4EOLB

Thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor ro3306
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cyclin-dependent kinase 2
publication title An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eolB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eolB02
4YOZA 1N4MA 4IMYB 5HNBB 2WIHB 2UZLB 2WPAB 3POMA 3LQ5B 1OL1B 2CJMB 1H25B 3BHTB 5FGKB 4EOIB 4F7NB 5HBEB 1H1RB 2C5XB 4F7SB 5I5ZB 4F7LB 5IF1B 2PHGA 2CCIB 3EJ1B 4BCHB 2IW6B 2B9RA 4CFVB 4BCGB 4F7JB 4YOOA 2WHBB 2C6TB 4BCIB 4EOQB 4BCQD 3TN8B 1AD6A 4BCMB 1D3UB 2WMAB 4ELLA 3MI9B 4KRCB 5HQ0B 4YOSA 2UUEB 2CCHB 1OIUB 1VINA 1XO2A 1PKDB 3DDPB 4F6WB 1OL2B 1H4LD 2I40B 1JOWA 2C4GB 3EOCB 4EORB 3BLQB 1QMZB 1F5QB 1P5EB 4EOOB 3RGFB 4ROEA 3G33B 4NSTB 1H28B 4FX3B 3BLRB 1VYWB 4KRDB 4BCKB 2IVXA 5HBHB 4CFUD 5HBJB 4G6LB 5HVYB 2W9FA 5ACBA 4EC9B 5L2WB 3DOGB 4BCOB 1GUXB 4II5B 1UNLD 4BCMD 4EOSB 2WFYB 1JKWA 2WIPB 5CYIB 4EC8B 4UN0A 1GH6B 1JSUB 2EUFA 4EOLB 1OKVB 1O9KB 2BPMB 1BU2A 2IW9B 3MIAB 4EOJB 4Y72B 1H1PB 1E9HB 2WEVB 4BCNB 1GY3B 2C5OB 1OKWB 2R7GA 4ROCA 5CEIB 2W9ZA 1UNGD 4CFXB 5LMKB 2W96A 2UZDB 4F6UB 4OR5B 1ZP2A 2C5NB 3BHUB 3K7AM 4OGRB 4BCJB 3TNWB 1H26B 2BKZB 2F2CA 2G9XB 3TNHB 2V22B 2UZEB 3QHWB 1W98B 5IDNB 4BCQB 5BNJB 4TTHA 5EFQB 4F6SB 1H27B 1URCB 3BLHB 1AISB 2JGZB 2PMIB 4BCPB 4EOPB 4CFNB 2WXVB 1FVVB 4YC3B 3BHVB 2QDJA 1KXUA 3MY1B 4EONB 3F5XB 4F70B 1TFBA 3DDQB 1G3NC 1FINB 1GUXA 1H24B 2C5VB 3MY5B 4BCND 4CXAB 1H1QB 1C9BA 2W2HA 1OGUB 2I53A 3QHRB 1O9KA 2PK9B 1OI9B 4CFUB 3H4CA 4I3ZB 1OIYB 4CRLB 1JSTB 5ICPB 2PK2A 4CFWB 4CFMB 1UNHD 5LQFB 4EOMB 2IW8B 3TNIB 3M03A 1H1SB 2X1NB 4BCFB 4EOKB 1VOLA 5IDPB 4RODA 3O0GD 2WMBB 4ELJA 2UZBB 2W99A 3EIDB
chains in the Genus database with same CATH superfamily
4YOZA 3QYEA 3X24B 2UZLB 1OL1B 3BG5A 5I5ZB 5IF1B 4BCHB 4YOOA 2WMAB 3MI9B 4YOSA 2UUEB 1OIUB 4F6WB 2DXCB 1H4LD 2I40B 2PJQA 3X28B 1F5QB 1P5EB 4BY7X 4ROEA 3A8GB 1VYWB 3TW6A 2IVXA 1UGRB 2CZ1B 3B57A 2QGSA 2W9FA 4JX5A 4BCOB 2BS4A 5CYIB 1UGPB 1JSUB 2LW4A 2G77A 4BY1X 1O9KB 1BU2A 3WVEB 4EOJB 1H1PB 4BCNB 3A8OB 1UNGD 1UGQB 3BHUB 2QQ8A 4OB2B 2BKZB 1FKMA 1W98B 5IDNB 4TTHA 4F6SB 1H27B 1URCB 1AISB 2JGZB 2PMIB 4CFNB 