2CYZB

Photo-activation state of fe-type nhase in anaerobic condition
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title photo-activation state of Fe-type NHase in anaerobic condition
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 56
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cyzB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cyzB02
3QYGB 1IREB 3A8HB 2DXCA 1QP2A 1DJ7B 2ZPBB 4L6V5 3A8GB 2DXBA 2PU9B 2DXBB 2CZ0B 3VYHB 4KT0E 4Y28E 2CZ6B 4FM4B 2CZ7B 3HHTB 2PVDB 1QP3A 1JB0E 2DD4A 3LW5E 4RKUE 2PVOB 3QZ9B 1UGSB 3X24B 2CZ1B 3A8MB 4OB3B 4OB2B 3VYGA 2ZZDA 3QYHB 2AHJB 2PVGB 1GXIE 2WSEE 5L8RE 4ZGDB 2QDYB 1PSEA 1UGPB 3A8LB 3QXEB 2WSCE 2O01E 2ZPEB 3QZ5B 2ZPIB 1PSFA 3VYGB 2ZCFB 2CYZB 1UGQB 2ZPHB 3X20B 1AHJB 2ZPGB 3X28B 3WVEB 4XK8E 4OB0B 2PUOB 2ZPFB 2DD5A 2D0QB 2DPPB 4ZGEB 2ZZDB 3X25B 2WSFE 4OB1B 4ZGJB 2DD5B 1V29B 1UGRB 3WVDB 2PUKB 2DXCB 2DD4B 3X26B 3A8OB
chains in the Genus database with same CATH superfamily
1N8RR 3EG9A 2A28A 3A8HB 2BE7D 3CBPA 2FVUA 3EH2A 1DJ7B 1WIEA 3RIRA 4BCFB 3I35A 1SHGA 2E10A 1K73C 3CMAA 2E70A 5FU6B 4NOYA 1BI3A 1AVZC 3LWHA 2MWPA 1LCKA 4PJOD 1Q7YU 2CZ0B 1K4US 2AZSA 3M0SA 4BI8B 4TTHA 3VS3A 1YCYA 2PVDB 4HCKA 5LJ5f 1U5SA 1M27C 2FO0A 2JVVA 3GOXA 1QMCA 4DOWA 1M90U 3JCMf 2KEAA 4D8KA 4GY5A 1PKSA 4CC4B 2JTMA 3CPWA 5LJ3f 5L23A 3EG3A 2C6TB 2HQEA 5GANd 1ZQ1A 1S72Q 5KE3A 1VQ5Q 2HL5C 4FL6A 1VQNQ 2FPDA 1YITT 4FYXB 3QXEB 2EJFA 5CIUA 4PJOA 3EGUA 1ZX6A 1JEGA 4FYVB 3WXMB 2QFZA 1JBMA 1QVPA 3QZ5B 5IHIA 4FX3B 1O75A 5GAOr 1UGVA 1VQOT 3V7CA 3JB9D 1OIYB 2A37A 2E12A 2LRQA 2J6FA 4E6RA 1OYXA 2EQIA 1KC8C 2ZPHB 2A08A 1RLQC 3G4ST 1G3NC 4CRLB 2A0FB 1TS9A 2FYKA 2LX9A 1PHTA 1UHCA 1ZLMA 2EJ9A 3M0PA 4KRCB 4J9DA 5LL6S 1OU9A 4WF2A 3QSUA 2ED1A 5IHYA 1VQOQ 3M5AA 3BHTB 2V22B 4C5HA 3EFOA 1TH7A 2RI3A 4F6WB 2JW4A 4LNPA 3F5XB 2LX7A 5LJ3h 4Y72B 2DAQA 1D1CA 5IXBA 3OYEA 4MDWA 3V8LA 2ECZA 2QTXA 4MMKA 2D6FA 2CP2A 2CP0A 3G33B 4KGZB 3A1PA 2DNUA 5L2WB 3D7SB 4C5GA 2M0YA 3HZJA 3M0RA 2KSSA 3JCMP 4JUVA 2WIPB 1YJNQ 4Y28E 2VGMA 3MKDA 1U1TA 4FM4B 1VQ4A 1EIFA 3RERA 1AWWA 5GAOn 3ZEHA 1YI2A 1VQPQ 3J80E 2QEXQ 1NEGA 3BY7A 4BCMB 1JXOA 3SEMA 3V8KA 2NWMA 1QLBA 3QZ9B 2W99A 3QO3A 1D3UB 2CUDA 5KYWA 1KSWA 2YRVA 4M7DF 4C92A 3L2ZA 2C06A 4BY1X 2MIOA 2VXFA 2AK5A 2ABLA 1I5OB 3PMIA 1QQJA 2KT1A 3L2VA 5KYXB 2QQ8A 2BKDN 2YUOA 4LDWA 2EQMA 1GCQC 4EOSB 4N0AA 3CBMA 4BE2A 4BCMD 4D8DA 4II1A 1KHIA 4Z88A 4BCQD 1UB4A 2JXBA 1S72A 4A4KA 2DIQA 3LQ5B 1YJ9A 4J7IA 1PM3A 2FHDA 5LJ5d 2XIDA 4C92D 1WQ7A 1IB8A 1M3BA 1XO2A 1YFNA 4EC9B 2HD0A 3VUZA 3B57A 3EAEA 4JJNK 2WIHB 4F04B 3CBOA 2RQRA 2D1XA 1ZBJA 3WVDB 4QT7A 3QYEA 3OYIA 3CEYA 1RAGB 2QQSA 1QWFA 1M1KC 2QA4Q 4B9XA 3OYMA 3QJ6A 4OMOA 5HKCA 4Q5WA 4C5IA 7AT1B 3A8GB 5CKFA 1AEYA 2DTIA 5GAN8 2E5KA 1PG5B 1MMNA 5GANh 1RAFB 3HKSA 3OS0A 1TUCA 2P0KA 2YLCA 5HBHB 5CVIA 1K73R 4M78F 1IGUA 2DO3A 3O5ZA 4M7AE 1YBYA 1AISB 4C92G 1JB0E 3GF5A 2QI2A 5D6WA 5DQVA 2DX1A 3LW5E 2QA4T 4RG2A 2QQBA 4WTOB 3OYGA 3FC3A 1WX6A 4JRIA 1IRXA 1ACMB 3VKHA 4A54A 4F7UG 1RL2A 2ZZDA 3HTRA 4QW2A 3C95A 3OS2A 1I5LA 3CCQQ 1GFDA 2K6DA 4PJNA 1EZZB 3MI9B 1IHVA 2B86A 1RABB 1NPPA 2RB6A 1M1KR 2OTJT 1K8AC 2RJFA 3BG9A 5HBJB 2MMPA 1VQMQ 1YIJA 1YJWQ 3Q1JA 2XDPA 2NUPB 1LVKA 1Q7YR 2ESWA 2MCNA 3JCMe 1YJ9T 1SSHA 1G5VA 2KQWA 4QVCA 3LGFA 4XQ3A 1KQSP 2GNCA 4F7JB 3A5ZB 2MAMA 3CCSA 1NEBA 3S6WA 3NTIA 4BCJB 2EYWA 1KJWA 4OMMA 3DL1A 2GCXA 2RJEA 1SF9A 4X1VA 5CO7A 5GANf 2BS3A 1EX4A 3EGXA 3LH0A 4NS5A 1NPRA 3CCUA 3FDRA 2LVMA 4F6UB 4J8OA 4DBQA 3EFOB 1I1JA 1NYFA 2C0IA 5AT1B 1V29B 2CSQA 2W10A 5IHKA 2K57A 3HL8A 1G3TA 1MMGA 4XU1A 3NFCA 4M75D 2AKLA 2DTHA 1M90R 4C8QF 2KI7A 5GJVB 3P8HA 3TCJA 2KY9A 1YI2T 1E7PA 1IHWA 4EMKA 2LCCA 1D3BB 4AKHA 4M7DE 2XICA 4OMQA 1FXXA 3QIIA 5CQYA 2FZGB 3PGGA 1N6AA 4BCNB 2BUDA 2RNAA 4FW2A 2XU8A 4LDUA 2CZ6B 3H41A 1HJDA 2P0QA 1FMKA 2SRCA 4DBHA 2OTJQ 4X34A 2WXVB 1TTHB 2P84A 4IUUA 5LJ5j 1M8VA 1PD1A 3TNIB 4RODA 3CQTA 2C4GB 4FT4A 3CCQA 2MWOA 1V1CA 2KVQG 2LC4A 2CKKA 2R5AA 2CCIB 2WPAB 1GXIE 2BKZB 3M54A 1VQPA 1YI2Q 1FINB 2LQKA 5CQXA 4EOMB 2A3LA 3VJPA 1QVFA 1QCOA 1MV0B 3EIDB 2QG9B 3EGDB 1G3YA 3JCMc 1H24B 3ME9A 1FMWA 2K2VA 3L2RA 4AFUC 4MZTA 1OOTA 2NUTA 3HRUA 3G4SQ 3MY1B 2DM1A 3FB9A 2DE0X 3VKIA 2WACA 1WHJA 1WJSA 1B7TA 3U23A 3KXTA 2F2VA 5HNBB 1Y0MA 2I0NA 4K11A 4M7AC 1N27A 2CP5A 3BE3A 4ZTJA 1AOJA 2C0OA 4NL2A 2LJ0A 1K1ZA 3GIBA 1TOVA 4C8QC 2F5KA 3QPHA 4EPCA 2RHYA 4GLKA 2IG0A 2EQUA 5GAMd 4YC3B 1CSKA 1WHMA 3L2WA 2GQIA 1W70A 2OTLT 3CCMT 1TD6A 1QCFA 1D1BA 1QWEA 2QDLA 2LCLA 2KR3A 1N9RA 1WJQA 2VXEA 2EYZA 4IUVA 4NL3A 1TFBA 4LD6A 2DJZA 4Z8AA 1VUBA 4JPBW 3EGDA 2RJCA 4NC6A 3NMZC 1N8RU 1O9KB 2IVWA 2RHUA 2C5VB 5HK0A 2G6FX 1MNDA 2WMBB 4M75E 1VQ6T 5GAN7 1OZ3A 5AYFA 1BI1A 3H0FA 4M7AA 2OJ2A 4M77C 3CMAT 5GJWB 4IURA 1YWOA 3QHWB 2KRNA 3PFSA 2CZ7B 4JJBA 4C8QA 1WHGA 4XTUA 1KG1A 2K3XA 3INZA 3VS1A 3G7ZA 4M7DC 2LZ6B 1H92A 3M55A 4OB2B 3OA6A 3VYGA 3H0HA 2D8HA 2HKQB 2OAUA 1K8AR 5A0GA 5L8RE 1VQ8A 2P4TA 2RK1A 3VS6A 1P92A 3CCRT 4M78E 3OYCA 1T0HA 4BDZA 4FCYA 1K73U 2E41A 1W1FA 2KMTA 2KNBB 3JCMh 4JRPA 4CFNB 4M77A 4IUTA 2OX7A 3CC2Q 4C8QD 2JUFA 3E9FA 2ENMA 1WDXA 2L0AA 1HYOA 1K0XA 1OZ2A 2BZXA 2HDAA 2QTVA 1UGQB 2RN8A 3NGPA 4CC3A 4M7DA 1PCXA 3LYIA 2OTLA 2MYSA 2XI9A 1BIBA 1WXTA 4XK8E 4OB0B 2WEVB 3QJYA 3M57A 5GAOl 1R0BG 3PMTA 2NUTB 3UDCA 1JJ2A 4ZGEB 4KBMB 1M2VA 1SRLA 2KXDA 3HO8A 3DTOA 2JTFA 1AZGB 3LGLA 1ZSZB 3RESA 5GAOm 1VQ9Q 5D7UA 1H1SB 2LJ1A 2VVKA 3NDQA 1QVFP 1WPYA 3L2UA 3PT9A 1WFWA 3QUIA 1U3OA 3BG3A 4QVZA 2GBQA 2KYMA 4RTTA 1G8XA 1OPLA 4R0KA 3JAME 5HK3A 3G71A 4E7SA 5KE2A 2C5XB 2DXUA 3QWXX 3CMEA 4EOKB 1GBRA 4EORB 3CXCS 2BIVA 2CREA 3HP9A 3A8MB 3VUBA 4HNVA 3OYKA 1V76A 3TREA 1YJ9Q 8AT1B 2KXCA 1VA7A 1QMZB 1VQ7Q 4J9CA 4ZGDB 2KR6A 2AT1B 3QYBA 2L3QA 3OS1A 4RG8A 3L2QA 4XTYA 3ZL7C 1UGPB 4BE0A 4LD9K 2PK2A 1YJNA 3G1JA 2YUQA 5J3BA 2WSCE 3ULRB 3HFNA 2RPNA 1NLOC 4ZNXA 4XU2A 2RHXA 4JS5A 3M03A 4M7DG 1VOMA 4HCBA 1E6GA 2H8HA 5HBEB 3OY9A 3CCET 1OEBA 4ME7A 5GAMg 2BS2A 3OQ5A 4KRTA 1GRIA 5FU7B 1H3ZA 1AHJB 4C92E 2LT4A 2MOXA 1AT1B 1ZA1B 2EKOA 3JB9G 4JRKA 4ZTFA 3GPLA 5GANj 5KYUB 5KYNA 2VGNA 1B07A 2NYSA 4LE9A 4P5NA 2DLPA 3SDZA 1WXBA 4XU0A 4O5VA 1KD1U 1JQQA 4CFUD 1Y96B 2O88A 3I56A 4EOJB 4PFPA 1RI0A 3DLMA 3BDUA 4E7IA 3LH5A 2Y90A 1Y96A 1BKBA 4QQ6A 1KQ2A 4PL6A 1G83A 2BE9B 2CT4A 4VUBA 2E3HA 3CCSQ 2RQWA 2X4YA 4HNUA 5GANg 4D6WA 2EBPA 2XG8D 5HY6A 4F7LB 4LN2A 4PFOA 2QDJA 3JCMg 4JRQA 4I3ZB 3QG1A 2QF7A 4A4HA 3SWNA 4QQGA 1RAAB 1VQOA 1M2VB 1FMVA 1GUXA 5ECAA 2UZDB 1UFFA 1ZSGA 3H4CA 4BCGB 2DD4A 3OS5A 1NG2A 1A0NB 1WYXA 3E19A 1RAIB 3QWYA 2CSIA 1Y07A 4F17A 4LUEA 2DVEA 3P8BB 1C0MA 1BB9A 2BS4A 1OKWB 1ZHIA 3FJ5A 1AWXA 3VRYA 1ZUYA 4M77F 3CMET 4EMHA 3GNFB 2DXTA 4JDSA 2QGSA 3REBB 1PRLC 2BZYA 1URCB 1JRIA 2CDTA 4AG1C 1ZA2B 5DLOA 2NUZA 2CP6A 8ATCB 2B9RA 1D09B 3MEUA 3CCEA 2EFIA 1YITA 4LDYA 2IVXA 4QKUA 2M02A 4C8QE 1O9SA 1ZBXA 2K4YA 2QYZA 4XTWA 2R57A 2VASA 4AFSC 4AFQC 3DDQB 4J9GA 2G9XB 4AT1B 1XNIA 2GF7A 2LT1A 3X20B 4PFZA 3E1SA 4C8QG 1GCPA 3I55Q 1TWBA 2L89A 1BBZA 2C5NB 4ELLA 1TUGB 3VS4A 4DOVA 