2CZ7B

Fe-type nhase photo-activated for 75min at 105k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Active Center Structures of Photo-reactive Nitrile Hydratase during its Photo-activation Process
rcsb
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz7B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz7B02
3X28B 3VYHB 3WVDB 1PSFA 4FM4B 3A8LB 3X26B 3A8GB 4ZGDB 4L6V5 2DXCA 1UGSB 2PUKB 1QP2A 3VYGA 2WSFE 3A8OB 3HHTB 4ZGEB 2DD4A 3A8HB 2ZCFB 2CZ0B 4OB2B 2CZ7B 2DXCB 1DJ7B 4OB3B 3WVEB 1UGRB 2DD5A 2QDYB 3VYGB 4OB1B 2ZPGB 2PU9B 2ZPEB 2WSEE 2PUOB 4OB0B 2DD4B 3QZ5B 2PVOB 3QZ9B 2DXBA 1QP3A 2DD5B 2PVDB 1IREB 2ZPFB 1JB0E 5L8RE 1PSEA 3QYHB 4RKUE 2DPPB 2DXBB 2AHJB 4XK8E 2ZPBB 1V29B 3X25B 2CYZB 3X24B 3LW5E 2D0QB 2ZZDA 2WSCE 2CZ6B 3QYGB 1AHJB 2O01E 4KT0E 3X20B 2PVGB 3A8MB 1GXIE 4Y28E 3QXEB 2ZPHB 2ZZDB 2ZPIB 4ZGJB 1UGQB 2CZ1B 1UGPB
chains in the Genus database with same CATH superfamily
1PRMC 1VOLA 1M1FA 1YI2T 1P5EB 1Y57A 2EYWA 2K7AA 4PNOA 3SDZA 1K9MR 1JOWA 2R58A 4E7LA 2FRYA 3TW7A 4AFSC 3UT1A 2V1RA 1W70A 2YLBA 5IHKA 3CXCA 3M0UA 2GBQA 1SEMA 1KQ1A 4B9WA 5IH2A 3I55T 1VQOQ 1GUXB 2FVUA 3MEUA 1U5SA 2RD1A 1UFFA 4ELYC 1S72Q 3JCMQ 4E7ZA 2DD5A 4BDZA 4IUUA 2YUQA 2PMIB 2IW8B 4BE2A 2OTLA 4LDXA 2QQ9A 1N4MA 4HT9A 2PZ1A 1K8AC 2P4RA 3R6NA 1I8FA 5KYNA 3GNGA 3POMA 4CFXB 2RK1A 2PVDB 1VQOT 2BPMB 4Y91A 4OMMA 3DL1A 1S72T 4LXCA 4EMKA 5KE2A 5DM7R 2VB6A 3CXCP 5CEIB 4RTVA 5FROA 4IMYB 1RL2A 2LZ6B 5CCAA 4D8KA 1Q82C 1VQ7A 5GMKj 3VKHA 2J6OA 1B34B 1ZA1B 2CSQA 1GRIA 1TD6A 2RJCA 4J9FA 2D0QB 5KYUA 2CUBA 1I0CA 3D7SB 4KUIA 3CCLA 2RN8A 5LMKB 1P92A 4M7AB 2K6DA 4E2FB 5GMKe 1Y96A 1URCB 1VQ4Q 1SF9A 1K73U 3CCEA 3OS5A 3CMEQ 1Q82U 5HBHB 4CFMB 2BZYA 3P8DA 3G6ET 5IDNB 2X3WD 4PJOB 5HCKA 3VKGA 5LJ5j 4HA8A 1UGPB 1WHJA 1PSFA 3M03A 3A8LB 2WACA 3RKYA 4M75E 3OYEA 2DRMA 3FJPA 3OYYA 3A1PA 3CMET 1Q81R 1JQQA 2FRWA 1PD0A 4EOJB 1NPRA 4J6YA 3MHXA 2DD4A 1BCMA 3BFMA 3VUBA 3G71Q 2R5MA 2V8KA 3V8KA 5GAOp 1VQKQ 3OYCA 3INZA 1EFNA 2W9FA 2HSPA 3QHWB 3CBOA 5KYYB 1TG0A 4JJBA 3EFSA 3MI9B 5IXBA 2FYKA 3QJYA 1O9KA 1WXUA 2K5FA 1JO8A 5GAMh 1K0XA 4CC2A 5DLOA 3DB3A 4DOWA 3OB9A 1Q86C 2WMAB 1RAGB 4IIMA 1GL5A 5L2WB 1VQKT 1VQPT 4EMGA 2WHBB 1WHLA 5AYFA 1OL1B 3MIAB 4RCCA 2DPPB 3I5SA 4LUDA 5LJ3h 2E4HA 4F6UB 1KC8C 4CC7A 3OW2S 4MZPA 3DOGB 4EIKA 2CCIB 1AZGB 3LWHA 4XTWA 2XI9A 4BB7A 1Q86U 1YJ9T 1OZ2A 5GMKm 3S3NA 4J83A 3BDUA 4IIOA 4PFZA 1AWOA 4CFWB 4F7UE 4M75A 3NTIA 4RTYA 3K7AM 2QK0A 3RERA 4JLIA 4EDUA 1RI9A 2IIMA 3CBPA 3QHRB 3QXEB 2ZZDB 3QHSA 2EBPA 2DXTA 2JTMA 3MEWA 1BI1A 4M4ZA 2YT6A 1H1PB 2CZ1B 1MV0B 1TUGB 3EJ1B 1W2BA 1JU5C 3OA6A 3OYFA 3ER0A 4TTHA 3E9GA 1YIJQ 2OJ2A 5GAOl 3CC7Q 5J3BA 1OU9A 5I21A 3CC2A 3S6WA 4A4FA 2P4TA 1MGQA 4CRLB 3TNWB 4PFOA 2HD0A 4CFUB 1Y0MA 3E1SA 2OAWA 1N9RA 3M4YA 4PK4A 2EGAA 4OB3B 2DO3A 2R7GA 2BS3A 4C8QB 3CCRQ 1Q7YC 3JV3A 2QGGA 2DMEA 1LJOA 1W2BP 4MDWA 5LJ5g 4C0DB 2W96A 3TREA 5IT9E 2M51A 2AT1B 1Y07A 2JXBA 4HCKA 3UDCA 2P0PA 4QKUA 3Q1JA 4F7UA 4DEXA 3BY7A 1KK7A 2JS2A 1QKWA 2X3XD 4AFUC 1Q7YU 1M30A 1WI7A 4MMLA 1QCNA 2HQXA 1YWPA 4GLMA 4RTZA 4I3ZB 3RUXA 3OS1A 4M75F 5FW9A 4OGCA 2P84A 1E6GA 2EKHA 5HBEB 5CKHA 5HVYB 3JCMe 2WSCE 1C0MA 4DBQA 3KHIA 1X6GA 4M7AG 4J5YA 3QSUA 5CKDA 1NJIR 4LDYA 4ANJA 3ZFJA 1QVFA 4ZN3A 1VINA 1VQNA 5I11A 1K8AR 4HVUA 3OYLA 3OYJA 4F16A 4HL4A 2KRMA 2R57A 2P0KA 3JB9J 1M4ZA 1TOVA 2B86A 5HKCA 2O4XA 2J06A 4HVWA 4EOKB 1NM7A 2X1NB 3CMAT 1AISB 1X75C 3VYHB 4FM4B 1OULA 3L42A 4KBMB 5IHYA 3I5RA 4C5HA 1Q82R 3SFMA 1HSQA 1WX6A 2K5LA 3JRZA 4CXAB 1SSFA 1G2BA 2EQJA 3VYGA 2EYXA 1YCSB 1MMAA 2GFAA 3EHRA 3HRSA 3SB2A 1U3OA 3A5ZB 1MMDA 2DVJA 2VUBA 5FU7C 4QQGA 1NZ9A 5LJ5f 2XDBA 3QG1A 2QAZA 1IO6A 1W4SA 1MV3A 4AG2C 1FXXA 4C0ZA 2MWOA 1ZX6A 2NUPB 4E7JA 1ZSZC 3N5BB 3TEEA 3CCSQ 4F7UF 4MFEA 2PQWA 1H1RB 3QIIA 4LN2A 4XTVA 3I56Q 2BKDN 3CD6A 1H4LD 2YUPA 5HK3A 4J9BA 3MCAB 4JRQA 3BE3A 3NMZC 2YRCA 1GY3B 5D6YA 1WHGA 1G5VA 2BE9B 2RHYA 4EMKC 2ABLA 5DQWA 1H28B 2LQ8A 3CCST 3LLRA 2ZPBB 1X27A 3JCMW 1SG5A 2DBKA 3OYDA 1I07A 4R0KA 2VC8A 1VQ9A 1VYWB 4ELLA 4HNVA 1VYVA 1BI2A 2HEQA 3CCVQ 1K1ZA 1FX7A 3NFCA 3OSVA 3V7CA 2CP5A 1H26B 2DEQA 2L3PA 2RNAA 4OMLA 1OIYB 1PWTA 2EVRA 5CKFA 1BBZA 1KQSA 2LJ1A 1UNHD 5GMKl 2JTEA 2FG0A 2F5KA 1OKVB 1CKBA 2HQEA 2KK4A 2O31A 5ECAA 4AMCA 1M90R 2ED1A 4M77A 1YITQ 2XHCA 1TXQA 3GP8A 2QEXA 2QFZA 2IVWA 4OF1A 1E7OA 4LD6A 4ZGDB 5FWBA 1B3QA 1KC8R 3P8BB 1M2VA 1BU1A 2VWFA 4J9GA 2QDLA 2RJDA 2RK2A 4KGZB 4XTZA 4EMHA 3C12A 3SHWA 2QTVA 1KQSP 5EG2A 2LJ3A 3H8ZA 4YTLA 2M16A 2CZ0B 2MYSA 3HP9A 4RG2A 4JZ4A 2DXCB 1B07A 4J9EA 4UN0A 2UZEB 5HNBB 3QWYA 4C8QG 1N8RU 1PHTA 2Z0WA 4ME7A 1I5LA 2PU9B 2R5AA 2CP6A 3C94A 2COWA 4N4HA 4A53A 5KE3A 2DXBA 2DF6A 2QA4T 3TQ7P 2X4XA 2K3BA 2OTJA 3CCQA 2ESWA 3PMTA 3M4GA 2E70A 3NDQA 5KYWA 2VV5A 3OSSC 1YJWQ 1QVFS 2DZCA 4RTXA 1VYUA 3S3MA 1H8KA 3JCMb 2KEAA 1LCKA 5GAOq 3E2UA 1XQHA 1RI0A 4FYXB 2RPNA 1MHNA 1IGQA 2CYZB 2LDMA 2NLUA 3V8JA 4ELJA 1VIEA 1MNEA 2DM1A 3OS2A 2KR6A 3RIRA 3VS5A 2I0NA 4F70B 3CCJA 2F2CA 2DKGA 1M2OA 2K79A 3CCJT 1KIKA 2ROTA 4M75D 2PVGB 1NG2A 4HKEA 2MCNA 4M77F 2XD0A 1OQKA 3ZBDA 5GANg 5KYXB 3QJ6A 3H0HA 1QVGS 1WHHA 2DTIA 1QWEA 4C5IA 2JM8A 2YUOA 4M7DB 3G4SA 2EAYA 5C0MA 