1FVVB 4YC3B 3QYGB 3F5XB 3DDQB 3MY5B 1O9KA 1ENWA 2PK2A 4CFMB 5LQFB 4EOMB 2WMBB 2W99A 1N4MA 3QYHB 3X20B 2WPAB 3LQ5B 2D0QB 5FGKB 1H1RB 2C5XB 3VYHB 2PHGA 4AKGA 2CCIB 3A8MB 2B9RA 4BCGB 4EOQB 4BCQD 2ZPEB 3PO3S 3TN8B 5DQVA 5HQ0B 1PKDB 2QDYB 2KMGA 3A8LB 5EJCA 3G33B 1H28B 3BLRB 4BCKB 3DTOA 4G6LB 4JX4A 5ACBA 4EC9B 3WVDB 3DOGB 4BCMD 1UNLD 2WFYB 1GH6B 1OKVB 4Y72B 1E9HB 1GY3B 3HZJA 2R7GA 4BBSM 2DD4B 4CFXB 4ZGDB 4F6UB 3X25B 3K7AM 2F2CA 2G9XB 3TNHB 2UZEB 4BCQB 4ZGEB 2CZ7B 3BLHB 4EOPB 3DJBA 2QDJA 4F70B 4LOCA 4CXAB 2W2HA 3GTMS 4AKHA 1OGUB 4AI6A 3QHRB 4MFEA 2ZZDB 5ICPB 1OIYB 2ZPIB 3TNIB 3M03A 4BCFB 1VOLA 4EOKB 3KHIA 3O0GD 4ELJA 2UZBB 3EIDB 3NDQA 4M6VA 2CJMB 1H25B 3BHTB 4EOIB 4F7NB 5HBEB 3HBLA 4F7LB 3QXEB 4ZGJB 3BG9A 4CFVB 2WHBB 2C6TB 2KR6A 4HL4A 2CCHB 4HNUA 3DDPB 1JOWA 2C4GB 3EOCB 4QSHA 1IREB 4EOOB 4NSTB 4KRDB 5HBHB 5HBJB 5HVYB 1TD6A 2ZCFB 1GUXB 4JX6A 4EOSB 4UN0A 2EUFA 3TW7A 3QZ9B 2BPMB 2DD5B 2BS3A 1UGSB 2C5OB 2W9ZA 5LMKB 5DQWA 4OB3B 4FM4B 4OGRB 3QZ5B 4BCJB 2V22B 4HLQA 3QWLA 3X26B 5BNJB 5EFQB 4BCPB 3MY1B 1TFBA 1GUXA 1C9BA 1H24B 4BCND 2CYZB 2PK9B 1OI9B 2CZ6B 3H4CA 2ZPFB 4I3ZB 1JSTB 2QF7A 4CFWB 2IW8B 2X1NB 4RODA 2ZPHB 4OB0B 5HNBB 4IMYB 2WIHB 2ZPBB 3DL1A 3POMA 4F7SB 1V29B 3EJ1B 2IW6B 4Z6YA 4F7JB 4BCIB 1AD6A 4BCMB 1D3UB 4ELLA 4KRCB 1VINA 1XO2A 1E7PA 2AHJB 1OL2B 5IHYA 4BBRM 3VKGA 4EORB 3BLQB 1QMZB 3RGFB 3A8HB 4FX3B 4AKIA 4CFUD 4BXXX 4OB1B 5L2WB 3BG3A 2IN3A 4II5B 2DPPB 1JKWA 2WIPB 4EC8B 2BS2A 2DMEA 2DXBB 4EOLB 2QFZA 2IW9B 3MIAB 3VYGB 2WEVB 1OKWB 4ROCA 5CEIB 2W96A 1QLBA 2UZDB 4OR5B 1ZP2A 2C5NB 3TNWB 1H26B 1AHJB 3HO8A 3VKHA 3QHWB 2WXVB 2CZ0B 2ZPGB 3BHVB 1KXUA 4MFDA 4EONB 3HB9A 1G3NC 1FINB 2C5VB 4HNVA 1H1QB 2I53A 4NC6A 3QYBA 4CFUB 4CRLB 1UNHD 1H1SB 5IDPB 4HNTA 3HHTB 2WJ9A 4MIMA
chains in the Genus database with same CATH topology
4YOZA 1N4MA 4IMYB 5HNBB 2WIHB 2UZLB 2WPAB 3POMA 3LQ5B 1OL1B 2CJMB 1H25B 3BHTB 5FGKB 4EOIB 4F7NB 5HBEB 1H1RB 2C5XB 4F7SB 5I5ZB 4F7LB 5IF1B 2PHGA 2CCIB 3EJ1B 4BCHB 2IW6B 2B9RA 4CFVB 4BCGB 4F7JB 4YOOA 2WHBB 2C6TB 4BCIB 4EOQB 4BCQD 3TN8B 1AD6A 4BCMB 1D3UB 2WMAB 4ELLA 3MI9B 4KRCB 5HQ0B 4YOSA 2UUEB 2CCHB 1OIUB 1VINA 1XO2A 1PKDB 3DDPB 4F6WB 