5GMKe 1TU0B 4E47A 2BZ8A 3E9GA 2DPPB 6AT1B 4XAXB 4M7AF 2LNHB 3VKGA 4J83A 2CH4A 3OYHA 4A4GA 4IUPA 1G2BA 3R6NA 1AD5A 1MMAA 2DBMA 2QK0A 1Q81R 1OIUB 3JCMV 3JCMb 2UZBB 2M0OA 5FROA 1J3TA 5LJ3e 3G71T 1QVGS 1VQPT 2YDLA 3JB9F 2CP3A 2CT3A 3K7AM 1M3AA 3CCMQ 4F70B 3RNJA 3UA7A 1PC0A 1PKTA 2QQRA 2DILA 2RK2A 4BD3A 2HAXA 1YWPA 1R77A 5J26A 2EAYA 2K5IA 4BCIB 1M8MA 1N4MA 3OYAA 5A0LA 4KRDB 2COYA 1M1FA 5CKDA 3TW7A 1NJIR 5GMKh 4R56A 4EIKA 2RO0A 3C4SA 3PVLA 2FRYA 4HT9A 2HL3A 2PVGB 3OYBA 4MZPA 4MFEA 3G71Q 4A53A 3URGA 2E6ZA 3CCLA 1WI7A 1VQ6Q 1QCNA 1PSEA 3QHSA 4KULA 2PQWA 2ROLA 4NSTB 1BCMA 2GFAA 3CMAQ 3RUXA 4UN0A 2QAZA 3OMCA 1MUZA 3KHIA 2HCKA 3M4GA 4C0GA 4DBRA 2DYIA 4HXJA 3VV0A 4M75F 2DETA 3OSSC 3V8JA 2KDSA 5FRNA 2BTTA 2EQKA 1YJNT 3UA6A 1OL1B 1UNLD 1OULA 2MF2A 5KYUA 5CEIB 3L1AA 3QDFA 2L8DA 4OP0A 2JGZB 4PJOB 1Q82U 3CCRQ 3CC4A 3PO3S 1VQLA 3CC2T 1UTIA 4M7AB 4E7LA 4RTZA 2WSFE 4ZGJB 2LQWA 3M58A 2JOYA 1P5EB 5EC7A 3OYYA 3VS5A 1H27B 1I4K1 3HFOA 1FX7A 3CPWP 3CCJA 4JLGA 4JS4A 3NTKA 1U1SA 4PJJA 5LMKB 4X9DA 1F1BB 3T9NA 1JJ2P 2IN3A 2HSPA 1TUDA 4E7KA 1H1PB 2DMEA 3G4SA 3KUFA 3H9NA 1Y7XA 1K0SA 1X27A 4C92C 3BG5A 3BDLA 3HHTB 3OSVA 1QP3A 2RMOA 4N4IA 4HCZA 4O6JA 4Z02A 5DLQE 1BI0A 2K79A 3EGXB 1W2BP 4RTXA 3OYJA 4PJOE 5GAMj 1QVGA 1GCQA 2LW4A 3C0CA 5GAN3 2WFYB 4N4HA 3VU3C 2AHJB 2EGCA 4V2SA 2HEQA 2R7GA 3PVQA 3I9QA 4IIMA 1Q81U 3MIAB 2J06A 4M7DB 1NE8A 4IIOA 4AKIA 1SRMA 1C1AA 1H26B 2E6NA 4CXAB 4B9WA 4HA8A 1OX9A 4PJOF 2NUPA 1KXUA 3JB9H 2VC8A 3JCMW 2XKOC 3EG1A 3M53A 3JCMX 4BI3A 3GNGA 4EONB 1TXQA 4Y92A 2EJGA 1H3HA 1VIEA 1UECA 1BK2A 3SWNB 3VS0A 3MO8A 4E2FB 5FRMA 5GANe 1H25B 4LXCA 4RTYA 3MY5B 2DF6A 4LDVA 1TSFA 2BPMB 3FIFA 2ZPFB 3EHQA 1ZP2A 1M1GA 5IDPB 3CCVQ 4LUDA 3UT1A 4MDXA 3L42A 2K3BA 1UG1A 4M78G 4YOZA 4E7HA 3DKMA 3HB9A 2V1QA 5D6YA 1FWZA 2DXCB 4C92F 4J9IA 1Q7YC 3I5RA 1KQSA 1XQHA 3CC4T 2LDMA 2DVJA 1Q95G 2RM4A 3C94A 3CCEQ 5GMKl 4F16A 2LP5A 1SHFA 1JJ2S 4ESRA 1D3BA 1VQNA 1OL2B 1OQKA 1X6GA 1YIJQ 1RACB 1VQMA 2YUPA 4C0DB 2H3EB 3CD6A 4BUGA 5GAN2 2PNIA 2IIMA 2L5QA 3HRSA 3J81E 2D0NA 3I56T 2DEUA 2K9GA 1UGSB 1ENWA 4EMKB 3OW2S 4BCQB 1C9BA 1C6VX 2PJQA 4JJDA 5EJCA 3V7SA 4MFDA 3RMSA 5A0DA 2FL7A 1K9MR 4JJCA 2RD1A 3CXCP 2KK4A 3TVTA 2W96A 1JSTB 1B3QA 1K9AA 1H1RB 4BCPB 2DZCA 3GTMS 1VQNT 1HD3A 2DMOA 3A8LB 4M6VA 2QQ9A 1NYGA 3CC7T 2W2HA 4HVUA 3M0TA 1HXDA 3RKYA 2H3JA 3NPFA 3KFVA 1GBQA 3IQLA 1FVVB 3I55T 3F70A 1D0YA 5GAN4 3EFSA 2DEQA 1OU8A 2ZPGB 3X28B 2AZVA 2UZLB 1WJRA 2L2PA 1B34B 3TEEA 5I11A 2YLBA 5DY9A 1BU1A 4JLIA 3CC7Q 1UHFA 2X3WD 3FEOA 1OV3A 3HRTA 1SSFA 4EMKC 2W0ZA 2DBKA 3FJPA 5KYWB 3CC7A 2EW3A 1T0JA 4A4EA 4OGCA 4PK4A 2WMAB 1LPLA 3R6OA 4CFVB 2HQXA 1K76A 1VOLA 1HSQA 1FYNA 1IREB 2EIFA 4ZN3A 5FU7C 1VQLT 3CC2A 1VQ4Q 4AKGA 1RI9A 2WJ9A 1GFCA 2QASA 3CCST 1SEMA 1NM7A 4C92B 2F5TX 2Z0WA 2LCSA 1BI2A 3M0QA 5LJ5g 2EGEA 2KT8A 2E1HA 4E7ZA 1VQ6A 5GAOp 1UDLA 3O8VA 2X4JA 3LWIA 1T3SA 2CGHA 2WHBB 4FSXA 2YUNA 5KCOA 3M0UA 1QKXA 4HNTA 2FPFA 3DDPB 4EDUA 3CPFA 1K9MU 5CK9A 4QQDA 1VQ8Q 4KUIA 1JKWA 4F7NB 2HBWA 1AWOA 4EOPB 1JOWA 3QYHB 2WSEE 1VIFA 1BYMA 4DEXA 3P8DA 2EYYA 3EHRA 2QDYB 2Y4XA 4FU6A 4CRIA 1T3LA 5GMKm 1BU2A 1NZ9A 2AKKA 1N9SA 3MP1A 4RTUA 3JCMQ 2RQVA 4F7UA 1EFNA 4C0DC 2XHCA 2JM9A 2JMCA 2HBPA 5EFQB 1NLPC 2O9VA 3OW2A 2ZPIB 1ZSZC 4PLLA 1S72T 2DA9A 3BFMA 2KROA 3I5SA 2VKNA 1ZUUA 1Q81C 4II5B 3RDVA 3JB9J 3UPUA 2V8KA 3NHNA 2HMAA 2KMGA 2DL4A 3WVEB 2LTOA 2CCHB 4HVVA 5CKBA 5A2QE 3M4YA 1X2QA 3OYFA 4BBRM 3REAB 2GGRA 2EWNA 2COWA 4BCND 2DK3A 3CD6Q 1YHQA 2EQJA 1X2KA 2OTLQ 5HVYB 1JXMA 1M9SA 2E65A 1JSUB 3CCMA 4LDXA 2O2OA 4F6SB 1UEBA 2KRSA 2QEXA 2OAWA 3VRZA 1Z9ZA 1ZSZA 2JS0A 4J7FA 3SFMA 2LJ3A 4YTLA 3H8ZA 5KH6A 4JX6A 2X1NB 2X35A 5CR2A 2DJQA 4M7AG 1XTDA 2I53A 2F1LA 4EOQB 2L3SA 3ZBDA 1N8RC 3VS2A 1YJWA 4FW1A 2DRKA 3M9QA 4EOLB 1SG5A 1K8AU 4QVDA 2E5QA 3TNWB 5KYYB 5EG2A 1VQ7A 1Q82C 4N4GA 2QEXT 2F2CA 2MK5A 4E7JA 4MIMA 3TSZA 5KYYA 3OBYA 5C0MA 4OMFB 4KUDK 1G3SA 1KHCA 1UE9A 3CCUT 3JV3A 2PTKA 4M78B 3GLXA 3MHXA 2DFUA 2GQVA 5IHNA 2V8IA 1VQ9T 1NBEB 4IKFA 5IXFA 1BCOA 1MGQA 4EC8B 1X69A 2CH4W 1D1AA 3JCMd 2G3RA 1VINA 3ER0A 3BLHB 1M30A 1YCSB 4M77E 4F7UF 3POMA 2FEIA 1IZ6A 4JX4A 2XDDA 4RCBA 5IF1B 2DL3A 2SEMA 1S1NA 3VYGB 5DM7R 3PTAA 3M56A 2E3IA 3V7RA 2M1HA 3QBYA 1WHKA 2D8JA 1Y71A 3KBGA 1OGUB 1I07A 3EG9B 5ACBA 4PJMA 3TW6A 3CCUQ 2VV5A 2OI3A 2FZCB 2A7YA 4F7UB 4CFUB 1KIKA 3CMEQ 3BHVB 3UATA 4C5EA 4BDYA 5I5ZB 1H1QB 3CC4Q 3SD4A 3HPWA 3ASKA 2V8JA 2CUBA 1ARKA 1ZUKA 4M75G 1PWTA 3NTHA 3CCQT 4J9BA 5CKHA 4BE1A 4J9FA 1W2BS 2IPOB 1VQ7T 5LJ5h 1UJYA 4N0AC 1WHHA 4RTWA 1W4SA 5M9OA 1JO8A 4M77B 3DLLA 2ZPBB 1YJWT 3CPWS 4BY7X 4J6WA 2DRMA 5I21A 3AT1B 2KBTA 2PK9B 2RH2A 3OYDA 4R55A 3A98A 1Q86R 2DXBB 4KT0E 3OMGA 4OMLA 4UC4A 2D9TA 3RKXA 5BNJB 1QKWA 1QLYA 3CCVT 3JCMJ 1VQLQ 1ABOA 1VQ4T 1X6BA 4RKUE 2J7IA 1GUXB 4C8QB 2O4XA 5D6XA 1WGSA 4PJOG 1VYVA 3FRNA 5LQFB 3LX7A 4BY6C 1VQKT 1B34A 2CZ1B 1AWJA 2FRWA 3QDRB 4ANJA 3MCAB 1H641 1OPKA 2EGAA 2LQ8A 1KD1R 1R8OB 3CCRA 3H0IA 2QGGA 1MMDA 3PNWC 4L59A 1OKVB 5J39A 1AZEA 2JJ9A 3QWLA 1M3CA 2YXYA 3QKJA 1Z9QA 1YN8A 2VUBA 2AIRB 4BACA 3TSWA 4OGRB 1YIJT 2QGFB 1E6HA 4M75A 2RA2A 4OVAA 4DA4A 1VQ9A 4G6LB 4PJLA 1YP5A 4J5YA 3O0GD 1AD6A 2MI6A 2ZCFB 3RMQA 2Y4YA 3CCLQ 5IT9E 2DKGA 3HBLA 1U06A 2CS7A 3N5BB 1RUWA 3J7AF 3DJBA 2F69A 4OMNA 4ORZA 2DL5A 4M78C 1OI9B 4FIBA 2DIGA 4J9HA 3PIOA 5IAYA 2DD5A 1F5QB 2RQTA 4KGXB 2FPEA 3CCVA 3MJXA 2D0QB 4BY6B 2ZZDB 2XD0A 4FT2A 2IW6B 3GP8A 2DD5B 1PKDB 2R5MA 2L3RA 4BCHB 2DD4B 5CCAA 2KAFA 5FLXE 3A8OB 2PZ1A 2FB7A 3SWNC 2F2XA 3QYGB 4JZ3A 3CCLT 2JMAA 4M75C 2JN0A 4L6V5 2J6OA 3FLGA 3EG2A 5HCKA 2NLUA 4A63B 2PU9B 4M75B 5CYIB 1D0ZA 4L5GA 1N5ZA 3MP8A 1IXDA 1UNHD 2JS2A 3RR6A 4M77G 4M78A 4QSHA 2RJDA 4PKCC 1WQWA 4IMYB 4ELZC 2X4WA 1KD1C 5KYXA 2ATCB 3GBQA 4GBQA 1M1KU 2L3PA 1GL5A 5GMKi 2X51A 2YRDA 3SB2A 3I56Q 2FG0A 1HK9A 3X24B 4FSSA 5LJ3j 2QXFA 4JX5A 2QQAA 3I55A 3HSBA 4PJOC 4C0FA 2VB6A 1X01A 1NJIC 3BW1A 3MEWA 4CFXB 4A4FA 2ROTA 2JT4A 2E64A 2CJMB 1X43A 1K9MC 1YNZA 2YRCA 4MZMA 3TQ7P 2ZAEA 1VQ5T 1KC8R 4MMLA 2W9ZA 4BCKB 4M78D 2XMFA 1OI1A 4EOOB 2DZ9A 1VYUA 2W9FA 1WXUA 2MPXC 1RAHB 4F14A 1SPKA 2M16A 3DB4A 2EYQA 2QA4A 1ABQA 1YITQ 3MP6A 4F7UE 2DYBA 1W6XA 5LJ5e 4XTZA 1Q86C 1E9HB 5DQWA 4XTXA 4C0ZA 5CAIA 4M7AD 2VYTA 3QHRB 5FWCA 1WA7A 4ZN1A 5C6SA 1RAEB 3OB9A 5IDNB 5CKEA 2DERA 2UUEB 5GAN6 4ELJA 1GY3B 4HKEA 4KH1B 1WNLA 2K7AA 2A36A 1TG0A 4Z6YA 5ICPB 4B6MA 2PUKB 3MEVA 4IUQA 2UZEB 3X26B 3EG0A 4TVRA 4Y91A 1U8RA 1YHQT 1OX8A 4ROEA 4X9CA 4M4ZA 1GH6B 2O9SA 4WCIA 4ROCA 5GAN5 1KFZA 3S3NA 2C5OB 2DXBA 2K5LA 2RQUA 1CKAA 3BHUB 3EJ1B 3M59A 1UUEA 4HL4A 3RGFB 3OBWA 2GTJA 1MHNA 2M9UA 4M77D 9ATCB 2R58A 1VQ5A 3UWNA 2K2MA 2P0PA 4Z89A 5LJ3g 2CP7A 2I2LA 2JNGA 4J6YA 4OGEA 2EKHA 2KYBA 4AMCA 2B8AA 3OYNA 1VQ8T 5FW9A 4CFMB 2P4RA 3PIPA 5HQ0B 2JTEA 2COZA 2V1RA 4OB3B 3DB3A 4M7DD 5GAMf 3MEAA 1LNXA 2V26A 2EUFA 4OMPA 2OTJA 4YOOA 3ZFJA 1X75C 1IGQA 2G77A 1BIAA 4GLMA 1E7OA 4OR5B 3E2UA 5GAMe 4RTVA 1Q86U 1KC8U 5FGKB 4BXXX 3CXCA 4CC7A 2O01E 4XU3A 2IW9B 2ZPEB 2HKNA 2LNVA 2X4XA 2FZKB 2YT6A 2GTOA 4KH0B 