2CYZB

Photo-activation state of fe-type nhase in anaerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title photo-activation state of Fe-type NHase in anaerobic condition
rcsb
molecule tags Lyase
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cyzB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cyzB02
2QDYB 5L8RE 3X25B 3X28B 1UGQB 2PU9B 2WSCE 3A8HB 2ZPGB 2PUOB 2DD5A 4Y28E 2ZCFB 3QZ5B 1V29B 3QYHB 2PVOB 2DXCA 2PVDB 2CZ7B 3QZ9B 2PVGB 4RKUE 2CZ1B 1UGPB 1UGRB 3X24B 3VYGB 1PSEA 1AHJB 2DXCB 4ZGDB 2D0QB 2ZPEB 1UGSB 3A8GB 2ZPHB 4ZGEB 3VYGA 1DJ7B 2DPPB 2DXBA 3A8MB 3VYHB 3HHTB 1PSFA 2ZPBB 3QXEB 4OB0B 2ZPFB 2PUKB 2DXBB 2ZZDA 3LW5E 2O01E 2CZ6B 2CYZB 4ZGJB 4OB2B 2WSEE 1GXIE 1JB0E 4XK8E 3WVDB 4FM4B 3QYGB 4OB1B 2CZ0B 2ZZDB 3A8OB 3A8LB 1QP3A 3WVEB 2DD4A 2AHJB 4KT0E 3X26B 1QP2A 2ZPIB 1IREB 4OB3B 2WSFE 3X20B 2DD4B 4L6V5 2DD5B
chains in the Genus database with same CATH superfamily
1RLQC 3PVLA 4X1VA 3FEOA 2KROA 3JCMW 1VQ9Q 1QKXA 2VXFA 4EORB 4E7LA 2QTVA 3H0HA 3G33B 4EOOB 2RPNA 3IQLA 3QZ5B 4RTZA 4AI6A 3CMEQ 1UTIA 5GAN3 5FROA 2Y4YA 3E9FA 2QQSA 1KC8C 1WFWA 2CJMB 1SHFA 4F7UF 2PVGB 2XK0A 1SEMA 1PKDB 3EFSA 1G3NC 3CCSQ 1VQ7Q 5GANd 2K79A 1JSTB 3VKGA 2AKLA 2EFIA 1H4LD 1K9AA 1G3WA 4QSHA 3HFNA 4PJMA 2CP5A 1JXMA 3OBYA 1D0YA 3D7SB 5D6WA 3VYGA 4M78B 2FPEA 3LLRA 2WEVB 3O5ZA 3CCMQ 4OMPA 5IXBA 1VYVA 1VQLQ 4MFDA 4OGCA 3CMAQ 4F7NB 2DEQA 4M7DE 2RHXA 5KYNA 1OIYB 2CCIB 4C0DC 3OYKA 1YJ9Q 1K8AC 2HEQA 4NOYA 3UT1A 3HKSA 1R77A 2K57A 4B9WA 1QQJA 4CFNB 1MV0B 2EBPA 2OTJT 4HL4A 2EW3A 4M75D 2AK5A 2VGNA 3RMQA 1ABQA 1MMAA 1K76A 4XAXB 2UUEB 2NUTB 3EJ1B 5I22A 5D6XA 5HBEB 3QUIA 4CRIA 4IKFA 1YN8A 4J5YA 3LQ5B 4NL3A 5LMKB 1RAAB 2MI6A 5GAMd 3QG1A 3X26B 3I35A 5ECAA 3LX7A 3QHWB 3HSBA 1KK7A 2DJZA 1X6BA 1Y96A 2DLPA 1QP2A 1JSUB 3QHSA 4BCPB 5FU6B 1D3BA 4GLMA 3MP1A 2OTLA 4PFZA 3CBMA 4TVRA 1BCMA 1BI2A 4MFEA 3QKJA 3F5XB 5DY9A 3J80E 4Q5WA 2V1RA 3M5AA 3PE0A 3MHXA 4M78F 2EQIA 2EJFA 4IIOA 4E2FB 1VYUA 4PK4A 1QVFA 1H3ZA 1N9RA 2D0NA 1BIBA 4ME7A 5FLXE 2EYXA 2XIDA 2PVOB 3SWNA 2GQIA 2ESWA 2V1QA 2Y4XA 1TS9A 3JCMQ 2VC8A 1W4SA 2COZA 3BG3A 5CK9A 4E7KA 4XTUA 2LCCA 3JB9D 1YJNQ 2M9UA 4BY1X 4BI3A 5HNBB 2L3QA 4M7AA 2P0PA 4CC2A 2X1NB 1G2BA 4Y92A 2P0QA 2BS3A 3RDVA 3E19A 4AKHA 4BCFB 3CCUQ 1H25B 3AHUA 4C0GA 2WIPB 1KHIA 4EC8B 1AWOA 3A5ZB 2M0OA 4KRDB 2F2WA 4UC4A 2L3SA 3RR6A 3LH5A 1WPYA 2KNBB 1M9SA 2KRMA 2NWMA 2QGSA 4ELJA 3OMGA 1R0BG 4C0FA 2PUKB 4OGRB 3LW5E 3JCMf 3S6WA 1W70A 5GMKj 4PLIA 2W9ZA 1ZUUA 4ELZC 1UECA 5DLQE 2E6ZA 3S3MA 2DERA 1H1QB 1H641 4PJNA 4M77A 3JAME 1Q86U 3VU3C 3J81E 4CC7A 3EH2A 4PJOE 4F17A 3NTKA 1IB8A 2VVKA 1Q86R 2PJQA 4OVAA 5A0LA 3TNHB 1YWOA 5HKCA 3GIBA 2OTLT 1BYMA 1HXDA 4KGZB 3VJPA 4QVZA 3EFOA 4M7AG 3OYBA 1XJWB 5IDNB 2VGMA 1YCYA 5CQXA 2KBTA 3E1SA 2B86A 2L8DA 5I2MA 1JEGA 5GANj 1U5SA 3CC2T 4J9DA 4C8QD 3DLLA 2F1LA 4DOWA 4XTVA 5GAN2 1D3BB 4K11A 4QKUA 1VQOQ 2E5KA 4BCHB 4J7FA 4DBFA 2ZAEA 4HT8A 3NFCA 4C5IA 4NC6A 1VQ8A 2K5FA 1OGUB 3VS6A 2EIFA 3CCRQ 1JRIA 1IHWA 1VQPQ 3AT1B 3MP6A 4FCYA 1NJIU 1UDLA 5LL6S 1OKVB 2FHDA 1F1BB 4HNUA 3SWNB 4PNOA 1MGQA 2V8KA 2RQVA 1HYOA 1QCOA 2F5KA 3JB9J 4L5GA 3I56A 2BZXA 3TSZA 1PD1A 2R5AA 4M77G 2CSQA 4ORZA 4AMCA 2R7GA 1XO2A 2JUFA 3CEYA 2YT6A 1GCQA 1VQNA 2E6NA 4C92D 1UNGD 1TUGB 2RK1A 3HB9A 1BK2A 4RMOA 3O8VA 5GMKm 3F70A 3QXEB 1YJWA 5GAMj 1Q81U 2DL5A 1TFBA 4EOLB 1B7TA 5KH6A 2YRVA 4G6LB 3JCMc 1Q81R 1KG1A 4ZN3A 1YIJQ 1N4MA 2XKOC 4JX5A 2W0ZA 5IXFA 4FM4B 2HMAA 2CDTA 2YLBA 2LCSA 5M9OA 3RESA 1UG1A 1VQ6Q 4BCNB 1Y0MA 2LX7A 3OYAA 2MF2A 4CFVB 2RF0A 4NS5A 4ELLA 1LPLA 3N5BB 4KGVB 5GANe 2QEXQ 4M77B 1FMKA 3RUXA 2YUOA 4J9BA 1UJYA 4R56A 4Z88A 4RCBA 4F7UE 1C1AA 1E6GA 1WHKA 3JB9I 2XHCA 3CCQA 1K4US 3ASKA 2E10A 2AZVA 1KC8U 1VQ8T 3EFOB 4PL6A 4A4GA 5CCAA 4JJDA 5CKHA 3QYHB 1KC8R 2JN0A 2WACA 3HZJA 5I21A 3UDCA 2WMAB 3PIOA 2KQWA 5FGKB 1NM7A 3R6NA 1EX4A 1URCB 3BW1A 3QYBA 1VQ5A 3I56T 2CP3A 2KI7A 2D0QB 8AT1B 3OYEA 1ZBJA 2PHGA 5EG2A 3VS3A 2CREA 2ROLA 2ZPHB 4JUVA 2J6FA 4ROEA 3CCJT 2DRMA 3TSWA 3VKHA 3QWYA 2LNVA 5GAMe 1YJWT 2OAUA 2C0TA 3QIIA 5I2SA 1K8AU 4RCCA 3UPUA 1GUXB 3EGUA 1R8OB 1M3AA 1X69A 1Q82C 1K8AR 2LX9A 3DB3A 1OULA 4OMMA 2DTIA 4M77F 2XDBA 3OBWA 4BDZA 3SEMA 1SPKA 3DKMA 1NPRA 1PC0A 2FVUA 4LNPA 3U23A 2MIOA 1RLPC 3I55A 4EMKC 1UJ0A 4F16A 2EQJA 4B6MA 5IHYA 3M0QA 1X2QA 2DD4A 4P5NA 2HQHA 4EMHA 1OU9A 3L1AA 1NYGA 2RA2A 5HBJB 5CIUA 4OMOA 3CCVA 3BG5A 5CKBA 1VQMA 2AIRB 2IW6B 3CCQT 1IREB 4M75A 2RHZA 3E2UA 4HCBA 2KR6A 1BI1A 3CC7A 4FSXA 1UGQB 1SSFA 4A4HA 5LJ3g 1WGSA 3NTHA 3VRYA 2YWWA 3OYNA 2EJ9A 5I11A 4FSSA 3OW2A 1BBZA 4IURA 2HBWA 2DK3A 2ZCFB 4HKEA 2EQKA 2YLCA 1FMVA 2KMGA 2GGRA 3RGFB 1W2BS 2J7IA 3INZA 4EOQB 1QVGP 3RIRA 4C0DB 1T3LA 4M7DC 3M0TA 1VQ5T 4RTWA 3THKA 2BZ8A 3HRSA 4BB7A 3G6EA 3JB9H 2W9FA 3OYMA 3EG2A 1SF9A 1M1GA 1YWPA 2K9GA 1H1PB 3ME9A 3MEWA 4BXXX 4BY7X 3I5RA 2ZPEB 4MDXA 1EFNA 3MO8A 1S72T 2W10A 2C5XB 2RMOA 3QJ6A 4MMKA 2DXBA 1VINA 2KXCA 3M53A 3M55A 2CUDA 2P4TA 4LD9K 4FU6A 2X4YA 3MEVA 3OB9A 4KUDK 3JCMb 3QYEA 8ATCB 3JSCA 7AT1B 1UB4A 1WJRA 1ZX6A 1ZUKA 1NJIC 4M75G 4BE1A 1RI0A 2QA4A 4PJOD 3WVDB 3CCEA 2K4YA 2KAFA 1P5EB 2PQWA 1QMCA 2D8HA 5D7UA 3PIPA 1W2BP 3G71A 1TTHB 5IT9E 1BKBA 3TW6A 3EHRA 1E6HA 4FL6A 2XMFA 2RM4A 2GTOA 3WXMB 1WHLA 2FG0A 2RO0A 5GMKi 5GAOl 1U8RA 2P4RA 1VQMT 3TN8B 1D1AA 3GPLA 2JZ2A 5FRNA 1G5VA 3ZEHA 2RHYA 4E7ZA 3KUFA 1WA7A 4EOKB 3X20B 3FIFA 2DD4B 2DD5B 2RHUA 2JS2A 3LGLA 1PRMC 1SKUB 3M0UA 1WZOA 1ZQ1A 2BPMB 3CPWA 1JBMA 4JRPA 2WPAB 4DBRA 2LQWA 2WMBB 4M75B 4JX6A 4M78G 3G6ET 5GAN5 2KGTA 1X6OA 4HT9A 1YP5A 4DOVA 3MIAB 2IIMA 1JJ2S 1UNHD 3JB9G 2K3XA 1TUDA 4Z8AA 2MCNA 2JJ9A 1M4ZA 1UGRB 2QDLA 3VV0A 2C0OA 1YITT 3UATA 3JCMJ 3MY5B 4IUPA 3Q1JA 4PJLA 4C8QA 5GAN6 1MMGA 1BU2A 2FO0A 2DBKA 3CCLQ 3H0IA 4M4ZA 5L23A 3BHVB 4HXJA 4MZTA 1XNIA 2DYIA 2CP7A 5GAOr 4RTUA 4PJOC 1BIAA 3CXCS 2RJDA 1VQ4A 2FB7A 4LD6A 4F6SB 1YHQT 2ED0A 2DXBB 4XU3A 3CC2Q 2O01E 2CZ6B 2L3PA 3M03A 1ZSZA 1PRLC 4II5B 1GXIE 4CRLB 2E70A 4EOSB 3GNFB 3L42A 3G71T 1HJDA 3REAB 3QWXX 3CD6A 2WFYB 3TNWB 3V8JA 1G3TA 4C92A 3TU4K 2DTHA 5HK0A 2K2VA 1EIFA 2MAMA 3EG1A 2O9VA 4M75F 1JJ2P 2YUNA 3WVEB 1Y71A 1WX6A 2PZ1A 2G6FX 4A4KA 4BY6C 3TEEA 4HNVA 2QTXA 2JXBA 1E7OA 3I5SA 4N4IA 1AEYA 2AT1B 2LNHB 4IMYB 2IW8B 2GNCA 4M7AE 2EYWA 1U3OA 4C8QG 2MMPA 1YNZA 2GFUA 3KHIA 2HNIA 3EGXA 4ATOA 3EIDB 1FWZA 3NTIA 1UGVA 1PD0A 1ZUYA 2MWOA 2JTMA 4EOMB 1B07A 2QQRA 5KYWB 4AT1B 1NE8A 3CXCP 4X34A 2JVVA 5FU7C 4O6JA 1WJQA 2L5QA 2G3RA 2BIVA 1X27A 3EHQA 2L2PA 4JLGA 4BCJB 1RL2A 2NYSA 4EMKA 3K7AM 4Z02A 4OGEA 2C6TB 2DL3A 1VQ9A 3UWNA 4DEYA 1ZA1B 4A54A 2D1XA 4C92G 3JCMP 3CMEA 4M77E 3JB9F 3HFOA 4FYYB 1VQ4T 2GCXA 1W98B 1Q82U 4C8QB 2A0FB 2L3RA 1AZGB 4JRIA 4IUTA 1I07A 3VS1A 3JCMg 1R0CB 1Q82R 3DJBA 3CCSA 1GH6B 1VQ7A 4FYWB 1QCFA 3HL8A 5EJCA 5GANg 2Z0WA 4RODA 1N27A 1OEBA 1VQ8Q 3CD6T 4MIMA 4AG1C 1M8MA 2IW9B 3CCMA 2KR3A 3PGGA 1T3SA 1VQLA 3FB9A 4WF2A 2LQ8A 2E3HA 1ZSZB 1NZ9A 2RJCA 2K5LA 3OS0A 1H27B 3L2WA 6AT1B 1HD3A 1YJ9A 3QJYA 4F70B 5ACBA 3HO8A 1JU5C 3BLHB 4C92B 1Q7YU 4CFXB 2O88A 4RG8A 3CBPA 5GANf 