5A0GA 1VQMA 2RO0A 1AD5A 5DLQE 4DEYA 2L0AA 2YRVA 4E6RA 2KRNA 4AFZC 1TTHB 3A8GB 2RQRA 4O5VA 2KMGA 2LJ0A 4LD9K 2E10A 4XU3A 2EGEA 3HHTB 3M5AA 3M55A 4ZGEB 3V8LA 4EORB 4HVVA 4AG1C 4E7SA 1D3BA 3EG9A 3MKDA 1R0BG 1YI2A 4UC4A 3EH2A 4MZMA 1KG1A 1KFZA 4LDWA 4M77G 1V1CA 2QDJA 3BDLA 2ZPEB 2DILA 2V8IA 2L89A 2VVKA 5FWCA 2IN3A 4BY6C 2DLPA 1QP3A 2HSEB 1ABOA 2DJZA 3EFOA 1X6BA 3MY1B 2CGHA 5D7UA 2DEUA 4OGEA 3I55A 5J39A 4IURA 3TU4K 4LDVA 1WXBA 3THKA 1BI3A 4Q5WA 1ZSZA 3CC4Q 2GQVA 4EOIB 2QQBA 1SRLA 1ZUKA 2RQTA 1UDLA 2KE9A 2AHJB 2RHZA 5GAOn 1M5Q1 2DVEA 3JCMJ 4BCMD 5GANf 1OX9A 4M78G 4IKFA 1VQ8Q 5HY6A 1HK9A 2G77A 2HZYA 1QLYA 3I9QA 1VQOA 3URGA 3FDRA 3OW2P 1S72A 1WJRA 3UA7A 3MJXA 5CKBA 3CC4T 2KDSA 1WGSA 2A28A 2W9ZA 1UUEA 3EGDB 1TSFA 1VQ7Q 1IHWA 2NUTA 4HNTA 1K73C 1UJ0A 4M7AE 3A98A 2VGNA 2MIOA 3MP8A 4FYVB 3MP6A 4JRIA 3O0GD 3VKIA 3QWXX 1AT1B 4IUQA 4BCPB 4YOSA 5CYIB 4BCQD 1CSKA 1D0ZA 4YOZA 2X4WA 1GUXA 3CCEQ 4BCHB 5I2MA 2JUFA 2O9VA 2C5OB 1WPYA 2PUKB 2FL7A 2WJ9A 4KRDB 3G6EA 1UB4A 2WSFE 1UECA 2KMTA 2F2VA 2GFUA 3L2QA 1IGUA 4KULA 4O6JA 1OX8A 3M0PA 4EC9B 2O88A 2V8JA 4N4IA 5LJ5h 2Y4YA 3V7RA 1VQ5Q 4PLLA 4J7FA 2FEIA 1OIUB 3TW6A 1VQ4T 3T9NA 1E7PA 1GFCA 3CMEA 2D6FA 1BI0A 3WXMB 2PK2A 3QZ5B 2GNCA 4BACA 2L2PA 3QZ9B 2JTFA 4K11A 2K5IA 5IHNA 2JNGA 2F5TX 1WYXA 2RA2A 4DA4A 1B34A 2O2OA 1TH7A 2LQWA 1VQ5T 4BY1X 2F69A 2C5NB 2RMOA 2EYYA 1M9SA 4M7AA 4D6WA 1QVPA 2A37A 1SSHA 2PK9B 4M75B 1OV3A 4PJOA 1NEGA 2ZAEA 2BZ8A 3G71A 1M3BA 3G71T 1EZZB 1NYFA 1AHJB 4PFPA 1VQLQ 3EGUA 1AWXA 1VQKA 1OEBA 2CKKA 2IG0A 3X20B 1VQPA 4BBSM 1VQ6Q 3EHQA 4ZTFA 4GLKA 3EG1A 5GAMj 2VXEA 1OI1A 2EQMA 1K76A 2LT4A 1D0XA 1JEGA 4FT2A 4KH1B 2GF7A 1G3SA 2VKNA 3JCMc 3VS7A 1X6OA 1UG1A 4M77D 4MFDA 1YJ9A 5GAMd 2KGTA 5GAMe 3O5ZA 4M77C 5FU6C 4EPCA 4F6SB 5LJ3j 4PJMA 4J8OA 3JSCA 4NC6A 4JS4A 2CT3A 4EOSB 1M1KR 1VQ6T 1KHCA 3REBB 3SWNB 1R77A 2DJQA 3PFSA 4FYYB 2M02A 1YNZA 2E3HA 3TNHB 5LJ3d 4OGRB 4C92B 5LJ3e 3BG5A 3CXCS 2WFYB 5KYYA 1N9SA 2K2VA 1UHFA 3DDQB 4BCFB 4DOVA 3L2RA 1WLPB 2PTKA 2CZ7B 4JDSA 5BNJB 3WVEB 1PKTA 3AHUA 2CH4A 4M78C 2XKOC 4KH0B 3CC2Q 5IHIA 1C1AA 4XQ3A 4ROCA 2ZPGB 2DRKA 2J6FA 2JVVA 4Z88A 4N0AA 3H4CA 4F7NB 2IPOB 1JJ2A 3REAB 4MDXA 2IW6B 1YWOA 2X4YA 4C8QE 3VS3A 2AZSA 2YUNA 2KYMA 1AZEA 1ABQA 3R6OA 4M7AF 4Z6YA 2I40B 3NPFA 2QASA 2RQWA 1WQ7A 2KXDA 1NLOC 1YIJT 3V7SA 4X34A 2J7IA 2DX1A 3CC7T 2YHTA 4PJOF 3FIFA 4LOCA 1HD3A 3M59A 1NLPC 1KD1U 3LGLA 1XO2A 3C95A 4BCND 4B6MA 1XTDA 2ZZDA 4HXJA 4BI8B 4QVDA 2G6FX 2RHIA 3OYMA 2LCSA 1ZUUA 4Y92A 2I53A 3PIPA 1JJ2P 3OYBA 5DQVA 3J81E 2B9RA 1Z9QA 2QGFB 4AFQC 3CCRT 1E9HB 3GTMS 3CPWA 4E7IA 4WTOB 4ROEA 1C9BA 2QQSA 1N5ZA 4BI4A 1MUZA 3OMGA 4BCQB 1FINB 1OGUB 1IRXA 3JCMd 3OYGA 1ZUYA 1GCPA 3VS6A 4ORZA 1TWBA 3E9FA 3UATA 1IB8A 2BKZB 3C0CA 4J6WA 4JX4A 3RESA 1HJDA 1VQNQ 4M6VA 4C5GA 1X01A 2E12A 3EFRA 2EJFA 4PJOG 1YN8A 4GY5A 3VRYA 1F5QB 1YP5A 4XTUA 1JKWA 2M9UA 2JM9A 2IW9B 4C8QA 1AEYA 4HCZA 1OU8A 2CP3A 2KY9A 4Z8AA 1OPLA 4ZTJA 2CJMB 1XOVA 5A2QE 3CPWP 3CMAA 2RHUA 5GAN5 3M0QA 1JXOA 3OBYA 5C6SA 2OAUA 1GCQA 1MMGA 4XU0A 3KUFA 1K73R 3UF4A 2X9HA 4A4EA 1X69A 4FW1A 4XU2A 4NOYA 4AT1B 4HCCA 3U23A 4F7LB 1YHQQ 3QYEA 1O9SA 4OMPA 5D6XA 3ULRB 1RACB 2QQRA 5KH6A 3MO8A 1TS9A 4PJJA 4M77E 3MEAA 1OL2B 5I2SA 4DBRA 1K9MU 2D9TA 1G3NC 2SRCA 3FC3A 4RUGA 1H1SB 2EYZA 1V29B 3OQ5A 3CD6Q 1QW1A 5J26A 4YC3B 3ME9A 5GANh 3HRTA 2YRDA 4BCKB 3QYGB 1BIAA 3L2WA 4OMFB 2RI5A 2LVMA 2CP0A 1WNLA 4KGXB 3EAEA 1W98B 3FRNA 1SPKA 4JRPA 4M78E 1U1TA 1G3YA 1ZQ1A 3CCUQ 4VUBA 4Y28E 4EOPB 4A4HA 4FIBA 3CCSA 1VQ9Q 2HDAA 4PLIA 2XIDA 2ZPIB 4EOLB 2KVQG 4ZNXA 3QPHA 4A63B 2HAXA 4J9CA 4FSSA 3EGXB 2QI2A 3H41A 3I56A 2EJ9A 3I56T 2DTOA 1OI9B 3JB9H 2KAFA 1W2BS 1PG5B 1D1CA 4C8QF 4KGVB 3H9NA 1M3AA 4Z02A 2LP5A 4XU1A 2E64A 5GJWB 1IXDA 3GF5A 5FRNA 4C92G 4NL2A 3PO3S 3PMIA 2NUPA 1ACMB 1UNLD 2Y4XA 3G7ZA 3HL8A 2LW4A 3CCVT 1RAFB 1Q86R 2QF7A 3UPUA 4HT8A 3JB9F 3A8HB 2V26A 3LGFA 4CC3A 2XMFA 3M0SA 3OMCA 2QEXQ 3HFOA 1DJ7B 4R56A 2LCCA 1T3SA 1FVVB 3FB9A 2DTHA 4EOOB 5D6WA 2QDYB 1M8MA 4BE0A 4OB1B 2MK5A 3QBYA 2DL4A 3TVTA 1N8RC 1LPLA 1D09B 2X4JA 3M0RA 3L2VA 2RQUA 1B7TA 1Q81C 4P5NA 4PJLA 1FMVA 3PIOA 2JOYA 2E6NA 5CQXA 1Z9ZA 1YITT 2RJFA 4IUPA 1JXMA 2E3IA 1G3WA 4AKIA 2FHDA 1BIBA 4M78A 2AIRB 2CP2A 3RKWA 2HMAA 3H6ZA 5EC7A 4M7AD 2UUEB 2DZ9A 2MPXC 4F04B 1Q81U 2Y90A 4X1VA 3TN8B 2XDDA 2HL5C 4M7AC 2RI2A 1LOJA 3DLLA 3X24B 2OTJQ 2QA4A 3CCQQ 3BHUB 2VASA 2MMPA 3S3OA 4PJOD 1RAEB 1Y71A 3JB9G 1KHIA 4RTTA 2P0QA 4LNPA 5GAN2 4PJOC 1VYTA 2NUZA 2EKOA 2GTJA 3G33B 1GXIE 3HKSA 2KRSA 2LNVA 1PD1A 1SKUB 1JBMA 1QMZB 2A36A 1GBQA 3PE0A 5FGKB 4X9DA 2WIPB 3OYHA 1H3ZA 2JJ9A 2X51A 4CI0C 4MZTA 2EJGA 4DQ2A 1JSTB 1FKMA 1UGVA 1PM3A 2LX7A 1E6HA 3CCMQ 4EOQB 3DDPB 1M3CA 6AT1B 5HBJB 1D0YA 3UWNA 1D3UB 5HK0A 2EQIA 1YJWT 3RMSA 4M7DE 1Q7YR 4E47A 1QQJA 3VS0A 1Y7XA 2RH2A 2A7YA 1WFWA 1QCFA 4L6V5 2DXCA 3M0TA 4RTUA 3JCMf 2CUDA 4OVAA 3ASKA 4XTYA 3G4SQ 4MIMA 2ATCB 1VQMQ 5GMKi 3ZL7C 3CCMT 3FEOA 2RF0A 2EPDA 4HNUA 2YWWA 8AT1B 4JLGA 2MAMA 1QMCA 4QVZA 1R8OB 5FU7B 1RABB 3QKJA 3LQ5B 5FLXE 1MMNA 2C06A 2UZBB 2L5QA 2CT4A 4OR5B 4M78F 4N0AC 1SHFA 1RUWA 2DIQA 2I2LA 1YJNQ 1AVZC 4JS5A 3QDRB 2EQUA 2FZKB 1BU2A 2DD5B 1NYGA 3GLXA 2K4YA 