2CZ7B

Fe-type nhase photo-activated for 75min at 105k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Active Center Structures of Photo-reactive Nitrile Hydratase during its Photo-activation Process
rcsb
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz7B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz7B02
5L8RE 2PU9B 2ZZDB 1UGSB 3LW5E 4RKUE 2CZ1B 3QZ5B 3VYHB 3X26B 3A8LB 1QP2A 1QP3A 2ZPGB 1AHJB 2QDYB 1UGRB 2DD4A 3QZ9B 3WVDB 1PSFA 3X25B 2DPPB 3HHTB 2ZCFB 3A8HB 3X24B 3A8MB 2CZ6B 3A8OB 3A8GB 2ZPEB 2WSCE 2DD4B 4OB3B 1IREB 2ZPFB 3VYGA 3QYGB 4Y28E 4FM4B 2CYZB 3QYHB 2CZ0B 2DXCA 2ZPHB 2WSFE 4OB0B 1GXIE 1V29B 2ZPBB 2DD5A 1UGQB 4ZGEB 4ZGDB 2PVOB 4XK8E 3X20B 2PVDB 2O01E 3VYGB 2AHJB 3WVEB 1DJ7B 2D0QB 2DXCB 2ZPIB 2CZ7B 2WSEE 2PUOB 2DD5B 1JB0E 1PSEA 4KT0E 2DXBA 4L6V5 1UGPB 4OB1B 2PUKB 4ZGJB 3QXEB 2PVGB 2ZZDA 3X28B 2DXBB 4OB2B
chains in the Genus database with same CATH superfamily
3OS2A 4F70B 2CH4A 4GY5A 1H4LD 3CCMQ 1YN8A 4Y91A 2EW3A 2LVMA 2E5QA 3SHWA 2CDTA 2WJ9A 1F1BB 4KGXB 5DY9A 1I81A 3AHUA 3CC2A 3SDZA 3OS5A 2RQRA 4IIMA 1RAFB 1MMNA 2UUEB 5KH6A 4QQGA 1J3TA 2Y90A 2V1RA 2DLPA 2DPPB 3GOXA 3H6ZA 1SHGA 4A4FA 2H8HA 3X24B 2X4JA 5J26A 1WDXA 2K5IA 4FIBA 2ZPEB 2DD4B 4FT4A 1PKSA 1JKWA 2J7IA 3EGDB 4Z02A 3M53A 5IHKA 1VQPT 2QDLA 2M51A 4AT1B 3G71A 2KGTA 4MZMA 2DL4A 1YFNA 2DTIA 2WPAB 2WSFE 4X1VA 2R58A 3MY1B 4PLIA 2IW9B 4M7AD 2GTJA 4XTZA 4XTXA 1M1GA 2LT4A 1NPPA 2LJ1A 4C8QD 2E6ZA 4PLLA 5GAOm 2KY9A 3RKWA 4J9BA 2EIFA 1VQMA 4EOLB 3E1SA 3ZL7C 3VUBA 1VQ9T 1W4SA 3NTIA 2XK0A 4RUGA 1Q86R 1M4ZA 1VQ6Q 4JRIA 2LQ8A 4LDYA 3QKJA 3V8JA 2EYYA 3S3OA 1UUEA 2XMFA 1PRMC 1I5OB 2B8AA 2Y4YA 4EMGA 2HZYA 4XU3A 2LP5A 5HBJB 5HBEB 2HQXA 2DYBA 4C8QF 3C95A 4JX5A 3SWNA 4EOJB 1M8VA 2JS2A 2L89A 3E9GA 1M90U 3M54A 2RJEA 3QJ6A 2L2PA 1WIEA 2K79A 3TW7A 5EJCA 2RQVA 3EG1A 2RD1A 4JS4A 4RTTA 4PJOB 2ZZDB 1HD3A 3E19A 4JJDA 1VQNQ 4F7UG 1G8XA 3CXCS 3JB9G 4M77B 2DL3A 1VYUA 3T9NA 4EOSB 4Y92A 2XI9A 3H0IA 4BXXX 4RMOA 2O9VA 1ZSZB 1H25B 4F17A 4C92G 3SWNC 1G3NC 2RB6A 3M0QA 3I9QA 5CKEA 3HHTB 3BHUB 4D8DA 1ZA2B 3UDCA 2ATCB 2FZKB 3PTAA 1Q81R 1E9HB 1K1ZA 2RH2A 3EFOB 4UN0A 3QYGB 5CQYA 2RHUA 4A4KA 1QW1A 5ECAA 5HK3A 4NOYA 1K73U 1CKBA 4BCQB 1Y07A 4FSXA 1GBQA 4FYWB 1VQ7T 3META 4ELLA 2HBPA 4LDWA 4MZTA 3F5XB 3I56T 1VQPQ 1QCFA 3EG9B 2DETA 1X2QA 3HRSA 2DXCB 1PCXA 3INZA 2F69A 2QYZA 2VV5A 2YUPA 3VUZA 2C0OA 3L2QA 3SB2A 2WACA 4BCND 3REBB 3I55T 1KQSA 5ICPB 1WYXA 2E6NA 3I5RA 3G1JA 4OMQA 1TU0B 4JUVA 2A7YA 2KR3A 2KR6A 4JS5A 1NYGA 4EOMB 1M1KR 3LH5A 1QVGA 3CMET 1BCMA 4OGRB 3R6NA 4M7DD 2KEAA 1HK9A 1QWFA 5GJWB 5I2SA 4JX4A 4QVDA 3MEWA 5IDNB 2OAUA 4RG8A 2DXUA 4BDZA 2CT4A 4CC4B 1TFBA 2W9FA 4HLQA 3KXTA 4KH0B 4MMKA 4BCGB 3QJYA 1G2BA 2AZSA 3G6EA 2CZ1B 3X26B 1NM7A 1BI0A 3P8HA 4IUQA 4N4IA 2RA2A 3GLXA 3GIBA 1AHJB 3LYIA 4V2SA 1UGVA 2RPNA 1GUXA 2F5KA 3J80E 3ZFJA 4J9GA 3RKYA 2YLCA 1JSUB 4R0KA 2UZEB 2PJQA 2RM4A 3FRNA 3VS7A 4G6LB 3LGLA 3OBYA 4FCYA 2PNIA 1MNDA 1RL2A 3CEYA 3LH0A 1VQ6A 1E6HA 1EIFA 1LNXA 2FO0A 2VASA 3JCMJ 4M7AG 2BPMB 3TNIB 1RACB 5HCKA 1WHGA 1H26B 4M75F 2M0OA 4J9IA 4JX6A 2VKNA 4C8QG 2GTOA 2KROA 1WJRA 2XHCA 3CCEA 1E6GA 5I22A 2FPFA 1Q82R 8AT1B 2QG9B 4R55A 3TU4K 3MJXA 1NLPC 4OMLA 4C5IA 2X4WA 2AT1B 2C6TB 2ZPHB 2O4XA 4F7UB 1BI3A 3TQ7P 2ZPBB 5IT9E 1JJ2A 4E7LA 5CQXA 4IMYB 3JRZA 3X20B 3K7AM 4FW1A 4KRCB 5GAN5 3S6WA 1M3BA 5LJ5d 4E2FB 1VQNA 2HSPA 4C92B 4DEYA 1G3YA 1H1PB 1N6AA 1NLOC 2LQWA 3CC2T 4F7SB 3G33B 1VQ7Q 2E1HA 2XD0A 2L8DA 4TVRA 2DFUA 5C0MA 3I56Q 3ZBDA 3RKXA 3M4YA 3CCRT 1M8MA 4RTUA 5FU7C 4EMHA 1SSFA 1NZ9A 1OV3A 2KRMA 3V8KA 1XTDA 3LWHA 1X6OA 2DEQA 5D7UA 1VQ5Q 3I55Q 2QEXT 4K11A 1WQWA 3MEVA 4XTWA 4L59A 2BZXA 5CIUA 1WHKA 3S3MA 3RR6A 2KAFA 1JSTB 2CT3A 2CS7A 1OEBA 1XO2A 3CMEQ 5GAMd 3BFMA 1F5QB 1BI2A 1VQOQ 4X34A 2EYWA 1YJNT 1M2VB 1BBZA 3A8LB 4E7JA 4B9WA 1HYOA 3PMTA 4CFUD 2BS2A 4ELJA 3OMCA 1QVGP 1Q7YC 1ZUKA 3TREA 1FXXA 3EIDB 5IHNA 2QA4Q 4IKFA 4M7AE 4ROEA 1K8AU 3KHIA 3IQLA 2IVXA 2QI2A 3CPWP 9ATCB 4BE1A 3OYDA 4WTOB 3QUIA 2NYSA 3A98A 4BY6C 1VIFA 3A8OB 1HXDA 2QGFB 4MDXA 3PGGA 4BE0A 2K6DA 3GF5A 2X4YA 2X3WD 4JRPA 1JBMA 5FROA 1RAAB 1UNLD 2AK5A 5KE3A 3RGFB 1WGSA 3VS6A 2LNHB 3HKSA 3BLHB 2V8IA 2PMIB 4KRDB 1UB4A 3WVEB 2LNVA 4M7DG 1MNEA 4VUBA 2DYIA 3VS4A 1LVKA 4P5NA 2C5OB 2LCSA 1Z9QA 3MEAA 2WMBB 5LL6S 1AEYA 3UWNA 3HRUA 4FSSA 1YCSB 4ZNXA 2HEQA 2ZAEA 1UGPB 2RI3A 2JVVA 2J6KA 4C8QB 2DK3A 3GNFB 4A4HA 3TVTA 3UPUA 3AT1B 4YTLA 1H24B 2PVGB 1WXTA 4IUVA 4LDXA 1GL5A 2QQRA 1XNIA 3CCRQ 1GFCA 2JN0A 1KK7A 2A28A 2R7GA 2GNCA 3BG3A 1B34A 2MMPA 1KXUA 4BBRM 2EJGA 3OQ5A 4PFOA 2D1XA 2I0NA 2K3BA 2Z0WA 4EOKB 4RKUE 3QZ5B 3TNHB 2QEXQ 2JGZB 1XOVA 3NGPA 1PKTA 1TOVA 4QW2A 4LE9A 1KD1C 2ESWA 2UZBB 2EQJA 3EFRA 3VRYA 3PVQA 4O5VA 2X35A 2OX7A 2LRQA 2YT6A 3EGXB 1YJ9A 1AD5A 3OYFA 3MY5B 4M78C 1PD1A 1YJNQ 4IUUA 3LQ5B 1NEBA 1SEMA 4FX3B 1VQ7A 3X25B 1TUCA 2W9ZA 1IO6A 4HT9A 1SHFA 2FYKA 3QIIA 4M78B 4E7KA 2KNBB 4HCBA 5EC7A 4EIKA 4JJCA 3RMSA 1ZBJA 5BNJB 4J9CA 4F6UB 4J9FA 1ZBXA 1UEBA 3I35A 3QYHB 1QMZB 4ZN1A 5I2MA 1VQ5A 1QLBA 3PMIA 4FYXB 1RAGB 4EORB 1WJQA 4RTXA 2RF0A 5LJ3d 1CSKA 3EG0A 2H3EB 2X51A 4E6RA 4ZGDB 2PVOB 4M7DE 3CMEA 1KHIA 1VQOA 4MDWA 5KCHA 2K9GA 1X27A 1P92A 3G6ET 2KQWA 3OYKA 2J05A 4JZ4A 1K9MU 2NUZA 1GFDA 4EOQB 2LZ6B 4KT0E 2FPDA 2V26A 4OGCA 3RUXA 2EVRA 2DTHA 1G3WA 4Z8AA 2QA4A 1SRLA 3MPUB 5D6XA 3GTMS 3BHTB 4HT8A 4ZGJB 1W2BA 4N0AA 2LX9A 2CREA 2JTEA 2AIRB 4CFMB 1GCPA 1OX8A 2E64A 4BCNB 5I11A 2J6OA 3CCJA 1AT1B 3NHNA 4A63B 2QQSA 3CCET 1WXBA 1X75C 2JJ9A 3L2RA 1FMVA 3WXMB 4HVUA 5DLQE 1GRIA 4OMOA 1C6VX 2YRVA 1NJIU 1KQ2A 4AG2C 3GPLA 2HCKA 2BE9B 2X1NB 2QQ9A 1D3BB 3H0HA 4J7FA 3REAB 2M16A 2ZGWA 4J6YA 4F04B 4BACA 4IURA 5IF1B 2X4XA 1AZEA 1FX7A 2DILA 1B07A 3CC4A 2FRYA 2P84A 2W10A 4N0AC 1IGQA 1RI0A 3CMAT 2DD4A 4BCMD 3VJPA 2KDSA 5CK9A 1SPKA 4FW2A 8ATCB 3CC7Q 4M75B 2F2VA 1YHQA 2RQTA 3DDPB 2KYMA 2JW4A 3M0UA 2BS4A 3RDVA 2LCLA 2EUFA 1KC8C 4XTVA 1ABQA 3GNGA 3OW2A 2DBMA 5CEIB 2IW8B 1JXOA 4B6MA 2CP3A 2K4YA 1KHCA 2PK2A 3MP6A 5GJVB 2P0PA 3CCRA 5GAOr 4II5B 3E2UA 3J81E 3HPWA 4EC9B 3CPFA 1YCYA 4C0DC 2HQHA 3JCMQ 1S72Q 2CCIB 4HCCA 4ZTFA 3LLRA 2QK0A 2D0QB 5IHYA 4GLKA 2QEXA 4IUPA 1PRLC 4C0DB 5IAYA 3U23A 5A0LA 5GAN2 4B9XA 4YC3B 2DD5B 2DTOA 3JCMX 3PO3S 1YJNA 2RNAA 4LN2A 3G6EQ 2JOYA 3DL1A 2FEIA 1RAEB 3M5AA 3KBGA 2PUKB 3URGA 2DRMA 2HBWA 4BCHB 1TH7A 3M0RA 3EG2A 2FPEA 1UFFA 4PJOA 4RODA 2MAMA 2ZZDA 2RN8A 3CCST 1VA7A 2G77A 5CO7A 2A36A 4PL6A 1QVFP 4M77A 2YHTA 1PWTA 2F2XA 4XAXB 5GANg 4X9DA 5GANe 1ZSZA 1C9BA 3SD4A 5KE2A 2CP5A 2ABLA 4QVZA 4XU1A 3FC3A 4M7AF 2WXVB 2KT1A 2UZDB 1QP2A 4II1A 4PJLA 4DBQA 3CCEQ 2HL5C 2CP2A 3GP8A 3GBQA 2DKGA 1VQKQ 4JJBA 1VOLA 1W2BP 1UE9A 3EFOA 4PJOC 4DOWA 2VC8A 3DDQB 1N9SA 1PSFA 5IXFA 5GMKe 5DLOA 4EOOB 4AKGA 4GLMA 4M77C 4CFUB 1UDLA 2ZCFB 1M3CA 4E7IA 1NPRA 3CMAQ 1ZSZC 5CAIA 3V8LA 2VUBA 4KRTA 2KMGA 1EFNA 2NLUA 4XTUA 4EMKB 3EG9A 4BI8B 2QF7A 2DXCA 2OI3A 3NFCA 3EG3A 4CFVB 1PM3A 5DQVA 2H3JA 5I5ZB 2VB6A 2SEMA 2WFYB 3HTRA 2AHJB 2CH4W 3OYGA 1OZ2A 5GMKh 3HBLA 2WSEE 3TEEA 4F14A 5KYNA 5FRNA 2DNUA 