RC 4C92A 1YJWA 2EFIA 2EQJA 3OYDA 3M53A 2E6ZA 5GAMh 3JB9G 3CPWS 3BDLA 2K57A 1LOJA 3M4YA 2CZ1B 2HBPA 4AKHA 4HKEA 2F5KA 3L2VA 1M8VA 3JCMX 3FRNA 3G7ZA 4BD3A 2EJFA 2LNVA 1JJ2A 2LCCA 1FXXA 2DD5B 2RB6A 3CCLA 3CCMA 5DM7R 5A2QE 2DAQA 1QVGS 4X34A 4BACA 1WQ7A 3HPWA 3HBLA 3GNFB 3M54A 4N0AA 2VXEA 4YTLA 3G6ET 1E7PA 1VQKA 1M9SA 2DJZA 2EKOA 3FB9A 4PJOA 3VJPA 1N9SA 2K2VA 4Y28E 3VKIA 2VGMA 1N8RU 1K9MU 3HSBA 4J5YA 2M16A 1G3WA 4M77C 3HP9A 1KC8C 2PVGB 3RMQA 2E1HA 2RI5A 1ZQ1A 2QQRA 1Q81U 4RG8A 2DXTA 2LTOA 1X75C 3BDUA 5LJ5g 4RMOA 4C92F 1IREB 1S72A 2OTLA 1Q86C 5FRNA 1N6AA 4M78B 2KSSA 5IT9E 3LW5E 3V7RA 4M77B 1JJ2S 3CCET 3H4CA 5J39A 1VQ8A 2KMGA 4F7UG 2XICA 2K5LA 3META 4DOVA 2K4YA 2JZ2A 4WF2A 4JLGA 2ZZDA 2DTIA 3GP8A 1VQ7A 2O4XA 2CZ7B 1R8OB 3N5BB 3OSSC 4BI3A 3OYGA 3E19A 2QA4A 1FWZA 2D0QB 2MWPA 4PJOF 3JCMW 3RERA 1KG1A 5CAIA 2LQ8A 3NFCA 3HFNA 2VXFA 1YCYA 2G3RA 3AHUA 1WJQA 2BKDN 2RJFA 4XTYA 4HNVA 2LRQA 1Y96B 3A5ZB 3M4GA 4R55A 2QQBA 4E7HA 1OZ2A 2DEQA 3CEYA 2LDMA 4JRKA 2KK4A 1B34A 3DB4A 3CCSA 3OW2A 2EQKA 2XK0A 4C92C 1M1KC 4KUDK 4N4GA 1VQ7T 3CC7T 3P8HA 2M0OA 4MMLA 5GMKe 4AI6A 1RI0A 4C8QG 4M7DE 2RHIA 3DL1A 4PKCC 5GAOr 4M75G 3S3OA 4BE0A 2E10A 5GAMd 3VYGB 3X28B 3J80E 4MZTA 5GANh 2DXBB 1K8AU 3C94A 4Q5WA 4C92B 1Y71A 3QZ9B 4MFDA 1PSEA 5A0LA 3PNWC 2DTOA 5L8RE 5GAMf 3O8VA 3JCMh 1TH7A 3VV0A 5GAN4 3DKMA 5LJ5j 4RCCA 2PVOB 2L8DA 4PJOC 4ZN3A 5I2SA 4HNTA 3RESA 3PGGA 4OMFB 1BYMA 1YBYA 2XDDA 2C06A 4ELZC 3OW2S 4HL4A 2E70A 2DXCB 3OYYA 3A8LB 1Y7XA 2DZCA 2WSEE 3P8DA 4M78D 2ZPGB 1MHNA 4ZGEB 1JBMA 2P0QA 4FM4B 2P0PA 4PJOB 3HFOA 4M77D 3T9NA 3CMAT 1VQ9T 4KBMB 2K3YA 3BG5A 3X26B 4XU1A 4JX4A 2EIFA 3INZA 4QQ6A 2E65A 3FJPA 3KXTA 3MEWA 4JUVA 1SSFA 2V8IA 3TW7A 5GAOm 4AKIA 3L2ZA 2QDJA 2XI9A 1M5Q1 3FC3A 3JB9J 1YHQT 1YJNA 1M90U 4MDWA 1Y07A 3JCMJ 4AKGA 3ZFJA 3LWIA 1XOVA 4BDYA 4QVCA 4QVDA 1OI1A 3I55A 1BI1A 5LJ5h 4ZGJB 2LQKA 2CZ0B 2GF7A 5GAOl 4IKFA 2EQMA 2GFAA 4M77E 2LC4A 2ZZDB 3L1AA 3A8MB 2RHYA 2V8JA 3DB3A 2O4XB 4II1A 4C0DC 4LD9K 1QVFA 2RH2A 3OY9A 4C8QA 2CZ6B 3FEOA 3QXEB 4Z02A 1WNLA 4M75A 2RHZA 4F7UF 1Q82C 3JSCA 5GANg 2FL7A 2HQEA 4BE2A 3URGA 4C0FA 2VUBA 5EG2A 4EDUA 3JCMg 4JX6A 2EAYA 2O01E 2G77A 5J26A 2QTXA 4KUIA 1DJ7B 1PSFA 2E5QA 1QW1A 5CKBA 4C0DB 4C92D 5GAN7 5LL6S 1B34B 4VUBA 3CCQA 5A0GA 1VQ5A 4XTVA 4XQ3A 2WJ9A 3UWNA 4MIMA 4HA8A 2E12A 3QYBA 1YJ9A 5HK3A 4HCCA 4M7AA 3OS5A 3X24B 4XU0A 5GANd 3BFMA 2F5TX 2ZPBB 4CI0C 5HKCA 2E41A 3CXCA 2KVQG 2L5QA 2XDBA 2BS2A 3JCMd 2ZPHB 1ZHIA 2FYKA 4E7LA 5GAN5 1QVFS 5D6YA 2GCXA 3E1SA 2HD0A 2R5MA 4HT9A 3M9QA 4PJOD 4A4KA 3CCJA 1O75A 2BUDA 2DXCA 3V7SA 1VQ5T 4C8QF 4LDVA 1VQ6T 4GY5A 1HK9A 4M75F 3LGLA 4M7DG 4QQGA 1M1FA 5CKHA 4C92E 1WGSA 1YJWT 4V2SA 3QUIA 4M78C 1BIAA 3VUZA 5DLQE 4J6YA 2B8AA 2LVMA 3OB9A 3ME9A 4PLIA 4X9DA 4DQ2A 2QEXA 1JB0E 4JJNK 1VQOA 4ATOA 3CCLT 1I8FA 1WJRA 3CXCS 3CCMT 3DLMA 1KQ1A 4JS5A 4M7AF 5EJCA 4OGEA 4FT2A 2LCLA 4C0ZA 5CK9A 1EIFA 1YITA 4OB1B 1K9MC 2I2LA 2PU9B 2X4YA 3OYLA 5GANj 1VQKT 4J8OA 3OSVA 5GAMe 4TVRA 4PJOE 5GAN6 1W2BA 2CKKA 1JRIA 2OTJA 2RI2A 5LJ3g 4HNUA 4GLKA 5CVIA 4BI4A 1Q81C 2RJCA 2XG8D 3SFMA 4OB3B 1KHIA 2QQ9A 3M58A 5LJ5d 3LWHA 5GMKm 4RCBA 3CCVA 4P5NA 3RUXA 3UT1A 5M9OA 3CD6T 4A4FA 4JRQA 2OTLT 1LJOA 4LDWA 4JRIA 1S72T 2ZPEB 4LD6A 2BS3A 5LJ5f 3VKGA 1H3ZA 2XKOC 4LDUA 2EJGA 3PMIA 2K5IA 2BS4A 1U8RA 1YIJA 2QF7A 5J3BA 2R57A 5C0MA 3SB2A 3L2UA 1VQ8T 4B9XA 2DTHA 4C8QB 2HAXA 3OYMA 4HLQA 1I81A 2LX9A 4M75B 4E47A 4IUUA 4M7AC 1G3SA 4J7FA 3QZ5B 3JAME 4BY6C 3CC4A 2YHTA 1W2BS 2MI6A 3L42A 3HRTA 3NTKA 2QA4T 1Q7YU 4M77G 2KQWA 1YI2A 4OF1A 4XAXB 5CQYA 4C5EA 5FU6C 1VQNA 2WSCE 4FIBA 5GAOq 3MHXA 2KY9A 4M7DA 4A53A 2HQXA 4FU6A 4M7AB 3GPLA 3SWNA 1WPYA 4BY6B 2FB7A 5A0DA 5LJ3h 4LDYA 4IUTA 4NS5A 3VUBA 3CCST 4N0AC 3MO8A 2MF2A 4XTWA 4JRPA 3VYHB 5I2MA 5FU6B 3QDRB 3NTIA 4M6VA 3FDRA 2EQUA 4OB2B 2LT1A 3UDCA 3MEUA 3JB9F 3HKSA 4L5GA 1BI2A 2K5FA 4MZPA 2NLUA 4F7UA 4ZTJA 5GMKi 1LNXA 3PTAA 4BBRM 3SDZA 4HT8A 3QYGB 2IVWA 3L2QA 3OYJA 5DY9A 1XQHA 1NJIU 1I5LA 1OYXA 4M7DF 3JB9I 4MFEA 1HXDA 1X6OA 4CRIA 4JDSA 2RM4A 2YLCA 4C92G 3G4SA 3OS2A 1WQWA 1UGPB 2K3XA 3M56A 5KE3A 3CC2A 3RMSA 4EMKA 1G3TA 3BW1A 3ASKA 3CBOA 3QG1A 2KAFA 4PL6A 4RG2A 3OYFA 2DXUA 4OGCA 4LDXA 3V8KA 5GAOp 2M1HA 4M78E 4C8QD 1VQLA 2JN0A 3BG9A 2WSFE 4ME7A 3I56A 3GF5A 4M75D 4MDXA 3RIRA 5FU7C 1K73U 1M90C 4Y91A 2DZ9A 4A4GA 1D3BA 4C0GA 3HL8A 3A8OB 3QO3A 3OS0A 1YJNT 2BIVA 3ZEHA 4QVZA 4PJOG 2XD0A 2JUFA 3KBGA 2DIGA 3RKWA 2FVUA 4RKUE 1QP2A 4BDZA 3JRZA 3PIPA 1NPRA 1VQPA 4LOCA 2L3RA 3CPFA 4JLIA 5FU7B 2R5AA 4M7AD 3I55T 3EAEA 4IURA 3V7CA 2EJ9A 2JOYA 3CMEA 1VUBA 2ZPFB 1P92A 3SWNC 4EMGA 1UGSB 4O5VA 3JCMP 2EWNA 1QVPA 3OYKA 3TEEA 3JCMc 1XNIA 5IN1A 1BIBA 4BUGA 3LX7A 2QQSA 5LJ3d 3EFSA 3ER0A 5GANf 4M7DB 1X01A 3X25B 1KD1C 3C4SA 4X9CA 2GQVA 3SWNB 5LJ5e 3JCMf 3CCUA 2V8KA 3PFSA 1N27A 4FSXA 2RJEA 3PT9A 4J6WA 4MZMA 4UC4A 3CCQT 4DA4A 2M9UA 5FROA 3PMTA 3CMET 3L2RA 2JNGA 