5LQFB 1IREB 4FL6A 1YI2Q 2BIVA 4EONB 4GBQA 3QYHB 2DK3A 3GIBA 3MEVA 4AKGA 2ED0A 3F70A 4XK8E 1XNIA 1G83A 3OW2A 5KYXA 1ZSGA 3BHTB 3VUZA 2EFIA 2QTXA 3M56A 2JMAA 3LH0A 3I55Q 4EMKB 3META 1EX4A 4C92C 5GAN8 4M7DA 2O01E 4WF2A 1KQSS 2ECZA 4KT0E 2NUTB 2C4GB 2MI6A 5EFQB 1H24B 4AI6A 8ATCB 3BW1A 5CIUA 2B8AA 3L2UA 2OTLQ 3HB9A 2DMOA 1VOMA 1W6XA 2COYA 2DL5A 5KYUB 1NEBA 1VA7A 2L3RA 4RMOA 2GTOA 1Y96B 4BBRM 4NS5A 5L23A 5GAN6 4CFUD 5KCHA 3IQLA 1NJIC 3HZJA 3CC4A 2HQHA 2XK0A 3HPWA 2EGCA 1UGSB 2WPAB 4FYWB 2OTLT 3VS1A 1RAAB 4C8QD 2LCLA 3L2ZA 3O8VA 4C8QC 4J6XA 5ACBA 1VQ8A 1VQ8T 1GFDA 1OOTA 1YFNA 2ZCFB 3CCLQ 2RB6A 5GMKh 1GBRA 2LX9A 2E65A 2LRQA 4TVRA 4PJOE 4C0DC 1NJIU 1K4US 4LDUA 2CCHB 1S1NA 2HBWA 1C6VX 3HBLA 2RI3A 2EYQA 1GCQC 3AT1B 3JB9D 3G6EQ 1K8AU 2C6TB 2PUOB 1VQ7T 2DD4B 4J7IA 1G8XA 1LNXA 4WCIA 4C0GA 5EJCA 2KT1A 1M1GA 3OYAA 1WJQA 3JCMP 2JW4A 2JGZB 3CCLT 2MOXA 2ZPFB 2YXYA 1VIFA 3JAME 1BB9A 3NHNA 2V1QA 3RR6A 1VUBA 2NWMA 3J80E 1O9KB 2QYZA 1VQ4A 3CCET 2H8HA 4M7DF 2C5VB 1RLQC 4FT4A 1H3HA 4EC8B 4F7JB 4RG8A 2JMCA 4JJDA 3EOCB 3EGDA 2DE0X 1AD6A 5IN1A 1BK2A 3RKXA 3FJ5A 1WQWA 5CQYA 1YCYA 4QSHA 2DL3A 1WJSA 3PVLA 1UJYA 1FYNA 3NTKA 1VQ5A 2KI7A 5LJ5d 5LJ5e 1N8RR 3A8MB 4BCJB 3TCJA 3ZEHA 1PNJA 3RDVA 4ZGJB 1BCOA 3HFNA 4BDYA 2EIFA 2BZXA 4ELZC 5CK9A 2QXFA 2HBPA 2KR3A 4OMNA 5M9OA 4KRCB 2KSSA 3MP1A 4FW2A 2EWNA 5CR2A 2DIGA 5A0DA 3X28B 2QQAA 4XTXA 1VQPQ 1YBYA 1TU0B 1H641 1FMWA 1AOJA 2H3JA 2HNIA 3HTRA 3PNWC 2KT8A 1ZA2B 1I1JA 2WEVB 4A4KA 1H92A 2KROA 2A08A 4M7DG 4C0FA 1YJ9Q 2C0OA 1M90C 3DKMA 4DBHA 2WXVB 3PVQA 2O9SA 3MY5B 3EG0A 4JX6A 4C92E 4F6WB 1VQLA 2F2XA 2QG9B 4FU6A 1VQLT 1XJWB 4F17A 2C5XB 1JRIA 1VQ6A 1AWWA 3QWLA 2KQWA 3UA6A 1D1BA 3VV0A 2WSEE 4KUDK 2J6KA 2JZ2A 4D8DA 2BUDA 4LE9A 1M90U 1EIFA 1FMKA 2CSIA 2E5QA 2DBMA 3DB4A 3QDFA 4E7KA 1KSWA 3M9QA 4QQ6A 1SHGA 1JB0E 2K3XA 1PC0A 4JUVA 1K0SA 2E1HA 4M78D 4CC4B 5I5ZB 4BY6B 4BCOB 1U1SA 1KC8U 5GAN3 2XDPA 2JN0A 1A0NB 1ZBJA 1TFBA 1UHCA 2D8JA 3X25B 4F7UB 5CAIA 1KD1C 2E6ZA 2YDLA 1HYOA 3LX7A 4IUTA 2AKKA 2CZ6B 3EG2A 3BG9A 2K57A 3H0IA 1QKXA 2CREA 2V22B 2D0NA 4IUVA 4JJNK 4BCMB 2BE7D 1YIJA 3CQTA 1NE8A 2ENMA 1F1BB 3CC2T 1M8VA 2VYTA 3CC7A 1U06A 3DJBA 2GCXA 4RCBA 3QYBA 3BLHB 1OZ3A 3SWNA 2C0IA 2L3SA 2GGRA 3LYIA 1X2QA 2M0YA 2L8DA 1KXUA 3DTOA 1ENWA 1N27A 4PL6A 4C92A 4F7SB 1O75A 1KQ2A 3JB9I 3E19A 1ZLMA 1M27C 1WDXA 1GH6B 1ARKA 2VXFA 2BS4A 3CCRA 4ZN1A 2O4XB 2DYIA 3VU3C 3JCMh 2DYBA 3A8OB 3NTHA 4XAXB 2DETA 1WXTA 3VRZA 4HCBA 2BS2A 2CP7A 3L1AA 1N6AA 2G3RA 2DAQA 1ZP2A 1NPPA 2SEMA 2VGMA 3TSZA 2LMJA 5CVIA 3VYGB 1X2KA 7AT1B 2D8HA 3PTAA 5IF1B 3VS2A 2JS0A 4L5GA 2UZLB 2PHGA 4JZ3A 4PKCC 3M58A 2F2WA 4J9HA 1JSUB 4V2SA 2BTTA 3P8HA 1FWZA 3CMAQ 2MF2A 4R55A 1UE9A 1U8RA 1T0HA 2DA9A 2AKLA 3DLMA 1QCOA 3OBWA 1PSEA 2IVXA 5GAMg 1R0CB 4FX3B 3BLQB 1VQNT 1K9MC 2W10A 1T3LA 5FRMA 4HLQA 3F5XB 1TUCA 1I5OB 3LW5E 1NBEB 3RNJA 3EG3A 3CBMA 5LJ3g 3G1JA 4AKHA 2HKQB 2M0OA 4M7DD 3SEMA 5LL6S 4M7DC 1LVKA 2W99A 4JPBW 4C92F 3C4SA 3JCMV 2RJEA 2ZPHB 2LT1A 1QVGA 2YLCA 1UGQB 1RLPC 4M75G 1TUDA 5I22A 2W2HA 3KFVA 1YHQA 1QVFP 2KBTA 1YHQT 1PRLC 2G9XB 3OYIA 4BY7X 1W1FA 2AZVA 3JCMX 4J9DA 2F1LA 2CS7A 3EIDB 3WVDB 3X26B 2JT4A 4LUEA 1PKSA 4KRTA 1OPKA 4BCIB 4RODA 4QVCA 2DL7A 4BUGA 5ICPB 5GANj 2ROLA 1QP2A 2M1HA 2E5KA 1RADB 4M77B 2L3QA 5FU6B 1PKDB 4JRKA 2FZGB 3CD6T 4DBFA 5CO7A 1ZBXA 3OYKA 4BXXX 1H25B 5GANd 4BCGB 1UNGD 2XICA 5GANe 4OB2B 4CFVB 3M54A 5CKEA 1WHMA 2C0TA 1M2VB 2PJQA 1QVGP 2EUFA 1I81A 2FZCB 1J3TA 2AK5A 2DFUA 3CCUA 3RGFB 1KJWA 3CCUT 1QLBA 4OMOA 1ZHIA 2FPFA 4JJCA 1JJ2S 4NSTB 2GQIA 4JX5A 5GAMf 1VQ9T 4A54A 2PNIA 5A0LA 5GAOr 4M78B 3CCVA 2COZA 4YOOA 3OS0A 1WZOA 3NGPA 5L8RE 2KXCA 4Z89A 4PJNA 4II5B 3JCMg 5LJ3f 3KBGA 2K3YA 3KXTA 4II1A 2WIHB 2DXBB 2KNBB 4F7UG 2MWPA 3GBQA 1BKBA 1HXDA 4G6LB 2OX7A 3VS4A 4QQDA 5KYWB 3EH1A 2ZGWA 4N4GA 1H27B 1PCXA 1YITA 3EGXA 2QEXT 5HQ0B 1IZ6A 2EQKA 3RBBB 2YSQA 3QO3A 4CFNB 5DY9A 1T0JA 4BCNB 1SRMA 1IHVA 3SD4A 3CPWS 2HCKA 2H3EB 5KCOA 2DNUA 2NYSA 2QA4Q 1WHKA 4QW2A 1QWFA 3PT9A 4NL3A 2LQNA 1CKAA 2XG8D 3M57A 1K9AA 3M53A 3MPUB 4BI3A 2FPDA 5IDPB 1RAHB 3RMQA 1Q95G 4X9CA 3FLGA 4E7HA 4OMQA 2A0FB 2RM4A 3B57A 1H1QB 1KD1R 2DXUA 2W0ZA 2J05A 4OP0A 4ESRA 3H0FA 2XU8A 4C5EA 1OKWB 2X35A 2UZDB 2A3LA 2OTJT 3VJPA 3CCQT 5GAN7 3J7AF 3BHVB 3CCJQ 3TSWA 4B9XA 2LNHB 2K2MA 4QT7A 1YJWA 2CDTA 1BYMA 1UGRB 2DL8A 1M1KC 3OY9A 9ATCB 3BG3A 4OB0B 4MMKA 1RAIB 5AT1B 2LQKA 2PVOB 1UEBA 1D3BB 2QQ8A 3EG9B 3GNFB 4A4GA 4L59A 4J9IA 1D1AA 3CCMA 2D1XA 3I35A 4F14A 1AWJA 1I4K1 3LWIA 1M1KU 4M75C 2KYBA 2RQVA 3HSBA 2FB7A 4RKUE 3PGGA 3TNIB 3GPLA 1G3TA 2QGSA 3CPFA 3EFOB 2FPEA 3LH5A 1UTIA 2HKNA 3G4ST 3HRUA 1ZSZB 1VQMT 1OYXA 1WA7A 2FO0A 3BLRB 4BE1A 2LC4A 2RHXA 3HO8A 4ATOA 4RTWA 5IXFA 2LTOA 4BD3A 4Y72B 1V76A 4EOMB 5GJVB 3OYNA 2CH4W 3GOXA 1X43A 5GAN4 2WMBB 2HL3A 4FSXA 1WIEA 3QUIA 2EW3A 3SWNC 5IAYA 2E41A 5GAOm 2OI3A 4CRIA 4FCYA 1MNDA 1YJNA 1YJNT 3CEYA 2DERA 4C92D 2K9GA
chains in the Genus database with same CATH topology