1OL2B 1H4LD 2I40B 1JOWA 2C4GB 3EOCB 4EORB 3BLQB 1QMZB 1F5QB 1P5EB 4EOOB 3RGFB 4ROEA 3G33B 4NSTB 1H28B 4FX3B 3BLRB 1VYWB 4KRDB 4BCKB 2IVXA 5HBHB 4CFUD 5HBJB 4G6LB 5HVYB 2W9FA 5ACBA 4EC9B 5L2WB 3DOGB 4BCOB 1GUXB 4II5B 1UNLD 4BCMD 4EOSB 2WFYB 1JKWA 2WIPB 5CYIB 4EC8B 4UN0A 1GH6B 1JSUB 2EUFA 4EOLB 1OKVB 1O9KB 2BPMB 1BU2A 2IW9B 3MIAB 4EOJB 4Y72B 1H1PB 1E9HB 2WEVB 4BCNB 1GY3B 2C5OB 1OKWB 2R7GA 4ROCA 5CEIB 2W9ZA 1UNGD 4CFXB 5LMKB 2W96A 2UZDB 4F6UB 4OR5B 1ZP2A 2C5NB 3BHUB 3K7AM 4OGRB 4BCJB 3TNWB 1H26B 2BKZB 2F2CA 2G9XB 3TNHB 2V22B 2UZEB 3QHWB 1W98B 5IDNB 4BCQB 5BNJB 4TTHA 5EFQB 4F6SB 1H27B 1URCB 3BLHB 1AISB 2JGZB 2PMIB 4BCPB 4EOPB 4CFNB 2WXVB 1FVVB 4YC3B 3BHVB 2QDJA 1KXUA 3MY1B 4EONB 3F5XB 4F70B 1TFBA 3DDQB 1G3NC 1FINB 1GUXA 1H24B 2C5VB 3MY5B 4BCND 4CXAB 1H1QB 1C9BA 2W2HA 1OGUB 2I53A 3QHRB 1O9KA 2PK9B 1OI9B 4CFUB 3H4CA 4I3ZB 1OIYB 4CRLB 1JSTB 5ICPB 2PK2A 4CFWB 4CFMB 1UNHD 5LQFB 4EOMB 2IW8B 3TNIB 3M03A 1H1SB 2X1NB 4BCFB 4EOKB 1VOLA 5IDPB 4RODA 3O0GD 2WMBB 4ELJA 2UZBB 2W99A 3EIDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOZ A;  1N4M A;  4IMY B;  5HNB B;  2WIH B;  2UZL B;  2WPA B;  3POM A;  3LQ5 B;  1OL1 B;  2CJM B;  1H25 B;  3BHT B;  5FGK B;  4EOI B;  4F7N B;  5HBE B;  1H1R B;  2C5X B;  4F7S B;  5I5Z B;  4F7L B;  5IF1 B;  2PHG A;  2CCI B;  3EJ1 B;  4BCH B;  2IW6 B;  2B9R A;  4CFV B;  4BCG B;  4F7J B;  4YOO A;  2WHB B;  2C6T B;  4BCI B;  4EOQ B;  4BCQ D;  3TN8 B;  1AD6 A;  4BCM B;  1D3U B;  2WMA B;  4ELL A;  3MI9 B;  4KRC B;  5HQ0 B;  4YOS A;  2UUE B;  2CCH B;  1OIU B;  1VIN A;  1XO2 A;  1PKD B;  3DDP B;  4F6W B;  1OL2 B;  1H4L D;  2I40 B;  1JOW A;  2C4G B;  3EOC B;  4EOR B;  3BLQ B;  1QMZ B;  1F5Q B;  1P5E B;  4EOO B;  3RGF B;  4ROE A;  3G33 B;  4NST B;  1H28 B;  4FX3 B;  3BLR B;  1VYW B;  4KRD B;  4BCK B;  2IVX A;  5HBH B;  4CFU D;  5HBJ B;  4G6L B;  5HVY B;  2W9F A;  5ACB A;  4EC9 B;  5L2W B;  3DOG B;  4BCO B;  1GUX B;  4II5 B;  1UNL D;  4BCM D;  4EOS B;  2WFY B;  1JKW A;  2WIP B;  5CYI B;  4EC8 B;  4UN0 A;  1GH6 B;  1JSU B;  2EUF A;  4EOL B;  1OKV B;  1O9K B;  2BPM B;  1BU2 A;  2IW9 B;  3MIA B;  4EOJ B;  4Y72 B;  1H1P B;  1E9H B;  2WEV