3GNGA 4BCKB 3CCJQ 2R5MA 4N0AC 2H8HA 4R0KA 5HBHB 2WIHB 4L6V5 2W99A 3PMIA 4J6YA 1YBYA 2QG9B 2EJGA 2QQ8A 3PT9A 5FWCA 1C6VX 2HSPA 4CFMB 2MK5A 1OOTA 1M3CA 3C94A 1H3HA 1KD1C 3EGXB 5GAMg 4C8QF 2KK4A 4AFZC 2FYKA 2BS2A 4OMQA 1QVPA 4ROCA 3QZ9B 2X3WD 2VWFA 1WLPB 4JJNK 3OSVA 4LE9A 1KQ1A 2K6DA 1GCPA 1I0CA 1FXXA 1W1FA 2KMTA 4ZGDB 1WJSA 3C95A 3A8GB 1AZEA 5IHNA 2M0YA 2Y90A 2JTEA 4JS5A 3M58A 4IUUA 4XU0A 4EMKB 2QGGA 2L89A 4AG2C 1KQSS 5GAMf 2X51A 1K9MC 3CCQQ 3G4SQ 1JQQA 3DDPB 4AFSC 1LVKA 2DM1A 4V2SA 3RERA 1YJNA 1NJIR 4C92F 3SHWA 2F5TX 2O31A 1MMDA 2ZZDA 2QI2A 2A3LA 1U1TA 2GF7A 4PFOA 2PNIA 5LJ3h 3CCMT 4YTLA 3I9QA 2B8AA 4IUVA 4CFUD 2ENMA 1C0MA 3CCUA 1GUXA 4BI4A 2GFAA 1X43A 2D9TA 2EKHA 2QFZA 2C4GB 2ED1A 3A8OB 4HCZA 2E4HA 2FPFA 2X4WA 2XDDA 1YI2A 4C5HA 3OYGA 1N8RC 2K5IA 4PLLA 2EPDA 2ABLA 3OW2S 4LUDA 3H9NA 3OS1A 2CP0A 5LJ5h 2CCHB 1VIFA 4JX4A 1S72Q 5KCHA 2LRQA 1NLPC 4PJJA 2DETA 2V26A 2FL7A 3VS0A 2DE0X 4AFUC 1KQSP 1ARKA 3MPUB 1O9SA 1OIUB 2XU8A 1GL5A 2GBQA 4JZ3A 4BCQD 5I5ZB 4BI8B 1MUZA 5J26A 5GAN8 1OL2B 4D6WA 2E5QA 2FRWA 1VYTA 3V8KA 2CH4W 2LP5A 2OAWA 2QDJA 2M02A 2JMAA 3X24B 3RKXA 3MEAA 1M1KU 3FC3A 3DTOA 3OYCA 3OMCA 1MV3A 1VQOA 5C6SA 2KRSA 1WXUA 2OX7A 3LYIA 2A28A 2DPPB 2NLUA 1VQMQ 1SRLA 1WYXA 3CCRA 5J39A 3A8MB 4MZPA 1VQPA 2RI5A 3OW2P 5LJ3d 3UF4A 3HHTB 4OMNA 4D8KA 4FW2A 2MWPA 4J9FA 3CCUT 3SDZA 3DB4A 4A53A 1TD6A 1H28B 4M75E 2LW4A 2P0KA 1ENWA 1WNLA 3UA7A 3MY1B 2G9XB 3P8HA 4N4HA 2VXEA 4ZGJB 4J8OA 1KIKA 4M7DD 1VQNT 4XK8E 4BACA 3G6EQ 2XDPA 2DL7A 3CPFA 3NMZC 2ZZDB 4ZNXA 2JS0A 1YI2T 4OR5B 3NHNA 2EYZA 2RNAA 2DYBA 2HL3A 3MI9B 1YFNA 4M7AD 3M0SA 2EQUA 3KXTA 1QP3A 5LJ5d 1YITQ 2LC4A 2AKKA 4ZTFA 4GBQA 4KT0E 2DIGA 1LCKA 4XTXA 4F7LB 2QQBA 3V7SA 1YIJA 1XOVA 2DIQA 4YC3B 1GBQA 2RHIA 2WSFE 5A0GA 3VS5A 2UZBB 4JJCA 3HPWA 1ZHIA 1UUEA 2UZEB 5D6YA 2DZ9A 3OSSC 3X28B 1X6GA 2IPOB 3EGDA 2DXUA 1VOLA 2DA9A 1IGQA 2QXFA 4PJOB 3BHUB 4BDYA 3A8HB 1Z9ZA 2ZPGB 2DJQA 2RQRA 4C5GA 4DBHA 4CI0C 2DD5A 1X01A 4RTTA 4M78E 4HVVA 1YHQQ 2BE9B 1ABOA 1EZZB 5CKFA 1PKSA 2CZ7B 2BKDN 3V7RA 4EIKA 1I8FA 2R57A 3GOXA 3RBBB 2FEIA 2DNUA 2XICA 1AWJA 1Q7YC 2KT8A 5IHIA 1VQOT 4D8DA 2EUFA 3LGFA 2COYA 2FZGB 2EYQA 5GAOq 2EGEA 4F14A 2KE9A 1OI1A 1LNXA 2CT3A 3C4SA 1OZ3A 4RUGA 1DJ7B 4C0ZA 2FZKB 3SWNC 4FW1A 1LJOA 3TW7A 3VYHB 4JLIA 3R6OA 2PK9B 3EG9A 3M57A 2KSSA 2OTJQ 3M59A 4QVDA 4B9XA 3EH1A 4OMFB 3CC4A 2LVMA 1RADB 2HCKA 4OB0B 2OI3A 5GJVB 2C5VB 2DO3A 4M7AC 5KCOA 4LOCA 5KE2A 2ZGWA 1D1BA 2E65A 2KEAA 1HSQA 2F2CA 1PWTA 2VYTA 5HVYB 1CSKA 2EAYA 2QQ9A 2CZ0B 4LDXA 1G83A 3OA6A 1M2VA 4J7IA 3TNIB 4PJOF 4RTYA 3TQ7P 1M90U 2LT1A 2NUZA 2RJEA 2D6FA 5CYIB 1PG5B 3ZBDA 1H8KA 1OYXA 2MPXC 1ZA2B 5AYFA 2LQKA 3FLGA 3SB2A 1MHNA 2J6OA 2KT1A 2ZPIB 4C8QE 4O5VA 2EGCA 3DLMA 3I55T 4BE0A 1KJWA 1FVVB 1RABB 2E64A 1VQ4Q 4UN0A 5GAN4 2QDYB 4FYXB 1G3YA 1KD1U 4PFPA 4M77C 3HRUA 4EOJB 2CP2A 4BUGA 5CKDA 3JCMh 5L2WB 2VKNA 1KD1R 4WTOB 5KE3A 3CCVT 3VUBA 3VS2A 4HNTA 1M5Q1 1OU8A 1QVFS 2JNGA 5KYWA 4EC9B 3EGDB 1M30A 5LJ3j 3CC7T 4RKUE 1KSWA 2CZ1B 3CD6Q 2UZDB 4JRQA 2GTJA 4FT2A 4BCGB 1U1SA 3OYYA 1AWXA 4ANJA 3BHTB 1BCOA 2DVJA 5A0DA 2A7YA 3MEUA 3RNJA 3ZFJA 2DX1A 2E3IA 2KVQG 4LXCA 3PTAA 4J83A 1UGSB 4Y72B 5IN1A 4C92E 4IUQA 1K9MU 2M1HA 5HQ0B 2IVWA 2YXYA 4F6WB 4QW2A 2H3EB 3H8ZA 3CC4T 2I0NA 4AFQC 1NPPA 1K9MR 2A37A 4HVWA 2G77A 2C5NB 1NBEB 1V1CA 2WJ9A 1M8VA 5LJ5j 3LWHA 2HQXA 3E9GA 1IRXA 1QVGA 3QHRB 1IZ6A 1KHCA 4RTXA 2EWNA 2RN8A 3L2UA 3H41A 1I81A 2EYYA 1M1KC 2YDLA 5DLOA 2YRDA 3EG9B 4OB2B 4BCMD 2WSEE 4KRTA 2FZCB 2HBPA 3H0FA 3OQ5A 2C5OB 4YOZA 1OZ2A 2F2XA 3CBOA 2OTLQ 2DVEA 3HP9A 3QO3A 4OB1B 2EGAA 1XQHA 2KRNA 3BFMA 1GCQC 1QVFP 1N8RU 1V76A 1OKWB 3OYHA 1N8RR 3CQTA 5CKEA 1KXUA 2QA4T 1TH7A 4QQ6A 4CC3A 3CCET 5IF1B 1WHHA 5HCKA 1M2VB 1WHJA 2GQVA 1J3TA 1IHVA 3DDQB 1K73C 1SG5A 3JCMd 2I2LA 2K3BA 3S3OA 2C0IA 2HKQB 3ULRB 1M2OA 4J9EA 4XQ3A 2BUDA 3EAEA 4Y91A 3QBYA 2DEUA 1OV3A 1JKWA 5LJ3e 1W2BA 1PHTA 1V29B 1D0ZA 1GY3B 1ZLMA 2HDAA 3M4YA 4ZN1A 2DXCA 2COWA 4YOSA 5KYUB 2LJ3A 1OPLA 1WQ7A 2J6KA 3PFSA 4PKCC 1TXQA 2CKKA 3OYLA 5IHKA 2MYSA 4E7JA 2QGFB 1PSEA 3QWLA 3FDRA 2LTOA 1JXOA 2OJ2A 2C06A 5FRMA 4CXAB 2LZ6B 1GFDA 2A36A 2D8JA 3RKYA 5IH2A 5GAOm 5LJ5e 1TWBA 2YSQA 1VQKA 4KULA 4M6VA 2QYZA 3G1JA 2QAZA 1CKAA 4N4GA 1JOWA 2RD1A 1WXBA 2E1HA 2LDMA 1IXDA 1PSFA 2DAQA 1VIEA 4KH1B 1WI7A 1N5ZA 2RB6A 4WCIA 2DRKA 3EG3A 1ZP2A 3CCLA 2LCLA 4FIBA 1B34A 3GTMS 4A4FA 1Z9QA 3FJPA 1D1CA 5CVIA 3JCMX 2MOXA 2LJ1A 5CAIA 1UEBA 1PCXA 2BTTA 3L2QA 4LDWA 2IVXA 4J6XA 1IGUA 3GLXA 1U06A 2P84A 3PO3S 1WIEA 3S3NA 5AT1B 2YUQA 4X9DA 2JGZB 2IG0A 4XU1A 3CC2A 1T0JA 2K7AA 2W96A 4Z6YA 4A63B 4M7DA 3EG0A 2DILA 2EQMA 3H6ZA 1AOJA 5GMKl 2V8JA 2DL4A 4M78D 1UHFA 3M9QA 3SD4A 2EKOA 4QQDA 3CMAA 1RACB 1X2KA 4YOOA 4CFUB 4E47A 3VRZA 2FRYA 2J06A 1M90C 3I56Q 1AWWA 1JJ2A 2UZLB 2E41A 1TG0A 2DTOA 1WHMA 2RK2A 4JRKA 1AT1B 1FX7A 2O4XA 1E7PA 2IN3A 1VQNQ 1UGPB 2LJ0A 1Q7YR 1E9HB 3P8BB 1OQKA 4M75C 2PK2A 2X4XA 4LDYA 3VYGB 1I5LA 1YJWQ 4HCCA 4QQGA 2NUPA 1YI2Q 2DXCB 4XTWA 5ICPB 2KXDA 2X4JA 3B57A 3KFVA 2VV5A 1VQKT 5KYYA 3BE3A 3MP8A 4J9HA 3G7ZA 4GY5A 3OYJA 2LT4A 4KH0B 3CXCA 5FWBA 5GJWB 4J9GA 4KBMB 1P92A 3HBLA 1BI3A 5IDPB 1VQ9T 4LDUA 2EVRA 1WHGA 3QPHA 4ZTJA 4DEXA 3CCLT 4BCQB 2X3XD 4M7DG 2ZPFB 4Z89A 2AZSA 3CMET 4I3ZB 4NSTB 3M4GA 5CQYA 3BLRB 2RQUA 1NEBA 3VS7A 4II1A 1OI9B 4F7SB 4BBRM 1JB0E 1ZBXA 1Y57A 2VB6A 1TOVA 3QYGB 2KYMA 3LH0A 1I4K1 1MNEA 5KYXA 3CCST 2WHBB 1VQ7T 3A1PA 4AKIA 3L2ZA 2QQAA 3M56A 1QW1A 2DFUA 5HK3A 4M78C 1B34B 1Y96B 4DA4A 1FKMA 3FRNA 3L2RA 3OS5A 2WXVB 2SEMA 1OX9A 2CGHA 1H24B 1RI9A 4BD3A 4IIMA 1D09B 1VQLT 3CMAT 4BBSM 2HQEA 1T0HA 2JTFA 1TSFA 4BE2A 2PMIB 3UA6A 5HY6A 1VQ5Q 1YJ9T 4J6WA 3EOCB 3V7CA 4M7DB 3T9NA 4E7IA 3GBQA 1RAIB 1IO6A 4Y28E 2RI3A 1GFCA 5EFQB 1RAGB 1QLYA 2F69A 4JDSA 4PJOA 2PTKA 3A98A 4M7AB 2CUBA 3CCJA 3PNWC 4F04B 1SRMA 2JM8A 5GAOp 1KQ2A 2JT4A 1QLBA 3BG9A 4DQ2A 1YCSB 5GMKe 5DQVA 1N9SA 1AHJB 5FU6C 3V8LA 2QK0A 1NYFA 1H92A 1RAHB 2BE7D 2O4XB 3PMTA 1CKBA 3BDLA 1BB9A 1Y07A 1HK9A 4OF1A 1OPKA 1O9KA 1UHCA 2NUPB 1B3QA 2CS7A 1LOJA 1RUWA 2DL8A 3I55Q 4LDVA 5KYYB 1G8XA 1SSHA 4OMLA 2DF6A 1VUBA 4KRCB 1BI0A 2BZYA 1VOMA 2CSIA 3ER0A 3JCMe 4C8QC 1M1KR 1JO8A 5CEIB 1QKWA 2HD0A 3META 2CYZB 2DXTA 4E7HA 3O0GD 2RQWA 4EDUA 3OYIA 3CCVQ 4R55A 2DMEA 2HKNA 1AD6A 4TTHA 3HRTA 3OYFA 4EONB 1AD5A 2RJFA 3NGPA 1YJNT 2DKGA 3BY7A 4M7DF 4JJBA 1QCNA 3G4SA 3CC7Q 3A8LB 1Q95G 1A0NB 1K0XA 4PJOG 1TUCA 3FJ5A 4EPCA 2K3YA 1H1SB 2AHJB 1WXTA 3NPFA 5KYXB 4M7AF 1K73U 1QMZB 2J05A 1ZSZC 1G3SA 1NG2A 4LN2A 2HL5C 2CP6A 4OB3B 2KDSA 2SRCA 3MKDA 1K73R 2LMJA 3CC4Q 5CR2A 4C92C 3SFMA 1Y7XA 2YHTA 2B9RA 4MZMA 2WSCE 4FX3B 3C12A 1I5OB 2PUOB 3VS4A 1VYWB 3QDRB 5DM7R 3CPWS 5BNJB 2JW4A 2E12A 3L2VA 1O75A 1WDXA 2O9SA 2PVDB 3KBGA 5GAOn 1S72A 1N6AA 1PM3A 1RAEB 1PKTA 1K0SA 2M51A 2I40B 4XU2A 1VQ6A 1M27C 1QVGS 2HZYA 2DMOA 1I1JA 4BCND 3M0PA 4F7UA 4ZGEB 1NEGA 4C5EA 2QA4Q 1KQSA 1UE9A 3CCEQ 2QEXA 5J3BA 3POMA 2XD0A 4OP0A 4M77D 1GBRA 4JPBW 1NLOC 3G71Q 1FYNA 4E6RA 3H4CA 2K2MA 1SHGA 3REBB 4F7JB 2JM9A 1C9BA 2V8IA 1O9KB 3DOGB 1XTDA 3VKIA 3CCRT 