2CZ7B

Fe-type nhase photo-activated for 75min at 105k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Center Structures of Photo-reactive Nitrile Hydratase during its Photo-activation Process
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz7B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz7B02
3WVDB 1JB0E 2PVOB 2CYZB 3A8OB 2QDYB 2CZ6B 1QP2A 1GXIE 1PSFA 2CZ7B 3VYGB 2PUKB 3A8LB 3A8GB 2DD5A 2PVGB 4OB2B 4OB1B 2ZCFB 3A8MB 2CZ1B 4ZGDB 2ZPHB 4XK8E 4Y28E 2O01E 2ZZDB 3QYHB 3X25B 4OB0B 2ZPGB 2DXCB 2D0QB 2DXBB 2PUOB 1DJ7B 3X28B 1UGRB 3X26B 1UGSB 2ZPIB 2AHJB 2ZZDA 3QZ9B 2DPPB 1AHJB 4RKUE 2WSEE 2DD4B 3A8HB 2WSFE 5L8RE 2DXBA 3X24B 3WVEB 3QZ5B 2CZ0B 3X20B 3QXEB 2DD4A 2DD5B 1V29B 3QYGB 3VYHB 1UGPB 2ZPFB 2ZPBB 2PVDB 1QP3A 2ZPEB 1PSEA 4ZGJB 4OB3B 3HHTB 2DXCA 4L6V5 3LW5E 2WSCE 4KT0E 1IREB 4ZGEB 4FM4B 1UGQB 2PU9B 3VYGA
chains in the Genus database with same CATH superfamily
5GANd 2QK0A 2EGEA 2WFYB 3EG1A 3CMEQ 2RHIA 1SSFA 4OMLA 1R0CB 3CC7A 5GANg 1VQKA 1NEBA 1JRIA 3HKSA 3M0PA 2HZYA 3E9GA 1Z9ZA 4RTYA 2BZ8A 2P0QA 4LN2A 4EMKC 4ZGDB 3H0IA 3PVQA 3CMAA 2EJFA 1N5ZA 2RJEA 1YJNA 2NUPA 2ZPGB 2L3QA 3F70A 2GNCA 4C5GA 2RJCA 2JW4A 4FSXA 4A4HA 2DL3A 4BI3A 1ZSZC 2DX1A 1M1KR 1HK9A 4OR5B 1G2BA 1PRLC 4QT7A 4PJOE 3CXCS 1OOTA 3UA7A 3QZ9B 3THKA 4M75F 4F6WB 1QVFS 1IZ6A 1FYNA 1X01A 1W2BS 5LJ5e 1TOVA 5BNJB 4BCGB 5CEIB 2A3LA 2R58A 3C94A 2E3IA 4F7UE 3NMZC 3SDZA 1H8KA 1VQ5T 1VQ8A 2YUOA 4KH1B 2LW4A 2EQJA 3VS5A 4M7AB 2A36A 2DIQA 3X20B 3V8LA 3TNWB 3M4YA 4J9GA 3S3OA 3CCRT 4ATOA 3I56A 2NLUA 2K3YA 1XNIA 2DETA 2XIDA 2NUTA 1WHGA 2MPXC 2X4XA 4M78F 2YUPA 4JX5A 2ZPFB 1VQMT 1XOVA 2CGHA 1YHQT 2O4XA 2PVDB 3BG3A 1SHGA 2QQBA 4M7AF 1QMZB 2PJQA 3OYMA 2K3XA 4F7NB 1D1CA 2DILA 3U23A 1TD6A 2WSCE 2WIPB 3OSVA 5FU7C 1IRXA 2HL3A 2IPOB 2RQVA 1AZEA 2KRSA 1GUXB 2R5AA 2COYA 3HSBA 1G3SA 3MEUA 1JB0E 3ULRB 2X3XD 3CCJT 3FJPA 4K11A 1AVZC 1QVPA 4CI0C 2FZGB 4EC8B 2XK0A 4KULA 4AKHA 1PM3A 3BHVB 1D0XA 1GXIE 1I5OB 3OS0A 4PJOB 1JEGA 3VYGB 3NFCA 5GAOq 2PUKB 2OAWA 1YITA 3CCSA 4M7AD 2EJ9A 3CC2Q 3TW7A 2BIVA 4J9BA 2CZ1B 3CCQA 4C0DB 1J3TA 1AWXA 4XK8E 3HBLA 3CCMT 4Y28E 2UZLB 1H1SB 1GFCA 3H4CA 3FEOA 2X51A 3UF4A 4BBRM 1X6GA 4BCKB 4Y91A 5LJ5d 4C8QD 5IHYA 2MMPA 3EHRA 2LQWA 3QSUA 3EAEA 1AEYA 4HLQA 2EQKA 2QQ8A 1N9RA 1VQ7T 4KGXB 2DPPB 2DM1A 5A0DA 3TNIB 2KI7A 2YUNA 1URCB 1RI0A 1C1AA 1KG1A 1I0CA 4J6XA 1WI7A 4PLLA 3KUFA 2KMGA 1QVGA 4N0AC 4HT8A 1X2QA 2DD4A 2X35A 1MNDA 3AHUA 1XJWB 1FMKA 1WJQA 3V8KA 4EMGA 2DRKA 4HCZA 1C6VX 1M30A 3JCMb 4M75D 1KFZA 4HNVA 2EW3A 4J7IA 1VQNQ 1H27B 4NC6A 3PMTA 3VS6A 4QQGA 4ELLA 4F7LB 3VUBA 3JB9H 3GIBA 4AKGA 1MMGA 1PD1A 3MIAB 3M0SA 3JCMJ 5GAN7 1PHTA 2RI2A 2HBWA 2IVWA 4TVRA 3ME9A 3QHRB 4BCND 1YWPA 4HNTA 1YNZA 2KROA 1KD1R 1QVFP 1UJ0A 2XU8A 4JUVA 2ATCB 1QLYA 1JO8A 1T0JA 3M9QA 1FX7A 2DTOA 1LPLA 2K9GA 3JAME 4I3ZB 4XQ3A 2ZPHB 5A0GA 2CT3A 1YJNT 2F5TX 1E9HB 2ZZDB 1M3BA 1OL1B 4OGRB 2X4JA 4BY7X 1YHQQ 3L42A 4DBQA 4ZNXA 4NL3A 2LC4A 4A4GA 4C5EA 1VQ6Q 2KT1A 2M9UA 3M54A 1BI2A 1LVKA 1KD1U 1K76A 3OA6A 2VGMA 2P0PA 3RMQA 3BDLA 2ROLA 3GP8A 2QA4Q 1QWEA 1BIAA 5LJ3h 2VVKA 5CO7A 2D8HA 1Q7YR 1VOLA 3A1PA 1VQ8Q 3L2VA 3I55Q 1E7OA 4IUQA 1LNXA 3MPUB 4DEXA 2L3SA 1ZA2B 1YJWA 3RERA 1UFFA 2RHXA 1XO2A 2FL7A 3QO3A 1RAAB 1U8RA 1Y57A 4RG8A 4OGEA 3OBWA 4JJNK 3DDPB 2ZAEA 3OYFA 4ELZC 1KJWA 4PJOF 3DLLA 1RLPC 1ABQA 3JCMc 2K57A 1YCSB 3CXCP 2ZPBB 5CKEA 1NG2A 2YRDA 4KUDK 3CCVA 4EOJB 4BY6B 2M02A 5GJWB 5FWBA 3M57A 1WHJA 1YI2A 1QLBA 5KYNA 3CCRQ 4MDXA 1ENWA 1K73U 3UT1A 4VUBA 2KXDA 4MMKA 1K8AC 1I5LA 3JB9G 3MP6A 3MJXA 1O9KB 3DDQB 4M77C 1OQKA 3CBPA 1BU2A 1JJ2P 2G3RA 4MFDA 2QAZA 4JLIA 4M77F 4M78B 2WHBB 4GLKA 1V1CA 5IHIA 2Y4XA 4FCYA 2JTMA 2JVVA 2V1QA 2EKHA 4HA8A 4BCPB 4XU2A 1YI2T 1AT1B 4CFXB 3G71T 1AZGB 1UTIA 3A98A 4ZN3A 1W70A 2O9VA 1FMVA 2CT4A 3HL8A 1QKWA 3QHSA 4RCBA 4OGCA 1OI1A 8ATCB 1G5VA 1KSWA 2CJMB 5LJ3d 5IHNA 5HY6A 5A2QE 3UA6A 3M58A 2J6OA 4BE1A 4AFSC 5HQ0B 2QEXA 2KRNA 1B3QA 5GANe 4JX4A 3CQTA 2EYXA 2IVXA 4C5IA 2KDSA 1VYWB 3H8ZA 1M27C 2C06A 1RI9A 1W98B 2G77A 1MNEA 4RTWA 3EG9A 3OB9A 2BE7D 3UWNA 1UNHD 5C0MA 2GFUA 2LQNA 4ZTFA 1K1ZA 1NYGA 4F04B 1U3OA 1C0MA 4N4IA 1PCXA 2YHTA 2BPMB 3M0RA 4PJMA 3E19A 1QCNA 4A53A 5DLOA 3URGA 5GAOl 2QQSA 4BXXX 3OMCA 5KYXB 1KC8U 4ZGJB 2DVEA 2E6NA 1MV3A 1O9KA 3PO3S 1Q82U 3NTHA 3MEVA 4KGVB 1Y96A 5CKDA 1N8RU 2R7GA 3G7ZA 1I8FA 3TNHB 5HBJB 1M8VA 5KE3A 4MZMA 1VIFA 1EFNA 4AMCA 5EJCA 1OI9B 2JGZB 1VQOQ 4PJOD 4YC3B 2KK4A 4BE2A 2KNBB 4RODA 1I81A 3LLRA 3OW2A 3JCMX 3G6EA 2WEVB 2K5IA 3E9FA 1TXQA 2NUTB 4YOZA 3M0UA 5I21A 2DD5A 1RUWA 2LJ3A 3LH0A 4DEYA 5IT9E 2JJ9A 5GJVB 3I5RA 5D6YA 5GAOn 4RTZA 2NYSA 4LD9K 3QIIA 3CCQQ 4OMPA 3FC3A 2QTVA 4E7IA 4C5HA 1YJ9A 2LVMA 3UPUA 5CK9A 3SWNA 2HDAA 5GAOr 3OYBA 1N8RC 1K0SA 3A5ZB 1WZOA 4QVCA 5CQXA 2QA4T 3MY1B 2EQIA 2L3RA 3CCLT 3QYEA 3OY9A 1CSKA 4PJOA 3VKHA 4ANJA 3JCMd 1OV3A 5KYYA 4AFZC 5GAMh 2DMOA 4D8DA 4BCJB 2P4TA 3C95A 4EOPB 2FPFA 2CZ0B 1M2OA 2RPNA 3IQLA 1NYFA 2E4HA 4J6YA 4F70B 1IXDA 3M03A 4CC2A 2OAUA 3TCJA 2RJFA 5GMKi 1Z9QA 4J5YA 4V2SA 1NZ9A 1UHFA 1Y7XA 4F7UA 4BCOB 1KIKA 1D3BA 5KYXA 1UNGD 5HBEB 3DB4A 4IIMA 1YITQ 2JOYA 1C9BA 1X27A 4M7AE 2OX7A 4A63B 1BI1A 1BCMA 4PK4A 3QYBA 4M78E 5KCOA 2WIHB 1ARKA 1YFNA 2QGFB 5KE2A 3EFSA 2H3EB 4C0GA 3OS1A 4M7DF 3M56A 4FM4B 4N0AA 4BD3A 4M77E 3AT1B 3OYJA 4QW2A 2PQWA 4C8QE 1VYTA 2QDYB 3O0GD 2LCSA 2O9SA 4EONB 3OYIA 3HP9A 3OBYA 2VKNA 2MI6A 2IW8B 3F5XB 2CSIA 2DERA 3EOCB 3H0HA 2LDMA 3OYKA 4EOSB 4NSTB 1X6OA 3D7SB 1KHCA 4HVVA 4CFMB 4FT4A 1MV0B 2JS0A 1WHMA 2ABLA 2V26A 1NPPA 3CMET 2QYZA 3SWNB 4D6WA 4HKEA 4ELJA 2V8JA 4M78G 1OIUB 2XMFA 2CP5A 1M3CA 2K7AA 2RQUA 4PJJA 3H6ZA 2VUBA 1MHNA 2GCXA 2C0IA 2YSQA 4M7DA 4QQ6A 5CKBA 4EOOB 2CSQA 4BCNB 2E12A 2ESWA 3EG9B 4EORB 3BFMA 1OKVB 4RMOA 4Z8AA 2YT6A 2F2WA 2VC8A 3CC7Q 3X24B 5KYUA 3EG0A 2RHUA 1VQ5A 3EG2A 1O9SA 1IB8A 3OYNA 4CXAB 2QQRA 2X4YA 2Z0WA 2QGGA 3CC2A 4FYVB 4LUDA 2B9RA 1VQ8T 1B34A 5CQYA 5GAMg 3J80E 3UATA 3RUXA 4LDYA 2K79A 4JX6A 2CUDA 2FRYA 4N4GA 3CPFA 5I2SA 3SEMA 1ZUKA 3RKYA 5HK3A 1RLQC 2ZGWA 2NUZA 4BUGA 5GMKj 1BIBA 4ZGEB 2KBTA 3G6EQ 3CCST 3B57A 1VQ9Q 3GNFB 3I55T 2RQWA 2HKQB 3POMA 3PE0A 2JMAA 1SF9A 2KY9A 3M59A 2RMOA 2QXFA 1U06A 2W9ZA 1QMCA 1F5QB 2BZXA 3OYDA 2QA4A 4WTOB 3OYGA 3EFRA 2J06A 4AFQC 1KC8R 2DIGA 4BCIB 5FLXE 4C8QC 1ZSGA 4HVWA 4J9CA 3RBBB 4PJNA 4II1A 3O8VA 1OULA 2OTLA 3G71Q 2DRMA 3QUIA 4HNUA 2HAXA 3REBB 4C8QA 3BLHB 1VQOT 4YOOA 1GY3B 1H4LD 3RGFB 3CMEA 3R6NA 1UGSB 2I40B 4AKIA 3DB3A 2LX9A 1FKMA 1ZP2A 2KT8A 1QCFA 2FYKA 2RK2A 1FVVB 1ZHIA 1W2BP 1HJDA 3LGFA 3M0QA 4LNPA 4CFUB 3G1JA 1NLPC 3LWIA 4XU1A 4J9HA 2JM9A 2E41A 3CCQT 1UB4A 2LCCA 4M78A 3INZA 4F7JB 5KYUB 4E7ZA 2RH2A 5ECAA 1JKWA 1LOJA 2KR6A 5KH6A 2IN3A 4C92F 3H0FA 3QWXX 3CCET 1WHLA 5FU6B 3CCUA 1ZA1B 4DOWA 4TTHA 3QG1A 3NGPA 4RTTA 1WPYA 4FX3B 5LJ3g 5IDNB 2JN0A 2JT4A 3FJ5A 2SEMA 4DBFA 1GBRA 2QFZA 4EOKB 1RL2A 4IUTA 5AT1B 1I1JA 1MUZA 3KXTA 2M1HA 2QEXQ 4M75A 2CKKA 1WDXA 5CYIB 1YJ9Q 2AZSA 3HHTB 4J6WA 1FMWA 1KQSP 4BI4A 2KSSA 1NBEB 3ZL7C 2JZ2A 1Q81C 5FW9A 2KYMA 4OVAA 4C0ZA 