1PSFA 4OF1A 1IO6A 3MPUB 1SKUB 1MV3A 4AG2C 2YSQA 2CYZB 1RADB 4ELYC 2RI2A 2HQHA 4YOSA 2LQNA 1VYWB 1NJIU 2X9HA 1XJWB 3C12A 5I2SA 1H28B 2YHTA 1YHQQ 2RHIA 1MNEA 2O4XB 3LLRA 2PUOB 3CD6T 3RBBB 2KGTA 1KQ1A 4EMGA 2IW8B 3X25B 4OB1B 2DTOA 2C0TA 1UGRB 5FWBA 3BLQB 2LMJA 2PMIB 1M90C 3META 4CI0C 1G3WA 4J6XA 1I81A 4J9EA 1WHLA 2VWFA 5GAMh 4CFWB 2DXCA 3UF4A 4XTVA 5GAOq 2K5FA 1QP2A 1WZOA 4PNOA 2RI5A 4HLQA 4F7SB 5I2MA 2EPDA 2J6KA 4HT8A 4AFZC 2F2WA 4BB7A 3DOGB 2HNIA 2E4HA 1I8FA 3OW2P 3VYHB 1QVFS 3EFRA 1W98B 1XOVA 3G6EA 2ZGWA 3OYLA 4BI4A 4PLIA 4EOIB 2RHZA 1VQKQ 4HVWA 3H6ZA 1M5Q1 2KRMA 3TNHB 4RCCA 2YWWA 1PD0A 2PVOB 4CC2A 4AI6A 1Y57A 5IH2A 4LOCA 2RF0A 4JZ4A 5LJ3d 4DEYA 3S3OA 2KE9A 3TU4K 4DQ2A 1VQKA 4HCCA 1FKMA 5KCHA 4FYYB 4DBFA 4RUGA 4RMOA 5FU6C 1UJ0A 5IN1A 3PE0A 1PNJA 1KK7A 5I22A 2J05A 3G6EQ 1WLPB 3EOCB 2DL8A 2HZYA 3VS7A 2PHGA 3SHWA 1PRMC 3EH1A 3AHUA 1M2OA 1JU5C 1Q82R 1CKBA 2EVRA 4KGVB 1VQMT 1W2BA 3THKA 4ATOA 2HSEB 2M51A 1KQSS 3CCJQ 2XK0A 3TN8B 1QW1A 2GFUA 3JB9I 2EYXA 1H4LD 1VYTA 2DL7A 4FYWB 1LOJA 1I0CA 1R0CB 1O9KA 3S3MA 3JRZA 2O31A 1RLPC 1H8KA 1UNGD 1M4ZA 2JZ2A 2XDBA 3G6ET 2X3XD 4BCOB 2K3YA 2I40B 4BBSM 1QVGP 1D0XA 3RKWA 2JM8A 3JSCA 3BLRB 2ED0A 3CCJT 1X6OA 1LJOA 5GMKj
chains in the Genus database with same CATH topology
4X9DA 4N0AC 3A8HB 2RJCA 3T9NA 4NC6A 1W4SA 3CBPA 2FVUA 5M9OA 1N8RU 4M77B 3DLLA 1DJ7B 2ZPBB 1YJWT 3CPWS 2IVWA 2RHUA 4J6WA 3RIRA 5I21A 5HK0A 4E7KA 4M75E 1VQ6T 2E10A 1K73C 5GAN7 1OZ3A 5AYFA 2E70A 5FU6B 4NOYA 1BI3A 1BI1A 2RH2A 3OYDA 4M77C 3LWHA 2MWPA 4M7AA 4PJOD 3G4SA 4R55A 3KUFA 1K9MU 2DXBB 1Q7YU 3CMAT 1Y7XA 2CZ0B 4IURA 4KT0E 3OMGA 3PFSA 4UC4A 2D9TA 3BG5A 3RKXA 4BI8B 4C92C 2CZ7B 3BDLA 3HHTB 1YCYA 2PVDB 3OSVA 1QP3A 4XTUA 4C8QA 3CCVT 1KG1A 3JCMJ 4N4IA 4HCZA 4O6JA 4Z02A 2K3XA 5LJ5f 1VQ4T 3INZA 5DLQE 1BI0A 4RKUE 2JVVA 3GOXA 3G7ZA 4DOWA 1M90U 4C8QB 3JCMf 2O4XA 5D6XA 3OYJA 4M7DC 4PJOE 1WGSA 4PJOG 5GAMj 3FRNA 3LX7A 4BY6C 1VQKT 4GY5A 1QVGA 1B34A 2CZ1B 2XDBA 3QDRB 3M55A 2JTMA 4OB2B 3CPWA 5GAN3 3OA6A 3MCAB 3VYGA 1H641 4N4HA 5LJ3f 3VU3C 2LQ8A 2AHJB 2HQEA 5GANd 2OAUA 4V2SA 5A0GA 1R8OB 5L8RE 1VQ8A 3CCRA 1ZQ1A 2P4TA 2RK1A 1Q81U 5KE3A 3PNWC 4L59A 1P92A 3CCRT 5J39A 4M78E 4FL6A 4M7DB 1NE8A 3OYCA 4HCCA 4AKIA 1YITT 3QWLA 4BDZA 3QKJA 3QXEB 2VUBA 1K73U 2EJFA 5CIUA 2E41A 2E6NA 4BACA 4B9WA 4PJOA 4HA8A 2KMTA 3JCMh 3WXMB 2QFZA 4JRPA 1JBMA 1QVPA 4M77A 4IUTA 4PJOF 1YIJT 3QZ5B 3JB9H 2VC8A 3JCMW 2XKOC 4C8QD 3M53A 2JUFA 4M75A 3JCMX 4BI3A 2RA2A 3E9FA 3GNGA 4OVAA 4DA4A 1O75A 5GAOr 1VQ9A 4J5YA 1VQOT 2MI6A 2ZCFB 2EJGA 2Y4YA 3RMQA 3V7CA 5IT9E 3JB9D 1VIEA 1OZ2A 2DKGA 2E12A 2LRQA 3SWNB 3HBLA 3MO8A 2CS7A 1OYXA 3N5BB 1KC8C 1UGQB 2ZPHB 3J7AF 2F69A 5FRMA 5GANe 4M7DA 4M78C 3G4ST 4FIBA 3LYIA 2OTLA 4LDVA 2LX9A 2FYKA 2XI9A 2DIGA 3FIFA 1BIBA 4XK8E 4OB0B 2EJ9A 3QJYA 3M57A 5GAOl 3PMTA 3PIOA 2ZPFB 5IAYA 2DD5A 5LL6S 3UDCA 1M1GA 1JJ2A 3CCVA 2D0QB 4WF2A 4ZGEB 4BY6B 2ZZDB 3UT1A 2XD0A 3L42A 4FT2A 4KBMB 3QSUA 4M78G 4MDXA 3GP8A 4E7HA 2DD5B 3M5AA 3HO8A 3DKMA 4C5HA 3HB9A 2R5MA 2JTFA 5D6YA 1FWZA 2DXCB 2L3RA 4C92F 1Q7YC 2DD4B 1TH7A 3LGLA 2KAFA 5CCAA 5FLXE 3A8OB 2RI3A 3RESA 5GAOm 2FB7A 3SWNC 1KQSA 1XQHA 3QYGB 5LJ3h 2DAQA 3CCLT 1WPYA 3L2UA 3CC4T 2LDMA 3OYEA 4MDWA 2RM4A 3PT9A 2JN0A 4M75C 3V8LA 4L6V5 2QTXA 3C94A 4MMKA 3FLGA 3CMAA 2D6FA 3QUIA 5GMKl 2NLUA 1GXIE 4C5GA 3BG3A 3HZJA 2KSSA 2PU9B 4M75B 4QVZA 3JCMP 1JJ2S 1D3BA 3MP8A 4L5GA 4JUVA 1VQNA 4M77G 4M78A 4QSHA 2RJDA 4PKCC 1WQWA 2VGMA 4Y28E 1U1TA 4FM4B 4ELZC 1VQ4A 1EIFA 3RERA 2X4WA 1KD1C 3JAME 1VQMA 5HK3A 5GAOn 3ZEHA 3G71A 1YI2A 4C0DB 5KE2A 3J80E 1M1KU 2DXUA 4BUGA 5GAN2 3CD6A 5GMKi 3BY7A 3CMEA 2L5QA 3HRSA 3CXCS 2BIVA 3SB2A 3V8KA 3J81E 1QLBA 3I56T 3QZ9B 3HP9A 1UGSB 3X24B 1HK9A 4EMKB 3OW2S 3A8MB 3QO3A 2QXFA 4JX5A 2QQAA 5LJ3j 3VUBA 3I55A 3HSBA 4PJOC 4HNVA 5EJCA 3V7SA 4C0FA 3OYKA 4MFDA 1X01A 1NJIC 3RMSA 2YRVA 4M7DF 5A0DA 3BW1A 4C92A 3L2ZA 3MEWA 3TREA 2C06A 2FL7A 2RD1A 4ZGDB 2KK4A 2KR6A 2VXFA 3QYBA 4A4FA 2E64A 4RG8A 3OS1A 3PMIA 1K9MC 3L2QA 3L2VA 4XTYA 2DZCA 4MZMA 1VQNT 2QQ8A 2BKDN 1UGPB 4BE0A 4LD9K 4LDWA 3A8LB 2EQMA 4M6VA 2QQ9A 1VQ5T 4MMLA 1YJNA 5J3BA 2WSCE 4M78D 3CC7T 1OI1A 3CBMA 4N0AA 2DZ9A 4BE2A 3HFNA 1HXDA 2M16A 4II1A 4XU2A 1KHIA 2RHXA 3DB4A 3RKYA 2EYQA 4JS5A 2H3JA 2QA4A 4M7DG 4HCBA 1UB4A 1S72A 4A4KA 3MP6A 4F7UE 3OY9A 3I55T 2DIQA 5LJ5e 1YJ9A 3CCET 4XTZA 3F70A 4ME7A 5GAMg 2BS2A 4J7IA 5GAN4 1Q86C 2FHDA 3OQ5A 4XTXA 4C0ZA 5CAIA 3EFSA 5FU7B 5LJ5d 2VYTA 2XIDA 4M7AD 4ZN1A 2DEQA 1H3ZA 1AHJB 2ZPGB 3X28B 4C92D 1WQ7A 4C92E 2LT4A 2EKOA 3OB9A 5CKEA 1WJRA 5GAN6 3OYNA 4ELJA 3JB9G 4JRKA 3TEEA 1B34B 4ZTFA 3GPLA 2YLBA 5GANj 2HD0A 5DY9A 4JLIA 4HKEA 3VUZA 3EAEA 2VGNA 3FEOA 1WNLA 3HRTA 1SSFA 4JJNK 4P5NA 4EMKC 3FJPA 3CC7A 4Z6YA 3SDZA 4XU0A 3CBOA 4A4EA 4O5VA 1KD1U 4OGCA 3WVDB 2PUKB 3R6OA 3MEVA 3QYEA 4IUQA 1Y96B 2HQXA 3OYIA 3CEYA 3X26B 4TVRA 4Y91A 3I56A 1U8RA 2QQSA 1YHQT 1M1KC 1RI0A 3DLMA 3BDUA 4B9XA 4E7IA 3OYMA 1IREB 2EIFA 1Y96A 1BKBA 2Y90A 3QJ6A 4Q5WA 4QQ6A 4X9CA 5FU7C 4C5IA 4ZN3A 1VQLT 4PL6A 3CC2A 1KQ2A 4AKGA 3A8GB 5GAN5 2WJ9A 5CKFA 3CCST 4VUBA 4C92B 3S3NA 2DTIA 2DXBA 2F5TX 2K5LA 5GAN8 1BI2A 2X4YA 5LJ5g 4HNUA 5GANh 5GANg 3HKSA 4D6WA 3OS0A 2XG8D 3M59A 5HY6A 2P0KA 2YLCA 2QDJA 4HL4A 5CVIA 2E1HA 3OBWA 4M78F 3QG1A 3JCMg 4JRQA 1MHNA 2QF7A 2M9UA 3SWNA 4A4HA 2DO3A 4M77D 4QQGA 5GAOp 1VQOA 1VQ6A 2R58A 3O8VA 2X4JA 3LWIA 1VQ5A 3UWNA 4M7AE 2CGHA 1YBYA 2P0PA 4FSXA 4C92G 1JB0E 5KCOA 3GF5A 5LJ3g 2QI2A 4HNTA 2I2LA 5D6WA 3H4CA 2DD4A 2JNGA 3LW5E 3CPFA 3OS5A 4J6YA 4OGEA 2B8AA 2QQBA 4QQDA 4RG2A 4EDUA 5CK9A 3PIPA 3OYGA 4KUIA 3FC3A 1VQ8T 3E19A 4JRIA 4F7UG 3VKHA 4A54A 4OB3B 1Y07A 3DB3A 4M7DD 1RL2A 2ZZDA 5GAMf 2DVEA 4QW2A 3C95A 3P8BB 3OS2A 1I5LA 3MEAA 1LNXA 3QYHB 2OTJA 3ZFJA 2BS4A 1NPPA 2WSEE 1VIFA 2RB6A 1BYMA 1ZHIA 3P8DA 1X75C 2OTJT 4M77F 3CMET 4EMHA 3GNFB 2DXTA 2QDYB 2G77A 2Y4XA 4FU6A 4JDSA 1BIAA 3BG9A 2MMPA 2RJFA 4CRIA 5GMKm 1K8AC 1NZ9A 1YIJA 5GAMe 1N9SA 3MP1A 1JRIA 3Q1JA 2XDPA 3JCMQ 1Q86U 4F7UA 1KC8U 5DLOA 4C0DC 3CXCA 2XHCA 2O01E 4XU3A 3MEUA 3JCMe 2ZPEB 2EFIA 3CCEA 2HBPA 2LNVA 2X4XA 1YJ9T 1YITA 1G5VA 4LDYA 2KQWA 4QVCA 3LGFA 2ZPIB 4XQ3A 3OW2A 4PLLA 4C8QE 1O9SA 1ZBXA 3A5ZB 3CCSA 2K4YA 1PSFA 2MAMA 1S72T 3BFMA 2R57A 4OF1A 4XTWA 3S6WA 3NTIA 2HAXA 1Q81C 2CYZB 3JB9J 4ELYC 1XNIA 2V8KA 2RI2A 3UPUA 2GF7A 3DL1A 2LT1A 3X20B 2GCXA 2RJEA 5CO7A 3E1SA 4C8QG 1NJIU 3C12A 5I2SA 2YHTA 5GANf 2KMGA 2LTOA 3WVEB 2BS3A 2L89A 5CKBA 5A2QE 2RHIA 3M4YA 3OYFA 2O4XB 3LLRA 3LH0A 4DOVA 2PUOB 5GMKe 4BBRM 4E47A 4NS5A 3CD6T 2EWNA 2DK3A 1YHQA 1NPRA 1KQ1A 2EQJA 4EMGA 4KUDK 3CCUA 3E9GA 2DPPB 3FDRA 2LVMA 4XAXB 4M7AF 3X25B 4J8OA 4OB1B 2DTOA 1M9SA 3VKGA 2E65A 1V29B 4J83A 2K57A 1UGRB 3HL8A 4A4GA 3OYHA 1G3TA 3CCMA 4IUPA 4XU1A 1M90C 4LDXA 3META 4CI0C 1G3WA 3NFCA 4J6XA 1I81A 5GAMh 1UEBA 4M75D 3JCMV 3JCMb 2QEXA 2M0OA 5FROA 2DTHA 4C8QF 2DXCA 5LJ3e 4XTVA 3P8HA 5GAOq 2K5FA 3TCJA 2KY9A 3G71T 1QP2A 1E7PA 1YI2T 1VQPT 1QVGS 3JB9F 4EMKA 2LCCA 4J7FA 4PNOA 2RI5A 1D3BB 4HLQA 4AKHA 5I2MA 3SFMA 4M7DE 2XICA 4HT8A 4YTLA 1FXXA 4BB7A 3QIIA 3H8ZA 