5A0DA 3X28B 3GP8A 2QQAA 1M1FA 3E9FA 2QEXA 4XTXA 2QFZA 2IVWA 1YI2T 1YBYA 1H641 4J6WA 4OF1A 4JX4A 4PNOA 3RESA 2H3JA 4LD6A 3SDZA 2HNIA 2R58A 4E7LA 4ZGDB 4M6VA 4C5GA 3PNWC 1X01A 2E12A 3EFRA 2EJFA 3P8BB 3TW7A 4PJOG 4GY5A 4XTUA 3UT1A 2M9UA 4A4KA 4C8QA 2RJDA 2RK2A 4XTZA 2YLBA 4EMHA 3C12A 4HCZA 4M7DG 4C0FA 5EG2A 3CXCA 2KY9A 3H8ZA 1KQ1A 1M90C 4B9WA 4ZTJA 3DKMA 1XOVA 4YTLA 2M16A 3I55T 2CZ0B 1KD1C 5A2QE 3HP9A 2FVUA 4RG2A 3CMAA 3MEUA 2DXCB 4JX6A 2RD1A 4C92E 2RHUA 4ELYC 4C8QG 5GAN5 3OBYA 3JCMQ 5C6SA 1VQLA 4FU6A 1VQLT 2DD5A 2OAUA 1JRIA 4BDZA 1VQ6A 4XU0A 1N8RU 3QWLA 4IUUA 3KUFA 2KQWA 4ME7A 1I5LA 2PU9B 2R5AA 3VV0A 4BE2A 3C94A 2OTLA 2WSEE 4N4HA 2QQ9A 4KUDK 4LDXA 4A53A 4HT9A 2JZ2A 4A4EA 4XU2A 1K8AC 4NOYA 5KE3A 4HCCA 2DXBA 2BUDA 1M90U 3QYEA 1O9SA 1EIFA 1I8FA 2QA4T 5D6XA 1Q86C 2X4XA 3GNGA 2QQRA 2E5QA 2OTJA 3DB4A 5KH6A 3CCQA 3MO8A 2RK1A 2PVDB 3M9QA 3M4GA 3PMTA 4E7KA 1VQOT 2E70A 4QQ6A 4M77E 1JB0E 4Y91A 2K3XA 2VV5A 3OSSC 4JUVA 3DL1A 3MEAA 2E1HA 4M78D 1S72T 1QVFS 2DZCA 4EMKA 5KE2A 5I2SA 4BY6B 5DM7R 1K9MU 2D9TA 3FC3A 3S3MA 1U1SA 5FROA 1KC8U 1RL2A 5CCAA 3JCMb 5GAN3 5GAOq 2XDPA 2JN0A 1Q82C 1XQHA 1VQ7A 1RI0A 3VKHA 1V29B 5GMKj 1MHNA 3X25B 2CYZB 3OQ5A 4F7UB 1QW1A 2LDMA 2NLUA 2E6ZA 5J26A 1B34B 3V8JA 4ELJA 1VIEA 3CC7T 3OS2A 3LX7A 2RJCA 3ME9A 2KR6A 2D0QB 3HRTA 4IUTA 3RIRA 5GANh 2CZ6B 3QYGB 1BIAA 3L2WA 4KUIA 3CCJA 3CCLA 4OMFB 3BG9A 2DKGA 2K57A 2RI5A 3CCJT 2LVMA 1WNLA 3EAEA 3FRNA 4IUVA 1P92A 4M7AB 4JRPA 5GMKe 4M75D 4JJNK 2PVGB 1Y96A 4HKEA 4M78E 1YIJA 4M77F 1NE8A 1U1TA 3ZBDA 1G3YA 1ZQ1A 5GANg 3CC2T 2XD0A 1M8VA 2VYTA 4VUBA 4Y28E 3CC7A 4A4HA 1K73U 4FIBA 2GCXA 3OS5A 4RCBA 3CCEA 3CCSA 3QJ6A 1Q82U 4PLIA 3QYBA 2XIDA 3P8DA 3G6ET 1OZ3A 2ZPIB 2KVQG 1QVGS 3SWNA 4PJOB 3QPHA 2HAXA 3LYIA 3VKGA 2DTIA 4C5IA 2QI2A 5LJ5j 3I56A 2EJ9A 2L8DA 3I56T 3G4SA 4M7DB 2EAYA 5C0MA 5A0GA 2DTOA 4HA8A 1UGPB 1N27A 3JB9H 2KAFA 4PL6A 1W2BS 1VQMA 4C92A 2RO0A 1O75A 1KQ2A 5DLQE 4C8QF 3JB9I 2YRVA 3E19A 1PSFA 2WACA 3A8LB 3RKYA 4M75E 3A8GB 2VXFA 3OYEA 2BS4A 4O5VA 4Z02A 4XU1A 2E64A 2KMGA 3FJPA 3OYYA 3CCRA 4ZN1A 3GF5A 4LD9K 2E10A 3CMET 5FRNA 2O4XB 4C92G 4NL2A 4XU3A 3PMIA 3VU3C 2Y4XA 3G7ZA 3HL8A 3JCMh 1NPRA 4J6YA 3CCVT 3MHXA 3A8OB 3NTHA 4XAXB 3HHTB 3M5AA 3M55A 4ZGEB 3V8LA 4HCBA 2QF7A 2DD4A 3UPUA 4HT8A 3JB9F 3A8HB 3LGFA 2BS2A 3VUBA 3BFMA 3OMCA 3L1AA 1N6AA 1D3BA 3HFOA 2R5MA 2V8KA 1DJ7B 2G3RA 3V8KA 5GAOp 4R56A 1YI2A 4UC4A 2DAQA 2LCCA 1NPPA 3FB9A 2DTHA 5D6WA 3OYCA 2QDYB 2VGMA 3INZA 4MZMA 5CVIA 3VYGB 4BE0A 4OB1B 1KG1A 3QBYA 3CBOA 4LDWA 4M77G 2QDJA 1N8RC 3BDLA 3PTAA 2ZPEB 3L2VA 2X4JA 2V8IA 3EFSA 2L89A 4L5GA 2FYKA 4PKCC 3QJYA 1Q81C 4BY6C 2K5FA 3M58A 4P5NA 1QP3A 5GAMh 2DJZA 5DLOA 3PIOA 4V2SA 3P8HA 2JOYA 3DB3A 2E6NA 1FWZA 3OB9A 2CGHA 5CQXA 4DOWA 1YITT 2MF2A 2RJFA 4IUPA 4OGEA 4R55A 3I55A 5J39A 1U8RA 1G3WA 4AKIA 2FHDA 1BIBA 4IURA 3TU4K 2OTJT 4LDVA 4M78A 1VQKT 1BI3A 1VQPT 3DLMA 4Q5WA 4EMGA 3OBWA 1PSEA 5GAMg 2GQVA 3RKWA 5AYFA 2QQBA 3H6ZA 4RCCA 2DPPB 1VQNT 1K9MC 2AHJB 5LJ3h 2RHZA 5FRMA 4M7AD 5GAOn 2DZ9A 1M5Q1 4HLQA 2DVEA 3OW2S 3JCMJ 1Q81U 1KC8C 2Y90A 4MZPA 5GANf 2XDDA 4M7AC 4M78G 4IKFA 2RI2A 3LWHA 1LOJA 3DLLA 4XTWA 3X24B 2XI9A 2QA4A 3LW5E 5HY6A 4BB7A 1Q86U 1HK9A 1YJ9T 2G77A 2MMPA 1OZ2A 5GMKm 3S3NA 4J83A 3CBMA 3S3OA 4PJOD 5CAIA 1Y71A 5LJ3g 1VQOA 3URGA 1KHIA 3JB9G 4AKHA 3BDUA 2P0QA 3FDRA 5GAN2 4PJOC 2M0OA 4M7DD 4F7UE 4M75A 3NTIA 1S72A 1WJRA 5LL6S 3MP1A 2EKOA 4M7DC 5CKBA 3CC4T 2KDSA 1WGSA 3RERA 1GXIE 4JLIA 3HKSA 4C92F 3C4SA 4EDUA 3JCMV 3CBPA 2LNVA 3QXEB 2RJEA 1JBMA 2ZPHB 2ZZDB 3QHSA 4HNTA 4X9DA 3OYHA 1K73C 1H3ZA 2LT1A 1QVGA 4M7AE 2DXTA 2JTMA 2YLCA 1UGQB 2VGNA 4M75G 3MEWA 4CI0C 3MP8A 1BI1A 2EJGA 3MP6A 4MZTA 4DQ2A 1FKMA 1YHQA 4JRIA 1YHQT 2CZ1B 3VKIA 3OYIA 3JCMX 1W2BA 3OA6A 4IUQA 3UWNA 5HK0A 3OYFA 2CS7A 3ER0A 3WVDB 1YJWT 3E9GA 3RMSA 3J7AF 4M7DE 3X26B 5GAOl 4E47A 2X4WA 1Y7XA 2RH2A 5J3BA 2A7YA 4QVCA 5I21A 5I2MA 3CC2A 3S6WA 2JUFA 2DXCA 4L6V5 2P4TA 4A4FA 4BUGA 5GANj 2PUKB 1QP2A 1WPYA 2M1HA 3JCMf 1MGQA 4M77B 2FL7A 5FU6B 4OVAA 2WJ9A 3G6EA 3ASKA 1UB4A 2WSFE 2HD0A 4XTYA 4JRKA 4MIMA 2KMTA 3CD6T 2GFUA 3L2QA 3E1SA 5CO7A 1ZBXA 5GMKi 1N9RA 4KULA 3OYKA 4O6JA 3CCMT 5GANd 2XICA 5GANe 3FEOA 2V8JA 4N4IA 4OB2B 3M4YA 3M54A 5LJ5h 2Y4YA 5CKEA 3V7RA 4OB3B 4HNUA 4J7FA 4PLLA 2DO3A 4JLGA 2MAMA 4QVZA 1R8OB 1I81A 2BS3A 4C8QB 1Q7YC 3TW6A 1VQ4T 3T9NA 1E7PA 5FU7B 3QKJA 5FLXE 3CCUA 3CCUT 1QLBA 2C06A 1ZHIA 1JJ2S 2L5QA 3CMEA 1LJOA 2D6FA 4JX5A 5GAMf 1VQ9T 1BI0A 3WXMB 4MDWA 4M78F 4A54A 4N0AC 3QZ5B 5A0LA 4C0DB 5LJ5g 4BACA 3TREA 2JTFA 3QZ9B 5IT9E 5GAOr 4M78B 3CCVA 2K5IA 2DIQA 2I2LA 4JS5A 1Y07A 3QDRB 2EQUA 2DD5B 3UDCA 3GLXA 2K4YA 2P0PA 3OS0A 2JNGA 2F5TX 3Q1JA 1IREB 2RA2A 4FL6A 4F7UA 3BY7A 4DA4A 1B34A 2BIVA 1TH7A 5L8RE 1VQ5T 2F69A 3JCMg 1Q7YU 5LJ3f 3KBGA 3QYHB 2K3YA 2DK3A 3KXTA 3MEVA 3GIBA 4II1A 4MMLA 2DXBB 1M9SA 2HQXA 4AKGA 3F70A 4M7AA 4XK8E 4F7UG 4D6WA 2MWPA 1XNIA 3RUXA 3OW2A 3OS1A 1BKBA 1HXDA 4M75F 1QVPA 4OGCA 4QQDA 3VUZA 2EFIA 5CKHA 4M75B 2QTXA 2ZGWA 3M56A 3LH0A 3JCMe 2WSCE 4EMKB 4N4GA 4PJOA 1YITA 3KHIA 3G71A 3G71T 4M7AG 3META 4C92C 5GAN8 2QEXT 4J5YA 3QSUA 1AHJB 2O01E 4M7DA 4WF2A 1IZ6A 5CKDA 1KQSS 4KT0E 1VQKA 2CKKA 2EQKA 2IG0A 3X20B 2MI6A 4BBSM 4LDYA 1VQPA 3ZFJA 4ZTFA 4GLKA 3QO3A 4AI6A 5DY9A 4ZN3A 5CR2A 1QVFA 5GAMj 3BW1A 5CIUA 2B8AA 2VXEA 3SD4A 1OI1A 3L2UA 3CPWS 1VQNA 2EQMA 3HB9A 2LT4A 3OYLA 4FT2A 3OYJA 2GF7A 1G3SA 