2CZ7B

Fe-type nhase photo-activated for 75min at 105k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Active Center Structures of Photo-reactive Nitrile Hydratase during its Photo-activation Process
rcsb
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz7B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz7B02
2ZPFB 4OB3B 1UGRB 2DXCA 4FM4B 1QP3A 3A8GB 2WSCE 1UGPB 1IREB 3VYGA 2AHJB 3VYGB 2ZPIB 2DXBA 3WVDB 3X20B 4L6V5 2CZ6B 4OB0B 2WSFE 4KT0E 3QYHB 4Y28E 2DXCB 3A8OB 2DD4A 2PUOB 3X25B 2DD4B 2CZ1B 2QDYB 3WVEB 3A8LB 3QYGB 4RKUE 1JB0E 2DD5A 2DXBB 3HHTB 5L8RE 2DD5B 2D0QB 3A8HB 2PVOB 2ZZDA 2ZZDB 2O01E 2CZ7B 2ZPEB 1QP2A 4ZGEB 2ZPGB 3LW5E 1PSEA 1GXIE 2ZPHB 2PVDB 3A8MB 2ZPBB 2PUKB 4ZGDB 2CZ0B 2CYZB 3X26B 1UGSB 1DJ7B 3QXEB 4OB2B 4OB1B 2PVGB 1V29B 3QZ9B 1UGQB 2DPPB 1AHJB 3QZ5B 2ZCFB 4ZGJB 4XK8E 2PU9B 3X24B 1PSFA 3X28B 3VYHB 2WSEE
chains in the Genus database with same CATH superfamily
1G83A 5DLOA 1C6VX 4LN2A 1KQSP 2RQWA 3GBQA 2A37A 2FO0A 4NSTB 4RUGA 5LMKB 2D9TA 1SPKA 3VYGA 4MIMA 2VVKA 1X27A 2HDAA 2HKQB 4RTTA 3JB9D 2K2MA 3E1SA 3I56A 1PRLC 1AD5A 3IQLA 2IW6B 1SF9A 2O4XB 4M7AD 3U23A 5I21A 1Q7YR 3TREA 2EGAA 3UF4A 2RM4A 3PMTA 4D6WA 1GFCA 2JTMA 5ECAA 2RD1A 3G1JA 3CCVQ 1N4MA 4JZ3A 2VASA 1VA7A 3H0FA 4HLQA 5DLQE 2NUPA 2RA2A 4V2SA 1R0BG 3L42A 1Q81C 3RUXA 2JT4A 3VKIA 2OX7A 1JB0E 1BI3A 4QSHA 3LX7A 1OZ3A 1KQSA 1H1QB 4A4KA 5GMKj 3CCST 4AFQC 5KH6A 1SRLA 3THKA 1ZA1B 1M90R 1RAGB 3TNHB 1A0NB 5CEIB 4L5GA 2CJMB 1BCMA 4M78E 3OA6A 4M77B 3M57A 3EG9A 4M75A 4IKFA 3CCJA 3RKXA 3I55A 2ZPHB 4KGZB 2PVDB 4BBSM 5IDNB 4ZNXA 2DX1A 1ZSGA 5HY6A 1VQ9Q 3X26B 2LP5A 3EHRA 4FYVB 2W99A 4FU6A 3INZA 4QW2A 3VS5A 2P0PA 1RABB 4OB1B 2H8HA 1Q81U 4BCJB 1R77A 1RADB 1UGQB 1X6BA 3OYNA 4RCCA 4ELZC 3PT9A 4E7JA 2DE0X 2DLPA 2L3PA 2Y90A 2XI9A 3HTRA 4KH0B 1BIAA 1YCSB 4N4IA 1OKVB 5CCAA 2DXCA 4BI4A 5CAIA 3CMET 4EOMB 4ATOA 2UZLB 1BK2A 1S72T 5IN1A 2QGFB 4FSXA 3M0SA 5LJ5e 1BI1A 3BHVB 3CCRT 2AHJB 3A5ZB 2KI7A 1JQQA 1YN8A 1TFBA 5HCKA 2XMFA 4A4EA 1WHJA 4II5B 3F5XB 1SHFA 2IW8B 4OB0B 3OQ5A 2OAUA 1G3NC 2R57A 2EBPA 3G7ZA 3CCUA 1M3BA 1QKXA 4M7AB 2RK2A 2QQBA 2R7GA 3CCET 4JX6A 3M9QA 3CC4Q 2OAWA 3CPFA 1ZBJA 3NFCA 4C8QG 1N5ZA 1VQPT 3M58A 1VQ5T 1BKBA 1KC8C 3VUZA 4E7LA 1G3YA 2KXDA 3CPWS 3GF5A 3D7SB 3MEAA 2FG0A 1TTHB 1T0JA 3QHWB 4BE2A 4MZPA 4PJOC 4EOPB 4C92A 2KMGA 3OYEA 2EWNA 3OYLA 2VKNA 1VQLT 1K73R 2RQUA 3V7SA 2ECZA 4BCOB 5KYXA 3KHIA 3OW2A 3C94A 5CKHA 2P84A 2KR6A 1KD1C 1RAFB 1OOTA 2JTEA 1IO6A 4J7FA 1MNDA 3I56T 4CFUD 3EG2A 2DMOA 5DQWA 7AT1B 2LQNA 2CCIB 5HK3A 3HZJA 3TEEA 2O9SA 3BFMA 4BXXX 4B6MA 3E19A 3QZ5B 1JRIA 2DFUA 1I81A 2M02A 1RLQC 1VQ6A 2GQIA 1X69A 2L3QA 3X28B 3V8KA 2WSEE 1D3BB 2JUFA 4PJOD 3MCAB 1UUEA 2EGCA 1UB4A 4LUEA 4ROCA 4F7UF 4BE1A 4ZTFA 2F2XA 2G77A 3CMAT 3LLRA 1SG5A 2XU8A 3CBPA 3G71Q 4AKGA 2MYSA 3DL1A 2H3JA 3BW1A 2WMAB 1M4ZA 4D8DA 3VYGB 4BY6C 3EGXB 1PG5B 4JRIA 5GANe 3M03A 2BZYA 1WI7A 3REAB 3UT1A 1JSUB 2QGGA 3MY1B 2MCNA 4A63B 3CCJT 1E9HB 1QWEA 4C8QE 1MV0B 3CC7Q 1C0MA 1EFNA 1X2QA 1M8VA 1VYTA 2QDYB 5DM7R 1BYMA 3PMIA 1WXUA 2IIMA 2VB6A 1JJ2P 3SWNA 3JCMc 2FZCB 2V1QA 1M3CA 4J9GA 3ZBDA 2O01E 4GBQA 1VQ4A 4BCKB 2A0FB 3TNIB 1H3HA 1G8XA 1WQWA 2ZPEB 2RNAA 3TCJA 4EIKA 4YOSA 4X1VA 2FRWA 3LWIA 1ABQA 4QKUA 4CFVB 3RESA 3OS2A 3CCMA 4YOOA 1OQKA 3EG9B 4M77F 2X3WD 1WQ7A 2LJ3A 2HEQA 2RI2A 4CFXB 4KH1B 1YIJT 4XQ3A 3K7AM 2EGEA 2AKLA 2BUDA 3M0RA 1X75C 2DETA 4C5IA 2KVQG 2GF7A 2J7IA 1Z9ZA 1PKSA 1AEYA 2A3LA 1NJIR 4CFUB 2MWPA 2DYIA 1O9KA 1NBEB 4F17A 1VQOQ 1JJ2A 3NMZC 3I9QA 3CCUT 1TS9A 4HT9A 4F7JB 5L2WB 1OX8A 4ZN3A 1OL2B 4IURA 3CCLA 1I0CA 4PJOB 3C12A 1JXMA 4XU2A 1VQNA 2CSQA 2PK9B 1UGRB 1BIBA 2UZDB 2OTLA 3FJ5A 1AWWA 1TSFA 5I22A 1Q82C 2F69A 4II1A 4BD3A 1T0HA 3NTKA 4AT1B 3EFOA 4DBQA 2A28A 3O8VA 2F2CA 2ZPIB 4EC9B 4QQGA 2X51A 2F5TX 4BY1X 2A36A 3JV3A 1WLPB 5KE2A 3GLXA 2CZ6B 4JS4A 3JAME 2ED0A 2K4YA 3JB9F 3QG1A 3QSUA 2WHBB 3EGUA 1AT1B 1LJOA 4M7AF 3M5AA 1D0YA 3DB3A 1TOVA 3CEYA 1M3AA 3OYDA 2XDBA 2KE9A 4LDUA 1QW1A 3M0UA 2X35A 3H8ZA 1M2OA 2PK2A 1OYXA 5LL6S 2YSQA 2VV5A 1MMDA 4LOCA 1VQ6T 1C9BA 4ZN1A 2EPDA 3M56A 5GMKh 3C95A 3KBGA 4BY6B 2KYBA 2V8KA 2OTJA 1B3QA 2BPMB 1JXOA 3OMGA 3OB9A 5LJ5j 3M59A 1LPLA 2PQWA 1YI2T 3TU4K 4EMGA 1AZGB 3RERA 4A54A 1DJ7B 2L5QA 4F7UG 4CFMB 1QCNA 1VIEA 1UJYA 3VKHA 4F16A 3HRSA 2HCKA 1YHQA 1D09B 1Q86U 3QZ9B 3VS2A 3POMA 4FW1A 1FXXA 5D7UA 4ZGJB 2NYSA 2KYMA 2NWMA 3CCSQ 3MI9B 5KYWA 3VS7A 1M2VA 1IXDA 5GAMe 1GUXA 2M9UA 1WHHA 2XD0A 2LCSA 1NM7A 1D1AA 1KHCA 3CXCA 2W10A 1W70A 4G6LB 4F7LB 3QDRB 1E6HA 2I40B 3ASKA 4BCQD 4R55A 1VINA 2LDMA 2EYWA 1VQ4T 2DXBA 1Q81R 4FT4A 3JCMb 4KGXB 3EIDB 3HBLA 1T3LA 1GCQC 5GAN8 4BBRM 1X6GA 5EG2A 1H28B 3QWXX 2CT3A 3OS1A 1QVGS 3JB9I 4F70B 1QVFP 3HPWA 2LC4A 2D6FA 1BI0A 2HL5C 3H9NA 5GAN6 2BS3A 5GAOr 2E5KA 5GAOq 3UPUA 5IHIA 3CMEQ 4M77G 4EOLB 3SWNB 2D0QB 1S72Q 2DTIA 5KYUA 3ZL7C 2QYZA 4R0KA 1FWZA 3RDVA 3CCRQ 3L1AA 2FPFA 4AFUC 2EQMA 1P92A 3CCLT 4GY5A 2JNGA 2MAMA 3T9NA 2WMBB 2XIDA 1X2KA 4ZGEB 2DO3A 5KYYB 1VQNT 5LJ3e 3LW5E 5HVYB 2P0KA 3ER0A 4LXCA 3CCEQ 2J6FA 3P8BB 4J6YA 1T3SA 1MMNA 4IUVA 2CP0A 3A8MB 1UNHD 4F7UE 3TSZA 3RBBB 4FYXB 1VQ5Q 2EUFA 1VQPQ 1TU0B 1Y0MA 4KRDB 1XNIA 2C5XB 3VJPA 4E2FB 5GANj 4C0DC 2FYKA 3I5SA 1WDXA 3L2ZA 3QWYA 3HKSA 4E7IA 1AHJB 1O9KB 3HP9A 1PD1A 2GGRA 4JS5A 5DY9A 1M1KU 2OI3A 3M53A 3JRZA 1G3SA 4JUVA 2HMAA 4HL4A 4JJBA 1VQLQ 3I35A 3WXMB 1WXBA 1NPRA 4PJOF 3BDUA 5I2MA 4M7DC 3JB9G 2BS2A 2CDTA 2YUQA 4FM4B 8AT1B 4F14A 4PK4A 4M7AG 4ELYC 4F7SB 3BLHB 2VXFA 4PFZA 4FW2A 1XQHA 4RODA 1VYUA 2YXYA 1KC8R 2L89A 2LTOA 3I56Q 1KSWA 4BCQB 3X20B 4L6V5 1IGUA 1WHKA 5AT1B 5GAOl 4HVVA 2L2PA 2PNIA 3FLGA 3CC2T 2EJGA 4RTYA 3FRNA 1VQ7A 2OTJT 2ESWA 4KT0E 1JKWA 2H3EB 4CC3A 4J6XA 1G3WA 1HJDA 1K76A 4M77E 1TXQA 1OZ2A 1Q95G 4M7DD 2E5QA 1H1PB 1EX4A 1NG2A 1FMKA 2QDJA 3SFMA 3CMAQ 2DVJA 3MJXA 3UA6A 2DL8A 4N0AC 1OEBA 4F04B 2L3SA 2PVOB 1KD1R 1Y96A 3BLQB 2PHGA 4HVWA 4N4GA 2E64A 2DEQA 2EAYA 1OI1A 4OGRB 1ZSZC 3GNGA 3VS4A 2RN8A 1QP2A 3SD4A 5L23A 1NZ9A 4OGEA 1YBYA 2HL3A 4CI0C 4E6RA 3BDLA 1GXIE 2F1LA 4X9CA 5GAN3 3CCJQ 2AZSA 4XU0A 4LUDA 1WZOA 4OGCA 5FGKB 3EHQA 4J9CA 5GMKm 1AISB 3EJ1B 1AOJA 2QI2A 3GTMS 1C1AA 1KXUA 3JCMV 4Z02A 1SHGA 2C0IA 2ZGWA 2K3XA 3EGDA 3SDZA 2VGMA 4DA4A 2YRVA 4PJLA 2XHCA 3KFVA 3HO8A 5ICPB 4GLMA 1OU8A 5KYWB 1BU2A 1UE9A 3VKGA 4F6SB 4RG8A 2C06A 4M7AE 2HZYA 1K9AA 2EQKA 4PLLA 9ATCB 1YIJQ 2RI5A 4HNVA 3CPWA 3NHNA 4XTWA 3PGGA 2HSEB 4WTOB 4HKEA 2WEVB 1ABOA 4ELJA 3DKMA 3MHXA 1IHWA 2NUZA 4C0DB 4C8QA 2YHTA 3HB9A 2DKGA 2FPEA 3CCUQ 3L2WA 5LJ5f 2YUOA 2XDDA 1H92A 4OMFB 3LWHA 2E3IA 2F2WA 1WXTA 5IH2A 2DD4A 3A8OB 3GOXA 2PUOB 2NUTA 4TVRA 4DBFA 5CKDA 2X4JA 1UNLD 2LMJA 2O88A 1X01A 3DTOA 4RKUE 1UHFA 4ME7A 4BI8B 4B9XA 5AYFA 1IGQA 2V8JA 4M7DB 2E6ZA 3MO8A 3OW2P 4M75C 3S3OA 5GAMj 5FU7C 3ULRB 1JSTB 1UNGD 2CZ7B 2KRNA 2P4RA 3MKDA 3OYAA 5FW9A 3NTIA 4CFWB 4BY7X 1OV3A 4C0GA 3BLRB 2RJFA 4LDVA 3PNWC 2FEIA 1LVKA 2HSPA 2RK1A 4PFPA 2C5NB 2CSIA 4Y91A 2K5LA 2ED1A 3CCQT 2PUKB 3BG9A 1W6XA 2WIHB 1WHMA 4PJOG 3DB4A 2W9FA 4XU1A 1IRXA 5D6YA 4EOIB 4MDXA 