2PU9B 3WVDB 2AKKA 2PTKA 2EGCA 2M0OA 4XU0A 4M78D 4NS5A 1H3ZA 1PD0A 2FO0A 2HEQA 3T9NA 5GAMe 4KBMB 1RAEB 1JU5C 1UE9A 2ED1A 2PHGA 3G4SQ 2FEIA 1FWZA 1GH6B 3TW6A 1D1AA 2K5FA 2YLCA 1M1FA 3EGXB 2A08A 5LJ5f 3CEYA 4C92C 1X2KA 4ORZA 4M77A 2CUBA 2L8DA 1N6AA 2D0NA 4X1VA 3TN8B 2DVJA 3I5SA 1PWTA 3Q1JA 4OP0A 3X28B 1N8RR 1TH7A 1G83A 4ELYC 1H3HA 2QDJA 3LX7A 5IXBA 5DLQE 2F5KA 2KGTA 1WFWA 1JSTB 3QDRB 1GL5A 3PNWC 5CAIA 2DD4B 1Q81R 1RAGB 4HCCA 3TREA 2FPDA 5GAN4 3CCUT 1KHIA 2E6ZA 3DTOA 2UZEB 3QZ5B 1JXOA 3QXEB 5J39A 1VQ9A 2DMEA 1G3YA 4P5NA 4B9XA 5CCAA 3JCMg 1KXUA 4C8QF 7AT1B 4JDSA 2EQUA 1K73R 4DBHA 1G3TA 1UGPB 2BTTA 2DF6A 1ZSZA 2RM4A 1M2VB 4XTXA 4C0FA 2DXCA 4FT2A 2AIRB 4XTWA 4CFUD 3JB9F 2KYBA 5GMKe 2HSPA 1MMAA 1QVFA 1K0XA 2DFUA 1E6GA 4E7LA 3C4SA 5LJ5g 1X69A 4R55A 3CCVQ 3A8OB 2EIFA 3VKGA 4JJDA 3ZEHA 1QVGS 4MDWA 1ZLMA 1QKXA 1XQHA 2DXTA 1K9AA 5DQVA 2V8IA 3QHWB 2DAQA 1JJ2A 1WXBA 3BHUB 4M77B 4F14A 4OF1A 1P5EB 2DJZA 2K2MA 1LCKA 2LQ8A 3A8LB 3GNGA 2RF0A 3G4SA 2Y4YA 4EC9B 2EYYA 2OTLQ 4OB2B 4OMOA 4J8OA 2E3HA 3A8MB 1BB9A 2DKGA 3PFSA 5HVYB 2PMIB 1YJNQ 3KHIA 1D0YA 2DXUA 2F2XA 3QYHB 1PKDB 2ECZA 4M77G 2D0QB 2DXBB 1VYUA 2PUOB 1RAIB 3OQ5A 2AT1B 1ZSZB 1BI0A 1TTHB 3V8JA 3TSWA 5IF1B 5KCHA 3CD6Q 1AWOA 2ZZDA 5LL6S 2JUFA 1W4SA 3EGXA 4E7JA 2DYIA 2EWNA 2ED0A 1SPKA 2W99A 3LH5A 2PK2A 3A8HB 2E1HA 2WSFE 1VQ6A 3RIRA 3CCJQ 4JRPA 2EBPA 1AWJA 1YJWQ 4IKFA 2XG8D 3HRUA 4ZTJA 2WXVB 3H41A 3CD6T 2DBKA 4J9EA 4R56A 4IURA 4LUEA 1K8AR 2K6DA 5IH2A 1KQSS 3CC4T 1TS9A 2D1XA 4RTVA 3LQ5B 3EH2A 4C0DC 2H8HA 1OPLA 1AOJA 5FWCA 2DL8A 4XTUA 5DM7R 2YUQA 1PSEA 2ENMA 4OB3B 2FZCB 4LXCA 2W0ZA 2YRVA 5HKCA 2HKNA 2RI3A 2VWFA 1PG5B 2QF7A 2A28A 1G8XA 1UJYA 2QG9B 2I2LA 3EH1A 4CC3A 1W6XA 4IUPA 3RR6A 3NHNA 1NJIR 3CCMQ 5FU6C 3E1SA 3CCMA 1TU0B 1UHCA 4J9IA 2FZKB 1HYOA 3JCMP 4E6RA 1E7PA 1M3AA 1YJWT 2QDLA 1U1SA 4F7SB 1O75A 1SG5A 1WGSA 2RB6A 3NTIA 5LJ5h 1ACMB 3A8GB 2KXCA 1M1KC 1SHFA 1IHVA 3QKJA 2MK5A 5LMKB 4AFUC 1H641 4BE0A 1JXMA 1PKTA 2PNIA 1VQ5Q 3X25B 4OMQA 2WJ9A 1QW1A 3SB2A 1BCOA 1YIJT 4FW2A 1U1TA 4FL6A 1ZUUA 1Q81U 5GAOp 4XTVA 1B34B 3HTRA 2XI9A 1WIEA 3BHTB 3FLGA 2RHYA 2BS4A 5IXFA 4Q5WA 4M7AA 2IG0A 1H26B 4A4EA 2LT4A 2OTJT 2GQIA 1YITT 2HSEB 2FVUA 1VQ6T 2EYWA 1V76A 4EDUA 4RUGA 4KRDB 4BY6C 2P4RA 1Q7YU 3I56Q 2E5QA 1IO6A 1BU1A 4J7FA 4KGZB 1Q86U 5DQWA 1UUEA 4BI8B 2ZPEB 2MWOA 4PNOA 4ZN1A 2E64A 2CP2A 2CP7A 4PFOA 3P8HA 4HXJA 4BCQD 2DE0X 2DYBA 2LNVA 1ZBXA 4EMHA 2C5OB 1H24B 4CC7A 1PC0A 1BBZA 4O6JA 1TUDA 2VV5A 2DZ9A 3H9NA 2BKDN 3G6ET 1T3LA 2PVOB 1OYXA 1Q95G 3I55A 1UNLD 3BG9A 2JXBA 1JSUB 4JZ4A 2EQMA 1G3WA 3MP8A 5LJ5j 3K7AM 3ER0A 3MCAB 1AWWA 2RQRA 2UUEB 2L5QA 3OYYA 4BACA 4B9WA 3M55A 4F6SB 4G6LB 2M0YA 1M90R 4FIBA 4WF2A 1R0BG 2HL5C 5GAOm 4HT9A 4CRIA 1YP5A 4GBQA 4KUIA 3EHQA 2EPDA 4NOYA 1PRMC 2DNUA 2GQVA 5HNBB 2YLBA 2VXEA 2F1LA 1MMNA 5I2MA 3GLXA 2WSEE 1WHHA 3VRYA 2OJ2A 4BY1X 4QSHA 5ICPB 1NPRA 4F7UF 2DL5A 4RTXA 2L3PA 1WNLA 1TG0A 1H25B 2R57A 2C5XB 4B6MA 3M5AA 2XKOC 1KQ2A 4AI6A 1NEGA 1SRMA 2DTHA 2CCHB 2XDDA 2D8JA 2W10A 1KC8C 9ATCB 1GBQA 1V29B 1OEBA 2EYZA 4PJLA 2M51A 1SSHA 2W96A 3VS1A 2HQXA 4J83A 2HNIA 1WXTA 4C92B 2QQAA 1K4US 1H1PB 1WYXA 1H92A 2AK5A 1YJ9T 1S1NA 3DKMA 1QCOA 2CH4W 2DEQA 3REAB 4HCBA 5L23A 2WACA 4XU3A 4F7UB 4L6V5 4JRQA 4L5GA 3G71A 3NDQA 2HD0A 3BG5A 1WHKA 1H1RB 3BW1A 2RI5A 1X75C 1I4K1 4N4HA 1VQPQ 2RHZA 1WXUA 2C5NB 1CKBA 4MZPA 3VYGA 5LJ3e 2XICA 4M7DD 1K9MC 1VQMQ 2RNAA 3RKXA 1VQLT 1PKSA 2OTJA 3VJPA 5LJ3j 1D3UB 5IN1A 3C0CA 4X9CA 4UC4A 2DBMA 2KR3A 1S72A 3HZJA 1OKWB 5CKFA 3PGGA 2EGAA 4M78C 3JCMQ 2K3BA 2CP6A 1ZBJA 3VKIA 2E70A 2HQHA 2BKZB 2O01E 4XAXB 1M90U 5GMKm 2DXCB 3EFOB 1SEMA 5KYYB 1OPKA 1LJOA 2RK1A 4GY5A 1JJ2S 3EFOA 4C92D 1VQNA 1OX9A 2XHCA 3X26B 4BCMD 1VOMA 4D8KA 2XDBA 3GPLA 4MMLA 2QASA 2MF2A 3MKDA 2GTJA 4Z02A 2OTLT 5CVIA 3L2RA 1Y71A 6AT1B 1S72T 1AHJB 2E65A 3CCEA 2GTOA 3I35A 1M90C 3DOGB 2HQEA 2LQKA 2MIOA 3LGLA 1NJIU 5D6XA 5L8RE 4IMYB 1R8OB 4M6VA 5EFQB 4DA4A 3WVEB 3OYHA 2D6FA 3UDCA 5FU7B 1UECA 4DBRA 2MOXA 2DL4A 3EIDB 2BS3A 1IGQA 3OYLA 4II5B 2P0KA 3JCMf 3MI9B 2W9FA 1NE8A 3LWHA 3LYIA 4M7DC 3KBGA 2MCNA 3QPHA 2A37A 5C6SA 4QVZA 4A4FA 2AZVA 5FGKB 3QBYA 4F7UG 1OU9A 3WXMB 1YCYA 4QVDA 5CR2A 2DL7A 4L59A 4OMFB 3CC4Q 3CPWP 1UG1A 5IAYA 1M1KU 1K8AU 3ZFJA 1K9MR 4BDZA 4E47A 4ESRA 5D7UA 2QTXA 4BCQB 5FROA 2HCKA 3HB9A 5J26A 4OMMA 4KRTA 2LNHB 3JCMe 1D09B 2C4GB 1IREB 1TSFA 3E2UA 1ZQ1A 2B86A 2YXYA 1T0HA 3CCRA 3I56T 3JSCA 2DTIA 2BE9B 3M0TA 2RQTA 2DK3A 1RADB 4C8QG 3OYEA 3TU4K 5DY9A 3V7SA 3EGDB 4DQ2A 2WPAB 2CREA 3N5BB 2C5VB 2CZ7B 4BBSM 2YRCA 2OI3A 1IHWA 4LDUA 1GFDA 4KRCB 2RA2A 3CCSQ 4OB1B 2IIMA 8AT1B 4LDVA 1BK2A 4KH0B 3HFNA 1YI2Q 1CKAA 2JMCA 3RMSA 2GFAA 2NWMA 4JS4A 1QQJA 3JCMV 2X9HA 4EOLB 1VQ4T 3PIOA 2LRQA 2X3WD 3S3MA 2LX7A 1KD1C 5GAMd 2C6TB 3VS2A 1UGVA 3CXCA 1GUXA 3VU3C 5ACBA 2E10A 2X1NB 2VXFA 5GAN3 4RKUE 1JOWA 1N9SA 2A7YA 4M7DB 3PVLA 1Y96B 4X9DA 4BB7A 3L2QA 3OYCA 1H1QB 3ASKA 1F1BB 2FB7A 2O88A 1JQQA 3JRZA 3JB9I 2R5MA 2OTJQ 3HO8A 4PJOC 2VASA 4XTYA 4M77D 5I22A 3VS4A 1NM7A 1EIFA 4E7HA 3L2WA 1VQLA 5GAMf 4EOIB 1OIYB 1YN8A 5HBHB 2RO0A 4JS5A 3VRZA 1NJIC 1VQKQ 1D0ZA 5M9OA 2PK9B 3CCLA 3CC4A 2EVRA 2LT1A 2W2HA 1M9SA 4O5VA 3CCUQ 4M4ZA 2L2PA 2LCLA 2RN8A 2LZ6B 1Q82R 1G3NC 3DLMA 2DLPA 3FIFA 3MY5B 1GCPA 2EFIA 3DL1A 2L89A 2JS2A 4RCCA 1R77A 1TWBA 2BZYA 2UZDB 2K4YA 1Q86C 3JCMW 1A0NB 1OGUB 2CYZB 2MWPA 2A0FB 2V22B 1WJRA 1YWOA 4M7AC 2CZ6B 1PNJA 1OX8A 3MO8A 4C92G 3OW2P 2C0OA 5HCKA 1Q7YC 2FRWA 2LTOA 3CCJA 1VIEA 2WMBB 2DJQA 2XDPA 1OU8A 4M7DE 4JZ3A 2Y90A 2KMTA 2FG0A 3MEWA 3VS3A 2DEUA 2IW6B 1AD5A 1OL2B 3TVTA 3RDVA 1UDLA 4UN0A 5KYWB 2DO3A 5D6WA 3EGDA 2QGSA 3SD4A 3SHWA 1VQNT 2K5LA 2PZ1A 1DJ7B 1X43A 4J9FA 3V7RA 3SWNC 5L2WB 1UGRB 4CFVB 1B7TA 1KQ1A 3G4ST 4RTUA 1WJSA 4EPCA 4LE9A 4CFWB 3RNJA 4FYYB 2AHJB 1VQOA 2V8KA 4MZTA 3L2ZA 1AISB 2KQWA 4R0KA 1Y0MA 4JJBA 4F16A 4HVUA 5GAMj 3QWLA 4CC4B 2P84A 1UEBA 2GGRA 1M8MA 1FXXA 4PFPA 3BLRB 4MIMA 2I53A 2DXBA 4PJOG 2WMAB 2G9XB 1OZ2A 3FB9A 4AG2C 1QVGP 2EUFA 4JRKA 2RD1A 3BDUA 2DZCA 3ZBDA 1D1BA 2IW9B 1H28B 2JTEA 2DD5B 3HPWA 1TUGB 3VUZA 4X34A 5LJ3f 4PLIA 4Z89A 4GLMA 1EX4A 3CCVT 2QEXT 1HD3A 1VQPA 2O31A 5FRNA 5GANh 2JM8A 1VYVA 2VGNA 1VQ4A 1QP3A 3JB9J 1YIJA 4IUVA 3CD6A 5KYWA 3EJ1B 1X6BA 3NPFA 2B8AA 3NTKA 4Z6YA 4M7DG 3RESA 4KT0E 3FRNA 3CC2T 3BY7A 2LJ1A 4ME7A 4F17A 4ROCA 3MP1A 1K73C 3SFMA 3CC7T 3QJ6A 2I0NA 4Y72B 2O4XB 5EG2A 1QP2A 1M4ZA 2KAFA 1ZX6A 2KE9A 1PSFA 3JV3A 4M75E 3S3NA 5GMKl 1TFBA 1QWFA 1VA7A 3V7CA 5IHKA 1VQ7Q 5CKHA 4FW1A 2PVGB 2CH4A 3P8DA 1U5SA 3JCMh 2F69A 4WCIA 5AYFA 3PTAA 2AKLA 5GAN8 4DOVA 4OB0B 3O5ZA 3OS5A 2J7IA 2EAYA 3CPWA 1HSQA 2EYQA 4JRIA 4C8QB 2JNGA 3J7AF 2MAMA 2J6FA 4HCKA 2ZPIB 1WX6A 4Y92A 2K2VA 1BYMA 2CP0A 5GANj 3G33B 2QQ9A 3GOXA 4EMKA 3J81E 2COWA 3QDFA 5A0LA 5FRMA 3MHXA 2LJ0A 3CBMA 4CRLB 5HK0A 1BI3A 1E6HA 4YOSA 1AD6A 3I9QA 2D9TA 3MEAA 1WQWA 3VS0A 4PFZA 2J05A 1IGUA 2KEAA 4JPBW 5I11A 3M53A 1XTDA 1D3BB 3JB9D 3DJBA 2YDLA 1GCQC 1M1GA 2J6KA 2JTFA 2FHDA 3GF5A 3TQ7P 1MMDA 2F2VA 5J3BA 3VYHB 2HMAA 3VV0A 3OYAA 4A4KA 1Q86R 3META 2FPEA 