5KH6A 5CQYA 4JX6A 2X35A 2HNIA 3PGGA 1I8FA 5CR2A 4M7AG 1XTDA 1N6AA 2BUDA 4LDUA 3VYHB 2XU8A 3EFRA 5HKCA 3ZBDA 1QVFS 2QQRA 2CZ6B 2RK2A 4BD3A 1XOVA 1N8RC 5J26A 2ZGWA 3OYLA 2EAYA 2K5IA 3G6EA 1YJWA 2P0QA 3M9QA 4BI4A 4PLIA 2RHZA 3OYAA 5A0LA 5C6SA 3H6ZA 4X34A 1M5Q1 1K8AU 4RCCA 4QVDA 1M1FA 2E5QA 4IUUA 2PVOB 5EG2A 3TW7A 5CKDA 1Q82C 1VQ7A 4AI6A 5LJ5j 1M8VA 5GMKh 4R56A 4N4GA 2QEXT 4FT4A 2RO0A 3CCQA 3C4SA 4MIMA 4LOCA 4E7JA 2MWOA 5LJ3d 2LC4A 2KVQG 3S3OA 3OBYA 2CKKA 3TU4K 2R5AA 5C0MA 4HT9A 4OMFB 4DQ2A 2PVGB 3OYBA 1VQKA 4MZPA 1G3SA 1FKMA 4MFEA 1KHCA 3M54A 4A53A 3URGA 5KCHA 3CCUT 1VQPA 2LQKA 3GLXA 4M78B 3MHXA 2E6ZA 2A3LA 2GQVA 5CQXA 3VJPA 3CCLA 1QVFA 2V8IA 5FU6C 4RMOA 1VQ9T 4IKFA 5IN1A 1PSEA 3QHSA 4KULA 1G3YA 3JCMc 1MGQA 2PQWA 2GFAA 3ME9A 3JCMd 2K2VA 3L2RA 2G3RA 3RUXA 4MZTA 3ER0A 3HRUA 4M77E 3FB9A 3OMCA 4F7UF 3VKIA 3AHUA 3M4GA 3KHIA 1IZ6A 4JX4A 4C0GA 2XDDA 2WACA 4RCBA 3VV0A 4M75F 1WJSA 3OSSC 3VYGB 3V8JA 5DM7R 3PTAA 3KXTA 3M56A 1VQMT 2KDSA 3V7RA 1W2BA 5FRNA 4ATOA 2M1HA 3QBYA 4M7AC 1N27A 1KQSS 2XK0A 2EQKA 1YJNT 1Y71A 1QW1A 3KBGA 2GFUA 4ZTJA 3JB9I 4NL2A 2MF2A 3L1AA 1LOJA 3GIBA 3TW6A 4C8QC 2L8DA 4OP0A 2VV5A 2F5KA 2A7YA 3QPHA 3JRZA 4EPCA 2RHYA 4GLKA 4F7UB 2IG0A 3S3MA 4PJOB 1Q82U 2EQUA 5GAMd 4BDYA 4C5EA 3CC4A 1VQLA 3CC2T 1M4ZA 2JZ2A 3HPWA 3SD4A 3L2WA 3ASKA 4M7AB 2V8JA 3G6ET 4E7LA 2WSFE 2K3YA 2OTLT 3CCMT 4ZGJB 3M58A 4M75G 2QA4T 2JOYA 3NTHA 3OYYA 2LCLA 1I4K1 3HFOA 1FX7A 3CCJA 4BBSM 3CCQT 4JLGA 1N9RA 1WJQA 2VXEA 4IUVA 5CKHA 4NL3A 3RKWA 4LD6A 2DJZA 3JSCA 4JS4A 4BE1A 1W2BS 3NTKA 3CCJT 1VQ7T 1X6OA 1LJOA 1U1SA 5LJ5h 1VUBA 5GMKj
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYG B;  1IRE B;  3A8H B;  2DXC A;  1QP2 A;  1DJ7 B;  2ZPB B;  4L6V 5;  3A8G B;  2DXB A;  2PU9 B;  2DXB B;  2CZ0 B;  3VYH B;  4KT0 E;  4Y28 E;  2CZ6 B;  4FM4 B;  2CZ7 B;  3HHT B;  2PVD B;  1QP3 A;  1JB0 E;  2DD4 A;  3LW5 E;  4RKU E;  2PVO B;  3QZ9 B;  1UGS B;  3X24 B;  2CZ1 B;  3A8M B;  4OB3 B;  4OB2 B;  3VYG A;  2ZZD A;  3QYH B;  2AHJ B;  2PVG B;  1GXI E;  2WSE E;  5L8R E;  4ZGD B;  2QDY B;  1PSE A;  1UGP B;  3A8L B;  3QXE B;  2WSC E;  2O01 E;  2ZPE B;  3QZ5 B;  2ZPI B;  1PSF A;  3VYG B;  2ZCF B;  2CYZ B;  1UGQ B;  2ZPH B;  3X20 B;  1AHJ B;  2ZPG B;  3X28 B;  3WVE B;  4XK8 E;  4OB0 B;  2PUO B;  2ZPF B;  2DD5 A;  2D0Q B;  2DPP B;  4ZGE B;  2ZZD B;  3X25 B;  2WSF E;  4OB1 B;  4ZGJ B;  2DD5 B;  1V29 B;  1UGR B;  3WVD B;  2PUK B;  2DXC B;  2DD4 B;  3X26 B;  3A8O B; 
#chains in the Genus database with same CATH topology
 1N8R R;  3EG9 A;  2A28 A;  3A8H B;  2BE7 D;  3CBP A;  2FVU A;  3EH2 A;  1DJ7 B;  1WIE A;  3RIR A;  4BCF B;  3I35 A;  1SHG A;  2E10 A;  1K73 C;  3CMA A;  2E70 A;  5FU6 B;  4NOY A;  1BI3 A;  1AVZ C;  3LWH A;  2MWP A;  1LCK A;  4PJO D;  1Q7Y U;  2CZ0 B;  1K4U S;  2AZS A;  3M0S A;  4BI8 B;  4TTH A;  3VS3 A;  1YCY A;  2PVD B;  4HCK A;  5LJ5 f;  1U5S A;  1M27 C;  2FO0 A;  2JVV A;  3GOX A;  1QMC A;  4DOW A;  1M90 U;  3JCM f;  2KEA A;  4D8K A;  4GY5 A;  1PKS A;  4CC4 B;  2JTM A;  3CPW A;  5LJ3 f;  5L23 A;  3EG3 A;  2C6T B;  2HQE A;  5GAN d;  1ZQ1 A;  1S72 Q;  5KE3 A;  1VQ5 Q;  2HL5 C;  4FL6 A;  1VQN Q;  2FPD A;  1YIT T;  4FYX B;  3QXE B;  2EJF A;  5CIU A;  4PJO A;  3EGU A;  1ZX6 A;  1JEG A;  4FYV B;  3WXM B;  2QFZ A;  1JBM A;  1QVP A;  3QZ5 B;  5IHI A;  4FX3 B;  1O75 A;  5GAO r;  1UGV A;  1VQO T;  3V7C A;  3JB9 D;  1OIY B;  2A37 A;  2E12 A;  2LRQ A;  2J6F A;  4E6R A;  1OYX A;  2EQI A;  1KC8 C;  2ZPH B;  2A08 A;  1RLQ C;  3G4S T;  1G3N C;  4CRL B;  2A0F B;  1TS9 A;  2FYK A;  2LX9 A;  1PHT A;  1UHC A;  1ZLM A;  2EJ9 A;  3M0P A;  4KRC B;  4J9D A;  5LL6 S;  1OU9 A;  4WF2 A;  3QSU A;  2ED1 A;  5IHY A;  1VQO Q;  3M5A A;  3BHT B;  2V22 B;  4C5H A;  3EFO A;  1TH7 A;  2RI3 A;  4F6W B;  2JW4 A;  4LNP A;  3F5X B;  2LX7 A;  5LJ3 h;  4Y72 B;  2DAQ A;  1D1C A;  5IXB A;  3OYE A;  4MDW A;  3V8L A;  2ECZ A;  2QTX A;  4MMK A;  2D6F A;  2CP2 A;  2CP0 A;  3G33 B;  4KGZ B;  3A1P A;  2DNU A;  5L2W B;  3D7S B;  4C5G A;  2M0Y A;  3HZJ A;  3M0R A;  2KSS A;  3JCM P;  4JUV A;  2WIP B;  1YJN Q;  4Y28 E;  2VGM A;  3MKD A;  1U1T A;  4FM4 B;  1VQ4 A;  1EIF A;  3RER A;  1AWW A;  5GAO n;  3ZEH A;  1YI2 A;  1VQP Q;  3J80 E;  2QEX Q;  1NEG A;  3BY7 A;  4BCM B;  1JXO A;  3SEM A;  3V8K A;  2NWM A;  1QLB A;  3QZ9 B;  2W99 A;  3QO3 A;  1D3U B;  2CUD A;  5KYW A;  1KSW A;  2YRV A;  4M7D F;  4C92 A;  3L2Z A;  2C06 A;  4BY1 X;  2MIO A;  2VXF A;  2AK5 A;  2ABL A;  1I5O B;  3PMI A;  1QQJ A;  2KT1 A;  3L2V A;  5KYX B;  2QQ8 A;  2BKD N;  2YUO A;  4LDW A;  2EQM A;  1GCQ C;  4EOS B;  4N0A A;  3CBM A;  4BE2 A;  4BCM D;  4D8D A;  4II1 A;  1KHI A;  4Z88 A;  4BCQ D;  1UB4 A;  2JXB A;  1S72 A;  4A4K A;  2DIQ A;  3LQ5 B;  1YJ9 A;  4J7I A;  1PM3 A;  2FHD A;  5LJ5 d;  2XID A;  4C92 D;  1WQ7 A;  1IB8 A;  1M3B A;  1XO2 A;  1YFN A;  4EC9 B;  2HD0 A;  3VUZ A;  3B57 A;  3EAE A;  4JJN K;  2WIH B;  4F04 B;  3CBO A;  2RQR A;  2D1X A;  1ZBJ A;  3WVD B;  4QT7 A;  3QYE A;  3OYI A;  3CEY A;  1RAG B;  2QQS A;  1QWF A;  1M1K C;  2QA4 Q;  4B9X A;  3OYM A;  3QJ6 A;  4OMO A;  5HKC A;  4Q5W A;  4C5I A;  7AT1 B;  3A8G B;  5CKF A;  1AEY A;  2DTI A;  5GAN 8;  2E5K A;  1PG5 B;  1MMN A;  5GAN h;  1RAF B;  3HKS A;  3OS0 A;  1TUC A;  2P0K A;  2YLC A;  5HBH B;  5CVI A;  1K73 R;  4M78 F;  1IGU A;  2DO3 A;  3O5Z A;  4M7A E;  1YBY A;  1AIS B;  4C92 G;  1JB0 E;  3GF5 A;  2QI2 A;  5D6W A;  5DQV A;  2DX1 A;  3LW5 E;  2QA4 T;  4RG2 A;  2QQB A;  4WTO B;  3OYG A;  3FC3 A;  1WX6 A;  4JRI A;  1IRX A;  1ACM B;  3VKH A;  4A54 A;  4F7U G;  1RL2 A;  2ZZD A;  3HTR A;  4QW2 A;  3C95 A;  3OS2 A;  1I5L A;  3CCQ Q;  1GFD A;  2K6D A;  4PJN A;  1EZZ B;  3MI9 B;  1IHV A;  2B86 A;  1RAB B;  1NPP A;  2RB6 A;  1M1K R;  2OTJ T;  1K8A C;  2RJF A;  3BG9 A;  5HBJ B;  2MMP A;  1VQM Q;  1YIJ A;  1YJW Q;  3Q1J A;  2XDP A;  2NUP B;  1LVK A;  1Q7Y R;  2ESW A;  2MCN A;  3JCM e;  1YJ9 T;  1SSH A;  1G5V A;  2KQW A;  4QVC A;  3LGF A;  4XQ3 A;  1KQS P;  2GNC A;  4F7J B;  3A5Z B;  2MAM A;  3CCS A;  1NEB A;  3S6W A;  3NTI A;  4BCJ B;  2EYW A;  1KJW A;  4OMM A;  3DL1 A;  2GCX A;  2RJE A;  1SF9 A;  4X1V A;  5CO7 A;  5GAN f;  2BS3 A;  1EX4 A;  3EGX A;  3LH0 A;  4NS5 A;  1NPR A;  3CCU A;  3FDR A;  2LVM A;  4F6U B;  4J8O A;  4DBQ A;  3EFO B;  1I1J A;  1NYF A;  2C0I A;  5AT1 B;  1V29 B;  2CSQ A;  2W10 A;  5IHK A;  2K57 A;  3HL8 A;  1G3T A;  1MMG A;  4XU1 A;  3NFC A;  4M75 D;  2AKL A;  2DTH A;  1M90 R;  4C8Q F;  2KI7 A;  5GJV B;  3P8H A;  3TCJ A;  2KY9 A;  1YI2 T;  1E7P A;  1IHW A;  4EMK A;  2LCC A;  1D3B B;  4AKH A;  4M7D E;  2XIC A;  4OMQ A;  1FXX A;  3QII A;  5CQY A;  2FZG B;  3PGG A;  1N6A A;  4BCN B;  2BUD A;  2RNA A;  4FW2 A;  2XU8 A;  4LDU A;  2CZ6 B;  3H41 A;  1HJD A;  2P0Q A;  1FMK A;  2SRC A;  4DBH A;  2OTJ Q;  4X34 A;  2WXV B;  1TTH B;  2P84 A;  4IUU A;  5LJ5 j;  1M8V A;  1PD1 A;  3TNI B;  4ROD A;  3CQT A;  2C4G B;  4FT4 A;  3CCQ A;  2MWO A;  1V1C A;  2KVQ G;  2LC4 A;  2CKK A;  