2L89A 4IUVA 5CCAA 1YJ9T 4M7AE 3GNGA 5GMKj 3OYEA 3HRUA 2QFZA 2R58A 3TU4K 3LGFA 1FKMA 3BY7A 2ZPIB 3J7AF 3G6EA 1KQ2A 4C5HA 3HZJA 2YLBA 3WVDB 3V8LA 4PNOA 2QXFA 2ZCFB 3QPHA 2D6FA 2IG0A 3S6WA 2DKGA 3S3NA 3C95A 4NC6A 3QYHB 3CCUT 2DD4A 4F7UB 3QJ6A 1M1GA 3CCJT 3QWLA 2DVEA 1WJSA 3CCRA 1KC8U 4EMKC 3WXMB 1FX7A 4OP0A 2RA2A 5AYFA 3A8HB 2QI2A 1KQSA 2E64A 4C5GA 2VV5A 1G3YA 5KCOA 2X35A 2XIDA 2OAUA 3FIFA 5LJ3j 2XHCA 3DLLA 3TW6A 1QP3A 3CCEA 1Q86U 3OS1A 3OYNA 1VQMT 2QEXT 2PVDB 3QKJA 4J6XA 4MMKA 1VQOT 4C8QC 4ELJA 4XTZA 4EMKB 1NZ9A 4O6JA 4ZTFA 4M75C 4XU2A 3JCMb 2JTFA 3MEVA 2RHXA 3EFRA 2XU8A 3CCRT 3C12A 1YITT 4B9WA 1BI3A 3V8JA 5CKDA 3JB9D 3G71A 1O9SA 3E9FA 2KMTA 4R56A 5GMKh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ1 B;  4OB2 B;  4ZGJ B;  2CZ0 B;  3WVE B;  2ZZD B;  3A8M B;  2DD5 B;  2CZ6 B;  3QXE B;  2PUK B;  4KT0 E;  3QYG B;  4Y28 E;  2O01 E;  1DJ7 B;  1PSF A;  2PVG B;  2AHJ B;  1UGP B;  3X24 B;  1IRE B;  2ZPB B;  3LW5 E;  2ZPH B;  2WSF E;  3A8O B;  2DXC A;  1V29 B;  1UGR B;  2ZZD A;  2CZ7 B;  4RKU E;  1QP2 A;  2DD5 A;  2D0Q B;  3HHT B;  2DD4 B;  1AHJ B;  2ZPF B;  1GXI E;  1JB0 E;  1UGS B;  1UGQ B;  4OB1 B;  2PU9 B;  2DPP B;  3X25 B;  2PUO B;  3X20 B;  3VYG B;  3X28 B;  2DXB B;  4OB3 B;  3QZ9 B;  1PSE A;  2CYZ B;  5L8R E;  4OB0 B;  2ZPE B;  2ZPI B;  2QDY B;  2PVO B;  3WVD B;  2ZCF B;  3QYH B;  2DXC B;  2DD4 A;  3A8L B;  4ZGD B;  2WSE E;  3QZ5 B;  4XK8 E;  2ZPG B;  4ZGE B;  4L6V 5;  4FM4 B;  3A8H B;  3X26 B;  1QP3 A;  2WSC E;  2PVD B;  3A8G B;  3VYG A;  2DXB A;  3VYH B; 
#chains in the Genus database with same CATH topology
 1D3B B;  5AT1 B;  3MP8 A;  4QSH A;  4EOI B;  1NPP A;  1U1S A;  3QSU A;  4UN0 A;  3NGP A;  1MNE A;  1RAG B;  1XTD A;  1ZSG A;  1TD6 A;  2JTE A;  1KJW A;  4HCZ A;  3CCV T;  1QCN A;  4FX3 B;  3RKX A;  4M7D D;  2CS7 A;  2RK2 A;  2RQU A;  3G71 T;  1YNZ A;  1NE8 A;  1T0H A;  3F70 A;  4DBH A;  1WXU A;  2IIM A;  2RHU A;  1UGV A;  3CCU Q;  3Q1J A;  1OIU B;  5GAM g;  3OBW A;  1Q7Y C;  3JCM V;  3QYE A;  3UAT A;  3S3M A;  2XDP A;  3QJY A;  4JS4 A;  2FHD A;  4EC9 B;  3KUF A;  1V29 B;  3GOX A;  1UGR B;  2W96 A;  2I0N A;  4ZN1 A;  3PIO A;  2EW3 A;  2KNB B;  2X4W A;  3R6N A;  2DX1 A;  2DD5 A;  2YUN A;  4FL6 A;  4J9B A;  2B9R A;  3JCM Q;  2QGF B;  5GAN e;  3H6Z A;  1HJD A;  3E9G A;  1GXI E;  1F5Q B;  2DM1 A;  1IZ6 A;  1UHC A;  2W9F A;  4EMH A;  1UGQ B;  3FJ5 A;  2QAZ A;  2HNI A;  3J81 E;  2IPO B;  4M78 A;  1T0J A;  1BK2 A;  3QBY A;  2PK9 B;  5GAN 2;  2KDS A;  2RK1 A;  2MCN A;  5CO7 A;  3CC2 T;  3VS5 A;  2E3H A;  1UFF A;  3NHN A;  3H8Z A;  4NL2 A;  2DA9 A;  4EPC A;  2VVK A;  1Q82 U;  4BBS M;  2WMB B;  1SEM A;  4C8Q E;  2KT1 A;  2MAM A;  1NJI R;  2QQ8 A;  1I4K 1;  4IUP A;  3BE3 A;  3GLX A;  4XK8 E;  1TUC A;  4L6V 5;  4J83 A;  2KEA A;  3OYC A;  4KUL A;  2ZGW A;  3TNW B;  3OBY A;  4WTO B;  3KHI A;  4KH0 B;  2C5X B;  1HD3 A;  3GIB A;  4N4H A;  2KYB A;  1YJW A;  5IF1 B;  3OYD A;  3BDL A;  2K57 A;  2HBP A;  2F5K A;  2BTT A;  2W0Z A;  2JMC A;  3JCM X;  2DD5 B;  5D7U A;  4RTY A;  5DM7 R;  2DAQ A;  3HBL A;  4N0A A;  4YTL A;  4D8K A;  3G6E T;  2EKO A;  3VJP A;  3QDF A;  1K9M U;  1G3W A;  1KC8 C;  1H1S B;  2EVR A;  4FCY A;  1Q81 U;  2YXY A;  5LJ5 g;  2NUP A;  4C92 F;  2MK5 A;  4FW1 A;  1R0C B;  4M78 B;  1NEG A;  1JXO A;  3V7R A;  5J39 A;  2B86 A;  2KMG A;  1ZSZ A;  2F2X A;  2JZ2 A;  4WF2 A;  3GP8 A;  2DTI A;  2BKZ B;  2CZ7 B;  2O4X A;  3OSS C;  4AT1 B;  3RER A;  2LQ8 A;  3HFN A;  2G3R A;  4HNV A;  2ED0 A;  2LRQ A;  4PJJ A;  2DNU A;  4JRK A;  1ABQ A;  1B34 A;  3DB4 A;  4ROE A;  4C92 C;  1M1K C;  1VQ7 T;  4EON B;  1ZLM A;  3CC7 T;  3P8H A;  4MML A;  2RHI A;  1YJW Q;  4F6U B;  2ABL A;  2PK2 A;  4M75 G;  2E10 A;  4MZT A;  1V1C A;  5GAN h;  1K8A U;  2VAS A;  1Y71 A;  3PNW C;  3VV0 A;  2GNC A;  2L2P A;  4ZN3 A;  4ROD A;  3RES A;  1Y57 A;  1YBY A;  1X2K A;  2XDD A;  3A8L B;  1SF9 A;  1PRL C;  3A1P A;  2ZPG B;  2P0Q A;  1JBM A;  4F7L B;  2G6F X;  3X26 B;  1AZE A;  4XU1 A;  3VS4 A;  4QQ6 A;  4BCN B;  4EOK B;  3INZ A;  2VB6 A;  4JUV A;  2V8I A;  1G83 A;  2UZL B;  2NUP B;  4PJN A;  3FC3 A;  1M5Q 1;  1YHQ T;  1YWO A;  4MDW A;  1Y07 A;  4J9G A;  3JCM J;  4AKG A;  3LWI A;  1XOV A;  1ZSZ B;  4QVC A;  3I55 A;  3MI9 B;  5GAO l;  2GF7 A;  4IKF A;  4M77 E;  2RHY A;  3DB3 A;  4II1 A;  2O4X B;  2DMO A;  4LD9 K;  2H8H A;  2Z0W A;  4DBR A;  1WNL A;  2RHZ A;  5GAN g;  2HQE A;  3URG A;  2VUB A;  1E6G A;  2DME A;  3CMA T;  2O01 E;  2G77 A;  2QTX A;  1C6V X;  1VQM T;  4C0D B;  4C92 D;  1B34 B;  2PHG A;  2WJ9 A;  4HA8 A;  5HK3 A;  1QCF A;  2CT3 A;  3X24 B;  1GFC A;  3H9N A;  5GAN d;  5FWC A;  4HCK A;  4CI0 C;  1QKX A;  5HKC A;  2C5N B;  2KVQ G;  2BS2 A;  1VQ9 Q;  2PMI B;  1E7O A;  4E7L A;  1D3U B;  2GCX A;  3DTO A;  1O75 A;  1VQ6 T;  4C8Q F;  4LDV A;  5HNB B;  1Q82 R;  4GY5 A;  