5IF1B 2DTHA 3OYFA 1Q82R 2ZCFB 2F2VA 2UZEB 1VQ7T 2LJ1A 4M75D 3X24B 3JCMg 1TUGB 1PSFA 1VQ6Q 3RKWA 3VYHB 3LGFA 1X43A 1AD6A 2ZPFB 1HYOA 1VQ8A 4OR5B 1ZSZB 1URCB 1EZZB 3H0HA 1OX9A 2WPAB 3C4SA 2GFAA 4JZ4A 4PKCC 1YI2Q 4FCYA 1OIUB 2E4HA 2KRMA 4EONB 1K8AU 3UDCA 1Q86R 4LD6A 3WVDB 5LJ3j 1Y07A 2AIRB 2LVMA 3PIPA 3R6OA 4RG2A 3LQ5B 3OY9A 3N5BB 3C0CA 4HA8A 4RMOA 2O31A 3PE0A 2ENMA 1CSKA 1G3TA 5GANf 2E70A 4C92C 3RMSA 1BU1A 3WVEB 2EQJA 3H6ZA 5GAMg 2YLCA 2YWWA 2CREA 2K5FA 2DEUA 2LNHB 2ROLA 3BG5A 2DJQA 5L8RE 2K7AA 5CQYA 1I07A 1GRIA 4KUIA 1N27A 3L2UA 3G6EA 1B7TA 4BCHB 3MEUA 1VQ4Q 4M4ZA 3I55T 1WHGA 1K1ZA 1QMZB 1WIEA 3OYBA 4HT8A 2EYXA 4DEYA 3TNWB 3I5RA 1OPLA 2JOYA 8ATCB 2QQAA 1VQMA 3OYGA 2NUPB 5GAN7 5FRNA 4EMKA 2KY9A 4YC3B 4LDWA 4PJOE 1FINB 1KIKA 3VV0A 3FJPA 4DOVA 4C92D 1U3OA 2CP6A 2AK5A 3EH2A 4AFZC 2FL7A 4CFNB 4BACA 4BDZA 4OP0A 4ELLA 4HCZA 5IAYA 4J9FA 1OGUB 4QQ6A 5CR2A 4Y72B 2KK4A 2JZ2A 1NPPA 4PLIA 4JRPA 3EGDB 1YCYA 5C0MA 2W2HA 3E2UA 3CCLQ 4M75B 1PC0A 1M90U 5FU7B 2GFUA 1HD3A 1E7OA 1PNJA 2R5MA 1VQNQ 1B07A 1ZUUA 4XTUA 1QCOA 3ME9A 3REBB 1H1RB 5LJ3g 3OYJA 2BZXA 1M27C 5GJVB 2DTOA 2CT4A 1Y7XA 2P4TA 3FEOA 2D1XA 3NGPA 2JTFA 1AWOA 2WFYB 1CKAA 2EYZA 4CRIA 2FVUA 3M0PA 4C8QB 4RTUA 1JO8A 3SWNC 3E9FA 1J3TA 1I8FA 4EOQB 3QYHB 2YDLA 3VUBA 1ARKA 2DXCB 3M0TA 5CVIA 2DD4B 2KBTA 4OF1A 1YITA 4ZTJA 1KQ2A 2COWA 2E6NA 5CKEA 3S3NA 4BDYA 3AT1B 3G33B 1M9SA 5J3BA 4AFSC 2DD5A 3Q1JA 1D0XA 3QIIA 1YJNA 3QJYA 4QVZA 2ROTA 3BG3A 2LX9A 2ZZDA 2BTTA 3G4SA 2HBPA 4M7DF 2C6TB 4LDXA 1OI9B 2E12A 4O6JA 1VQKA 4FX3B 3V8LA 2COZA 1M1FA 1FYNA 2B86A 1W2BS 3MY5B 3JCMf 1QVGP 4EPCA 2C4GB 5KYNA 4JDSA 3CC2Q 1I4K1 1V1CA 3L2QA 1VQ8T 2OTJQ 3UATA 1WYXA 1FKMA 4F7UA 1Q86C 5GMKe 1WX6A 1Y71A 2PJQA 3M4YA 1UECA 2QASA 2ZPBB 1UHCA 3CBMA 2DA9A 2L0AA 2VWFA 2M0OA 2JGZB 5IHNA 2WACA 4C92B 1AWXA 4QVDA 2CP3A 4XTVA 3CXCP 4XU3A 2KAFA 2PU9B 4CC4B 2DBKA 4FSSA 1LOJA 2O4XA 2PTKA 4WF2A 2KQWA 4IUUA 5D6XA 1E7PA 5KYXB 2MI6A 3BE3A 3QBYA 3HL8A 5KCOA 1H8KA 1K73U 1NYGA 4KUDK 1UDLA 2V1RA 5IHKA 2V22B 4TTHA 1O9SA 1YJ9A 1QVGA 3JCMh 4KBMB 4RTVA 2LQWA 1UGPB 3PO3S 5FWCA 5GAMf 2KNBB 2GTOA 3EG3A 1QCFA 3QPHA 3EOCB 4XTXA 2QTXA 2RQVA 1YP5A 3NDQA 1JOWA 3G6ET 2JMAA 3OBYA 4N4HA 4BCPB 4DQ2A 1JU5C 1R8OB 1YJWA 1VUBA 1PRMC 3DDPB 1MUZA 2HQEA 2JW4A 2DZCA 2HD0A 1U06A 4MFEA 3S6WA 3MEWA 2RJCA 1VQMT 2EVRA 4EOOB 1ZX6A 2K57A 1HK9A 2QQRA 2DIQA 5HBEB 4VUBA 4M77A 4HNUA 2QG9B 3MP1A 3PVLA 4J6WA 2JVVA 1KG1A 1BI2A 1WFWA 2JN0A 4R56A 2W9ZA 2W96A 5A0LA 4Z6YA 4IUQA 4RTXA 3LYIA 2QA4A 4BCND 1WJQA 2E1HA 3URGA 2BZ8A 2KT1A 3CCMT 1LCKA 2VYTA 5GAMh 2DYBA 1H26B 5HBHB 2J06A 3LGLA 4C5GA 1RACB 2W0ZA 2DNUA 5I5ZB 4J9EA 1KQ1A 3CCSA 2CKKA 2RJDA 2A7YA 5LQFB 3M54A 3VS6A 5EC7A 1I5OB 2CZ0B 2M1HA 1M1KC 3QJ6A 2ABLA 2CP7A 2GCXA 5LJ3f 2C0TA 1NE8A 3LH5A 3QXEB 2X3XD 4M78A 4MFDA 3NTHA 2O9VA 2M16A 2DRKA 1MHNA 3VS1A 2DXUA 5LJ5g 4BCFB 2R58A 1KFZA 2OTLT 3OMCA 3QKJA 4X9DA 2E3HA 3TW6A 2QGSA 4M7AA 1V76A 4M75F 1YITT 1D1BA 1MNEA 2J6KA 1K9MC 2SEMA 2WSCE 1YJNT 3CCQQ 1YWPA 2MWOA 4ORZA 3G4ST 3BY7A 4EOJB 3HRUA 1VQKT 1AZEA 3CMEA 3EFSA 2MOXA 3ZFJA 4J5YA 4B9WA 4BCMD 1H27B 4JLIA 4HNTA 1H4LD 5LJ3h 1M1GA 2JMCA 1VQ7Q 2WSFE 2QEXA 4M7DG 1VOLA 3DJBA 1BBZA 4JX5A 1WPYA 2DJZA 1XJWB 2QQSA 4MZMA 2FZGB 2RMOA 1ZQ1A 5D6WA 3EFOB 3A8LB 3QYGB 1D1CA 2IG0A 2D0NA 2X4WA 1ZUYA 2DRMA 3CD6A 1B34A 1VQPA 2FHDA 2DD5B 5A0GA 3A8HB 2DBMA 5IDPB 1K9MU 1GBQA 2ZZDB 2HKNA 5GAN5 4OMQA 3TW7A 4BCNB 2Y4YA 1W1FA 2E10A 4IIOA 1G2BA 2RQRA 3R6NA 3QO3A 4IUPA 5J39A 2HNIA 3UA7A 1H641 2K2VA 1YJ9T 3A1PA 1OKWB 3A98A 5GMKi 2RHUA 2YRDA 2WXVB 2BKDN 1YHQT 1OL1B 1IB8A 1RAHB 1MMGA 1QLBA 1ZLMA 2I0NA 4M78D 1QVFS 5IXBA 2M51A 3CBOA 2ATCB 1YJWT 4C92F 2KGTA 2GTJA 2BKZB 1FX7A 1PWTA 3EGXA 5CIUA 1UEBA 2JXBA 2FB7A 5FROA 5CQXA 3I55Q 2QAZA 5GANg 2DK3A 3CPWP 1GY3B 3EG1A 5IT9E 4CC2A 3P8DA 3EAEA 1AVZC 4HCKA 2J6OA 1VYWB 1H25B 4J9BA 5HKCA 3ZEHA 2EKOA 2FPDA 4NS5A 1QP3A 4HVUA 1JEGA 1IREB 2EFIA 1N9SA 4Z89A 2QA4T 2RHXA 4C5HA 4FIBA 2DVEA 3CMAA 2L3RA 1X6OA 4PNOA 1M2VB 2UZBB 4M7DE 4BCMB 2EIFA 1NEGA 3META 1N9RA 1GUXB 1QLYA 3DLLA 1H1SB 2PMIB 1RL2A 4O5VA 4Y28E 3CCVA 3OYYA 2RPNA 2G6FX 3X25B 2RB6A 2K3BA 1K0XA 3FIFA 4MMKA 3KUFA 2EW3A 3BHTB 2GBQA 1WHLA 1GL5A 1WJRA 1KJWA 4BB7A 3SB2A 3QYBA 2DXBB 3OSSC 1NLPC 3J7AF 3RNJA 1M8MA 4LDYA 1ZUKA 2CGHA 1F5QB 4DBRA 4AI6A 1Y57A 2BE7D 1W4SA 5LJ5d 3M0QA 4F6WB 2RI3A 2YUPA 5CYIB 2R5AA 2B9RA 3VRYA 1IZ6A 1UTIA 2JS0A 4PJOA 1N8RC 1SKUB 3VS0A 2XICA 1I1JA 4Z88A 1VQ9A 1TD6A 1UGVA 2CUDA 4M75G 1UGSB 1KQSS 3SEMA 2MK5A 3FDRA 5KYUB 2EYYA 2KR3A 2DL7A 4OB2B 5FLXE 1V29B 1YIJA 4M78B 2KT8A 4XK8E 4L59A 1MGQA 2E41A 2QEXT 2DM1A 1RUWA 4PJJA 4FYWB 4IMYB 3H0IA 4J7IA 4A4HA 1K8AC 5LJ5h 1BCOA 1VQ8Q 5BNJB 4PL6A 2F5KA 4EDUA 3QUIA 2E65A 2MF2A 3VRZA 4Q5WA 3A8GB 3CD6T 4C8QC 4C5EA 1N8RU 2LQKA 2JJ9A 2VXEA 2HBWA 4QQDA 3DDQB 4CC7A 3PVQA 2Y4XA 5GAN4 5KE3A 2VC8A 2AZVA 2RH2A 1IHVA 1FMWA 3NPFA 2DILA 1G5VA 1RLPC 3RKYA 3RR6A 3CC4A 1YNZA 1VOMA 1PM3A 3JB9J 4HCCA 3V7RA 4AKHA 2EYQA 4OMNA 5J26A 2CH4A 5CKFA 2CP5A 4Z8AA 3HHTB 4E7HA 3GPLA 5HBJB 1B34B 4C8QD 1Q7YC 2J05A 4JRQA 1LNXA 4J9HA 4RTZA 2MPXC 3HSBA 3DLMA 2WIPB 3G6EQ 1KC8U 4JRKA 2QXFA 2QTVA 2JM8A 3JCMW 2KMTA 3EG0A 4LD9K 5GANd 2L8DA 1UFFA 4C92G 2HQXA 2EJ9A 1VQMQ 2K5IA 3MP6A 5GAOm 4M75E 1PD0A 2FZKB 4J9DA 4ZGDB 3GIBA 1NLOC 3M4GA 3OYCA 4ANJA 3S3MA 1S1NA 2LT1A 2X4XA 3UWNA 1Y96B 4OMLA 1M90C 2QQ8A 4QT7A 1NEBA 1W2BP 3JB9H 2LX7A 1YI2A 4KGVB 1TWBA 4EOKB 1PHTA 1KD1U 4YOZA 3CCMQ 1Q7YU 2LCLA 2LW4A 3PFSA 2CCHB 3CCVT 1QKWA 1WNLA 4J8OA 2V26A 1D0ZA 5M9OA 3OW2S 4I3ZB 4OMOA 2G3RA 1FMVA 1PKTA 4XTZA 5DQVA 3F70A 4DBHA 3G71A 1MMAA 5GANh 4KRTA 5CO7A 1R0CB 1GCPA 2RQTA 5I2SA 3MIAB 2KEAA 3FB9A 4C0ZA 4JJNK 2RF0A 5ACBA 2KROA 2V8IA 2YLBA 3OS5A 1W98B 3EH1A 3BHUB 4J9IA 2LT4A 2VUBA 1W2BA 4ROEA 3H4CA 4C0FA 3JCMJ 3CC7A 3P8HA 3HRTA 2OTLQ 3OSVA 2QK0A 2I2LA 1SSFA 3OYHA 5KYYA 1QMCA 2CZ1B 2XKOC 1VQ9T 1M30A 1YITQ 2FRYA 2LJ0A 1PCXA 4FL6A 2DL4A 2K79A 1F1BB 2KXCA 2HAXA 4NL2A 1YJNQ 2QDLA 1E6GA 2X1NB 4E7KA 3V7CA 3QDFA 3G4SQ 1M1KR 1JBMA 2X4YA 1VQKQ 4EMKC 2QQ9A 1YFNA 4EORB 4C92E 2GQVA 2Z0WA 1AWJA 3DOGB 2IPOB 2NUTB 2YRCA 3TVTA 1RAAB 1TG0A 3M55A 4NL3A 5IHYA 2SRCA 4JJDA 2B8AA 4RTWA 4J83A 3O0GD 2COYA 2D8HA 1OULA 4EC8B 2MIOA 5GAOp 3TN8B 5IXFA 1TUDA 1VIFA 1GFDA 1K73C 1K9MR 3JCMd 1ZA2B 2RJEA 1VQOA 2YUNA 4LE9A 4M78F 1NYFA 4E47A 4MMLA 1WA7A 4BI3A 5KCHA 5FWBA 4ESRA 4MDWA 4XAXB 3VU3C 5CKBA 3CC4T 2IW9B 3KXTA 1SEMA 2XK0A 3TSWA 2CP2A 4JX4A 4BCGB 1XO2A 2YT6A 1YJ9Q 1GH6B 4F7NB 1OPKA 3GNFB 3QWLA 2LQ8A 2C5VB 4NOYA 1YHQQ 2JS2A 5FU6C 4X34A 4AG2C 5GAN2 4AG1C 3OS0A 1O75A 2GNCA 2A08A 3JCMe 1JJ2S 3MP8A 1ACMB 2CH4W 5HK0A 4LNPA 1TUCA 5A0DA 1WGSA 1ZP2A 2DMEA 1YJWQ 1U8RA 2BE9B 2BIVA 3OBWA 1Q82U 2EQUA 1MV3A 5GMKl 1RAEB 4Y92A 1EIFA 2OJ2A 2CS7A 3CQTA 1GBRA 2XG8D 1XOVA 2XDPA 4FYYB 3CC2A 1GCQA 5GAMd 2DAQA 2JM9A 3MEVA 2P0QA 4IUTA 4UC4A 4E7SA 4EOSB 1YWOA 3L2VA 1VYVA 3FC3A 1U1TA 3QHSA 2QA4Q 3RIRA 3QYEA 1QQJA 2K6DA 6AT1B 1K0SA 4YTLA 2DZ9A 3TQ7P 1H24B 2I53A 1ZHIA 2DL3A 2ZPGB 3LH0A 4IIMA 1RAIB 3HFOA 2RHYA 5I11A 1HXDA 2EJFA 