4KH1B 1YP5A 3OSSC 3CXCA 3DTOA 1PSEA 4AI6A 4M4ZA 3E9FA 1YJ9T 2EJ9A 3LGFA 3QWLA 3CC7A 3CCUT 4OB1B 5GAN7 2PZ1A 3QWXX 1M90C 1D0YA 2DX1A 1M30A 5GAN8 1Q7YR 1AISB 1QVGS 1M2OA 2L3PA 1BU2A 1I5LA 3QHSA 1VQ5T 4CRLB 2YWWA 3JSCA 4BCKB 1ZUUA 2CCHB 3CPWS 3NPFA 3PE0A 3CCSQ 2XDPA 3G7ZA 3JAME 1Y57A 1VQOT 1QP3A 1OULA 4ELYC 4A4GA 3JCMd 1P5EB 2G3RA 2E41A 1S72A 2DBKA 1Q86U 2QDYB 5IH2A 2MK5A 3CCQT 1G3SA 4CXAB 2I40B 5GANj 4J7IA 4OR5B 4BI4A 1TXQA 4IUTA 2O88A 2QA4T 5HY6A 1K76A 1K73C 4EOIB 4C0ZA 3TW6A 4OB3B 1H28B 1TSFA 2EQIA 4QT7A 2K3YA 2QTXA 4M7DF 2E4HA 3V7RA 3BHVB 1OOTA 2GCXA 3CBOA 3CCJT 2DL8A 2A37A 5GMKj 2K7AA 4HL4A 1V29B 2WEVB 2OTJA 1D1CA 1UGQB 2WMAB 2GFAA 4PKCC 2IPOB 1H27B 3RERA 2CZ7B 2PUOB 1D09B 1RAHB 1T0JA 3CC4T 1O75A 4QSHA 1VQKA 1FMKA 1UNHD 2C5NB 1T0HA 2YUNA 3PVLA 5GAOq 2JUFA 4Q5WA 1Q81U 2D9TA 2G6FX 3ER0A 1YHQT 4QQDA 4C92C 1KD1R 1IHWA 3VS5A 1SF9A 3RESA 2WIPB 2VXFA 2P4RA 2DM1A 2DVJA 2KVQG 2LJ0A 3OYIA 5IN1A 4A4EA 1R0BG 3MHXA 1M2VA 2EKOA 3M59A 5M9OA 3CMAA 1YJ9Q 2IVWA 3NDQA 1ABOA 3CCUQ 3A1PA 1O9KA 3CCVA 2E3IA 4JRKA 2HDAA 5GAN4 5GAN6 4BDYA 2DAQA 2KYBA 2COWA 4OMPA 3L2UA 4CRIA 2ED1A 2J6FA 3H4CA 1HSQA 3DB3A 3CD6Q 4WCIA 1WPYA 4F6SB 2DA9A 5IDPB 3MO8A 3B57A 5ACBA 5GAOn 1A0NB 2JM9A 2PQWA 3HFNA 5LMKB 1M1KU 2FB7A 4DBRA 5EFQB 2OJ2A 2P0KA 4OMFB 4M6VA 1VIEA 1ZQ1A 4HCKA 3RBBB 1KQSP 4BCMB 1UJ0A 5GAMf 3CCQQ 4DA4A 1K0XA 1OX9A 1EX4A 3BLQB 5J39A 1H8KA 2CP7A 1H92A 1RLPC 4BY7X 1OQKA 2LX7A 4OMMA 4OB0B 4MFEA 1MGQA 2E70A 6AT1B 1MMAA 2LCCA 4QQ6A 1ARKA 3V7CA 4C0GA 2RQUA 4MMLA 1UJYA 3CCSA 4PJOD 3CCJQ 5KYWB 3H8ZA 4EDUA 1BCOA 4OP0A 1ZP2A 1OL1B 2IG0A 2DF6A 2G9XB 3M56A 4M77D 1URCB 5LJ5g 4ORZA 5LJ5e 2QFZA 2DJQA 1I1JA 3S3NA 1OI1A 4PJNA 3VKHA 2BIVA 4GBQA 1TD6A 2QGGA 2ROLA 4BCOB 5HBHB 1WHHA 2LJ3A 3OYMA 3O0GD 1Q82U 5D6YA 3CC4Q 1WLPB 2KE9A 2YUOA 1Y71A 4BCFB 2COZA 1LPLA 4C8QC 1OI9B 1ZUYA 3FEOA 1N8RR 4LD6A 1YHQQ 5L2WB 4M7AB 3OYAA 4F16A 3OB9A 5KYYA 2NUTB 1Y0MA 1Z9ZA 2CP0A 2JTFA 3M58A 4NL2A 1KC8R 1VQ8T 3EGXA 5KYUB 1YIJA 1LJOA 2JNGA 4OMNA 4BCQD 4D8KA 3PT9A 2KXCA 1ACMB 2FVUA 4CFNB 2QGSA 5FU6C 1K8AC 1IXDA 5GAMg 1D3UB 1JJ2P 4M78A 3SFMA 3NMZC 5GAMe 4OVAA 1U1TA 1H1SB 5CKFA 2FG0A 4LD9K 5FU6B 3UA6A 1QCOA 3WVDB 2HSEB 2PK9B 4LUDA 4E47A 3M55A 1TG0A 4M78E 3A8MB 3RIRA 3CC7T 3QYBA 4HVVA 2QQ8A 4BCPB 1B7TA 4KGVB 4CFXB 3HL8A 2PTKA 2RJFA 5A2QE 2D8HA 4LUEA 1OKVB 2KXDA 1IREB 2AZVA 3OBWA 1VUBA 3H0FA 2RO0A 5DM7R 2C5VB 2CZ0B 2KSSA 3NTKA 1WZOA 5EG2A 4HVWA 3CCUA 3HRTA 4ZGEB 4R56A 3VS3A 4XK8E 1Q95G 5GAMh 2EPDA 3VYGB 1KSWA 2MWOA 1DJ7B 1K9AA 5CR2A 1WJSA 4BUGA 3CD6A 2L3QA 4RG2A 1S72T 1QVFS 2L3SA 4HNUA 3UATA 5L23A 2D6FA 2XDBA 3OA6A 3ASKA 1N4MA 2C0TA 3CQTA 1W98B 4Z89A 3CCLT 5LJ3f 3N5BB 5KYXA 1OPKA 1KJWA 1MMDA 1D3BA 4A53A 5FW9A 3VRZA 2EKHA 3CCQA 1B34B 5AYFA 2XICA 1W2BS 5LJ5j 1M27C 4JLIA 1H1QB 1QLYA 4J9HA 1W6XA 5J3BA 1HJDA 5FGKB 1UNGD 2OTJT 2A3LA 2W96A 4M75A 4DBFA 4XU2A 4JZ3A 1T3SA 1OL2B 5FWBA 1XJWB 2ZPGB 3R6OA 2HNIA 3EH2A 2O31A 2CUBA 1O9SA 1KC8U 3EHQA 1VQ8Q 3JCMc 1E7OA 1VQKT 5FRMA 3JB9I 2VVKA 2XIDA 5A0DA 1GY3B 1TUGB 2RI5A 5CCAA 4BI3A 4RTZA 2HL3A 4M7DB 3A8GB 4PJOG 2WSCE 2FHDA 3DOGB 4BD3A 3HB9A 5GAMj 1ENWA 3TCJA 4M75C 3DLMA 3BE3A 4M77G 1JXMA 1Y96B 3L2WA 2K3XA 2HD0A 2LW4A 1TTHB 3EGDA 1QKXA 3MKDA 5GANf 4HA8A 2EQUA 3EFSA 2LC4A 5CVIA 3VS0A 1N8RC 2DD5A 1M90R 3CCVT 3EOCB 2MPXC 4XQ3A 1JOWA 4PFPA 2CUDA 4A54A 2O01E 2RK2A 2R5AA 1GCQC 1D0XA 5LJ3g 5LJ3e 2FRWA 2QQAA 4YOZA 3A5ZB 5HK0A 3L1AA 1SKUB 2VWFA 2OAWA 1NYFA 1R8OB 1JB0E 2YRDA 1M5Q1 2XDDA 2OTLA 2DERA 4BB7A 5A0GA 1VINA 4JPBW 1PHTA 3QDFA 2DEUA 2QTVA 1IHVA 1SRMA 1QCNA 3Q1JA 4RCBA 2DIGA 4WF2A 4JJNK 3BG9A 2JT4A 1NJIC 2K2VA 1NEGA 2IN3A 2CSIA 5GMKl 2DXBB 2MIOA 2YLBA 4AFSC 2PHGA 1IB8A 3OMGA 1ZHIA 2EJFA 4F7NB 5L8RE 3OYJA 5LJ3h 3CCLQ 1BK2A 1K73R 2B86A 4DEXA 3QBYA 3OS0A 2NUPB 1VQ4T 4YOSA 2YUQA 3POMA 1BIAA 4CC2A 3L2ZA 3FIFA 5FWCA 1E7PA 1PC0A 4I3ZB 4D6WA 1ZA1B 1TS9A 1YWPA 2DVEA 4EC8B 4PK4A 2YDLA 1W70A 2GGRA 2L5QA 5FLXE 4E7HA 3C0CA 2OTJQ 3LWIA 4N4GA 2K5FA 2Y4XA 1FMWA 2W99A 3FJPA 4EMKA 4PJOE 1YITT 1QQJA 1OU9A 2R57A 2XU8A 4Z88A 1KQ1A 1NG2A 1WI7A 4M77E 1I0CA 4FT2A 2QXFA 1YJWT 3O8VA 2GF7A 4FL6A 1AWOA 2QASA 4J83A 3BY7A 4CFWB 2YXYA 5AT1B 1ZLMA 2DE0X 1B3QA 4HKEA 4IIOA 2L3RA 3UA7A 1X01A 1YIJT 1NBEB 1OYXA 3V7SA 4EMKC 4JRQA 1OZ3A 2ZPIB 2EYXA 3MP8A 3QPHA 1RI9A 1UHFA 1X43A 1M1FA 5GANh 2KRNA 3RMQA 5CYIB 1RAIB 4KULA 1KG1A 3G4ST 3CCVQ 3OYCA 1VQ8A 2YSQA 3OY9A 1KFZA 4E7ZA 2P4TA 3OYHA 1I07A 2RJCA 1WQ7A 2CP6A 1C0MA 2E10A 3MEUA 5LJ3j 3QXEB 1QKWA 1WNLA 1X69A 2LDMA 4M78D 3DLLA 2BS3A 4HNVA 2K5LA 1JQQA 1YI2T 2NWMA 2BZYA 2A08A 4AFZC 2HMAA 5DQWA 1PNJA 2VGMA 3C12A 1U8RA 2MI6A 1PD0A 4C5HA 4Z6YA 4MZPA 2FZGB 1T3LA 2ENMA 3OW2P 3F70A 4C0FA 1WX6A 4AKHA 2M1HA 3EGUA 4KGZB 3SWNB 1BYMA 2C4GB 3LW5E 3VYHB 3MI9B 1H3HA 1MV0B 2RHYA 1LOJA 3OYEA 1KQSS 4J6WA 1VQLA 2FL7A 4M78F 4HXJA 3M0PA 3CD6T 1K0SA 1R0CB 2VGNA 4JDSA 2KI7A 1VQ4Q 2BZ8A 2I2LA 1TWBA 1FKMA 4LDUA 4ME7A 1WXUA 1G3TA 2DIQA 2KBTA 1R77A 3CCMA 3QO3A 2K57A 2CZ6B 1D1BA 2E65A 4J9EA 3PIPA 3HO8A 3BG5A 1OIYB 4NL3A 4C5EA 4Y28E 1BI1A 4FM4B 2LT1A 3O5ZA 2JMAA 2EWNA 1V1CA 1YITQ 4OGEA 4PJMA 2HKQB 2DL5A 3JCMf 1IGUA 2BTTA 1G5VA 1U1SA 2DRKA 1OPLA 1RABB 2VYTA 4F7JB 3LX7A 3CCLA 2JS0A 3CBMA 1YJWQ 3JV3A 1RLQC 4XU0A 1WFWA 1VQ9Q 4F7UA 1WHLA 4FYVB 2HKNA 3CPWA 1FVVB 2A0FB 4CC3A 5GAOp 2UZLB 1OU8A 2M9UA 4C92A 1JRIA 5GMKm 4F7UE 4RTYA 1YIJQ 3QHRB 4O6JA 4KUIA 1ZX6A 4N4HA 5I21A 2RQWA 4HNTA 4M75D 3M0TA 1K8AR 3UT1A 2D0NA 1N5ZA 4DQ2A 2LMJA 2EBPA 3X28B 2R5MA 1AZGB 1JU5C 2BE7D 3MCAB 3G4SQ 4C92E 1BU1A 3EJ1B 2C5XB 1JJ2S 2X9HA 5HVYB 4DBHA 3J7AF 4BY1X 1PG5B 4Y72B 2GQIA 1OIUB 4NC6A 2RHXA 1BIBA 2M02A 2RHZA 3TSWA 1Q86C 4DOVA 3VKGA 4NSTB 3HZJA 3JB9J 1W1FA 4LNPA 2F1LA 1VYWB 4F7LB 1IZ6A 4AFUC 7AT1B 1YI2Q 2DXTA 2V22B 3M03A 4ANJA 4PJJA 5IXBA 1UGRB 2P0QA 2KT8A 2MWPA 5LJ5f 2EYZA 4J8OA 3QZ9B 2KRSA 1M9SA 3JCMg 2FZCB 2C0IA 4J5YA 3JCMe 2O2OA 2DO3A 2BUDA 2OTLT 1GBRA 3VU3C 3BDUA 1Q7YU 4BBSM 1IRXA 4CC7A 1GUXB 2CSQA 4AFQC 3CXCP 1WA7A 3ULRB 1RUWA 4AKIA 2RHIA 2KK4A 3L2VA 1MHNA 2ZPFB 2LTOA 2CGHA 1H3ZA 4XTYA 3FLGA 4ATOA 2MOXA 5KYWA 1H641 2BKZB 4MIMA 3MP1A 1U06A 3M9QA 2I53A 5GMKi 2EYQA 2JZ2A 4OF1A 1SG5A 1MMGA 3BDLA 1OKWB 3OYNA 4M78G 1MUZA 5FU7B 1Q81C 2O4XB 3JCMh 4HCZA 2EGAA 2DJZA 4CI0C 2AKLA 2F2WA 2MF2A 3DKMA 2YRCA 4QVCA 3G71T 3JCMW 4MFDA 3L42A 1YWOA 3QDRB 3JCMb 1FWZA 4AMCA 2B9RA 2F2CA 3JCMP 1UHCA 4ROCA 2F5TX 2V1QA 1VQ4A 1AWWA 3OS1A 3MIAB 4AG1C 1I4K1 2EQKA 4M7AA 2DMEA 2NUTA 3P8BB 5CKBA 1VQPA 4RTVA 4C8QA 2WIHB 5KYUA 2EGCA 1KIKA 1PKDB 3FJ5A 1N9RA 4BCJB 1O9KB 4YOOA 4J6XA 1VQMT 3I5SA 1Y7XA 1BKBA 2O9SA 3KUFA 1SSHA 5IHIA 2JMCA 4LOCA 3QWYA 3C94A 2EFIA 1YITA 1LCKA 4C8QE 2PU9B 3HFOA 2J06A 3NTHA 5C6SA 1M1KC 2EQMA 1AWJA 1YJWA 4TTHA 4PJOF 1JEGA 2JM8A 1VQ9A 4ZN3A 1UG1A 2CKKA 4BY6B 1QVPA 4M7AC 3JB9H 1G83A 1D1AA 2XG8D 2E3HA 2MYSA 2VXEA 3EHRA 4M77F 2EAYA 3BLRB 2RMOA 1UECA 1K9MR 1KD1U 5KCOA 3DB4A 1AWXA 1VOMA 3A8HB 4FYYB 2K2MA 4ZTJA 5LJ5h 2AKKA 1QWEA 3CBPA 3VYGA 4C5GA 3G4SA 3UF4A 3DJBA 3HSBA 3BW1A 2OTLQ 2LQKA 1NE8A 3VS2A 2COYA 1OGUB 