1X6G A;  4V2S A;  4M78 C;  1SHF A;  3VUZ A;  4J6Y A;  2LVM A;  3OB9 A;  4PLI A;  4X9D A;  1JB0 E;  5ACB A;  4YOS A;  4M7A F;  1KQ1 A;  5EJC A;  1YIT A;  5CK9 A;  2COW A;  2I2L A;  1WHL A;  2PU9 B;  4F6W B;  2E3I A;  1FMW A;  2DL7 A;  2QDL A;  2OTJ A;  2RI2 A;  4HNU A;  4X1V A;  3I55 Q;  2QQ9 A;  3M58 A;  3LWH A;  4RCB A;  4P5N A;  2OTL T;  4JRI A;  2ZPE B;  1ACM B;  2XKO C;  2K5I A;  3SB2 A;  2DTH A;  4CC2 A;  2LX9 A;  1I81 A;  4E47 A;  4M7A C;  1G3S A;  1K9M R;  3CC4 A;  2YHT A;  2O2O A;  2CP7 A;  3HRT A;  3NTK A;  2QA4 T;  1YI2 A;  2ECZ A;  3VS7 A;  4OF1 A;  4XAX B;  1Q81 R;  4M7D A;  2KY9 A;  2L0A A;  4BY6 B;  1WPY A;  2VWF A;  3RR6 A;  2X1N B;  2FB7 A;  3CCS T;  1H4L D;  4N0A C;  3CCL Q;  4CRL B;  4HXJ A;  2QGS A;  1M3A A;  1UEC A;  3QDR B;  4BY7 X;  3NTI A;  2EQU A;  5EFQ B;  3MEU A;  3HKS A;  4FYX B;  4L5G A;  1M1K R;  1BI2 A;  1E6H A;  3EHR A;  4MZP A;  3EID B;  5GMK i;  1LNX A;  3PTA A;  4IIO A;  4HT8 A;  2HL3 A;  3RBB B;  1XO2 A;  1YIT Q;  1IHV A;  3DOG B;  1IRX A;  2GTJ A;  4CFV B;  3JB9 I;  4PFO A;  4CRI A;  1VQ8 Q;  2OTJ Q;  4BCM D;  1W98 B;  4RTU A;  4C92 G;  3UA7 A;  1UGP B;  5KE3 A;  3M56 A;  3CBO A;  4RG2 A;  2DXU A;  1AD6 A;  1V76 A;  4C8Q D;  5HBE B;  2WSF E;  1MV0 B;  3RIR A;  5FU7 C;  1K73 U;  5I11 A;  2ESW A;  2DET A;  1YJN T;  2BIV A;  1OPK A;  4IMY B;  1ZUK A;  4ELL A;  2DIG A;  3JRZ A;  4EOP B;  3PIP A;  1VQP A;  4JLI A;  2R5A A;  4M7A D;  2NYS A;  4RTT A;  2EQI A;  4IUR A;  2EJ9 A;  2JOY A;  1VUB A;  1YI2 Q;  1P92 A;  4EOM B;  3SWN C;  2HDA A;  4QT7 A;  2DYI A;  1QVP A;  3OYK A;  3TEE A;  3JCM c;  5IN1 A;  1BIB A;  3PO3 S;  5IHY A;  1AD5 A;  2FZK B;  4M7D B;  1X01 A;  3X25 B;  2ROL A;  4X9C A;  2JT4 A;  2EPD A;  2GQV A;  2YUQ A;  3JCM f;  4MZM A;  3MPU B;  5IH2 A;  2K9G A;  4J6W A;  2LJ3 A;  5FRO A;  2JNG A;  1BB9 A;  1GRI A;  1PC0 A;  2HBW A;  3LGF A;  1K0X A;  3S3N A;  4CC3 A;  3CCU T;  2CP5 A;  3CCJ T;  3QWL A;  2IVX A;  2DVE A;  4EMK C;  4RTX A;  4BCP B;  3A8H B;  2QI2 A;  1KD1 R;  1KQS A;  2VV5 A;  4AFZ C;  1WZO A;  2XID A;  5LJ3 j;  3OS1 A;  1VQO T;  1YN8 A;  2QK0 A;  3JCM b;  3MEV A;  4PK4 A;  2DBK A;  2BPM B;  1QWE A;  2XU8 A;  4B9W A;  1BI3 A;  2FRW A;  1M2V A;  2KMT A;  2JMA A;  3NTH A;  1WXT A;  5KCH A;  1ZBX A;  3EGD A;  2WMA B;  1VQP Q;  2P4T A;  3WVE B;  1OZ3 A;  4KRC B;  1PG5 B;  2P0K A;  1UEB A;  2DL8 A;  4L59 A;  1KQS S;  1UNH D;  4M78 G;  1SRM A;  3M59 A;  3OYH A;  3EH1 A;  8AT1 B;  5L23 A;  5CKE A;  3HRS A;  4RUG A;  1D0X A;  4K11 A;  3OYB A;  2VGN A;  3L2W A;  2P84 A;  3VU3 C;  1OI9 B;  1TG0 A;  1BCO A;  3CD6 A;  3M55 A;  5IAY A;  2GTO A;  4F6S B;  3LYI A;  2E6N A;  5DLO A;  1OEB A;  1VQN T;  4F7S B;  2QTV A;  2AZS A;  2A3L A;  2QEX Q;  3MEA A;  1MV3 A;  2VYT A;  1QCO A;  2QAS A;  2RI3 A;  1GBR A;  1JEG A;  1MGQ A;  4E7K A;  5GAN 8;  4M7A G;  3M0T A;  2RO0 A;  3MP1 A;  5HY6 A;  1NJI C;  5CQX A;  1GCP A;  1U06 A;  4E7I A;  1YIJ Q;  3X20 B;  3G4S T;  2YRD A;  1M2V B;  3LH0 A;  2Y90 A;  2VC8 A;  2CYZ B;  4Z88 A;  1N9R A;  5GAM j;  1Z9Q A;  4BB7 A;  1FMV A;  3EGD B;  1RAA B;  2V1Q A;  1SPK A;  5KE2 A;  4BCI B;  4M7D C;  2MWO A;  1CSK A;  4C5I A;  3P8B B;  1KQS P;  2W9Z A;  2Y4X A;  1IGQ A;  4EOR B;  3O0G D;  4YOZ A;  2X51 A;  3QHS A;  2RQR A;  4HCB A;  4OMQ A;  2RD1 A;  3CD6 Q;  2H3J A;  2HZY A;  2X4X A;  5CIU A;  4E2F B;  2YT6 A;  5LJ3 f;  5CEI B;  5KYW A;  4Z89 A;  5C6S A;  4NL3 A;  2YRV A;  3HB9 A;  5HK0 A;  1GY3 B;  4NOY A;  1AZG B;  2DXB A;  3RKY A;  1K73 R;  4C92 A;  4PFP A;  2E6Z A;  5GAM h;  1VYV A;  4A63 B;  1MMG A;  4AKH A;  3GTM S;  4HKE A;  3K7A M;  2LMJ A;  3G7Z A;  1Z9Z A;  4BD3 A;  4CFU D;  4EOQ B;  3RGF B;  2LCC A;  1FXX A;  4X34 A;  4BAC A;  3H0H A;  2DER A;  1WQ7 A;  1WA7 A;  1VQK A;  2VXE A;  2AKL A;  1E7P A;  4JZ4 A;  3FB9 A;  4Y28 E;  3VKI A;  1MMD A;  3HSB A;  4J5Y A;  3I9Q A;  2PVG B;  2EBP A;  1X69 A;  4RG8 A;  2DXT A;  2LTO A;  3BDU A;  3EFO A;  5FRN A;  1N6A A;  1U3O A;  2KSS A;  3LW5 E;  1OPL A;  2MYS A;  3CCE T;  4F7U G;  4HVV A;  3MET A;  3BLQ B;  3OYG A;  3QWY A;  1PWT A;  1RAB B;  2KI7 A;  4PJO F;  1PHT A;  2DFU A;  2VXF A;  2FRY A;  1WJQ A;  2RJF A;  2LP5 A;  1ARK A;  2QQB A;  1ZX6 A;  3CEY A;  1HSQ A;  2LDM A;  2KK4 A;  3EG9 A;  2EQK A;  2XK0 A;  1LCK A;  5KYW B;  1GBQ A;  1S1N A;  5GMK e;  1I5O B;  2K6D A;  4BE0 A;  5GAM d;  1RLQ C;  2DXB B;  2NUT A;  3SEM A;  4Q5W A;  1N4M A;  4C92 B;  5A0L A;  1H27 B;  5GAM f;  3O8V A;  1TH7 A;  1ZA1 B;  2L3P A;  5LJ5 j;  4RCC A;  4PJO C;  2CJM B;  2EGA A;  3PGG A;  4OMF B;  1VQK Q;  4HL4 A;  2DXC B;  1JOW A;  2X3X D;  3EG1 A;  3ULR B;  4FM4 B;  2P0P A;  3GBQ A;  1VQ9 T;  4KBM B;  2K3Y A;  2COY A;  4R0K A;  2D1X A;  1OKW B;  4JX4 A;  2E65 A;  3CXC P;  1VA7 A;  1SSF A;  3TNH B;  3TW7 A;  5GAO m;  3EFO B;  2BZX A;  5FW9 