4HL4A 2R57A 5KCOA 2P0KA 3JCMc 3JB9J 1M4ZA 4QW2A 3PT9A 5HKCA 1X6OA 2O4XA 4NL3A 2L3RA 4M77D 4MFDA 4RMOA 1YJ9A 5GAMd 1Y96B 2XG8D 3M57A 3M53A 4M77C 5FU6C 5GAMe 4BBRM 4BI3A 3CMAT 4EPCA 5LJ3j 4NS5A 5GAN6 1X75C 3JSCA 4NC6A 3VYHB 4J8OA 5KCHA 4JS4A 3RMQA 4FM4B 4X9CA 1NJIC 3HZJA 3L42A 1VQ6T 3FLGA 4KBMB 1KHCA 3SWNB 3CC4A 2XK0A 3HPWA 4E7HA 4C5HA 2RM4A 1UGSB 3SFMA 2K5LA 3PFSA 2OTLT 3JRZA 2DXUA 1SSFA 5LJ3d 2EQJA 3VYGA 4C8QD 2LCLA 4OP0A 3L2ZA 4C92B 3BG5A 5LJ3e 3CXCS 2XU8A 2GFAA 3HRSA 3O8VA 3SB2A 4C8QC 1N9SA 4J6XA 3A5ZB 4C5EA 2K2VA 2VUBA 2X35A 1VQ8A 1VQ8T 2A3LA 4QQGA 5FU7C 3VJPA 1NZ9A 5GAN7 5LJ5f 3CCQT 4DOVA 2XDBA 2ZCFB 3QG1A 3L2RA 1W4SA 4B9XA 2RB6A 5GMKh 2LX9A 2E65A 2LRQA 1FXXA 2CZ7B 4TVRA 4C0ZA 4C0DC 4JDSA 1NJIU 2MWOA 4PJOE 3WVEB 4LDUA 1YJWA 3AHUA 1BYMA 1UGRB 4M78C 2XKOC 4E7JA 2RI3A 3HBLA 3N5BB 3OY9A 1M1KC 4XQ3A 2EYQA 2ZPGB 3TEEA 3JB9D 3BG3A 2JVVA 1K8AU 4N0AA 3H4CA 4F7UF 4MFEA 2PQWA 1JJ2A 2PUOB 4MDXA 4OB0B 4MMKA 2DD4B 1VQ7T 2LQKA 4J7IA 1LNXA 2PVOB 3QIIA 1UEBA 2X4YA 4XTVA 5EJCA 2BKDN 1D3BB 4C0GA 2QQ8A 4C8QE 1M1GA 3GNFB 4A4GA 1WJQA 3OYAA 3CD6A 4L59A 3JCMP 4C92D 5HK3A 3CCLT 3R6OA 3CCMA 4M7AF 4Z6YA 3MCAB 2ZPFB 4JRQA 1VIFA 3JAME 1I4K1 3LWIA 1WQ7A 1M1KU 5D6YA 4M75C 3V7SA 1YIJT 4X34A 1G5VA 1VUBA 3HSBA 2FB7A 2RHYA 3PGGA 4RKUE 2YHTA 4PJOF 4EMKC 3J80E 3FIFA 3GPLA 4LOCA 2LQ8A 3CCST 1VQ4A 3CCET 3LLRA 3M59A 2ZPBB 1G3TA 3CPFA 3JCMW 1KD1U 3OYDA 4M7DF 1VQ9A 3LGLA 2VC8A 4FT4A 4HNVA 4RG8A 1BI2A 1FX7A 3NFCA 3C95A 3G4ST 5IN1A 1XTDA 3HRUA 2ZZDA 3OSVA 4BI8B 3RKXA 4QVDA 2RHIA 3V7CA 1VQMT 3OYMA 1WQWA 2DEQA 1OYXA 5CQYA 1YCYA 4QSHA 1WJSA 4BE1A 3PIPA 3OYBA 3NTKA 5CKFA 2LC4A 1KQSA 1VQ5A 5LJ5d 3J81E 2RHXA 3HO8A 5LJ5e 4ATOA 3A8MB 5GMKl 3CCRT 2LTOA 4BD3A 2F5KA 3TCJA 3CPWA 3ZEHA 4E7IA 3OYNA 3GOXA 2QQSA 4ZGJB 2HQEA 3HFNA 2KK4A 2EIFA 5GAN4 4ELZC 4FSXA 4BDYA 5CK9A 2QXFA 3QUIA 2HBPA 4BI4A 3OMGA 3SWNC 5IAYA 2E41A 5GAOm 4CRIA 5M9OA 4M77A 1YJNA 3JCMd 1YJNT 3OYGA 2KSSA 3CEYA 2XHCA 2EWNA 2DIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X28 B;  3VYH B;  3WVD B;  1PSF A;  4FM4 B;  3A8L B;  3X26 B;  3A8G B;  4ZGD B;  4L6V 5;  2DXC A;  1UGS B;  2PUK B;  1QP2 A;  3VYG A;  2WSF E;  3A8O B;  3HHT B;  4ZGE B;  2DD4 A;  3A8H B;  2ZCF B;  2CZ0 B;  4OB2 B;  2CZ7 B;  2DXC B;  1DJ7 B;  4OB3 B;  3WVE B;  1UGR B;  2DD5 A;  2QDY B;  3VYG B;  4OB1 B;  2ZPG B;  2PU9 B;  2ZPE B;  2WSE E;  2PUO B;  4OB0 B;  2DD4 B;  3QZ5 B;  2PVO B;  3QZ9 B;  2DXB A;  1QP3 A;  2DD5 B;  2PVD B;  1IRE B;  2ZPF B;  1JB0 E;  5L8R E;  1PSE A;  3QYH B;  4RKU E;  2DPP B;  2DXB B;  2AHJ B;  4XK8 E;  2ZPB B;  1V29 B;  3X25 B;  2CYZ B;  3X24 B;  3LW5 E;  2D0Q B;  2ZZD A;  2WSC E;  2CZ6 B;  3QYG B;  1AHJ B;  2O01 E;  4KT0 E;  3X20 B;  2PVG B;  3A8M B;  1GXI E;  4Y28 E;  3QXE B;  2ZPH B;  2ZZD B;  2ZPI B;  4ZGJ B;  1UGQ B;  2CZ1 B;  1UGP B; 
#chains in the Genus database with same CATH topology
 1PRM C;  1VOL A;  1M1F A;  1YI2 T;  1P5E B;  1Y57 A;  2EYW A;  2K7A A;  4PNO A;  3SDZ A;  1K9M R;  1JOW A;  2R58 A;  4E7L A;  2FRY A;  3TW7 A;  4AFS C;  3UT1 A;  2V1R A;  1W70 A;  2YLB A;  5IHK A;  3CXC A;  3M0U A;  2GBQ A;  1SEM A;  1KQ1 A;  4B9W A;  5IH2 A;  3I55 T;  1VQO Q;  1GUX B;  2FVU A;  3MEU A;  1U5S A;  2RD1 A;  1UFF A;  4ELY C;  1S72 Q;  3JCM Q;  4E7Z A;  2DD5 A;  4BDZ A;  4IUU A;  2YUQ A;  2PMI B;  2IW8 B;  4BE2 A;  2OTL A;  4LDX A;  2QQ9 A;  1N4M A;  4HT9 A;  2PZ1 A;  1K8A C;  2P4R A;  3R6N A;  1I8F A;  5KYN A;  3GNG A;  3POM A;  4CFX B;  2RK1 A;  2PVD B;  1VQO T;  2BPM B;  4Y91 A;  4OMM A;  3DL1 A;  1S72 T;  4LXC A;  4EMK A;  5KE2 A;  5DM7 R;  2VB6 A;  3CXC P;  5CEI B;  4RTV A;  5FRO A;  4IMY B;  1RL2 A;  2LZ6 B;  5CCA A;  4D8K A;  1Q82 C;  1VQ7 A;  5GMK j;  3VKH A;  2J6O A;  1B34 B;  1ZA1 B;  2CSQ A;  1GRI A;  1TD6 A;  2RJC A;  4J9F A;  2D0Q B;  5KYU A;  2CUB A;  1I0C A;  3D7S B;  4KUI A;  3CCL A;  2RN8 A;  5LMK B;  1P92 A;  4M7A B;  2K6D A;  4E2F B;  5GMK e;  1Y96 A;  1URC B;  1VQ4 Q;  1SF9 A;  1K73 U;  3CCE A;  3OS5 A;  3CME Q;  1Q82 U;  5HBH B;  4CFM B;  2BZY A;  3P8D A;  3G6E T;  5IDN B;  2X3W D;  4PJO B;  5HCK A;  3VKG A;  5LJ5 j;  4HA8 A;  1UGP B;  1WHJ A;  1PSF A;  3M03 A;  3A8L B;  2WAC A;  3RKY A;  4M75 E;  3OYE A;  2DRM A;  3FJP A;  3OYY A;  3A1P A;  3CME T;  1Q81 R;  1JQQ A;  2FRW A;  1PD0 A;  4EOJ B;  1NPR A;  4J6Y A;  3MHX A;  2DD4 A;  1BCM A;  3BFM A;  3VUB A;  3G71 Q;  2R5M A;  2V8K A;  3V8K A;  5GAO p;  1VQK Q;  3OYC A;  3INZ A;  1EFN A;  2W9F A;  2HSP A;  3QHW B;  3CBO A;  5KYY B;  1TG0 A;  4JJB A;  3EFS A;  3MI9 B;  5IXB A;  2FYK A;  3QJY A;  1O9K A;  1WXU A;  2K5F A;  1JO8 A;  5GAM h;  1K0X A;  4CC2 A;  5DLO A;  3DB3 A;  4DOW A;  3OB9 A;  1Q86 C;  2WMA B;  1RAG B;  4IIM A;  1GL5 A;  5L2W B;  1VQK T;  1VQP T;  4EMG A;  2WHB B;  1WHL A;  5AYF A;  1OL1 B;  3MIA B;  4RCC A;  2DPP B;  3I5S A;  4LUD A;  5LJ3 h;  2E4H A;  4F6U B;  1KC8 C;  4CC7 A;  3OW2 S;  4MZP A;  3DOG B;  4EIK A;  2CCI B;  1AZG B;  3LWH A;  4XTW A;  2XI9 A;  4BB7 A;  1Q86 U;  1YJ9 T;  1OZ2 A;  5GMK m;  3S3N A;  4J83 A;  3BDU A;  4IIO A;  4PFZ A;  1AWO A;  4CFW B;  4F7U E;  4M75 A;  3NTI A;  4RTY