4BCHB 1RAHB 3CMAQ 1FINB 2SRCA 2G6FX 3GBQA 2BUDA 1Y07A 3OS2A 2XD0A 4BCMB 4M75B 3CPWS 4NL2A 2NUPB 1WQ7A 4ROEA 4FYWB 1P92A 1BKBA 1SRLA 1YHQA 1Q82C 5GMKh 1M5Q1 3PT9A 3R6OA 3HFOA 2M16A 1RACB 3LW5E 1HXDA 5I5ZB 4AG1C 2CDTA 3OMGA 4M75C 2KRMA 3CCEQ 4JJCA 4OMNA 1MGQA 5EC7A 3FDRA 3L2UA 1N4MA 4C92E 1EZZB 1VQKT 1RABB 1YBYA 3CBOA 2KVQG 1I07A 2CCIB 1GRIA 2RJDA 4EIKA 2L0AA 2V1RA 3OSSC 3EGUA 3QJYA 2CS7A 2EJGA 1VUBA 2H3JA 3TSZA 1VQ7A 2EKOA 1KQSA 2ZCFB 4F6UB 2HBPA 1B07A 3KFVA 1VINA 4LDXA 4M7AG 3RKWA 1OZ3A 4EOMB 1NLOC 5IDPB 1ZUYA 2ROTA 4FYXB 3L1AA 4IUUA 4E7KA 1GCQA 4CFNB 4PL6A 2GF7A 3C12A 1VQ4Q 4E2FB 4C92A 3OW2S 2C0TA 4LDWA 3HRTA 5GAN2 4EMKB 2CP3A 2O2OA 4JLGA 3EG3A 1VQPT 1S72Q 5GAN6 5GAN5 4AT1B 2X4WA 1K9MU 1VQ9T 2LP5A 3BLQB 1M2VA 4XTZA 4YTLA 1W1FA 5CIUA 1VQLQ 2GBQA 1SKUB 3PMIA 1RAFB 1N27A 4RG2A 2BS2A 4BDYA 1JBMA 4A54A 3TEEA 4FU6A 4QQDA 2F2CA 1T3SA 1W2BA 4HL4A 3QYGB 4QKUA 4IIOA 4J9DA 2VYTA 4LD6A 2VB6A 3M4GA 2UZBB 3S6WA 4E7SA 2QI2A 3CMAT 2MYSA 1KK7A 4BCFB 1YIJQ 1WLPB 4MFEA 1ABOA 5GANf 3GTMS 4PKCC 3HRSA 4M75G 1VQMA 1WA7A 4LOCA 3VS7A 3QWYA 4EOQB 1TUCA 3PIPA 2E5KA 4Z88A 5LQFB 2DA9A 3P8BB 3CCLQ 2LMJA 2COZA 2YWWA 1UGQB 3BE3A 4FSSA
chains in the Genus database with same CATH topology
5GANd 1QVFA 2DTIA 4E7LA 1M8VA 3C4SA 5KE3A 4MZMA 5LJ5g 1VIFA 4R55A 3A8OB 2DK3A 2EIFA 4C8QG 5EJCA 3VKGA 1SSFA 2RHIA 3OYEA 3TU4K 5DY9A 3ZEHA 3V7SA 1QVGS 4MDWA 4PJOD 2KK4A 4DQ2A 4BE2A 1XQHA 2DXTA 3CC7A 5GANg 1VQKA 1I81A 3LLRA 2V8IA 3OW2A 3N5BB 2DAQA 3JCMX 1JJ2A 2CZ7B 3G6EA 2K5IA 1JRIA 3E9FA 4BBSM 4M77B 3HKSA 4OF1A 2DJZA 4LDUA 3E9GA 2LQ8A 3A8LB 3GNGA 3G4SA 2Y4YA 5I21A 2RA2A 2DD5A 2P0QA 4OB2B 4OB1B 4J8OA 3LH0A 3A8MB 4EMKC 4ZGDB 4LDVA 2DKGA 5GAOn 5D6YA 5IT9E 3PFSA 4LD9K 3QIIA 3KHIA 3HFNA 2DXUA 3CMAA 3RMSA 3QYHB 2GFAA 2EJFA 2RJEA 4JS4A 1YJNA 2ZPGB 3FC3A 4M77G 4E7IA 2D0QB 3F70A 4C5HA 2DXBB 3JCMV 2PUOB 2RJCA 4C5GA 3OQ5A 1VQ4T 1YJ9A 2LVMA 3PIOA 3UPUA 2LRQA 5CK9A 3S3MA 1BI0A 4FSXA 3SWNA 3V8JA 4A4HA 1KD1C 4BI3A 5GAOr 5KCHA 3OYBA 5GAMd 1HK9A 1N8RC 2ZZDA 3CXCA 5LL6S 3A5ZB 2JUFA 3CXCS 3VU3C 4PJOE 4QVCA 5CQXA 2QA4T 3QZ9B 1W4SA 2E10A 4M75F 2L3RA 2VXFA 3CCLT 1IZ6A 1X01A 5GAN3 2EWNA 5LJ5e 4RKUE 4E7JA 1W2BS 3QYEA 1N9SA 2A3LA 2A7YA 2R58A 3C94A 4F7UE 4M7DB 1Y96B 3SDZA 4X9DA 4BB7A 3A8HB 2E1HA 3OY9A 2WSFE 3OYCA 3L2QA 1VQ5T 1VQ6A 3VKHA 3ASKA 1VQ8A 2FB7A 4PJOA 3RIRA 3JCMd 5GAMh 3JRZA 4JRPA 2P4TA 3JB9I 3C95A 2EQJA 2R5MA 4M7AB 2DIQA 3HO8A 2CZ0B 3X20B 4IKFA 3V8LA 2XG8D 3M4YA 3HRUA 4ZTJA 4PJOC 4XTYA 4M77D 3S3OA 4J6YA 1EIFA 3CCRT 4E7HA 3CD6T 3I56A 4ATOA 2NLUA 2K3YA 1XNIA 3L2WA 2OAUA 4R56A 3TCJA 1VQLA 2XIDA 5GAMf 4IURA 2RJFA 5GMKi 4J5YA 1KQSS 2X4XA 4V2SA 1NZ9A 4M78F 3CC4T 1Y7XA 4F7UA 2RO0A 4JX5A 2ZPFB 4JS5A 1VQMT 1NJIC 1XOVA 4C0DC 2CGHA 5M9OA 1D3BA 3CCLA 3CC4A 3DB4A 1YHQT 2O4XA 2PVDB 2JOYA 3BG3A 4M7AE 2LT1A 1M9SA 4O5VA 2QQBA 4XTUA 5DM7R 1BI1A 4M7AF 3OYMA 2LCLA 1PSEA 3QYBA 4OB3B 3DLMA 2K3XA 2YRVA 5HKCA 4M78E 2RI3A 3FIFA 5KCOA 2QF7A 5KE2A 3EFSA 2EFIA 2WSCE 4C0GA 3OS1A 3DL1A 2L89A 3OSVA 2I2LA 4M7DF 4IUPA 4RCCA 5FU7C 3M56A 4FM4B 5FU6C 4N0AA 2K4YA 3E1SA 4BD3A 3CCMA 1Q86C 2R5AA 4M77E 3JCMW 3HSBA 1G3SA 3MEUA 1JB0E 3OYJA 2CYZB 2MWPA 3JCMP 4QW2A 1WJRA 2PQWA 4C8QE 3CCJT 2QDYB 3FJPA 4M7AC 2CZ6B 1E7PA 1QVPA 3MO8A 4C92G 4CI0C 2XK0A 1YJWT 4KULA 4AKHA 1GXIE 1Q7YC 1U1SA 3OYIA 2LTOA 3HP9A 1O75A 3OBYA 3OS0A 3CCJA 4PJOB 2MI6A 3VYGB 1VIEA 3NFCA 5GAOq 2PUKB 2LDMA 3OYKA 1WGSA 2RB6A 1YITA 3NTIA 3CCSA 4M7AD 2EJ9A 2XDPA 3TW7A 4M7DE 5LJ5h 2Y90A 2KMTA 3A8GB 1M1KC 2BIVA 3MEWA 3QKJA 1X6OA 1KHCA 4FT4A 2CZ1B 3CCQA 4C0DB 1H641 4XK8E 3HBLA 3CCMT 4Y28E 4BE0A 1NPPA 3X25B 3CMET 2WJ9A 1QW1A 2DO3A 5D6WA 3SB2A 3SD4A 3SWNB 4HKEA 3H4CA 4ELJA 3FEOA 4D6WA 2K5LA 2V8JA 1YIJT 1VQNT 4M78G 1DJ7B 1U1TA 3V7RA 4BBRM 4FL6A 3SWNC 4Y91A 5LJ5d 1UGRB 3LWHA 1KQ1A 3G4ST 1Q81U 3H6ZA 1WJSA 4EPCA 2VUBA 1MHNA 4XTVA 2GCXA 4C8QD 1B34B 5GAOp 2MMPA 3QSUA 2AHJB 2XI9A 2V8KA 3EAEA 4MZTA 3L2ZA 1VQOA 4HLQA 4M7DA 2KQWA 2EQKA 2QQ8A 1N9RA 4QQ6A 5CKBA 2DPPB 1VQ7T 5GAMj 3QWLA 3FLGA 2RHYA 5A0DA 2BS4A 1UEBA 2E12A 1FXXA 4Q5WA 1RI0A 3BFMA 1KG1A 4RMOA 4M7AA 2IG0A 4J6XA 4MIMA 2VC8A 2DXBA 4PJOG 1OZ2A 4A4EA 2LT4A 3FB9A 4PLLA 3X24B 2OTJT 3KUFA 2KMGA 1YITT 4JRKA 1QVGA 2FVUA 4N0AC 1VQ6T 1VQ5A 2RHUA 4EDUA 1O9SA 2RD1A 3BDUA 4HT8A 2DZCA 3ZBDA 2DD4A 2X35A 4BY6C 2DD5B 3HPWA 3OYNA 2QQRA 3AHUA 2X4YA 1Q7YU 1WJQA 3CC2A 3VUZA 1VQ8T 1B34A 4X34A 5CQYA 4PLIA 5LJ3f 3V8KA 4EMGA 5GAMg 4HCZA 3J80E 2E5QA 3RUXA 4LDYA 4J7FA 3JCMb 3CCVT 4JX6A 4M75D 2QEXT 1Q86U 4N4GA 4HNVA 1VQPA 3CPFA 4J7IA 5GANh 5FRNA 1VQ4A 2VGNA 4BI8B 1QP3A 2ZPEB 4NC6A 3JB9J 2MWOA 3PMTA 5I2SA 1YIJA 4IUVA 4PNOA 4ZN1A 2E64A 4QQGA 3RKYA 3CD6A 5HK3A 2ZGWA 3VUBA 2B8AA 3JB9H 4BUGA 5GMKj 1BIBA 3NTKA 4Z6YA 3P8HA 3GIBA 4M7DG 4JRQA 3RESA 4KT0E 2LNVA 4AKGA 1ZBXA 4EMHA 4ZGEB 3FRNA 3CC2T 3JCMJ 5GAN7 3BY7A 4O6JA 3CCST 2VV5A 4ME7A 2RI2A 3MP1A 3GNFB 3I55T 2DZ9A 2BKDN 2IVWA 4TVRA 3G6ET 1K73C 3M59A 2KY9A 2PVOB 3ME9A 1OYXA 3SFMA 3CC7T 3QJ6A 3I55A 2QXFA 3BG9A 2O4XB 1QP2A 5EG2A 1M4ZA 2EQMA 4HNTA 1G3WA 3MP8A 5LJ5j 3OYDA 2QA4A 2KAFA 3OYGA 4M75E 1PSFA 3EFRA 3ER0A 3S3NA 2XU8A 4JUVA 5GMKl 3V7CA 3MCAB 2L5QA 2DIGA 3M9QA 1FX7A 5CKHA 3OYYA 4BACA 4B9WA 2DTOA 2PVGB 3M55A 4C8QC 5FLXE 3P8DA 3JAME 4II1A 3O8VA 2OTLA 4XQ3A 3JCMh 2ZPHB 2F69A 4FIBA 4WF2A 5AYFA 5A0GA 5GAOm 2F5TX 1YJNT 3PTAA 2ZZDB 3QUIA 5GAN8 4HT9A 4CRIA 4DOVA 4HNUA 4OB0B 4KUIA 2HAXA 2X4JA 3OS5A 4C8QA 2EAYA 3L42A 4NL3A 1VQOT 3CPWA 2LC4A 4A4GA 2EYQA 4C5EA 4JRIA 4C8QB 2JNGA 4NOYA 3CMEA 1UGSB 4AKIA 2M9UA 2GQVA 3DB3A 2LX9A 3M54A 1FKMA 1BI2A 2MAMA 3J7AF 1KD1U 2ZPIB 2YLBA 2FYKA 2RK2A 1ZHIA 2K2VA 2VGMA 2P0PA 3RMQA 3BDLA 3OA6A 3LGFA 2VXEA 1BYMA 3GP8A 5I2MA 1BIAA 5LJ3h 2QQ9A 5GANj 3GLXA 3GOXA 2WSEE 5CO7A 4EMKA 3J81E 4QSHA 3LWIA 4XU1A 5A0LA 3L2VA 3MHXA 5FRMA 4IUQA 2E41A 3CCQT 1NPRA 3CBMA 1LNXA 1UB4A 4F7UF 5HK0A 2LCCA 4M78A 1BI3A 3INZA 1WNLA 2R57A 2D9TA 1YJWA 3MEAA 3RERA 1WQWA 2RH2A 2XKOC 1LOJA 3M5AA 1KQ2A 4AI6A 3M53A 2KR6A 1XTDA 2RHXA 5KH6A 2DTHA 1D3BB 2FL7A 2XDDA 3JB9D 4C92F 1M1GA 3CCET 3QO3A 2JTFA 1KC8C 2FHDA 5FU6B 3CCUA 3GF5A 1U8RA 1V29B 4DOWA 5J3BA 4RG8A 3QG1A 3VYHB 4OGEA 3OBWA 3VV0A 4A4KA 3OYAA 3META 1WPYA 4JJNK 5LJ3g 3OYFA 2JN0A 2HQXA 4J83A 4ELZC 4PJOF 3DLLA 2HNIA 2BUDA 1Y07A 2K57A 3JCMc 2QFZA 1RL2A 4IUTA 4C92B 3OS2A 2XD0A 2ZPBB 2QQAA 4M75B 3CPWS 4NL2A 5CKEA 3KXTA 2M1HA 1WQ7A 1YJ9T 1P92A 1BKBA 4M75A 2CKKA 3DKMA 1YHQA 1QVFS 2DEQA 1Q82C 4KUDK 3CCVA 3HHTB 1M5Q1 3PT9A 3R6OA 4J6WA 5GMKh 4HCBA 4BY6B 3HFOA 2WACA 2M16A 4XU3A 4L6V5 3LW5E 4L5GA 1HXDA 4F7UB 3M57A 2KSSA 4BI4A 2HD0A 3G71A 3OMGA 1QLBA 3BG5A 1YI2A 4M75C 4MDXA 2JZ2A 2RI5A 1X75C 1I4K1 1MGQA 3BW1A 4N4HA 4VUBA 2RHZA 3UT1A 1Q81C 4OVAA 1K73U 4C0ZA 2PU9B 4MZPA 3FDRA 3VYGA 3WVDB 4MMKA 5LJ3e 3L2UA 1K8AC 1I5LA 2XICA 3JB9G 4C92E 4M7DD 3MP6A 1K9MC 1VQKT 2M0OA 1YBYA 4XU0A 3RKXA 4M78D 4NS5A 4M77C 1VQLT 3CBOA 2KVQG 1H3ZA 2OTJA 3CBPA 3VJPA 5LJ3j 5IN1A 2RJDA 2G3RA 4MFDA 4X9CA 3T9NA 4JLIA 5GAMe 4KBMB 4UC4A 4M77F 4M78B 1S72A 3HZJA 3OSSC 4GLKA 3QJYA 2CS7A 2EJGA 2Y4XA 