A;  3ZFJ A;  4ESR A;  4BDY A;  2I40 B;  5LJ5 h;  2EQM A;  5IXB A;  2V8J A;  1EZZ B;  2RH2 A;  1OOT A;  4C8Q A;  2CZ6 B;  1Q82 C;  1H3H A;  2K7A A;  3JSC A;  2AT1 B;  4BE2 A;  4BCO B;  3JB9 J;  2EAY A;  5J26 A;  4KUI A;  5CKB A;  1DJ7 B;  5KYN A;  3L2V A;  1AEY A;  3JB9 H;  4VUB A;  3EG9 B;  3THK A;  5A0G A;  3CCQ A;  3QYB A;  1YJ9 A;  2KRN A;  2ENM A;  4HCC A;  4M7A A;  4XU0 A;  2AZV A;  1ABO A;  2ZPB B;  2E41 A;  1OUL A;  1MND A;  1ZHI A;  2EYZ A;  2NUT B;  3E1S A;  2HD0 A;  4HT9 A;  5LMK B;  4PJO D;  1NYG A;  1GUX A;  3VS2 A;  1HK9 A;  4M7D G;  3LGL A;  3QUI A;  1BU1 A;  4F17 A;  4WCI A;  2B8A A;  1H1P B;  3CCL T;  4CFX B;  1I8F A;  2VKN A;  1TUG B;  3CCM T;  3VRZ A;  4JS5 A;  1WFW A;  2WFY B;  4C0Z A;  2HCK A;  4OB1 B;  3VS3 A;  1K9M C;  3BHU B;  5GAN j;  1QMC A;  4BI4 A;  1Q81 C;  3NMZ C;  4OB3 B;  3CCV A;  5LJ5 d;  2IN3 A;  2JGZ B;  3AT1 B;  1TWB A;  3RUX A;  3D7S B;  4BCM B;  1S72 T;  2AIR B;  1CKA A;  2DF6 A;  5LJ5 f;  1WDX A;  3TVT A;  1H3Z A;  2EJG A;  2GBQ A;  1VQ8 T;  1ZP2 A;  4GBQ A;  3QHW B;  5HQ0 B;  2CSI A;  2HMA A;  4B9X A;  4C8Q B;  4HLQ A;  3CCQ Q;  2MI6 A;  1R0B G;  1YJ9 Q;  1H1R B;  4AG2 C;  3MIA B;  5CQY A;  4C5E A;  2HKN A;  2WSC E;  2YUO A;  3MHX A;  4FIB A;  5GAO q;  1OL2 B;  4A53 A;  2HQX A;  4M7A B;  3GPL A;  3SWN A;  4KGV B;  2CUB A;  3VUB A;  2MF2 A;  4XTW A;  1R77 A;  4J9F A;  3LH5 A;  5I5Z B;  4OB2 B;  2HSP A;  1GUX B;  1PKD B;  2X9H A;  4F7U A;  1SSH A;  1TXQ A;  3QYG B;  3UA6 A;  3OYJ A;  2JM8 A;  1I5L A;  2KRO A;  4MFE A;  3EOC B;  4JDS A;  3HTR A;  1TUD A;  3CC2 A;  4KRD B;  3RMS A;  2YWW A;  4EMK A;  3CCV Q;  2KAF A;  1TU0 B;  5GAO p;  2M1H A;  2JN0 A;  4ME7 A;  2OI3 A;  1OX9 A;  5I22 A;  4Y91 A;  4A4G A;  4C0G A;  1TS9 A;  4QVZ A;  4PJO G;  2JUF A;  3RKW A;  4HVW A;  5FU7 B;  1KK7 A;  2DL5 A;  3CME A;  2ZPF B;  1YWP A;  1I1J A;  2CSQ A;  2ATC B;  2PTK A;  2QQS A;  3ER0 A;  2CP2 A;  5GAN f;  2G9X B;  1KD1 C;  3SWN B;  1UJY A;  1N8R U;  2WIP B;  2V8K A;  1N27 A;  4DA4 A;  2H3E B;  4OMN A;  1K4U S;  1D0Z A;  2C5V B;  3GNG A;  2M0Y A;  4JJD A;  2R58 A;  3VRY A;  3G6E A;  2AKK A;  2ZCF B;  2D6F A;  3TNI B;  2IG0 A;  3S6W A;  4NC6 A;  5ICP B;  3EG0 A;  4F7U B;  1WLP B;  1SG5 A;  4F7J B;  1WJS A;  1WI7 A;  3WXM B;  1FX7 A;  2DIL A;  2RA2 A;  1SRL A;  3CC2 Q;  1G3Y A;  4EOO B;  2OAU A;  2O9S A;  2XHC A;  3BHT B;  1Q86 U;  2C5O B;  3OYN A;  2QEX T;  2PVD B;  4MMK A;  4C8Q C;  4ELJ A;  2YUP A;  4EMK B;  2JTF A;  3EFR A;  3C12 A;  3V8J A;  4OMP A;  3ZL7 C;  2FG0 A;  1PNJ A;  3SHW A;  4B6M A;  3H41 A;  3CME Q;  1H8K A;  1WX6 A;  4AFQ C;  4DEX A;  1W6X A;  4KT0 E;  1BKB A;  5HBH B;  2V26 A;  2WPA B;  2CH4 W;  2KYM A;  2FPE A;  3OMG A;  1TOV A;  3CC7 A;  5KH6 A;  1YIJ T;  2UZE B;  1VQ4 A;  5KYY A;  2YSQ A;  1K1Z A;  2AHJ B;  1PKS A;  4J7I A;  3OA6 A;  2D9T A;  4OVA A;  1PM3 A;  1SKU B;  2BE9 B;  1UNL D;  2JVV A;  2PQW A;  1TSF A;  1RAD B;  4XU3 A;  3G6E Q;  2RNA A;  4YC3 B;  3OQ5 A;  4LN2 A;  2RQV A;  5D6W A;  2A36 A;  5FLX E;  1WXB A;  2DO3 A;  5FWB A;  2DL4 A;  1AWO A;  2XMF A;  2CCH B;  1RUW A;  4QW2 A;  3M57 A;  3HHT B;  2DL3 A;  1AHJ B;  4LUE A;  3TSW A;  1ZUY A;  4BXX X;  2LT4 A;  5LJ3 e;  1MMN A;  1YHQ A;  4CFU B;  2X4J A;  3SD4 A;  2HKQ B;  1K8A R;  2IW6 B;  2IW8 B;  2HEQ A;  4YOO A;  1U1T A;  2J7I A;  4Z6Y A;  2DK3 A;  1M4Z A;  3H0F A;  3TRE A;  3M5A A;  3CC4 Q;  4A54 A;  2FPD A;  1K73 C;  1VQL T;  2KE9 A;  3I56 T;  3CMA A;  2LZ6 B;  3EHQ A;  1VQM A;  3HO8 A;  2F2W A;  1WHG A;  3FLG A;  5IHN A;  1OGU B;  3R6O A;  1VQ4 Q;  4M75 E;  1Y96 A;  4A4E A;  1IO6 A;  1T3S A;  4FYV B;  4DOW A;  1QVG A;  4PLL A;  5KYY B;  9ATC B;  6AT1 B;  4ELY C;  3DDQ B;  3VKH A;  2J6O A;  2W99 A;  4JX5 A;  3EG2 A;  2JTM A;  2O9V A;  2QQA A;  3LLR A;  3M0Q A;  1IB8 A;  1UDL A;  4M77 F;  1RL2 A;  2WAC A;  1C1A A;  1VQ6 A;  2PJQ A;  3NDQ A;  3VYG A;  4IUQ A;  4BI8 B;  2KRM A;  4PJM A;  1E9H B;  4M4Z A;  4OGR B;  1LOJ A;  2F2V A;  1M8V A;  3FRN A;  4ANJ A;  1JJ2 A;  2EJF A;  2RB6 A;  1QVG S;  1VYW B;  3GNF B;  3JV3 A;  1ZA2 B;  1YHQ Q;  4BCQ D;  2DJZ A;  2UZD B;  4PJO A;  2VGM A;  2EYX A;  4M77 C;  5KYX A;  2E1H A;  2RI5 A;  1ZQ1 A;  4JJC A;  2QQR A;  1N8R R;  4RMO A;  2OTL A;  1X75 C;  2CP6 A;  1IRE B;  4BY1 X;  4BCH B;  1JJ2 S;  1QQJ A;  3CMA Q;  2MPX C;  4II5 B;  2OAW A;  1VQM Q;  1H92 A;  2DEU A;  2ZZD A;  1RI9 A;  4BI3 A;  3E19 A;  4AG1 C;  3KFV A;  2QA4 A;  1FWZ A;  2D0Q B;  5HBJ B;  1KG1 A;  5CAI A;  3AHU A;  2BKD N;  2K79 A;  4XTY A;  1QKW A;  3A5Z B;  1JSU B;  1Y96 B;  3M4G A;  4E7H A;  2DEQ A;  2C0T A;  3CCS A;  3UF4 A;  3OW2 A;  1Q86 R;  4FYW B;  3EG3 A;  1UUE A;  4N4G A;  2ED1 A;  1VQ6 Q;  4JZ3 A;  2M0O A;  2J6F A;  4C8Q G;  3DL1 A;  4PKC C;  5GAO r;  2EKH A;  3S3O A;  1K0S A;  3VYG B;  3X28 B;  4CFW B;  2MOX A;  3QZ9 