2IN3A 3G71T 3L2RA 2WJ9A 1OU9A 2CYZB 1RI9A 3H41A 1ZBXA 5EJCA 4FT2A 2VGNA 5EFQB 3O5ZA 3E9GA 2KRSA 2AT1B 1WJSA 2LNVA 3MPUB 3VS3A 3CC7T 1XTDA 4XTYA 2MMPA 3JCMX 5CK9A 4EMKB 1HSQA 4OB3B 1H3ZA 2NLUA 4QVCA 1Z9QA 3GP8A 2DL5A 5LJ3d 4DEXA 5C6SA 1UJ0A 3HFNA 4JPBW 1NJIC 2BS4A 4BE0A 2HQHA 1QVPA 2LCCA 2X9HA 1P5EB 4DOWA 3RGFB 2LZ6B 2G9XB 1QWFA 4M7DA 3RMQA 2DERA 4M77C 4HCBA 5HNBB 4OMPA 3J80E 2IVXA 1TH7A 4NC6A 4GLKA 4WCIA 2M0YA 3V8JA 2ZAEA 3EFRA 2QEXQ 5GAOn 4CXAB 4PJMA 1U5SA 3QHRB 2LRQA 1SSHA 2DIGA 3CXCS 2C5OB 2C0OA 5A2QE 4JJCA 1K4US 1FVVB 4M6VA 2DF6A 3AHUA 2UUEB 3OYIA 1CKBA 1N8RR 3PIOA 3CD6Q 4RCBA 4E7ZA 2EQIA 2RHZA 1S72A 5GJWB 1KHIA 1VQOT 4PJNA 1NJIU 1SRMA 1RI0A 1KK7A 1ENWA 3CCRA 1QVFA 4D8KA 4OVAA 3B57A 1OIYB 1UG1A 5FU6B 2RHIA 3JSCA 4C8QF 4M77D 4A4GA 4AKIA 4JLGA 2PZ1A 4A4FA 1N6AA 3PTAA 2RO0A 4N0AA 2K9GA 4A53A 2DXTA 3OYKA 3JCMP 1PSEA 4KRCB 4KULA 2CUBA 3CCEA 4PFOA 4M78C 4BUGA 4M78G 4MZTA 2O2OA 1BB9A 4UN0A 2KSSA 1VQ5A 4CRLB 1ZSZA 1M5Q1 2D8JA 4P5NA 1K8AR 2IVWA 3SHWA 5HQ0B 2QFZA 3CCQA 4M7AC 2PVGB 3JCMQ 2AKKA 4K11A 4EMHA 4HXJA 2DPPB 4OMMA 1D3UB 1PKDB 4BCIB 2K3YA 4F6UB 1U1SA 2EKHA 4AMCA 3J81E 1D3BA 1I5LA 2QF7A 4F7UB 5FRMA 1VQLA 2KDSA 3OYMA
chains in the Genus database with same CATH topology
2XD0A 4J7IA 2R5MA 5DLOA 4A4HA 1K8AC 5LJ5h 1KHCA 4PL6A 2F5KA 4EDUA 3CXCA 3QUIA 2E65A 2MF2A 4XTUA 4Q5WA 3A8GB 3CD6T 3ME9A 4C8QC 4C5EA 2D9TA 3QDRB 1N8RU 5LJ3g 2LQKA 3OYJA 3VYGA 4MIMA 2VXEA 3S6WA 3ASKA 4R55A 3JB9D 2LDMA 3E1SA 3I56A 1VQ4T 4QQDA 2DXBA 2DTOA 4FT4A 3JCMb 2Y4XA 1Y7XA 2P4TA 5GAN4 5KE3A 3HBLA 2VC8A 3FEOA 5GAN8 4BBRM 2RH2A 2JTFA 2O4XB 4M7AD 5EG2A 5I21A 4CRIA 1G5VA 2FVUA 3TREA 4C8QB 2RM4A 3PMTA 4D6WA 3SWNC 3E9FA 3RKYA 2JTMA 1I8FA 3QYHB 3VUBA 3OS1A 2DXCB 1QVGS 3JB9I 3CC4A 2RD1A 3HPWA 2LC4A 2D6FA 1BI0A 2DD4B 4OF1A 5CVIA 3JB9J 4HCCA 1YITA 4ZTJA 5GAN6 4HLQA 2BS3A 3V7RA 5DLQE 2RA2A 5GAOr 4AKHA 1VQ5T 2E6NA 5CKEA 3L42A 3S3NA 4V2SA 4BDYA 2EYQA 5J26A 3RUXA 1Q81C 5GAOq 5CKFA 3VKIA 3UPUA 1M9SA 5J3BA 1JB0E 1BI3A 2DD5A 4M77G 3Q1JA 4QSHA 3QIIA 3LX7A 1YJNA 3HHTB 3SWNB 4E7HA 3QJYA 4QVZA 2D0QB 1B34B 1OZ3A 3BG3A 2DTIA 2LX9A 2ZZDA 4C8QD 4A4KA 3G4SA 2HBPA 4M7DF 4JRQA 1LNXA 4LDXA 3DLMA 2E12A 4O6JA 5GMKj 1FWZA 3CCST 1VQKA 3HSBA 3L1AA 3V8LA 5KH6A 1KC8U 4JRKA 1M1FA 2EQMA 1P92A 3CCLT 1W2BS 4GY5A 2JNGA 2MAMA 2QXFA 3JCMf 3T9NA 4EPCA 4L5GA 3JCMW 2KMTA 2XIDA 4LD9K 4M78E 4JDSA 3OA6A 4ZGEB 2DO3A 1I4K1 4M77B 5GANd 1VQNT 5LJ3e 3LW5E 3M57A 2L8DA 4C92G 3L2QA 1VQ8T 2HQXA 2EJ9A 2P0KA 4M75A 1FKMA 3ER0A 3CCJA 3RKXA 3I55A 4F7UA 4IKFA 2ZPHB 2PVDB 2K5IA 3P8BB 4J6YA 3MP6A 4IUVA 1Q86C 5GAOm 5GMKe 3A8MB 4BBSM 1Y71A 1KQ2A 3M4YA 4M75E 4F7UE 2ZPBB 4ZGDB 3GIBA 3CBMA 5HY6A 3OYCA 3M4GA 3S3MA 1XNIA 3X26B 2LT1A 2X4XA 2M0OA 3UWNA 3VJPA 5GANj 1Y96B 1M90C 4FU6A 3INZA 4QW2A 4C0DC 2FYKA 2QQ8A 2WACA 2P0PA 4C92B 3JB9H 3L2ZA 4OB1B 1YI2A 1Q81U 4QVDA 3HKSA 4XTVA 1UGQB 3OYNA 4E7IA 1AHJB 4XU3A 2KAFA 3HP9A 1KD1U 4RCCA 4JS5A 2PU9B 5DY9A 4ELZC 1LOJA 1Q7YU 1M1KU 2LCLA 2O4XA 4WF2A 3PT9A 3M53A 2KQWA 3JRZA 1G3SA 4E7JA 4IUUA 3PFSA 4JUVA 2Y90A 5D6XA 2XI9A 3CCVT 1WNLA 1E7PA 4HL4A 1BIAA 4J8OA 5M9OA 2MI6A 3OW2S 1KQSA 3QBYA 3HL8A 5KCOA 3WXMB 1K73U 1NPRA 4PJOF 3BDUA 5I2MA 2G3RA 4N4IA 4KUDK 4M7DC 3JB9G 4XTZA 5CCAA 2BS2A 2DXCA 1O9SA 1YJ9A 1QVGA 4BI4A 3JCMh 4KBMB 4FM4B 5CAIA 3CMET 3F70A 4ATOA 3G71A 1UGPB 4M7AG 4ELYC 5GANh 5GAMf 2VXFA 5CO7A 1S72T 3QPHA 1XQHA 5IN1A 4FSXA 5I2SA 3FB9A 4XTXA 4C0ZA 5LJ5e 4JJNK 2QTXA 1BI1A 3CCRT 2AHJB 3G6ET 2L89A 2LTOA 3A5ZB 2V8IA 2YLBA 3OS5A 3OBYA 4N4HA 3X20B 4L6V5 4DQ2A 1R8OB 4A4EA 1YJWA 1VUBA 5GAOl 4OB0B 3FLGA 3OQ5A 2HQEA 2EJGA 3CC2T 2DZCA 2HD0A 2OAUA 4MFEA 2LT4A 2R57A 2VUBA 3FRNA 3G7ZA 3MEWA 2RK2A 2RJCA 4M7AB 1VQMT 3H4CA 2QQBA 4C0FA 1W2BA 3JCMJ 2K57A 4KT0E 3CC7A 3P8HA 3HRTA 4JX6A 3CCET 1HK9A 2QQRA 3M9QA 3OSVA 2DIQA 2I2LA 1SSFA 3OYHA 4VUBA 3CPFA 4M77A 4HNUA 3NFCA 3MP1A 2CZ1B 4C8QG 1VQPT 3M58A 2XKOC 4J6XA 1BKBA 1G3WA 1VQ9T 4J6WA 1Q7YC 1KC8C 3CCUA 4M77E 3VUZA 2JVVA 4FL6A 4E7LA 1KG1A 1OZ2A 1BI2A 2E5QA 2JN0A 4M7DD 4R56A 2QDJA 1G3YA 3SFMA 3CPWS 5A0LA 2HAXA 3GF5A 4N0AC 3MEAA 4Z6YA 4IUQA 4NL2A 2PVOB 3LYIA 2QA4A 1Y96A 4E7KA 3V7CA 4BE2A 1WJQA 2E1HA 4MZPA 3URGA 4PJOC 4C92A 1JBMA 2X4YA 3CCMT 2KMGA 2QQ9A 4EMKC 4N4GA 2EWNA 2E64A 2DEQA 3OYEA 2OTJT 2EAYA 1OI1A 2VYTA 5GAMh 3OYLA 4C92E 2GQVA 3LGLA 3GNGA 1VQLT 1QP2A 3SD4A 4C5GA 1NZ9A 4OGEA 1YBYA 1KQ1A 4CI0C 3CCSA 2CKKA 3BDLA 3V7SA 1GXIE 2RJDA 2A7YA 3M55A 4X9CA 5GAN3 4NL3A 3M54A 4XU0A 3KHIA 3OW2A 3C94A 5CKHA 2KR6A 4OGCA 1KD1C 2B8AA 2CZ0B 5GMKm 2M1HA 4J83A 1M1KC 3QJ6A 2QI2A 2GCXA 4J7FA 5LJ3f 3I56T 1NE8A 3QXEB 5GAOp 5HK3A 3HZJA 1VIFA 3JCMV 4M78A 3TEEA 3GPLA 4MFDA 4Z02A 3BFMA 3NTHA 1K73C 2M16A 3JCMd 1MHNA 3E19A 2RJEA 2ZGWA 2DXUA 3QZ5B 2K3XA 3SDZA 5LJ5g 1VQOA 2VGMA 1JRIA 4DA4A 2YRVA 4M78F 4E47A 1I81A 2XHCA 2R58A 4MMLA 4BI3A 5KCHA 3HO8A 1VQ6A 4PJOD 3V8KA 3X28B 2OTLT 2WSEE 1D3BB 2JUFA 3OMCA 3MCAB 3QKJA 4MDWA 4X9DA 4XAXB 5CKBA 3VU3C 3TW6A 3CC4T 3KXTA 3VKGA 1UB4A 2XK0A 4M7AA 4M75F 1YITT 4F7UF 4BE1A 4RG8A 4ZTFA 2C06A 2G77A 4JX4A 4M7AE 3CMAT 3LLRA 1K9MC 2XU8A 2WSCE 3CBPA 2EQKA 3QWLA 2LQ8A 4AKGA 3GNFB 4NOYA 4PLLA 1YJNT 2MWOA 2RI5A 5FU6C 3DL1A 2H3JA 3BW1A 3G4ST 4X34A 3BY7A 5GAN2 4HNVA 3OS0A 3CPWA 1M4ZA 1O75A 3HRUA 3VYGB 4XTWA 1VQKT 3JCMe 3CMEA 1JJ2S 3EFSA 3MP8A 3ZFJA 4J5YA 3PGGA 4BY6C 4B9WA 5HK0A 4HKEA 4JRIA 4ELJA 1WGSA 4JLIA 5GANe 5A0DA 4HNTA 3DKMA 3MHXA 1U8RA 4C0DB 4C8QA 2YHTA 2BIVA 3OBWA 3HB9A 5LJ3h 2DKGA 1Q82U 1M1GA 2EQUA 3UT1A 3L2WA 2WSFE 5GMKl 5LJ5f 2XDDA 2QEXA 4M7DG 3CCJT 4OMFB 4C8QE 1EIFA 3LWHA 4JX5A 1WPYA 2CS7A 2DJZA 2DD4A 3A8OB 2QQSA 4MZMA 3GOXA 2PUOB 1XOVA 2XG8D 2XDPA 4TVRA 5CKDA 2X4JA 3CC2A 1M8VA 5GAMd 2DAQA 2QDYB 5DM7R 1BYMA 3PMIA 1X01A 1ZQ1A 2P0QA 3MEVA 4IUTA 4UC4A 5D6WA 3A8LB 3QYGB 4RKUE 3L2VA 2IG0A 4ME7A 4BI8B 2X4WA 3SWNA 3JCMc 4B9XA 3CD6A 5AYFA 2V8JA 1B34A 4M7DB 3FC3A 2E6ZA 1U1TA 1VQPA 3MO8A 2FHDA 2DD5B 5A0GA 3A8HB 3QHSA 4M75C 1K9MU 3S3OA 5GAMj 2ZZDB 5FU7C 3RIRA 3QYEA 3ZBDA 5GAN5 2O01E 1VQ4A 3TW7A 1WQWA 2CZ7B 2ZPEB 2Y4YA 3OYAA 3NTIA 3TCJA 2E10A 4YTLA 2DZ9A 4C0GA 1ZHIA 2RJFA 3LWIA 4LDVA 2ZPGB 3LH0A 3QO3A 3PNWC 4IUPA 5J39A 3RESA 3OS2A 2HNIA 3CCMA 3HFOA 2RHYA 1H641 1HXDA 2K2VA 2RK1A 2EJFA 4M77F 1YJ9T 4Y91A 2K5LA 5GMKi 3L2RA 3G71T 2WJ9A 1WQ7A 2RHUA 3CCQT 2BKDN 2PUKB 1YHQT 2RI2A 1YIJT 2CYZB 3BG9A 4XQ3A 2BUDA 1X75C 4C5IA 1ZBXA 4PJOG 2KVQG 5EJCA 2GF7A 1QLBA 3DB4A 4FT2A 4M78D 1QVFS 2VGNA 4XU1A 2A3LA 3CBOA 2MWPA 5D6YA 4MDXA 2DTHA 1YJWT 4C92F 3OYFA 3E9GA 2ZCFB 1JJ2A 3CCUT 4HT9A 1FX7A 1VQ7T 5CIUA 4M75D 1WJSA 3X24B 2LNVA 1UEBA 3JCMg 1PSFA 3CC7T 1XTDA 2FB7A 3VYHB 5CQXA 3RKWA 5FROA 4IURA 4ZN3A 3LGFA 3CCLA 5GANg 4XTYA 2DK3A 2MMPA 3JCMX 4PJOB 3C12A 5CK9A 5IT9E 4EMKB 3P8DA 2ZPFB 4OB3B 3EAEA 4XU2A 1VQ8A 1VQNA 1H3ZA 2NLUA 4QVCA 1UGRB 1BIBA 2OTLA 3GP8A 1VQ7A 5HKCA 3ZEHA 5LJ3d 2EKOA 4NS5A 5C6SA 3HFNA 1NJIC 1QP3A 2BS4A 1Q82C 2F69A 3C4SA 4BE0A 4II1A 1IREB 2EFIA 2GFAA 1QVPA 3NTKA 4PKCC 4BD3A 1N9SA 2LCCA 2QA4T 3O8VA 4DOWA 2RHXA 4C5HA 4FIBA 2ZPIB 2DVEA 4QQGA 4M7DA 3CMAA 3RMQA 2L3RA 