2JTMA 1VUBA 3PGGA 1FWZA 5CKFA 4M78C 3TW6A 2H3JA 2JVVA 3JCMQ 1VQ7A 2K5FA 2EKOA 4HA8A 2YLCA 1KQSA 1M1FA 5LJ5f 4XU2A 2ZCFB 2HBPA 3CEYA 3VKIA 4C92C 2E70A 1YI2T 4LDXA 3G71T 4M7AG 2O01E 3RKWA 1OZ3A 4XAXB 4ZN3A 4M77A 1M90U 2L8DA 1N6AA 3L1AA 4IUUA 5GMKm 2DXCB 4E7KA 3Q1JA 4OP0A 4PL6A 2GF7A 3C12A 3HL8A 4RCBA 1LJOA 2RK1A 3X28B 3QHSA 4GY5A 1JJ2S 4OGCA 1TH7A 4C92D 1OI1A 4C92A 2XHCA 3OW2S 4ELYC 3X26B 1VQNA 1G5VA 2XDBA 2QDJA 4LDWA 3GPLA 3LX7A 4MMLA 5LJ3d 5DLQE 2F5KA 5HY6A 5A2QE 2MF2A 4Z02A 2OTLT 3HRTA 5CVIA 1Y71A 5GAN2 1S72T 4EMKB 3M58A 4BE1A 4JLGA 1VQPT 1AHJB 2E65A 5GAN6 5GAN5 2QEXA 5GANe 3QDRB 3CCEA 4JX4A 3PNWC 2X4WA 1K9MU 5CAIA 1M90C 1VQ9T 2DD4B 4XTZA 4C5IA 4HCCA 4YTLA 2KDSA 2HQEA 3TREA 2LQKA 3LGLA 5CIUA 1NJIU 5D6XA 5L8RE 3H8ZA 3PMIA 5GAN4 3CCUT 1N27A 1R8OB 4M6VA 1KHIA 4RG2A 4DA4A 2C06A 2BS2A 4BDYA 3WVEB 2E6ZA 3OYHA 1JBMA 3QZ5B 3UDCA 2D6FA 2G77A 5FU7B 4A54A 3TEEA 3OB9A 3QXEB 2BS3A 4FU6A 3UWNA 4QQDA 5J39A 3OYLA 1VQ9A 3JB9F 1G3YA 2P0KA 4P5NA 3JCMf 4B9XA 3JCMg 5CCAA 1W2BA 4HL4A 4C8QF 3QYGB 1NE8A 3LYIA 4JDSA 2EQUA 2GFUA 3KBGA 5C0MA 3QPHA 4ZTFA 5C6SA 4M7DC 4QVZA 4A4FA 3QBYA 4F7UG 3WXMB 1YCYA 2VYTA 4LD6A 4QVDA 5CR2A 3M4GA 4L59A 4N4IA 2YHTA 4OMFB 1G3TA 1UGPB 3S6WA 3E19A 2QI2A 3CMAT 5IAYA 4A53A 1M1KU 1K8AU 3ZFJA 5DLOA 3URGA 2RM4A 5GAOl 4BDZA 4E47A 4MFEA 2QQSA 2QTXA 3OMCA 5GANf 1KC8U 4ZGJB 4PKCC 3HRSA 4XTXA 2DVEA 2E6NA 4M75G 5FROA 3HB9A 4LOCA 2DXCA 4C0FA 1VQMA 5J26A 3PIPA 4FT2A 3JCMe 1Q82U 3NTHA 3MEVA 1IREB 1Y96A 5CKDA 1ZQ1A 3P8BB 4XTWA 1N8RU 3G7ZA 1I8FA 3CCRA 1UGQB 3L2RA 3I56T 5GMKe 3JSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVD B;  1JB0 E;  2PVO B;  2CYZ B;  3A8O B;  2QDY B;  2CZ6 B;  1QP2 A;  1GXI E;  1PSF A;  2CZ7 B;  3VYG B;  2PUK B;  3A8L B;  3A8G B;  2DD5 A;  2PVG B;  4OB2 B;  4OB1 B;  2ZCF B;  3A8M B;  2CZ1 B;  4ZGD B;  2ZPH B;  4XK8 E;  4Y28 E;  2O01 E;  2ZZD B;  3QYH B;  3X25 B;  4OB0 B;  2ZPG B;  2DXC B;  2D0Q B;  2DXB B;  2PUO B;  1DJ7 B;  3X28 B;  1UGR B;  3X26 B;  1UGS B;  2ZPI B;  2AHJ B;  2ZZD A;  3QZ9 B;  2DPP B;  1AHJ B;  4RKU E;  2WSE E;  2DD4 B;  3A8H B;  2WSF E;  5L8R E;  2DXB A;  3X24 B;  3WVE B;  3QZ5 B;  2CZ0 B;  3X20 B;  3QXE B;  2DD4 A;  2DD5 B;  1V29 B;  3QYG B;  3VYH B;  1UGP B;  2ZPF B;  2ZPB B;  2PVD B;  1QP3 A;  2ZPE B;  1PSE A;  4ZGJ B;  4OB3 B;  3HHT B;  2DXC A;  4L6V 5;  3LW5 E;  2WSC E;  4KT0 E;  1IRE B;  4ZGE B;  4FM4 B;  1UGQ B;  2PU9 B;  3VYG A; 
#chains in the Genus database with same CATH topology
 5GAN d;  2QK0 A;  2EGE A;  2WFY B;  3EG1 A;  3CME Q;  2RHI A;  1SSF A;  4OML A;  1R0C B;  3CC7 A;  5GAN g;  1VQK A;  1NEB A;  1JRI A;  3HKS A;  3M0P A;  2HZY A;  3E9G A;  1Z9Z A;  4RTY A;  2BZ8 A;  2P0Q A;  4LN2 A;  4EMK C;  4ZGD B;  3H0I A;  3PVQ A;  3CMA A;  2EJF A;  1N5Z A;  2RJE A;  1YJN A;  2NUP A;  2ZPG B;  2L3Q A;  3F70 A;  2GNC A;  4C5G A;  2RJC A;  2JW4 A;  4FSX A;  4A4H A;  2DL3 A;  4BI3 A;  1ZSZ C;  2DX1 A;  1M1K R;  1HK9 A;  4OR5 B;  1G2B A;  1PRL C;  4QT7 A;  4PJO E;  3CXC S;  1OOT A;  3UA7 A;  3QZ9 B;  3THK A;  4M75 F;  4F6W B;  1QVF S;  1IZ6 A;  1FYN A;  1X01 A;  1W2B S;  5LJ5 e;  1TOV A;  5BNJ B;  4BCG B;  5CEI B;  2A3L A;  2R58 A;  3C94 A;  2E3I A;  4F7U E;  3NMZ C;  3SDZ A;  1H8K A;  1VQ5 T;  1VQ8 A;  2YUO A;  4KH1 B;  2LW4 A;  2EQJ A;  3VS5 A;  4M7A B;  2A36 A;  2DIQ A;  3X20 B;  3V8L A;  3TNW B;  3M4Y A;  4J9G A;  3S3O A;  3CCR T;  4ATO A;  3I56 A;  2NLU A;  2K3Y A;  1XNI A;  2DET A;  2XID A;  2NUT A;  1WHG A;  2MPX C;  2X4X A;  4M78 F;  2YUP A;  4JX5 A;  2ZPF B;  1VQM T;  1XOV A;  2CGH A;  1YHQ T;  2O4X A;  2PVD B;  3BG3 A;  1SHG A;  2QQB A;  4M7A F;  1QMZ B;  2PJQ A;  3OYM A;  2K3X A;  4F7N B;  1D1C A;  2DIL A;  3U23 A;  1TD6 A;  2WSC E;  2WIP B;  3OSV A;  5FU7 C;  1IRX A;  2HL3 A;  2IPO B;  2RQV A;  1AZE A;  2KRS A;  1GUX B;  2R5A A;  2COY A;  3HSB A;  1G3S A;  3MEU A;  1JB0 E;  3ULR B;  2X3X D;  3CCJ T;  3FJP A;  4K11 A;  1AVZ C;  1QVP A;  4CI0 C;  2FZG B;  4EC8 B;  2XK0 A;  4KUL A;  4AKH A;  1PM3 A;  3BHV B;  1D0X A;  1GXI E;  1I5O B;  3OS0 A;  4PJO B;  1JEG A;  3VYG B;  3NFC A;  5GAO q;  2PUK B;  2OAW A;  1YIT A;  3CCS A;  4M7A D;  2EJ9 A;  3CC2 Q;  3TW7 A;  2BIV A;  4J9B A;  2CZ1 B;  3CCQ A;  4C0D B;  1J3T A;  1AWX A;  4XK8 E;  3HBL A;  3CCM T;  4Y28 E;  2UZL B;  1H1S B;  1GFC A;  3H4C A;  3FEO A;  2X51 A;  3UF4 A;  4BBR M;  1X6G A;  4BCK B;  4Y91 A;  5LJ5 d;  4C8Q D;  5IHY A;  2MMP A;  3EHR A;  2LQW A;  3QSU A;  3EAE A;  1AEY A;  4HLQ A;  2EQK A;  2QQ8 A;  1N9R A;  1VQ7 T;  4KGX B;  2DPP B;  2DM1 A;  5A0D A;  3TNI B;  2KI7 A;  2YUN A;  1URC B;  1RI0 A;  1C1A A;  1KG1 A;  1I0C A;  4J6X A;  1WI7 A;  4PLL A;  3KUF A;  2KMG A;  1QVG A;  4N0A C;  4HT8 A;  1X2Q A;  2DD4 A;  2X35 A;  1MND A;  3AHU A;  1XJW B;  1FMK A;  1WJQ A;  3V8K A;  4EMG A;  2DRK A;  4HCZ A;  1C6V X;  1M30 A;  3JCM b;  4M75 D;  1KFZ A;  4HNV A;  2EW3 A;  4J7I A;  1VQN Q;  1H27 B;  4NC6 A;  3PMT A;  3VS6 A;  4QQG A;  4ELL A;  4F7L B;  3VUB A;  3JB9 H;  3GIB A;  4AKG A;  1MMG A;  1PD1 A;  3MIA B;  3M0S A;  3JCM J;  5GAN 7;  1PHT A;  2RI2 A;  2HBW A;  2IVW A;  4TVR A;  3ME9 A;  3QHR B;  4BCN D;  1YWP A;  4HNT A;  1YNZ A;  2KRO A;  1KD1 R;  1QVF P;  1UJ0 A;  2XU8 A;  4JUV A;  2ATC B;  1QLY A;  1JO8 A;  1T0J A;  3M9Q A;  1FX7 A;  2DTO A;  1LPL A;  2K9G A;  3JAM E;  4I3Z B;  4XQ3 A;  2ZPH B;  5A0G A;  2CT3 A;  1YJN T;  2F5T X;  1E9H B;  2ZZD B;  1M3B A;  1OL1 B;  4OGR B;  2X4J A;  4BY7 X;  1YHQ Q;  3L42 A;  4DBQ A;  4ZNX A;  4NL3 A;  2LC4 A;  4A4G A;  4C5E A;  1VQ6 Q;  2KT1 A;  2M9U A;  3M54 A;  1BI2 A;  1LVK A;  1KD1 U;  1K76 A;  3OA6 A;  2VGM A;  2P0P A;  3RMQ A;  3BDL A;  2ROL A;  3GP8 A;  2QA4 Q;  1QWE A;  1BIA A;  5LJ3 h;  2VVK A;  5CO7 A;  2D8H A;  1Q7Y R;  1VOL A;  3A1P A;  1VQ8 Q;  3L2V A;  3I55 Q;  1E7O A;  4IUQ A;  1LNX A;  3MPU B;  4DEX A;  2L3S A;  1ZA2 B;  1YJW A;  3RER A;  1UFF A;  2RHX A;  1XO2 A;  2FL7 A;  3QO3 A;  1RAA B;  1U8R A;  1Y57 A;  4RG8 A;  4OGE A;  3OBW A;  4JJN K;  3DDP B;  2ZAE A;  3OYF A;  4ELZ C;  1KJW A;  4PJO F;  3DLL A;  1RLP C;  1ABQ A;  3JCM c;  2K57 A;  1YCS B;  3CXC P;  2ZPB B;  5CKE A;  1NG2 A;  2YRD A;  4KUD K;  3CCV A;  4EOJ B;  4BY6 B;  2M02 A;  5GJW B;  5FWB A;  3M57 A;  1WHJ A;  1YI2 A;  1QLB A;  5KYN A;  3CCR Q;  4MDX A;  1ENW A;  1K73 U;  3UT1 A;  4VUB A;  2KXD A;  4MMK A;  1K8A C;  1I5L A;  3JB9 G;  3MP6 A;  3MJX A;  1O9K B;  3DDQ B;  4M77 C;  1OQK A;  3CBP A;  1BU2 A;  1JJ2 P;  2G3R A;  4MFD A;  2QAZ A;  4JLI A;  4M77 F;  4M78 B;  2WHB B;  4GLK A;  1V1C A;  5IHI A;  2Y4X A;  4FCY A;  2JTM A;  2JVV A;  2V1Q A;  2EKH A;  4HA8 A;  4BCP B;  4XU2 A;  1YI2 T;  1AT1 B;  4CFX B;  3G71 T;  1AZG B;  1UTI A;  3A98 A;  4ZN3 A;  1W70 A;  2O9V A;  1FMV A;  2CT4 A;  3HL8 A;  1QKW A;  3QHS A;  4RCB A;  4OGC A;  1OI1 A;  8ATC B;  1G5V A;  1KSW A;  2CJM B;  5LJ3 d;  5IHN A;  5HY6 A;  5A2Q E;  3UA6 A;  3M58 A;  2J6O A;  4BE1 A;  4AFS C;  5HQ0 B;  2QEX A;  2KRN A;  