2R5A A;  2CCI B;  2WPA B;  1GXI E;  2BKZ B;  3M54 A;  1VQP A;  1YI2 Q;  1FIN B;  2LQK A;  5CQX A;  4EOM B;  2A3L A;  3VJP A;  1QVF A;  1QCO A;  1MV0 B;  3EID B;  2QG9 B;  3EGD B;  1G3Y A;  3JCM c;  1H24 B;  3ME9 A;  1FMW A;  2K2V A;  3L2R A;  4AFU C;  4MZT A;  1OOT A;  2NUT A;  3HRU A;  3G4S Q;  3MY1 B;  2DM1 A;  3FB9 A;  2DE0 X;  3VKI A;  2WAC A;  1WHJ A;  1WJS A;  1B7T A;  3U23 A;  3KXT A;  2F2V A;  5HNB B;  1Y0M A;  2I0N A;  4K11 A;  4M7A C;  1N27 A;  2CP5 A;  3BE3 A;  4ZTJ A;  1AOJ A;  2C0O A;  4NL2 A;  2LJ0 A;  1K1Z A;  3GIB A;  1TOV A;  4C8Q C;  2F5K A;  3QPH A;  4EPC A;  2RHY A;  4GLK A;  2IG0 A;  2EQU A;  5GAM d;  4YC3 B;  1CSK A;  1WHM A;  3L2W A;  2GQI A;  1W70 A;  2OTL T;  3CCM T;  1TD6 A;  1QCF A;  1D1B A;  1QWE A;  2QDL A;  2LCL A;  2KR3 A;  1N9R A;  1WJQ A;  2VXE A;  2EYZ A;  4IUV A;  4NL3 A;  1TFB A;  4LD6 A;  2DJZ A;  4Z8A A;  1VUB A;  4JPB W;  3EGD A;  2RJC A;  4NC6 A;  3NMZ C;  1N8R U;  1O9K B;  2IVW A;  2RHU A;  2C5V B;  5HK0 A;  2G6F X;  1MND A;  2WMB B;  4M75 E;  1VQ6 T;  5GAN 7;  1OZ3 A;  5AYF A;  1BI1 A;  3H0F A;  4M7A A;  2OJ2 A;  4M77 C;  3CMA T;  5GJW B;  4IUR A;  1YWO A;  3QHW B;  2KRN A;  3PFS A;  2CZ7 B;  4JJB A;  4C8Q A;  1WHG A;  4XTU A;  1KG1 A;  2K3X A;  3INZ A;  3VS1 A;  3G7Z A;  4M7D C;  2LZ6 B;  1H92 A;  3M55 A;  4OB2 B;  3OA6 A;  3VYG A;  3H0H A;  2D8H A;  2HKQ B;  2OAU A;  1K8A R;  5A0G A;  5L8R E;  1VQ8 A;  2P4T A;  2RK1 A;  3VS6 A;  1P92 A;  3CCR T;  4M78 E;  3OYC A;  1T0H A;  4BDZ A;  4FCY A;  1K73 U;  2E41 A;  1W1F A;  2KMT A;  2KNB B;  3JCM h;  4JRP A;  4CFN B;  4M77 A;  4IUT A;  2OX7 A;  3CC2 Q;  4C8Q D;  2JUF A;  3E9F A;  2ENM A;  1WDX A;  2L0A A;  1HYO A;  1K0X A;  1OZ2 A;  2BZX A;  2HDA A;  2QTV A;  1UGQ B;  2RN8 A;  3NGP A;  4CC3 A;  4M7D A;  1PCX A;  3LYI A;  2OTL A;  2MYS A;  2XI9 A;  1BIB A;  1WXT A;  4XK8 E;  4OB0 B;  2WEV B;  3QJY A;  3M57 A;  5GAO l;  1R0B G;  3PMT A;  2NUT B;  3UDC A;  1JJ2 A;  4ZGE B;  4KBM B;  1M2V A;  1SRL A;  2KXD A;  3HO8 A;  3DTO A;  2JTF A;  1AZG B;  3LGL A;  1ZSZ B;  3RES A;  5GAO m;  1VQ9 Q;  5D7U A;  1H1S B;  2LJ1 A;  2VVK A;  3NDQ A;  1QVF P;  1WPY A;  3L2U A;  3PT9 A;  1WFW A;  3QUI A;  1U3O A;  3BG3 A;  4QVZ A;  2GBQ A;  2KYM A;  4RTT A;  1G8X A;  1OPL A;  4R0K A;  3JAM E;  5HK3 A;  3G71 A;  4E7S A;  5KE2 A;  2C5X B;  2DXU A;  3QWX X;  3CME A;  4EOK B;  1GBR A;  4EOR B;  3CXC S;  2BIV A;  2CRE A;  3HP9 A;  3A8M B;  3VUB A;  4HNV A;  3OYK A;  1V76 A;  3TRE A;  1YJ9 Q;  8AT1 B;  2KXC A;  1VA7 A;  1QMZ B;  1VQ7 Q;  4J9C A;  4ZGD B;  2KR6 A;  2AT1 B;  3QYB A;  2L3Q A;  3OS1 A;  4RG8 A;  3L2Q A;  4XTY A;  3ZL7 C;  1UGP B;  4BE0 A;  4LD9 K;  2PK2 A;  1YJN A;  3G1J A;  2YUQ A;  5J3B A;  2WSC E;  3ULR B;  3HFN A;  2RPN A;  1NLO C;  4ZNX A;  4XU2 A;  2RHX A;  4JS5 A;  3M03 A;  4M7D G;  1VOM A;  4HCB A;  1E6G A;  2H8H A;  5HBE B;  3OY9 A;  3CCE T;  1OEB A;  4ME7 A;  5GAM g;  2BS2 A;  3OQ5 A;  4KRT A;  1GRI A;  5FU7 B;  1H3Z A;  1AHJ B;  4C92 E;  2LT4 A;  2MOX A;  1AT1 B;  1ZA1 B;  2EKO A;  3JB9 G;  4JRK A;  4ZTF A;  3GPL A;  5GAN j;  5KYU B;  5KYN A;  2VGN A;  1B07 A;  2NYS A;  4LE9 A;  4P5N A;  2DLP A;  3SDZ A;  1WXB A;  4XU0 A;  4O5V A;  1KD1 U;  1JQQ A;  4CFU D;  1Y96 B;  2O88 A;  3I56 A;  4EOJ B;  4PFP A;  1RI0 A;  3DLM A;  3BDU A;  4E7I A;  3LH5 A;  2Y90 A;  1Y96 A;  1BKB A;  4QQ6 A;  1KQ2 A;  4PL6 A;  1G83 A;  2BE9 B;  2CT4 A;  4VUB A;  2E3H A;  3CCS Q;  2RQW A;  2X4Y A;  4HNU A;  5GAN g;  4D6W A;  2EBP A;  2XG8 D;  5HY6 A;  4F7L B;  4LN2 A;  4PFO A;  2QDJ A;  3JCM g;  4JRQ A;  4I3Z B;  3QG1 A;  2QF7 A;  4A4H A;  3SWN A;  4QQG A;  1RAA B;  1VQO A;  1M2V B;  1FMV A;  1GUX A;  5ECA A;  2UZD B;  1UFF A;  1ZSG A;  3H4C A;  4BCG B;  2DD4 A;  3OS5 A;  1NG2 A;  1A0N B;  1WYX A;  3E19 A;  1RAI B;  3QWY A;  2CSI A;  1Y07 A;  4F17 A;  4LUE A;  2DVE A;  3P8B B;  1C0M A;  1BB9 A;  2BS4 A;  1OKW B;  1ZHI A;  3FJ5 A;  1AWX A;  3VRY A;  1ZUY A;  4M77 F;  3CME T;  4EMH A;  3GNF B;  2DXT A;  4JDS A;  2QGS A;  3REB B;  1PRL C;  2BZY A;  1URC B;  1JRI A;  2CDT A;  4AG1 C;  1ZA2 B;  5DLO A;  2NUZ A;  2CP6 A;  8ATC B;  2B9R A;  1D09 B;  3MEU A;  3CCE A;  2EFI A;  1YIT A;  4LDY A;  2IVX A;  4QKU A;  2M02 A;  4C8Q E;  1O9S A;  1ZBX A;  2K4Y A;  2QYZ A;  4XTW A;  2R57 A;  2VAS A;  4AFS C;  4AFQ C;  3DDQ B;  4J9G A;  2G9X B;  4AT1 B;  1XNI A;  2GF7 A;  2LT1 A;  3X20 B;  4PFZ A;  3E1S A;  4C8Q G;  1GCP A;  3I55 Q;  1TWB A;  2L89 A;  1BBZ A;  2C5N B;  4ELL A;  1TUG B;  3VS4 A;  4DOV A;  5GMK e;  1TU0 B;  4E47 A;  2BZ8 A;  3E9G A;  2DPP B;  6AT1 B;  4XAX B;  4M7A F;  2LNH B;  3VKG A;  4J83 A;  2CH4 A;  3OYH A;  4A4G A;  4IUP A;  1G2B A;  3R6N A;  1AD5 A;  1MMA A;  2DBM A;  2QK0 A;  1Q81 R;  1OIU B;  3JCM V;  3JCM b;  2UZB B;  2M0O A;  5FRO A;  1J3T A;  5LJ3 e;  3G71 T;  1QVG S;  1VQP T;  2YDL A;  3JB9 F;  2CP3 A;  2CT3 A;  3K7A M;  1M3A A;  3CCM Q;  4F70 B;  3RNJ A;  3UA7 A;  1PC0 A;  1PKT A;  2QQR A;  2DIL A;  2RK2 A;  4BD3 A;  2HAX A;  1YWP A;  1R77 A;  5J26 A;  2EAY A;  2K5I A;  4BCI B;  1M8M A;  1N4M A;  3OYA A;  5A0L A;  4KRD B;  2COY A;  1M1F A;  5CKD A;  3TW7 A;  1NJI R;  5GMK h;  4R56 A;  4EIK A;  2RO0 A;  3C4S A;  3PVL A;  2FRY A;  4HT9 A;  2HL3 A;  2PVG B;  3OYB A;  4MZP A;  4MFE A;  3G71 Q;  4A53 A;  3URG A;  2E6Z A;  3CCL A;  1WI7 A;  1VQ6 Q;  1QCN A;  1PSE A;  3QHS A;  4KUL A;  2PQW A;  2ROL A;  4NST B;  1BCM A;  2GFA A;  3CMA Q;  3RUX A;  4UN0 A;  2QAZ A;  3OMC A;  1MUZ A;  3KHI A;  2HCK A;  3M4G A;  4C0G A;  4DBR A;  2DYI A;  4HXJ A;  3VV0 A;  4M75 F;  2DET A;  3OSS C;  3V8J A;  2KDS A;  5FRN A;  2BTT A;  2EQK A;  1YJN T;  3UA6 A;  1OL1 B;  1UNL D;  1OUL A;  2MF2 A;  5KYU A;  5CEI B;  3L1A A;  3QDF A;  2L8D A;  4OP0 A;  2JGZ B;  4PJO B;  1Q82 U;  3CCR Q;  3CC4 A;  3PO3 S;  1VQL A;  3CC2 T;  1UTI A;  4M7A B;  4E7L A;  4RTZ A;  2WSF E;  4ZGJ B;  2LQW A;  3M58 A;  2JOY A;  1P5E B;  5EC7 A;  3OYY A;  3VS5 A;  1H27 B;  1I4K 1;  3HFO A;  1FX7 A;  3CPW P;  3CCJ A;  4JLG A;  4JS4 A;  3NTK A;  1U1S A;  4PJJ A;  5LMK B;  4X9D A;  1F1B B;  3T9N A;  1JJ2 P;  2IN3 A;  2HSP A;  1TUD A;  4E7K A;  1H1P B;  2DME A;  3G4S A;  3KUF A;  3H9N A;  1Y7X A;  1K0S A;  1X27 A;  4C92 C;  3BG5 A;  3BDL A;  3HHT B;  3OSV A;  1QP3 A;  2RMO A;  4N4I A;  4HCZ A;  4O6J A;  4Z02 A;  5DLQ E;  1BI0 A;  2K79 A;  3EGX B;  1W2B P;  4RTX A;  3OYJ A;  4PJO E;  5GAM j;  1QVG A;  1GCQ A;  2LW4 A;  3C0C A;  5GAN 3;  2WFY B;  4N4H A;  3VU3 C;  2AHJ B;  2EGC A;  4V2S A;  2HEQ A;  2R7G A;  3PVQ A;  3I9Q A;  4IIM A;  1Q81 U;  3MIA B;  2J06 A;  4M7D B;  1NE8 A;  4IIO A;  4AKI A;  1SRM A;  1C1A A;  1H26 B;  2E6N A;  4CXA B;  4B9W A;  4HA8 A;  1OX9 A;  4PJO F;  2NUP A;  1KXU A;  3JB9 H;  2VC8 A;  3JCM W;  2XKO C;  3EG1 A;  3M53 A;  3JCM X;  4BI3 A;  3GNG A;  4EON B;  1TXQ A;  4Y92 A;  2EJG A;  1H3H A;  1VIE A;  1UEC A;  1BK2 A;  3SWN B;  3VS0 A;  3MO8 A;  4E2F B;  5FRM A;  5GAN e;  1H25 B;  