2F5TX 1K8AU 4M77C 3UDCA 4HCBA 4LD6A 3WVDB 1X6OA 3GLXA 5KE2A 2CZ6B 5LJ3j 3J80E 4PNOA 3JAME 1Y07A 4JS4A 4M7DE 2EIFA 1TH7A 4NC6A 2K4YA 2LVMA 3QG1A 4GLKA 3META 1N9RA 3PIPA 3JB9F 3R6OA 4RG2A 3QSUA 3V8JA 3EFRA 3OY9A 3DLLA 5GAOn 3N5BB 1LJOA 4M7AF 1RL2A 3M5AA 4O5VA 3DB3A 4HA8A 2LRQA 4Y28E 4RMOA 2DIGA 3CCVA 3OYYA 3CXCS 3CEYA 3X25B 5A2QE 1G3TA 2RB6A 5GANf 3OYDA 2E70A 4C92C 3FIFA 2XDBA 4MMKA 4M6VA 3RMSA 3WVEB 3KUFA 4LDUA 2EQJA 3AHUA 3H6ZA 5GAMg 1QW1A 1WJRA 2YLCA 2K5FA 3OYIA 4BB7A 2X35A 3H8ZA 3SB2A 4RCBA 3BG5A 3QYBA 2DXBB 3PIOA 3OSSC 5L8RE 2RHZA 1OYXA 5LL6S 1S72A 5CQYA 1KHIA 1VQOT 3J7AF 1NJIU 4KUIA 4LDYA 1N27A 1RI0A 2VV5A 3L2UA 1QVFA 2CGHA 3CCRA 3G6EA 3MEUA 4AI6A 4LOCA 1VQ6T 5LJ5d 1W4SA 4OVAA 4ZN1A 3I55T 5FU6B 3M56A 2RHIA 3JSCA 2RI3A 4C8QF 5GMKh 4M77D 3C95A 4A4GA 4AKIA 4JLGA 4A4FA 1N6AA 3OYBA 4HT8A 3PTAA 2RO0A 3KBGA 4N0AA 4A53A 4BY6B 2R5AA 2DXTA 2V8KA 2JOYA 3OYKA 1IZ6A 2OTJA 2QQAA 3JCMP 1VQMA 1PSEA 3OMGA 3OYGA 3OB9A 4KULA 3CCEA 4PJOA 4M78C 4BUGA 5GAN7 4M78G 4MZTA 1N8RC 5FRNA 4EMKA 5LJ5j 2KY9A 3M59A 2XICA 2KSSA 2PQWA 1YI2T 4LDWA 3TU4K 4PJOE 1VQ5A 4EMGA 1VQ9A 1M5Q1 3VV0A 3FJPA 4DOVA 3RERA 4A54A 4M75G 1UGSB 1DJ7B 4P5NA 2L5QA 2IVWA 3FDRA 4C92D 4F7UG 1KQSS 2FL7A 1VIEA 4OB2B 5FLXE 4BACA 4OP0A 3VKHA 2QFZA 3CCQA 3HRSA 4BDZA 4HCZA 4M7AC 2PVGB 5IAYA 1V29B 3JCMQ 1YIJA 1YHQA 1Q86U 3QZ9B 4M78B 4EMHA 2DPPB 5CR2A 4QQ6A 1FXXA 2K3YA 2KK4A 4ZGJB 2JZ2A 1U1SA 4XK8E 1NPPA 1MGQA 4L59A 4PLIA 3J81E 1D3BA 1YCYA 2E41A 2QEXT 4JRPA 5C0MA 1I5LA 2QF7A 4M75B 5GAMe 4F7UB 1M90U 5FRMA 5FU7B 2M9UA 2GFUA 1VQLA 2KDSA 3OYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPF B;  4OB3 B;  1UGR B;  2DXC A;  4FM4 B;  1QP3 A;  3A8G B;  2WSC E;  1UGP B;  1IRE B;  3VYG A;  2AHJ B;  3VYG B;  2ZPI B;  2DXB A;  3WVD B;  3X20 B;  4L6V 5;  2CZ6 B;  4OB0 B;  2WSF E;  4KT0 E;  3QYH B;  4Y28 E;  2DXC B;  3A8O B;  2DD4 A;  2PUO B;  3X25 B;  2DD4 B;  2CZ1 B;  2QDY B;  3WVE B;  3A8L B;  3QYG B;  4RKU E;  1JB0 E;  2DD5 A;  2DXB B;  3HHT B;  5L8R E;  2DD5 B;  2D0Q B;  3A8H B;  2PVO B;  2ZZD A;  2ZZD B;  2O01 E;  2CZ7 B;  2ZPE B;  1QP2 A;  4ZGE B;  2ZPG B;  3LW5 E;  1PSE A;  1GXI E;  2ZPH B;  2PVD B;  3A8M B;  2ZPB B;  2PUK B;  4ZGD B;  2CZ0 B;  2CYZ B;  3X26 B;  1UGS B;  1DJ7 B;  3QXE B;  4OB2 B;  4OB1 B;  2PVG B;  1V29 B;  3QZ9 B;  1UGQ B;  2DPP B;  1AHJ B;  3QZ5 B;  2ZCF B;  4ZGJ B;  4XK8 E;  2PU9 B;  3X24 B;  1PSF A;  3X28 B;  3VYH B;  2WSE E; 
#chains in the Genus database with same CATH topology
 1G83 A;  5DLO A;  1C6V X;  4LN2 A;  1KQS P;  2RQW A;  3GBQ A;  2A37 A;  2FO0 A;  4NST B;  4RUG A;  5LMK B;  2D9T A;  1SPK A;  3VYG A;  4MIM A;  2VVK A;  1X27 A;  2HDA A;  2HKQ B;  4RTT A;  3JB9 D;  2K2M A;  3E1S A;  3I56 A;  1PRL C;  1AD5 A;  3IQL A;  2IW6 B;  1SF9 A;  2O4X B;  4M7A D;  3U23 A;  5I21 A;  1Q7Y R;  3TRE A;  2EGA A;  3UF4 A;  2RM4 A;  3PMT A;  4D6W A;  1GFC A;  2JTM A;  5ECA A;  2RD1 A;  3G1J A;  3CCV Q;  1N4M A;  4JZ3 A;  2VAS A;  1VA7 A;  3H0F A;  4HLQ A;  5DLQ E;  2NUP A;  2RA2 A;  4V2S A;  1R0B G;  3L42 A;  1Q81 C;  3RUX A;  2JT4 A;  3VKI A;  2OX7 A;  1JB0 E;  1BI3 A;  4QSH A;  3LX7 A;  1OZ3 A;  1KQS A;  1H1Q B;  4A4K A;  5GMK j;  3CCS T;  4AFQ C;  5KH6 A;  1SRL A;  3THK A;  1ZA1 B;  1M90 R;  1RAG B;  3TNH B;  1A0N B;  5CEI B;  4L5G A;  2CJM B;  1BCM A;  4M78 E;  3OA6 A;  4M77 B;  3M57 A;  3EG9 A;  4M75 A;  4IKF A;  3CCJ A;  3RKX A;  3I55 A;  2ZPH B;  4KGZ B;  2PVD B;  4BBS M;  5IDN B;  4ZNX A;  2DX1 A;  1ZSG A;  5HY6 A;  1VQ9 Q;  3X26 B;  2LP5 A;  3EHR A;  4FYV B;  2W99 A;  4FU6 A;  3INZ A;  4QW2 A;  3VS5 A;  2P0P A;  1RAB B;  4OB1 B;  2H8H A;  1Q81 U;  4BCJ B;  1R77 A;  1RAD B;  1UGQ B;  1X6B A;  3OYN A;  4RCC A;  4ELZ C;  3PT9 A;  4E7J A;  2DE0 X;  2DLP A;  2L3P A;  2Y90 A;  2XI9 A;  3HTR A;  4KH0 B;  1BIA A;  1YCS B;  4N4I A;  1OKV B;  5CCA A;  2DXC A;  4BI4 A;  5CAI A;  3CME T;  4EOM B;  4ATO A;  2UZL B;  1BK2 A;  1S72 T;  5IN1 A;  2QGF B;  4FSX A;  3M0S A;  5LJ5 e;  1BI1 A;  3BHV B;  3CCR T;  2AHJ B;  3A5Z B;  2KI7 A;  1JQQ A;  1YN8 A;  1TFB A;  5HCK A;  2XMF A;  4A4E A;  1WHJ A;  4II5 B;  3F5X B;  1SHF A;  2IW8 B;  4OB0 B;  3OQ5 A;  2OAU A;  1G3N C;  2R57 A;  2EBP A;  3G7Z A;  3CCU A;  1M3B A;  1QKX A;  4M7A B;  2RK2 A;  2QQB A;  2R7G A;  3CCE T;  4JX6 A;  3M9Q A;  3CC4 Q;  2OAW A;  3CPF A;  1ZBJ A;  3NFC A;  4C8Q G;  1N5Z A;  1VQP T;  3M58 A;  1VQ5 T;  1BKB A;  1KC8 C;  3VUZ A;  4E7L A;  1G3Y A;  2KXD A;  3CPW S;  3GF5 A;  3D7S B;  3MEA A;  2FG0 A;  1TTH B;  1T0J A;  3QHW B;  4BE2 A;  4MZP A;  4PJO C;  4EOP B;  4C92 A;  2KMG A;  3OYE A;  2EWN A;  3OYL A;  2VKN A;  1VQL T;  1K73 R;  2RQU A;  3V7S A;  2ECZ A;  4BCO B;  5KYX A;  3KHI A;  3OW2 A;  3C94 A;  5CKH A;  2P84 A;  2KR6 A;  1KD1 C;  1RAF B;  1OOT A;  2JTE A;  1IO6 A;  4J7F A;  1MND A;  3I56 T;  4CFU D;  3EG2 A;  2DMO A;  5DQW A;  7AT1 B;  2LQN A;  2CCI B;  5HK3 A;  3HZJ A;  3TEE A;  2O9S A;  3BFM A;  4BXX X;  4B6M A;  3E19 A;  3QZ5 B;  1JRI A;  2DFU A;  1I81 A;  2M02 A;  1RLQ C;  1VQ6 A;  2GQI A;  1X69 A;  2L3Q A;  3X28 B;  3V8K A;  2WSE E;  1D3B B;  2JUF A;  4PJO D;  3MCA B;  1UUE A;  2EGC A;  1UB4 A;  4LUE A;  4ROC A;  4F7U F;  4BE1 A;  4ZTF A;  2F2X A;  2G77 A;  3CMA T;  3LLR A;  1SG5 A;  2XU8 A;  3CBP A;  3G71 Q;  4AKG A;  2MYS A;  3DL1 A;  2H3J A;  3BW1 A;  2WMA B;  1M4Z A;  4D8D A;  3VYG B;  4BY6 C;  3EGX B;  1PG5 B;  4JRI A;  5GAN e;  3M03 A;  2BZY A;  1WI7 A;  3REA B;  3UT1 A;  1JSU B;  2QGG A;  3MY1 B;  2MCN A;  4A63 B;  3CCJ T;  1E9H B;  1QWE A;  4C8Q E;  1MV0 B;  3CC7 Q;  1C0M A;  1EFN A;  1X2Q A;  1M8V A;  1VYT A;  2QDY B;  5DM7 R;  1BYM A;  3PMI A;  1WXU A;  2IIM A;  2VB6 A;  1JJ2 P;  3SWN A;  3JCM c;  2FZC B;  2V1Q A;  1M3C A;  4J9G A;  3ZBD A;  2O01 E;  4GBQ A;  1VQ4 A;  4BCK B;  2A0F B;  3TNI B;  1H3H A;  1G8X A;  1WQW A;  2ZPE B;  2RNA A;  3TCJ A;  4EIK A;  4YOS A;  4X1V A;  2FRW A;  3LWI A;  1ABQ A;  4QKU A;  4CFV B;  3RES A;  3OS2 A;  3CCM A;  4YOO A;  1OQK A;  3EG9 B;  4M77 F;  2X3W D;  1WQ7 A;  2LJ3 A;  2HEQ A;  2RI2 A;  4CFX B;  4KH1 B;  1YIJ T;  4XQ3 A;  3K7A M;  2EGE A;  2AKL A;  2BUD A;  3M0R A;  1X75 C;  2DET A;  4C5I A;  2KVQ G;  2GF7 A;  2J7I A;  1Z9Z A;  1PKS A;  1AEY A;  2A3L A;  1NJI R;  4CFU B;  2MWP A;  2DYI A;  1O9K A;  1NBE B;  4F17 A;  1VQO Q;  1JJ2 A;  3NMZ C;  3I9Q A;  3CCU T;  1TS9 A;  4HT9 A;  4F7J B;  5L2W B;  1OX8 A;  4ZN3 A;  1OL2 B;  4IUR A;  3CCL A;  1I0C A;  4PJO B;  3C12 A;  1JXM A;  4XU2 A;  1VQN A;  2CSQ A;  2PK9 B;  1UGR B;  1BIB A;  2UZD B;  2OTL A;  3FJ5 A;  1AWW A;  1TSF A;  5I22 A;  1Q82 C;  2F69 A;  4II1 A;  4BD3 A;  1T0H A;  3NTK A;  4AT1 B;  3EFO A;  4DBQ A;  2A28 A;  3O8V A;  2F2C A;  2ZPI B;  4EC9 B;  4QQG A;  2X51 A;  2F5T X;  4BY1 X;  2A36 A;  3JV3 A;  1WLP B;  5KE2 A;  3GLX A;  2CZ6 B;  4JS4 A;  3JAM E;  2ED0 A;  2K4Y A;  3JB9 F;  3QG1 A;  3QSU A;  2WHB B;  3EGU A;  1AT1 B;  1LJO A;  4M7A F;  3M5A A;  1D0Y A;  3DB3 A;  1TOV A;  