B;  4MFD A;  2UUE B;  2DTO A;  2J06 A;  3M0S A;  2L8D A;  1NEB A;  1VIN A;  3EJ1 B;  5I2S A;  4HNT A;  1BYM A;  3TQ7 P;  4KRT A;  3OW2 S;  1QVG P;  2E70 A;  1WHM A;  1BCM A;  1Y7X A;  2DZC A;  2WSE E;  1MHN A;  4PFZ A;  4OML A;  3T9N A;  4M77 D;  4PJO B;  1UG1 A;  2A37 A;  1IHW A;  2OTL Q;  5KYX B;  1I0C A;  2HQH A;  4LXC A;  2EIF A;  4FSS A;  3KXT A;  2QDJ A;  1M90 U;  1YJN A;  1I07 A;  1JJ2 P;  1WHK A;  2YDL A;  3QHR B;  2RN8 A;  2X3W D;  2PNI A;  4QVD A;  1BI1 A;  2LQK A;  2D0N A;  1IXD A;  2DJQ A;  2GFA A;  2LC4 A;  2ZZD B;  3L1A A;  3A8M B;  4KUD K;  1QVF A;  3OY9 A;  2RMO A;  3FEO A;  3QXE B;  4Z02 A;  5EC7 A;  1KIK A;  1H24 B;  4C0F A;  5EG2 A;  4EDU A;  5LJ3 g;  5GAN 7;  5LL6 S;  1VQ5 A;  4XQ3 A;  3UWN A;  1TTH B;  2E12 A;  1D1B A;  1GFD A;  4Z8A A;  3BFM A;  2F5T X;  2FEI A;  3CXC A;  2XDB A;  2L5Q A;  4F16 A;  3PVL A;  2EGC A;  2FYK A;  4E7S A;  1QVF S;  1JXM A;  1MUZ A;  1W70 A;  4JPB W;  3VS0 A;  7AT1 B;  3CCJ A;  2BUD A;  2DXC A;  3V7S A;  3I5S A;  2BZY A;  4M75 F;  4QQG A;  5CKH A;  4C92 E;  1YJW T;  1WGS A;  3OW2 P;  2KT8 A;  1YCS B;  3DJB A;  1B3Q A;  3ME9 A;  3LQ5 B;  1VQO A;  4ATO A;  3CXC S;  2KGT A;  2C4G B;  1LVK A;  1YP5 A;  1QWF A;  1WHJ A;  1SHG A;  4J9E A;  3DDP B;  1EIF A;  2CH4 A;  4BCG B;  4TVR A;  5GAN 6;  1ZBJ A;  1ZUU A;  2CKK A;  1JRI A;  4G6L B;  5CVI A;  1GH6 B;  2RJC A;  1KHI A;  5GMK m;  4AMC A;  3UT1 A;  1LJO A;  2QYZ A;  2CDT A;  2BS4 A;  1U8R A;  5J3B A;  4ROC A;  2R57 A;  1H26 B;  2RF0 A;  2A08 A;  3OYM A;  3POM A;  4IUU A;  4J7F A;  3QZ5 B;  3RDV A;  1VQ5 Q;  1FMK A;  1Q7Y U;  4M77 G;  2KQW A;  1J3T A;  1VQN A;  1U5S A;  3IQL A;  5FU6 C;  1K9A A;  2KRS A;  1AOJ A;  4FU6 A;  4OMO A;  4RTZ A;  5A0D A;  4EIK A;  2LX7 A;  1OV3 A;  4IUT A;  4LDY A;  4EOL B;  3CCJ Q;  3VYH B;  1QVF P;  5I2M A;  2OJ2 A;  4ZNX A;  1WYX A;  2HSE B;  2LT1 A;  3E2U A;  3UDC A;  1ENW A;  2V1R A;  3JB9 F;  2M51 A;  1F1B B;  1FIN B;  1VQO Q;  4ZTJ A;  3SDZ A;  3PE0 A;  2K2M A;  2WIH B;  1X6B A;  2WXV B;  5DY9 A;  3L2Q A;  1OYX A;  1X6O A;  3QWX X;  1KXU A;  1WIE A;  3G4S A;  1OQK A;  1WQW A;  2O88 A;  2K3X A;  1BU2 A;  1B07 A;  1G3T A;  3BW1 A;  2C0I A;  4OR5 B;  3QG1 A;  4OGC A;  1A0N B;  1B7T A;  2BZ8 A;  4M78 E;  3GF5 A;  4M75 D;  2DRK A;  1VYU A;  1AVZ C;  2CUD A;  2K3B A;  3A8O B;  3HL8 A;  3QO3 A;  3OS0 A;  3ZEH A;  3KBG A;  2GGR A;  1YFN A;  4RKU E;  4BDZ A;  1NPR A;  1TFB A;  4LOC A;  3CPF A;  3I55 T;  1FVV B;  4FW2 A;  1VQN Q;  4O5V A;  3JCM P;  1GL5 A;  4TTH A;  2ROT A;  1XNI A;  1QMZ B;  4KH1 B;  3U23 A;  3C4S A;  3MY1 B;  1M3B A;  1M90 R;  3PFS A;  4FSX A;  4EOS B;  3PT9 A;  4UC4 A;  3CME T;  3L2R A;  2L89 A;  4AFU C;  1PD1 A;  5CCA A;  3M0U A;  4M7A E;  5GMK j;  3TU4 K;  1NM7 A;  3BY7 A;  5GJW B;  1M27 C;  4F7N B;  3HZJ A;  2YLB A;  3WVD B;  3QPH A;  2QGG A;  2DKG A;  3C95 A;  3QYH B;  2HL5 C;  2DD4 A;  3A98 A;  1GCQ C;  2DE0 X;  1X43 A;  1RAC B;  2FPF A;  3CCR A;  1KC8 U;  2AK5 A;  4OP0 A;  3G4S Q;  2E64 A;  4C5G A;  5KCO A;  2X35 A;  1OL1 B;  3FIF A;  3TW6 A;  1QP3 A;  3CCE A;  1KFZ A;  3QKJ A;  3H0I A;  1G2B A;  1AT1 B;  1YIT T;  1D1A A;  5CKD A;  3JB9 D;  3G71 A;  4KGX B;  5GMK h;  2OTJ T;  5GMK l;  3M0P A;  3MCA B;  1OU8 A;  2GQI A;  1O9K A;  4N4I A;  4E7J A;  3OYA A;  2WHB B;  4ORZ A;  2PUK B;  4XTX A;  2D8H A;  2RJD A;  1M3C A;  1M1K U;  5I21 A;  3ZBD A;  2GFU A;  2CGH A;  1BI0 A;  2F69 A;  5CKF A;  1VIF A;  1JKW A;  4IIM A;  3CC4 T;  3EH2 A;  1G5V A;  2CT4 A;  4QQD A;  1KSW A;  5D6X A;  4D6W A;  4DEY A;  1K8A C;  2O31 A;  4OMM A;  1YI2 T;  3MY5 B;  2NUZ A;  1QLB A;  5FRM A;  2RQW A;  1VQ4 T;  3EGU A;  4Y92 A;  2KXC A;  1H64 1;  3OMC A;  1VQ9 A;  3CCR Q;  1XJW B;  5KYU A;  3TCJ A;  5GAO n;  1H1Q B;  2DD4 B;  3UPU A;  2A7Y A;  1H28 B;  1NLP C;  3REA B;  3QII A;  3CBP A;  4E6R A;  1Q7Y R;  3CCE Q;  3JCM e;  4F7U E;  2A28 A;  4XTU A;  1BBZ A;  4CXA B;  1VOM A;  2DPP B;  2KR3 A;  1VIE A;  3G71 Q;  2PUO B;  1D1C A;  2W2H A;  1NYF A;  4J9H A;  4BCQ B;  1OX8 A;  4M77 A;  1UJ0 A;  3BHV B;  1KHC A;  1AWJ A;  4OB0 B;  3BG3 A;  5GAN 3;  3PVQ A;  3CBM A;  2DIQ A;  4KGZ B;  3O5Z A;  2QDY B;  1UB4 A;  5CR2 A;  4HVU A;  4NST B;  3OYI A;  2EYQ A;  1O9K B;  2MMP A;  2KR6 A;  3CPW A;  2FO0 A;  4BE1 A;  4ZGD B;  2CRE A;  2FZC B;  1MMA A;  3NPF A;  4FT4 A;  1RLP C;  1M8M A;  1VQP T;  2L3S A;  1PKT A;  2NWM A;  4M78 F;  3MP6 A;  2COZ A;  1Q95 G;  2EYY A;  3A8G B;  2Y4Y A;  2C0O A;  4J9I A;  1FYN A;  4A4H A;  1KD1 U;  2CP0 A;  3RNJ A;  1W4S A;  1PRM C;  3F5X B;  1N8R C;  2M02 A;  2W10 A;  2EFI A;  2EQJ A;  4DBF A;  3M53 A;  3JB9 G;  3CPW S;  1K76 A;  3M4Y A;  2CZ1 B;  4F04 B;  1PCX A;  1JST B;  1G3N C;  1AWX A;  1D0Y A;  2LNV A;  2P4R A;  3MJX A;  3BLH B;  4JJB A;  3CCL A;  3CCM A;  5A2Q E;  5KYU B;  3HPW A;  3TN8 B;  1HYO