2GFUA 2PVDB 4M75G 4NS5A 1NJIR 3QYEA 4ESRA 1FINB 1M3AA 4L5GA 1H1RB 4ELZC 4BE2A 2LQNA 3CC2Q 3THKA 5CKHA 1YI2A 2EGEA 2WHBB 1VQLT 3QHWB 1Q82C 2IIMA 4EPCA 5CKDA 4KBMB 5GAOl 1AVZC 3VKIA 3D7SB 3TN8B 1S1NA 1I8FA 2ROTA 3CCMT 3SEMA 1UTIA 3TNWB 2JXBA 1K4US 4LDVA 1BB9A 3G71Q 1TUDA 5KYYB 3ME9A 1X6GA 2L0AA 2MCNA 1CKAA 4J9DA 1RADB 1D0ZA 3FB9A 5HKCA 2RK1A 1YBYA 4PNOA 2IW6B 3ZEHA 3PFSA 3I56A 2GBQA 2DMOA 2E5KA 1UGSB 1GH6B 2KMTA 1VQMQ 3OYLA 3M0SA 4QKUA 3QSUA 1VYTA 4M7DA 2D8JA 2HAXA 1QMCA 1V76A 3QG1A 3PIOA 2DL7A 2C06A 1YNZA 3I55A 4JLGA 2QQBA 3M4GA 4EONB 3M57A 2W0ZA 4RCCA 1WHJA 2X3XD 4FU6A 1Y96A 3VV0A 1QVFA 5GAN3 1X2KA 1EZZB 2RJDA 3FDRA 3JB9D 1X6BA 1N8RU 3OYBA 5LQFB 2CYZB 2SRCA 2QDJA 3KFVA 2BKDN 4M7DC 4C92D 3H41A 4M75E 3RNJA 1GXIE 2RI2A 3VS1A 3H9NA 1GCQA 1FYNA 1VQ6T 1WHMA 3PNWC 4LXCA 1U5SA 3C4SA 1MV3A 4F7UF 2XKOC 3HP9A 3JB9F 2V8KA 4EOPB 3TSZA 1ZSGA 1C1AA 2DZ9A 1AD6A 2W2HA 5HQ0B 4F6WB 3EAEA 2DXBA 4C92F 4L6V5 3OYYA 2E12A 1VYVA 3OW2S 2GQVA 5KYXB 2HQEA 1U3OA 3EH1A 1N27A 1K9MC 1JO8A 1VQLQ 4X9CA 3P8DA 4E7SA 1XQHA 2DZCA 2M0YA 5GANd 2NUPA 4KUDK 4BCIB 2JTMA 1VQNT 2CJMB 2ED0A 1AOJA 2QAZA 2V8JA 3OSVA 4PFZA 5D6WA 2ECZA 4RTWA 3JCMV 4OB2B 4UC4A 5HNBB
chains in the Genus database with same CATH topology
3F70A 4GY5A 4C0FA 5GAN6 5GAN4 2MMPA 3OS2A 3BG3A 1B34A 2DAQA 4AKHA 4BDYA 4BBRM 2EJGA 2M1HA 3OQ5A 4Y91A 3SWNB 4CRIA 3L2UA 1BYMA 3H4CA 2LVMA 3LW5E 2E5QA 4RKUE 3QZ5B 3VYHB 1XOVA 3DB3A 2WJ9A 4QW2A 2RHYA 1WPYA 1LOJA 3OYEA 1KQSS 1KD1C 5DY9A 4J6WA 1VQLA 2FL7A 4M78F 1I81A 3AHUA 3CC2A 2EQJA 3SDZA 3MO8A 3OS5A 3EFRA 3CD6T 4O5VA 2X35A 5KH6A 2LRQA 1YJ9A 4QQGA 5GAOn 3OYFA 2PQWA 2Y90A 2VGNA 4M78C 4JDSA 3HFNA 4IUUA 1M1KU 2FB7A 2I2LA 1VQ7A 1FKMA 3X25B 4LDUA 2DPPB 4ME7A 4HT9A 3GOXA 3H6ZA 1G3TA 2DIQA 2P0KA 4OMFB 4A4FA 3CCMA 2FYKA 4M6VA 1VIEA 1ZQ1A 3QIIA 3X24B 3QO3A 4M78B 4E7KA 4HCBA 2K57A 2CZ6B 2X4JA 2E65A 5J26A 2K5IA 4FIBA 3RMSA 3PIPA 2ZPEB 3HO8A 2DD4B 4FT4A 5GAMf 4DA4A 3BG5A 1ZBXA 1UEBA 3M53A 4Z02A 4NL3A 1VQPT 4C5EA 4Y28E 1BI1A 4FM4B 5J39A 3QYHB 2LT1A 4ZN1A 3G71A 5I2MA 1VQ5A 1QLBA 3PMIA 2EWNA 4MZMA 1WJQA 4OGEA 5LJ3d 2DTIA 3JCMf 4OB0B 2WSFE 2R58A 4MFEA 4PLIA 1MGQA 2E70A 4ZGDB 1U1SA 2LCCA 2PVOB 4QQ6A 1KHIA 3CMEA 4M7DE 1VQOA 4MDWA 4M7AD 1G5VA 3V7CA 2VYTA 4XTZA 3LX7A 1M1GA 3CBMA 4XTXA 4C0GA 5KCHA 4MMLA 2LT4A 4XU0A 4F7UA 3CCSA 1NPPA 4PJOD 4C8QD 1P92A 2E6ZA 4PLLA 2KY9A 5GAOm 3G6ET 3RKWA 2KQWA 2EIFA 3H8ZA 1VQMA 4EDUA 4M7DF 4OP0A 3OYKA 3E1SA 3CPWA 3VUBA 2IG0A 1VQ9T 4M77D 3M56A 1K9MU 1W4SA 5GAOp 3NTIA 2XK0A 4KT0E 5LJ5g 1M4ZA 2M9UA 4JRIA 4OGCA 3RUXA 5LJ5e 2QFZA 1JRIA 2DTHA 2LQ8A 1G3WA 3QKJA 4LDYA 3V8JA 4C92A 4F7UE 5GMKm 3S3NA 2QA4A 1OI1A 3S3OA 2B8AA 2Y4YA 3VKHA 2BIVA 4O6JA 4KUIA 4N4HA 4XU3A 5D6XA 4EMGA 5I21A 4HNTA 4M75D 4HT8A 4ZGJB 2HQXA 1W2BA 4N0AA 3OYMA 2LX9A 3UT1A 1Q82U 5D6YA 4DQ2A 4C8QF 3X28B 2R5MA 3MCAB 2E64A 3C95A 4JX5A 1Y71A 3SWNA 4C92E 3CCJA 1JJ2S 1M8VA 2QQSA 3CCET 2L89A 1X75C 4C8QC 3J7AF 3L2RA 3E9GA 3FEOA 1M90U 4LD6A 3M54A 3WXMB 2RJEA 3QJ6A 5DLQE 4NC6A 4M7AB 3TW7A 2RHXA 5EJCA 1BIBA 3OYAA 2RHZA 2YRVA 3OB9A 1NJIU 1KQ2A 1Q86C 2JTFA 2RD1A 3M58A 3VKGA 4NL2A 4DOVA 3GPLA 4JS4A 1VQ8T 4PJOB 2ZZDB 1YIJA 2QQ9A 3HZJA 3JB9J 1LJOA 2JNGA 1D3BB 3E19A 4J7FA 3PT9A 2M16A 2ZGWA 4J6YA 1IZ6A 4F7UG 2FVUA 4IURA 2X4XA 4BACA 3CXCS 1FX7A 4M77B 2DXTA 3JB9G 5FU6C 1K8AC 3T9NA 3CC4A 5GAMg 4M78A 2XI9A 3SFMA 5GAMe 4OVAA 1U1TA 4RMOA 4N0AC 1UGRB 5CKFA 1RI0A 3CMAT 2P0QA 2DD4A 4LD9K 3VJPA 5FU6B 2KDSA 2MWPA 4C92G 5CK9A 4J8OA 3SWNC 5LJ5f 3QZ9B 3WVDB 4M75B 2RB6A 1M9SA 3JCMg 1YHQA 4J5YA 5CKEA 3JCMe 4E47A 3HHTB 3M55A 2DO3A 2BUDA 2OTLT 4M78E 3VU3C 2BS4A 3BDUA 1Q7YU 4BBSM 3A8MB 3RIRA 3CC7T 2LCLA 3QYBA 3UDCA 1KC8C 2QQ8A 4XTVA 3PTAA 3HL8A 4AKIA 2RH2A 2RJFA 5A2QE 3GNGA 2RHIA 2KK4A 3OW2A 3L2VA 1MHNA 1IREB 2ZPFB 2LTOA 2CGHA 1H3ZA 3QYGB 2K4YA 4XTYA 3FLGA 2RHUA 3OBWA 1VUBA 5CQYA 1KHCA 4A4KA 4ATOA 1QW1A 2RO0A 5HK3A 5DM7R 2CZ0B 4NOYA 1K73U 2KSSA 3MP6A 3NTKA 1H641 5EG2A 4MIMA 1Y07A 2P0PA 4FSXA 3MP1A 3CCRA 5GAOr 3CCUA 3M9QA 3HRTA 1VQ7T 4ZGEB 3META 4R56A 4XK8E 5GMKi 2HBPA 5GAMh 4LDWA 3J81E 2EYQA 4MZTA 3HPWA 3CPFA 1YCYA 3VYGB 4C0DC 3I56T 2MWOA 3JCMQ 2JZ2A 4OF1A 4HCCA 1DJ7B 3BDLA 3OYNA 4ZTFA 5CR2A 3LLRA 4M78G 2D0QB 1WJSA 3HRSA 2DXCB 4GLKA 4IUPA 5FU7B 4BUGA 3INZA 2QEXA 3CD6A 4RG2A 2F69A 2O4XB 4C0DB 1Q81C 3JCMh 5IAYA 4HCZA 5A0LA 2VV5A 5GAN2 3VUZA 4B9XA 3L2QA 1S72T 2DD5B 2DJZA 4CI0C 1QVFS 3CCLA 2MF2A 3DKMA 4HNUA 4QVCA 3G71T 3SB2A 4MFDA 2DTOA 2WACA 3L42A 3QDRB 1FWZA 3JCMb 3JCMX 3I55T 1KQSA 2E6NA 2D6FA 3JCMP 2XDBA 2F5TX 1YJNA 3OA6A 4JUVA 1VQ4A 2A7YA 2KR6A 3OS1A 4JS5A 2JOYA 3ASKA 3DL1A 1I4K1 2EQKA 3M5AA 3OW2S 3KBGA 2PUKB 3URGA 1QVGA 4M7AA 3CMET 1TH7A 3CCLT 3P8BB 5CKBA 5LJ3f 1VQPA 3N5BB 4C8QA 2MAMA 2ZZDA 4M7DD 4PJOA 3CCST 1N9RA 1HK9A 4A53A 1D3BA 2G77A 4J6XA 5CO7A 5I2SA 4JX4A 1VQMT 4PL6A 4QVDA 3MEWA 3CCQA 1B34B 1Y7XA 5AYFA 1BKBA 3KUFA 2XICA 4M77A 2YHTA 1W2BS 5LJ5j 2OAUA 4RG8A 4LOCA 2DXUA 4BDZA 4JLIA 3C94A 4XAXB 2EFIA 5GANg 1YITA 4X9DA 4HLQA 5GANe 3KXTA 4C8QE 4MMKA 2PU9B 3HFOA 5J3BA 3SD4A 5KE2A 3QJYA 2OTJT 2A3LA 4QVZA 4M75A 4XU1A 2CZ1B 3FC3A 3G6EA 4M7AF 3X26B 1BI0A 3NTHA 3P8HA 4IUQA 1QP2A 4II1A 2EQMA 4N4IA 2RA2A 4XU2A 5C6SA 1M1KC 1YJWA 4PJOF 3GLXA 3GIBA 3GP8A 2ZPGB 1VQ9A 1AHJB 3R6OA 4ZN3A 2DKGA 2CKKA 3LYIA 1QVPA 2HNIA 2F5KA 4BY6B 3JB9H 4M7AC 4V2SA 2XG8D 3J80E 3ZFJA 2VXEA 1O9SA 3RKYA 1KC8U 2YLCA 4M77F 3JCMc 4PJOC 2RM4A 3FRNA 2EAYA 4DOWA 2VC8A 3LGLA 1VQKT 5FRMA 3OBYA 1N9SA 1PSFA 2XIDA 5A0DA 5CCAA 5GMKe 5DLOA 2RI5A 1RL2A 3JB9I 1KD1U 4BI3A 3CEYA 3LH0A 4AKGA 1EIFA 1VQ6A 5KCOA 3DB4A 1LNXA 4M77C 3JCMJ 4M7DB 2ZCFB 3A8HB 4M7AG 4E7IA 1NPRA 4M75F 2M0OA 3A8GB 4PJOG 4JX6A 4C8QG 4ZTJA 2WSCE 2FHDA 4BD3A 3HB9A 5GAMj 5CAIA 1WJRA 2VUBA 2XHCA 3V8LA 3CCEA 5LJ5h 2KMGA 3CBPA 3TCJA 3VYGA 4M75C 2NLUA 4XTUA 4C5GA 3G4SA 3DLMA 4M77G 4R55A 3TU4K 3HSBA 4EMKB 1Y96B 3BW1A 2K3XA 2QF7A 4BI8B 3L2WA 4C5IA 2HD0A 2DXCA 3NFCA 2X4WA 3JCMW 2ZPHB 2O4XA 2LQKA 1NE8A 4F7UB 2H3JA 1BI3A 4HA8A 2ZPBB 2EQUA 3EFSA 2LC4A 5CVIA 4E7LA 5IT9E 2DD5A 5CQXA 3CCVT 1N8RC 1JJ2A 3JRZA 2GFUA 3X20B 4XQ3A 2PVDB 4M75G 4A54A 5GAN5 2O01E 2RK2A 4NS5A 2R5AA 3QYEA 3S6WA 4L5GA 2AHJB 5LJ5d 4ELZC 4BE2A 3OYGA 5LJ3g 1OZ2A 1VQNA 5LJ3e 2QQAA 3A5ZB 5HK0A 5CKHA 1YI2A 4C92B 5GMKh 3L1AA 3HBLA 2WSEE 3TEEA 5FRNA 1VQLT 1G3YA 1N6AA 3OSSC 1R8OB 3CC2T 1JB0E 3CXCA 2XD0A 2E1HA 1Q82C 1PSEA 4AI6A 2L8DA 4TVRA 5C0MA 4EPCA 1M5Q1 3E9FA 2XDDA 1YJ9T 2OTLA 5CKDA 4KBMB 3ZBDA 4BB7A 3RKXA 5GAOl 2EJ9A 5A0GA 3M4YA 3CCRT 3LGFA 3QWLA 3VKIA 3CC7A 3CCUT 4OB1B 5GAN7 3Q1JA 4RCBA 1I8FA 5FU7C 2DIGA 1M90C 4WF2A 4JJNK 3BG9A 4EMHA 3CCMT 1SSFA 1NZ9A 3V8KA 5GAN8 1XTDA 2K2VA 3LWHA 1X6OA 2DEQA 4LDVA 1NJIC 5GMKl 2DXBB 3ME9A 2QEXT 1WQWA 3MEVA 4XTWA 4L59A 2YLBA 1QVGS 5CIUA 3S3MA 1I5LA 3FB9A 2KAFA 3QHSA 5HKCA 1VQ5T 3OMGA 2CS7A 2RK1A 1ZHIA 1YBYA 3JSCA 4PNOA 2EJFA 3ZEHA 5GAMd 3BFMA 3PFSA 1BI2A 5L8RE 3OYJA 5LJ3h 3I56A 3OS0A 3QBYA 4X34A 3CPWS 1YJNT 1VQ4T 1UGSB 2XDPA 3G7ZA 3JAME 2KMTA 3A8LB 1BIAA 3OYLA 4B9WA 1QP3A 4E7JA 1VQOT 3L2ZA 4ELYC 3FIFA 3PMTA 4A4GA 