B;  4BCN B;  1GY3 B;  2C5O B;  1OKW B;  2R7G A;  4ROC A;  5CEI B;  2W9Z A;  1UNG D;  4CFX B;  5LMK B;  2W96 A;  2UZD B;  4F6U B;  4OR5 B;  1ZP2 A;  2C5N B;  3BHU B;  3K7A M;  4OGR B;  4BCJ B;  3TNW B;  1H26 B;  2BKZ B;  2F2C A;  2G9X B;  3TNH B;  2V22 B;  2UZE B;  3QHW B;  1W98 B;  5IDN B;  4BCQ B;  5BNJ B;  4TTH A;  5EFQ B;  4F6S B;  1H27 B;  1URC B;  3BLH B;  1AIS B;  2JGZ B;  2PMI B;  4BCP B;  4EOP B;  4CFN B;  2WXV B;  1FVV B;  4YC3 B;  3BHV B;  2QDJ A;  1KXU A;  3MY1 B;  4EON B;  3F5X B;  4F70 B;  1TFB A;  3DDQ B;  1G3N C;  1FIN B;  1GUX A;  1H24 B;  2C5V B;  3MY5 B;  4BCN D;  4CXA B;  1H1Q B;  1C9B A;  2W2H A;  1OGU B;  2I53 A;  3QHR B;  1O9K A;  2PK9 B;  1OI9 B;  4CFU B;  3H4C A;  4I3Z B;  1OIY B;  4CRL B;  1JST B;  5ICP B;  2PK2 A;  4CFW B;  4CFM B;  1UNH D;  5LQF B;  4EOM B;  2IW8 B;  3TNI B;  3M03 A;  1H1S B;  2X1N B;  4BCF B;  4EOK B;  1VOL A;  5IDP B;  4ROD A;  3O0G D;  2WMB B;  4ELJ A;  2UZB B;  2W99 A;  3EID B; 
#chains in the Genus database with same CATH topology
 4YOZ A;  3QYE A;  3X24 B;  2UZL B;  1OL1 B;  3BG5 A;  5I5Z B;  5IF1 B;  4BCH B;  4YOO A;  2WMA B;  3MI9 B;  4YOS A;  2UUE B;  1OIU B;  4F6W B;  2DXC B;  1H4L D;  2I40 B;  2PJQ A;  3X28 B;  1F5Q B;  1P5E B;  4BY7 X;  4ROE A;  3A8G B;  1VYW B;  3TW6 A;  2IVX A;  1UGR B;  2CZ1 B;  3B57 A;  2QGS A;  2W9F A;  4JX5 A;  4BCO B;  2BS4 A;  5CYI B;  1UGP B;  1JSU B;  2LW4 A;  2G77 A;  4BY1 X;  1O9K B;  1BU2 A;  3WVE B;  4EOJ B;  1H1P B;  4BCN B;  3A8O B;  1UNG D;  1UGQ B;  3BHU B;  2QQ8 A;  4OB2 B;  2BKZ B;  1FKM A;  1W98 B;  5IDN B;  4TTH A;  4F6S B;  1H27 B;  1URC B;  1AIS B;  2JGZ B;  2PMI B;  4CFN B;  1FVV B;  4YC3 B;  3QYG B;  3F5X B;  3DDQ B;  3MY5 B;  1O9K A;  1ENW A;  2PK2 A;  4CFM B;  5LQF B;  4EOM B;  2WMB B;  2W99 A;  1N4M A;  3QYH B;  3X20 B;  2WPA B;  3LQ5 B;  2D0Q B;  5FGK B;  1H1R B;  2C5X B;  3VYH B;  2PHG A;  4AKG A;  2CCI B;  3A8M B;  2B9R A;  4BCG B;  4EOQ B;  4BCQ D;  2ZPE B;  3PO3 S;  3TN8 B;  5DQV A;  5HQ0 B;  1PKD B;  2QDY B;  2KMG A;  3A8L B;  5EJC A;  3G33 B;  1H28 B;  3BLR B;  4BCK B;  3DTO A;  4G6L B;  4JX4 A;  5ACB A;  4EC9 B;  3WVD B;  