3CEY A;  1M3A A;  3OYD A;  2XDB A;  2KE9 A;  4LDU A;  1QW1 A;  3M0U A;  2X35 A;  3H8Z A;  1M2O A;  2PK2 A;  1OYX A;  5LL6 S;  2YSQ A;  2VV5 A;  1MMD A;  4LOC A;  1VQ6 T;  1C9B A;  4ZN1 A;  2EPD A;  3M56 A;  5GMK h;  3C95 A;  3KBG A;  4BY6 B;  2KYB A;  2V8K A;  2OTJ A;  1B3Q A;  2BPM B;  1JXO A;  3OMG A;  3OB9 A;  5LJ5 j;  3M59 A;  1LPL A;  2PQW A;  1YI2 T;  3TU4 K;  4EMG A;  1AZG B;  3RER A;  4A54 A;  1DJ7 B;  2L5Q A;  4F7U G;  4CFM B;  1QCN A;  1VIE A;  1UJY A;  3VKH A;  4F16 A;  3HRS A;  2HCK A;  1YHQ A;  1D09 B;  1Q86 U;  3QZ9 B;  3VS2 A;  3POM A;  4FW1 A;  1FXX A;  5D7U A;  4ZGJ B;  2NYS A;  2KYM A;  2NWM A;  3CCS Q;  3MI9 B;  5KYW A;  3VS7 A;  1M2V A;  1IXD A;  5GAM e;  1GUX A;  2M9U A;  1WHH A;  2XD0 A;  2LCS A;  1NM7 A;  1D1A A;  1KHC A;  3CXC A;  2W10 A;  1W70 A;  4G6L B;  4F7L B;  3QDR B;  1E6H A;  2I40 B;  3ASK A;  4BCQ D;  4R55 A;  1VIN A;  2LDM A;  2EYW A;  1VQ4 T;  2DXB A;  1Q81 R;  4FT4 A;  3JCM b;  4KGX B;  3EID B;  3HBL A;  1T3L A;  1GCQ C;  5GAN 8;  4BBR M;  1X6G A;  5EG2 A;  1H28 B;  3QWX X;  2CT3 A;  3OS1 A;  1QVG S;  3JB9 I;  4F70 B;  1QVF P;  3HPW A;  2LC4 A;  2D6F A;  1BI0 A;  2HL5 C;  3H9N A;  5GAN 6;  2BS3 A;  5GAO r;  2E5K A;  5GAO q;  3UPU A;  5IHI A;  3CME Q;  4M77 G;  4EOL B;  3SWN B;  2D0Q B;  1S72 Q;  2DTI A;  5KYU A;  3ZL7 C;  2QYZ A;  4R0K A;  1FWZ A;  3RDV A;  3CCR Q;  3L1A A;  2FPF A;  4AFU C;  2EQM A;  1P92 A;  3CCL T;  4GY5 A;  2JNG A;  2MAM A;  3T9N A;  2WMB B;  2XID A;  1X2K A;  4ZGE B;  2DO3 A;  5KYY B;  1VQN T;  5LJ3 e;  3LW5 E;  5HVY B;  2P0K A;  3ER0 A;  4LXC A;  3CCE Q;  2J6F A;  3P8B B;  4J6Y A;  1T3S A;  1MMN A;  4IUV A;  2CP0 A;  3A8M B;  1UNH D;  4F7U E;  3TSZ A;  3RBB B;  4FYX B;  1VQ5 Q;  2EUF A;  1VQP Q;  1TU0 B;  1Y0M A;  4KRD B;  1XNI A;  2C5X B;  3VJP A;  4E2F B;  5GAN j;  4C0D C;  2FYK A;  3I5S A;  1WDX A;  3L2Z A;  3QWY A;  3HKS A;  4E7I A;  1AHJ B;  1O9K B;  3HP9 A;  1PD1 A;  2GGR A;  4JS5 A;  5DY9 A;  1M1K U;  2OI3 A;  3M53 A;  3JRZ A;  1G3S A;  4JUV A;  2HMA A;  4HL4 A;  4JJB A;  1VQL Q;  3I35 A;  3WXM B;  1WXB A;  1NPR A;  4PJO F;  3BDU A;  5I2M A;  4M7D C;  3JB9 G;  2BS2 A;  2CDT A;  2YUQ A;  4FM4 B;  8AT1 B;  4F14 A;  4PK4 A;  4M7A G;  4ELY C;  4F7S B;  3BLH B;  2VXF A;  4PFZ A;  4FW2 A;  1XQH A;  4ROD A;  1VYU A;  2YXY A;  1KC8 R;  2L89 A;  2LTO A;  3I56 Q;  1KSW A;  4BCQ B;  3X20 B;  4L6V 5;  1IGU A;  1WHK A;  5AT1 B;  5GAO l;  4HVV A;  2L2P A;  2PNI A;  3FLG A;  3CC2 T;  2EJG A;  4RTY A;  3FRN A;  1VQ7 A;  2OTJ T;  2ESW A;  4KT0 E;  1JKW A;  2H3E B;  4CC3 A;  4J6X A;  1G3W A;  1HJD A;  1K76 A;  4M77 E;  1TXQ A;  1OZ2 A;  1Q95 G;  4M7D D;  2E5Q A;  1H1P B;  1EX4 A;  1NG2 A;  1FMK A;  2QDJ A;  3SFM A;  3CMA Q;  2DVJ A;  3MJX A;  3UA6 A;  2DL8 A;  4N0A C;  1OEB A;  4F04 B;  2L3S A;  2PVO B;  1KD1 R;  1Y96 A;  3BLQ B;  2PHG A;  4HVW A;  4N4G A;  2E64 A;  2DEQ A;  2EAY A;  1OI1 A;  4OGR B;  1ZSZ C;  3GNG A;  3VS4 A;  2RN8 A;  1QP2 A;  3SD4 A;  5L23 A;  1NZ9 A;  4OGE A;  1YBY A;  2HL3 A;  4CI0 C;  4E6R A;  3BDL A;  1GXI E;  2F1L A;  4X9C A;  5GAN 3;  3CCJ Q;  2AZS A;  4XU0 A;  4LUD A;  1WZO A;  4OGC A;  5FGK B;  3EHQ A;  4J9C A;  5GMK m;  1AIS B;  3EJ1 B;  1AOJ A;  2QI2 A;  3GTM S;  1C1A A;  1KXU A;  3JCM V;  4Z02 A;  1SHG A;  2C0I A;  2ZGW A;  2K3X A;  3EGD A;  3SDZ A;  2VGM A;  4DA4 A;  2YRV A;  4PJL A;  2XHC A;  3KFV A;  3HO8 A;  5ICP B;  4GLM A;  1OU8 A;  5KYW B;  1BU2 A;  1UE9 A;  3VKG A;  4F6S B;  4RG8 A;  2C06 A;  4M7A E;  2HZY A;  1K9A A;  2EQK A;  4PLL A;  9ATC B;  1YIJ Q;  2RI5 A;  4HNV A;  3CPW A;  3NHN A;  4XTW A;  3PGG A;  2HSE B;  4WTO B;  4HKE A;  2WEV B;  1ABO A;  4ELJ A;  3DKM A;  3MHX A;  1IHW A;  2NUZ A;  4C0D B;  4C8Q A;  2YHT A;  3HB9 A;  2DKG A;  2FPE A;  3CCU Q;  3L2W A;  5LJ5 f;  2YUO A;  2XDD A;  1H92 A;  4OMF B;  3LWH A;  2E3I A;  2F2W A;  1WXT A;  5IH2 A;  2DD4 A;  3A8O B;  3GOX A;  2PUO B;  2NUT A;  4TVR A;  4DBF A;  5CKD A;  2X4J A;  1UNL D;  2LMJ A;  2O88 A;  1X01 A;  3DTO A;  4RKU E;  1UHF A;  4ME7 A;  4BI8 B;  4B9X A;  5AYF A;  1IGQ A;  2V8J A;  4M7D B;  2E6Z A;  3MO8 A;  3OW2 P;  4M75 C;  3S3O A;  5GAM j;  5FU7 C;  3ULR B;  1JST B;  1UNG D;  2CZ7 B;  2KRN A;  2P4R A;  3MKD A;  3OYA A;  5FW9 A;  3NTI A;  4CFW B;  4BY7 X;  1OV3 A;  4C0G A;  3BLR B;  2RJF A;  4LDV A;  3PNW C;  2FEI A;  1LVK A;  2HSP A;  2RK1 A;  4PFP A;  2C5N B;  2CSI A;  4Y91 A;  2K5L A;  2ED1 A;  3CCQ T;  2PUK B;  3BG9 A;  1W6X A;  2WIH B;  1WHM A;  4PJO G;  3DB4 A;  2W9F A;  4XU1 A;  1IRX A;  5D6Y A;  4EOI B;  4MDX A;  5IF1 B;  2DTH A;  3OYF A;  1Q82 R;  2ZCF B;  2F2V A;  2UZE B;  1VQ7 T;  2LJ1 A;  4M75 D;  3X24 B;  3JCM g;  1TUG B;  1PSF A;  1VQ6 Q;  3RKW A;  3VYH B;  3LGF A;  1X43 A;  1AD6 A;  2ZPF B;  1HYO A;  1VQ8 A;  4OR5 B;  1ZSZ B;  1URC B;  1EZZ B;  3H0H A;  1OX9 A;  2WPA B;  3C4S A;  2GFA A;  4JZ4 A;  4PKC C;  1YI2 Q;  4FCY A;  1OIU B;  2E4H A;  2KRM A;  4EON B;  1K8A U;  3UDC A;  1Q86 R;  4LD6 A;  3WVD B;  5LJ3 j;  1Y07 A;  2AIR B;  2LVM A;  3PIP A;  3R6O A;  4RG2 A;  3LQ5 B;  3OY9 A;  3N5B B;  3C0C A;  4HA8 A;  4RMO A;  2O31 A;  3PE0 A;  2ENM A;  1CSK A;  1G3T A;  5GAN f;  2E70 A;  4C92 C;  3RMS A;  1BU1 A;  3WVE B;  2EQJ A;  3H6Z A;  5GAM g;  2YLC A;  2YWW A;  2CRE A;  2K5F A;  2DEU A;  2LNH B;  2ROL A;  3BG5 A;  2DJQ A;  5L8R E;  2K7A A;  5CQY A;  1I07 A;  1GRI A;  4KUI A;  1N27 A;  3L2U A;  3G6E A;  1B7T A;  4BCH B;  3MEU A;  1VQ4 Q;  4M4Z A;  3I55 T;  1WHG A;  1K1Z A;  1QMZ B;  1WIE A;  3OYB A;  4HT8 A;  2EYX A;  4DEY A;  3TNW B;  3I5R A;  1OPL A;  2JOY A;  8ATC B;  2QQA A;  1VQM A;  3OYG A;  2NUP B;  5GAN 7;  5FRN A;  4EMK A;  2KY9 A;  4YC3 B;  4LDW A;  4PJO E;  1FIN B;  1KIK A;  3VV0 A;  3FJP A;  4DOV A;  4C92 D;  1U3O A;  2CP6 A;  2AK5 A;  3EH2 A;  4AFZ C;  2FL7 A;  4CFN B;  4BAC A;  4BDZ A;  4OP0 A;  4ELL A;  4HCZ A;  5IAY A;  4J9F A;  1OGU B;  4QQ6 A;  5CR2 A;  4Y72 B;  2KK4 A;  2JZ2 A;  1NPP A;  4PLI A;  4JRP A;  3EGD B;  1YCY A;  5C0M A;  2W2H A;  3E2U A;  3CCL Q;  4M75 B;  1PC0 A;  1M90 U;  5FU7 B;  2GFU A;  1HD3 A;  1E7O A;  1PNJ A;  2R5M A;  1VQN Q;  1B07 A;  1ZUU A;  4XTU A;  1QCO A;  3ME9 A;  3REB B;  1H1R B;  5LJ3 g;  3OYJ A;  2BZX A;  1M27 C;  5GJV B;  2DTO A;  2CT4 A;  1Y7X A;  2P4T A;  3FEO A;  2D1X A;  3NGP A;  2JTF A;  1AWO A;  2WFY B;  1CKA A;  2EYZ A;  4CRI A;  2FVU A;  3M0P A;  4C8Q B;  4RTU A;  1JO8 A;  3SWN C;  3E9F A;  1J3T A;  1I8F A;  4EOQ B;  3QYH B;  2YDL A;  3VUB A;  1ARK A;  2DXC B;  3M0T A;  5CVI A;  2DD4 B;  2KBT A;  4OF1 A;  1YIT A;  4ZTJ A;  1KQ2 A;  2COW A;  2E6N A;  5CKE A;  3S3N A;  4BDY A;  3AT1 B;  3G33 B;  1M9S A;  5J3B A;  4AFS C;  2DD5 A;  3Q1J A;  1D0X A;  3QII A;  1YJN A;  3QJY A;  4QVZ A;  2ROT A;  3BG3 A;  2LX9 A;  2ZZD A;  2BTT A;  3G4S A;  2HBP A;  4M7D F;  2C6T B;  4LDX A;  1OI9 B;  2E12 A;  4O6J A;  1VQK A;  4FX3 B;  3V8L A;  2COZ A;  1M1F A;  1FYN A;  2B86 A;  1W2B S;  3MY5 B;  3JCM f;  