3QSUA 3JCMd 2G3RA 4M7DA 1E7PA 2BS2A 2E41A 4D6WA 1S72A 1Q86U 2HAXA 2QDYB 4ELJA 2DVEA 3OMCA 3QG1A 3PIOA 2C06A 1Q7YC 3I55A 3TREA 3CCQT 4JLGA 1FXXA 1G3SA 2L5QA 5FLXE 4E7HA 4IKFA 4M7AE 5GANj 2QQBA 3M4GA 3LWIA 3M57A 4N4GA 1K8AU 4J7IA 4RCCA 2K5FA 2Y4XA 3KHIA 3FJPA 4FU6A 2QI2A 1Y96A 4EMKA 4PJOE 3VV0A 4BI4A 4BE1A 3OYDA 1YITT 4IUTA 2R57A 3QUIA 2QA4T 2XU8A 1QVFA 5HY6A 5GAN3 4BY6C 1VIFA 1K73C 1KQ1A 3A8OB 1HXDA 2RJDA 4M77E 4C0ZA 3TW6A 3FDRA 3JB9D 4OB3B 4FT2A 4MDXA 1N8RU 2K3YA 2QTXA 2QXFA 3PGGA 4BE0A 3OYBA 3GF5A 2X4YA 3O8VA 1YJWT 3V7RA 2GF7A 4JRPA 4FL6A 2CYZB 1JBMA 3BY7A 4J83A 5FROA 2GCXA 3CCJT 3CBOA 5KE3A 2QDJA 2BKDN 5GMKj 4M7DC 4C92D 4HL4A 4M75E 1GXIE 1V29B 2RI2A 4HKEA 2OTJA 1WGSA 2L3RA 1UGQB 1VQ6T 3HKSA 2V8IA 2GFAA 4PKCC 3PNWC 1X01A 1YIJT 3C4SA 1OYXA 4F7UF 2XKOC 1UB4A 3WVEB 3HP9A 2LNVA 3V7SA 4EMKC 4M7DG 3JB9F 3RERA 2V8KA 4JRQA 1OZ3A 2ZPIB 3QPHA 3MP8A 2CZ7B 2PUOB 4VUBA 1M1FA 5GANh 3CC4T 3RMQA 1O75A 4QSHA 4P5NA 1VQKA 2DZ9A 3MEAA 4KULA 5LL6S 3G4ST 1KG1A 3EAEA 3UWNA 3HRUA 3OYCA 2DXBA 4C92F 1VQ8A 4L6V5 3OYYA 1UGPB 2E12A 2RI3A 2JVVA 4C8QB 5GAOq 2GQVA 2JUFA 3OY9A 2DK3A 2HQEA 3GNFB 2D9TA 3ER0A 4Q5WA 5GANf 1Q81U 1YHQT 4QQDA 2P4TA 1N27A 4C92C 3OYHA 1K9MC 2RJCA 4A4HA 1WQ7A 3UPUA 2E10A 3MEUA 4YTLA 5LJ3j 3RESA 3QXEB 2VXFA 2PVGB 1WNLA 4X9CA 3P8DA 2LDMA 1XQHA 2DZCA 4IUVA 5GANd 4M78D 4KUDK 3DLLA 2BS3A 4HNVA 2JTMA 2KVQG 2K5LA 5IN1A 3OYIA 4LDXA 4A4EA 3MHXA 5M9OA 1XNIA 2EKOA 2QQRA 3M59A 2V8JA 3OSVA 5D6WA 3CMAA 1YI2T 2IVWA 1VQNT 2VGMA 3C12A 1U8RA 3JCMV 2MI6A 4OB2B 4C5HA 4Z6YA 3CCVA 2JN0A 4JRKA 4MZPA 4UC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R E;  2PU9 B;  2ZZD B;  1UGS B;  3LW5 E;  4RKU E;  2CZ1 B;  3QZ5 B;  3VYH B;  3X26 B;  3A8L B;  1QP2 A;  1QP3 A;  2ZPG B;  1AHJ B;  2QDY B;  1UGR B;  2DD4 A;  3QZ9 B;  3WVD B;  1PSF A;  3X25 B;  2DPP B;  3HHT B;  2ZCF B;  3A8H B;  3X24 B;  3A8M B;  2CZ6 B;  3A8O B;  3A8G B;  2ZPE B;  2WSC E;  2DD4 B;  4OB3 B;  1IRE B;  2ZPF B;  3VYG A;  3QYG B;  4Y28 E;  4FM4 B;  2CYZ B;  3QYH B;  2CZ0 B;  2DXC A;  2ZPH B;  2WSF E;  4OB0 B;  1GXI E;  1V29 B;  2ZPB B;  2DD5 A;  1UGQ B;  4ZGE B;  4ZGD B;  2PVO B;  4XK8 E;  3X20 B;  2PVD B;  2O01 E;  3VYG B;  2AHJ B;  3WVE B;  1DJ7 B;  2D0Q B;  2DXC B;  2ZPI B;  2CZ7 B;  2WSE E;  2PUO B;  2DD5 B;  1JB0 E;  1PSE A;  4KT0 E;  2DXB A;  4L6V 5;  1UGP B;  4OB1 B;  2PUK B;  4ZGJ B;  3QXE B;  2PVG B;  2ZZD A;  3X28 B;  2DXB B;  4OB2 B; 
#chains in the Genus database with same CATH topology
 3OS2 A;  4F70 B;  2CH4 A;  4GY5 A;  1H4L D;  3CCM Q;  1YN8 A;  4Y91 A;  2EW3 A;  2LVM A;  2E5Q A;  3SHW A;  2CDT A;  2WJ9 A;  1F1B B;  4KGX B;  5DY9 A;  1I81 A;  3AHU A;  3CC2 A;  3SDZ A;  3OS5 A;  2RQR A;  4IIM A;  1RAF B;  1MMN A;  2UUE B;  5KH6 A;  4QQG A;  1J3T A;  2Y90 A;  2V1R A;  2DLP A;  2DPP B;  3GOX A;  3H6Z A;  1SHG A;  4A4F A;  2H8H A;  3X24 B;  2X4J A;  5J26 A;  1WDX A;  2K5I A;  4FIB A;  2ZPE B;  2DD4 B;  4FT4 A;  1PKS A;  1JKW A;  2J7I A;  3EGD B;  4Z02 A;  3M53 A;  5IHK A;  1VQP T;  2QDL A;  2M51 A;  4AT1 B;  3G71 A;  2KGT A;  4MZM A;  2DL4 A;  1YFN A;  2DTI A;  2WPA B;  2WSF E;  4X1V A;  2R58 A;  3MY1 B;  4PLI A;  2IW9 B;  4M7A D;  2GTJ A;  4XTZ A;  4XTX A;  1M1G A;  2LT4 A;  1NPP A;  2LJ1 A;  4C8Q D;  2E6Z A;  4PLL A;  5GAO m;  2KY9 A;  3RKW A;  4J9B A;  2EIF A;  1VQM A;  4EOL B;  3E1S A;  3ZL7 C;  3VUB A;  1VQ9 T;  1W4S A;  3NTI A;  2XK0 A;  4RUG A;  1Q86 R;  1M4Z A;  1VQ6 Q;  4JRI A;  2LQ8 A;  4LDY A;  3QKJ A;  3V8J A;  2EYY A;  3S3O A;  1UUE A;  2XMF A;  1PRM C;  1I5O B;  2B8A A;  2Y4Y A;  4EMG A;  2HZY A;  4XU3 A;  2LP5 A;  5HBJ B;  5HBE B;  2HQX A;  2DYB A;  4C8Q F;  3C95 A;  4JX5 A;  3SWN A;  4EOJ B;  1M8V A;  2JS2 A;  2L89 A;  3E9G A;  1M90 U;  3M54 A;  2RJE A;  3QJ6 A;  2L2P A;  1WIE A;  2K79 A;  3TW7 A;  5EJC A;  2RQV A;  3EG1 A;  2RD1 A;  4JS4 A;  4RTT A;  4PJO B;  2ZZD B;  1HD3 A;  3E19 A;  4JJD A;  1VQN Q;  4F7U G;  1G8X A;  3CXC S;  3JB9 G;  4M77 B;  2DL3 A;  1VYU A;  3T9N A;  4EOS B;  4Y92 A;  2XI9 A;  3H0I A;  4BXX X;  4RMO A;  2O9V A;  1ZSZ B;  1H25 B;  4F17 A;  4C92 G;  3SWN C;  1G3N C;  2RB6 A;  3M0Q A;  3I9Q A;  5CKE A;  3HHT B;  3BHU B;  4D8D A;  1ZA2 B;  3UDC A;  2ATC B;  2FZK B;  3PTA A;  1Q81 R;  1E9H B;  1K1Z A;  2RH2 A;  3EFO B;  4UN0 A;  3QYG B;  5CQY A;  2RHU A;  4A4K A;  1QW1 A;  5ECA A;  5HK3 A;  4NOY A;  1K73 U;  1CKB A;  4BCQ B;  1Y07 A;  4FSX A;  1GBQ A;  4FYW B;  1VQ7 T;  3MET A;  4ELL A;  2HBP A;  4LDW A;  4MZT A;  3F5X B;  3I56 T;  1VQP Q;  1QCF A;  3EG9 B;  2DET A;  1X2Q A;  3HRS A;  2DXC B;  1PCX A;  3INZ A;  2F69 A;  2QYZ A;  2VV5 A;  2YUP A;  3VUZ A;  2C0O A;  3L2Q A;  3SB2 A;  2WAC A;  4BCN D;  3REB B;  3I55 T;  1KQS A;  5ICP B;  1WYX A;  2E6N A;  3I5R A;  3G1J A;  4OMQ A;  1TU0 B;  4JUV A;  2A7Y A;  2KR3 A;  2KR6 A;  4JS5 A;  1NYG A;  4EOM B;  1M1K R;  3LH5 A;  1QVG A;  3CME T;  1BCM A;  4OGR B;  3R6N A;  4M7D D;  2KEA A;  1HK9 A;  1QWF A;  5GJW B;  5I2S A;  4JX4 A;  4QVD A;  3MEW A;  5IDN B;  2OAU A;  4RG8 A;  2DXU A;  4BDZ A;  2CT4 A;  4CC4 B;  1TFB A;  2W9F A;  4HLQ A;  3KXT A;  4KH0 B;  4MMK A;  4BCG B;  3QJY A;  1G2B A;  2AZS A;  3G6E A;  2CZ1 B;  3X26 B;  1NM7 A;  1BI0 A;  3P8H A;  4IUQ A;  4N4I A;  2RA2 A;  3GLX A;  3GIB A;  1AHJ B;  3LYI A;  4V2S A;  1UGV A;  2RPN A;  1GUX A;  2F5K A;  3J80 E;  3ZFJ A;  4J9G A;  3RKY A;  2YLC A;  1JSU B;  4R0K A;  2UZE B;  2PJQ A;  2RM4 A;  3FRN A;  3VS7 A;  4G6L B;  3LGL A;  3OBY A;  4FCY A;  2PNI A;  1MND A;  1RL2 A;  3CEY A;  3LH0 A;  1VQ6 A;  1E6H A;  1EIF A;  1LNX A;  2FO0 A;  2VAS A;  3JCM J;  4M7A G;  2BPM B;  3TNI B;  1RAC B;  5HCK A;  1WHG A;  1H26 B;  4M75 F;  2M0O A;  4J9I A;  4JX6 A;  2VKN A;  4C8Q G;  2GTO A;  2KRO A;  1WJR A;  2XHC A;  3CCE A;  1E6G A;  5I22 A;  2FPF A;  1Q82 R;  8AT1 B;  2QG9 B;  4R55 A;  3TU4 K;  3MJX A;  1NLP C;  4OML A;  4C5I A;  2X4W A;  2AT1 B;  2C6T B;  2ZPH B;  2O4X A;  4F7U B;  1BI3 A;  3TQ7 P;  2ZPB B;  5IT9 E;  1JJ2 A;  4E7L A;  5CQX A;  4IMY B;  3JRZ A;  3X20 B;  3K7A M;  4FW1 A;  4KRC B;  5GAN 5;  3S6W A;  1M3B A;  5LJ5 d;  4E2F B;  1VQN A;  2HSP A;  4C92 B;  4DEY A;  1G3Y A;  1H1P B;  1N6A A;  1NLO C;  2LQW A;  3CC2 T;  4F7S B;  3G33 B;  1VQ7 Q;  2E1H A;  2XD0 A;  2L8D A;  4TVR A;  2DFU A;  5C0M A;  3I56 Q;  3ZBD A;  3RKX A;  3M4Y A;  3CCR T;  1M8M A;  4RTU A;  5FU7 C;  4EMH A;  1SSF A;  1NZ9 A;  1OV3 A;  2KRM A;  3V8K A;  1XTD A;  3LWH A;  1X6O A;  2DEQ A;  5D7U A;  1VQ5 Q;  3I55 Q;  2QEX T;  4K11 A;  1WQW A;  3MEV A;  4XTW A;  4L59 A;  2BZX A;  5CIU A;  1WHK A;  3S3M A;  3RR6 A;  2KAF A;  1JST B;  2CT3 A;  2CS7 A;  1OEB A;  1XO2 A;  3CME Q;  5GAM d;  3BFM A;  1F5Q B;  1BI2 A;  1VQO Q;  4X34 A;  2EYW A;  1YJN T;  1M2V B;  1BBZ A;  3A8L B;  4E7J A;  4B9W A;  1HYO A;  3PMT A;  4CFU D;  2BS2 A;  4ELJ A;  3OMC A;  1QVG P;  1Q7Y C;  1ZUK A;  3TRE A;  1FXX A;  3EID B;  5IHN A;  2QA4 Q;  4IKF A;  4M7A E;  4ROE A;  1K8A U;  3KHI A;  