3DOG B;  4BCM D;  1UNL D;  2WFY B;  1GH6 B;  1OKV B;  4Y72 B;  1E9H B;  1GY3 B;  3HZJ A;  2R7G A;  4BBS M;  2DD4 B;  4CFX B;  4ZGD B;  4F6U B;  3X25 B;  3K7A M;  2F2C A;  2G9X B;  3TNH B;  2UZE B;  4BCQ B;  4ZGE B;  2CZ7 B;  3BLH B;  4EOP B;  3DJB A;  2QDJ A;  4F70 B;  4LOC A;  4CXA B;  2W2H A;  3GTM S;  4AKH A;  1OGU B;  4AI6 A;  3QHR B;  4MFE A;  2ZZD B;  5ICP B;  1OIY B;  2ZPI B;  3TNI B;  3M03 A;  4BCF B;  1VOL A;  4EOK B;  3KHI A;  3O0G D;  4ELJ A;  2UZB B;  3EID B;  3NDQ A;  4M6V A;  2CJM B;  1H25 B;  3BHT B;  4EOI B;  4F7N B;  5HBE B;  3HBL A;  4F7L B;  3QXE B;  4ZGJ B;  3BG9 A;  4CFV B;  2WHB B;  2C6T B;  2KR6 A;  4HL4 A;  2CCH B;  4HNU A;  3DDP B;  1JOW A;  2C4G B;  3EOC B;  4QSH A;  1IRE B;  4EOO B;  4NST B;  4KRD B;  5HBH B;  5HBJ B;  5HVY B;  1TD6 A;  2ZCF B;  1GUX B;  4JX6 A;  4EOS B;  4UN0 A;  2EUF A;  3TW7 A;  3QZ9 B;  2BPM B;  2DD5 B;  2BS3 A;  1UGS B;  2C5O B;  2W9Z A;  5LMK B;  5DQW A;  4OB3 B;  4FM4 B;  4OGR B;  3QZ5 B;  4BCJ B;  2V22 B;  4HLQ A;  3QWL A;  3X26 B;  5BNJ B;  5EFQ B;  4BCP B;  3MY1 B;  1TFB A;  1GUX A;  1C9B A;  1H24 B;  4BCN D;  2CYZ B;  2PK9 B;  1OI9 B;  2CZ6 B;  3H4C A;  2ZPF B;  4I3Z B;  1JST B;  2QF7 A;  4CFW B;  2IW8 B;  2X1N B;  4ROD A;  2ZPH B;  4OB0 B;  5HNB B;  4IMY B;  2WIH B;  2ZPB B;  3DL1 A;  3POM A;  4F7S B;  1V29 B;  3EJ1 B;  2IW6 B;  4Z6Y A;  4F7J B;  4BCI B;  1AD6 A;  4BCM B;  1D3U B;  4ELL A;  4KRC B;  1VIN A;  1XO2 A;  1E7P A;  2AHJ B;  1OL2 B;  5IHY A;  4BBR M;  3VKG A;  4EOR B;  3BLQ B;  1QMZ B;  3RGF B;  3A8H B;  4FX3 B;  4AKI A;  4CFU D;  4BXX X;  4OB1 B;  5L2W B;  3BG3 A;  2IN3 A;  4II5 B;  2DPP B;  1JKW A;  2WIP B;  4EC8 B;  2BS2 A;  2DME A;  2DXB B;  4EOL B;  2QFZ A;  2IW9 B;  3MIA B;  3VYG B;  2WEV B;  1OKW B;  4ROC A;  5CEI B;  2W96 A;  1QLB A;  2UZD B;  4OR5 B;  1ZP2 A;  2C5N B;  3TNW B;  1H26 B;  1AHJ B;  3HO8 A;  3VKH A;  3QHW B;  2WXV B;  2CZ0 B;  2ZPG B;  3BHV B;  1KXU A;  4MFD A;  4EON B;  3HB9 A;  1G3N C;  1FIN B;  2C5V B;  4HNV A;  1H1Q B;  2I53 A;  4NC6 A;  3QYB A;  4CFU B;  4CRL B;  1UNH D;  1H1S B;  5IDP B;  4HNT A;  3HHT B;  2WJ9 A;  4MIM A; 