A;  3M54 A;  1M9S A;  2CP3 A;  1N9S A;  2K2V A;  2EUF A;  2M16 A;  1IGU A;  3HP9 A;  5HVY B;  3I35 A;  3RMQ A;  5IHI A;  2A0F B;  1OIY B;  1S72 A;  4EC8 B;  1Q86 C;  2F2C A;  2F1L A;  5IT9 E;  2E4H A;  4M77 B;  2JJ9 A;  2JM9 A;  3H4C A;  5L2W B;  1VQ8 A;  5IDN B;  2XIC A;  2K5L A;  4DOV A;  2K4Y A;  1CKB A;  1QLY A;  4JLG A;  2SRC A;  1VQ7 A;  3N5B B;  1R8O B;  2DBM A;  5BNJ B;  2L3Q A;  2MWP A;  3JCM W;  3NFC A;  1KC8 R;  1YCY A;  4R55 A;  1OZ2 A;  3VS1 A;  2RQT A;  2D8J A;  3I5R A;  4AI6 A;  1RI0 A;  4M7D E;  3J80 E;  3C0C A;  3C94 A;  3CD6 T;  1PSE A;  1NBE B;  5L8R E;  5GAN 4;  3JCM h;  3CPW P;  4RTW A;  3DKM A;  3CCM Q;  2PVO B;  5IXF A;  1VOL A;  2WEV B;  3EGX A;  2C06 A;  4ELZ C;  3OYY A;  2IW9 B;  3P8D A;  2UZB B;  1URC B;  4M78 D;  2LQN A;  4ZGE B;  1RAI B;  1UHF A;  3HFO A;  2LNH B;  4CC4 B;  1S72 Q;  3BG5 A;  8ATC B;  1H25 B;  1ZSZ C;  3FJP A;  3MEW A;  1NLO C;  4AKI A;  3L2Z A;  2XI9 A;  1JQQ A;  2EYW A;  3TSZ A;  4QKU A;  1VQ7 Q;  1OI1 A;  3CC7 Q;  4ZGJ B;  5IDP B;  2CZ0 B;  1RAE B;  4C0D C;  4E7Z A;  1C0M A;  1C9B A;  2DVJ A;  4M75 A;  4F14 A;  4F7U F;  2FL7 A;  4I3Z B;  1OU9 A;  3JCM g;  4JX6 A;  2E5Q A;  1PSF A;  1QW1 A;  1UTI A;  4XTV A;  4MIM A;  4EOJ B;  3G33 B;  2CCI B;  2PZ1 A;  3OS5 A;  1UNG D;  3JCM d;  2ZPH B;  5GAN 5;  5D6Y A;  2R5M A;  3G1J A;  3M9Q A;  2LQW A;  2DYB A;  2YRC A;  4J9C A;  4A4K A;  1VQ5 T;  4RTV A;  1G8X A;  2JS2 A;  5DQV A;  1M1F A;  1VYT A;  4J9D A;  3EGX B;  4BCN D;  1BIA A;  5DLQ E;  2QEX A;  4DQ2 A;  4JJN K;  1RAH B;  5GJV B;  5DQW A;  1WJR A;  2EGE A;  3DLM A;  4OGE A;  4FT2 A;  2LCL A;  1VQK T;  2X4Y A;  3OYL A;  4J8O A;  3OSV A;  5GAM e;  4PJO E;  2I53 A;  1W2B A;  3B57 A;  2DLP A;  4GLK A;  2XG8 D;  1EX4 A;  4CFN B;  3SFM A;  1M30 A;  5M9O A;  4A4F A;  4JRQ A;  4LDW A;  2JXB A;  4LD6 A;  2BS3 A;  3VKG A;  4LDU A;  4AFS C;  3PMI A;  3REB B;  1X2Q A;  1YIJ A;  2QF7 A;  5C0M A;  3L2U A;  4BCJ B;  2R7G A;  2HAX A;  1T3L A;  1Y0M A;  2RPN A;  4M75 B;  3JAM E;  4BY6 C;  2SEM A;  1W2B S;  3L42 A;  2JS0 A;  2KBT A;  4LE9 A;  1WHH A;  5FGK B;  4FYY B;  5LJ3 h;  1W1F A;  4NS5 A;  3MO8 A;  1RAF B;  4JRP A;  5FU6 B;  1UE9 A;  4M6V A;  4LUD A;  3FDR A;  5ECA A;  1JU5 C;  5IHK A;  2K5F A;  2NLU A;  4BBR M;  2IVW A;  1NJI U;  1XQH A;  4M7D F;  1OKV B;  1HXD A;  3M03 A;  1X27 A;  2RM4 A;  1GCQ A;  2YLC A;  3OS2 A;  4Y72 B;  2LCS A;  4PL6 A;  3ASK A;  2DRM A;  3OYF A;  1EFN A;  5LQF B;  4LDX A;  1PD0 A;  1P5E B;  3V8K A;  1VQL A;  2QA4 Q;  4PJL A;  3BG9 A;  3I56 A;  4MDX A;  1M90 C;  1NG2 A;  2LW4 A;  2DZ9 A;  2MIO A;  1D3B A;  2XD0 A;  3CCS Q;  2JW4 A;  4DBQ A;  2FVU A;  1QP2 A;  2L3R A;  4BCF B;  3EAE A;  3V7C A;  2C6T B;  1JO8 A;  4EMG A;  1W2B P;  1UGS B;  1LPL A;  5HCK A;  2EWN A;  2J6K A;  4BUG A;  2KXD A;  3LX7 A;  5LJ3 d;  3EFS A;  4GLM A;  5LJ5 e;  3CCU A;  1D09 B;  2RJE A;  3MKD A;  3CCQ T;  2M9U A;  3PMT A;  1AIS B;  4IUV A;  2LJ0 A;  2ZAE A;  1YJ9 T;  2LJ1 A;  3OYE A;  3HRU A;  2QFZ A;  4LNP A;  1FKM A;  2ZPI B;  3J7A F;  2E5K A;  1KQ2 A;  3M0R A;  4C5H A;  1AWW A;  3V8L A;  4PNO A;  2QXF A;  2J05 A;  1M2O A;  2BE7 D;  1N5Z A;  4CC7 A;  4D8D A;  3QJ6 A;  1M1G A;  2FZG B;  2V22 B;  1YJN Q;  5AYF A;  2QG9 B;  3BLR B;  3DLL A;  3CQT A;  4F70 B;  4BCK B;  4J6X A;  1VQL Q;  3I56 Q;  4XTZ A;  1NZ9 A;  4O6J A;  4ZTF A;  4M75 C;  4XU2 A;  3VS6 A;  2RHX A;  3CCR T;  2OX7 A;  1O9S A;  4CFM B;  3E9F A;  4R56 A;  5CYI B; 
#chains in the Genus database with same CATH homology
 5KCH A;  2OTJ T;  1D3B B;  5GMK l;  1ZBX A;  3MP8 A;  4QSH A;  1NPP A;  3MCA B;  1U1S A;  2P4T A;  3QSU A;  3WVE B;  3NTH A;  1XTD A;  1OZ3 A;  2P0K A;  4HCZ A;  3CCV T;  1UEB A;  4N4I A;  4L59 A;  3OYA A;  4E7J A;  1KQS S;  3RKX A;  4M78 G;  4M7D D;  3M59 A;  3OYH A;  3JB9 H;  2CS7 A;  2PUK B;  2RK2 A;  4KT0 E;  1BKB A;  4XTX A;  5CKE A;  3HRS A;  3OMG A;  2RJD A;  3G71 T;  3CC7 A;  5KH6 A;  1NE8 A;  1YIJ T;  3F70 A;  1M1K U;  5I21 A;  1VQ4 A;  3OYB A;  2RHU A;  2VGN A;  2GFU A;  3ZBD A;  3L2W A;  2CGH A;  1BI0 A;  2F69 A;  3VU3 C;  3Q1J A;  5CKF A;  1VIF A;  2AHJ B;  5GAM g;  3OBW A;  4J7I A;  3OA6 A;  2D9T A;  3M55 A;  4OVA A;  5IAY A;  3CC4 T;  1Q7Y C;  3CD6 A;  3JCM V;  1G5V A;  3LYI A;  4QQD A;  5D6X A;  2JVV A;  3QYE A;  2PQW A;  2E6N A;  4D6W A;  5DLO A;  3S3M A;  2XDP A;  1YI2 T;  1K8A C;  3QJY A;  4JS4 A;  1VQN T;  1QLB A;  5FRM A;  2FHD A;  4XU3 A;  3OQ5 A;  2A3L A;  5D6W A;  1VQ4 T;  3KUF A;  5FLX E;  3MEA A;  1V29 B;  3GOX A;  1UGR B;  4ZN1 A;  3PIO A;  2DO3 A;  2X4W A;  2VYT A;  1H64 1;  2DD5 A;  3OMC A;  1VQ9 A;  4QW2 A;  3M57 A;  2RI3 A;  4FL6 A;  3HHT B;  3TCJ A;  5GAO n;  2DD4 B;  3UPU A;  2A7Y A;  1MGQ A;  4E7K A;  3QII A;  3JCM Q;  1AHJ B;  5GAN 8;  4M7A G;  5GAN e;  3CBP A;  3H6Z A;  3E9G A;  1GXI E;  