3IQL A;  2IVX A;  2QI2 A;  3CPW P;  9ATC B;  4BE1 A;  3OYD A;  4WTO B;  3QUI A;  2NYS A;  3A98 A;  4BY6 C;  1VIF A;  3A8O B;  1HXD A;  2QGF B;  4MDX A;  3PGG A;  4BE0 A;  2K6D A;  3GF5 A;  2X4Y A;  2X3W D;  4JRP A;  1JBM A;  5FRO A;  1RAA B;  1UNL D;  2AK5 A;  5KE3 A;  3RGF B;  1WGS A;  3VS6 A;  2LNH B;  3HKS A;  3BLH B;  2V8I A;  2PMI B;  4KRD B;  1UB4 A;  3WVE B;  2LNV A;  4M7D G;  1MNE A;  4VUB A;  2DYI A;  3VS4 A;  1LVK A;  4P5N A;  2C5O B;  2LCS A;  1Z9Q A;  3MEA A;  2WMB B;  5LL6 S;  1AEY A;  3UWN A;  3HRU A;  4FSS A;  1YCS B;  4ZNX A;  2HEQ A;  2ZAE A;  1UGP B;  2RI3 A;  2JVV A;  2J6K A;  4C8Q B;  2DK3 A;  3GNF B;  4A4H A;  3TVT A;  3UPU A;  3AT1 B;  4YTL A;  1H24 B;  2PVG B;  1WXT A;  4IUV A;  4LDX A;  1GL5 A;  2QQR A;  1XNI A;  3CCR Q;  1GFC A;  2JN0 A;  1KK7 A;  2A28 A;  2R7G A;  2GNC A;  3BG3 A;  1B34 A;  2MMP A;  1KXU A;  4BBR M;  2EJG A;  3OQ5 A;  4PFO A;  2D1X A;  2I0N A;  2K3B A;  2Z0W A;  4EOK B;  4RKU E;  3QZ5 B;  3TNH B;  2QEX Q;  2JGZ B;  1XOV A;  3NGP A;  1PKT A;  1TOV A;  4QW2 A;  4LE9 A;  1KD1 C;  2ESW A;  2UZB B;  2EQJ A;  3EFR A;  3VRY A;  3PVQ A;  4O5V A;  2X35 A;  2OX7 A;  2LRQ A;  2YT6 A;  3EGX B;  1YJ9 A;  1AD5 A;  3OYF A;  3MY5 B;  4M78 C;  1PD1 A;  1YJN Q;  4IUU A;  3LQ5 B;  1NEB A;  1SEM A;  4FX3 B;  1VQ7 A;  3X25 B;  1TUC A;  2W9Z A;  1IO6 A;  4HT9 A;  1SHF A;  2FYK A;  3QII A;  4M78 B;  4E7K A;  2KNB B;  4HCB A;  5EC7 A;  4EIK A;  4JJC A;  3RMS A;  1ZBJ A;  5BNJ B;  4J9C A;  4F6U B;  4J9F A;  1ZBX A;  1UEB A;  3I35 A;  3QYH B;  1QMZ B;  4ZN1 A;  5I2M A;  1VQ5 A;  1QLB A;  3PMI A;  4FYX B;  1RAG B;  4EOR B;  1WJQ A;  4RTX A;  2RF0 A;  5LJ3 d;  1CSK A;  3EG0 A;  2H3E B;  2X51 A;  4E6R A;  4ZGD B;  2PVO B;  4M7D E;  3CME A;  1KHI A;  1VQO A;  4MDW A;  5KCH A;  2K9G A;  1X27 A;  1P92 A;  3G6E T;  2KQW A;  3OYK A;  2J05 A;  4JZ4 A;  1K9M U;  2NUZ A;  1GFD A;  4EOQ B;  2LZ6 B;  4KT0 E;  2FPD A;  2V26 A;  4OGC A;  3RUX A;  2EVR A;  2DTH A;  1G3W A;  4Z8A A;  2QA4 A;  1SRL A;  3MPU B;  5D6X A;  3GTM S;  3BHT B;  4HT8 A;  4ZGJ B;  1W2B A;  4N0A A;  2LX9 A;  2CRE A;  2JTE A;  2AIR B;  4CFM B;  1GCP A;  1OX8 A;  2E64 A;  4BCN B;  5I11 A;  2J6O A;  3CCJ A;  1AT1 B;  3NHN A;  4A63 B;  2QQS A;  3CCE T;  1WXB A;  1X75 C;  2JJ9 A;  3L2R A;  1FMV A;  3WXM B;  4HVU A;  5DLQ E;  1GRI A;  4OMO A;  1C6V X;  2YRV A;  1NJI U;  1KQ2 A;  4AG2 C;  3GPL A;  2HCK A;  2BE9 B;  2X1N B;  2QQ9 A;  1D3B B;  3H0H A;  4J7F A;  3REA B;  2M16 A;  2ZGW A;  4J6Y A;  4F04 B;  4BAC A;  4IUR A;  5IF1 B;  2X4X A;  1AZE A;  1FX7 A;  2DIL A;  1B07 A;  3CC4 A;  2FRY A;  2P84 A;  2W10 A;  4N0A C;  1IGQ A;  1RI0 A;  3CMA T;  2DD4 A;  4BCM D;  3VJP A;  2KDS A;  5CK9 A;  1SPK A;  4FW2 A;  8ATC B;  3CC7 Q;  4M75 B;  2F2V A;  1YHQ A;  2RQT A;  3DDP B;  2KYM A;  2JW4 A;  3M0U A;  2BS4 A;  3RDV A;  2LCL A;  2EUF A;  1KC8 C;  4XTV A;  1ABQ A;  3GNG A;  3OW2 A;  2DBM A;  5CEI B;  2IW8 B;  1JXO A;  4B6M A;  2CP3 A;  2K4Y A;  1KHC A;  2PK2 A;  3MP6 A;  5GJV B;  2P0P A;  3CCR A;  5GAO r;  4II5 B;  3E2U A;  3J81 E;  3HPW A;  4EC9 B;  3CPF A;  1YCY A;  4C0D C;  2HQH A;  3JCM Q;  1S72 Q;  2CCI B;  4HCC A;  4ZTF A;  3LLR A;  2QK0 A;  2D0Q B;  5IHY A;  4GLK A;  2QEX A;  4IUP A;  1PRL C;  4C0D B;  5IAY A;  3U23 A;  5A0L A;  5GAN 2;  4B9X A;  4YC3 B;  2DD5 B;  2DTO A;  3JCM X;  3PO3 S;  1YJN A;  2RNA A;  4LN2 A;  3G6E Q;  2JOY A;  3DL1 A;  2FEI A;  1RAE B;  3M5A A;  3KBG A;  2PUK B;  3URG A;  2DRM A;  2HBW A;  4BCH B;  1TH7 A;  3M0R A;  3EG2 A;  2FPE A;  1UFF A;  4PJO A;  4ROD A;  2MAM A;  2ZZD A;  2RN8 A;  3CCS T;  1VA7 A;  2G77 A;  5CO7 A;  2A36 A;  4PL6 A;  1QVF P;  4M77 A;  2YHT A;  1PWT A;  2F2X A;  4XAX B;  5GAN g;  4X9D A;  5GAN e;  1ZSZ A;  1C9B A;  3SD4 A;  5KE2 A;  2CP5 A;  2ABL A;  4QVZ A;  4XU1 A;  3FC3 A;  4M7A F;  2WXV B;  2KT1 A;  2UZD B;  1QP2 A;  4II1 A;  4PJL A;  4DBQ A;  3CCE Q;  2HL5 C;  2CP2 A;  3GP8 A;  3GBQ A;  2DKG A;  1VQK Q;  4JJB A;  1VOL A;  1W2B P;  1UE9 A;  3EFO A;  4PJO C;  4DOW A;  2VC8 A;  3DDQ B;  1N9S A;  1PSF A;  5IXF A;  5GMK e;  5DLO A;  4EOO B;  4AKG A;  4GLM A;  4M77 C;  4CFU B;  1UDL A;  2ZCF B;  1M3C A;  4E7I A;  1NPR A;  3CMA Q;  1ZSZ C;  5CAI A;  3V8L A;  2VUB A;  4KRT A;  2KMG A;  1EFN A;  2NLU A;  4XTU A;  4EMK B;  3EG9 A;  4BI8 B;  2QF7 A;  2DXC A;  2OI3 A;  3NFC A;  3EG3 A;  4CFV B;  1PM3 A;  5DQV A;  2H3J A;  5I5Z B;  2VB6 A;  2SEM A;  2WFY B;  3HTR A;  2AHJ B;  2CH4 W;  3OYG A;  1OZ2 A;  5GMK h;  3HBL A;  2WSE E;  3TEE A;  4F14 A;  5KYN A;  5FRN A;  2DNU A;  4KH1 B;  1YP5 A;  3OSS C;  3CXC A;  3DTO A;  1PSE A;  4AI6 A;  4M4Z A;  3E9F A;  1YJ9 T;  2EJ9 A;  3LGF A;  3QWL A;  3CC7 A;  3CCU T;  4OB1 B;  5GAN 7;  2PZ1 A;  3QWX X;  1M90 C;  1D0Y A;  2DX1 A;  1M30 A;  5GAN 8;  1Q7Y R;  1AIS B;  1QVG S;  1M2O A;  2L3P A;  1BU2 A;  1I5L A;  3QHS A;  1VQ5 T;  4CRL B;  2YWW A;  3JSC A;  4BCK B;  1ZUU A;  2CCH B;  3CPW S;  3NPF A;  3PE0 A;  3CCS Q;  2XDP A;  3G7Z A;  3JAM E;  1Y57 A;  1VQO T;  1QP3 A;  1OUL A;  4ELY C;  4A4G A;  3JCM d;  1P5E B;  2G3R A;  2E41 A;  1S72 A;  2DBK A;  1Q86 U;  2QDY B;  5IH2 A;  2MK5 A;  3CCQ T;  1G3S A;  4CXA B;  2I40 B;  5GAN j;  4J7I A;  4OR5 B;  4BI4 A;  1TXQ A;  4IUT A;  2O88 A;  2QA4 T;  5HY6 A;  1K76 A;  1K73 C;  4EOI B;  4C0Z A;  3TW6 A;  4OB3 B;  1H28 B;  1TSF A;  2EQI A;  4QT7 A;  2K3Y A;  2QTX A;  4M7D F;  2E4H A;  3V7R A;  3BHV B;  1OOT A;  2GCX A;  3CBO A;  3CCJ T;  2DL8 A;  2A37 A;  5GMK j;  2K7A A;  4HL4 A;  1V29 B;  2WEV B;  2OTJ A;  1D1C A;  1UGQ B;  2WMA B;  2GFA A;  4PKC C;  2IPO B;  1H27 B;  3RER A;  2CZ7 B;  2PUO B;  1D09 B;  1RAH B;  1T0J A;  3CC4 T;  1O75 A;  4QSH A;  1VQK A;  1FMK A;  1UNH D;  2C5N B;  1T0H A;  2YUN A;  3PVL A;  5GAO q;  2JUF A;  4Q5W A;  1Q81 U;  2D9T A;  2G6F X;  3ER0 A;  1YHQ T;  4QQD A;  4C92 C;  1KD1 R;  1IHW A;  3VS5 A;  1SF9 A;  3RES A;  2WIP B;  2VXF A;  2P4R A;  2DM1 A;  2DVJ A;  2KVQ G;  2LJ0 A;  3OYI A;  5IN1 A;  4A4E A;  1R0B G;  3MHX A;  1M2V A;  2EKO A;  3M59 A;  5M9O A;  3CMA A;  1YJ9 Q;  2IVW A;  3NDQ A;  1ABO A;  3CCU Q;  3A1P A;  1O9K A;  3CCV A;  2E3I A;  4JRK A;  2HDA A;  5GAN 4;  5GAN 6;  4BDY A;  2DAQ A;  2KYB A;  2COW A;  4OMP A;  3L2U A;  4CRI A;  2ED1 A;  2J6F A;  3H4C A;  1HSQ A;  3DB3 A;  3CD6 Q;  4WCI A;  1WPY A;  4F6S B;  2DA9 A;  5IDP B;  3MO8 A;  3B57 A;  5ACB A;  5GAO n;  1A0N B;  2JM9 A;  2PQW A;  3HFN A;  5LMK B;  1M1K U;  2FB7 A;  4DBR A;  5EFQ B;  2OJ2 A;  2P0K A;  4OMF B;  4M6V A;  1VIE A;  1ZQ1 A;  4HCK A;  3RBB B;  1KQS P;  4BCM B;  1UJ0 A;  5GAM f;  3CCQ Q;  4DA4 A;  1K0X A;  1OX9 A;  1EX4 A;  3BLQ B;  5J39 A;  1H8K A;  2CP7 A;  1H92 A;  1RLP C;  4BY7 X;  1OQK A;  2LX7 A;  4OMM A;  4OB0 B;  4MFE A;  1MGQ A;  2E70 A;  6AT1 B;  1MMA A;  2LCC A;  4QQ6 A;  1ARK A;  3V7C A;  4C0G A;  2RQU A;  4MML A;  1UJY A;  3CCS A;  4PJO D;  3CCJ Q;  5KYW B;  3H8Z A;  4EDU A;  1BCO A;  4OP0 A;  1ZP2 A;  1OL1 B;  