2R58A 5EC7A 3JCMV 3URGA 1VA7A 1VQPT 4JS4A 4HLQA 1M3BA 4J9IA 3G4ST 4ESRA 1MMNA 3ZL7C 4N0AA 4KUIA 4JZ4A 4BY6B 3CPWP 1FMWA 4HCKA 2W2HA 2A08A 4KGXB 2JMCA 5CO7A 1Q86C 3J7AF 2XI9A 2RH2A 1H26B 1OL1B 2HSEB 1ZSGA 3BDUA 4XTYA 4E7SA 3MJXA 4CFWB 4NL2A 5FU7B 3BLQB 4F7UG 1H1RB 5L8RE 3X25B 3JRZA 4CC4B 3OS2A 2PU9B 4BCOB 5GMKh 1AISB 1S1NA 1X75C 1YITA 4BCMB 3QSUA 1YIJT 5LJ5g 1M90R 1UFFA 5LJ3f 3JV3A 2F2VA 4FT4A 3NDQA 2O2OA 3TREA 2BKZB 3LWIA 1VQ6T 3GP8A 4A4EA 1F5QB 4J9CA 4M78A 1D3UB 3QDFA 3OY9A 2DZCA 3DL1A 4HA8A 5KYUA 2RQTA 4L59A 2BS4A 1WQWA 2I53A 3OYDA 2ROTA 2FPDA 2QEXT 9ATCB 1PNJA 1YHQA 4F6UB 3MCAB 5GANh 3HTRA 4LUEA 1QWEA 3P8DA 3RMSA 1W6XA 2CT4A 5LJ5f 3C0CA 5DQWA 5IAYA 4X9CA 2M16A 2X9HA 4F7UB 2V22B 3GF5A 2ZPBB 4BCIB 3M0RA 4ELYC 2YRCA 5A2QE 4GLKA 1K1ZA 1MNDA 3RKWA 4QT7A 5GAN7 5LQFB 2NUTA 1QWFA 4MMLA 2CH4A 2L0AA 4FYVB 4AKGA 1RAFB 4RTVA 3VUZA 2KY9A 1Q81C 1ACMB 4DBQA 4EOPB 4EOIB 3EFRA 1GRIA 2XG8D 1UNLD 2VASA 3TCJA 4VUBA 2ECZA 1D0XA 2OTJA 2H3JA 1BU1A 1TU0B 2VUBA 4MDWA 2QF7A 2YUPA 5C0MA 4RG2A 2HAXA 2KYBA 1AVZC 1FINB 2JOYA 4HVUA 4XTZA 1KFZA 3PVQA 4QVCA 2X35A 2ATCB 2LQNA 2QASA 1VQKQ 3TVTA 4EMGA 5GAMh 2DBMA 5FW9A 1OX8A 2RI2A 3M54A 1M1FA
chains in the Genus database with same CATH topology
2EKOA 2KR6A 4QQDA 1BI1A 2FL7A 3CC7A 3CMAA 4FSXA 1UGQB 1SSFA 3FEOA 4A4HA 5LJ3g 1WGSA 3NTHA 3JCMW 2VXFA 4E7LA 3OYNA 4E47A 2EJ9A 1O9SA 3OW2A 2XU8A 4IURA 2DK3A 2ZCFB 3QZ5B 4HKEA 4AI6A 2EQKA 2YLCA 5J26A 4BI8B 5GAN8 2KMGA 1M90C 4D6WA 1JJ2A 2E5QA 5GAN3 1W2BS 5FROA 3INZA 2E41A 2Y4YA 3E9FA 2DTOA 2QQSA 4JRKA 2RK2A 1KC8C 4F7UF 1FX7A 3RIRA 2O4XA 4C0DB 3V8KA 4M7DC 1E7PA 2PVGB 2XK0A 1VQ5T 3G6EA 1UGPB 3HRSA 4BB7A 2QDJA 3JB9H 3P8BB 4M75C 3OYMA 3EFSA 3X24B 2X4XA 1M1GA 3MEAA 3RKXA 1M1KU 4LDYA 3VYGB 3FC3A 1I5LA 4HCCA 3ME9A 4QQGA 3MEWA 2DXCB 5GANd 3OMCA 3OYCA 3VKGA 2EFIA 4XTWA 2ZPEB 1G3WA 4QSHA 3HFNA 1VQOA 4MDXA 5C6SA 2X4JA 1VQKT 2VV5A 3TU4K 3OBYA 3MO8A 5D6WA 3MP8A 3LYIA 4M78B 3VYGA 1S72T 3LLRA 2DPPB 2NLUA 3QJ6A 4MMKA 2DXBA 3G7ZA 4GY5A 3M53A 3OYJA 3M55A 2LT4A 3CCRA 3CXCA 2P4TA 5J39A 3A8MB 4LD9K 4KBMB 1P92A 4FU6A 4MZPA 1VQPA 3HBLA 2RI5A 2X4YA 3MEVA 3OB9A 4MFDA 4OGCA 1BI3A 1VQ9T 4KUDK 3JCMb 4LDUA 3QYEA 5LJ3d 3QPHA 3HHTB 4ZTJA 2DEQA 3CCLT 4M7DE 3JSCA 4M7DG 2ZPFB 1UB4A 2MWPA 1WJRA 2RHXA 3CMET 3CCUT 3SDZA 3DB4A 4A53A 3OYKA 4C0DC 4M75E 1K8AC 3M4GA 1NJIC 4M75G 5CQYA 2P0KA 4NOYA 3UT1A 1WNLA 4BE1A 3P8HA 3HKSA 2K57A 1RI0A 4N4HA 4B9WA 2VXEA 4ZGJB 4II1A 4J8OA 2QA4A 4M7DD 4PJOD 1VQNT 4BBRM 1JB0E 1ZBXA 4XK8E 4BACA 3WVDB 2OTJT 4HL4A 3CCEA 2K4YA 3QYGB 2KAFA 4M75D 2PQWA 2VGNA 2XDPA 3RMQA 3LH0A 3CPFA 1I4K1 3CCST 1VQ7T 2ZZDB 1YI2T 4XAXB 4AKIA 3L2ZA 3PIPA 2QQAA 3M56A 1QW1A 5HK3A 3G71A 5IT9E 4M78C 1BKBA 5D6XA 4M7AD 3TW6A 1B34B 2EQUA 1Y96B 4DA4A 3KXTA 3QUIA 4CRIA 1QP3A 1FKMA 4FL6A 5LJ5d 4IKFA 3FRNA 2RM4A 4J5YA 3WXMB 2LC4A 2RO0A 3OS5A 5GMKi 5GAOl 4NL3A 3L2RA 4ZTFA 1VQMT 1U8RA 2MI6A 5GAMd 4KT0E 2DIGA 3QG1A 3GPLA 3X26B 4XTXA 2JZ2A 3LX7A 2CGHA 5FRNA 3HSBA 2QQBA 3V7SA 2DJZA 3ZEHA 1Y96A 4BD3A 2RHYA 1QP2A 1XOVA 3KUFA 3QHSA 5FU6B 1VQLT 1D3BA 2DIQA 3MP1A 3CMAT 2OTLA 4BBSM 2RHIA 2WSFE 5A0GA 2HQEA 3X20B 3FIFA 2DD4B 2JTFA 1ZHIA 3CBMA 3HPWA 1BI2A 4TVRA 4MFEA 3QKJA 2DD5B 5D6YA 4BE2A 2DZ9A 3OSSC 5DY9A 2RHUA 3X28B 5HY6A 3J80E 4Q5WA 1YJ9T 3M5AA 4J6WA 3V7CA 3LGLA 2DXUA 3MHXA 4M78F 2EJFA 4M7DB 2QXFA 3T9NA 1ZQ1A 3CPWA 4E7IA 1JBMA 4BDYA 4PJOB 3A8HB 1QVFA 2ZPGB 4JRPA 1H3ZA 4C5GA 1N9RA 4CI0C 1BIBA 2DD5A 2RI3A 4ME7A 4Y28E 1X01A 4M75B 4M78E 4JX6A 5FLXE 4M78G 2XIDA 2PVOB 3SWNA 3G6ET 5GAN5 1X6OA 2F69A 2Y4XA 5CKFA 4HT9A 4DOVA 1JJ2S 4JDSA 4PJOA 2CZ7B 3JB9G 2BKDN 2K3XA 2VC8A 4M7AB 1W4SA 3V7RA 3BG3A 3JCMQ 3CCJA 1I8FA 5CK9A 2R57A 1M4ZA 1UGRB 3GOXA 3PNWC 3VV0A 5GAOp 4E7KA 1KQ2A 1YITT 2XICA 1Q7YC 1QLBA 4XTUA 3JCMJ 1VQOT 3LGFA 3BG9A 4DQ2A 2LCCA 5GMKe 1N9SA 3JB9D 4IUPA 2M9UA 1AHJB 3Q1JA 2EYQA 5FU6C 3V8LA 2P0PA 4BI3A 4C8QA 5GAN6 5GAOq 4M7AA 1OI1A 1LNXA 2O4XB 3PMTA 2P0QA 2BS3A 3C4SA 1OZ3A 3BDLA 3E19A 4AKHA 1DJ7B 1Y07A 4MZTA 4C0ZA 1HK9A 4C0GA 3AHUA 3SWNC 4OF1A 1KHIA 1XNIA 1LJOA 5GAOr 3TW7A 3A5ZB 2M0OA 4PJOC 3VYHB 4JLIA 3R6OA 4UC4A 1BIAA 2CS7A 3CXCS 1LOJA 3M57A 2KSSA 2RJDA 1WPYA 3M59A 4QVDA 1VQ4A 1M9SA 2FB7A 4LD6A 4B9XA 4LDVA 4OMFB 3CC4A 2LVMA 4OB0B 4ELJA 3OMGA 4C0FA 2PUKB 3JCMP 1YHQT 2DXBB 1VUBA 1BI0A 2DO3A 3ER0A 3JCMe 4XU3A 4M7AC 3LW5E 4C8QC 5KCOA 4LOCA 3JCMf 2HD0A 2O01E 2ZGWA 2CZ6B 2CYZB 2DXTA 3META 2E65A 3S6WA 4E7HA 3OYIA 4EDUA 1GXIE 5GMKj 2E70A 4R55A 4PLIA 4ELZC 2VYTA 3GNFB 3L42A 5DLQE 3G71T 2E6ZA 3HRTA 2EAYA 3OYFA 3S3MA 2QQ9A 2CZ0B 1H641 4LDXA 3OA6A 2RJFA 3CD6A 1YJNT 2DKGA 1G3TA 3BY7A 4J7IA 4PJOF 3V8JA 4C92A 2DTHA 5HK0A 2K2VA 1EIFA 4M77A 3JAME 3A8LB 2MAMA 3G4SA 3VU3C 1Q86U 2LT1A 1M90U 3J81E 4M75F 2RJEA 4PJOE 2D6FA 4PJOG 3NTKA 3WVEB 3ZBDA 1Y71A 4EPCA 2K3YA 2AHJB 1OYXA 4A4KA 3TEEA 4BY6C 4HNVA 2QTXA 4OVAA 5A0LA 4N4IA 5HKCA 3GIBA 4M7AF 2OTLT 1K73U 1BYMA 1HXDA 3VJPA 5AYFA 2LQKA 3FLGA 3SB2A 1MHNA 1G3SA 4QVZA 2ZPIB 4M7AE 4C8QE 4M7AG 4O5VA 4OB3B 2KDSA 3DLMA 4C8QG 2MMPA 3OYBA 2VGMA 3I55T 1YCYA 2GFUA 4BE0A 3KHIA 2HNIA 5CQXA 2E64A 4ATOA 3E1SA 5GAN4 2L8DA 5I2MA 1FWZA 3NTIA 2QDYB 5GANj 1G3YA 5CR2A 4C92C 1KD1U 2MWOA 3SFMA 2JTMA 4M77C 1Y7XA 3HRUA 4C8QD 2QQRA 2YHTA 3DLLA 3CC2T 4BUGA 4MZMA 2WSCE 5CKDA 3C12A 4XTVA 3JCMh 1D3BB 1NE8A 4DOWA 5GAN2 2PUOB 4X34A 5KE3A 3CCVT 3VUBA 2JVVA 3QDRB 4O6JA 5FU7C 1WJQA 4HNTA 1M5Q1 5DM7R 4J7FA 3CPWS 1QVFS 4HT8A 3NFCA 4C5IA 4NC6A 2E12A 2JNGA 3L2VA 2L5QA 2K5FA 1VQ8A 1O75A 2EIFA 2G3RA 2BIVA 1JRIA 2PVDB 3KBGA 5GAOn 1S72A 5LJ3j 3CC7T 4RKUE 2CZ1B 3MP6A 1N6AA 4JLGA 4FT2A 4JRQA 1RL2A 1NJIU 5LL6S 4EMKA 4Z02A 1U1SA 3OYYA 4OGEA 2FHDA 4XU2A 5A0DA 1VQ6A 4HNUA 2A7YA 3MEUA 4PNOA 3SWNB 1MGQA 3ZFJA 1VQ9A 2V8KA 3UWNA 1QVGS 2KVQG 3PTAA 4J83A 1UGSB 4F7UA 5IN1A 4C92E 4A54A 2F5KA 4ZGEB 4L5GA 4C92G 3I56A 4IUQA 4M77E 4C5EA 3CMEA 2R5AA 3HFOA 4M77G 1K9MU 3JB9F 2M1HA 1KQSA 2IVWA 1VQ4T 4QW2A 2QEXA 2JUFA 3H8ZA 3CEYA 3CC4T 1NPPA 2GCXA 5J3BA 1Q82U 4C8QB 2G77A 2E6NA 1VQNA 4C92D 2XD0A 2L3RA 4OP0A 2WJ9A 2RK1A 4JRIA 4M77D 1M8VA 3HB9A 4RMOA 3O8VA 4IUTA 3F70A 5GMKm 2HQXA 3E9GA 3JCMg 5LJ5j 3LWHA 1QVGA 3H4CA 3CCSA 3QXEB 1YJWA 1VQ7A 1IZ6A 5GAMj 1KHCA 1Q81U 4HCBA 3HL8A 5EJCA 2V8IA 5KH6A 5GANg 2YRVA 1XTDA 2EWNA 3L2UA 3VKIA 3CCRT 1I81A 2R58A 1M1KC 3JCMV 3URGA 5DLOA 3JCMc 1KG1A 1N27A 4OB2B 4ZN3A 1VQPT 2WSEE 4JS4A 3CD6T 1G5VA 4HLQA 4MIMA 2HBPA 4JX5A 2XKOC 3OQ5A 3G4ST 3CCMA 4FM4B 1OZ2A 3CBOA 3PGGA 2DVEA 2YLBA 3HP9A 4N0AA 4KUIA 3QO3A 4OB1B 4BY6B 1VQLA 1XQHA 3FB9A 3BFMA 2LQ8A 4WF2A 1N8RU 5M9OA 3RESA 1NZ9A 2RJCA 3OYHA 2K5LA 3OS0A 5KE2A 5CKEA 3L2WA 2QA4T 5CO7A 1TH7A 4QQ6A 3QJYA 2MF2A 3OYAA 1YJ9A 1Q86C 3CCET 3J7AF 3HO8A 4NS5A 2XI9A 2RH2A 4C92B 3N5BB 5GANe 1Q7YU 4M77B 2GQVA 4RG8A 3BDUA 3CBPA 4XTYA 5GANf 3GNGA 4R56A 2R5MA 4RCBA 4N0AC 1K73C 4NL2A 5FU7B 4F7UE 2I2LA 3JCMd 4F7UG 4L6V5 3JB9I 2XHCA 3CCQA 3PMIA 4J6YA 5L8RE 3X25B 3S3OA 1YBYA 3JRZA 3OS2A 4XQ3A 2BUDA 2PU9B 2EJGA 3ASKA 3EAEA 2QQ8A 5GMKh 3PT9A 2E10A 1X75C 1YITA 4Y91A 1KC8U 3QSUA 3QBYA 1VQ8T 1YIJT 5LJ5g 