1B3Q A;  5GAN e;  4JX4 A;  3CQT A;  2EYX A;  2IVX A;  4C5I A;  2KDS A;  1VYW B;  3H8Z A;  1M27 C;  2C06 A;  1RI9 A;  1W98 B;  2G77 A;  1MNE A;  4RTW A;  3EG9 A;  3OB9 A;  2BE7 D;  3UWN A;  1UNH D;  5C0M A;  2GFU A;  2LQN A;  4ZTF A;  1K1Z A;  1NYG A;  4F04 B;  1U3O A;  1C0M A;  4N4I A;  1PCX A;  2YHT A;  2BPM B;  3M0R A;  4PJM A;  3E19 A;  1QCN A;  4A53 A;  5DLO A;  3URG A;  5GAO l;  2QQS A;  4BXX X;  3OMC A;  5KYX B;  1KC8 U;  4ZGJ B;  2DVE A;  2E6N A;  1MV3 A;  1O9K A;  3PO3 S;  1Q82 U;  3NTH A;  3MEV A;  4KGV B;  1Y96 A;  5CKD A;  1N8R U;  2R7G A;  3G7Z A;  1I8F A;  3TNH B;  5HBJ B;  1M8V A;  5KE3 A;  4MZM A;  1VIF A;  1EFN A;  4AMC A;  5EJC A;  1OI9 B;  2JGZ B;  1VQO Q;  4PJO D;  4YC3 B;  2KK4 A;  4BE2 A;  2KNB B;  4ROD A;  1I81 A;  3LLR A;  3OW2 A;  3JCM X;  3G6E A;  2WEV B;  2K5I A;  3E9F A;  1TXQ A;  2NUT B;  4YOZ A;  3M0U A;  5I21 A;  2DD5 A;  1RUW A;  2LJ3 A;  3LH0 A;  4DEY A;  5IT9 E;  2JJ9 A;  5GJV B;  3I5R A;  5D6Y A;  5GAO n;  4RTZ A;  2NYS A;  4LD9 K;  3QII A;  3CCQ Q;  4OMP A;  3FC3 A;  2QTV A;  4E7I A;  4C5H A;  1YJ9 A;  2LVM A;  3UPU A;  5CK9 A;  3SWN A;  2HDA A;  5GAO r;  3OYB A;  1N8R C;  1K0S A;  3A5Z B;  1WZO A;  4QVC A;  5CQX A;  2QA4 T;  3MY1 B;  2EQI A;  2L3R A;  3CCL T;  3QYE A;  3OY9 A;  1CSK A;  4PJO A;  3VKH A;  4ANJ A;  3JCM d;  1OV3 A;  5KYY A;  4AFZ C;  5GAM h;  2DMO A;  4D8D A;  4BCJ B;  2P4T A;  3C95 A;  4EOP B;  2FPF A;  2CZ0 B;  1M2O A;  2RPN A;  3IQL A;  1NYF A;  2E4H A;  4J6Y A;  4F70 B;  1IXD A;  3M03 A;  4CC2 A;  2OAU A;  3TCJ A;  2RJF A;  5GMK i;  1Z9Q A;  4J5Y A;  4V2S A;  1NZ9 A;  1UHF A;  1Y7X A;  4F7U A;  4BCO B;  1KIK A;  1D3B A;  5KYX A;  1UNG D;  5HBE B;  3DB4 A;  4IIM A;  1YIT Q;  2JOY A;  1C9B A;  1X27 A;  4M7A E;  2OX7 A;  4A63 B;  1BI1 A;  1BCM A;  4PK4 A;  3QYB A;  4M78 E;  5KCO A;  2WIH B;  1ARK A;  1YFN A;  2QGF B;  5KE2 A;  3EFS A;  2H3E B;  4C0G A;  3OS1 A;  4M7D F;  3M56 A;  4FM4 B;  4N0A A;  4BD3 A;  4M77 E;  3AT1 B;  3OYJ A;  4QW2 A;  2PQW A;  4C8Q E;  1VYT A;  2QDY B;  3O0G D;  2LCS A;  2O9S A;  4EON B;  3OYI A;  3HP9 A;  3OBY A;  2VKN A;  2MI6 A;  2IW8 B;  3F5X B;  2CSI A;  2DER A;  3EOC B;  3H0H A;  2LDM A;  3OYK A;  4EOS B;  4NST B;  1X6O A;  3D7S B;  1KHC A;  4HVV A;  4CFM B;  4FT4 A;  1MV0 B;  2JS0 A;  1WHM A;  2ABL A;  2V26 A;  1NPP A;  3CME T;  2QYZ A;  3SWN B;  4D6W A;  4HKE A;  4ELJ A;  2V8J A;  4M78 G;  1OIU B;  2XMF A;  2CP5 A;  1M3C A;  2K7A A;  2RQU A;  4PJJ A;  3H6Z A;  2VUB A;  1MHN A;  2GCX A;  2C0I A;  2YSQ A;  4M7D A;  4QQ6 A;  5CKB A;  4EOO B;  2CSQ A;  4BCN B;  2E12 A;  2ESW A;  3EG9 B;  4EOR B;  3BFM A;  1OKV B;  4RMO A;  4Z8A A;  2YT6 A;  2F2W A;  2VC8 A;  3CC7 Q;  3X24 B;  5KYU A;  3EG0 A;  2RHU A;  1VQ5 A;  3EG2 A;  1O9S A;  1IB8 A;  3OYN A;  4CXA B;  2QQR A;  2X4Y A;  2Z0W A;  2QGG A;  3CC2 A;  4FYV B;  4LUD A;  2B9R A;  1VQ8 T;  1B34 A;  5CQY A;  5GAM g;  3J80 E;  3UAT A;  3RUX A;  4LDY A;  2K79 A;  4JX6 A;  2CUD A;  2FRY A;  4N4G A;  3CPF A;  5I2S A;  3SEM A;  1ZUK A;  3RKY A;  5HK3 A;  1RLQ C;  2ZGW A;  2NUZ A;  4BUG A;  5GMK j;  1BIB A;  4ZGE B;  2KBT A;  3G6E Q;  3CCS T;  3B57 A;  1VQ9 Q;  3GNF B;  3I55 T;  2RQW A;  2HKQ B;  3POM A;  3PE0 A;  2JMA A;  1SF9 A;  2KY9 A;  3M59 A;  2RMO A;  2QXF A;  1U06 A;  2W9Z A;  1QMC A;  1F5Q B;  2BZX A;  3OYD A;  2QA4 A;  4WTO B;  3OYG A;  3EFR A;  2J06 A;  4AFQ C;  1KC8 R;  2DIG A;  4BCI B;  5FLX E;  4C8Q C;  1ZSG A;  4HVW A;  4J9C A;  3RBB B;  4PJN A;  4II1 A;  3O8V A;  1OUL A;  2OTL A;  3G71 Q;  2DRM A;  3QUI A;  4HNU A;  2HAX A;  3REB B;  4C8Q A;  3BLH B;  1VQO T;  4YOO A;  1GY3 B;  1H4L D;  3RGF B;  3CME A;  3R6N A;  1UGS B;  2I40 B;  4AKI A;  3DB3 A;  2LX9 A;  1FKM A;  1ZP2 A;  2KT8 A;  1QCF A;  2FYK A;  2RK2 A;  1FVV B;  1ZHI A;  1W2B P;  1HJD A;  3LGF A;  3M0Q A;  4LNP A;  4CFU B;  3G1J A;  1NLP C;  3LWI A;  4XU1 A;  4J9H A;  2JM9 A;  2E41 A;  3CCQ T;  1UB4 A;  2LCC A;  4M78 A;  3INZ A;  4F7J B;  5KYU B;  4E7Z A;  2RH2 A;  5ECA A;  1JKW A;  1LOJ A;  2KR6 A;  5KH6 A;  2IN3 A;  4C92 F;  3H0F A;  3QWX X;  3CCE T;  1WHL A;  5FU6 B;  3CCU A;  1ZA1 B;  4DOW A;  4TTH A;  3QG1 A;  3NGP A;  4RTT A;  1WPY A;  4FX3 B;  5LJ3 g;  5IDN B;  2JN0 A;  2JT4 A;  3FJ5 A;  2SEM A;  4DBF A;  1GBR A;  2QFZ A;  4EOK B;  1RL2 A;  4IUT A;  5AT1 B;  1I1J A;  1MUZ A;  3KXT A;  2M1H A;  2QEX Q;  4M75 A;  2CKK A;  1WDX A;  5CYI B;  1YJ9 Q;  2AZS A;  3HHT B;  4J6W A;  1FMW A;  1KQS P;  4BI4 A;  2KSS A;  1NBE B;  3ZL7 C;  2JZ2 A;  1Q81 C;  5FW9 A;  2KYM A;  4OVA A;  4C0Z A;  2PU9 B;  3WVD B;  2AKK A;  2PTK A;  2EGC A;  2M0O A;  4XU0 A;  4M78 D;  4NS5 A;  1H3Z A;  1PD0 A;  2FO0 A;  2HEQ A;  3T9N A;  5GAM e;  4KBM B;  1RAE B;  1JU5 C;  1UE9 A;  2ED1 A;  2PHG A;  3G4S Q;  2FEI A;  1FWZ A;  1GH6 B;  3TW6 A;  1D1A A;  2K5F A;  2YLC A;  1M1F A;  3EGX B;  2A08 A;  5LJ5 f;  3CEY A;  4C92 C;  1X2K A;  4ORZ A;  4M77 A;  2CUB A;  2L8D A;  1N6A A;  2D0N A;  4X1V A;  3TN8 B;  2DVJ A;  3I5S A;  1PWT A;  3Q1J A;  4OP0 A;  3X28 B;  1N8R R;  1TH7 A;  1G83 A;  4ELY C;  1H3H A;  2QDJ A;  3LX7 A;  5IXB A;  5DLQ E;  2F5K A;  2KGT A;  1WFW A;  1JST B;  3QDR B;  1GL5 A;  3PNW C;  5CAI A;  2DD4 B;  1Q81 R;  1RAG B;  4HCC A;  3TRE A;  2FPD A;  5GAN 4;  3CCU T;  1KHI A;  2E6Z A;  3DTO A;  2UZE B;  3QZ5 B;  1JXO A;  3QXE B;  5J39 A;  1VQ9 A;  2DME A;  1G3Y A;  4P5N A;  4B9X A;  5CCA A;  3JCM g;  1KXU A;  4C8Q F;  7AT1 B;  4JDS A;  2EQU A;  1K73 R;  4DBH A;  1G3T A;  1UGP B;  2BTT A;  2DF6 A;  1ZSZ A;  2RM4 A;  1M2V B;  4XTX A;  4C0F A;  2DXC A;  4FT2 A;  2AIR B;  4XTW A;  4CFU D;  3JB9 F;  2KYB A;  5GMK e;  2HSP A;  1MMA A;  1QVF A;  1K0X A;  2DFU A;  1E6G A;  4E7L A;  3C4S A;  5LJ5 g;  1X69 A;  4R55 A;  3CCV Q;  3A8O B;  2EIF A;  3VKG A;  4JJD A;  3ZEH A;  1QVG S;  4MDW A;  1ZLM A;  1QKX A;  1XQH A;  2DXT A;  1K9A A;  5DQV A;  2V8I A;  3QHW B;  2DAQ A;  1JJ2 A;  1WXB A;  3BHU B;  4M77 B;  4F14 A;  4OF1 A;  1P5E B;  2DJZ A;  2K2M A;  1LCK A;  2LQ8 A;  3A8L B;  3GNG A;  2RF0 A;  3G4S A;  2Y4Y A;  4EC9 B;  2EYY A;  2OTL Q;  4OB2 B;  4OMO A;  4J8O A;  2E3H A;  3A8M B;  1BB9 A;  2DKG A;  3PFS A;  5HVY B;  2PMI B;  1YJN Q;  3KHI A;  1D0Y A;  2DXU A;  2F2X A;  3QYH B;  1PKD B;  2ECZ A;  4M77 G;  2D0Q B;  2DXB B;  1VYU A;  2PUO B;  1RAI B;  3OQ5 A;  2AT1 B;  1ZSZ B;  1BI0 A;  1TTH B;  3V8J A;  3TSW A;  5IF1 B;  5KCH A;  3CD6 Q;  1AWO A;  2ZZD A;  5LL6 S;  2JUF A;  1W4S A;  3EGX A;  4E7J A;  2DYI A;  2EWN A;  2ED0 A;  1SPK A;  2W99 A;  3LH5 A;  2PK2 A;  3A8H B;  2E1H A;  2WSF E;  1VQ6 A;  3RIR A;  3CCJ Q;  4JRP A;  2EBP A;  1AWJ A;  1YJW Q;  4IKF A;  2XG8 D;  3HRU A;  4ZTJ A;  2WXV B;  3H41 A;  3CD6 T;  2DBK A;  4J9E A;  4R56 A;  4IUR A;  4LUE A;  1K8A R;  2K6D A;  5IH2 A;  1KQS S;  3CC4 T;  1TS9 A;  2D1X A;  4RTV A;  3LQ5 B;  3EH2 A;  4C0D C;  2H8H A;  1OPL A;  1AOJ A;  5FWC A;  2DL8 A;  4XTU A;  5DM7 R;  2YUQ A;  1PSE A;  2ENM A;  4OB3 