2IG0 A;  2DF6 A;  2G9X B;  3M56 A;  4M77 D;  1URC B;  5LJ5 g;  4ORZ A;  5LJ5 e;  2QFZ A;  2DJQ A;  1I1J A;  3S3N A;  1OI1 A;  4PJN A;  3VKH A;  2BIV A;  4GBQ A;  1TD6 A;  2QGG A;  2ROL A;  4BCO B;  5HBH B;  1WHH A;  2LJ3 A;  3OYM A;  3O0G D;  1Q82 U;  5D6Y A;  3CC4 Q;  1WLP B;  2KE9 A;  2YUO A;  1Y71 A;  4BCF B;  2COZ A;  1LPL A;  4C8Q C;  1OI9 B;  1ZUY A;  3FEO A;  1N8R R;  4LD6 A;  1YHQ Q;  5L2W B;  4M7A B;  3OYA A;  4F16 A;  3OB9 A;  5KYY A;  2NUT B;  1Y0M A;  1Z9Z A;  2CP0 A;  2JTF A;  3M58 A;  4NL2 A;  1KC8 R;  1VQ8 T;  3EGX A;  5KYU B;  1YIJ A;  1LJO A;  2JNG A;  4OMN A;  4BCQ D;  4D8K A;  3PT9 A;  2KXC A;  1ACM B;  2FVU A;  4CFN B;  2QGS A;  5FU6 C;  1K8A C;  1IXD A;  5GAM g;  1D3U B;  1JJ2 P;  4M78 A;  3SFM A;  3NMZ C;  5GAM e;  4OVA A;  1U1T A;  1H1S B;  5CKF A;  2FG0 A;  4LD9 K;  5FU6 B;  3UA6 A;  1QCO A;  3WVD B;  2HSE B;  2PK9 B;  4LUD A;  4E47 A;  3M55 A;  1TG0 A;  4M78 E;  3A8M B;  3RIR A;  3CC7 T;  3QYB A;  4HVV A;  2QQ8 A;  4BCP B;  1B7T A;  4KGV B;  4CFX B;  3HL8 A;  2PTK A;  2RJF A;  5A2Q E;  2D8H A;  4LUE A;  1OKV B;  2KXD A;  1IRE B;  2AZV A;  3OBW A;  1VUB A;  3H0F A;  2RO0 A;  5DM7 R;  2C5V B;  2CZ0 B;  2KSS A;  3NTK A;  1WZO A;  5EG2 A;  4HVW A;  3CCU A;  3HRT A;  4ZGE B;  4R56 A;  3VS3 A;  4XK8 E;  1Q95 G;  5GAM h;  2EPD A;  3VYG B;  1KSW A;  2MWO A;  1DJ7 B;  1K9A A;  5CR2 A;  1WJS A;  4BUG A;  3CD6 A;  2L3Q A;  4RG2 A;  1S72 T;  1QVF S;  2L3S A;  4HNU A;  3UAT A;  5L23 A;  2D6F A;  2XDB A;  3OA6 A;  3ASK A;  1N4M A;  2C0T A;  3CQT A;  1W98 B;  4Z89 A;  3CCL T;  5LJ3 f;  3N5B B;  5KYX A;  1OPK A;  1KJW A;  1MMD A;  1D3B A;  4A53 A;  5FW9 A;  3VRZ A;  2EKH A;  3CCQ A;  1B34 B;  5AYF A;  2XIC A;  1W2B S;  5LJ5 j;  1M27 C;  4JLI A;  1H1Q B;  1QLY A;  4J9H A;  1W6X A;  5J3B A;  1HJD A;  5FGK B;  1UNG D;  2OTJ T;  2A3L A;  2W96 A;  4M75 A;  4DBF A;  4XU2 A;  4JZ3 A;  1T3S A;  1OL2 B;  5FWB A;  1XJW B;  2ZPG B;  3R6O A;  2HNI A;  3EH2 A;  2O31 A;  2CUB A;  1O9S A;  1KC8 U;  3EHQ A;  1VQ8 Q;  3JCM c;  1E7O A;  1VQK T;  5FRM A;  3JB9 I;  2VVK A;  2XID A;  5A0D A;  1GY3 B;  1TUG B;  2RI5 A;  5CCA A;  4BI3 A;  4RTZ A;  2HL3 A;  4M7D B;  3A8G B;  4PJO G;  2WSC E;  2FHD A;  3DOG B;  4BD3 A;  3HB9 A;  5GAM j;  1ENW A;  3TCJ A;  4M75 C;  3DLM A;  3BE3 A;  4M77 G;  1JXM A;  1Y96 B;  3L2W A;  2K3X A;  2HD0 A;  2LW4 A;  1TTH B;  3EGD A;  1QKX A;  3MKD A;  5GAN f;  4HA8 A;  2EQU A;  3EFS A;  2LC4 A;  5CVI A;  3VS0 A;  1N8R C;  2DD5 A;  1M90 R;  3CCV T;  3EOC B;  2MPX C;  4XQ3 A;  1JOW A;  4PFP A;  2CUD A;  4A54 A;  2O01 E;  2RK2 A;  2R5A A;  1GCQ C;  1D0X A;  5LJ3 g;  5LJ3 e;  2FRW A;  2QQA A;  4YOZ A;  3A5Z B;  5HK0 A;  3L1A A;  1SKU B;  2VWF A;  2OAW A;  1NYF A;  1R8O B;  1JB0 E;  2YRD A;  1M5Q 1;  2XDD A;  2OTL A;  2DER A;  4BB7 A;  5A0G A;  1VIN A;  4JPB W;  1PHT A;  3QDF A;  2DEU A;  2QTV A;  1IHV A;  1SRM A;  1QCN A;  3Q1J A;  4RCB A;  2DIG A;  4WF2 A;  4JJN K;  3BG9 A;  2JT4 A;  1NJI C;  2K2V A;  1NEG A;  2IN3 A;  2CSI A;  5GMK l;  2DXB B;  2MIO A;  2YLB A;  4AFS C;  2PHG A;  1IB8 A;  3OMG A;  1ZHI A;  2EJF A;  4F7N B;  5L8R E;  3OYJ A;  5LJ3 h;  3CCL Q;  1BK2 A;  1K73 R;  2B86 A;  4DEX A;  3QBY A;  3OS0 A;  2NUP B;  1VQ4 T;  4YOS A;  2YUQ A;  3POM A;  1BIA A;  4CC2 A;  3L2Z A;  3FIF A;  5FWC A;  1E7P A;  1PC0 A;  4I3Z B;  4D6W A;  1ZA1 B;  1TS9 A;  1YWP A;  2DVE A;  4EC8 B;  4PK4 A;  2YDL A;  1W70 A;  2GGR A;  2L5Q A;  5FLX E;  4E7H A;  3C0C A;  2OTJ Q;  3LWI A;  4N4G A;  2K5F A;  2Y4X A;  1FMW A;  2W99 A;  3FJP A;  4EMK A;  4PJO E;  1YIT T;  1QQJ A;  1OU9 A;  2R57 A;  2XU8 A;  4Z88 A;  1KQ1 A;  1NG2 A;  1WI7 A;  4M77 E;  1I0C A;  4FT2 A;  2QXF A;  1YJW T;  3O8V A;  2GF7 A;  4FL6 A;  1AWO A;  2QAS A;  4J83 A;  3BY7 A;  4CFW B;  2YXY A;  5AT1 B;  1ZLM A;  2DE0 X;  1B3Q A;  4HKE A;  4IIO A;  2L3R A;  3UA7 A;  1X01 A;  1YIJ T;  1NBE B;  1OYX A;  3V7S A;  4EMK C;  4JRQ A;  1OZ3 A;  2ZPI B;  2EYX A;  3MP8 A;  3QPH A;  1RI9 A;  1UHF A;  1X43 A;  1M1F A;  5GAN h;  2KRN A;  3RMQ A;  5CYI B;  1RAI B;  4KUL A;  1KG1 A;  3G4S T;  3CCV Q;  3OYC A;  1VQ8 A;  2YSQ A;  3OY9 A;  1KFZ A;  4E7Z A;  2P4T A;  3OYH A;  1I07 A;  2RJC A;  1WQ7 A;  2CP6 A;  1C0M A;  2E10 A;  3MEU A;  5LJ3 j;  3QXE B;  1QKW A;  1WNL A;  1X69 A;  2LDM A;  4M78 D;  3DLL A;  2BS3 A;  4HNV A;  2K5L A;  1JQQ A;  1YI2 T;  2NWM A;  2BZY A;  2A08 A;  4AFZ C;  2HMA A;  5DQW A;  1PNJ A;  2VGM A;  3C12 A;  1U8R A;  2MI6 A;  1PD0 A;  4C5H A;  4Z6Y A;  4MZP A;  2FZG B;  1T3L A;  2ENM A;  3OW2 P;  3F70 A;  4C0F A;  1WX6 A;  4AKH A;  2M1H A;  3EGU A;  4KGZ B;  3SWN B;  1BYM A;  2C4G B;  3LW5 E;  3VYH B;  3MI9 B;  1H3H A;  1MV0 B;  2RHY A;  1LOJ A;  3OYE A;  1KQS S;  4J6W A;  1VQL A;  2FL7 A;  4M78 F;  4HXJ A;  3M0P A;  3CD6 T;  1K0S A;  1R0C B;  2VGN A;  4JDS A;  2KI7 A;  1VQ4 Q;  2BZ8 A;  2I2L A;  1TWB A;  1FKM A;  4LDU A;  4ME7 A;  1WXU A;  1G3T A;  2DIQ A;  2KBT A;  1R77 A;  3CCM A;  3QO3 A;  2K57 A;  2CZ6 B;  1D1B A;  2E65 A;  4J9E A;  3PIP A;  3HO8 A;  3BG5 A;  1OIY B;  4NL3 A;  4C5E A;  4Y28 E;  1BI1 A;  4FM4 B;  2LT1 A;  3O5Z A;  2JMA A;  2EWN A;  1V1C A;  1YIT Q;  4OGE A;  4PJM A;  2HKQ B;  2DL5 A;  3JCM f;  1IGU A;  2BTT A;  1G5V A;  1U1S A;  2DRK A;  1OPL A;  1RAB B;  2VYT A;  4F7J B;  3LX7 A;  3CCL A;  2JS0 A;  3CBM A;  1YJW Q;  3JV3 A;  1RLQ C;  4XU0 A;  1WFW A;  1VQ9 Q;  4F7U A;  1WHL A;  4FYV B;  2HKN A;  3CPW A;  1FVV B;  2A0F B;  4CC3 A;  5GAO p;  2UZL B;  1OU8 A;  2M9U A;  4C92 A;  1JRI A;  5GMK m;  4F7U E;  4RTY A;  1YIJ Q;  3QHR B;  4O6J A;  4KUI A;  1ZX6 A;  4N4H A;  5I21 A;  2RQW A;  4HNT A;  4M75 D;  3M0T A;  1K8A R;  3UT1 A;  2D0N A;  1N5Z A;  4DQ2 A;  2LMJ A;  2EBP A;  3X28 B;  2R5M A;  1AZG B;  1JU5 C;  2BE7 D;  3MCA B;  3G4S Q;  4C92 E;  1BU1 A;  3EJ1 B;  2C5X B;  1JJ2 S;  2X9H A;  5HVY B;  4DBH A;  3J7A F;  4BY1 X;  1PG5 B;  4Y72 B;  2GQI A;  1OIU B;  4NC6 A;  2RHX A;  1BIB A;  2M02 A;  2RHZ A;  3TSW A;  1Q86 C;  4DOV A;  3VKG A;  4NST B;  3HZJ A;  3JB9 J;  1W1F A;  4LNP A;  2F1L A;  1VYW B;  4F7L B;  1IZ6 A;  4AFU C;  7AT1 B;  1YI2 Q;  2DXT A;  2V22 B;  3M03 A;  4ANJ A;  4PJJ A;  5IXB A;  1UGR B;  2P0Q A;  2KT8 A;  2MWP A;  5LJ5 f;  2EYZ A;  4J8O A;  3QZ9 B;  2KRS A;  1M9S A;  3JCM g;  2FZC B;  2C0I A;  4J5Y A;  3JCM e;  2O2O A;  2DO3 A;  2BUD A;  2OTL T;  1GBR A;  3VU3 C;  3BDU A;  1Q7Y U;  4BBS M;  1IRX A;  4CC7 A;  1GUX B;  2CSQ A;  4AFQ C;  3CXC P;  1WA7 A;  3ULR B;  1RUW A;  4AKI A;  2RHI A;  2KK4 A;  3L2V A;  1MHN A;  2ZPF B;  2LTO A;  2CGH A;  1H3Z A;  4XTY A;  3FLG A;  4ATO A;  2MOX A;  5KYW A;  1H64 1;  2BKZ B;  4MIM A;  3MP1 A;  1U06 A;  3M9Q A;  2I53 A;  5GMK i;  2EYQ A;  2JZ2 A;  4OF1 A;  1SG5 A;  1MMG A;  3BDL A;  1OKW B;  3OYN A;  4M78 G;  1MUZ A;  5FU7 B;  1Q81 C;  2O4X B;  3JCM h;  4HCZ A;  2EGA A;  2DJZ A;  4CI0 C;  2AKL A;  2F2W A;  2MF2 A;  3DKM A;  2YRC A;  4QVC A;  3G71 T;  3JCM W;  4MFD A;  3L42 