1QVG P;  4EPC A;  2C4G B;  5KYN A;  4JDS A;  3CC2 Q;  1I4K 1;  1V1C A;  3L2Q A;  1VQ8 T;  2OTJ Q;  3UAT A;  1WYX A;  1FKM A;  4F7U A;  1Q86 C;  5GMK e;  1WX6 A;  1Y71 A;  2PJQ A;  3M4Y A;  1UEC A;  2QAS A;  2ZPB B;  1UHC A;  3CBM A;  2DA9 A;  2L0A A;  2VWF A;  2M0O A;  2JGZ B;  5IHN A;  2WAC A;  4C92 B;  1AWX A;  4QVD A;  2CP3 A;  4XTV A;  3CXC P;  4XU3 A;  2KAF A;  2PU9 B;  4CC4 B;  2DBK A;  4FSS A;  1LOJ A;  2O4X A;  2PTK A;  4WF2 A;  2KQW A;  4IUU A;  5D6X A;  1E7P A;  5KYX B;  2MI6 A;  3BE3 A;  3QBY A;  3HL8 A;  5KCO A;  1H8K A;  1K73 U;  1NYG A;  4KUD K;  1UDL A;  2V1R A;  5IHK A;  2V22 B;  4TTH A;  1O9S A;  1YJ9 A;  1QVG A;  3JCM h;  4KBM B;  4RTV A;  2LQW A;  1UGP B;  3PO3 S;  5FWC A;  5GAM f;  2KNB B;  2GTO A;  3EG3 A;  1QCF A;  3QPH A;  3EOC B;  4XTX A;  2QTX A;  2RQV A;  1YP5 A;  3NDQ A;  1JOW A;  3G6E T;  2JMA A;  3OBY A;  4N4H A;  4BCP B;  4DQ2 A;  1JU5 C;  1R8O B;  1YJW A;  1VUB A;  1PRM C;  3DDP B;  1MUZ A;  2HQE A;  2JW4 A;  2DZC A;  2HD0 A;  1U06 A;  4MFE A;  3S6W A;  3MEW A;  2RJC A;  1VQM T;  2EVR A;  4EOO B;  1ZX6 A;  2K57 A;  1HK9 A;  2QQR A;  2DIQ A;  5HBE B;  4VUB A;  4M77 A;  4HNU A;  2QG9 B;  3MP1 A;  3PVL A;  4J6W A;  2JVV A;  1KG1 A;  1BI2 A;  1WFW A;  2JN0 A;  4R56 A;  2W9Z A;  2W96 A;  5A0L A;  4Z6Y A;  4IUQ A;  4RTX A;  3LYI A;  2QA4 A;  4BCN D;  1WJQ A;  2E1H A;  3URG A;  2BZ8 A;  2KT1 A;  3CCM T;  1LCK A;  2VYT A;  5GAM h;  2DYB A;  1H26 B;  5HBH B;  2J06 A;  3LGL A;  4C5G A;  1RAC B;  2W0Z A;  2DNU A;  5I5Z B;  4J9E A;  1KQ1 A;  3CCS A;  2CKK A;  2RJD A;  2A7Y A;  5LQF B;  3M54 A;  3VS6 A;  5EC7 A;  1I5O B;  2CZ0 B;  2M1H A;  1M1K C;  3QJ6 A;  2ABL A;  2CP7 A;  2GCX A;  5LJ3 f;  2C0T A;  1NE8 A;  3LH5 A;  3QXE B;  2X3X D;  4M78 A;  4MFD A;  3NTH A;  2O9V A;  2M16 A;  2DRK A;  1MHN A;  3VS1 A;  2DXU A;  5LJ5 g;  4BCF B;  2R58 A;  1KFZ A;  2OTL T;  3OMC A;  3QKJ A;  4X9D A;  2E3H A;  3TW6 A;  2QGS A;  4M7A A;  1V76 A;  4M75 F;  1YIT T;  1D1B A;  1MNE A;  2J6K A;  1K9M C;  2SEM A;  2WSC E;  1YJN T;  3CCQ Q;  1YWP A;  2MWO A;  4ORZ A;  3G4S T;  3BY7 A;  4EOJ B;  3HRU A;  1VQK T;  1AZE A;  3CME A;  3EFS A;  2MOX A;  3ZFJ A;  4J5Y A;  4B9W A;  4BCM D;  1H27 B;  4JLI A;  4HNT A;  1H4L D;  5LJ3 h;  1M1G A;  2JMC A;  1VQ7 Q;  2WSF E;  2QEX A;  4M7D G;  1VOL A;  3DJB A;  1BBZ A;  4JX5 A;  1WPY A;  2DJZ A;  1XJW B;  2QQS A;  4MZM A;  2FZG B;  2RMO A;  1ZQ1 A;  5D6W A;  3EFO B;  3A8L B;  3QYG B;  1D1C A;  2IG0 A;  2D0N A;  2X4W A;  1ZUY A;  2DRM A;  3CD6 A;  1B34 A;  1VQP A;  2FHD A;  2DD5 B;  5A0G A;  3A8H B;  2DBM A;  5IDP B;  1K9M U;  1GBQ A;  2ZZD B;  2HKN A;  5GAN 5;  4OMQ A;  3TW7 A;  4BCN B;  2Y4Y A;  1W1F A;  2E10 A;  4IIO A;  1G2B A;  2RQR A;  3R6N A;  3QO3 A;  4IUP A;  5J39 A;  2HNI A;  3UA7 A;  1H64 1;  2K2V A;  1YJ9 T;  3A1P A;  1OKW B;  3A98 A;  5GMK i;  2RHU A;  2YRD A;  2WXV B;  2BKD N;  1YHQ T;  1OL1 B;  1IB8 A;  1RAH B;  1MMG A;  1QLB A;  1ZLM A;  2I0N A;  4M78 D;  1QVF S;  5IXB A;  2M51 A;  3CBO A;  2ATC B;  1YJW T;  4C92 F;  2KGT A;  2GTJ A;  2BKZ B;  1FX7 A;  1PWT A;  3EGX A;  5CIU A;  1UEB A;  2JXB A;  2FB7 A;  5FRO A;  5CQX A;  3I55 Q;  2QAZ A;  5GAN g;  2DK3 A;  3CPW P;  1GY3 B;  3EG1 A;  5IT9 E;  4CC2 A;  3P8D A;  3EAE A;  1AVZ C;  4HCK A;  2J6O A;  1VYW B;  1H25 B;  4J9B A;  5HKC A;  3ZEH A;  2EKO A;  2FPD A;  4NS5 A;  1QP3 A;  4HVU A;  1JEG A;  1IRE B;  2EFI A;  1N9S A;  4Z89 A;  2QA4 T;  2RHX A;  4C5H A;  4FIB A;  2DVE A;  3CMA A;  2L3R A;  1X6O A;  4PNO A;  1M2V B;  2UZB B;  4M7D E;  4BCM B;  2EIF A;  1NEG A;  3MET A;  1N9R A;  1GUX B;  1QLY A;  3DLL A;  1H1S B;  2PMI B;  1RL2 A;  4O5V A;  4Y28 E;  3CCV A;  3OYY A;  2RPN A;  2G6F X;  3X25 B;  2RB6 A;  2K3B A;  1K0X A;  3FIF A;  4MMK A;  3KUF A;  2EW3 A;  3BHT B;  2GBQ A;  1WHL A;  1GL5 A;  1WJR A;  1KJW A;  4BB7 A;  3SB2 A;  3QYB A;  2DXB B;  3OSS C;  1NLP C;  3J7A F;  3RNJ A;  1M8M A;  4LDY A;  1ZUK A;  2CGH A;  1F5Q B;  4DBR A;  4AI6 A;  1Y57 A;  2BE7 D;  1W4S A;  5LJ5 d;  3M0Q A;  4F6W B;  2RI3 A;  2YUP A;  5CYI B;  2R5A A;  2B9R A;  3VRY A;  1IZ6 A;  1UTI A;  2JS0 A;  4PJO A;  1N8R C;  1SKU B;  3VS0 A;  2XIC A;  1I1J A;  4Z88 A;  1VQ9 A;  1TD6 A;  1UGV A;  2CUD A;  4M75 G;  1UGS B;  1KQS S;  3SEM A;  2MK5 A;  3FDR A;  5KYU B;  2EYY A;  2KR3 A;  2DL7 A;  4OB2 B;  5FLX E;  1V29 B;  1YIJ A;  4M78 B;  2KT8 A;  4XK8 E;  4L59 A;  1MGQ A;  2E41 A;  2QEX T;  2DM1 A;  1RUW A;  4PJJ A;  4FYW B;  4IMY B;  3H0I A;  4J7I A;  4A4H A;  1K8A C;  5LJ5 h;  1BCO A;  1VQ8 Q;  5BNJ B;  4PL6 A;  2F5K A;  4EDU A;  3QUI A;  2E65 A;  2MF2 A;  3VRZ A;  4Q5W A;  3A8G B;  3CD6 T;  4C8Q C;  4C5E A;  1N8R U;  2LQK A;  2JJ9 A;  2VXE A;  2HBW A;  4QQD A;  3DDQ B;  4CC7 A;  3PVQ A;  2Y4X A;  5GAN 4;  5KE3 A;  2VC8 A;  2AZV A;  2RH2 A;  1IHV A;  1FMW A;  3NPF A;  2DIL A;  1G5V A;  1RLP C;  3RKY A;  3RR6 A;  3CC4 A;  1YNZ A;  1VOM A;  1PM3 A;  3JB9 J;  4HCC A;  3V7R A;  4AKH A;  2EYQ A;  4OMN A;  5J26 A;  2CH4 A;  5CKF A;  2CP5 A;  4Z8A A;  3HHT B;  4E7H A;  3GPL A;  5HBJ B;  1B34 B;  4C8Q D;  1Q7Y C;  2J05 A;  4JRQ A;  1LNX A;  4J9H A;  4RTZ A;  2MPX C;  3HSB A;  3DLM A;  2WIP B;  3G6E Q;  1KC8 U;  4JRK A;  2QXF A;  2QTV A;  2JM8 A;  3JCM W;  2KMT A;  3EG0 A;  4LD9 K;  5GAN d;  2L8D A;  1UFF A;  4C92 G;  2HQX A;  2EJ9 A;  1VQM Q;  2K5I A;  3MP6 A;  5GAO m;  4M75 E;  1PD0 A;  2FZK B;  4J9D A;  4ZGD B;  3GIB A;  1NLO C;  3M4G A;  3OYC A;  4ANJ A;  3S3M A;  1S1N A;  2LT1 A;  2X4X A;  3UWN A;  1Y96 B;  4OML A;  1M90 C;  2QQ8 A;  4QT7 A;  1NEB A;  1W2B P;  3JB9 H;  2LX7 A;  1YI2 A;  4KGV B;  1TWB A;  4EOK B;  1PHT A;  1KD1 U;  4YOZ A;  3CCM Q;  1Q7Y U;  2LCL A;  2LW4 A;  3PFS A;  2CCH B;  3CCV T;  1QKW A;  1WNL A;  4J8O A;  2V26 A;  1D0Z A;  5M9O A;  3OW2 S;  4I3Z B;  4OMO A;  2G3R A;  1FMV A;  1PKT A;  4XTZ A;  5DQV A;  3F70 A;  4DBH A;  3G71 A;  1MMA A;  5GAN h;  4KRT A;  5CO7 A;  1R0C B;  1GCP A;  2RQT A;  5I2S A;  3MIA B;  2KEA A;  3FB9 A;  4C0Z A;  4JJN K;  2RF0 A;  5ACB A;  2KRO A;  2V8I A;  2YLB A;  3OS5 A;  1W98 B;  3EH1 A;  3BHU B;  4J9I A;  2LT4 A;  2VUB A;  1W2B A;  4ROE A;  3H4C A;  4C0F A;  3JCM J;  3CC7 A;  3P8H A;  3HRT A;  2OTL Q;  3OSV A;  2QK0 A;  2I2L A;  1SSF A;  3OYH A;  5KYY A;  1QMC A;  2CZ1 B;  2XKO C;  1VQ9 T;  1M30 A;  1YIT Q;  2FRY A;  2LJ0 A;  1PCX A;  4FL6 A;  2DL4 A;  2K79 A;  1F1B B;  2KXC A;  2HAX A;  4NL2 A;  1YJN Q;  2QDL A;  1E6G A;  2X1N B;  4E7K A;  3V7C A;  3QDF A;  3G4S Q;  1M1K R;  1JBM A;  2X4Y A;  1VQK Q;  4EMK C;  2QQ9 A;  1YFN A;  4EOR B;  4C92 E;  2GQV A;  2Z0W A;  1AWJ A;  3DOG B;  2IPO B;  2NUT B;  2YRC A;  3TVT A;  1RAA B;  1TG0 A;  3M55 A;  4NL3 A;  5IHY A;  2SRC A;  4JJD A;  2B8A A;  4RTW A;  4J83 A;  3O0G D;  2COY A;  2D8H A;  1OUL A;  4EC8 B;  2MIO A;  5GAO p;  3TN8 B;  5IXF A;  1TUD A;  1VIF A;  1GFD A;  1K73 C;  1K9M R;  3JCM d;  1ZA2 B;  2RJE A;  1VQO A;  2YUN A;  4LE9 A;  4M78 F;  1NYF