B;  2FZC B;  4LXC A;  2W0Z A;  2YRV A;  5HKC A;  2HKN A;  2RI3 A;  2VWF A;  1PG5 B;  2QF7 A;  2A28 A;  1G8X A;  1UJY A;  2QG9 B;  2I2L A;  3EH1 A;  4CC3 A;  1W6X A;  4IUP A;  3RR6 A;  3NHN A;  1NJI R;  3CCM Q;  5FU6 C;  3E1S A;  3CCM A;  1TU0 B;  1UHC A;  4J9I A;  2FZK B;  1HYO A;  3JCM P;  4E6R A;  1E7P A;  1M3A A;  1YJW T;  2QDL A;  1U1S A;  4F7S B;  1O75 A;  1SG5 A;  1WGS A;  2RB6 A;  3NTI A;  5LJ5 h;  1ACM B;  3A8G B;  2KXC A;  1M1K C;  1SHF A;  1IHV A;  3QKJ A;  2MK5 A;  5LMK B;  4AFU C;  1H64 1;  4BE0 A;  1JXM A;  1PKT A;  2PNI A;  1VQ5 Q;  3X25 B;  4OMQ A;  2WJ9 A;  1QW1 A;  3SB2 A;  1BCO A;  1YIJ T;  4FW2 A;  1U1T A;  4FL6 A;  1ZUU A;  1Q81 U;  5GAO p;  4XTV A;  1B34 B;  3HTR A;  2XI9 A;  1WIE A;  3BHT B;  3FLG A;  2RHY A;  2BS4 A;  5IXF A;  4Q5W A;  4M7A A;  2IG0 A;  1H26 B;  4A4E A;  2LT4 A;  2OTJ T;  2GQI A;  1YIT T;  2HSE B;  2FVU A;  1VQ6 T;  2EYW A;  1V76 A;  4EDU A;  4RUG A;  4KRD B;  4BY6 C;  2P4R A;  1Q7Y U;  3I56 Q;  2E5Q A;  1IO6 A;  1BU1 A;  4J7F A;  4KGZ B;  1Q86 U;  5DQW A;  1UUE A;  4BI8 B;  2ZPE B;  2MWO A;  4PNO A;  4ZN1 A;  2E64 A;  2CP2 A;  2CP7 A;  4PFO A;  3P8H A;  4HXJ A;  4BCQ D;  2DE0 X;  2DYB A;  2LNV A;  1ZBX A;  4EMH A;  2C5O B;  1H24 B;  4CC7 A;  1PC0 A;  1BBZ A;  4O6J A;  1TUD A;  2VV5 A;  2DZ9 A;  3H9N A;  2BKD N;  3G6E T;  1T3L A;  2PVO B;  1OYX A;  1Q95 G;  3I55 A;  1UNL D;  3BG9 A;  2JXB A;  1JSU B;  4JZ4 A;  2EQM A;  1G3W A;  3MP8 A;  5LJ5 j;  3K7A M;  3ER0 A;  3MCA B;  1AWW A;  2RQR A;  2UUE B;  2L5Q A;  3OYY A;  4BAC A;  4B9W A;  3M55 A;  4F6S B;  4G6L B;  2M0Y A;  1M90 R;  4FIB A;  4WF2 A;  1R0B G;  2HL5 C;  5GAO m;  4HT9 A;  4CRI A;  1YP5 A;  4GBQ A;  4KUI A;  3EHQ A;  2EPD A;  4NOY A;  1PRM C;  2DNU A;  2GQV A;  5HNB B;  2YLB A;  2VXE A;  2F1L A;  1MMN A;  5I2M A;  3GLX A;  2WSE E;  1WHH A;  3VRY A;  2OJ2 A;  4BY1 X;  4QSH A;  5ICP B;  1NPR A;  4F7U F;  2DL5 A;  4RTX A;  2L3P A;  1WNL A;  1TG0 A;  1H25 B;  2R57 A;  2C5X B;  4B6M A;  3M5A A;  2XKO C;  1KQ2 A;  4AI6 A;  1NEG A;  1SRM A;  2DTH A;  2CCH B;  2XDD A;  2D8J A;  2W10 A;  1KC8 C;  9ATC B;  1GBQ A;  1V29 B;  1OEB A;  2EYZ A;  4PJL A;  2M51 A;  1SSH A;  2W96 A;  3VS1 A;  2HQX A;  4J83 A;  2HNI A;  1WXT A;  4C92 B;  2QQA A;  1K4U S;  1H1P B;  1WYX A;  1H92 A;  2AK5 A;  1YJ9 T;  1S1N A;  3DKM A;  1QCO A;  2CH4 W;  2DEQ A;  3REA B;  4HCB A;  5L23 A;  2WAC A;  4XU3 A;  4F7U B;  4L6V 5;  4JRQ A;  4L5G A;  3G71 A;  3NDQ A;  2HD0 A;  3BG5 A;  1WHK A;  1H1R B;  3BW1 A;  2RI5 A;  1X75 C;  1I4K 1;  4N4H A;  1VQP Q;  2RHZ A;  1WXU A;  2C5N B;  1CKB A;  4MZP A;  3VYG A;  5LJ3 e;  2XIC A;  4M7D D;  1K9M C;  1VQM Q;  2RNA A;  3RKX A;  1VQL T;  1PKS A;  2OTJ A;  3VJP A;  5LJ3 j;  1D3U B;  5IN1 A;  3C0C A;  4X9C A;  4UC4 A;  2DBM A;  2KR3 A;  1S72 A;  3HZJ A;  1OKW B;  5CKF A;  3PGG A;  2EGA A;  4M78 C;  3JCM Q;  2K3B A;  2CP6 A;  1ZBJ A;  3VKI A;  2E70 A;  2HQH A;  2BKZ B;  2O01 E;  4XAX B;  1M90 U;  5GMK m;  2DXC B;  3EFO B;  1SEM A;  5KYY B;  1OPK A;  1LJO A;  2RK1 A;  4GY5 A;  1JJ2 S;  3EFO A;  4C92 D;  1VQN A;  1OX9 A;  2XHC A;  3X26 B;  4BCM D;  1VOM A;  4D8K A;  2XDB A;  3GPL A;  4MML A;  2QAS A;  2MF2 A;  3MKD A;  2GTJ A;  4Z02 A;  2OTL T;  5CVI A;  3L2R A;  1Y71 A;  6AT1 B;  1S72 T;  1AHJ B;  2E65 A;  3CCE A;  2GTO A;  3I35 A;  1M90 C;  3DOG B;  2HQE A;  2LQK A;  2MIO A;  3LGL A;  1NJI U;  5D6X A;  5L8R E;  4IMY B;  1R8O B;  4M6V A;  5EFQ B;  4DA4 A;  3WVE B;  3OYH A;  2D6F A;  3UDC A;  5FU7 B;  1UEC A;  4DBR A;  2MOX A;  2DL4 A;  3EID B;  2BS3 A;  1IGQ A;  3OYL A;  4II5 B;  2P0K A;  3JCM f;  3MI9 B;  2W9F A;  1NE8 A;  3LWH A;  3LYI A;  4M7D C;  3KBG A;  2MCN A;  3QPH A;  2A37 A;  5C6S A;  4QVZ A;  4A4F A;  2AZV A;  5FGK B;  3QBY A;  4F7U G;  1OU9 A;  3WXM B;  1YCY A;  4QVD A;  5CR2 A;  2DL7 A;  4L59 A;  4OMF B;  3CC4 Q;  3CPW P;  1UG1 A;  5IAY A;  1M1K U;  1K8A U;  3ZFJ A;  1K9M R;  4BDZ A;  4E47 A;  4ESR A;  5D7U A;  2QTX A;  4BCQ B;  5FRO A;  2HCK A;  3HB9 A;  5J26 A;  4OMM A;  4KRT A;  2LNH B;  3JCM e;  1D09 B;  2C4G B;  1IRE B;  1TSF A;  3E2U A;  1ZQ1 A;  2B86 A;  2YXY A;  1T0H A;  3CCR A;  3I56 T;  3JSC A;  2DTI A;  2BE9 B;  3M0T A;  2RQT A;  2DK3 A;  1RAD B;  4C8Q G;  3OYE A;  3TU4 K;  5DY9 A;  3V7S A;  3EGD B;  4DQ2 A;  2WPA B;  2CRE A;  3N5B B;  2C5V B;  2CZ7 B;  4BBS M;  2YRC A;  2OI3 A;  1IHW A;  4LDU A;  1GFD A;  4KRC B;  2RA2 A;  3CCS Q;  4OB1 B;  2IIM A;  8AT1 B;  4LDV A;  1BK2 A;  4KH0 B;  3HFN A;  1YI2 Q;  1CKA A;  2JMC A;  3RMS A;  2GFA A;  2NWM A;  4JS4 A;  1QQJ A;  3JCM V;  2X9H A;  4EOL B;  1VQ4 T;  3PIO A;  2LRQ A;  2X3W D;  3S3M A;  2LX7 A;  1KD1 C;  5GAM d;  2C6T B;  3VS2 A;  1UGV A;  3CXC A;  1GUX A;  3VU3 C;  5ACB A;  2E10 A;  2X1N B;  2VXF A;  5GAN 3;  4RKU E;  1JOW A;  1N9S A;  2A7Y A;  4M7D B;  3PVL A;  1Y96 B;  4X9D A;  4BB7 A;  3L2Q A;  3OYC A;  1H1Q B;  3ASK A;  1F1B B;  2FB7 A;  2O88 A;  1JQQ A;  3JRZ A;  3JB9 I;  2R5M A;  2OTJ Q;  3HO8 A;  4PJO C;  2VAS A;  4XTY A;  4M77 D;  5I22 A;  3VS4 A;  1NM7 A;  1EIF A;  4E7H A;  3L2W A;  1VQL A;  5GAM f;  4EOI B;  1OIY B;  1YN8 A;  5HBH B;  2RO0 A;  4JS5 A;  3VRZ A;  1NJI C;  1VQK Q;  1D0Z A;  5M9O A;  2PK9 B;  3CCL A;  3CC4 A;  2EVR A;  2LT1 A;  2W2H A;  1M9S A;  4O5V A;  3CCU Q;  4M4Z A;  2L2P A;  2LCL A;  2RN8 A;  2LZ6 B;  1Q82 R;  1G3N C;  3DLM A;  2DLP A;  3FIF A;  3MY5 B;  1GCP A;  2EFI A;  3DL1 A;  2L89 A;  2JS2 A;  4RCC A;  1R77 A;  1TWB A;  2BZY A;  2UZD B;  2K4Y A;  1Q86 C;  3JCM W;  1A0N B;  1OGU B;  2CYZ B;  2MWP A;  2A0F B;  2V22 B;  1WJR A;  1YWO A;  4M7A C;  2CZ6 B;  1PNJ A;  1OX8 A;  3MO8 A;  4C92 G;  3OW2 P;  2C0O A;  5HCK A;  1Q7Y C;  2FRW A;  2LTO A;  3CCJ A;  1VIE A;  2WMB B;  2DJQ A;  2XDP A;  1OU8 A;  4M7D E;  4JZ3 A;  2Y90 A;  2KMT A;  2FG0 A;  3MEW A;  3VS3 A;  2DEU A;  2IW6 B;  1AD5 A;  1OL2 B;  3TVT A;  3RDV A;  1UDL A;  4UN0 A;  5KYW B;  2DO3 A;  5D6W A;  3EGD A;  2QGS A;  3SD4 A;  3SHW A;  1VQN T;  2K5L A;  2PZ1 A;  1DJ7 B;  1X43 A;  4J9F A;  3V7R A;  3SWN C;  5L2W B;  1UGR B;  4CFV B;  1B7T A;  1KQ1 A;  3G4S T;  4RTU A;  1WJS A;  4EPC A;  4LE9 A;  4CFW B;  3RNJ A;  4FYY B;  2AHJ B;  1VQO A;  2V8K A;  4MZT A;  3L2Z A;  1AIS B;  2KQW A;  4R0K A;  1Y0M A;  4JJB A;  4F16 A;  4HVU A;  5GAM j;  3QWL A;  4CC4 B;  2P84 A;  1UEB A;  2GGR A;  1M8M A;  1FXX A;  4PFP A;  3BLR B;  4MIM A;  2I53 A;  2DXB A;  4PJO G;  2WMA B;  2G9X B;  1OZ2 A;  3FB9 A;  4AG2 C;  1QVG P;  2EUF A;  4JRK A;  2RD1 A;  3BDU A;  2DZC A;  3ZBD A;  1D1B A;  2IW9 B;  1H28 B;  2JTE A;  2DD5 B;  3HPW A;  1TUG B;  3VUZ A;  4X34 A;  5LJ3 f;  4PLI A;  4Z89 A;  4GLM A;  1EX4 A;  3CCV T;  2QEX T;  1HD3 A;  1VQP A;  2O31 A;  5FRN A;  5GAN h;  2JM8 A;  1VYV A;  2VGN A;  1VQ4 A;  1QP3 A;  3JB9 J;  1YIJ A;  4IUV A;  3CD6 A;  5KYW A;  3EJ1 B;  1X6B A;  3NPF A;  2B8A A;  3NTK A;  4Z6Y A;  4M7D G;  3RES A;  4KT0 E;  3FRN A;  3CC2 T;  3BY7 A;  2LJ1 A;  4ME7 