A;  1YWO A;  3QDR B;  3JCM b;  1FWZ A;  4AMC A;  2B9R A;  2F2C A;  3JCM P;  1UHC A;  4ROC A;  2F5T X;  2V1Q A;  1VQ4 A;  1AWW A;  3OS1 A;  3MIA B;  4AG1 C;  1I4K 1;  2EQK A;  4M7A A;  2DME A;  2NUT A;  3P8B B;  5CKB A;  1VQP A;  4RTV A;  4C8Q A;  2WIH B;  5KYU A;  2EGC A;  1KIK A;  1PKD B;  3FJ5 A;  1N9R A;  4BCJ B;  1O9K B;  4YOO A;  4J6X A;  1VQM T;  3I5S A;  1Y7X A;  1BKB A;  2O9S A;  3KUF A;  1SSH A;  5IHI A;  2JMC A;  4LOC A;  3QWY A;  3C94 A;  2EFI A;  1YIT A;  1LCK A;  4C8Q E;  2PU9 B;  3HFO A;  2J06 A;  3NTH A;  5C6S A;  1M1K C;  2EQM A;  1AWJ A;  1YJW A;  4TTH A;  4PJO F;  1JEG A;  2JM8 A;  1VQ9 A;  4ZN3 A;  1UG1 A;  2CKK A;  4BY6 B;  1QVP A;  4M7A C;  3JB9 H;  1G83 A;  1D1A A;  2XG8 D;  2E3H A;  2MYS A;  2VXE A;  3EHR A;  4M77 F;  2EAY A;  3BLR B;  2RMO A;  1UEC A;  1K9M R;  1KD1 U;  5KCO A;  3DB4 A;  1AWX A;  1VOM A;  3A8H B;  4FYY B;  2K2M A;  4ZTJ A;  5LJ5 h;  2AKK A;  1QWE A;  3CBP A;  3VYG A;  4C5G A;  3G4S A;  3UF4 A;  3DJB A;  3HSB A;  3BW1 A;  2OTL Q;  2LQK A;  1NE8 A;  3VS2 A;  2COY A;  1OGU B;  2GFU A;  2PVD B;  4M75 G;  4NS5 A;  1NJI R;  3QYE A;  4ESR A;  1FIN B;  1M3A A;  4L5G A;  1H1R B;  4ELZ C;  4BE2 A;  2LQN A;  3CC2 Q;  3THK A;  5CKH A;  1YI2 A;  2EGE A;  2WHB B;  1VQL T;  3QHW B;  1Q82 C;  2IIM A;  4EPC A;  5CKD A;  4KBM B;  5GAO l;  1AVZ C;  3VKI A;  3D7S B;  3TN8 B;  1S1N A;  1I8F A;  2ROT A;  3CCM T;  3SEM A;  1UTI A;  3TNW B;  2JXB A;  1K4U S;  4LDV A;  1BB9 A;  3G71 Q;  1TUD A;  5KYY B;  3ME9 A;  1X6G A;  2L0A A;  2MCN A;  1CKA A;  4J9D A;  1RAD B;  1D0Z A;  3FB9 A;  5HKC A;  2RK1 A;  1YBY A;  4PNO A;  2IW6 B;  3ZEH A;  3PFS A;  3I56 A;  2GBQ A;  2DMO A;  2E5K A;  1UGS B;  1GH6 B;  2KMT A;  1VQM Q;  3OYL A;  3M0S A;  4QKU A;  3QSU A;  1VYT A;  4M7D A;  2D8J A;  2HAX A;  1QMC A;  1V76 A;  3QG1 A;  3PIO A;  2DL7 A;  2C06 A;  1YNZ A;  3I55 A;  4JLG A;  2QQB A;  3M4G A;  4EON B;  3M57 A;  2W0Z A;  4RCC A;  1WHJ A;  2X3X D;  4FU6 A;  1Y96 A;  3VV0 A;  1QVF A;  5GAN 3;  1X2K A;  1EZZ B;  2RJD A;  3FDR A;  3JB9 D;  1X6B A;  1N8R U;  3OYB A;  5LQF B;  2CYZ B;  2SRC A;  2QDJ A;  3KFV A;  2BKD N;  4M7D C;  4C92 D;  3H41 A;  4M75 E;  3RNJ A;  1GXI E;  2RI2 A;  3VS1 A;  3H9N A;  1GCQ A;  1FYN A;  1VQ6 T;  1WHM A;  3PNW C;  4LXC A;  1U5S A;  3C4S A;  1MV3 A;  4F7U F;  2XKO C;  3HP9 A;  3JB9 F;  2V8K A;  4EOP B;  3TSZ A;  1ZSG A;  1C1A A;  2DZ9 A;  1AD6 A;  2W2H A;  5HQ0 B;  4F6W B;  3EAE A;  2DXB A;  4C92 F;  4L6V 5;  3OYY A;  2E12 A;  1VYV A;  3OW2 S;  2GQV A;  5KYX B;  2HQE A;  1U3O A;  3EH1 A;  1N27 A;  1K9M C;  1JO8 A;  1VQL Q;  4X9C A;  3P8D A;  4E7S A;  1XQH A;  2DZC A;  2M0Y A;  5GAN d;  2NUP A;  4KUD K;  4BCI B;  2JTM A;  1VQN T;  2CJM B;  2ED0 A;  1AOJ A;  2QAZ A;  2V8J A;  3OSV A;  4PFZ A;  5D6W A;  2ECZ A;  4RTW A;  3JCM V;  4OB2 B;  4UC4 A;  5HNB B; 
#chains in the Genus database with same CATH homology
 3F70 A;  4GY5 A;  4C0F A;  5GAN 6;  5GAN 4;  2MMP A;  3OS2 A;  3BG3 A;  1B34 A;  2DAQ A;  4AKH A;  4BDY A;  4BBR M;  2EJG A;  2M1H A;  3OQ5 A;  4Y91 A;  3SWN B;  4CRI A;  3L2U A;  1BYM A;  3H4C A;  2LVM A;  3LW5 E;  2E5Q A;  4RKU E;  3QZ5 B;  3VYH B;  1XOV A;  3DB3 A;  2WJ9 A;  4QW2 A;  2RHY A;  1WPY A;  1LOJ A;  3OYE A;  1KQS S;  1KD1 C;  5DY9 A;  4J6W A;  1VQL A;  2FL7 A;  4M78 F;  1I81 A;  3AHU A;  3CC2 A;  2EQJ A;  3SDZ A;  3MO8 A;  3OS5 A;  3EFR A;  3CD6 T;  4O5V A;  2X35 A;  5KH6 A;  2LRQ A;  1YJ9 A;  4QQG A;  5GAO n;  3OYF A;  2PQW A;  2Y90 A;  2VGN A;  4M78 C;  4JDS A;  3HFN A;  4IUU A;  1M1K U;  2FB7 A;  2I2L A;  1VQ7 A;  1FKM A;  3X25 B;  4LDU A;  2DPP B;  4ME7 A;  4HT9 A;  3GOX A;  3H6Z A;  1G3T A;  2DIQ A;  2P0K A;  4OMF B;  4A4F A;  3CCM A;  2FYK A;  4M6V A;  1VIE A;  1ZQ1 A;  3QII A;  3X24 B;  3QO3 A;  4M78 B;  4E7K A;  4HCB A;  2K57 A;  2CZ6 B;  2X4J A;  2E65 A;  5J26 A;  2K5I A;  4FIB A;  3RMS A;  3PIP A;  2ZPE B;  3HO8 A;  2DD4 B;  4FT4 A;  5GAM f;  4DA4 A;  3BG5 A;  1ZBX A;  1UEB A;  3M53 A;  4Z02 A;  4NL3 A;  1VQP T;  4C5E A;  4Y28 E;  1BI1 A;  4FM4 B;  5J39 A;  3QYH B;  2LT1 A;  4ZN1 A;  3G71 A;  5I2M A;  1VQ5 A;  1QLB A;  3PMI A;  2EWN A;  4MZM A;  1WJQ A;  4OGE A;  5LJ3 d;  2DTI A;  3JCM f;  4OB0 B;  2WSF E;  2R58 A;  4MFE A;  4PLI A;  1MGQ A;  2E70 A;  4ZGD B;  1U1S A;  2LCC A;  2PVO B;  4QQ6 A;  1KHI A;  3CME A;  4M7D E;  1VQO A;  4MDW A;  4M7A D;  1G5V A;  3V7C A;  2VYT A;  4XTZ A;  3LX7 A;  1M1G A;  3CBM A;  4XTX A;  4C0G A;  5KCH A;  4MML A;  2LT4 A;  4XU0 A;  4F7U A;  3CCS A;  1NPP A;  4PJO D;  4C8Q D;  1P92 A;  2E6Z A;  4PLL A;  2KY9 A;  5GAO m;  3G6E T;  3RKW A;  2KQW A;  2EIF A;  3H8Z A;  1VQM A;  4EDU A;  4M7D F;  4OP0 A;  3OYK A;  3E1S A;  3CPW A;  3VUB A;  2IG0 A;  1VQ9 T;  4M77 D;  3M56 A;  1K9M U;  1W4S A;  5GAO p;  3NTI A;  2XK0 A;  4KT0 E;  5LJ5 g;  1M4Z A;  2M9U A;  4JRI A;  4OGC A;  3RUX A;  5LJ5 e;  2QFZ A;  1JRI A;  2DTH A;  2LQ8 A;  1G3W A;  3QKJ A;  4LDY A;  3V8J A;  4C92 A;  4F7U E;  5GMK m;  3S3N A;  2QA4 A;  1OI1 A;  3S3O A;  2B8A A;  2Y4Y A;  3VKH A;  2BIV A;  4O6J A;  4KUI A;  4N4H A;  4XU3 A;  5D6X A;  4EMG A;  5I21 A;  4HNT A;  4M75 D;  4HT8 A;  4ZGJ B;  2HQX A;  1W2B A;  4N0A A;  3OYM A;  2LX9 A;  3UT1 A;  1Q82 U;  5D6Y A;  4DQ2 A;  4C8Q F;  3X28 B;  2R5M A;  3MCA B;  2E64 A;  3C95 A;  4JX5 A;  1Y71 A;  3SWN A;  4C92 E;  3CCJ A;  1JJ2 S;  1M8V A;  2QQS A;  3CCE T;  2L89 A;  1X75 C;  4C8Q C;  3J7A F;  3L2R A;  3E9G A;  3FEO A;  1M90 U;  4LD6 A;  3M54 A;  3WXM B;  2RJE A;  3QJ6 A;  5DLQ E;  4NC6 A;  4M7A B;  3TW7 A;  2RHX A;  5EJC A;  1BIB A;  3OYA A;  2RHZ A;  2YRV A;  3OB9 A;  1NJI U;  1KQ2 A;  1Q86 C;  2JTF A;  2RD1 A;  3M58 A;  3VKG A;  4NL2 A;  4DOV A;  3GPL A;  4JS4 A;  1VQ8 T;  4PJO B;  2ZZD B;  1YIJ A;  2QQ9 A;  3HZJ A;  3JB9 J;  1LJO A;  2JNG A;  1D3B B;  3E19 A;  4J7F A;  3PT9 A;  2M16 A;  2ZGW A;  4J6Y A;  1IZ6 A;  4F7U G;  2FVU A;  4IUR A;  2X4X A;  4BAC A;  3CXC S;  1FX7 A;  4M77 B;  2DXT A;  3JB9 G;  5FU6 C;  1K8A C;  3T9N A;  3CC4 A;  5GAM g;  4M78 A;  2XI9 A;  3SFM A;  5GAM e;  4OVA A;  1U1T A;  4RMO A;  4N0A C;  1UGR B;  5CKF A;  1RI0 A;  3CMA T;  2P0Q A;  2DD4 A;  4LD9 K;  3VJP A;  5FU6 B;  2KDS A;  2MWP A;  4C92 G;  5CK9 A;  4J8O A;  3SWN C;  5LJ5 f;  3QZ9 B;  3WVD B;  4M75 B;  2RB6 A;  1M9S A;  3JCM g;  1YHQ A;  4J5Y A;  5CKE A;  3JCM e;  4E47 A;  3HHT B;  3M55 A;  2DO3 A;  2BUD A;  2OTL T;  4M78 E;  3VU3 C;  2BS4 A;  3BDU A;  1Q7Y U;  4BBS M;  3A8M B;  3RIR A;  3CC7 T;  2LCL A;  3QYB A;  3UDC A;  1KC8 C;  2QQ8 A;  4XTV A;  3PTA A;  3HL8 A;  4AKI A;  2RH2 A;  2RJF A;  5A2Q E;  3GNG A;  2RHI A;  2KK4 A;  3OW2 A;  3L2V A;  1MHN A;  1IRE B;  2ZPF B;  2LTO A;  2CGH A;  1H3Z A;  3QYG B;  2K4Y A;  4XTY A;  3FLG A;  2RHU A;  3OBW A;  1VUB A;  5CQY A;  1KHC A;  4A4K A;  4ATO A;  1QW1 A;  2RO0 A;  5HK3 A;  5DM7 R;  2CZ0 B;  4NOY A;  1K73 U;  2KSS A;  3MP6 A;  3NTK A;  1H64 1;  5EG2 A;  4MIM A;  1Y07 A;  2P0P A;  