4LXC A;  4RTY A;  3MY5 B;  2DF6 A;  4LDV A;  1TSF A;  2BPM B;  3FIF A;  2ZPF B;  3EHQ A;  1ZP2 A;  1M1G A;  5IDP B;  3CCV Q;  4LUD A;  3UT1 A;  4MDX A;  3L42 A;  2K3B A;  1UG1 A;  4M78 G;  4YOZ A;  4E7H A;  3DKM A;  3HB9 A;  2V1Q A;  5D6Y A;  1FWZ A;  2DXC B;  4C92 F;  4J9I A;  1Q7Y C;  3I5R A;  1KQS A;  1XQH A;  3CC4 T;  2LDM A;  2DVJ A;  1Q95 G;  2RM4 A;  3C94 A;  3CCE Q;  5GMK l;  4F16 A;  2LP5 A;  1SHF A;  1JJ2 S;  4ESR A;  1D3B A;  1VQN A;  1OL2 B;  1OQK A;  1X6G A;  1YIJ Q;  1RAC B;  1VQM A;  2YUP A;  4C0D B;  2H3E B;  3CD6 A;  4BUG A;  5GAN 2;  2PNI A;  2IIM A;  2L5Q A;  3HRS A;  3J81 E;  2D0N A;  3I56 T;  2DEU A;  2K9G A;  1UGS B;  1ENW A;  4EMK B;  3OW2 S;  4BCQ B;  1C9B A;  1C6V X;  2PJQ A;  4JJD A;  5EJC A;  3V7S A;  4MFD A;  3RMS A;  5A0D A;  2FL7 A;  1K9M R;  4JJC A;  2RD1 A;  3CXC P;  2KK4 A;  3TVT A;  2W96 A;  1JST B;  1B3Q A;  1K9A A;  1H1R B;  4BCP B;  2DZC A;  3GTM S;  1VQN T;  1HD3 A;  2DMO A;  3A8L B;  4M6V A;  2QQ9 A;  1NYG A;  3CC7 T;  2W2H A;  4HVU A;  3M0T A;  1HXD A;  3RKY A;  2H3J A;  3NPF A;  3KFV A;  1GBQ A;  3IQL A;  1FVV B;  3I55 T;  3F70 A;  1D0Y A;  5GAN 4;  3EFS A;  2DEQ A;  1OU8 A;  2ZPG B;  3X28 B;  2AZV A;  2UZL B;  1WJR A;  2L2P A;  1B34 B;  3TEE A;  5I11 A;  2YLB A;  5DY9 A;  1BU1 A;  4JLI A;  3CC7 Q;  1UHF A;  2X3W D;  3FEO A;  1OV3 A;  3HRT A;  1SSF A;  4EMK C;  2W0Z A;  2DBK A;  3FJP A;  5KYW B;  3CC7 A;  2EW3 A;  1T0J A;  4A4E A;  4OGC A;  4PK4 A;  2WMA B;  1LPL A;  3R6O A;  4CFV B;  2HQX A;  1K76 A;  1VOL A;  1HSQ A;  1FYN A;  1IRE B;  2EIF A;  4ZN3 A;  5FU7 C;  1VQL T;  3CC2 A;  1VQ4 Q;  4AKG A;  1RI9 A;  2WJ9 A;  1GFC A;  2QAS A;  3CCS T;  1SEM A;  1NM7 A;  4C92 B;  2F5T X;  2Z0W A;  2LCS A;  1BI2 A;  3M0Q A;  5LJ5 g;  2EGE A;  2KT8 A;  2E1H A;  4E7Z A;  1VQ6 A;  5GAO p;  1UDL A;  3O8V A;  2X4J A;  3LWI A;  1T3S A;  2CGH A;  2WHB B;  4FSX A;  2YUN A;  5KCO A;  3M0U A;  1QKX A;  4HNT A;  2FPF A;  3DDP B;  4EDU A;  3CPF A;  1K9M U;  5CK9 A;  4QQD A;  1VQ8 Q;  4KUI A;  1JKW A;  4F7N B;  2HBW A;  1AWO A;  4EOP B;  1JOW A;  3QYH B;  2WSE E;  1VIF A;  1BYM A;  4DEX A;  3P8D A;  2EYY A;  3EHR A;  2QDY B;  2Y4X A;  4FU6 A;  4CRI A;  1T3L A;  5GMK m;  1BU2 A;  1NZ9 A;  2AKK A;  1N9S A;  3MP1 A;  4RTU A;  3JCM Q;  2RQV A;  4F7U A;  1EFN A;  4C0D C;  2XHC A;  2JM9 A;  2JMC A;  2HBP A;  5EFQ B;  1NLP C;  2O9V A;  3OW2 A;  2ZPI B;  1ZSZ C;  4PLL A;  1S72 T;  2DA9 A;  3BFM A;  2KRO A;  3I5S A;  2VKN A;  1ZUU A;  1Q81 C;  4II5 B;  3RDV A;  3JB9 J;  3UPU A;  2V8K A;  3NHN A;  2HMA A;  2KMG A;  2DL4 A;  3WVE B;  2LTO A;  2CCH B;  4HVV A;  5CKB A;  5A2Q E;  3M4Y A;  1X2Q A;  3OYF A;  4BBR M;  3REA B;  2GGR A;  2EWN A;  2COW A;  4BCN D;  2DK3 A;  3CD6 Q;  1YHQ A;  2EQJ A;  1X2K A;  2OTL Q;  5HVY B;  1JXM A;  1M9S A;  2E65 A;  1JSU B;  3CCM A;  4LDX A;  2O2O A;  4F6S B;  1UEB A;  2KRS A;  2QEX A;  2OAW A;  3VRZ A;  1Z9Z A;  1ZSZ A;  2JS0 A;  4J7F A;  3SFM A;  2LJ3 A;  4YTL A;  3H8Z A;  5KH6 A;  4JX6 A;  2X1N B;  2X35 A;  5CR2 A;  2DJQ A;  4M7A G;  1XTD A;  2I53 A;  2F1L A;  4EOQ B;  2L3S A;  3ZBD A;  1N8R C;  3VS2 A;  1YJW A;  4FW1 A;  2DRK A;  3M9Q A;  4EOL B;  1SG5 A;  1K8A U;  4QVD A;  2E5Q A;  3TNW B;  5KYY B;  5EG2 A;  1VQ7 A;  1Q82 C;  4N4G A;  2QEX T;  2F2C A;  2MK5 A;  4E7J A;  4MIM A;  3TSZ A;  5KYY A;  3OBY A;  5C0M A;  4OMF B;  4KUD K;  1G3S A;  1KHC A;  1UE9 A;  3CCU T;  3JV3 A;  2PTK A;  4M78 B;  3GLX A;  3MHX A;  2DFU A;  2GQV A;  5IHN A;  2V8I A;  1VQ9 T;  1NBE B;  4IKF A;  5IXF A;  1BCO A;  1MGQ A;  4EC8 B;  1X69 A;  2CH4 W;  1D1A A;  3JCM d;  2G3R A;  1VIN A;  3ER0 A;  3BLH B;  1M30 A;  1YCS B;  4M77 E;  4F7U F;  3POM A;  2FEI A;  1IZ6 A;  4JX4 A;  2XDD A;  4RCB A;  5IF1 B;  2DL3 A;  2SEM A;  1S1N A;  3VYG B;  5DM7 R;  3PTA A;  3M56 A;  2E3I A;  3V7R A;  2M1H A;  3QBY A;  1WHK A;  2D8J A;  1Y71 A;  3KBG A;  1OGU B;  1I07 A;  3EG9 B;  5ACB A;  4PJM A;  3TW6 A;  3CCU Q;  2VV5 A;  2OI3 A;  2FZC B;  2A7Y A;  4F7U B;  4CFU B;  1KIK A;  3CME Q;  3BHV B;  3UAT A;  4C5E A;  4BDY A;  5I5Z B;  1H1Q B;  3CC4 Q;  3SD4 A;  3HPW A;  3ASK A;  2V8J A;  2CUB A;  1ARK A;  1ZUK A;  4M75 G;  1PWT A;  3NTH A;  3CCQ T;  4J9B A;  5CKH A;  4BE1 A;  4J9F A;  1W2B S;  2IPO B;  1VQ7 T;  5LJ5 h;  1UJY A;  4N0A C;  1WHH A;  4RTW A;  1W4S A;  5M9O A;  1JO8 A;  4M77 B;  3DLL A;  2ZPB B;  1YJW T;  3CPW S;  4BY7 X;  4J6W A;  2DRM A;  5I21 A;  3AT1 B;  2KBT A;  2PK9 B;  2RH2 A;  3OYD A;  4R55 A;  3A98 A;  1Q86 R;  2DXB B;  4KT0 E;  3OMG A;  4OML A;  4UC4 A;  2D9T A;  3RKX A;  5BNJ B;  1QKW A;  1QLY A;  3CCV T;  3JCM J;  1VQL Q;  1ABO A;  1VQ4 T;  1X6B A;  4RKU E;  2J7I A;  1GUX B;  4C8Q B;  2O4X A;  5D6X A;  1WGS A;  4PJO G;  1VYV A;  3FRN A;  5LQF B;  3LX7 A;  4BY6 C;  1VQK T;  1B34 A;  2CZ1 B;  1AWJ A;  2FRW A;  3QDR B;  4ANJ A;  3MCA B;  1H64 1;  1OPK A;  2EGA A;  2LQ8 A;  1KD1 R;  1R8O B;  3CCR A;  3H0I A;  2QGG A;  1MMD A;  3PNW C;  4L59 A;  1OKV B;  5J39 A;  1AZE A;  2JJ9 A;  3QWL A;  1M3C A;  2YXY A;  3QKJ A;  1Z9Q A;  1YN8 A;  2VUB A;  2AIR B;  4BAC A;  3TSW A;  4OGR B;  1YIJ T;  2QGF B;  1E6H A;  4M75 A;  2RA2 A;  4OVA A;  4DA4 A;  1VQ9 A;  4G6L B;  4PJL A;  1YP5 A;  4J5Y A;  3O0G D;  1AD6 A;  2MI6 A;  2ZCF B;  3RMQ A;  2Y4Y A;  3CCL Q;  5IT9 E;  2DKG A;  3HBL A;  1U06 A;  2CS7 A;  3N5B B;  1RUW A;  3J7A F;  3DJB A;  2F69 A;  4OMN A;  4ORZ A;  2DL5 A;  4M78 C;  1OI9 B;  4FIB A;  2DIG A;  4J9H A;  3PIO A;  5IAY A;  2DD5 A;  1F5Q B;  2RQT A;  4KGX B;  2FPE A;  3CCV A;  3MJX A;  2D0Q B;  4BY6 B;  2ZZD B;  2XD0 A;  4FT2 A;  2IW6 B;  3GP8 A;  2DD5 B;  1PKD B;  2R5M A;  2L3R A;  4BCH B;  2DD4 B;  5CCA A;  2KAF A;  5FLX E;  3A8O B;  2PZ1 A;  2FB7 A;  3SWN C;  2F2X A;  3QYG B;  4JZ3 A;  3CCL T;  2JMA A;  4M75 C;  2JN0 A;  4L6V 5;  2J6O A;  3FLG A;  3EG2 A;  5HCK A;  2NLU A;  4A63 B;  2PU9 B;  4M75 B;  5CYI B;  1D0Z A;  4L5G A;  1N5Z A;  3MP8 A;  1IXD A;  1UNH D;  2JS2 A;  3RR6 A;  4M77 G;  4M78 A;  4QSH A;  2RJD A;  4PKC C;  1WQW A;  4IMY B;  4ELZ C;  2X4W A;  1KD1 C;  5KYX A;  2ATC B;  3GBQ A;  4GBQ A;  1M1K U;  2L3P A;  1GL5 A;  5GMK i;  2X51 A;  2YRD A;  3SB2 A;  3I56 Q;  2FG0 A;  1HK9 A;  3X24 B;  4FSS A;  5LJ3 j;  2QXF A;  4JX5 A;  2QQA A;  3I55 A;  3HSB A;  4PJO C;  4C0F A;  2VB6 A;  1X01 A;  1NJI C;  3BW1 A;  3MEW A;  4CFX B;  4A4F A;  2ROT A;  2JT4 A;  2E64 A;  2CJM B;  1X43 A;  1K9M C;  1YNZ A;  2YRC A;  4MZM A;  3TQ7 P;  2ZAE A;  1VQ5 T;  1KC8 R;  4MML A;  2W9Z A;  4BCK B;  4M78 D;  2XMF A;  1OI1 A;  4EOO B;  2DZ9 A;  1VYU A;  2W9F A;  1WXU A;  2MPX C;  1RAH B;  4F14 A;  1SPK A;  2M16 A;  3DB4 A;  2EYQ A;  2QA4 A;  1ABQ A;  1YIT Q;  3MP6 A;  4F7U E;  2DYB A;  1W6X A;  5LJ5 e;  4XTZ A;  1Q86 C;  1E9H B;  5DQW A;  4XTX A;  4C0Z A;  5CAI A;  4M7A D;  2VYT A;  3QHR B;  5FWC A;  1WA7 A;  4ZN1 A;  5C6S A;  1RAE B;  3OB9 A;  5IDN B;  5CKE A;  2DER A;  2UUE B;  5GAN 6;  4ELJ A;  1GY3 B;  4HKE A;  4KH1 