A;  4F17 A;  4ROC A;  3MP1 A;  1K73 C;  3SFM A;  3CC7 T;  3QJ6 A;  2I0N A;  4Y72 B;  2O4X B;  5EG2 A;  1QP2 A;  1M4Z A;  2KAF A;  1ZX6 A;  2KE9 A;  1PSF A;  3JV3 A;  4M75 E;  3S3N A;  5GMK l;  1TFB A;  1QWF A;  1VA7 A;  3V7C A;  5IHK A;  1VQ7 Q;  5CKH A;  4FW1 A;  2PVG B;  2CH4 A;  3P8D A;  1U5S A;  3JCM h;  2F69 A;  4WCI A;  5AYF A;  3PTA A;  2AKL A;  5GAN 8;  4DOV A;  4OB0 B;  3O5Z A;  3OS5 A;  2J7I A;  2EAY A;  3CPW A;  1HSQ A;  2EYQ A;  4JRI A;  4C8Q B;  2JNG A;  3J7A F;  2MAM A;  2J6F A;  4HCK A;  2ZPI B;  1WX6 A;  4Y92 A;  2K2V A;  1BYM A;  2CP0 A;  5GAN j;  3G33 B;  2QQ9 A;  3GOX A;  4EMK A;  3J81 E;  2COW A;  3QDF A;  5A0L A;  5FRM A;  3MHX A;  2LJ0 A;  3CBM A;  4CRL B;  5HK0 A;  1BI3 A;  1E6H A;  4YOS A;  1AD6 A;  3I9Q A;  2D9T A;  3MEA A;  1WQW A;  3VS0 A;  4PFZ A;  2J05 A;  1IGU A;  2KEA A;  4JPB W;  5I11 A;  3M53 A;  1XTD A;  1D3B B;  3JB9 D;  3DJB A;  2YDL A;  1GCQ C;  1M1G A;  2J6K A;  2JTF A;  2FHD A;  3GF5 A;  3TQ7 P;  1MMD A;  2F2V A;  5J3B A;  3VYH B;  2HMA A;  3VV0 A;  3OYA A;  4A4K A;  1Q86 R;  3MET A;  2FPE A;  4BCH B;  1RAH B;  3CMA Q;  1FIN B;  2SRC A;  2G6F X;  3GBQ A;  2BUD A;  1Y07 A;  3OS2 A;  2XD0 A;  4BCM B;  4M75 B;  3CPW S;  4NL2 A;  2NUP B;  1WQ7 A;  4ROE A;  4FYW B;  1P92 A;  1BKB A;  1SRL A;  1YHQ A;  1Q82 C;  5GMK h;  1M5Q 1;  3PT9 A;  3R6O A;  3HFO A;  2M16 A;  1RAC B;  3LW5 E;  1HXD A;  5I5Z B;  4AG1 C;  2CDT A;  3OMG A;  4M75 C;  2KRM A;  3CCE Q;  4JJC A;  4OMN A;  1MGQ A;  5EC7 A;  3FDR A;  3L2U A;  1N4M A;  4C92 E;  1EZZ B;  1VQK T;  1RAB B;  1YBY A;  3CBO A;  2KVQ G;  1I07 A;  2CCI B;  1GRI A;  2RJD A;  4EIK A;  2L0A A;  2V1R A;  3OSS C;  3EGU A;  3QJY A;  2CS7 A;  2EJG A;  1VUB A;  2H3J A;  3TSZ A;  1VQ7 A;  2EKO A;  1KQS A;  2ZCF B;  4F6U B;  2HBP A;  1B07 A;  3KFV A;  1VIN A;  4LDX A;  4M7A G;  3RKW A;  1OZ3 A;  4EOM B;  1NLO C;  5IDP B;  1ZUY A;  2ROT A;  4FYX B;  3L1A A;  4IUU A;  4E7K A;  1GCQ A;  4CFN B;  4PL6 A;  2GF7 A;  3C12 A;  1VQ4 Q;  4E2F B;  4C92 A;  3OW2 S;  2C0T A;  4LDW A;  3HRT A;  5GAN 2;  4EMK B;  2CP3 A;  2O2O A;  4JLG A;  3EG3 A;  1VQP T;  1S72 Q;  5GAN 6;  5GAN 5;  4AT1 B;  2X4W A;  1K9M U;  1VQ9 T;  2LP5 A;  3BLQ B;  1M2V A;  4XTZ A;  4YTL A;  1W1F A;  5CIU A;  1VQL Q;  2GBQ A;  1SKU B;  3PMI A;  1RAF B;  1N27 A;  4RG2 A;  2BS2 A;  4BDY A;  1JBM A;  4A54 A;  3TEE A;  4FU6 A;  4QQD A;  2F2C A;  1T3S A;  1W2B A;  4HL4 A;  3QYG B;  4QKU A;  4IIO A;  4J9D A;  2VYT A;  4LD6 A;  2VB6 A;  3M4G A;  2UZB B;  3S6W A;  4E7S A;  2QI2 A;  3CMA T;  2MYS A;  1KK7 A;  4BCF B;  1YIJ Q;  1WLP B;  4MFE A;  1ABO A;  5GAN f;  3GTM S;  4PKC C;  3HRS A;  4M75 G;  1VQM A;  1WA7 A;  4LOC A;  3VS7 A;  3QWY A;  4EOQ B;  1TUC A;  3PIP A;  2E5K A;  4Z88 A;  5LQF B;  2DA9 A;  3P8B B;  3CCL Q;  2LMJ A;  2COZ A;  2YWW A;  1UGQ B;  3BE3 A;  4FSS A; 
#chains in the Genus database with same CATH homology
 5GAN d;  1QVF A;  2DTI A;  4E7L A;  1M8V A;  3C4S A;  5KE3 A;  4MZM A;  5LJ5 g;  1VIF A;  4R55 A;  3A8O B;  2DK3 A;  2EIF A;  4C8Q G;  5EJC A;  3VKG A;  1SSF A;  2RHI A;  3OYE A;  3TU4 K;  5DY9 A;  3ZEH A;  3V7S A;  1QVG S;  4MDW A;  4PJO D;  2KK4 A;  4DQ2 A;  4BE2 A;  1XQH A;  2DXT A;  3CC7 A;  5GAN g;  1VQK A;  1I81 A;  3LLR A;  2V8I A;  3OW2 A;  3N5B B;  2DAQ A;  3JCM X;  1JJ2 A;  2CZ7 B;  3G6E A;  2K5I A;  1JRI A;  3E9F A;  4BBS M;  4M77 B;  3HKS A;  4OF1 A;  2DJZ A;  4LDU A;  3E9G A;  2LQ8 A;  3A8L B;  3GNG A;  3G4S A;  2Y4Y A;  5I21 A;  2RA2 A;  2DD5 A;  2P0Q A;  4OB2 B;  4OB1 B;  4J8O A;  3LH0 A;  3A8M B;  4EMK C;  4ZGD B;  4LDV A;  2DKG A;  5GAO n;  5D6Y A;  5IT9 E;  3PFS A;  4LD9 K;  3QII A;  3KHI A;  3HFN A;  2DXU A;  3CMA A;  3RMS A;  3QYH B;  2GFA A;  2EJF A;  2RJE A;  4JS4 A;  1YJN A;  2ZPG B;  3FC3 A;  4M77 G;  4E7I A;  2D0Q B;  3F70 A;  4C5H A;  2DXB B;  3JCM V;  2PUO B;  2RJC A;  4C5G A;  3OQ5 A;  1VQ4 T;  1YJ9 A;  2LVM A;  3PIO A;  3UPU A;  2LRQ A;  5CK9 A;  3S3M A;  1BI0 A;  4FSX A;  3SWN A;  3V8J A;  4A4H A;  1KD1 C;  4BI3 A;  5GAO r;  5KCH A;  3OYB A;  5GAM d;  1HK9 A;  1N8R C;  2ZZD A;  3CXC A;  5LL6 S;  3A5Z B;  2JUF A;  3CXC S;  3VU3 C;  4PJO E;  4QVC A;  5CQX A;  2QA4 T;  3QZ9 B;  1W4S A;  2E10 A;  4M75 F;  2L3R A;  2VXF A;  3CCL T;  1IZ6 A;  1X01 A;  5GAN 3;  2EWN A;  5LJ5 e;  4RKU E;  4E7J A;  1W2B S;  3QYE A;  1N9S A;  2A3L A;  2A7Y A;  2R58 A;  3C94 A;  4F7U E;  4M7D B;  1Y96 B;  3SDZ A;  4X9D A;  4BB7 A;  3A8H B;  2E1H A;  3OY9 A;  2WSF E;  3OYC A;  3L2Q A;  1VQ5 T;  1VQ6 A;  3VKH A;  3ASK A;  1VQ8 A;  2FB7 A;  4PJO A;  3RIR A;  3JCM d;  5GAM h;  3JRZ A;  4JRP A;  2P4T A;  3JB9 I;  3C95 A;  2EQJ A;  2R5M A;  4M7A B;  2DIQ A;  3HO8 A;  2CZ0 B;  3X20 B;  4IKF A;  3V8L A;  2XG8 D;  3M4Y A;  3HRU A;  4ZTJ A;  4PJO C;  4XTY A;  4M77 D;  3S3O A;  4J6Y A;  1EIF A;  3CCR T;  4E7H A;  3CD6 T;  3I56 A;  4ATO A;  2NLU A;  2K3Y A;  1XNI A;  3L2W A;  2OAU A;  4R56 A;  3TCJ A;  1VQL A;  2XID A;  5GAM f;  4IUR A;  2RJF A;  5GMK i;  4J5Y A;  1KQS S;  2X4X A;  4V2S A;  1NZ9 A;  4M78 F;  3CC4 T;  1Y7X A;  4F7U A;  2RO0 A;  4JX5 A;  2ZPF B;  4JS5 A;  1VQM T;  1NJI C;  1XOV A;  4C0D C;  2CGH A;  5M9O A;  1D3B A;  3CCL A;  3CC4 A;  3DB4 A;  1YHQ T;  2O4X A;  2PVD B;  2JOY A;  3BG3 A;  4M7A E;  2LT1 A;  1M9S A;  4O5V A;  2QQB A;  4XTU A;  5DM7 R;  1BI1 A;  4M7A F;  3OYM A;  2LCL A;  1PSE A;  3QYB A;  4OB3 B;  3DLM A;  2K3X A;  2YRV A;  5HKC A;  4M78 E;  2RI3 A;  3FIF A;  5KCO A;  2QF7 A;  5KE2 A;  3EFS A;  2EFI A;  2WSC E;  4C0G A;  3OS1 A;  3DL1 A;  2L89 A;  3OSV A;  2I2L A;  4M7D F;  4IUP A;  4RCC A;  5FU7 C;  3M56 A;  4FM4 B;  5FU6 C;  4N0A A;  2K4Y A;  3E1S A;  4BD3 A;  3CCM A;  1Q86 C;  2R5A A;  4M77 E;  3JCM W;  3HSB A;  1G3S A;  3MEU A;  1JB0 E;  3OYJ A;  2CYZ B;  2MWP A;  3JCM P;  4QW2 A;  1WJR A;  2PQW A;  4C8Q E;  3CCJ T;  2QDY B;  3FJP A;  4M7A C;  2CZ6 B;  1E7P A;  1QVP A;  3MO8 A;  4C92 G;  4CI0 C;  2XK0 A;  1YJW T;  4KUL A;  4AKH A;  1GXI E;  1Q7Y C;  1U1S A;  3OYI A;  2LTO A;  3HP9 A;  1O75 A;  3OBY A;  3OS0 A;  3CCJ A;  4PJO B;  2MI6 A;  3VYG B;  1VIE A;  3NFC A;  5GAO q;  2PUK B;  2LDM A;  3OYK A;  1WGS A;  2RB6 A;  1YIT A;  3NTI A;  3CCS A;  4M7A D;  2EJ9 A;  2XDP A;  3TW7 A;  4M7D E;  5LJ5 h;  2Y90 A;  2KMT A;  3A8G B;  1M1K C;  2BIV A;  3MEW A;  3QKJ A;  1X6O A;  1KHC A;  4FT4 A;  2CZ1 B;  3CCQ A;  4C0D B;  1H64 1;  4XK8 E;  3HBL A;  3CCM T;  4Y28 E;  4BE0 A;  1NPP A;  3X25 B;  3CME T;  2WJ9 A;  1QW1 A;  2DO3 A;  5D6W A;  3SB2 A;  3SD4 A;  3SWN B;  4HKE A;  3H4C A;  4ELJ A;  3FEO A;  4D6W A;  2K5L A;  2V8J A;  1YIJ T;  1VQN T;  4M78 G;  1DJ7 B;  1U1T A;  3V7R A;  4BBR M;  4FL6 A;  3SWN C;  4Y91 A;  5LJ5 d;  1UGR B;  3LWH A;  1KQ1 A;  3G4S T;  1Q81 U;  3H6Z A;  1WJS A;  4EPC A;  2VUB A;  1MHN A;  4XTV A;  2GCX A;  4C8Q D;  1B34 B;  5GAO p;  2MMP A;  3QSU A;  2AHJ B;  2XI9 A;  2V8K A;  3EAE A;  4MZT A;  3L2Z A;  1VQO A;  4HLQ A;  4M7D A;  2KQW A;  