A;  3K7A M;  2QK0 A;  3RER A;  4JLI A;  4EDU A;  1RI9 A;  2IIM A;  3CBP A;  3QHR B;  3QXE B;  2ZZD B;  3QHS A;  2EBP A;  2DXT A;  2JTM A;  3MEW A;  1BI1 A;  4M4Z A;  2YT6 A;  1H1P B;  2CZ1 B;  1MV0 B;  1TUG B;  3EJ1 B;  1W2B A;  1JU5 C;  3OA6 A;  3OYF A;  3ER0 A;  4TTH A;  3E9G A;  1YIJ Q;  2OJ2 A;  5GAO l;  3CC7 Q;  5J3B A;  1OU9 A;  5I21 A;  3CC2 A;  3S6W A;  4A4F A;  2P4T A;  1MGQ A;  4CRL B;  3TNW B;  4PFO A;  2HD0 A;  4CFU B;  1Y0M A;  3E1S A;  2OAW A;  1N9R A;  3M4Y A;  4PK4 A;  2EGA A;  4OB3 B;  2DO3 A;  2R7G A;  2BS3 A;  4C8Q B;  3CCR Q;  1Q7Y C;  3JV3 A;  2QGG A;  2DME A;  1LJO A;  1W2B P;  4MDW A;  5LJ5 g;  4C0D B;  2W96 A;  3TRE A;  5IT9 E;  2M51 A;  2AT1 B;  1Y07 A;  2JXB A;  4HCK A;  3UDC A;  2P0P A;  4QKU A;  3Q1J A;  4F7U A;  4DEX A;  3BY7 A;  1KK7 A;  2JS2 A;  1QKW A;  2X3X D;  4AFU C;  1Q7Y U;  1M30 A;  1WI7 A;  4MML A;  1QCN A;  2HQX A;  1YWP A;  4GLM A;  4RTZ A;  4I3Z B;  3RUX A;  3OS1 A;  4M75 F;  5FW9 A;  4OGC A;  2P84 A;  1E6G A;  2EKH A;  5HBE B;  5CKH A;  5HVY B;  3JCM e;  2WSC E;  1C0M A;  4DBQ A;  3KHI A;  1X6G A;  4M7A G;  4J5Y A;  3QSU A;  5CKD A;  1NJI R;  4LDY A;  4ANJ A;  3ZFJ A;  1QVF A;  4ZN3 A;  1VIN A;  1VQN A;  5I11 A;  1K8A R;  4HVU A;  3OYL A;  3OYJ A;  4F16 A;  4HL4 A;  2KRM A;  2R57 A;  2P0K A;  3JB9 J;  1M4Z A;  1TOV A;  2B86 A;  5HKC A;  2O4X A;  2J06 A;  4HVW A;  4EOK B;  1NM7 A;  2X1N B;  3CMA T;  1AIS B;  1X75 C;  3VYH B;  4FM4 B;  1OUL A;  3L42 A;  4KBM B;  5IHY A;  3I5R A;  4C5H A;  1Q82 R;  3SFM A;  1HSQ A;  1WX6 A;  2K5L A;  3JRZ A;  4CXA B;  1SSF A;  1G2B A;  2EQJ A;  3VYG A;  2EYX A;  1YCS B;  1MMA A;  2GFA A;  3EHR A;  3HRS A;  3SB2 A;  1U3O A;  3A5Z B;  1MMD A;  2DVJ A;  2VUB A;  5FU7 C;  4QQG A;  1NZ9 A;  5LJ5 f;  2XDB A;  3QG1 A;  2QAZ A;  1IO6 A;  1W4S A;  1MV3 A;  4AG2 C;  1FXX A;  4C0Z A;  2MWO A;  1ZX6 A;  2NUP B;  4E7J A;  1ZSZ C;  3N5B B;  3TEE A;  3CCS Q;  4F7U F;  4MFE A;  2PQW A;  1H1R B;  3QII A;  4LN2 A;  4XTV A;  3I56 Q;  2BKD N;  3CD6 A;  1H4L D;  2YUP A;  5HK3 A;  4J9B A;  3MCA B;  4JRQ A;  3BE3 A;  3NMZ C;  2YRC A;  1GY3 B;  5D6Y A;  1WHG A;  1G5V A;  2BE9 B;  2RHY A;  4EMK C;  2ABL A;  5DQW A;  1H28 B;  2LQ8 A;  3CCS T;  3LLR A;  2ZPB B;  1X27 A;  3JCM W;  1SG5 A;  2DBK A;  3OYD A;  1I07 A;  4R0K A;  2VC8 A;  1VQ9 A;  1VYW B;  4ELL A;  4HNV A;  1VYV A;  1BI2 A;  2HEQ A;  3CCV Q;  1K1Z A;  1FX7 A;  3NFC A;  3OSV A;  3V7C A;  2CP5 A;  1H26 B;  2DEQ A;  2L3P A;  2RNA A;  4OML A;  1OIY B;  1PWT A;  2EVR A;  5CKF A;  1BBZ A;  1KQS A;  2LJ1 A;  1UNH D;  5GMK l;  2JTE A;  2FG0 A;  2F5K A;  1OKV B;  1CKB A;  2HQE A;  2KK4 A;  2O31 A;  5ECA A;  4AMC A;  1M90 R;  2ED1 A;  4M77 A;  1YIT Q;  2XHC A;  1TXQ A;  3GP8 A;  2QEX A;  2QFZ A;  2IVW A;  4OF1 A;  1E7O A;  4LD6 A;  4ZGD B;  5FWB A;  1B3Q A;  1KC8 R;  3P8B B;  1M2V A;  1BU1 A;  2VWF A;  4J9G A;  2QDL A;  2RJD A;  2RK2 A;  4KGZ B;  4XTZ A;  4EMH A;  3C12 A;  3SHW A;  2QTV A;  1KQS P;  5EG2 A;  2LJ3 A;  3H8Z A;  4YTL A;  2M16 A;  2CZ0 B;  2MYS A;  3HP9 A;  4RG2 A;  4JZ4 A;  2DXC B;  1B07 A;  4J9E A;  4UN0 A;  2UZE B;  5HNB B;  3QWY A;  4C8Q G;  1N8R U;  1PHT A;  2Z0W A;  4ME7 A;  1I5L A;  2PU9 B;  2R5A A;  2CP6 A;  3C94 A;  2COW A;  4N4H A;  4A53 A;  5KE3 A;  2DXB A;  2DF6 A;  2QA4 T;  3TQ7 P;  2X4X A;  2K3B A;  2OTJ A;  3CCQ A;  2ESW A;  3PMT A;  3M4G A;  2E70 A;  3NDQ A;  5KYW A;  2VV5 A;  3OSS C;  1YJW Q;  1QVF S;  2DZC A;  4RTX A;  1VYU A;  3S3M A;  1H8K A;  3JCM b;  2KEA A;  1LCK A;  5GAO q;  3E2U A;  1XQH A;  1RI0 A;  4FYX B;  2RPN A;  1MHN A;  1IGQ A;  2CYZ B;  2LDM A;  2NLU A;  3V8J A;  4ELJ A;  1VIE A;  1MNE A;  2DM1 A;  3OS2 A;  2KR6 A;  3RIR A;  3VS5 A;  2I0N A;  4F70 B;  3CCJ A;  2F2C A;  2DKG A;  1M2O A;  2K79 A;  3CCJ T;  1KIK A;  2ROT A;  4M75 D;  2PVG B;  1NG2 A;  4HKE A;  2MCN A;  4M77 F;  2XD0 A;  1OQK A;  3ZBD A;  5GAN g;  5KYX B;  3QJ6 A;  3H0H A;  1QVG S;  1WHH A;  2DTI A;  1QWE A;  4C5I A;  2JM8 A;  2YUO A;  4M7D B;  3G4S A;  2EAY A;  5C0M A;  5A0G A;  1VQM A;  2RO0 A;  1AD5 A;  5DLQ E;  4DEY A;  2L0A A;  2YRV A;  4E6R A;  2KRN A;  4AFZ C;  1TTH B;  3A8G B;  2RQR A;  4O5V A;  2KMG A;  2LJ0 A;  4LD9 K;  2E10 A;  4XU3 A;  2EGE A;  3HHT B;  3M5A A;  3M55 A;  4ZGE B;  3V8L A;  4EOR B;  4HVV A;  4AG1 C;  4E7S A;  1D3B A;  3EG9 A;  3MKD A;  1R0B G;  1YI2 A;  4UC4 A;  3EH2 A;  4MZM A;  1KG1 A;  1KFZ A;  4LDW A;  4M77 G;  1V1C A;  2QDJ A;  3BDL A;  2ZPE B;  2DIL A;  2V8I A;  2L89 A;  2VVK A;  5FWC A;  2IN3 A;  4BY6 C;  2DLP A;  1QP3 A;  2HSE B;  1ABO A;  2DJZ A;  3EFO A;  1X6B A;  3MY1 B;  2CGH A;  5D7U A;  2DEU A;  4OGE A;  3I55 A;  5J39 A;  4IUR A;  3TU4 K;  4LDV A;  1WXB A;  3THK A;  1BI3 A;  4Q5W A;  1ZSZ A;  3CC4 Q;  2GQV A;  4EOI B;  2QQB A;  1SRL A;  1ZUK A;  2RQT A;  1UDL A;  2KE9 A;  2AHJ B;  2RHZ A;  5GAO n;  1M5Q 1;  2DVE A;  3JCM J;  4BCM D;  5GAN f;  1OX9 A;  4M78 G;  4IKF A;  1VQ8 Q;  5HY6 A;  1HK9 A;  2G77 A;  2HZY A;  1QLY A;  3I9Q A;  1VQO A;  3URG A;  3FDR A;  3OW2 P;  1S72 A;  1WJR A;  3UA7 A;  3MJX A;  5CKB A;  3CC4 T;  2KDS A;  1WGS A;  2A28 A;  