5LJ3e 1W2BA 4PL6A 4A4GA 5CCAA 3C94A 1V29B 5LJ3f 5CKHA 1KD1C 3M4YA 3QYHB 4ZN1A 4C8QF 2KK4A 4FT4A 5GAMg 2JN0A 2WACA 2DXCA 2FYKA 2BS2A 1QVPA 3HZJA 5I21A 3TREA 3QZ9B 3UDCA 3LWIA 1VQ6T 3GP8A 4A4EA 1WQ7A 3PFSA 3PIOA 3OSVA 4JJNK 2KQWA 1KQ1A 4M78A 4PKCC 2CKKA 1YIJA 3OYLA 3BW1A 3OY9A 3QYBA 4E7JA 1VQ5A 1PSEA 2DZCA 3DL1A 3QWLA 1FXXA 4HA8A 3I56T 4M7DF 2KMTA 4ZGDB 3M9QA 4L59A 2D0QB 2BS4A 1WJSA 1WQWA 2LTOA 3FDRA 3OYEA 2C06A 5FRMA 5EG2A 3C95A 3OYDA 3A8GB 2QEXT 2ZPHB 2Y90A 4JUVA 1YHQA 4JS5A 3M58A 3RKYA 4IUUA 3CCJT 3MCAB 4XU0A 4EMKB 5GAOm 5LJ5e 5GANh 3VKHA 3P8DA 2LNVA 3RMSA 5LJ5f 3JB9J 2L89A 5GAMe 1VQKA 1KQSS 1YJWT 4KULA 2OAUA 4M6VA 3QIIA 5GAMf 5IAYA 1K9MC 4N4GA 5I2SA 4X9CA 1K8AU 2RD1A 2M16A 2E1HA 4RCCA 2LDMA 4F7UB 1PSFA 3GF5A 2ZPBB 4V2SA 3UPUA 4ELYC 1R8OB 3RERA 1YJNA 1Q82C 2DAQA 2LX9A 1VIEA 3DB3A 4C92F 2F5TX 5A2QE 4GLKA 2DTIA 2QI2A 2RB6A 2A3LA 1U1TA 2GF7A 2ZZDA 4M77F 3RKWA 5LJ3h 5GAN7 3CCMT 4YTLA 3CCLA 2XDBA 4MMLA 2B8AA 3OBWA 4IUVA 2LCLA 4AKGA 4FIBA 1B34A 4A4FA 3CCUA 4BDZA 3VUZA 3FJPA 2KY9A 4BI4A 1Q81C 5CVIA 2GFAA 3DKMA 3JCMX 2D9TA 1NPRA 3EFRA 5CAIA 1UEBA 2QFZA 2XG8D 3TCJA 2FVUA 3L2QA 4LDWA 4VUBA 2OTJA 2H3JA 3A8OB 4J6XA 4HCZA 3I55A 2VUBA 3GLXA 4MDWA 4EMKC 2QF7A 2EQJA 5C0MA 3S3NA 2X4WA 2XDDA 4RG2A 2DD4A 4C5HA 3OYGA 4P5NA 1YI2A 2HAXA 4EMHA 1N8RC 2K5IA 4X9DA 4XU1A 2IG0A 4PLLA 3L1AA 3CC2A 2RA2A 2JOYA 3OW2S 4XTZA 5CIUA 3OS1A 4QVCA 5LJ5h 2X35A 4Z6YA 3CCVA 3BG5A 4M7DA 5CKBA 1VQMA 2EQMA 3H6ZA 3CCQT 1VIFA 4JX4A 1IREB 4EMGA 5KCHA 2LRQA 5GMKl 5GAMh 2V8JA 4M75A 4M78D 2RHZA 3RUXA 2RI2A 3SD4A 3M54A 1M1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDY B;  5L8R E;  3X25 B;  3X28 B;  1UGQ B;  2PU9 B;  2WSC E;  3A8H B;  2ZPG B;  2PUO B;  2DD5 A;  4Y28 E;  2ZCF B;  3QZ5 B;  1V29 B;  3QYH B;  2PVO B;  2DXC A;  2PVD B;  2CZ7 B;  3QZ9 B;  2PVG B;  4RKU E;  2CZ1 B;  1UGP B;  1UGR B;  3X24 B;  3VYG B;  1PSE A;  1AHJ B;  2DXC B;  4ZGD B;  2D0Q B;  2ZPE B;  1UGS B;  3A8G B;  2ZPH B;  4ZGE B;  3VYG A;  1DJ7 B;  2DPP B;  2DXB A;  3A8M B;  3VYH B;  3HHT B;  1PSF A;  2ZPB B;  3QXE B;  4OB0 B;  2ZPF B;  2PUK B;  2DXB B;  2ZZD A;  3LW5 E;  2O01 E;  2CZ6 B;  2CYZ B;  4ZGJ B;  4OB2 B;  2WSE E;  1GXI E;  1JB0 E;  4XK8 E;  3WVD B;  4FM4 B;  3QYG B;  4OB1 B;  2CZ0 B;  2ZZD B;  3A8O B;  3A8L B;  1QP3 A;  3WVE B;  2DD4 A;  2AHJ B;  4KT0 E;  3X26 B;  1QP2 A;  2ZPI B;  1IRE B;  4OB3 B;  2WSF E;  3X20 B;  2DD4 B;  4L6V 5;  2DD5 B; 
#chains in the Genus database with same CATH topology
 1RLQ C;  3PVL A;  4X1V A;  3FEO A;  2KRO A;  3JCM W;  1VQ9 Q;  1QKX A;  2VXF A;  4EOR B;  4E7L A;  2QTV A;  3H0H A;  3G33 B;  4EOO B;  2RPN A;  3IQL A;  3QZ5 B;  4RTZ A;  4AI6 A;  3CME Q;  1UTI A;  5GAN 3;  5FRO A;  2Y4Y A;  3E9F A;  2QQS A;  1KC8 C;  1WFW A;  2CJM B;  1SHF A;  4F7U F;  2PVG B;  2XK0 A;  1SEM A;  1PKD B;  3EFS A;  1G3N C;  3CCS Q;  1VQ7 Q;  5GAN d;  2K79 A;  1JST B;  3VKG A;  2AKL A;  2EFI A;  1H4L D;  1K9A A;  1G3W A;  4QSH A;  3HFN A;  4PJM A;  2CP5 A;  1JXM A;  3OBY A;  1D0Y A;  3D7S B;  5D6W A;  3VYG A;  4M78 B;  2FPE A;  3LLR A;  2WEV B;  3O5Z A;  3CCM Q;  4OMP A;  5IXB A;  1VYV A;  1VQL Q;  4MFD A;  4OGC A;  3CMA Q;  4F7N B;  2DEQ A;  4M7D E;  2RHX A;  5KYN A;  1OIY B;  2CCI B;  4C0D C;  3OYK A;  1YJ9 Q;  1K8A C;  2HEQ A;  4NOY A;  3UT1 A;  3HKS A;  1R77 A;  2K57 A;  4B9W A;  1QQJ A;  4CFN B;  1MV0 B;  2EBP A;  2OTJ T;  4HL4 A;  2EW3 A;  4M75 D;  2AK5 A;  2VGN A;  3RMQ A;  1ABQ A;  1MMA A;  1K76 A;  4XAX B;  2UUE B;  2NUT B;  3EJ1 B;  5I22 A;  5D6X A;  5HBE B;  3QUI A;  4CRI A;  4IKF A;  1YN8 A;  4J5Y A;  3LQ5 B;  4NL3 A;  5LMK B;  1RAA B;  2MI6 A;  5GAM d;  3QG1 A;  3X26 B;  3I35 A;  5ECA A;  3LX7 A;  3QHW B;  3HSB A;  1KK7 A;  2DJZ A;  1X6B A;  1Y96 A;  2DLP A;  1QP2 A;  1JSU B;  3QHS A;  4BCP B;  5FU6 B;  1D3B A;  4GLM A;  3MP1 A;  2OTL A;  4PFZ A;  3CBM A;  4TVR A;  1BCM A;  1BI2 A;  4MFE A;  3QKJ A;  3F5X B;  5DY9 A;  3J80 E;  4Q5W A;  2V1R A;  3M5A A;  3PE0 A;  3MHX A;  4M78 F;  2EQI A;  2EJF A;  4IIO A;  4E2F B;  1VYU A;  4PK4 A;  1QVF A;  1H3Z A;  1N9R A;  2D0N A;  1BIB A;  4ME7 A;  5FLX E;  2EYX A;  2XID A;  2PVO B;  3SWN A;  2GQI A;  2ESW A;  2V1Q A;  2Y4X A;  1TS9 A;  3JCM Q;  2VC8 A;  1W4S A;  2COZ A;  3BG3 A;  5CK9 A;  4E7K A;  4XTU A;  2LCC A;  3JB9 D;  1YJN Q;  2M9U A;  4BY1 X;  4BI3 A;  5HNB B;  2L3Q A;  4M7A A;  2P0P A;  4CC2 A;  2X1N B;  1G2B A;  4Y92 A;  2P0Q A;  2BS3 A;  3RDV A;  3E19 A;  4AKH A;  4BCF B;  3CCU Q;  1H25 B;  3AHU A;  4C0G A;  2WIP B;  1KHI A;  4EC8 B;  1AWO A;  3A5Z B;  2M0O A;  4KRD B;  2F2W A;  4UC4 A;  2L3S A;  3RR6 A;  3LH5 A;  1WPY A;  2KNB B;  1M9S A;  2KRM A;  2NWM A;  2QGS A;  4ELJ A;  3OMG A;  1R0B G;  4C0F A;  2PUK B;  4OGR B;  3LW5 E;  3JCM f;  3S6W A;  1W70 A;  5GMK j;  4PLI A;  2W9Z A;  1ZUU A;  4ELZ C;  1UEC A;  5DLQ E;  2E6Z A;  3S3M A;  2DER A;  1H1Q B;  1H64 1;  4PJN A;  4M77 A;  3JAM E;  1Q86 U;  3VU3 C;  3J81 E;  4CC7 A;  3EH2 A;  4PJO E;  4F17 A;  3NTK A;  1IB8 A;  2VVK A;  1Q86 R;  2PJQ A;  4OVA A;  5A0L A;  3TNH B;  1YWO A;  5HKC A;  3GIB A;  2OTL T;  1BYM A;  1HXD A;  4KGZ B;  3VJP A;  4QVZ A;  3EFO A;  4M7A G;  3OYB A;  1XJW B;  5IDN B;  2VGM A;  1YCY A;  5CQX A;  2KBT A;  3E1S A;  2B86 A;  2L8D A;  5I2M A;  1JEG A;  5GAN j;  1U5S A;  3CC2 T;  4J9D A;  4C8Q D;  3DLL A;  2F1L A;  4DOW A;  4XTV A;  5GAN 2;  1D3B B;  4K11 A;  4QKU A;  1VQO Q;  2E5K A;  4BCH B;  4J7F A;  4DBF A;  2ZAE A;  4HT8 A;  3NFC A;  4C5I A;  4NC6 A;  1VQ8 A;  2K5F A;  1OGU B;  3VS6 A;  2EIF A;  3CCR Q;  1JRI A;  1IHW A;  1VQP Q;  3AT1 B;  3MP6 A;  4FCY A;  1NJI U;  1UDL A;  5LL6 S;  1OKV B;  2FHD A;  1F1B B;  4HNU A;  3SWN B;  4PNO A;  1MGQ A;  2V8K A;  2RQV A;  1HYO A;  1QCO A;  2F5K A;  3JB9 J;  4L5G A;  3I56 A;  2BZX A;  3TSZ A;  1PD1 A;  2R5A A;  4M77 G;  2CSQ A;  4ORZ A;  4AMC A;  2R7G A;  1XO2 A;  2JUF A;  3CEY A;  2YT6 A;  1GCQ A;  1VQN A;  2E6N A;  4C92 D;  1UNG D;  1TUG B;  2RK1 A;  3HB9 A;  1BK2 A;  4RMO A;  3O8V A;  5GMK m;  3F70 A;  3QXE B;  1YJW A;  5GAM j;  1Q81 U;  2DL5 A;  1TFB A;  4EOL B;  1B7T A;  5KH6 A;  2YRV A;  4G6L B;  3JCM c;  1Q81 R;  1KG1 A;  4ZN3 A;  1YIJ Q;  1N4M A;  2XKO C;  4JX5 A;  2W0Z A;  5IXF A;  4FM4 B;  2HMA A;  2CDT A;  2YLB A;  2LCS A;  5M9O A;  3RES A;  1UG1 A;  1VQ6 Q;  4BCN B;  1Y0M A;  2LX7 A;  3OYA A;  2MF2 A;  4CFV B;  2RF0 A;  4NS5 A;  4ELL A;  1LPL A;  3N5B B;  4KGV B;  5GAN e;  2QEX Q;  4M77 B;  1FMK A;  3RUX A;  2YUO A;  4J9B A;  1UJY A;  4R56 A;  4Z88 A;  4RCB A;  4F7U E;  1C1A A;  1E6G A;  1WHK A;  3JB9 I;  2XHC A;  3CCQ A;  1K4U S;  3ASK A;  2E10 A;  2AZV A;  1KC8 U;  1VQ8 T;  3EFO B;  4PL6 A;  4A4G A;  5CCA A;  4JJD A;  5CKH A;  3QYH B;  1KC8 R;  2JN0 A;  2WAC A;  3HZJ A;  5I21 A;  3UDC A;  2WMA B;  3PIO A;  2KQW A;  5FGK B;  1NM7 A;  3R6N A;  1EX4 A;  1URC B;  3BW1 A;  3QYB A;  1VQ5 A;  3I56 T;  2CP3 A;  2KI7 A;  2D0Q B;  8AT1 B;  3OYE A;  1ZBJ A;  2PHG A;  5EG2 A;  3VS3 