#chains in the Genus database with same CATH homology
 4YOZ A;  1N4M A;  4IMY B;  5HNB B;  2WIH B;  2UZL B;  2WPA B;  3POM A;  3LQ5 B;  1OL1 B;  2CJM B;  1H25 B;  3BHT B;  5FGK B;  4EOI B;  4F7N B;  5HBE B;  1H1R B;  2C5X B;  4F7S B;  5I5Z B;  4F7L B;  5IF1 B;  2PHG A;  2CCI B;  3EJ1 B;  4BCH B;  2IW6 B;  2B9R A;  4CFV B;  4BCG B;  4F7J B;  4YOO A;  2WHB B;  2C6T B;  4BCI B;  4EOQ B;  4BCQ D;  3TN8 B;  1AD6 A;  4BCM B;  1D3U B;  2WMA B;  4ELL A;  3MI9 B;  4KRC B;  5HQ0 B;  4YOS A;  2UUE B;  2CCH B;  1OIU B;  1VIN A;  1XO2 A;  1PKD B;  3DDP B;  4F6W B;  1OL2 B;  1H4L D;  2I40 B;  1JOW A;  2C4G B;  3EOC B;  4EOR B;  3BLQ B;  1QMZ B;  1F5Q B;  1P5E B;  4EOO B;  3RGF B;  4ROE A;  3G33 B;  4NST B;  1H28 B;  4FX3 B;  3BLR B;  1VYW B;  4KRD B;  4BCK B;  2IVX A;  5HBH B;  4CFU D;  5HBJ B;  4G6L B;  5HVY B;  2W9F A;  5ACB A;  4EC9 B;  5L2W B;  3DOG B;  4BCO B;  1GUX B;  4II5 B;  1UNL D;  4BCM D;  4EOS B;  2WFY B;  1JKW A;  2WIP B;  5CYI B;  4EC8 B;  4UN0 A;  1GH6 B;  1JSU B;  2EUF A;  4EOL B;  1OKV B;  1O9K B;  2BPM B;  1BU2 A;  2IW9 B;  3MIA B;  4EOJ B;  4Y72 B;  1H1P B;  1E9H B;  2WEV B;  4BCN B;  1GY3 B;  2C5O B;  1OKW B;  2R7G A;  4ROC A;  5CEI B;  2W9Z A;  1UNG D;  4CFX B;  5LMK B;  2W96 A;  2UZD B;  4F6U B;  4OR5 B;  1ZP2 A;  2C5N B;  3BHU B;  3K7A M;  4OGR B;  4BCJ B;  3TNW B;  1H26 B;  2BKZ B;  2F2C A;  2G9X B;  3TNH B;  2V22 B;  2UZE B;  3QHW B;  1W98 B;  5IDN B;  4BCQ B;  5BNJ B;  4TTH A;  5EFQ B;  4F6S B;  1H27 B;  1URC B;  3BLH B;  1AIS B;  2JGZ B;  2PMI B;  4BCP B;  4EOP B;  4CFN B;  2WXV B;  1FVV B;  4YC3 B;  3BHV B;  2QDJ A;  1KXU A;  3MY1 B;  4EON B;  3F5X B;  4F70 B;  1TFB A;  3DDQ B;  1G3N C;  1FIN B;  1GUX A;  1H24 B;  2C5V B;  3MY5 B;  4BCN D;  4CXA B;  1H1Q B;  1C9B A;  2W2H A;  1OGU B;  2I53 A;  3QHR B;  1O9K A;  2PK9 B;  1OI9 B;  4CFU B;  3H4C A;  4I3Z B;  1OIY B;  4CRL B;  1JST B;  5ICP B;  2PK2 A;  4CFW B;  4CFM B;  1UNH D;  5LQF B;  4EOM B;  2IW8 B;  3TNI B;  3M03 A;  1H1S B;  2X1N B;  4BCF B;  4EOK B;  1VOL A;  5IDP B;  4ROD A;  3O0G D;  2WMB B;  4ELJ A;  2UZB B;  2W99 A;  3EID B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...