2EQK A;  2QQ8 A;  1N9R A;  4QQ6 A;  5CKB A;  2DPP B;  1VQ7 T;  5GAM j;  3QWL A;  3FLG A;  2RHY A;  5A0D A;  2BS4 A;  1UEB A;  2E12 A;  1FXX A;  4Q5W A;  1RI0 A;  3BFM A;  1KG1 A;  4RMO A;  4M7A A;  2IG0 A;  4J6X A;  4MIM A;  2VC8 A;  2DXB A;  4PJO G;  1OZ2 A;  4A4E A;  2LT4 A;  3FB9 A;  4PLL A;  3X24 B;  2OTJ T;  3KUF A;  2KMG A;  1YIT T;  4JRK A;  1QVG A;  2FVU A;  4N0A C;  1VQ6 T;  1VQ5 A;  2RHU A;  4EDU A;  1O9S A;  2RD1 A;  3BDU A;  4HT8 A;  2DZC A;  3ZBD A;  2DD4 A;  2X35 A;  4BY6 C;  2DD5 B;  3HPW A;  3OYN A;  2QQR A;  3AHU A;  2X4Y A;  1Q7Y U;  1WJQ A;  3CC2 A;  3VUZ A;  1VQ8 T;  1B34 A;  4X34 A;  5CQY A;  4PLI A;  5LJ3 f;  3V8K A;  4EMG A;  5GAM g;  4HCZ A;  3J80 E;  2E5Q A;  3RUX A;  4LDY A;  4J7F A;  3JCM b;  3CCV T;  4JX6 A;  4M75 D;  2QEX T;  1Q86 U;  4N4G A;  4HNV A;  1VQP A;  3CPF A;  4J7I A;  5GAN h;  5FRN A;  1VQ4 A;  2VGN A;  4BI8 B;  1QP3 A;  2ZPE B;  4NC6 A;  3JB9 J;  2MWO A;  3PMT A;  5I2S A;  1YIJ A;  4IUV A;  4PNO A;  4ZN1 A;  2E64 A;  4QQG A;  3RKY A;  3CD6 A;  5HK3 A;  2ZGW A;  3VUB A;  2B8A A;  3JB9 H;  4BUG A;  5GMK j;  1BIB A;  3NTK A;  4Z6Y A;  3P8H A;  3GIB A;  4M7D G;  4JRQ A;  3RES A;  4KT0 E;  2LNV A;  4AKG A;  1ZBX A;  4EMH A;  4ZGE B;  3FRN A;  3CC2 T;  3JCM J;  5GAN 7;  3BY7 A;  4O6J A;  3CCS T;  2VV5 A;  4ME7 A;  2RI2 A;  3MP1 A;  3GNF B;  3I55 T;  2DZ9 A;  2BKD N;  2IVW A;  4TVR A;  3G6E T;  1K73 C;  3M59 A;  2KY9 A;  2PVO B;  3ME9 A;  1OYX A;  3SFM A;  3CC7 T;  3QJ6 A;  3I55 A;  2QXF A;  3BG9 A;  2O4X B;  1QP2 A;  5EG2 A;  1M4Z A;  2EQM A;  4HNT A;  1G3W A;  3MP8 A;  5LJ5 j;  3OYD A;  2QA4 A;  2KAF A;  3OYG A;  4M75 E;  1PSF A;  3EFR A;  3ER0 A;  3S3N A;  2XU8 A;  4JUV A;  5GMK l;  3V7C A;  3MCA B;  2L5Q A;  2DIG A;  3M9Q A;  1FX7 A;  5CKH A;  3OYY A;  4BAC A;  4B9W A;  2DTO A;  2PVG B;  3M55 A;  4C8Q C;  5FLX E;  3P8D A;  3JAM E;  4II1 A;  3O8V A;  2OTL A;  4XQ3 A;  3JCM h;  2ZPH B;  2F69 A;  4FIB A;  4WF2 A;  5AYF A;  5A0G A;  5GAO m;  2F5T X;  1YJN T;  3PTA A;  2ZZD B;  3QUI A;  5GAN 8;  4HT9 A;  4CRI A;  4DOV A;  4HNU A;  4OB0 B;  4KUI A;  2HAX A;  2X4J A;  3OS5 A;  4C8Q A;  2EAY A;  3L42 A;  4NL3 A;  1VQO T;  3CPW A;  2LC4 A;  4A4G A;  2EYQ A;  4C5E A;  4JRI A;  4C8Q B;  2JNG A;  4NOY A;  3CME A;  1UGS B;  4AKI A;  2M9U A;  2GQV A;  3DB3 A;  2LX9 A;  3M54 A;  1FKM A;  1BI2 A;  2MAM A;  3J7A F;  1KD1 U;  2ZPI B;  2YLB A;  2FYK A;  2RK2 A;  1ZHI A;  2K2V A;  2VGM A;  2P0P A;  3RMQ A;  3BDL A;  3OA6 A;  3LGF A;  2VXE A;  1BYM A;  3GP8 A;  5I2M A;  1BIA A;  5LJ3 h;  2QQ9 A;  5GAN j;  3GLX A;  3GOX A;  2WSE E;  5CO7 A;  4EMK A;  3J81 E;  4QSH A;  3LWI A;  4XU1 A;  5A0L A;  3L2V A;  3MHX A;  5FRM A;  4IUQ A;  2E41 A;  3CCQ T;  1NPR A;  3CBM A;  1LNX A;  1UB4 A;  4F7U F;  5HK0 A;  2LCC A;  4M78 A;  1BI3 A;  3INZ A;  1WNL A;  2R57 A;  2D9T A;  1YJW A;  3MEA A;  3RER A;  1WQW A;  2RH2 A;  2XKO C;  1LOJ A;  3M5A A;  1KQ2 A;  4AI6 A;  3M53 A;  2KR6 A;  1XTD A;  2RHX A;  5KH6 A;  2DTH A;  1D3B B;  2FL7 A;  2XDD A;  3JB9 D;  4C92 F;  1M1G A;  3CCE T;  3QO3 A;  2JTF A;  1KC8 C;  2FHD A;  5FU6 B;  3CCU A;  3GF5 A;  1U8R A;  1V29 B;  4DOW A;  5J3B A;  4RG8 A;  3QG1 A;  3VYH B;  4OGE A;  3OBW A;  3VV0 A;  4A4K A;  3OYA A;  3MET A;  1WPY A;  4JJN K;  5LJ3 g;  3OYF A;  2JN0 A;  2HQX A;  4J83 A;  4ELZ C;  4PJO F;  3DLL A;  2HNI A;  2BUD A;  1Y07 A;  2K57 A;  3JCM c;  2QFZ A;  1RL2 A;  4IUT A;  4C92 B;  3OS2 A;  2XD0 A;  2ZPB B;  2QQA A;  4M75 B;  3CPW S;  4NL2 A;  5CKE A;  3KXT A;  2M1H A;  1WQ7 A;  1YJ9 T;  1P92 A;  1BKB A;  4M75 A;  2CKK A;  3DKM A;  1YHQ A;  1QVF S;  2DEQ A;  1Q82 C;  4KUD K;  3CCV A;  3HHT B;  1M5Q 1;  3PT9 A;  3R6O A;  4J6W A;  5GMK h;  4HCB A;  4BY6 B;  3HFO A;  2WAC A;  2M16 A;  4XU3 A;  4L6V 5;  3LW5 E;  4L5G A;  1HXD A;  4F7U B;  3M57 A;  2KSS A;  4BI4 A;  2HD0 A;  3G71 A;  3OMG A;  1QLB A;  3BG5 A;  1YI2 A;  4M75 C;  4MDX A;  2JZ2 A;  2RI5 A;  1X75 C;  1I4K 1;  1MGQ A;  3BW1 A;  4N4H A;  4VUB A;  2RHZ A;  3UT1 A;  1Q81 C;  4OVA A;  1K73 U;  4C0Z A;  2PU9 B;  4MZP A;  3FDR A;  3VYG A;  3WVD B;  4MMK A;  5LJ3 e;  3L2U A;  1K8A C;  1I5L A;  2XIC A;  3JB9 G;  4C92 E;  4M7D D;  3MP6 A;  1K9M C;  1VQK T;  2M0O A;  1YBY A;  4XU0 A;  3RKX A;  4M78 D;  4NS5 A;  4M77 C;  1VQL T;  3CBO A;  2KVQ G;  1H3Z A;  2OTJ A;  3CBP A;  3VJP A;  5LJ3 j;  5IN1 A;  2RJD A;  2G3R A;  4MFD A;  4X9C A;  3T9N A;  4JLI A;  5GAM e;  4KBM B;  4UC4 A;  4M77 F;  4M78 B;  1S72 A;  3HZJ A;  3OSS C;  4GLK A;  3QJY A;  2CS7 A;  2EJG A;  2Y4X A;  2JTM A;  1VUB A;  3PGG A;  1FWZ A;  5CKF A;  4M78 C;  3TW6 A;  2H3J A;  2JVV A;  3JCM Q;  1VQ7 A;  2K5F A;  2EKO A;  4HA8 A;  2YLC A;  1KQS A;  1M1F A;  5LJ5 f;  4XU2 A;  2ZCF B;  2HBP A;  3CEY A;  3VKI A;  4C92 C;  2E70 A;  1YI2 T;  4LDX A;  3G71 T;  4M7A G;  2O01 E;  3RKW A;  1OZ3 A;  4XAX B;  4ZN3 A;  4M77 A;  1M90 U;  2L8D A;  1N6A A;  3L1A A;  4IUU A;  5GMK m;  2DXC B;  4E7K A;  3Q1J A;  4OP0 A;  4PL6 A;  2GF7 A;  3C12 A;  3HL8 A;  4RCB A;  1LJO A;  2RK1 A;  3X28 B;  3QHS A;  4GY5 A;  1JJ2 S;  4OGC A;  1TH7 A;  4C92 D;  1OI1 A;  4C92 A;  2XHC A;  3OW2 S;  4ELY C;  3X26 B;  1VQN A;  1G5V A;  2XDB A;  2QDJ A;  4LDW A;  3GPL A;  3LX7 A;  4MML A;  5LJ3 d;  5DLQ E;  2F5K A;  5HY6 A;  5A2Q E;  2MF2 A;  4Z02 A;  2OTL T;  3HRT A;  5CVI A;  1Y71 A;  5GAN 2;  1S72 T;  4EMK B;  3M58 A;  4BE1 A;  4JLG A;  1VQP T;  1AHJ B;  2E65 A;  5GAN 6;  5GAN 5;  2QEX A;  5GAN e;  3QDR B;  3CCE A;  4JX4 A;  3PNW C;  2X4W A;  1K9M U;  5CAI A;  1M90 C;  1VQ9 T;  2DD4 B;  4XTZ A;  4C5I A;  4HCC A;  4YTL A;  2KDS A;  2HQE A;  3TRE A;  2LQK A;  3LGL A;  5CIU A;  1NJI U;  5D6X A;  5L8R E;  3H8Z A;  3PMI A;  5GAN 4;  3CCU T;  1N27 A;  1R8O B;  4M6V A;  1KHI A;  4RG2 A;  4DA4 A;  2C06 A;  2BS2 A;  4BDY A;  3WVE B;  2E6Z A;  3OYH A;  1JBM A;  3QZ5 B;  3UDC A;  2D6F A;  2G77 A;  5FU7 B;  4A54 A;  3TEE A;  3OB9 A;  3QXE B;  2BS3 A;  4FU6 A;  3UWN A;  4QQD A;  5J39 A;  3OYL A;  1VQ9 A;  3JB9 F;  1G3Y A;  2P0K A;  4P5N A;  3JCM f;  4B9X A;  3JCM g;  5CCA A;  1W2B A;  4HL4 A;  4C8Q F;  3QYG B;  1NE8 A;  3LYI A;  4JDS A;  2EQU A;  2GFU A;  3KBG A;  5C0M A;  3QPH A;  4ZTF A;  5C6S A;  4M7D C;  4QVZ A;  4A4F A;  3QBY A;  4F7U G;  3WXM B;  1YCY A;  2VYT A;  4LD6 A;  4QVD A;  5CR2 A;  3M4G A;  4L59 A;  4N4I A;  2YHT A;  4OMF B;  1G3T A;  1UGP B;  3S6W A;  3E19 A;  2QI2 A;  3CMA T;  5IAY A;  4A53 A;  1M1K U;  1K8A U;  3ZFJ A;  5DLO A;  3URG A;  2RM4 A;  5GAO l;  4BDZ A;  4E47 A;  4MFE A;  2QQS A;  2QTX A;  3OMC A;  5GAN f;  1KC8 U;  4ZGJ B;  4PKC C;  3HRS A;  4XTX A;  2DVE A;  2E6N A;  4M75 G;  5FRO A;  3HB9 A;  4LOC A;  2DXC A;  4C0F A;  1VQM A;  5J26 A;  3PIP A;  4FT2 A;  3JCM e;  1Q82 U;  3NTH A;  3MEV A;  1IRE B;  1Y96 A;  5CKD A;  1ZQ1 A;  3P8B B;  4XTW A;  1N8R U;  3G7Z A;  1I8F A;  3CCR A;  1UGQ B;  3L2R A;  3I56 T;  5GMK e;  3JSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...