A;  2CRE A;  2ROL A;  2ZPH B;  4JUV A;  2J6F A;  4ROE A;  3CCJ T;  2DRM A;  3TSW A;  3VKH A;  3QWY A;  2LNV A;  5GAM e;  1YJW T;  2OAU A;  2C0T A;  3QII A;  5I2S A;  1K8A U;  4RCC A;  3UPU A;  1GUX B;  3EGU A;  1R8O B;  1M3A A;  1X69 A;  1Q82 C;  1K8A R;  2LX9 A;  3DB3 A;  1OUL A;  4OMM A;  2DTI A;  4M77 F;  2XDB A;  3OBW A;  4BDZ A;  3SEM A;  1SPK A;  3DKM A;  1NPR A;  1PC0 A;  2FVU A;  4LNP A;  3U23 A;  2MIO A;  1RLP C;  3I55 A;  4EMK C;  1UJ0 A;  4F16 A;  2EQJ A;  4B6M A;  5IHY A;  3M0Q A;  1X2Q A;  2DD4 A;  4P5N A;  2HQH A;  4EMH A;  1OU9 A;  3L1A A;  1NYG A;  2RA2 A;  5HBJ B;  5CIU A;  4OMO A;  3CCV A;  3BG5 A;  5CKB A;  1VQM A;  2AIR B;  2IW6 B;  3CCQ T;  1IRE B;  4M75 A;  2RHZ A;  3E2U A;  4HCB A;  2KR6 A;  1BI1 A;  3CC7 A;  4FSX A;  1UGQ B;  1SSF A;  4A4H A;  5LJ3 g;  1WGS A;  3NTH A;  3VRY A;  2YWW A;  3OYN A;  2EJ9 A;  5I11 A;  4FSS A;  3OW2 A;  1BBZ A;  4IUR A;  2HBW A;  2DK3 A;  2ZCF B;  4HKE A;  2EQK A;  2YLC A;  1FMV A;  2KMG A;  2GGR A;  3RGF B;  1W2B S;  2J7I A;  3INZ A;  4EOQ B;  1QVG P;  3RIR A;  4C0D B;  1T3L A;  4M7D C;  3M0T A;  1VQ5 T;  4RTW A;  3THK A;  2BZ8 A;  3HRS A;  4BB7 A;  3G6E A;  3JB9 H;  2W9F A;  3OYM A;  3EG2 A;  1SF9 A;  1M1G A;  1YWP A;  2K9G A;  1H1P B;  3ME9 A;  3MEW A;  4BXX X;  4BY7 X;  3I5R A;  2ZPE B;  4MDX A;  1EFN A;  3MO8 A;  1S72 T;  2W10 A;  2C5X B;  2RMO A;  3QJ6 A;  4MMK A;  2DXB A;  1VIN A;  2KXC A;  3M53 A;  3M55 A;  2CUD A;  2P4T A;  4LD9 K;  4FU6 A;  2X4Y A;  3MEV A;  3OB9 A;  4KUD K;  3JCM b;  3QYE A;  8ATC B;  3JSC A;  7AT1 B;  1UB4 A;  1WJR A;  1ZX6 A;  1ZUK A;  1NJI C;  4M75 G;  4BE1 A;  1RI0 A;  2QA4 A;  4PJO D;  3WVD B;  3CCE A;  2K4Y A;  2KAF A;  1P5E B;  2PQW A;  1QMC A;  2D8H A;  5D7U A;  3PIP A;  1W2B P;  3G71 A;  1TTH B;  5IT9 E;  1BKB A;  3TW6 A;  3EHR A;  1E6H A;  4FL6 A;  2XMF A;  2RM4 A;  2GTO A;  3WXM B;  1WHL A;  2FG0 A;  2RO0 A;  5GMK i;  5GAO l;  1U8R A;  2P4R A;  1VQM T;  3TN8 B;  1D1A A;  3GPL A;  2JZ2 A;  5FRN A;  1G5V A;  3ZEH A;  2RHY A;  4E7Z A;  3KUF A;  1WA7 A;  4EOK B;  3X20 B;  3FIF A;  2DD4 B;  2DD5 B;  2RHU A;  2JS2 A;  3LGL A;  1PRM C;  1SKU B;  3M0U A;  1WZO A;  1ZQ1 A;  2BPM B;  3CPW A;  1JBM A;  4JRP A;  2WPA B;  4DBR A;  2LQW A;  2WMB B;  4M75 B;  4JX6 A;  4M78 G;  3G6E T;  5GAN 5;  2KGT A;  1X6O A;  4HT9 A;  1YP5 A;  4DOV A;  3MIA B;  2IIM A;  1JJ2 S;  1UNH D;  3JB9 G;  2K3X A;  1TUD A;  4Z8A A;  2MCN A;  2JJ9 A;  1M4Z A;  1UGR B;  2QDL A;  3VV0 A;  2C0O A;  1YIT T;  3UAT A;  3JCM J;  3MY5 B;  4IUP A;  3Q1J A;  4PJL A;  4C8Q A;  5GAN 6;  1MMG A;  1BU2 A;  2FO0 A;  2DBK A;  3CCL Q;  3H0I A;  4M4Z A;  5L23 A;  3BHV B;  4HXJ A;  4MZT A;  1XNI A;  2DYI A;  2CP7 A;  5GAO r;  4RTU A;  4PJO C;  1BIA A;  3CXC S;  2RJD A;  1VQ4 A;  2FB7 A;  4LD6 A;  4F6S B;  1YHQ T;  2ED0 A;  2DXB B;  4XU3 A;  3CC2 Q;  2O01 E;  2CZ6 B;  2L3P A;  3M03 A;  1ZSZ A;  1PRL C;  4II5 B;  1GXI E;  4CRL B;  2E70 A;  4EOS B;  3GNF B;  3L42 A;  3G71 T;  1HJD A;  3REA B;  3QWX X;  3CD6 A;  2WFY B;  3TNW B;  3V8J A;  1G3T A;  4C92 A;  3TU4 K;  2DTH A;  5HK0 A;  2K2V A;  1EIF A;  2MAM A;  3EG1 A;  2O9V A;  4M75 F;  1JJ2 P;  2YUN A;  3WVE B;  1Y71 A;  1WX6 A;  2PZ1 A;  2G6F X;  4A4K A;  4BY6 C;  3TEE A;  4HNV A;  2QTX A;  2JXB A;  1E7O A;  3I5S A;  4N4I A;  1AEY A;  2AT1 B;  2LNH B;  4IMY B;  2IW8 B;  2GNC A;  4M7A E;  2EYW A;  1U3O A;  4C8Q G;  2MMP A;  1YNZ A;  2GFU A;  3KHI A;  2HNI A;  3EGX A;  4ATO A;  3EID B;  1FWZ A;  3NTI A;  1UGV A;  1PD0 A;  1ZUY A;  2MWO A;  2JTM A;  4EOM B;  1B07 A;  2QQR A;  5KYW B;  4AT1 B;  1NE8 A;  3CXC P;  4X34 A;  2JVV A;  5FU7 C;  4O6J A;  1WJQ A;  2L5Q A;  2G3R A;  2BIV A;  1X27 A;  3EHQ A;  2L2P A;  4JLG A;  4BCJ B;  1RL2 A;  2NYS A;  4EMK A;  3K7A M;  4Z02 A;  4OGE A;  2C6T B;  2DL3 A;  1VQ9 A;  3UWN A;  4DEY A;  1ZA1 B;  4A54 A;  2D1X A;  4C92 G;  3JCM P;  3CME A;  4M77 E;  3JB9 F;  3HFO A;  4FYY B;  1VQ4 T;  2GCX A;  1W98 B;  1Q82 U;  4C8Q B;  2A0F B;  2L3R A;  1AZG B;  4JRI A;  4IUT A;  1I07 A;  3VS1 A;  3JCM g;  1R0C B;  1Q82 R;  3DJB A;  3CCS A;  1GH6 B;  1VQ7 A;  4FYW B;  1QCF A;  3HL8 A;  5EJC A;  5GAN g;  2Z0W A;  4ROD A;  1N27 A;  1OEB A;  1VQ8 Q;  3CD6 T;  4MIM A;  4AG1 C;  1M8M A;  2IW9 B;  3CCM A;  2KR3 A;  3PGG A;  1T3S A;  1VQL A;  3FB9 A;  4WF2 A;  2LQ8 A;  2E3H A;  1ZSZ B;  1NZ9 A;  2RJC A;  2K5L A;  3OS0 A;  1H27 B;  3L2W A;  6AT1 B;  1HD3 A;  1YJ9 A;  3QJY A;  4F70 B;  5ACB A;  3HO8 A;  1JU5 C;  3BLH B;  4C92 B;  1Q7Y U;  4CFX B;  2O88 A;  4RG8 A;  3CBP A;  5GAN f;  3GNG A;  4BCK B;  3CCJ Q;  2R5M A;  4N0A C;  2H8H A;  4R0K A;  5HBH B;  2WIH B;  4L6V 5;  2W99 A;  3PMI A;  4J6Y A;  1YBY A;  2QG9 B;  2EJG A;  2QQ8 A;  3PT9 A;  5FWC A;  1C6V X;  2HSP A;  4CFM B;  2MK5 A;  1OOT A;  1M3C A;  3C94 A;  1H3H A;  1KD1 C;  3EGX B;  5GAM g;  4C8Q F;  2KK4 A;  4AFZ C;  2FYK A;  2BS2 A;  4OMQ A;  1QVP A;  4ROC A;  3QZ9 B;  2X3W D;  2VWF A;  1WLP B;  4JJN K;  3OSV A;  4LE9 A;  1KQ1 A;  2K6D A;  1GCP A;  1I0C A;  1FXX A;  1W1F A;  2KMT A;  4ZGD B;  1WJS A;  3C95 A;  3A8G B;  1AZE A;  5IHN A;  2M0Y A;  2Y90 A;  2JTE A;  4JS5 A;  3M58 A;  4IUU A;  4XU0 A;  4EMK B;  2QGG A;  2L89 A;  4AG2 C;  1KQS S;  5GAM f;  2X51 A;  1K9M C;  3CCQ Q;  3G4S Q;  1JQQ A;  3DDP B;  4AFS C;  1LVK A;  2DM1 A;  4V2S A;  3RER A;  1YJN A;  1NJI R;  4C92 F;  3SHW A;  2F5T X;  2O31 A;  1MMD A;  2ZZD A;  2QI2 A;  2A3L A;  1U1T A;  2GF7 A;  4PFO A;  2PNI A;  5LJ3 h;  3CCM T;  4YTL A;  3I9Q A;  2B8A A;  4IUV A;  4CFU D;  2ENM A;  1C0M A;  3CCU A;  1GUX A;  4BI4 A;  2GFA A;  1X43 A;  2D9T A;  2EKH A;  2QFZ A;  2C4G B;  2ED1 A;  3A8O B;  4HCZ A;  2E4H A;  2FPF A;  2X4W A;  2XDD A;  1YI2 A;  4C5H A;  3OYG A;  1N8R C;  2K5I A;  4PLL A;  2EPD A;  2ABL A;  3OW2 S;  4LUD A;  3H9N A;  3OS1 A;  2CP0 A;  5LJ5 h;  2CCH B;  1VIF A;  4JX4 A;  1S72 Q;  5KCH A;  2LRQ A;  1NLP C;  4PJJ A;  2DET A;  2V26 A;  2FL7 A;  3VS0 A;  2DE0 X;  4AFU C;  1KQS P;  1ARK A;  3MPU B;  1O9S A;  1OIU B;  2XU8 A;  1GL5 A;  2GBQ A;  4JZ3 A;  4BCQ D;  5I5Z B;  4BI8 B;  1MUZ A;  5J26 A;  5GAN 8;  1OL2 B;  4D6W A;  2E5Q A;  2FRW A;  1VYT A;  3V8K A;  2CH4 W;  2LP5 A;  2OAW A;  2QDJ A;  2M02 A;  2JMA A;  3X24 B;  3RKX A;  3MEA A;  1M1K U;  3FC3 A;  3DTO A;  3OYC A;  3OMC A;  1MV3 A;  1VQO A;  5C6S A;  2KRS A;  1WXU A;  2OX7 A;  3LYI A;  2A28 A;  2DPP B;  2NLU A;  1VQM Q;  1SRL A;  1WYX A;  3CCR A;  5J39 A;  3A8M B;  4MZP A;  1VQP A;  2RI5 A;  3OW2 P;  5LJ3 d;  3UF4 A;  3HHT B;  4OMN A;  4D8K A;  4FW2 A;  2MWP A;  4J9F A;  3CCU T;  3SDZ A;  3DB4 A;  4A53 A;  1TD6 A;  1H28 B;  4M75 E;  2LW4 A;  2P0K A;  1ENW A;  1WNL A;  3UA7 A;  3MY1 B;  2G9X B;  3P8H A;  4N4H A;  2VXE A;  4ZGJ B;  4J8O A;  1KIK A;  4M7D D;  1VQN T;  4XK8 E;  4BAC A;  3G6E Q;  2XDP A;  2DL7 A;  3CPF A;  3NMZ C;  2ZZD B;  4ZNX A;  2JS0 A;  1YI2 T;  4OR5 B;  3NHN A;  2EYZ A;  2RNA A;  2DYB A;  2HL3 A;  3MI9 B;  1YFN A;  