2LT4 A;  1IZ6 A;  3JCM e;  2RO0 A;  5LJ3 e;  3MP1 A;  5HY6 A;  4F7U E;  1YHQ A;  2X4J A;  1UGQ B;  4XTU A;  3SD4 A;  4EMH A;  1NJI C;  5CQX A;  2DPP B;  1U1T A;  2HNI A;  3J81 E;  4E7I A;  1VIE A;  2PUO B;  4Z6Y A;  4M78 A;  3X20 B;  4M77 A;  3G4S T;  3QBY A;  5GAN 2;  2DK3 A;  2KDS A;  2RK1 A;  3LH0 A;  2Y90 A;  5CO7 A;  2VC8 A;  1M4Z A;  2CYZ B;  3CC2 T;  1N9R A;  5GAM j;  1KHC A;  4OB0 B;  3TRE A;  3BG3 A;  3M5A A;  4BB7 A;  3CBM A;  5GAN 3;  2DIQ A;  3H8Z A;  4NL2 A;  4A54 A;  2QDY B;  1UB4 A;  5CR2 A;  1K73 C;  5KE2 A;  4EPC A;  3OYI A;  1VQL T;  4M7D C;  2MWO A;  3I56 T;  2EYQ A;  4C5I A;  3CMA A;  1Q82 U;  3P8B B;  2MMP A;  1VQM A;  4BBS M;  3HO8 A;  2KR6 A;  2Y4X A;  3CPW A;  3FLG A;  4C8Q E;  4BE1 A;  4ZGD B;  2MAM A;  3R6O A;  2QQ8 A;  1I4K 1;  4IUP A;  4M75 E;  1Y96 A;  4A4E A;  3GLX A;  4XK8 E;  4L6V 5;  4J83 A;  3QHS A;  4FT4 A;  4HCB A;  2RD1 A;  1VQP T;  2H3J A;  2X4X A;  4DOW A;  4PLL A;  5CIU A;  4KUL A;  3OYC A;  2ZGW A;  1QVG A;  4ELY C;  5LJ3 f;  3OBY A;  3VKH A;  4JX5 A;  4M78 F;  2JTM A;  2QQA A;  3MP6 A;  3LLR A;  4M77 F;  3A8G B;  1RL2 A;  2Y4Y A;  5C6S A;  3KHI A;  2WAC A;  4NL3 A;  4A4H A;  1KD1 U;  2YRV A;  3HB9 A;  5HK0 A;  1VQ6 A;  3VYG A;  4IUQ A;  4BI8 B;  3GIB A;  1W4S A;  4N4H A;  4NOY A;  2DXB A;  3RKY A;  1N8R C;  4C92 A;  1YJW A;  2EFI A;  2EQJ A;  3OYD A;  3M53 A;  2E6Z A;  5GAM h;  3JB9 G;  3CPW S;  3BDL A;  2K57 A;  1LOJ A;  3M4Y A;  2CZ1 B;  2HBP A;  4AKH A;  4HKE A;  2F5K A;  3L2V A;  1M8V A;  3JCM X;  3FRN A;  3G7Z A;  4BD3 A;  2EJF A;  2LNV A;  1JJ2 A;  2LCC A;  1FXX A;  2DD5 B;  2RB6 A;  3CCL A;  3CCM A;  5DM7 R;  5A2Q E;  2DAQ A;  1QVG S;  4X34 A;  4BAC A;  1WQ7 A;  3HPW A;  3HBL A;  3GNF B;  3M54 A;  4N0A A;  2VXE A;  4YTL A;  3G6E T;  1E7P A;  1VQK A;  1M9S A;  2DJZ A;  2EKO A;  3FB9 A;  4PJO A;  3VJP A;  1N9S A;  2K2V A;  4Y28 E;  3VKI A;  2VGM A;  1N8R U;  1K9M U;  3HSB A;  4J5Y A;  2M16 A;  1G3W A;  4M77 C;  3HP9 A;  1KC8 C;  2PVG B;  3RMQ A;  2E1H A;  2RI5 A;  1ZQ1 A;  2QQR A;  1Q81 U;  4RG8 A;  2DXT A;  2LTO A;  1X75 C;  3BDU A;  5LJ5 g;  4RMO A;  4C92 F;  1IRE B;  1S72 A;  2OTL A;  1Q86 C;  5FRN A;  1N6A A;  4M78 B;  2KSS A;  5IT9 E;  3LW5 E;  3V7R A;  4M77 B;  1JJ2 S;  3CCE T;  3H4C A;  5J39 A;  1VQ8 A;  2KMG A;  4F7U G;  2XIC A;  2K5L A;  3MET A;  4DOV A;  2K4Y A;  2JZ2 A;  4WF2 A;  4JLG A;  2ZZD A;  2DTI A;  3GP8 A;  1VQ7 A;  2O4X A;  2CZ7 B;  1R8O B;  3N5B B;  3OSS C;  4BI3 A;  3OYG A;  3E19 A;  2QA4 A;  1FWZ A;  2D0Q B;  2MWP A;  4PJO F;  3JCM W;  3RER A;  1KG1 A;  5CAI A;  2LQ8 A;  3NFC A;  3HFN A;  2VXF A;  1YCY A;  2G3R A;  3AHU A;  1WJQ A;  2BKD N;  2RJF A;  4XTY A;  4HNV A;  2LRQ A;  1Y96 B;  3A5Z B;  3M4G A;  4R55 A;  2QQB A;  4E7H A;  1OZ2 A;  2DEQ A;  3CEY A;  2LDM A;  4JRK A;  2KK4 A;  1B34 A;  3DB4 A;  3CCS A;  3OW2 A;  2EQK A;  2XK0 A;  4C92 C;  1M1K C;  4KUD K;  4N4G A;  1VQ7 T;  3CC7 T;  3P8H A;  2M0O A;  4MML A;  5GMK e;  4AI6 A;  1RI0 A;  4C8Q G;  4M7D E;  2RHI A;  3DL1 A;  4PKC C;  5GAO r;  4M75 G;  3S3O A;  4BE0 A;  2E10 A;  5GAM d;  3VYG B;  3X28 B;  3J80 E;  4MZT A;  5GAN h;  2DXB B;  1K8A U;  3C94 A;  4Q5W A;  4C92 B;  1Y71 A;  3QZ9 B;  4MFD A;  1PSE A;  5A0L A;  3PNW C;  2DTO A;  5L8R E;  5GAM f;  3O8V A;  3JCM h;  1TH7 A;  3VV0 A;  5GAN 4;  3DKM A;  5LJ5 j;  4RCC A;  2PVO B;  2L8D A;  4PJO C;  4ZN3 A;  5I2S A;  4HNT A;  3RES A;  3PGG A;  4OMF B;  1BYM A;  1YBY A;  2XDD A;  2C06 A;  4ELZ C;  3OW2 S;  4HL4 A;  2E70 A;  2DXC B;  3OYY A;  3A8L B;  1Y7X A;  2DZC A;  2WSE E;  3P8D A;  4M78 D;  2ZPG B;  1MHN A;  4ZGE B;  1JBM A;  2P0Q A;  4FM4 B;  2P0P A;  4PJO B;  3HFO A;  4M77 D;  3T9N A;  3CMA T;  1VQ9 T;  4KBM B;  2K3Y A;  3BG5 A;  3X26 B;  4XU1 A;  4JX4 A;  2EIF A;  3INZ A;  4QQ6 A;  2E65 A;  3FJP A;  3KXT A;  3MEW A;  4JUV A;  1SSF A;  2V8I A;  3TW7 A;  5GAO m;  4AKI A;  3L2Z A;  2QDJ A;  2XI9 A;  1M5Q 1;  3FC3 A;  3JB9 J;  1YHQ T;  1YJN A;  1M90 U;  4MDW A;  1Y07 A;  3JCM J;  4AKG A;  3ZFJ A;  3LWI A;  1XOV A;  4BDY A;  4QVC A;  4QVD A;  1OI1 A;  3I55 A;  1BI1 A;  5LJ5 h;  4ZGJ B;  2LQK A;  2CZ0 B;  2GF7 A;  5GAO l;  4IKF A;  2EQM A;  2GFA A;  4M77 E;  2LC4 A;  2ZZD B;  3L1A A;  3A8M B;  2RHY A;  2V8J A;  3DB3 A;  2O4X B;  4II1 A;  4C0D C;  4LD9 K;  1QVF A;  2RH2 A;  3OY9 A;  4C8Q A;  2CZ6 B;  3FEO A;  3QXE B;  4Z02 A;  1WNL A;  4M75 A;  2RHZ A;  4F7U F;  1Q82 C;  3JSC A;  5GAN g;  2FL7 A;  2HQE A;  4BE2 A;  3URG A;  4C0F A;  2VUB A;  5EG2 A;  4EDU A;  3JCM g;  4JX6 A;  2EAY A;  2O01 E;  2G77 A;  5J26 A;  2QTX A;  4KUI A;  1DJ7 B;  1PSF A;  2E5Q A;  1QW1 A;  5CKB A;  4C0D B;  4C92 D;  5GAN 7;  5LL6 S;  1B34 B;  4VUB A;  3CCQ A;  5A0G A;  1VQ5 A;  4XTV A;  4XQ3 A;  2WJ9 A;  3UWN A;  4MIM A;  4HA8 A;  2E12 A;  3QYB A;  1YJ9 A;  5HK3 A;  4HCC A;  4M7A A;  