A;  4E47 A;  4MML A;  1WA7 A;  4BI3 A;  5KCH A;  5FWB A;  4ESR A;  4MDW A;  4XAX B;  3VU3 C;  5CKB A;  3CC4 T;  2IW9 B;  3KXT A;  1SEM A;  2XK0 A;  3TSW A;  2CP2 A;  4JX4 A;  4BCG B;  1XO2 A;  2YT6 A;  1YJ9 Q;  1GH6 B;  4F7N B;  1OPK A;  3GNF B;  3QWL A;  2LQ8 A;  2C5V B;  4NOY A;  1YHQ Q;  2JS2 A;  5FU6 C;  4X34 A;  4AG2 C;  5GAN 2;  4AG1 C;  3OS0 A;  1O75 A;  2GNC A;  2A08 A;  3JCM e;  1JJ2 S;  3MP8 A;  1ACM B;  2CH4 W;  5HK0 A;  4LNP A;  1TUC A;  5A0D A;  1WGS A;  1ZP2 A;  2DME A;  1YJW Q;  1U8R A;  2BE9 B;  2BIV A;  3OBW A;  1Q82 U;  2EQU A;  1MV3 A;  5GMK l;  1RAE B;  4Y92 A;  1EIF A;  2OJ2 A;  2CS7 A;  3CQT A;  1GBR A;  2XG8 D;  1XOV A;  2XDP A;  4FYY B;  3CC2 A;  1GCQ A;  5GAM d;  2DAQ A;  2JM9 A;  3MEV A;  2P0Q A;  4IUT A;  4UC4 A;  4E7S A;  4EOS B;  1YWO A;  3L2V A;  1VYV A;  3FC3 A;  1U1T A;  3QHS A;  2QA4 Q;  3RIR A;  3QYE A;  1QQJ A;  2K6D A;  6AT1 B;  1K0S A;  4YTL A;  2DZ9 A;  3TQ7 P;  1H24 B;  2I53 A;  1ZHI A;  2DL3 A;  2ZPG B;  3LH0 A;  4IIM A;  1RAI B;  3HFO A;  2RHY A;  5I11 A;  1HXD A;  2EJF A;  2IN3 A;  3G71 T;  3L2R A;  2WJ9 A;  1OU9 A;  2CYZ B;  1RI9 A;  3H41 A;  1ZBX A;  5EJC A;  4FT2 A;  2VGN A;  5EFQ B;  3O5Z A;  3E9G A;  2KRS A;  2AT1 B;  1WJS A;  2LNV A;  3MPU B;  3VS3 A;  3CC7 T;  1XTD A;  4XTY A;  2MMP A;  3JCM X;  5CK9 A;  4EMK B;  1HSQ A;  4OB3 B;  1H3Z A;  2NLU A;  4QVC A;  1Z9Q A;  3GP8 A;  2DL5 A;  5LJ3 d;  4DEX A;  5C6S A;  1UJ0 A;  3HFN A;  4JPB W;  1NJI C;  2BS4 A;  4BE0 A;  2HQH A;  1QVP A;  2LCC A;  2X9H A;  1P5E B;  4DOW A;  3RGF B;  2LZ6 B;  2G9X B;  1QWF A;  4M7D A;  3RMQ A;  2DER A;  4M77 C;  4HCB A;  5HNB B;  4OMP A;  3J80 E;  2IVX A;  1TH7 A;  4NC6 A;  4GLK A;  4WCI A;  2M0Y A;  3V8J A;  2ZAE A;  3EFR A;  2QEX Q;  5GAO n;  4CXA B;  4PJM A;  1U5S A;  3QHR B;  2LRQ A;  1SSH A;  2DIG A;  3CXC S;  2C5O B;  2C0O A;  5A2Q E;  4JJC A;  1K4U S;  1FVV B;  4M6V A;  2DF6 A;  3AHU A;  2UUE B;  3OYI A;  1CKB A;  1N8R R;  3PIO A;  3CD6 Q;  4RCB A;  4E7Z A;  2EQI A;  2RHZ A;  1S72 A;  5GJW B;  1KHI A;  1VQO T;  4PJN A;  1NJI U;  1SRM A;  1RI0 A;  1KK7 A;  1ENW A;  3CCR A;  1QVF A;  4D8K A;  4OVA A;  3B57 A;  1OIY B;  1UG1 A;  5FU6 B;  2RHI A;  3JSC A;  4C8Q F;  4M77 D;  4A4G A;  4AKI A;  4JLG A;  2PZ1 A;  4A4F A;  1N6A A;  3PTA A;  2RO0 A;  4N0A A;  2K9G A;  4A53 A;  2DXT A;  3OYK A;  3JCM P;  1PSE A;  4KRC B;  4KUL A;  2CUB A;  3CCE A;  4PFO A;  4M78 C;  4BUG A;  4M78 G;  4MZT A;  2O2O A;  1BB9 A;  4UN0 A;  2KSS A;  1VQ5 A;  4CRL B;  1ZSZ A;  1M5Q 1;  2D8J A;  4P5N A;  1K8A R;  2IVW A;  3SHW A;  5HQ0 B;  2QFZ A;  3CCQ A;  4M7A C;  2PVG B;  3JCM Q;  2AKK A;  4K11 A;  4EMH A;  4HXJ A;  2DPP B;  4OMM A;  1D3U B;  1PKD B;  4BCI B;  2K3Y A;  4F6U B;  1U1S A;  2EKH A;  4AMC A;  3J81 E;  1D3B A;  1I5L A;  2QF7 A;  4F7U B;  5FRM A;  1VQL A;  2KDS A;  3OYM A; 
#chains in the Genus database with same CATH homology
 2XD0 A;  4J7I A;  2R5M A;  5DLO A;  4A4H A;  1K8A C;  5LJ5 h;  1KHC A;  4PL6 A;  2F5K A;  4EDU A;  3CXC A;  3QUI A;  2E65 A;  2MF2 A;  4XTU A;  4Q5W A;  3A8G B;  3CD6 T;  3ME9 A;  4C8Q C;  4C5E A;  2D9T A;  3QDR B;  1N8R U;  5LJ3 g;  2LQK A;  3OYJ A;  3VYG A;  4MIM A;  2VXE A;  3S6W A;  3ASK A;  4R55 A;  3JB9 D;  2LDM A;  3E1S A;  3I56 A;  1VQ4 T;  4QQD A;  2DXB A;  2DTO A;  4FT4 A;  3JCM b;  2Y4X A;  1Y7X A;  2P4T A;  5GAN 4;  5KE3 A;  3HBL A;  2VC8 A;  3FEO A;  5GAN 8;  4BBR M;  2RH2 A;  2JTF A;  2O4X B;  4M7A D;  5EG2 A;  5I21 A;  4CRI A;  1G5V A;  2FVU A;  3TRE A;  4C8Q B;  2RM4 A;  3PMT A;  4D6W A;  3SWN C;  3E9F A;  3RKY A;  2JTM A;  1I8F A;  3QYH B;  3VUB A;  3OS1 A;  2DXC B;  1QVG S;  3JB9 I;  3CC4 A;  2RD1 A;  3HPW A;  2LC4 A;  2D6F A;  1BI0 A;  2DD4 B;  4OF1 A;  5CVI A;  3JB9 J;  4HCC A;  1YIT A;  4ZTJ A;  5GAN 6;  4HLQ A;  2BS3 A;  3V7R A;  5DLQ E;  2RA2 A;  5GAO r;  4AKH A;  1VQ5 T;  2E6N A;  5CKE A;  3L42 A;  3S3N A;  4V2S A;  4BDY A;  2EYQ A;  5J26 A;  3RUX A;  1Q81 C;  5GAO q;  5CKF A;  3VKI A;  3UPU A;  1M9S A;  5J3B A;  1JB0 E;  1BI3 A;  2DD5 A;  4M77 G;  3Q1J A;  4QSH A;  3QII A;  3LX7 A;  1YJN A;  3HHT B;  3SWN B;  4E7H A;  3QJY A;  4QVZ A;  2D0Q B;  1B34 B;  1OZ3 A;  3BG3 A;  2DTI A;  2LX9 A;  2ZZD A;  4C8Q D;  4A4K A;  3G4S A;  2HBP A;  4M7D F;  4JRQ A;  1LNX A;  4LDX A;  3DLM A;  2E12 A;  4O6J A;  5GMK j;  1FWZ A;  3CCS T;  1VQK A;  3HSB A;  3L1A A;  3V8L A;  5KH6 A;  1KC8 U;  4JRK A;  1M1F A;  2EQM A;  1P92 A;  3CCL T;  1W2B S;  4GY5 A;  2JNG A;  2MAM A;  2QXF A;  3JCM f;  3T9N A;  4EPC A;  4L5G A;  3JCM W;  2KMT A;  2XID A;  4LD9 K;  4M78 E;  4JDS A;  3OA6 A;  4ZGE B;  2DO3 A;  1I4K 1;  4M77 B;  5GAN d;  1VQN T;  5LJ3 e;  3LW5 E;  3M57 A;  2L8D A;  4C92 G;  3L2Q A;  1VQ8 T;  2HQX A;  2EJ9 A;  2P0K A;  4M75 A;  1FKM A;  3ER0 A;  3CCJ A;  3RKX A;  3I55 A;  4F7U A;  4IKF A;  2ZPH B;  2PVD B;  2K5I A;  3P8B B;  4J6Y A;  3MP6 A;  4IUV A;  1Q86 C;  5GAO m;  5GMK e;  3A8M B;  4BBS M;  1Y71 A;  1KQ2 A;  3M4Y A;  4M75 E;  4F7U E;  2ZPB B;  4ZGD B;  3GIB A;  3CBM A;  5HY6 A;  3OYC A;  3M4G A;  3S3M A;  1XNI A;  3X26 B;  2LT1 A;  2X4X A;  2M0O A;  3UWN A;  3VJP A;  5GAN j;  1Y96 B;  1M90 C;  4FU6 A;  3INZ A;  4QW2 A;  4C0D C;  2FYK A;  2QQ8 A;  2WAC A;  2P0P A;  4C92 B;  3JB9 H;  3L2Z A;  4OB1 B;  1YI2 A;  1Q81 U;  4QVD A;  3HKS A;  4XTV A;  1UGQ B;  3OYN A;  4E7I A;  1AHJ B;  4XU3 A;  2KAF A;  3HP9 A;  1KD1 U;  4RCC A;  4JS5 A;  2PU9 B;  5DY9 A;  4ELZ C;  1LOJ A;  1Q7Y U;  1M1K U;  2LCL A;  2O4X A;  4WF2 A;  3PT9 A;  3M53 A;  2KQW A;  3JRZ A;  1G3S A;  4E7J A;  4IUU A;  3PFS A;  4JUV A;  2Y90 A;  5D6X A;  2XI9 A;  3CCV T;  1WNL A;  1E7P A;  4HL4 A;  1BIA A;  4J8O A;  5M9O A;  2MI6 A;  3OW2 S;  1KQS A;  3QBY A;  3HL8 A;  5KCO A;  3WXM B;  1K73 U;  1NPR A;  4PJO F;  3BDU A;  5I2M A;  2G3R A;  4N4I A;  4KUD K;  4M7D C;  3JB9 G;  4XTZ A;  5CCA A;  2BS2 A;  2DXC A;  1O9S A;  1YJ9 A;  1QVG A;  4BI4 A;  3JCM h;  4KBM B;  4FM4 B;  5CAI A;  3CME T;  3F70 A;  4ATO A;  3G71 A;  1UGP B;  4M7A G;  4ELY C;  5GAN h;  5GAM f;  2VXF A;  5CO7 A;  1S72 T;  3QPH A;  1XQH A;  5IN1 A;  4FSX A;  5I2S A;  3FB9 A;  4XTX A;  4C0Z A;  5LJ5 e;  4JJN K;  2QTX A;  1BI1 A;  3CCR T;  2AHJ B;  3G6E T;  2L89 A;  2LTO A;  3A5Z B;  2V8I A;  2YLB A;  3OS5 A;  3OBY A;  4N4H A;  3X20 B;  4L6V 5;  4DQ2 A;  1R8O B;  4A4E A;  1YJW A;  1VUB A;  5GAO l;  4OB0 B;  3FLG A;  3OQ5 A;  2HQE A;  2EJG A;  3CC2 T;  2DZC A;  2HD0 A;  2OAU A;  4MFE A;  2LT4 A;  2R57 A;  2VUB A;  3FRN A;  3G7Z A;  3MEW A;  2RK2 A;  2RJC A;  4M7A B;  1VQM T;  3H4C A;  2QQB A;  4C0F A;  1W2B A;  3JCM J;  2K57 A;  4KT0 E;  3CC7 A;  3P8H A;  3HRT A;  4JX6 A;  3CCE T;  1HK9 A;  2QQR A;  3M9Q A;  3OSV A;  2DIQ A;  2I2L A;  1SSF A;  3OYH A;  4VUB A;  3CPF A;  4M77 A;  4HNU A;  3NFC A;  3MP1 A;  2CZ1 B;  4C8Q G;  1VQP T;  3M58 A;  2XKO C;  4J6X A;  1BKB A;  1G3W A;  1VQ9 T;  4J6W A;  1Q7Y C;  1KC8 C;  3CCU A;  4M77 E;  3VUZ A;  2JVV A;  