B;  1WNL A;  2K7A A;  2A36 A;  1TG0 A;  4Z6Y A;  5ICP B;  4B6M A;  2PUK B;  3MEV A;  4IUQ A;  2UZE B;  3X26 B;  3EG0 A;  4TVR A;  4Y91 A;  1U8R A;  1YHQ T;  1OX8 A;  4ROE A;  4X9C A;  4M4Z A;  1GH6 B;  2O9S A;  4WCI A;  4ROC A;  5GAN 5;  1KFZ A;  3S3N A;  2C5O B;  2DXB A;  2K5L A;  2RQU A;  1CKA A;  3BHU B;  3EJ1 B;  3M59 A;  1UUE A;  4HL4 A;  3RGF B;  3OBW A;  2GTJ A;  1MHN A;  2M9U A;  4M77 D;  9ATC B;  2R58 A;  1VQ5 A;  3UWN A;  2K2M A;  2P0P A;  4Z89 A;  5LJ3 g;  2CP7 A;  2I2L A;  2JNG A;  4J6Y A;  4OGE A;  2EKH A;  2KYB A;  4AMC A;  2B8A A;  3OYN A;  1VQ8 T;  5FW9 A;  4CFM B;  2P4R A;  3PIP A;  5HQ0 B;  2JTE A;  2COZ A;  2V1R A;  4OB3 B;  3DB3 A;  4M7D D;  5GAM f;  3MEA A;  1LNX A;  2V26 A;  2EUF A;  4OMP A;  2OTJ A;  4YOO A;  3ZFJ A;  1X75 C;  1IGQ A;  2G77 A;  1BIA A;  4GLM A;  1E7O A;  4OR5 B;  3E2U A;  5GAM e;  4RTV A;  1Q86 U;  1KC8 U;  5FGK B;  4BXX X;  3CXC A;  4CC7 A;  2O01 E;  4XU3 A;  2IW9 B;  2ZPE B;  2HKN A;  2LNV A;  2X4X A;  2FZK B;  2YT6 A;  2GTO A;  4KH0 B;  1PSF A;  4OF1 A;  1IO6 A;  3MPU B;  1SKU B;  1MV3 A;  4AG2 C;  2YSQ A;  2CYZ B;  1RAD B;  4ELY C;  2RI2 A;  2HQH A;  4YOS A;  2LQN A;  1VYW B;  1NJI U;  2X9H A;  1XJW B;  3C12 A;  5I2S A;  1H28 B;  2YHT A;  1YHQ Q;  2RHI A;  1MNE A;  2O4X B;  3LLR A;  2PUO B;  3CD6 T;  3RBB B;  2KGT A;  1KQ1 A;  4EMG A;  2IW8 B;  3X25 B;  4OB1 B;  2DTO A;  2C0T A;  1UGR B;  5FWB A;  3BLQ B;  2LMJ A;  2PMI B;  1M90 C;  3MET A;  4CI0 C;  1G3W A;  4J6X A;  1I81 A;  4J9E A;  1WHL A;  2VWF A;  5GAM h;  4CFW B;  2DXC A;  3UF4 A;  4XTV A;  5GAO q;  2K5F A;  1QP2 A;  1WZO A;  4PNO A;  2RI5 A;  4HLQ A;  4F7S B;  5I2M A;  2EPD A;  2J6K A;  4HT8 A;  4AFZ C;  2F2W A;  4BB7 A;  3DOG B;  2HNI A;  2E4H A;  1I8F A;  3OW2 P;  3VYH B;  1QVF S;  3EFR A;  1W98 B;  1XOV A;  3G6E A;  2ZGW A;  3OYL A;  4BI4 A;  4PLI A;  4EOI B;  2RHZ A;  1VQK Q;  4HVW A;  3H6Z A;  1M5Q 1;  2KRM A;  3TNH B;  4RCC A;  2YWW A;  1PD0 A;  2PVO B;  4CC2 A;  4AI6 A;  1Y57 A;  5IH2 A;  4LOC A;  2RF0 A;  4JZ4 A;  5LJ3 d;  4DEY A;  3S3O A;  2KE9 A;  3TU4 K;  4DQ2 A;  1VQK A;  4HCC A;  1FKM A;  5KCH A;  4FYY B;  4DBF A;  4RUG A;  4RMO A;  5FU6 C;  1UJ0 A;  5IN1 A;  3PE0 A;  1PNJ A;  1KK7 A;  5I22 A;  2J05 A;  3G6E Q;  1WLP B;  3EOC B;  2DL8 A;  2HZY A;  3VS7 A;  2PHG A;  3SHW A;  1PRM C;  3EH1 A;  3AHU A;  1M2O A;  1JU5 C;  1Q82 R;  1CKB A;  2EVR A;  4KGV B;  1VQM T;  1W2B A;  3THK A;  4ATO A;  2HSE B;  2M51 A;  1KQS S;  3CCJ Q;  2XK0 A;  3TN8 B;  1QW1 A;  2GFU A;  3JB9 I;  2EYX A;  1H4L D;  1VYT A;  2DL7 A;  4FYW B;  1LOJ A;  1I0C A;  1R0C B;  1O9K A;  3S3M A;  3JRZ A;  2O31 A;  1RLP C;  1H8K A;  1UNG D;  1M4Z A;  2JZ2 A;  2XDB A;  3G6E T;  2X3X D;  4BCO B;  2K3Y A;  2I40 B;  4BBS M;  1QVG P;  1D0X A;  3RKW A;  2JM8 A;  3JSC A;  3BLR B;  2ED0 A;  3CCJ T;  1X6O A;  1LJO A;  5GMK j; 
#chains in the Genus database with same CATH homology
 4X9D A;  4N0A C;  3A8H B;  2RJC A;  3T9N A;  4NC6 A;  1W4S A;  3CBP A;  2FVU A;  5M9O A;  1N8R U;  4M77 B;  3DLL A;  1DJ7 B;  2ZPB B;  1YJW T;  3CPW S;  2IVW A;  2RHU A;  4J6W A;  3RIR A;  5I21 A;  5HK0 A;  4E7K A;  4M75 E;  1VQ6 T;  2E10 A;  1K73 C;  5GAN 7;  1OZ3 A;  5AYF A;  2E70 A;  5FU6 B;  4NOY A;  1BI3 A;  1BI1 A;  2RH2 A;  3OYD A;  4M77 C;  3LWH A;  2MWP A;  4M7A A;  4PJO D;  3G4S A;  4R55 A;  3KUF A;  1K9M U;  2DXB B;  1Q7Y U;  3CMA T;  1Y7X A;  2CZ0 B;  4IUR A;  4KT0 E;  3OMG A;  3PFS A;  4UC4 A;  2D9T A;  3BG5 A;  3RKX A;  4BI8 B;  4C92 C;  2CZ7 B;  3BDL A;  3HHT B;  1YCY A;  2PVD B;  3OSV A;  1QP3 A;  4XTU A;  4C8Q A;  3CCV T;  1KG1 A;  3JCM J;  4N4I A;  4HCZ A;  4O6J A;  4Z02 A;  2K3X A;  5LJ5 f;  1VQ4 T;  3INZ A;  5DLQ E;  1BI0 A;  4RKU E;  2JVV A;  3GOX A;  3G7Z A;  4DOW A;  1M90 U;  4C8Q B;  3JCM f;  2O4X A;  5D6X A;  3OYJ A;  4M7D C;  4PJO E;  1WGS A;  4PJO G;  5GAM j;  3FRN A;  3LX7 A;  4BY6 C;  1VQK T;  4GY5 A;  1QVG A;  1B34 A;  2CZ1 B;  2XDB A;  3QDR B;  3M55 A;  2JTM A;  4OB2 B;  3CPW A;  5GAN 3;  3OA6 A;  3MCA B;  3VYG A;  1H64 1;  4N4H A;  5LJ3 f;  3VU3 C;  2LQ8 A;  2AHJ B;  2HQE A;  5GAN d;  2OAU A;  4V2S A;  5A0G A;  1R8O B;  5L8R E;  1VQ8 A;  3CCR A;  1ZQ1 A;  2P4T A;  2RK1 A;  1Q81 U;  5KE3 A;  3PNW C;  4L59 A;  1P92 A;  3CCR T;  5J39 A;  4M78 E;  4FL6 A;  4M7D B;  1NE8 A;  3OYC A;  4HCC A;  4AKI A;  1YIT T;  3QWL A;  4BDZ A;  3QKJ A;  3QXE B;  2VUB A;  1K73 U;  2EJF A;  5CIU A;  2E41 A;  2E6N A;  4BAC A;  4B9W A;  4PJO A;  4HA8 A;  2KMT A;  3JCM h;  3WXM B;  2QFZ A;  4JRP A;  1JBM A;  1QVP A;  4M77 A;  4IUT A;  4PJO F;  1YIJ T;  3QZ5 B;  3JB9 H;  2VC8 A;  3JCM W;  2XKO C;  4C8Q D;  3M53 A;  2JUF A;  4M75 A;  3JCM X;  4BI3 A;  2RA2 A;  3E9F A;  3GNG A;  4OVA A;  4DA4 A;  1O75 A;  5GAO r;  1VQ9 A;  4J5Y A;  1VQO T;  2MI6 A;  2ZCF B;  2EJG A;  2Y4Y A;  3RMQ A;  3V7C A;  5IT9 E;  3JB9 D;  1VIE A;  1OZ2 A;  2DKG A;  2E12 A;  2LRQ A;  3SWN B;  3HBL A;  3MO8 A;  2CS7 A;  1OYX A;  3N5B B;  1KC8 C;  1UGQ B;  2ZPH B;  3J7A F;  2F69 A;  5FRM A;  5GAN e;  4M7D A;  4M78 C;  3G4S T;  4FIB A;  3LYI A;  2OTL A;  4LDV A;  2LX9 A;  2FYK A;  2XI9 A;  2DIG A;  3FIF A;  1BIB A;  4XK8 E;  4OB0 B;  2EJ9 A;  3QJY A;  3M57 A;  5GAO l;  3PMT A;  3PIO A;  2ZPF B;  5IAY A;  2DD5 A;  5LL6 S;  3UDC A;  1M1G A;  1JJ2 A;  3CCV A;  2D0Q B;  4WF2 A;  4ZGE B;  4BY6 B;  2ZZD B;  3UT1 A;  2XD0 A;  3L42 A;  4FT2 A;  4KBM B;  3QSU A;  4M78 G;  4MDX A;  3GP8 A;  4E7H A;  2DD5 B;  3M5A A;  3HO8 A;  3DKM A;  4C5H A;  3HB9 A;  2R5M A;  2JTF A;  5D6Y A;  1FWZ A;  2DXC B;  2L3R A;  4C92 F;  1Q7Y C;  2DD4 B;  1TH7 A;  3LGL A;  2KAF A;  5CCA A;  5FLX E;  3A8O B;  2RI3 A;  3RES A;  5GAO m;  2FB7 A;  3SWN C;  1KQS A;  1XQH A;  3QYG B;  5LJ3 h;  2DAQ A;  3CCL T;  1WPY A;  3L2U A;  3CC4 T;  2LDM A;  3OYE A;  4MDW A;  2RM4 A;  3PT9 A;  2JN0 A;  4M75 C;  3V8L A;  4L6V 5;  2QTX A;  3C94 A;  4MMK A;  3FLG A;  3CMA A;  2D6F A;  3QUI A;  5GMK l;  2NLU A;  1GXI E;  4C5G A;  3BG3 A;  3HZJ A;  2KSS A;  2PU9 B;  4M75 B;  4QVZ A;  3JCM P;  1JJ2 S;  1D3B A;  3MP8 A;  4L5G A;  4JUV A;  1VQN A;  4M77 G;  4M78 A;  4QSH A;  2RJD A;  4PKC C;  1WQW A;  2VGM A;  4Y28 E;  1U1T A;  4FM4 B;  4ELZ C;  1VQ4 A;  1EIF A;  3RER A;  2X4W A;  1KD1 C;  3JAM E;  1VQM A;  5HK3 A;  5GAO n;  3ZEH A;  3G71 A;  1YI2 A;  4C0D B;  5KE2 A;  3J80 E;  1M1K U;  2DXU A;  4BUG A;  5GAN 2;  3CD6 A;  5GMK i;  3BY7 A;  3CME A;  2L5Q A;  3HRS A;  3CXC S;  2BIV A;  3SB2 A;  3V8K A;  3J81 E;  1QLB A;  3I56 T;  3QZ9 B;  3HP9 A;  1UGS B;  3X24 B;  1HK9 A;  4EMK B;  3OW2 S;  3A8M B;  3QO3 A;  2QXF A;  4JX5 A;  2QQA A;  5LJ3 j;  3VUB A;  3I55 A;  3HSB A;  4PJO C;  4HNV A;  5EJC A;  3V7S A;  4C0F A;  3OYK A;  4MFD A;  1X01 A;  1NJI C;  3RMS A;  2YRV A;  4M7D F;  5A0D A;  3BW1 A;  4C92 A;  3L2Z A;  3MEW A;  3TRE A;  2C06 A;  2FL7 A;  2RD1 A;  4ZGD B;  2KK4 A;  2KR6 A;  2VXF A;  3QYB A;  4A4F A;  2E64 A;  4RG8 A;  3OS1 A;  3PMI A;  1K9M C;  3L2Q