3OS5 A;  3X24 B;  4XU0 A;  5GAN d;  3BFM A;  2F5T X;  2ZPB B;  4CI0 C;  5HKC A;  2E41 A;  3CXC A;  2KVQ G;  2L5Q A;  2XDB A;  2BS2 A;  3JCM d;  2ZPH B;  1ZHI A;  2FYK A;  4E7L A;  5GAN 5;  1QVF S;  5D6Y A;  2GCX A;  3E1S A;  2HD0 A;  2R5M A;  4HT9 A;  3M9Q A;  4PJO D;  4A4K A;  3CCJ A;  1O75 A;  2BUD A;  2DXC A;  3V7S A;  1VQ5 T;  4C8Q F;  4LDV A;  1VQ6 T;  4GY5 A;  1HK9 A;  4M75 F;  3LGL A;  4M7D G;  4QQG A;  1M1F A;  5CKH A;  4C92 E;  1WGS A;  1YJW T;  4V2S A;  3QUI A;  4M78 C;  1BIA A;  3VUZ A;  5DLQ E;  4J6Y A;  2B8A A;  2LVM A;  3OB9 A;  3ME9 A;  4PLI A;  4X9D A;  4DQ2 A;  2QEX A;  1JB0 E;  4JJN K;  1VQO A;  4ATO A;  3CCL T;  1I8F A;  1WJR A;  3CXC S;  3CCM T;  3DLM A;  1KQ1 A;  4JS5 A;  4M7A F;  5EJC A;  4OGE A;  4FT2 A;  2LCL A;  4C0Z A;  5CK9 A;  1EIF A;  1YIT A;  4OB1 B;  1K9M C;  2I2L A;  2PU9 B;  2X4Y A;  3OYL A;  5GAN j;  1VQK T;  4J8O A;  3OSV A;  5GAM e;  4TVR A;  4PJO E;  5GAN 6;  1W2B A;  2CKK A;  1JRI A;  2OTJ A;  2RI2 A;  5LJ3 g;  4HNU A;  4GLK A;  5CVI A;  4BI4 A;  1Q81 C;  2RJC A;  2XG8 D;  3SFM A;  4OB3 B;  1KHI A;  2QQ9 A;  3M58 A;  5LJ5 d;  3LWH A;  5GMK m;  4RCB A;  3CCV A;  4P5N A;  3RUX A;  3UT1 A;  5M9O A;  3CD6 T;  4A4F A;  4JRQ A;  2OTL T;  1LJO A;  4LDW A;  4JRI A;  1S72 T;  2ZPE B;  4LD6 A;  2BS3 A;  5LJ5 f;  3VKG A;  1H3Z A;  2XKO C;  4LDU A;  2EJG A;  3PMI A;  2K5I A;  2BS4 A;  1U8R A;  1YIJ A;  2QF7 A;  5J3B A;  2R57 A;  5C0M A;  3SB2 A;  3L2U A;  1VQ8 T;  4B9X A;  2DTH A;  4C8Q B;  2HAX A;  3OYM A;  4HLQ A;  1I81 A;  2LX9 A;  4M75 B;  4E47 A;  4IUU A;  4M7A C;  1G3S A;  4J7F A;  3QZ5 B;  3JAM E;  4BY6 C;  3CC4 A;  2YHT A;  1W2B S;  2MI6 A;  3L42 A;  3HRT A;  3NTK A;  2QA4 T;  1Q7Y U;  4M77 G;  2KQW A;  1YI2 A;  4OF1 A;  4XAX B;  5CQY A;  4C5E A;  5FU6 C;  1VQN A;  2WSC E;  4FIB A;  5GAO q;  3MHX A;  2KY9 A;  4M7D A;  4A53 A;  2HQX A;  4FU6 A;  4M7A B;  3GPL A;  3SWN A;  1WPY A;  4BY6 B;  2FB7 A;  5A0D A;  5LJ3 h;  4LDY A;  4IUT A;  4NS5 A;  3VUB A;  3CCS T;  4N0A C;  3MO8 A;  2MF2 A;  4XTW A;  4JRP A;  3VYH B;  5I2M A;  5FU6 B;  3QDR B;  3NTI A;  4M6V A;  3FDR A;  2EQU A;  4OB2 B;  2LT1 A;  3UDC A;  3MEU A;  3JB9 F;  3HKS A;  4L5G A;  1BI2 A;  2K5F A;  4MZP A;  2NLU A;  4F7U A;  4ZTJ A;  5GMK i;  1LNX A;  3PTA A;  4BBR M;  3SDZ A;  4HT8 A;  3QYG B;  2IVW A;  3L2Q A;  3OYJ A;  5DY9 A;  1XQH A;  1NJI U;  1I5L A;  1OYX A;  4M7D F;  3JB9 I;  4MFE A;  1HXD A;  1X6O A;  4CRI A;  4JDS A;  2RM4 A;  2YLC A;  4C92 G;  3G4S A;  3OS2 A;  1WQW A;  1UGP B;  2K3X A;  3M56 A;  5KE3 A;  3CC2 A;  3RMS A;  4EMK A;  1G3T A;  3BW1 A;  3ASK A;  3CBO A;  3QG1 A;  2KAF A;  4PL6 A;  4RG2 A;  3OYF A;  2DXU A;  4OGC A;  4LDX A;  3V8K A;  5GAO p;  2M1H A;  4M78 E;  4C8Q D;  1VQL A;  2JN0 A;  3BG9 A;  2WSF E;  4ME7 A;  3I56 A;  3GF5 A;  4M75 D;  4MDX A;  3RIR A;  5FU7 C;  1K73 U;  1M90 C;  4Y91 A;  2DZ9 A;  4A4G A;  1D3B A;  4C0G A;  3HL8 A;  3A8O B;  3QO3 A;  3OS0 A;  1YJN T;  2BIV A;  3ZEH A;  4QVZ A;  4PJO G;  2XD0 A;  2JUF A;  3KBG A;  2DIG A;  3RKW A;  2FVU A;  4RKU E;  1QP2 A;  4BDZ A;  3JRZ A;  3PIP A;  1NPR A;  1VQP A;  4LOC A;  2L3R A;  3CPF A;  4JLI A;  5FU7 B;  2R5A A;  4M7A D;  3I55 T;  3EAE A;  4IUR A;  3V7C A;  2EJ9 A;  2JOY A;  3CME A;  1VUB A;  2ZPF B;  1P92 A;  3SWN C;  4EMG A;  1UGS B;  4O5V A;  3JCM P;  2EWN A;  1QVP A;  3OYK A;  3TEE A;  3JCM c;  1XNI A;  5IN1 A;  1BIB A;  4BUG A;  3LX7 A;  2QQS A;  5LJ3 d;  3EFS A;  3ER0 A;  5GAN f;  4M7D B;  1X01 A;  3X25 B;  1KD1 C;  3C4S A;  4X9C A;  2GQV A;  3SWN B;  5LJ5 e;  3JCM f;  3CCU A;  2V8K A;  3PFS A;  1N27 A;  4FSX A;  2RJE A;  3PT9 A;  4J6W A;  4MZM A;  4UC4 A;  3CCQ T;  4DA4 A;  2M9U A;  5FRO A;  3PMT A;  3CME T;  3L2R A;  2JNG A;  2L89 A;  4IUV A;  5CCA A;  1YJ9 T;  4M7A E;  3GNG A;  5GMK j;  3OYE A;  3HRU A;  2QFZ A;  2R58 A;  3TU4 K;  3LGF A;  1FKM A;  3BY7 A;  2ZPI B;  3J7A F;  3G6E A;  1KQ2 A;  4C5H A;  3HZJ A;  2YLB A;  3WVD B;  3V8L A;  4PNO A;  2QXF A;  2ZCF B;  3QPH A;  2D6F A;  2IG0 A;  3S6W A;  2DKG A;  3S3N A;  3C95 A;  4NC6 A;  3QYH B;  3CCU T;  2DD4 A;  4F7U B;  3QJ6 A;  1M1G A;  3CCJ T;  3QWL A;  2DVE A;  1WJS A;  3CCR A;  1KC8 U;  4EMK C;  3WXM B;  1FX7 A;  4OP0 A;  2RA2 A;  5AYF A;  3A8H B;  2QI2 A;  1KQS A;  2E64 A;  4C5G A;  2VV5 A;  1G3Y A;  5KCO A;  2X35 A;  2XID A;  2OAU A;  3FIF A;  5LJ3 j;  2XHC A;  3DLL A;  3TW6 A;  1QP3 A;  3CCE A;  1Q86 U;  3OS1 A;  3OYN A;  1VQM T;  2QEX T;  2PVD B;  3QKJ A;  4J6X A;  4MMK A;  1VQO T;  4C8Q C;  4ELJ A;  4XTZ A;  4EMK B;  1NZ9 A;  4O6J A;  4ZTF A;  4M75 C;  4XU2 A;  3JCM b;  2JTF A;  3MEV A;  2RHX A;  3EFR A;  2XU8 A;  3CCR T;  3C12 A;  1YIT T;  4B9W A;  1BI3 A;  3V8J A;  5CKD A;  3JB9 D;  3G71 A;  1O9S A;  3E9F A;  2KMT A;  4R56 A;  5GMK h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...