4M7A D;  3M0S A;  2EQU A;  3KXT A;  1QP3 A;  5LJ5 d;  1YIT Q;  2LC4 A;  2AKK A;  4ZTF A;  4GBQ A;  4KT0 E;  2DIG A;  1LCK A;  4XTX A;  4F7L B;  2QQB A;  3V7S A;  1YIJ A;  1XOV A;  2DIQ A;  4YC3 B;  1GBQ A;  2RHI A;  2WSF E;  5A0G A;  3VS5 A;  2UZB B;  4JJC A;  3HPW A;  1ZHI A;  1UUE A;  2UZE B;  5D6Y A;  2DZ9 A;  3OSS C;  3X28 B;  1X6G A;  2IPO B;  3EGD A;  2DXU A;  1VOL A;  2DA9 A;  1IGQ A;  2QXF A;  4PJO B;  3BHU B;  4BDY A;  3A8H B;  1Z9Z A;  2ZPG B;  2DJQ A;  2RQR A;  4C5G A;  4DBH A;  4CI0 C;  2DD5 A;  1X01 A;  4RTT A;  4M78 E;  4HVV A;  1YHQ Q;  2BE9 B;  1ABO A;  1EZZ B;  5CKF A;  1PKS A;  2CZ7 B;  2BKD N;  3V7R A;  4EIK A;  1I8F A;  2R57 A;  3GOX A;  3RBB B;  2FEI A;  2DNU A;  2XIC A;  1AWJ A;  1Q7Y C;  2KT8 A;  5IHI A;  1VQO T;  4D8D A;  2EUF A;  3LGF A;  2COY A;  2FZG B;  2EYQ A;  5GAO q;  2EGE A;  4F14 A;  2KE9 A;  1OI1 A;  1LNX A;  2CT3 A;  3C4S A;  1OZ3 A;  4RUG A;  1DJ7 B;  4C0Z A;  2FZK B;  3SWN C;  4FW1 A;  1LJO A;  3TW7 A;  3VYH B;  4JLI A;  3R6O A;  2PK9 B;  3EG9 A;  3M57 A;  2KSS A;  2OTJ Q;  3M59 A;  4QVD A;  4B9X A;  3EH1 A;  4OMF B;  3CC4 A;  2LVM A;  1RAD B;  2HCK A;  4OB0 B;  2OI3 A;  5GJV B;  2C5V B;  2DO3 A;  4M7A C;  5KCO A;  4LOC A;  5KE2 A;  2ZGW A;  1D1B A;  2E65 A;  2KEA A;  1HSQ A;  2F2C A;  1PWT A;  2VYT A;  5HVY B;  1CSK A;  2EAY A;  2QQ9 A;  2CZ0 B;  4LDX A;  1G83 A;  3OA6 A;  1M2V A;  4J7I A;  3TNI B;  4PJO F;  4RTY A;  3TQ7 P;  1M90 U;  2LT1 A;  2NUZ A;  2RJE A;  2D6F A;  5CYI B;  1PG5 B;  3ZBD A;  1H8K A;  1OYX A;  2MPX C;  1ZA2 B;  5AYF A;  2LQK A;  3FLG A;  3SB2 A;  1MHN A;  2J6O A;  2KT1 A;  2ZPI B;  4C8Q E;  4O5V A;  2EGC A;  3DLM A;  3I55 T;  4BE0 A;  1KJW A;  1FVV B;  1RAB B;  2E64 A;  1VQ4 Q;  4UN0 A;  5GAN 4;  2QDY B;  4FYX B;  1G3Y A;  1KD1 U;  4PFP A;  4M77 C;  3HRU A;  4EOJ B;  2CP2 A;  4BUG A;  5CKD A;  3JCM h;  5L2W B;  2VKN A;  1KD1 R;  4WTO B;  5KE3 A;  3CCV T;  3VUB A;  3VS2 A;  4HNT A;  1M5Q 1;  1OU8 A;  1QVF S;  2JNG A;  5KYW A;  4EC9 B;  3EGD B;  1M30 A;  5LJ3 j;  3CC7 T;  4RKU E;  1KSW A;  2CZ1 B;  3CD6 Q;  2UZD B;  4JRQ A;  2GTJ A;  4FT2 A;  4BCG B;  1U1S A;  3OYY A;  1AWX A;  4ANJ A;  3BHT B;  1BCO A;  2DVJ A;  5A0D A;  2A7Y A;  3MEU A;  3RNJ A;  3ZFJ A;  2DX1 A;  2E3I A;  2KVQ G;  4LXC A;  3PTA A;  4J83 A;  1UGS B;  4Y72 B;  5IN1 A;  4C92 E;  4IUQ A;  1K9M U;  2M1H A;  5HQ0 B;  2IVW A;  2YXY A;  4F6W B;  4QW2 A;  2H3E B;  3H8Z A;  3CC4 T;  2I0N A;  4AFQ C;  1NPP A;  1K9M R;  2A37 A;  4HVW A;  2G77 A;  2C5N B;  1NBE B;  1V1C A;  2WJ9 A;  1M8V A;  5LJ5 j;  3LWH A;  2HQX A;  3E9G A;  1IRX A;  1QVG A;  3QHR B;  1IZ6 A;  1KHC A;  4RTX A;  2EWN A;  2RN8 A;  3L2U A;  3H41 A;  1I81 A;  2EYY A;  1M1K C;  2YDL A;  5DLO A;  2YRD A;  3EG9 B;  4OB2 B;  4BCM D;  2WSE E;  4KRT A;  2FZC B;  2HBP A;  3H0F A;  3OQ5 A;  2C5O B;  4YOZ A;  1OZ2 A;  2F2X A;  3CBO A;  2OTL Q;  2DVE A;  3HP9 A;  3QO3 A;  4OB1 B;  2EGA A;  1XQH A;  2KRN A;  3BFM A;  1GCQ C;  1QVF P;  1N8R U;  1V76 A;  1OKW B;  3OYH A;  1N8R R;  3CQT A;  5CKE A;  1KXU A;  2QA4 T;  1TH7 A;  4QQ6 A;  4CC3 A;  3CCE T;  5IF1 B;  1WHH A;  5HCK A;  1M2V B;  1WHJ A;  2GQV A;  1J3T A;  1IHV A;  3DDQ B;  1K73 C;  1SG5 A;  3JCM d;  2I2L A;  2K3B A;  3S3O A;  2C0I A;  2HKQ B;  3ULR B;  1M2O A;  4J9E A;  4XQ3 A;  2BUD A;  3EAE A;  4Y91 A;  3QBY A;  2DEU A;  1OV3 A;  1JKW A;  5LJ3 e;  1W2B A;  1PHT A;  1V29 B;  1D0Z A;  1GY3 B;  1ZLM A;  2HDA A;  3M4Y A;  4ZN1 A;  2DXC A;  2COW A;  4YOS A;  5KYU B;  2LJ3 A;  1OPL A;  1WQ7 A;  2J6K A;  3PFS A;  4PKC C;  1TXQ A;  2CKK A;  3OYL A;  5IHK A;  2MYS A;  4E7J A;  2QGF B;  1PSE A;  3QWL A;  3FDR A;  2LTO A;  1JXO A;  2OJ2 A;  2C06 A;  5FRM A;  4CXA B;  2LZ6 B;  1GFD A;  2A36 A;  2D8J A;  3RKY A;  5IH2 A;  5GAO m;  5LJ5 e;  1TWB A;  2YSQ A;  1VQK A;  4KUL A;  4M6V A;  2QYZ A;  3G1J A;  2QAZ A;  1CKA A;  4N4G A;  1JOW A;  2RD1 A;  1WXB A;  2E1H A;  2LDM A;  1IXD A;  1PSF A;  2DAQ A;  1VIE A;  4KH1 B;  1WI7 A;  1N5Z A;  2RB6 A;  4WCI A;  2DRK A;  3EG3 A;  1ZP2 A;  3CCL A;  2LCL A;  4FIB A;  1B34 A;  3GTM S;  4A4F A;  1Z9Q A;  3FJP A;  1D1C A;  5CVI A;  3JCM X;  2MOX A;  2LJ1 A;  5CAI A;  1UEB A;  1PCX A;  2BTT A;  3L2Q A;  4LDW A;  2IVX A;  4J6X A;  1IGU A;  3GLX A;  1U06 A;  2P84 A;  3PO3 S;  1WIE A;  3S3N A;  5AT1 B;  2YUQ A;  4X9D A;  2JGZ B;  2IG0 A;  4XU1 A;  3CC2 A;  1T0J A;  2K7A A;  2W96 A;  4Z6Y A;  4A63 B;  4M7D A;  3EG0 A;  2DIL A;  2EQM A;  3H6Z A;  1AOJ A;  5GMK l;  2V8J A;  2DL4 A;  4M78 D;  1UHF A;  3M9Q A;  3SD4 A;  2EKO A;  4QQD A;  3CMA A;  1RAC B;  1X2K A;  4YOO A;  4CFU B;  4E47 A;  3VRZ A;  2FRY A;  2J06 A;  1M90 C;  3I56 Q;  1AWW A;  1JJ2 A;  2UZL B;  2E41 A;  1TG0 A;  2DTO A;  1WHM A;  2RK2 A;  4JRK A;  1AT1 B;  1FX7 A;  2O4X A;  1E7P A;  2IN3 A;  1VQN Q;  1UGP B;  2LJ0 A;  1Q7Y R;  1E9H B;  3P8B B;  1OQK A;  4M75 C;  2PK2 A;  2X4X A;  4LDY A;  3VYG B;  1I5L A;  1YJW Q;  4HCC A;  4QQG A;  2NUP A;  1YI2 Q;  2DXC B;  4XTW A;  5ICP B;  2KXD A;  2X4J A;  3B57 A;  3KFV A;  2VV5 A;  1VQK T;  5KYY A;  3BE3 A;  3MP8 A;  4J9H A;  3G7Z A;  4GY5 A;  3OYJ A;  2LT4 A;  4KH0 B;  3CXC A;  5FWB A;  5GJW B;  4J9G A;  4KBM B;  1P92 A;  3HBL A;  1BI3 A;  5IDP B;  1VQ9 T;  4LDU A;  2EVR A;  1WHG A;  3QPH A;  4ZTJ A;  4DEX A;  3CCL T;  4BCQ B;  2X3X D;  4M7D G;  2ZPF B;  4Z89 A;  2AZS A;  3CME T;  4I3Z B;  4NST B;  3M4G A;  5CQY A;  3BLR B;  2RQU A;  1NEB A;  3VS7 A;  4II1 A;  1OI9 B;  4F7S B;  4BBR M;  1JB0 E;  1ZBX A;  1Y57 A;  2VB6 A;  1TOV A;  3QYG B;  2KYM A;  3LH0 A;  1I4K 1;  1MNE A;  5KYX A;  3CCS T;  2WHB B;  1VQ7 T;  3A1P A;  4AKI A;  3L2Z A;  2QQA A;  3M56 A;  1QW1 A;  2DFU A;  5HK3 A;  4M78 C;  1B34 B;  1Y96 B;  4DA4 A;  1FKM A;  3FRN A;  3L2R A;  3OS5 A;  2WXV B;  2SEM A;  1OX9 A;  2CGH A;  1H24 B;  1RI9 A;  4BD3 A;  4IIM A;  1D09 B;  1VQL T;  3CMA T;  4BBS M;  2HQE A;  1T0H A;  2JTF A;  1TSF A;  4BE2 A;  2PMI B;  3UA6 A;  5HY6 A;  1VQ5 Q;  1YJ9 T;  4J6W A;  3EOC B;  3V7C A;  4M7D B;  3T9N A;  4E7I A;  3GBQ A;  1RAI B;  1IO6 A;  4Y28 E;  2RI3 A;  1GFC A;  5EFQ B;  1RAG B;  1QLY A;  2F69 A;  4JDS A;  4PJO A;  2PTK A;  3A98 A;  4M7A B;  2CUB A;  3CCJ A;  3PNW C;  4F04 B;  1SRM A;  2JM8 A;  5GAO p;  1KQ2 A;  2JT4 A;  1QLB A;  3BG9 A;  4DQ2 A;  1YCS B;  5GMK e;  5DQV A;  1N9S A;  1AHJ B;  5FU6 C;  3V8L A;  2QK0 A;  1NYF A;  1H92 A;  1RAH B;  2BE7 D;  2O4X B;  3PMT A;  1CKB A;  3BDL A;  1BB9 A;  1Y07 A;  1HK9 A;  4OF1 A;  1OPK A;  1O9K A;  1UHC A;  2NUP B;  1B3Q A;  2CS7 A;  1LOJ A;  1RUW A;  2DL8 A;  3I55 Q;  4LDV A;  5KYY B;  1G8X A;  1SSH A;  4OML A;  2DF6 A;  1VUB A;  4KRC B;  1BI0 A;  2BZY A;  1VOM A;  2CSI A;  3ER0 A;  3JCM e;  4C8Q C;  1M1K R;  1JO8 A;  5CEI B;  1QKW A;  2HD0 A;  3MET A;  2CYZ B;  2DXT A;  4E7H A;  3O0G D;  2RQW A;  4EDU A;  3OYI A;  3CCV Q;  4R55 A;  2DME A;  2HKN A;  1AD6 A;  4TTH A;  3HRT A;  3OYF A;  4EON B;  1AD5 A;  2RJF A;  3NGP A;  1YJN