2W9Z A;  1UUE A;  3EGD B;  1TSF A;  1VQ7 Q;  1IHW A;  2NUT A;  4HNT A;  1K73 C;  1UJ0 A;  4M7A E;  3A98 A;  2VGN A;  2MIO A;  3MP8 A;  4FYV B;  3MP6 A;  4JRI A;  3O0G D;  3VKI A;  3QWX X;  1AT1 B;  4IUQ A;  4BCP B;  4YOS A;  5CYI B;  4BCQ D;  1CSK A;  1D0Z A;  4YOZ A;  2X4W A;  1GUX A;  3CCE Q;  4BCH B;  5I2M A;  2JUF A;  2O9V A;  2C5O B;  1WPY A;  2PUK B;  2FL7 A;  2WJ9 A;  4KRD B;  3G6E A;  1UB4 A;  2WSF E;  1UEC A;  2KMT A;  2F2V A;  2GFU A;  3L2Q A;  1IGU A;  4KUL A;  4O6J A;  1OX8 A;  3M0P A;  4EC9 B;  2O88 A;  2V8J A;  4N4I A;  5LJ5 h;  2Y4Y A;  3V7R A;  1VQ5 Q;  4PLL A;  4J7F A;  2FEI A;  1OIU B;  3TW6 A;  1VQ4 T;  3T9N A;  1E7P A;  1GFC A;  3CME A;  2D6F A;  1BI0 A;  3WXM B;  2PK2 A;  3QZ5 B;  2GNC A;  4BAC A;  2L2P A;  3QZ9 B;  2JTF A;  4K11 A;  2K5I A;  5IHN A;  2JNG A;  2F5T X;  1WYX A;  2RA2 A;  4DA4 A;  1B34 A;  2O2O A;  1TH7 A;  2LQW A;  1VQ5 T;  4BY1 X;  2F69 A;  2C5N B;  2RMO A;  2EYY A;  1M9S A;  4M7A A;  4D6W A;  1QVP A;  2A37 A;  1SSH A;  2PK9 B;  4M75 B;  1OV3 A;  4PJO A;  1NEG A;  2ZAE A;  2BZ8 A;  3G71 A;  1M3B A;  3G71 T;  1EZZ B;  1NYF A;  1AHJ B;  4PFP A;  1VQL Q;  3EGU A;  1AWX A;  1VQK A;  1OEB A;  2CKK A;  2IG0 A;  3X20 B;  1VQP A;  4BBS M;  1VQ6 Q;  3EHQ A;  4ZTF A;  4GLK A;  3EG1 A;  5GAM j;  2VXE A;  1OI1 A;  2EQM A;  1K76 A;  2LT4 A;  1D0X A;  1JEG A;  4FT2 A;  4KH1 B;  2GF7 A;  1G3S A;  2VKN A;  3JCM c;  3VS7 A;  1X6O A;  1UG1 A;  4M77 D;  4MFD A;  1YJ9 A;  5GAM d;  2KGT A;  5GAM e;  3O5Z A;  4M77 C;  5FU6 C;  4EPC A;  4F6S B;  5LJ3 j;  4PJM A;  4J8O A;  3JSC A;  4NC6 A;  4JS4 A;  2CT3 A;  4EOS B;  1M1K R;  1VQ6 T;  1KHC A;  3REB B;  3SWN B;  1R77 A;  2DJQ A;  3PFS A;  4FYY B;  2M02 A;  1YNZ A;  2E3H A;  3TNH B;  5LJ3 d;  4OGR B;  4C92 B;  5LJ3 e;  3BG5 A;  3CXC S;  2WFY B;  5KYY A;  1N9S A;  2K2V A;  1UHF A;  3DDQ B;  4BCF B;  4DOV A;  3L2R A;  1WLP B;  2PTK A;  2CZ7 B;  4JDS A;  5BNJ B;  3WVE B;  1PKT A;  3AHU A;  2CH4 A;  4M78 C;  2XKO C;  4KH0 B;  3CC2 Q;  5IHI A;  1C1A A;  4XQ3 A;  4ROC A;  2ZPG B;  2DRK A;  2J6F A;  2JVV A;  4Z88 A;  4N0A A;  3H4C A;  4F7N B;  2IPO B;  1JJ2 A;  3REA B;  4MDX A;  2IW6 B;  1YWO A;  2X4Y A;  4C8Q E;  3VS3 A;  2AZS A;  2YUN A;  2KYM A;  1AZE A;  1ABQ A;  3R6O A;  4M7A F;  4Z6Y A;  2I40 B;  3NPF A;  2QAS A;  2RQW A;  1WQ7 A;  2KXD A;  1NLO C;  1YIJ T;  3V7S A;  4X34 A;  2J7I A;  2DX1 A;  3CC7 T;  2YHT A;  4PJO F;  3FIF A;  4LOC A;  1HD3 A;  3M59 A;  1NLP C;  1KD1 U;  3LGL A;  1XO2 A;  3C95 A;  4BCN D;  4B6M A;  1XTD A;  2ZZD A;  4HXJ A;  4BI8 B;  4QVD A;  2G6F X;  2RHI A;  3OYM A;  2LCS A;  1ZUU A;  4Y92 A;  2I53 A;  3PIP A;  1JJ2 P;  3OYB A;  5DQV A;  3J81 E;  2B9R A;  1Z9Q A;  2QGF B;  4AFQ C;  3CCR T;  1E9H B;  3GTM S;  3CPW A;  4E7I A;  4WTO B;  4ROE A;  1C9B A;  2QQS A;  1N5Z A;  4BI4 A;  1MUZ A;  3OMG A;  4BCQ B;  1FIN B;  1OGU B;  1IRX A;  3JCM d;  3OYG A;  1ZUY A;  1GCP A;  3VS6 A;  4ORZ A;  1TWB A;  3E9F A;  3UAT A;  1IB8 A;  2BKZ B;  3C0C A;  4J6W A;  4JX4 A;  3RES A;  1HJD A;  1VQN Q;  4M6V A;  4C5G A;  1X01 A;  2E12 A;  3EFR A;  2EJF A;  4PJO G;  1YN8 A;  4GY5 A;  3VRY A;  1F5Q B;  1YP5 A;  4XTU A;  1JKW A;  2M9U A;  2JM9 A;  2IW9 B;  4C8Q A;  1AEY A;  4HCZ A;  1OU8 A;  2CP3 A;  2KY9 A;  4Z8A A;  1OPL A;  4ZTJ A;  2CJM B;  1XOV A;  5A2Q E;  3CPW P;  3CMA A;  2RHU A;  5GAN 5;  3M0Q A;  1JXO A;  3OBY A;  5C6S A;  2OAU A;  1GCQ A;  1MMG A;  4XU0 A;  3KUF A;  1K73 R;  3UF4 A;  2X9H A;  4A4E A;  1X69 A;  4FW1 A;  4XU2 A;  4NOY A;  4AT1 B;  4HCC A;  3U23 A;  4F7L B;  1YHQ Q;  3QYE A;  1O9S A;  4OMP A;  5D6X A;  3ULR B;  1RAC B;  2QQR A;  5KH6 A;  3MO8 A;  1TS9 A;  4PJJ A;  4M77 E;  3MEA A;  1OL2 B;  5I2S A;  4DBR A;  1K9M U;  2D9T A;  1G3N C;  2SRC A;  3FC3 A;  4RUG A;  1H1S B;  2EYZ A;  1V29 B;  3OQ5 A;  3CD6 Q;  1QW1 A;  5J26 A;  4YC3 B;  3ME9 A;  5GAN h;  3HRT A;  2YRD A;  4BCK B;  3QYG B;  1BIA A;  3L2W A;  4OMF B;  2RI5 A;  2LVM A;  2CP0 A;  1WNL A;  4KGX B;  3EAE A;  1W98 B;  3FRN A;  1SPK A;  4JRP A;  4M78 E;  1U1T A;  1G3Y A;  1ZQ1 A;  3CCU Q;  4VUB A;  4Y28 E;  4EOP B;  4A4H A;  4FIB A;  3CCS A;  1VQ9 Q;  2HDA A;  4PLI A;  2XID A;  2ZPI B;  4EOL B;  2KVQ G;  4ZNX A;  3QPH A;  4A63 B;  2HAX A;  4J9C A;  4FSS A;  3EGX B;  2QI2 A;  3H41 A;  3I56 A;  2EJ9 A;  3I56 T;  2DTO A;  1OI9 B;  3JB9 H;  2KAF A;  1W2B S;  1PG5 B;  1D1C A;  4C8Q F;  4KGV B;  3H9N A;  1M3A A;  4Z02 A;  2LP5 A;  4XU1 A;  2E64 A;  5GJW B;  1IXD A;  3GF5 A;  5FRN A;  4C92 G;  4NL2 A;  3PO3 S;  3PMI A;  2NUP A;  1ACM B;  1UNL D;  2Y4X A;  3G7Z A;  3HL8 A;  2LW4 A;  3CCV T;  1RAF B;  1Q86 R;  2QF7 A;  3UPU A;  4HT8 A;  3JB9 F;  3A8H B;  2V26 A;  3LGF A;  4CC3 A;  2XMF A;  3M0S A;  3OMC A;  2QEX Q;  3HFO A;  1DJ7 B;  4R56 A;  2LCC A;  1T3S A;  1FVV B;  3FB9 A;  2DTH A;  4EOO B;  5D6W A;  2QDY B;  1M8M A;  4BE0 A;  4OB1 B;  2MK5 A;  3QBY A;  2DL4 A;  3TVT A;  1N8R C;  1LPL A;  1D09 B;  2X4J A;  3M0R A;  3L2V A;  2RQU A;  1B7T A;  1Q81 C;  4P5N A;  4PJL A;  1FMV A;  3PIO A;  2JOY A;  2E6N A;  5CQX A;  1Z9Z A;  1YIT T;  2RJF A;  4IUP A;  1JXM A;  