A;  3L2V A;  4XTY A;  2DZC A;  4MZM A;  1VQN T;  2QQ8 A;  2BKD N;  1UGP B;  4BE0 A;  4LD9 K;  4LDW A;  3A8L B;  2EQM A;  4M6V A;  2QQ9 A;  1VQ5 T;  4MML A;  1YJN A;  5J3B A;  2WSC E;  4M78 D;  3CC7 T;  1OI1 A;  3CBM A;  4N0A A;  2DZ9 A;  4BE2 A;  3HFN A;  1HXD A;  2M16 A;  4II1 A;  4XU2 A;  1KHI A;  2RHX A;  3DB4 A;  3RKY A;  2EYQ A;  4JS5 A;  2H3J A;  2QA4 A;  4M7D G;  4HCB A;  1UB4 A;  1S72 A;  4A4K A;  3MP6 A;  4F7U E;  3OY9 A;  3I55 T;  2DIQ A;  5LJ5 e;  1YJ9 A;  3CCE T;  4XTZ A;  3F70 A;  4ME7 A;  5GAM g;  2BS2 A;  4J7I A;  5GAN 4;  1Q86 C;  2FHD A;  3OQ5 A;  4XTX A;  4C0Z A;  5CAI A;  3EFS A;  5FU7 B;  5LJ5 d;  2VYT A;  2XID A;  4M7A D;  4ZN1 A;  2DEQ A;  1H3Z A;  1AHJ B;  2ZPG B;  3X28 B;  4C92 D;  1WQ7 A;  4C92 E;  2LT4 A;  2EKO A;  3OB9 A;  5CKE A;  1WJR A;  5GAN 6;  3OYN A;  4ELJ A;  3JB9 G;  4JRK A;  3TEE A;  1B34 B;  4ZTF A;  3GPL A;  2YLB A;  5GAN j;  2HD0 A;  5DY9 A;  4JLI A;  4HKE A;  3VUZ A;  3EAE A;  2VGN A;  3FEO A;  1WNL A;  3HRT A;  1SSF A;  4JJN K;  4P5N A;  4EMK C;  3FJP A;  3CC7 A;  4Z6Y A;  3SDZ A;  4XU0 A;  3CBO A;  4A4E A;  4O5V A;  1KD1 U;  4OGC A;  3WVD B;  2PUK B;  3R6O A;  3MEV A;  3QYE A;  4IUQ A;  1Y96 B;  2HQX A;  3OYI A;  3CEY A;  3X26 B;  4TVR A;  4Y91 A;  3I56 A;  1U8R A;  2QQS A;  1YHQ T;  1M1K C;  1RI0 A;  3DLM A;  3BDU A;  4B9X A;  4E7I A;  3OYM A;  1IRE B;  2EIF A;  1Y96 A;  1BKB A;  2Y90 A;  3QJ6 A;  4Q5W A;  4QQ6 A;  4X9C A;  5FU7 C;  4C5I A;  4ZN3 A;  1VQL T;  4PL6 A;  3CC2 A;  1KQ2 A;  4AKG A;  3A8G B;  5GAN 5;  2WJ9 A;  5CKF A;  3CCS T;  4VUB A;  4C92 B;  3S3N A;  2DTI A;  2DXB A;  2F5T X;  2K5L A;  5GAN 8;  1BI2 A;  2X4Y A;  5LJ5 g;  4HNU A;  5GAN h;  5GAN g;  3HKS A;  4D6W A;  3OS0 A;  2XG8 D;  3M59 A;  5HY6 A;  2P0K A;  2YLC A;  2QDJ A;  4HL4 A;  5CVI A;  2E1H A;  3OBW A;  4M78 F;  3QG1 A;  3JCM g;  4JRQ A;  1MHN A;  2QF7 A;  2M9U A;  3SWN A;  4A4H A;  2DO3 A;  4M77 D;  4QQG A;  5GAO p;  1VQO A;  1VQ6 A;  2R58 A;  3O8V A;  2X4J A;  3LWI A;  1VQ5 A;  3UWN A;  4M7A E;  2CGH A;  1YBY A;  2P0P A;  4FSX A;  4C92 G;  1JB0 E;  5KCO A;  3GF5 A;  5LJ3 g;  2QI2 A;  4HNT A;  2I2L A;  5D6W A;  3H4C A;  2DD4 A;  2JNG A;  3LW5 E;  3CPF A;  3OS5 A;  4J6Y A;  4OGE A;  2B8A A;  2QQB A;  4QQD A;  4RG2 A;  4EDU A;  5CK9 A;  3PIP A;  3OYG A;  4KUI A;  3FC3 A;  1VQ8 T;  3E19 A;  4JRI A;  4F7U G;  3VKH A;  4A54 A;  4OB3 B;  1Y07 A;  3DB3 A;  4M7D D;  1RL2 A;  2ZZD A;  5GAM f;  2DVE A;  4QW2 A;  3C95 A;  3P8B B;  3OS2 A;  1I5L A;  3MEA A;  1LNX A;  3QYH B;  2OTJ A;  3ZFJ A;  2BS4 A;  1NPP A;  2WSE E;  1VIF A;  2RB6 A;  1BYM A;  1ZHI A;  3P8D A;  1X75 C;  2OTJ T;  4M77 F;  3CME T;  4EMH A;  3GNF B;  2DXT A;  2QDY B;  2G77 A;  2Y4X A;  4FU6 A;  4JDS A;  1BIA A;  3BG9 A;  2MMP A;  2RJF A;  4CRI A;  5GMK m;  1K8A C;  1NZ9 A;  1YIJ A;  5GAM e;  1N9S A;  3MP1 A;  1JRI A;  3Q1J A;  2XDP A;  3JCM Q;  1Q86 U;  4F7U A;  1KC8 U;  5DLO A;  4C0D C;  3CXC A;  2XHC A;  2O01 E;  4XU3 A;  3MEU A;  3JCM e;  2ZPE B;  2EFI A;  3CCE A;  2HBP A;  2LNV A;  2X4X A;  1YJ9 T;  1YIT A;  1G5V A;  4LDY A;  2KQW A;  4QVC A;  3LGF A;  2ZPI B;  4XQ3 A;  3OW2 A;  4PLL A;  4C8Q E;  1O9S A;  1ZBX A;  3A5Z B;  3CCS A;  2K4Y A;  1PSF A;  2MAM A;  1S72 T;  3BFM A;  2R57 A;  4OF1 A;  4XTW A;  3S6W A;  3NTI A;  2HAX A;  1Q81 C;  2CYZ B;  3JB9 J;  4ELY C;  1XNI A;  2V8K A;  2RI2 A;  3UPU A;  2GF7 A;  3DL1 A;  2LT1 A;  3X20 B;  2GCX A;  2RJE A;  5CO7 A;  3E1S A;  4C8Q G;  1NJI U;  3C12 A;  5I2S A;  2YHT A;  5GAN f;  2KMG A;  2LTO A;  3WVE B;  2BS3 A;  2L89 A;  5CKB A;  5A2Q E;  2RHI A;  3M4Y A;  3OYF A;  2O4X B;  3LLR A;  3LH0 A;  4DOV A;  2PUO B;  5GMK e;  4BBR M;  4E47 A;  4NS5 A;  3CD6 T;  2EWN A;  2DK3 A;  1YHQ A;  1NPR A;  1KQ1 A;  2EQJ A;  4EMG A;  4KUD K;  3CCU A;  3E9G A;  2DPP B;  3FDR A;  2LVM A;  4XAX B;  4M7A F;  3X25 B;  4J8O A;  4OB1 B;  2DTO A;  1M9S A;  3VKG A;  2E65 A;  1V29 B;  4J83 A;  2K57 A;  1UGR B;  3HL8 A;  4A4G A;  3OYH A;  1G3T A;  3CCM A;  4IUP A;  4XU1 A;  1M90 C;  4LDX A;  3MET A;  4CI0 C;  1G3W A;  3NFC A;  4J6X A;  1I81 A;  5GAM h;  1UEB A;  4M75 D;  3JCM V;  3JCM b;  2QEX A;  2M0O A;  5FRO A;  2DTH A;  4C8Q F;  2DXC A;  5LJ3 e;  4XTV A;  3P8H A;  5GAO q;  2K5F A;  3TCJ A;  2KY9 A;  3G71 T;  1QP2 A;  1E7P A;  1YI2 T;  1VQP T;  1QVG S;  3JB9 F;  4EMK A;  2LCC A;  4J7F A;  4PNO A;  2RI5 A;  1D3B B;  4HLQ A;  4AKH A;  5I2M A;  3SFM A;  4M7D E;  2XIC A;  4HT8 A;  4YTL A;  1FXX A;  4BB7 A;  3QII A;  3H8Z A;  5KH6 A;  5CQY A;  4JX6 A;  2X35 A;  2HNI A;  3PGG A;  1I8F A;  5CR2 A;  4M7A G;  1XTD A;  1N6A A;  2BUD A;  4LDU A;  3VYH B;  2XU8 A;  3EFR A;  5HKC A;  3ZBD A;  1QVF S;  2QQR A;  2CZ6 B;  2RK2 A;  4BD3 A;  1XOV A;  1N8R C;  5J26 A;  2ZGW A;  3OYL A;  2EAY A;  2K5I A;  3G6E A;  1YJW A;  2P0Q A;  3M9Q A;  4BI4 A;  4PLI A;  2RHZ A;  3OYA A;  5A0L A;  5C6S A;  3H6Z A;  4X34 A;  1M5Q 1;  1K8A U;  4RCC A;  4QVD A;  1M1F A;  2E5Q A;  4IUU A;  2PVO B;  5EG2 A;  3TW7 A;  5CKD A;  1Q82 C;  1VQ7 A;  4AI6 A;  5LJ5 j;  1M8V A;  5GMK h;  4R56 A;  4N4G A;  2QEX T;  4FT4 A;  2RO0 A;  3CCQ A;  3C4S A;  4MIM A;  4LOC A;  4E7J A;  2MWO A;  5LJ3 d;  2LC4 A;  2KVQ G;  3S3O A;  3OBY A;  2CKK A;  3TU4 K;  2R5A A;  5C0M A;  4HT9 A;  4OMF B;  4DQ2 A;  2PVG B;  3OYB A;  1VQK A;  4MZP A;  1G3S A;  1FKM A;  4MFE A;  1KHC A;  3M54 A;  4A53 A;  3URG A;  5KCH A;  3CCU T;  1VQP A;  2LQK A;  3GLX A;  4M78 B;  3MHX A;  2E6Z A;  2A3L A;  2GQV A;  5CQX A;  3VJP A;  3CCL A;  1QVF A;  2V8I A;  5FU6 C;  4RMO A;  1VQ9 T;  4IKF A;  5IN1 A;  1PSE A;  3QHS A;  4KUL A;  1G3Y A;  3JCM c;  1MGQ A;  2PQW A;  2GFA A;  3ME9 A;  3JCM d;  2K2V A;  3L2R A;  2G3R A;  3RUX A;  4MZT A;  3ER0 A;  3HRU A;  4M77 E;  3FB9 A;  3OMC A;  4F7U F;  3VKI A;  3AHU A;  3M4G A;  3KHI A;  1IZ6 A;  4JX4 A;  4C0G A;  2XDD A;  2WAC A;  4RCB A;  3VV0 A;  4M75 F;  1WJS A;  3OSS C;  3VYG B;  3V8J A;  5DM7 R;  3PTA A;  3KXT A;  3M56 A;  1VQM T;  2KDS A;  3V7R A;  1W2B A;  5FRN A;  4ATO A;  2M1H A;  3QBY A;  4M7A C;  1N27 A;  1KQS S;  2XK0 A;  2EQK A;  1YJN T;  1Y71 A;  1QW1 A;  3KBG A;  2GFU A;  4ZTJ A;  3JB9 I;  4NL2 A;  2MF2 A;  3L1A A;  1LOJ A;  3GIB A;  3TW6 A;  4C8Q C;  2L8D A;  4OP0 A;  2VV5 A;  2F5K A;  2A7Y A;  3QPH A;  3JRZ A;  4EPC A;  2RHY A;  4GLK A;  4F7U B;  2IG0 A;  3S3M A;  4PJO B;  1Q82 U;  2EQU A;  5GAM d;  4BDY A;  4C5E A;  3CC4 A;  1VQL A;  3CC2 T;  1M4Z A;  2JZ2 A;  3HPW A;  3SD4 A;  3L2W A;  3ASK A;  4M7A B;  2V8J A;  3G6E T;  4E7L A;  2WSF E;  2K3Y A;  2OTL T;  3CCM T;  4ZGJ B;  3M58 A;  4M75 G;  2QA4 T;  2JOY A;  3NTH A;  3OYY A;  2LCL A;  1I4K 1;  3HFO A;  1FX7 A;  3CCJ A;  4BBS M;  3CCQ T;  4JLG A;  1N9R A;  1WJQ A;  2VXE A;  4IUV A;  5CKH A;  4NL3 A;  3RKW A;  4LD6 A;  2DJZ A;  3JSC A;  4JS4 A;  4BE1 A;  1W2B S;  3NTK A;  3CCJ T;  1VQ7 T;  1X6O A;  1LJO A;  1U1S A;  5LJ5 h;  1VUB A;  5GMK j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...