4FL6 A;  4E7L A;  1KG1 A;  1OZ2 A;  1BI2 A;  2E5Q A;  2JN0 A;  4M7D D;  4R56 A;  2QDJ A;  1G3Y A;  3SFM A;  3CPW S;  5A0L A;  2HAX A;  3GF5 A;  4N0A C;  3MEA A;  4Z6Y A;  4IUQ A;  4NL2 A;  2PVO B;  3LYI A;  2QA4 A;  1Y96 A;  4E7K A;  3V7C A;  4BE2 A;  1WJQ A;  2E1H A;  4MZP A;  3URG A;  4PJO C;  4C92 A;  1JBM A;  2X4Y A;  3CCM T;  2KMG A;  2QQ9 A;  4EMK C;  4N4G A;  2EWN A;  2E64 A;  2DEQ A;  3OYE A;  2OTJ T;  2EAY A;  1OI1 A;  2VYT A;  5GAM h;  3OYL A;  4C92 E;  2GQV A;  3LGL A;  3GNG A;  1VQL T;  1QP2 A;  3SD4 A;  4C5G A;  1NZ9 A;  4OGE A;  1YBY A;  1KQ1 A;  4CI0 C;  3CCS A;  2CKK A;  3BDL A;  3V7S A;  1GXI E;  2RJD A;  2A7Y A;  3M55 A;  4X9C A;  5GAN 3;  4NL3 A;  3M54 A;  4XU0 A;  3KHI A;  3OW2 A;  3C94 A;  5CKH A;  2KR6 A;  4OGC A;  1KD1 C;  2B8A A;  2CZ0 B;  5GMK m;  2M1H A;  4J83 A;  1M1K C;  3QJ6 A;  2QI2 A;  2GCX A;  4J7F A;  5LJ3 f;  3I56 T;  1NE8 A;  3QXE B;  5GAO p;  5HK3 A;  3HZJ A;  1VIF A;  3JCM V;  4M78 A;  3TEE A;  3GPL A;  4MFD A;  4Z02 A;  3BFM A;  3NTH A;  1K73 C;  2M16 A;  3JCM d;  1MHN A;  3E19 A;  2RJE A;  2ZGW A;  2DXU A;  3QZ5 B;  2K3X A;  3SDZ A;  5LJ5 g;  1VQO A;  2VGM A;  1JRI A;  4DA4 A;  2YRV A;  4M78 F;  4E47 A;  1I81 A;  2XHC A;  2R58 A;  4MML A;  4BI3 A;  5KCH A;  3HO8 A;  1VQ6 A;  4PJO D;  3V8K A;  3X28 B;  2OTL T;  2WSE E;  1D3B B;  2JUF A;  3OMC A;  3MCA B;  3QKJ A;  4MDW A;  4X9D A;  4XAX B;  5CKB A;  3VU3 C;  3TW6 A;  3CC4 T;  3KXT A;  3VKG A;  1UB4 A;  2XK0 A;  4M7A A;  4M75 F;  1YIT T;  4F7U F;  4BE1 A;  4RG8 A;  4ZTF A;  2C06 A;  2G77 A;  4JX4 A;  4M7A E;  3CMA T;  3LLR A;  1K9M C;  2XU8 A;  2WSC E;  3CBP A;  2EQK A;  3QWL A;  2LQ8 A;  4AKG A;  3GNF B;  4NOY A;  4PLL A;  1YJN T;  2MWO A;  2RI5 A;  5FU6 C;  3DL1 A;  2H3J A;  3BW1 A;  3G4S T;  4X34 A;  3BY7 A;  5GAN 2;  4HNV A;  3OS0 A;  3CPW A;  1M4Z A;  1O75 A;  3HRU A;  3VYG B;  4XTW A;  1VQK T;  3JCM e;  3CME A;  1JJ2 S;  3EFS A;  3MP8 A;  3ZFJ A;  4J5Y A;  3PGG A;  4BY6 C;  4B9W A;  5HK0 A;  4HKE A;  4JRI A;  4ELJ A;  1WGS A;  4JLI A;  5GAN e;  5A0D A;  4HNT A;  3DKM A;  3MHX A;  1U8R A;  4C0D B;  4C8Q A;  2YHT A;  2BIV A;  3OBW A;  3HB9 A;  5LJ3 h;  2DKG A;  1Q82 U;  1M1G A;  2EQU A;  3UT1 A;  3L2W A;  2WSF E;  5GMK l;  5LJ5 f;  2XDD A;  2QEX A;  4M7D G;  3CCJ T;  4OMF B;  4C8Q E;  1EIF A;  3LWH A;  4JX5 A;  1WPY A;  2CS7 A;  2DJZ A;  2DD4 A;  3A8O B;  2QQS A;  4MZM A;  3GOX A;  2PUO B;  1XOV A;  2XG8 D;  2XDP A;  4TVR A;  5CKD A;  2X4J A;  3CC2 A;  1M8V A;  5GAM d;  2DAQ A;  2QDY B;  5DM7 R;  1BYM A;  3PMI A;  1X01 A;  1ZQ1 A;  2P0Q A;  3MEV A;  4IUT A;  4UC4 A;  5D6W A;  3A8L B;  3QYG B;  4RKU E;  3L2V A;  2IG0 A;  4ME7 A;  4BI8 B;  2X4W A;  3SWN A;  3JCM c;  4B9X A;  3CD6 A;  5AYF A;  2V8J A;  1B34 A;  4M7D B;  3FC3 A;  2E6Z A;  1U1T A;  1VQP A;  3MO8 A;  2FHD A;  2DD5 B;  5A0G A;  3A8H B;  3QHS A;  4M75 C;  1K9M U;  3S3O A;  5GAM j;  2ZZD B;  5FU7 C;  3RIR A;  3QYE A;  3ZBD A;  5GAN 5;  2O01 E;  1VQ4 A;  3TW7 A;  1WQW A;  2CZ7 B;  2ZPE B;  2Y4Y A;  3OYA A;  3NTI A;  3TCJ A;  2E10 A;  4YTL A;  2DZ9 A;  4C0G A;  1ZHI A;  2RJF A;  3LWI A;  4LDV A;  2ZPG B;  3LH0 A;  3QO3 A;  3PNW C;  4IUP A;  5J39 A;  3RES A;  3OS2 A;  2HNI A;  3CCM A;  3HFO A;  2RHY A;  1H64 1;  1HXD A;  2K2V A;  2RK1 A;  2EJF A;  4M77 F;  1YJ9 T;  4Y91 A;  2K5L A;  5GMK i;  3L2R A;  3G71 T;  2WJ9 A;  1WQ7 A;  2RHU A;  3CCQ T;  2BKD N;  2PUK B;  1YHQ T;  2RI2 A;  1YIJ T;  2CYZ B;  3BG9 A;  4XQ3 A;  2BUD A;  1X75 C;  4C5I A;  1ZBX A;  4PJO G;  2KVQ G;  5EJC A;  2GF7 A;  1QLB A;  3DB4 A;  4FT2 A;  4M78 D;  1QVF S;  2VGN A;  4XU1 A;  2A3L A;  3CBO A;  2MWP A;  5D6Y A;  4MDX A;  2DTH A;  1YJW T;  4C92 F;  3OYF A;  3E9G A;  2ZCF B;  1JJ2 A;  3CCU T;  4HT9 A;  1FX7 A;  1VQ7 T;  5CIU A;  4M75 D;  1WJS A;  3X24 B;  2LNV A;  1UEB A;  3JCM g;  1PSF A;  3CC7 T;  1XTD A;  2FB7 A;  3VYH B;  5CQX A;  3RKW A;  5FRO A;  4IUR A;  4ZN3 A;  3LGF A;  3CCL A;  5GAN g;  4XTY A;  2DK3 A;  2MMP A;  3JCM X;  4PJO B;  3C12 A;  5CK9 A;  5IT9 E;  4EMK B;  3P8D A;  2ZPF B;  4OB3 B;  3EAE A;  4XU2 A;  1VQ8 A;  1VQN A;  1H3Z A;  2NLU A;  4QVC A;  1UGR B;  1BIB A;  2OTL A;  3GP8 A;  1VQ7 A;  5HKC A;  3ZEH A;  5LJ3 d;  2EKO A;  4NS5 A;  5C6S A;  3HFN A;  1NJI C;  1QP3 A;  2BS4 A;  1Q82 C;  2F69 A;  3C4S A;  4BE0 A;  4II1 A;  1IRE B;  2EFI A;  2GFA A;  1QVP A;  3NTK A;  4PKC C;  4BD3 A;  1N9S A;  2LCC A;  2QA4 T;  3O8V A;  4DOW A;  2RHX A;  4C5H A;  4FIB A;  2ZPI B;  2DVE A;  4QQG A;  4M7D A;  3CMA A;  3RMQ A;  2L3R A;  2F5T X;  1K8A U;  4M77 C;  3UDC A;  4HCB A;  4LD6 A;  3WVD B;  1X6O A;  3GLX A;  5KE2 A;  2CZ6 B;  5LJ3 j;  3J80 E;  4PNO A;  3JAM E;  1Y07 A;  4JS4 A;  4M7D E;  2EIF A;  1TH7 A;  4NC6 A;  2K4Y A;  2LVM A;  3QG1 A;  4GLK A;  3MET A;  1N9R A;  3PIP A;  3JB9 F;  3R6O A;  4RG2 A;  3QSU A;  3V8J A;  3EFR A;  3OY9 A;  3DLL A;  5GAO n;  3N5B B;  1LJO A;  4M7A F;  1RL2 A;  3M5A A;  4O5V A;  3DB3 A;  4HA8 A;  2LRQ A;  4Y28 E;  4RMO A;  2DIG A;  3CCV A;  3OYY A;  3CXC S;  3CEY A;  3X25 B;  5A2Q E;  1G3T A;  2RB6 A;  5GAN f;  3OYD A;  2E70 A;  4C92 C;  3FIF A;  2XDB A;  4MMK A;  4M6V A;  3RMS A;  3WVE B;  3KUF A;  4LDU A;  2EQJ A;  3AHU A;  3H6Z A;  5GAM g;  1QW1 A;  1WJR A;  2YLC A;  2K5F A;  3OYI A;  4BB7 A;  2X35 A;  3H8Z A;  3SB2 A;  4RCB A;  3BG5 A;  3QYB A;  2DXB B;  3PIO A;  3OSS C;  5L8R E;  2RHZ A;  1OYX A;  5LL6 S;  1S72 A;  5CQY A;  1KHI A;  1VQO T;  3J7A F;  1NJI U;  4KUI A;  4LDY A;  1N27 A;  1RI0 A;  2VV5 A;  3L2U A;  1QVF A;  2CGH A;  3CCR A;  3G6E A;  3MEU A;  4AI6 A;  4LOC A;  1VQ6 T;  5LJ5 d;  1W4S A;  4OVA A;  4ZN1 A;  3I55 T;  5FU6 B;  3M56 A;  2RHI A;  3JSC A;  2RI3 A;  4C8Q F;  5GMK h;  4M77 D;  3C95 A;  4A4G A;  4AKI A;  4JLG A;  4A4F A;  1N6A A;  3OYB A;  4HT8 A;  3PTA A;  2RO0 A;  3KBG A;  4N0A A;  4A53 A;  4BY6 B;  2R5A A;  2DXT A;  2V8K A;  2JOY A;  3OYK A;  1IZ6 A;  2OTJ A;  2QQA A;  3JCM P;  1VQM A;  1PSE A;  3OMG A;  3OYG A;  3OB9 A;  4KUL A;  3CCE A;  4PJO A;  4M78 C;  4BUG A;  5GAN 7;  4M78 G;  4MZT A;  1N8R C;  5FRN A;  4EMK A;  5LJ5 j;  2KY9 A;  3M59 A;  2XIC A;  2KSS A;  2PQW A;  1YI2 T;  4LDW A;  3TU4 K;  4PJO E;  1VQ5 A;  4EMG A;  1VQ9 A;  1M5Q 1;  3VV0 A;  3FJP A;  4DOV A;  3RER A;  4A54 A;  4M75 G;  1UGS B;  1DJ7 B;  4P5N A;  2L5Q A;  2IVW A;  3FDR A;  4C92 D;  4F7U G;  1KQS S;  2FL7 A;  1VIE A;  4OB2 B;  5FLX E;  4BAC A;  4OP0 A;  3VKH A;  2QFZ A;  3CCQ A;  3HRS A;  4BDZ A;  4HCZ A;  4M7A C;  2PVG B;  5IAY A;  1V29 B;  3JCM Q;  1YIJ A;  1YHQ A;  1Q86 U;  3QZ9 B;  4M78 B;  4EMH A;  2DPP B;  5CR2 A;  4QQ6 A;  1FXX A;  2K3Y A;  2KK4 A;  4ZGJ B;  2JZ2 A;  1U1S A;  4XK8 E;  1NPP A;  1MGQ A;  4L59 A;  4PLI A;  3J81 E;  1D3B A;  1YCY A;  2E41 A;  2QEX T;  4JRP A;  5C0M A;  1I5L A;  2QF7 A;  4M75 B;  5GAM e;  4F7U B;  1M90 U;  5FRM A;  5FU7 B;  2M9U A;  2GFU A;  1VQL A;  2KDS A;  3OYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...