4FSX A;  3MP1 A;  3CCR A;  5GAO r;  3CCU A;  3M9Q A;  3HRT A;  1VQ7 T;  4ZGE B;  3MET A;  4R56 A;  4XK8 E;  5GMK i;  2HBP A;  5GAM h;  4LDW A;  3J81 E;  2EYQ A;  4MZT A;  3HPW A;  3CPF A;  1YCY A;  3VYG B;  4C0D C;  3I56 T;  2MWO A;  3JCM Q;  2JZ2 A;  4OF1 A;  4HCC A;  1DJ7 B;  3BDL A;  3OYN A;  4ZTF A;  5CR2 A;  3LLR A;  4M78 G;  2D0Q B;  1WJS A;  3HRS A;  2DXC B;  4GLK A;  4IUP A;  5FU7 B;  4BUG A;  3INZ A;  2QEX A;  3CD6 A;  4RG2 A;  2F69 A;  2O4X B;  4C0D B;  1Q81 C;  3JCM h;  5IAY A;  4HCZ A;  5A0L A;  2VV5 A;  5GAN 2;  3VUZ A;  4B9X A;  3L2Q A;  1S72 T;  2DD5 B;  2DJZ A;  4CI0 C;  1QVF S;  3CCL A;  2MF2 A;  3DKM A;  4HNU A;  4QVC A;  3G71 T;  3SB2 A;  4MFD A;  2DTO A;  2WAC A;  3L42 A;  3QDR B;  1FWZ A;  3JCM b;  3JCM X;  3I55 T;  1KQS A;  2E6N A;  2D6F A;  3JCM P;  2XDB A;  2F5T X;  1YJN A;  3OA6 A;  4JUV A;  1VQ4 A;  2A7Y A;  2KR6 A;  3OS1 A;  4JS5 A;  2JOY A;  3ASK A;  3DL1 A;  1I4K 1;  2EQK A;  3M5A A;  3OW2 S;  3KBG A;  2PUK B;  3URG A;  1QVG A;  4M7A A;  3CME T;  1TH7 A;  3CCL T;  3P8B B;  5CKB A;  5LJ3 f;  1VQP A;  3N5B B;  4C8Q A;  2MAM A;  2ZZD A;  4M7D D;  4PJO A;  3CCS T;  1N9R A;  1HK9 A;  4A53 A;  1D3B A;  2G77 A;  4J6X A;  5CO7 A;  5I2S A;  4JX4 A;  1VQM T;  4PL6 A;  4QVD A;  3MEW A;  3CCQ A;  1B34 B;  1Y7X A;  5AYF A;  1BKB A;  3KUF A;  2XIC A;  4M77 A;  2YHT A;  1W2B S;  5LJ5 j;  2OAU A;  4RG8 A;  4LOC A;  2DXU A;  4BDZ A;  4JLI A;  3C94 A;  4XAX B;  2EFI A;  5GAN g;  1YIT A;  4X9D A;  4HLQ A;  5GAN e;  3KXT A;  4C8Q E;  4MMK A;  2PU9 B;  3HFO A;  5J3B A;  3SD4 A;  5KE2 A;  3QJY A;  2OTJ T;  2A3L A;  4QVZ A;  4M75 A;  4XU1 A;  2CZ1 B;  3FC3 A;  3G6E A;  4M7A F;  3X26 B;  1BI0 A;  3NTH A;  3P8H A;  4IUQ A;  1QP2 A;  4II1 A;  2EQM A;  4N4I A;  2RA2 A;  4XU2 A;  5C6S A;  1M1K C;  1YJW A;  4PJO F;  3GLX A;  3GIB A;  3GP8 A;  2ZPG B;  1VQ9 A;  1AHJ B;  3R6O A;  4ZN3 A;  2DKG A;  2CKK A;  3LYI A;  1QVP A;  2HNI A;  2F5K A;  4BY6 B;  3JB9 H;  4M7A C;  4V2S A;  2XG8 D;  3J80 E;  3ZFJ A;  2VXE A;  1O9S A;  3RKY A;  1KC8 U;  2YLC A;  4M77 F;  3JCM c;  4PJO C;  2RM4 A;  3FRN A;  2EAY A;  4DOW A;  2VC8 A;  3LGL A;  1VQK T;  5FRM A;  3OBY A;  1N9S A;  1PSF A;  2XID A;  5A0D A;  5CCA A;  5GMK e;  5DLO A;  2RI5 A;  1RL2 A;  3JB9 I;  1KD1 U;  4BI3 A;  3CEY A;  3LH0 A;  4AKG A;  1EIF A;  1VQ6 A;  5KCO A;  3DB4 A;  1LNX A;  4M77 C;  3JCM J;  4M7D B;  2ZCF B;  3A8H B;  4M7A G;  4E7I A;  1NPR A;  4M75 F;  2M0O A;  3A8G B;  4PJO G;  4JX6 A;  4C8Q G;  4ZTJ A;  2WSC E;  2FHD A;  4BD3 A;  3HB9 A;  5GAM j;  5CAI A;  1WJR A;  2VUB A;  2XHC A;  3V8L A;  3CCE A;  5LJ5 h;  2KMG A;  3CBP A;  3TCJ A;  3VYG A;  4M75 C;  2NLU A;  4XTU A;  4C5G A;  3G4S A;  3DLM A;  4M77 G;  4R55 A;  3TU4 K;  3HSB A;  4EMK B;  1Y96 B;  3BW1 A;  2K3X A;  2QF7 A;  4BI8 B;  3L2W A;  4C5I A;  2HD0 A;  2DXC A;  3NFC A;  2X4W A;  3JCM W;  2ZPH B;  2O4X A;  2LQK A;  1NE8 A;  4F7U B;  2H3J A;  1BI3 A;  4HA8 A;  2ZPB B;  2EQU A;  3EFS A;  2LC4 A;  5CVI A;  4E7L A;  5IT9 E;  2DD5 A;  5CQX A;  3CCV T;  1N8R C;  1JJ2 A;  3JRZ A;  2GFU A;  3X20 B;  4XQ3 A;  2PVD B;  4M75 G;  4A54 A;  5GAN 5;  2O01 E;  2RK2 A;  4NS5 A;  2R5A A;  3QYE A;  3S6W A;  4L5G A;  2AHJ B;  5LJ5 d;  4ELZ C;  4BE2 A;  3OYG A;  5LJ3 g;  1OZ2 A;  1VQN A;  5LJ3 e;  2QQA A;  3A5Z B;  5HK0 A;  5CKH A;  1YI2 A;  4C92 B;  5GMK h;  3L1A A;  3HBL A;  2WSE E;  3TEE A;  5FRN A;  1VQL T;  1G3Y A;  1N6A A;  3OSS C;  1R8O B;  3CC2 T;  1JB0 E;  3CXC A;  2XD0 A;  2E1H A;  1Q82 C;  1PSE A;  4AI6 A;  2L8D A;  4TVR A;  5C0M A;  4EPC A;  1M5Q 1;  3E9F A;  2XDD A;  1YJ9 T;  2OTL A;  5CKD A;  4KBM B;  3ZBD A;  4BB7 A;  3RKX A;  5GAO l;  2EJ9 A;  5A0G A;  3M4Y A;  3CCR T;  3LGF A;  3QWL A;  3VKI A;  3CC7 A;  3CCU T;  4OB1 B;  5GAN 7;  3Q1J A;  4RCB A;  1I8F A;  5FU7 C;  2DIG A;  1M90 C;  4WF2 A;  4JJN K;  3BG9 A;  4EMH A;  3CCM T;  1SSF A;  1NZ9 A;  3V8K A;  5GAN 8;  1XTD A;  2K2V A;  3LWH A;  1X6O A;  2DEQ A;  4LDV A;  1NJI C;  5GMK l;  2DXB B;  3ME9 A;  2QEX T;  1WQW A;  3MEV A;  4XTW A;  4L59 A;  2YLB A;  1QVG S;  5CIU A;  3S3M A;  1I5L A;  3FB9 A;  2KAF A;  3QHS A;  5HKC A;  1VQ5 T;  3OMG A;  2CS7 A;  2RK1 A;  1ZHI A;  1YBY A;  3JSC A;  4PNO A;  2EJF A;  3ZEH A;  5GAM d;  3BFM A;  3PFS A;  1BI2 A;  5L8R E;  3OYJ A;  5LJ3 h;  3I56 A;  3OS0 A;  3QBY A;  4X34 A;  3CPW S;  1YJN T;  1VQ4 T;  1UGS B;  2XDP A;  3G7Z A;  3JAM E;  2KMT A;  3A8L B;  1BIA A;  3OYL A;  4B9W A;  1QP3 A;  4E7J A;  1VQO T;  3L2Z A;  4ELY C;  3FIF A;  3PMT A;  4A4G A;  3QSU A;  3JCM d;  2G3R A;  4M7D A;  1E7P A;  2BS2 A;  2E41 A;  4D6W A;  1S72 A;  1Q86 U;  2HAX A;  2QDY B;  4ELJ A;  2DVE A;  3OMC A;  3QG1 A;  3PIO A;  2C06 A;  1Q7Y C;  3I55 A;  3TRE A;  3CCQ T;  4JLG A;  1FXX A;  1G3S A;  2L5Q A;  5FLX E;  4E7H A;  4IKF A;  4M7A E;  5GAN j;  2QQB A;  3M4G A;  3LWI A;  3M57 A;  4N4G A;  1K8A U;  4J7I A;  4RCC A;  2K5F A;  2Y4X A;  3KHI A;  3FJP A;  4FU6 A;  2QI2 A;  1Y96 A;  4EMK A;  4PJO E;  3VV0 A;  4BI4 A;  4BE1 A;  3OYD A;  1YIT T;  4IUT A;  2R57 A;  3QUI A;  2QA4 T;  2XU8 A;  1QVF A;  5HY6 A;  5GAN 3;  4BY6 C;  1VIF A;  1K73 C;  1KQ1 A;  3A8O B;  1HXD A;  2RJD A;  4M77 E;  4C0Z A;  3TW6 A;  3FDR A;  3JB9 D;  4OB3 B;  4FT2 A;  4MDX A;  1N8R U;  2K3Y A;  2QTX A;  2QXF A;  3PGG A;  4BE0 A;  3OYB A;  3GF5 A;  2X4Y A;  3O8V A;  1YJW T;  3V7R A;  2GF7 A;  4JRP A;  4FL6 A;  2CYZ B;  1JBM A;  3BY7 A;  4J83 A;  5FRO A;  2GCX A;  3CCJ T;  3CBO A;  5KE3 A;  2QDJ A;  2BKD N;  5GMK j;  4M7D C;  4C92 D;  4HL4 A;  4M75 E;  1GXI E;  1V29 B;  2RI2 A;  4HKE A;  2OTJ A;  1WGS A;  2L3R A;  1UGQ B;  1VQ6 T;  3HKS A;  2V8I A;  2GFA A;  4PKC C;  3PNW C;  1X01 A;  1YIJ T;  3C4S A;  1OYX A;  4F7U F;  2XKO C;  1UB4 A;  3WVE B;  3HP9 A;  2LNV A;  3V7S A;  4EMK C;  4M7D G;  3JB9 F;  3RER A;  2V8K A;  4JRQ A;  1OZ3 A;  2ZPI B;  3QPH A;  3MP8 A;  2CZ7 B;  2PUO B;  4VUB A;  1M1F A;  5GAN h;  3CC4 T;  3RMQ A;  1O75 A;  4QSH A;  4P5N A;  1VQK A;  2DZ9 A;  3MEA A;  4KUL A;  5LL6 S;  3G4S T;  1KG1 A;  3EAE A;  3UWN A;  3HRU A;  3OYC A;  2DXB A;  4C92 F;  1VQ8 A;  4L6V 5;  3OYY A;  1UGP B;  2E12 A;  2RI3 A;  2JVV A;  4C8Q B;  5GAO q;  2GQV A;  2JUF A;  3OY9 A;  2DK3 A;  2HQE A;  3GNF B;  2D9T A;  3ER0 A;  4Q5W A;  5GAN f;  1Q81 U;  1YHQ T;  4QQD A;  2P4T A;  1N27 A;  4C92 C;  3OYH A;  1K9M C;  2RJC A;  4A4H A;  1WQ7 A;  3UPU A;  2E10 A;  3MEU A;  4YTL A;  5LJ3 j;  3RES A;  3QXE B;  2VXF A;  2PVG B;  1WNL A;  4X9C A;  3P8D A;  2LDM A;  1XQH A;  2DZC A;  4IUV A;  5GAN d;  4M78 D;  4KUD K;  3DLL A;  2BS3 A;  4HNV A;  2JTM A;  2KVQ G;  2K5L A;  5IN1 A;  3OYI A;  4LDX A;  4A4E A;  3MHX A;  5M9O A;  1XNI A;  2EKO A;  2QQR A;  3M59 A;  2V8J A;  3OSV A;  5D6W A;  3CMA A;  1YI2 T;  2IVW A;  1VQN T;  2VGM A;  3C12 A;  1U8R A;  3JCM V;  2MI6 A;  4OB2 B;  4C5H A;  4Z6Y A;  3CCV A;  2JN0 A;  4JRK A;  4MZP A;  4UC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...