T;  2DKG A;  3BY7 A;  4M7D F;  4JJB A;  1QCN A;  3G4S A;  3CC7 Q;  3A8L B;  1Q95 G;  1A0N B;  1K0X A;  4PJO G;  1TUC A;  3FJ5 A;  4EPC A;  2K3Y A;  1H1S B;  2AHJ B;  1WXT A;  3NPF A;  5KYX B;  4M7A F;  1K73 U;  1QMZ B;  2J05 A;  1ZSZ C;  1G3S A;  1NG2 A;  4LN2 A;  2HL5 C;  2CP6 A;  4OB3 B;  2KDS A;  2SRC A;  3MKD A;  1K73 R;  2LMJ A;  3CC4 Q;  5CR2 A;  4C92 C;  3SFM A;  1Y7X A;  2YHT A;  2B9R A;  4MZM A;  2WSC E;  4FX3 B;  3C12 A;  1I5O B;  2PUO B;  3VS4 A;  1VYW B;  3QDR B;  5DM7 R;  3CPW S;  5BNJ B;  2JW4 A;  2E12 A;  3L2V A;  1O75 A;  1WDX A;  2O9S A;  2PVD B;  3KBG A;  5GAO n;  1S72 A;  1N6A A;  1PM3 A;  1RAE B;  1PKT A;  1K0S A;  2M51 A;  2I40 B;  4XU2 A;  1VQ6 A;  1M27 C;  1QVG S;  2HZY A;  2DMO A;  1I1J A;  4BCN D;  3M0P A;  4F7U A;  4ZGE B;  1NEG A;  4C5E A;  2QA4 Q;  1KQS A;  1UE9 A;  3CCE Q;  2QEX A;  5J3B A;  3POM A;  2XD0 A;  4OP0 A;  4M77 D;  1GBR A;  4JPB W;  1NLO C;  3G71 Q;  1FYN A;  4E6R A;  3H4C A;  2K2M A;  1SHG A;  3REB B;  4F7J B;  2JM9 A;  1C9B A;  2V8I A;  1O9K B;  3DOG B;  1XTD A;  3VKI A;  3CCR T;  2R58 A;  5EC7 A;  3JCM V;  3URG A;  1VA7 A;  1VQP T;  4JS4 A;  4HLQ A;  1M3B A;  4J9I A;  3G4S T;  4ESR A;  1MMN A;  3ZL7 C;  4N0A A;  4KUI A;  4JZ4 A;  4BY6 B;  3CPW P;  1FMW A;  4HCK A;  2W2H A;  2A08 A;  4KGX B;  2JMC A;  5CO7 A;  1Q86 C;  3J7A F;  2XI9 A;  2RH2 A;  1H26 B;  1OL1 B;  2HSE B;  1ZSG A;  3BDU A;  4XTY A;  4E7S A;  3MJX A;  4CFW B;  4NL2 A;  5FU7 B;  3BLQ B;  4F7U G;  1H1R B;  5L8R E;  3X25 B;  3JRZ A;  4CC4 B;  3OS2 A;  2PU9 B;  4BCO B;  5GMK h;  1AIS B;  1S1N A;  1X75 C;  1YIT A;  4BCM B;  3QSU A;  1YIJ T;  5LJ5 g;  1M90 R;  1UFF A;  5LJ3 f;  3JV3 A;  2F2V A;  4FT4 A;  3NDQ A;  2O2O A;  3TRE A;  2BKZ B;  3LWI A;  1VQ6 T;  3GP8 A;  4A4E A;  1F5Q B;  4J9C A;  4M78 A;  1D3U B;  3QDF A;  3OY9 A;  2DZC A;  3DL1 A;  4HA8 A;  5KYU A;  2RQT A;  4L59 A;  2BS4 A;  1WQW A;  2I53 A;  3OYD A;  2ROT A;  2FPD A;  2QEX T;  9ATC B;  1PNJ A;  1YHQ A;  4F6U B;  3MCA B;  5GAN h;  3HTR A;  4LUE A;  1QWE A;  3P8D A;  3RMS A;  1W6X A;  2CT4 A;  5LJ5 f;  3C0C A;  5DQW A;  5IAY A;  4X9C A;  2M16 A;  2X9H A;  4F7U B;  2V22 B;  3GF5 A;  2ZPB B;  4BCI B;  3M0R A;  4ELY C;  2YRC A;  5A2Q E;  4GLK A;  1K1Z A;  1MND A;  3RKW A;  4QT7 A;  5GAN 7;  5LQF B;  2NUT A;  1QWF A;  4MML A;  2CH4 A;  2L0A A;  4FYV B;  4AKG A;  1RAF B;  4RTV A;  3VUZ A;  2KY9 A;  1Q81 C;  1ACM B;  4DBQ A;  4EOP B;  4EOI B;  3EFR A;  1GRI A;  2XG8 D;  1UNL D;  2VAS A;  3TCJ A;  4VUB A;  2ECZ A;  1D0X A;  2OTJ A;  2H3J A;  1BU1 A;  1TU0 B;  2VUB A;  4MDW A;  2QF7 A;  2YUP A;  5C0M A;  4RG2 A;  2HAX A;  2KYB A;  1AVZ C;  1FIN B;  2JOY A;  4HVU A;  4XTZ A;  1KFZ A;  3PVQ A;  4QVC A;  2X35 A;  2ATC B;  2LQN A;  2QAS A;  1VQK Q;  3TVT A;  4EMG A;  5GAM h;  2DBM A;  5FW9 A;  1OX8 A;  2RI2 A;  3M54 A;  1M1F A; 
#chains in the Genus database with same CATH homology
 2EKO A;  2KR6 A;  4QQD A;  1BI1 A;  2FL7 A;  3CC7 A;  3CMA A;  4FSX A;  1UGQ B;  1SSF A;  3FEO A;  4A4H A;  5LJ3 g;  1WGS A;  3NTH A;  3JCM W;  2VXF A;  4E7L A;  3OYN A;  4E47 A;  2EJ9 A;  1O9S A;  3OW2 A;  2XU8 A;  4IUR A;  2DK3 A;  2ZCF B;  3QZ5 B;  4HKE A;  4AI6 A;  2EQK A;  2YLC A;  5J26 A;  4BI8 B;  5GAN 8;  2KMG A;  1M90 C;  4D6W A;  1JJ2 A;  2E5Q A;  5GAN 3;  1W2B S;  5FRO A;  3INZ A;  2E41 A;  2Y4Y A;  3E9F A;  2DTO A;  2QQS A;  4JRK A;  2RK2 A;  1KC8 C;  4F7U F;  1FX7 A;  3RIR A;  2O4X A;  4C0D B;  3V8K A;  4M7D C;  1E7P A;  2PVG B;  2XK0 A;  1VQ5 T;  3G6E A;  1UGP B;  3HRS A;  4BB7 A;  2QDJ A;  3JB9 H;  3P8B B;  4M75 C;  3OYM A;  3EFS A;  3X24 B;  2X4X A;  1M1G A;  3MEA A;  3RKX A;  1M1K U;  4LDY A;  3VYG B;  3FC3 A;  1I5L A;  4HCC A;  3ME9 A;  4QQG A;  3MEW A;  2DXC B;  5GAN d;  3OMC A;  3OYC A;  3VKG A;  2EFI A;  4XTW A;  2ZPE B;  1G3W A;  4QSH A;  3HFN A;  1VQO A;  4MDX A;  5C6S A;  2X4J A;  1VQK T;  2VV5 A;  3TU4 K;  3OBY A;  3MO8 A;  5D6W A;  3MP8 A;  3LYI A;  4M78 B;  3VYG A;  1S72 T;  3LLR A;  2DPP B;  2NLU A;  3QJ6 A;  4MMK A;  2DXB A;  3G7Z A;  4GY5 A;  3M53 A;  3OYJ A;  3M55 A;  2LT4 A;  3CCR A;  3CXC A;  2P4T A;  5J39 A;  3A8M B;  4LD9 K;  4KBM B;  1P92 A;  4FU6 A;  4MZP A;  1VQP A;  3HBL A;  2RI5 A;  2X4Y A;  3MEV A;  3OB9 A;  4MFD A;  4OGC A;  1BI3 A;  1VQ9 T;  4KUD K;  3JCM b;  4LDU A;  3QYE A;  5LJ3 d;  3QPH A;  3HHT B;  4ZTJ A;  2DEQ A;  3CCL T;  4M7D E;  3JSC A;  4M7D G;  2ZPF B;  1UB4 A;  2MWP A;  1WJR A;  2RHX A;  3CME T;  3CCU T;  3SDZ A;  3DB4 A;  4A53 A;  3OYK A;  4C0D C;  4M75 E;  1K8A C;  3M4G A;  1NJI C;  4M75 G;  5CQY A;  2P0K A;  4NOY A;  3UT1 A;  1WNL A;  4BE1 A;  3P8H A;  3HKS A;  2K57 A;  1RI0 A;  4N4H A;  4B9W A;  2VXE A;  4ZGJ B;  4II1 A;  4J8O A;  2QA4 A;  4M7D D;  4PJO D;  1VQN T;  4BBR M;  1JB0 E;  1ZBX A;  4XK8 E;  4BAC A;  3WVD B;  2OTJ T;  4HL4 A;  3CCE A;  2K4Y A;  3QYG B;  2KAF A;  4M75 D;  2PQW A;  2VGN A;  2XDP A;  3RMQ A;  3LH0 A;  3CPF A;  1I4K 1;  3CCS T;  1VQ7 T;  2ZZD B;  1YI2 T;  4XAX B;  4AKI A;  3L2Z A;  3PIP A;  2QQA A;  3M56 A;  1QW1 A;  5HK3 A;  3G71 A;  5IT9 E;  4M78 C;  1BKB A;  5D6X A;  4M7A D;  3TW6 A;  1B34 B;  2EQU A;  1Y96 B;  4DA4 A;  3KXT A;  3QUI A;  4CRI A;  1QP3 A;  1FKM A;  4FL6 A;  5LJ5 d;  4IKF A;  3FRN A;  2RM4 A;  4J5Y A;  3WXM B;  2LC4 A;  2RO0 A;  3OS5 A;  5GMK i;  5GAO l;  4NL3 A;  3L2R A;  4ZTF A;  1VQM T;  1U8R A;  2MI6 A;  5GAM d;  4KT0 E;  2DIG A;  3QG1 A;  3GPL A;  3X26 B;  4XTX A;  2JZ2 A;  3LX7 A;  2CGH A;  5FRN A;  3HSB A;  2QQB A;  3V7S A;  2DJZ A;  3ZEH A;  1Y96 A;  4BD3 A;  2RHY A;  1QP2 A;  1XOV A;  3KUF A;  3QHS A;  5FU6 B;  1VQL T;  1D3B A;  2DIQ A;  3MP1 A;  3CMA T;  2OTL A;  4BBS M;  2RHI A;  2WSF E;  5A0G A;  2HQE A;  3X20 B;  3FIF A;  2DD4 B;  2JTF A;  1ZHI A;  3CBM A;  3HPW A;  1BI2 A;  4TVR A;  4MFE A;  3QKJ A;  2DD5 B;  5D6Y A;  4BE2 A;  2DZ9 A;  3OSS C;  5DY9 A;  2RHU A;  3X28 B;  5HY6 A;  3J80 E;  4Q5W A;  1YJ9 T;  3M5A A;  4J6W A;  3V7C A;  3LGL A;  2DXU A;  3MHX A;  4M78 F;  2EJF A;  4M7D B;  2QXF A;  3T9N A;  1ZQ1 A;  3CPW A;  4E7I A;  1JBM A;  4BDY A;  4PJO B;  3A8H B;  1QVF A;  2ZPG B;  4JRP A;  1H3Z A;  4C5G A;  1N9R A;  4CI0 C;  1BIB A;  2DD5 A;  2RI3 A;  4ME7 A;  4Y28 E;  1X01 A;  4M75 B;  4M78 E;  4JX6 A;  5FLX E;  4M78 G;  2XID A;  2PVO B;  3SWN A;  3G6E T;  5GAN 5;  1X6O A;  2F69 A;  2Y4X A;  5CKF A;  4HT9 A;  4DOV A;  1JJ2 S;  4JDS A;  4PJO A;  2CZ7 B;  3JB9 G;  2BKD N;  2K3X A;  2VC8 A;  4M7A B;  1W4S A;  3V7R A;  3BG3 A;  3JCM Q;  3CCJ A;  1I8F A;  5CK9 A;  2R57 A;  1M4Z A;  1UGR B;  3GOX A;  3PNW C;  3VV0 A;  5GAO p;  4E7K A;  1KQ2 A;  1YIT T;  2XIC A;  1Q7Y C;  1QLB A;  4XTU A;  3JCM J;  1VQO T;  3LGF A;  3BG9 A;  4DQ2 A;  2LCC A;  5GMK e;  1N9S A;  3JB9 D;  4IUP A;  2M9U A;  1AHJ B;  3Q1J A;  2EYQ A;  5FU6 C;  3V8L A;  2P0P A;  4BI3 A;  4C8Q A;  5GAN 6;  5GAO q;  4M7A A;  1OI1 A;  1LNX A;  2O4X B;  3PMT A;  2P0Q A;  2BS3 A;  3C4S A;  1OZ3 A;  3BDL A;  3E19 A;  4AKH A;  1DJ7 B;  1Y07 A;  4MZT A;  4C0Z A;  1HK9 A;  4C0G A;  3AHU A;  3SWN C;  4OF1 A;  1KHI A;  1XNI A;  1LJO A;  5GAO r;  3TW7 A;  3A5Z B;  2M0O A;  4PJO C;  3VYH B;  4JLI A;  3R6O A;  4UC4 A;  1BIA A;  2CS7 A;  3CXC S;  1LOJ A;  3M57 A;  2KSS A;  2RJD A;  1WPY A;  3M59 A;  4QVD A;  1VQ4 A;  1M9S A;  2FB7 A;  4LD6 A;  4B9X A;  4LDV A;  4OMF B;  3CC4 A;  2LVM A;  4OB0 B;  4ELJ A;  3OMG A;  4C0F A;  2PUK B;  3JCM P;  1YHQ T;  2DXB B;  1VUB A;  1BI0 A;  2DO3 A;  3ER0 A;  3JCM e;  4XU3 A;  4M7A C;  3LW5 E;  4C8Q C;  5KCO A;  4LOC A;  3JCM f;  2HD0 A;  2O01 E;  2ZGW A;  2CZ6 B;  2CYZ B;  2DXT A;  3MET A;  2E65 A;  3S6W A;  4E7H A;  3OYI A;  4EDU A;  1GXI E;  5GMK j;  2E70 A;  4R55 A;  4PLI A;  4ELZ C;  2VYT A;  3GNF B;  3L42 A;  5DLQ E;  3G71 T;  2E6Z A;  3HRT A;  2EAY A;  3OYF A;  3S3M A;  2QQ9 A;  2CZ0 B;  1H64 1;  4LDX A;  3OA6 A;  2RJF A;  3CD6 A;  1YJN T;  2DKG A;  1G3T A;  3BY7 A;  4J7I A;  4PJO F;  3V8J A;  4C92 A;  2DTH A;  5HK0 A;  2K2V A;  1EIF A;  4M77 A;  3JAM E;  3A8L B;  2MAM A;  3G4S A;  3VU3 C;  1Q86 U;  2LT1 A;  1M90 U;  3J81 E;  4M75 F;  2RJE A;  4PJO E;  2D6F A;  4PJO G;  3NTK A;  3WVE B;  3ZBD A;  1Y71 A;  4EPC A;  2K3Y A;  2AHJ B;  1OYX A;  4A4K A;  3TEE A;  4BY6 C;  4HNV A;  2QTX A;  4OVA A;  5A0L A;  4N4I A;  5HKC A;  3GIB A;  4M7A F;  2OTL T;  1K73 U;  1BYM A;  1HXD A;  3VJP A;  5AYF A;  2LQK A;  3FLG A;  3SB2 A;  1MHN A;  1G3S A;  4QVZ A;  2ZPI B;  4M7A E;  4C8Q E;  4M7A G;  4O5V A;  4OB3 B;  2KDS A;  3DLM A;  4C8Q G;  2MMP A;  3OYB A;  2VGM A;  3I55 T;  1YCY A;  2GFU A;  4BE0 A;  3KHI A;  2HNI A;  5CQX A;  2E64 A;  4ATO A;  3E1S A;  5GAN 4;  2L8D A;  5I2M A;  1FWZ A;  3NTI A;  2QDY B;  5GAN j;  1G3Y A;  5CR2 A;  4C92 C;  1KD1 U;  2MWO A;  3SFM A;  2JTM A;  4M77 C;  1Y7X A;  3HRU A;  4C8Q D;  2QQR A;  2YHT A;  3DLL A;  3CC2 T;  4BUG A;  4MZM A;  2WSC E;  5CKD A;  3C12 A;  4XTV A;  3JCM h;  1D3B B;  1NE8 A;  4DOW A;  5GAN 2;  2PUO B;  4X34 A;  5KE3 A;  3CCV T;  3VUB A;  2JVV A;  3QDR B;  4O6J A;  5FU7 C;  1WJQ A;  4HNT A;  1M5Q 1;  5DM7 R;  4J7F A;  3CPW S;  1QVF S;  4HT8 A;  3NFC A;  4C5I A;  4NC6 A;  2E12 A;  2JNG A;  3L2V A;  2L5Q A;  2K5F A;  1VQ8 A;  1O75 A;  2EIF A;  2G3R A;  2BIV A;  1JRI A;  2PVD B;  3KBG A;  5GAO n;  1S72 A;  5LJ3 j;  3CC7 T;  4RKU E;  2CZ1 B;  3MP6 A;  1N6A A;  4JLG A;  4FT2 A;  4JRQ A;  1RL2 A;  1NJI U;  5LL6 S;  4EMK A;  4Z02 A;  1U1S A;  3OYY A;  4OGE A;  2FHD A;  4XU2 A;  5A0D A;  1VQ6 A;  4HNU A;  2A7Y A;  3MEU A;  4PNO A;  3SWN B;  1MGQ A;  3ZFJ A;  1VQ9 A;  2V8K A;  3UWN A;  1QVG S;  2KVQ G;  3PTA A;  4J83 A;  1UGS B;  4F7U A;  5IN1 A;  4C92 E;  4A54 A;  2F5K A;  4ZGE B;  4L5G A;  4C92 G;  3I56 A;  4IUQ A;  4M77 E;  4C5E A;  3CME A;  2R5A A;  3HFO A;  4M77 G;  1K9M U;  3JB9 F;  2M1H A;  1KQS A;  2IVW A;  1VQ4 T;  4QW2 A;  2QEX A;  2JUF A;  3H8Z A;  3CEY A;  3CC4 T;  1NPP A;  2GCX A;  5J3B A;  1Q82 U;  4C8Q B;  2G77 A;  2E6N A;  1VQN A;  4C92 D;  2XD0 A;  2L3R A;  4OP0 A;  2WJ9 A;  2RK1 A;  4JRI A;  4M77 D;  1M8V A;  3HB9 A;  4RMO A;  3O8V A;  4IUT A;  3F70 A;  5GMK m;  2HQX A;  3E9G A;  3JCM g;  5LJ5 j;  3LWH A;  1QVG A;  3H4C A;  3CCS A;  3QXE B;  1YJW A;  1VQ7 A;  1IZ6 A;  5GAM j;  1KHC A;  1Q81 U;  4HCB A;  3HL8 A;  5EJC A;  2V8I A;  5KH6 A;  5GAN g;  2YRV A;  1XTD A;  2EWN A;  3L2U A;  3VKI A;  3CCR T;  1I81 A;  2R58 A;  1M1K C;  3JCM V;  3URG A;  5DLO A;  3JCM c;  1KG1 A;  1N27 A;  4OB2 B;  4ZN3 A;  1VQP T;  2WSE E;  4JS4 A;  3CD6 T;  1G5V A;  4HLQ A;  4MIM A;  2HBP A;  4JX5 A;  2XKO C;  3OQ5 A;  3G4S T;  3CCM A;  4FM4 B;  1OZ2 A;  3CBO A;  3PGG A;  2DVE A;  2YLB A;  3HP9 A;  4N0A A;  4KUI A;  3QO3 A;  4OB1 B;  4BY6 B;  1VQL A;  1XQH A;  3FB9 A;  3BFM A;  2LQ8 A;  4WF2 A;  1N8R U;  5M9O A;  3RES A;  1NZ9 A;  2RJC A;  3OYH A;  2K5L A;  3OS0 A;  5KE2 A;  5CKE A;  3L2W A;  2QA4 T;  5CO7 A;  1TH7 A;  4QQ6 A;  3QJY A;  2MF2 A;  3OYA A;  1YJ9 A;  1Q86 C;  3CCE T;  3J7A F;  3HO8 A;  4NS5 A;  2XI9 A;  2RH2 A;  4C92 B;  3N5B B;  5GAN e;  1Q7Y U;  4M77 B;  2GQV A;  4RG8 A;  3BDU A;  3CBP A;  4XTY A;  5GAN f;  3GNG A;  4R56 A;  2R5M A;  4RCB A;  4N0A C;  1K73 C;  4NL2 A;  5FU7 B;  4F7U E;  2I2L A;  3JCM d;  4F7U G;  4L6V 5;  3JB9 I;  2XHC A;  3CCQ A;  3PMI A;  4J6Y A;  5L8R E;  3X25 B;  3S3O A;  1YBY A;  3JRZ A;  3OS2 A;  4XQ3 A;  2BUD A;  2PU9 B;  2EJG A;  3ASK A;  3EAE A;  2QQ8 A;  5GMK h;  3PT9 A;  2E10 A;  1X75 C;  1YIT A;  4Y91 A;  1KC8 U;  3QSU A;  3QBY A;  1VQ8 T;  1YIJ T;  5LJ5 g;  5LJ3 e;  1W2B A;  4PL6 A;  4A4G A;  5CCA A;  3C94 A;  1V29 B;  5LJ3 f;  5CKH A;  1KD1 C;  3M4Y A;  3QYH B;  4ZN1 A;  4C8Q F;  2KK4 A;  4FT4 A;  5GAM g;  2JN0 A;  2WAC A;  2DXC A;  2FYK A;  2BS2 A;  1QVP A;  3HZJ A;  5I21 A;  3TRE A;  3QZ9 B;  3UDC A;  3LWI A;  1VQ6 T;  3GP8 A;  4A4E A;  1WQ7 A;  3PFS A;  3PIO A;  3OSV A;  4JJN K;  2KQW A;  1KQ1 A;  4M78 A;  4PKC C;  2CKK A;  1YIJ A;  3OYL A;  3BW1 A;  3OY9 A;  3QYB A;  4E7J A;  1VQ5 A;  1PSE A;  2DZC A;  3DL1 A;  3QWL A;  1FXX A;  4HA8 A;  3I56 T;  4M7D F;  2KMT A;  4ZGD B;  3M9Q A;  4L59 A;  2D0Q B;  2BS4 A;  1WJS A;  1WQW A;  2LTO A;  3FDR A;  3OYE A;  2C06 A;  5FRM A;  5EG2 A;  3C95 A;  3OYD A;  3A8G B;  2QEX T;  2ZPH B;  2Y90 A;  4JUV A;  1YHQ A;  4JS5 A;  3M58 A;  3RKY A;  4IUU A;  3CCJ T;  3MCA B;  4XU0 A;  4EMK B;  5GAO m;  5LJ5 e;  5GAN h;  3VKH A;  3P8D A;  2LNV A;  3RMS A;  5LJ5 f;  3JB9 J;  2L89 A;  5GAM e;  1VQK A;  1KQS S;  1YJW T;  4KUL A;  2OAU A;  4M6V A;  3QII A;  5GAM f;  5IAY A;  1K9M C;  4N4G A;  5I2S A;  4X9C A;  1K8A U;  2RD1 A;  2M16 A;  2E1H A;  4RCC A;  2LDM A;  4F7U B;  1PSF A;  3GF5 A;  2ZPB B;  4V2S A;  3UPU A;  4ELY C;  1R8O B;  3RER A;  1YJN A;  1Q82 C;  2DAQ A;  2LX9 A;  1VIE A;  3DB3 A;  4C92 F;  2F5T X;  5A2Q E;  4GLK A;  2DTI A;  2QI2 A;  2RB6 A;  2A3L A;  1U1T A;  2GF7 A;  2ZZD A;  4M77 F;  3RKW A;  5LJ3 h;  5GAN 7;  3CCM T;  4YTL A;  3CCL A;  2XDB A;  4MML A;  2B8A A;  3OBW A;  4IUV A;  2LCL A;  4AKG A;  4FIB A;  1B34 A;  4A4F A;  3CCU A;  4BDZ A;  3VUZ A;  3FJP A;  2KY9 A;  4BI4 A;  1Q81 C;  5CVI A;  2GFA A;  3DKM A;  3JCM X;  2D9T A;  1NPR A;  3EFR A;  5CAI A;  1UEB A;  2QFZ A;  2XG8 D;  3TCJ A;  2FVU A;  3L2Q A;  4LDW A;  4VUB A;  2OTJ A;  2H3J A;  3A8O B;  4J6X A;  4HCZ A;  3I55 A;  2VUB A;  3GLX A;  4MDW A;  4EMK C;  2QF7 A;  2EQJ A;  5C0M A;  3S3N A;  2X4W A;  2XDD A;  4RG2 A;  2DD4 A;  4C5H A;  3OYG A;  4P5N A;  1YI2 A;  2HAX A;  4EMH A;  1N8R C;  2K5I A;  4X9D A;  4XU1 A;  2IG0 A;  4PLL A;  3L1A A;  3CC2 A;  2RA2 A;  2JOY A;  3OW2 S;  4XTZ A;  5CIU A;  3OS1 A;  4QVC A;  5LJ5 h;  2X35 A;  4Z6Y A;  3CCV A;  3BG5 A;  4M7D A;  5CKB A;  1VQM A;  2EQM A;  3H6Z A;  3CCQ T;  1VIF A;  4JX4 A;  1IRE B;  4EMG A;  5KCH A;  2LRQ A;  5GMK l;  5GAM h;  2V8J A;  4M75 A;  4M78 D;  2RHZ A;  3RUX A;  2RI2 A;  3SD4 A;  3M54 A;  1M1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...