2E3I A;  1G3W A;  4AKI A;  2FHD A;  1BIB A;  4M78 A;  2AIR B;  2CP2 A;  3RKW A;  2HMA A;  3H6Z A;  5EC7 A;  4M7A D;  2UUE B;  2DZ9 A;  2MPX C;  4F04 B;  1Q81 U;  2Y90 A;  4X1V A;  3TN8 B;  2XDD A;  2HL5 C;  4M7A C;  2RI2 A;  1LOJ A;  3DLL A;  3X24 B;  2OTJ Q;  2QA4 A;  3CCQ Q;  3BHU B;  2VAS A;  2MMP A;  3S3O A;  4PJO D;  1RAE B;  1Y71 A;  3JB9 G;  1KHI A;  4RTT A;  2P0Q A;  4LNP A;  5GAN 2;  4PJO C;  1VYT A;  2NUZ A;  2EKO A;  2GTJ A;  3G33 B;  1GXI E;  3HKS A;  2KRS A;  2LNV A;  1PD1 A;  1SKU B;  1JBM A;  1QMZ B;  2A36 A;  1GBQ A;  3PE0 A;  5FGK B;  4X9D A;  2WIP B;  3OYH A;  1H3Z A;  2JJ9 A;  2X51 A;  4CI0 C;  4MZT A;  2EJG A;  4DQ2 A;  1JST B;  1FKM A;  1UGV A;  1PM3 A;  2LX7 A;  1E6H A;  3CCM Q;  4EOQ B;  3DDP B;  1M3C A;  6AT1 B;  5HBJ B;  1D0Y A;  3UWN A;  1D3U B;  5HK0 A;  2EQI A;  1YJW T;  3RMS A;  4M7D E;  1Q7Y R;  4E47 A;  1QQJ A;  3VS0 A;  1Y7X A;  2RH2 A;  2A7Y A;  1WFW A;  1QCF A;  4L6V 5;  2DXC A;  3M0T A;  4RTU A;  3JCM f;  2CUD A;  4OVA A;  3ASK A;  4XTY A;  3G4S Q;  4MIM A;  2ATC B;  1VQM Q;  5GMK i;  3ZL7 C;  3CCM T;  3FEO A;  2RF0 A;  2EPD A;  4HNU A;  2YWW A;  8AT1 B;  4JLG A;  2MAM A;  1QMC A;  4QVZ A;  1R8O B;  5FU7 B;  1RAB B;  3QKJ A;  3LQ5 B;  5FLX E;  1MMN A;  2C06 A;  2UZB B;  2L5Q A;  2CT4 A;  4OR5 B;  4M78 F;  4N0A C;  1SHF A;  1RUW A;  2DIQ A;  2I2L A;  1YJN Q;  1AVZ C;  4JS5 A;  3QDR B;  2EQU A;  2FZK B;  1BU2 A;  2DD5 B;  1NYG A;  3GLX A;  2K4Y A;  5LQF B;  1IRE B;  4FL6 A;  1YI2 Q;  2BIV A;  4EON B;  4GBQ A;  3QYH B;  2DK3 A;  3GIB A;  3MEV A;  4AKG A;  2ED0 A;  3F70 A;  4XK8 E;  1XNI A;  1G83 A;  3OW2 A;  5KYX A;  1ZSG A;  3BHT B;  3VUZ A;  2EFI A;  2QTX A;  3M56 A;  2JMA A;  3LH0 A;  3I55 Q;  4EMK B;  3MET A;  1EX4 A;  4C92 C;  5GAN 8;  4M7D A;  2O01 E;  4WF2 A;  1KQS S;  2ECZ A;  4KT0 E;  2NUT B;  2C4G B;  2MI6 A;  5EFQ B;  1H24 B;  4AI6 A;  8ATC B;  3BW1 A;  5CIU A;  2B8A A;  3L2U A;  2OTL Q;  3HB9 A;  2DMO A;  1VOM A;  1W6X A;  2COY A;  2DL5 A;  5KYU B;  1NEB A;  1VA7 A;  2L3R A;  4RMO A;  2GTO A;  1Y96 B;  4BBR M;  4NS5 A;  5L23 A;  5GAN 6;  4CFU D;  5KCH A;  3IQL A;  1NJI C;  3HZJ A;  3CC4 A;  2HQH A;  2XK0 A;  3HPW A;  2EGC A;  1UGS B;  2WPA B;  4FYW B;  2OTL T;  3VS1 A;  1RAA B;  4C8Q D;  2LCL A;  3L2Z A;  3O8V A;  4C8Q C;  4J6X A;  5ACB A;  1VQ8 A;  1VQ8 T;  1GFD A;  1OOT A;  1YFN A;  2ZCF B;  3CCL Q;  2RB6 A;  5GMK h;  1GBR A;  2LX9 A;  2E65 A;  2LRQ A;  4TVR A;  4PJO E;  4C0D C;  1NJI U;  1K4U S;  4LDU A;  2CCH B;  1S1N A;  2HBW A;  1C6V X;  3HBL A;  2RI3 A;  2EYQ A;  1GCQ C;  3AT1 B;  3JB9 D;  3G6E Q;  1K8A U;  2C6T B;  2PUO B;  1VQ7 T;  2DD4 B;  4J7I A;  1G8X A;  1LNX A;  4WCI A;  4C0G A;  5EJC A;  2KT1 A;  1M1G A;  3OYA A;  1WJQ A;  3JCM P;  2JW4 A;  2JGZ B;  3CCL T;  2MOX A;  2ZPF B;  2YXY A;  1VIF A;  3JAM E;  1BB9 A;  3NHN A;  2V1Q A;  3RR6 A;  1VUB A;  2NWM A;  3J80 E;  1O9K B;  2QYZ A;  1VQ4 A;  3CCE T;  2H8H A;  4M7D F;  2C5V B;  1RLQ C;  4FT4 A;  1H3H A;  4EC8 B;  4F7J B;  4RG8 A;  2JMC A;  4JJD A;  3EOC B;  3EGD A;  2DE0 X;  1AD6 A;  5IN1 A;  1BK2 A;  3RKX A;  3FJ5 A;  1WQW A;  5CQY A;  1YCY A;  4QSH A;  2DL3 A;  1WJS A;  3PVL A;  1UJY A;  1FYN A;  3NTK A;  1VQ5 A;  2KI7 A;  5LJ5 d;  5LJ5 e;  1N8R R;  3A8M B;  4BCJ B;  3TCJ A;  3ZEH A;  1PNJ A;  3RDV A;  4ZGJ B;  1BCO A;  3HFN A;  4BDY A;  2EIF A;  2BZX A;  4ELZ C;  5CK9 A;  2QXF A;  2HBP A;  2KR3 A;  4OMN A;  5M9O A;  4KRC B;  2KSS A;  3MP1 A;  4FW2 A;  2EWN A;  5CR2 A;  2DIG A;  5A0D A;  3X28 B;  2QQA A;  4XTX A;  1VQP Q;  1YBY A;  1TU0 B;  1H64 1;  1FMW A;  1AOJ A;  2H3J A;  2HNI A;  3HTR A;  3PNW C;  2KT8 A;  1ZA2 B;  1I1J A;  2WEV B;  4A4K A;  1H92 A;  2KRO A;  2A08 A;  4M7D G;  4C0F A;  1YJ9 Q;  2C0O A;  1M90 C;  3DKM A;  4DBH A;  2WXV B;  3PVQ A;  2O9S A;  3MY5 B;  3EG0 A;  4JX6 A;  4C92 E;  4F6W B;  1VQL A;  2F2X A;  2QG9 B;  4FU6 A;  1VQL T;  1XJW B;  4F17 A;  2C5X B;  1JRI A;  1VQ6 A;  1AWW A;  3QWL A;  2KQW A;  3UA6 A;  1D1B A;  3VV0 A;  2WSE E;  4KUD K;  2J6K A;  2JZ2 A;  4D8D A;  2BUD A;  4LE9 A;  1M90 U;  1EIF A;  1FMK A;  2CSI A;  2E5Q A;  2DBM A;  3DB4 A;  3QDF A;  4E7K A;  1KSW A;  3M9Q A;  4QQ6 A;  1SHG A;  1JB0 E;  2K3X A;  1PC0 A;  4JUV A;  1K0S A;  2E1H A;  4M78 D;  4CC4 B;  5I5Z B;  4BY6 B;  4BCO B;  1U1S A;  1KC8 U;  5GAN 3;  2XDP A;  2JN0 A;  1A0N B;  1ZBJ A;  1TFB A;  1UHC A;  2D8J A;  3X25 B;  4F7U B;  5CAI A;  1KD1 C;  2E6Z A;  2YDL A;  1HYO A;  3LX7 A;  4IUT A;  2AKK A;  2CZ6 B;  3EG2 A;  3BG9 A;  2K57 A;  3H0I A;  1QKX A;  2CRE A;  2V22 B;  2D0N A;  4IUV A;  4JJN K;  4BCM B;  2BE7 D;  1YIJ A;  3CQT A;  1NE8 A;  2ENM A;  1F1B B;  3CC2 T;  1M8V A;  2VYT A;  3CC7 A;  1U06 A;  3DJB A;  2GCX A;  4RCB A;  3QYB A;  3BLH B;  1OZ3 A;  3SWN A;  2C0I A;  2L3S A;  2GGR A;  3LYI A;  1X2Q A;  2M0Y A;  2L8D A;  1KXU A;  3DTO A;  1ENW A;  1N27 A;  4PL6 A;  4C92 A;  4F7S B;  1O75 A;  1KQ2 A;  3JB9 I;  3E19 A;  1ZLM A;  1M27 C;  1WDX A;  1GH6 B;  1ARK A;  2VXF A;  2BS4 A;  3CCR A;  4ZN1 A;  2O4X B;  2DYI A;  3VU3 C;  3JCM h;  2DYB A;  3A8O B;  3NTH A;  4XAX B;  2DET A;  1WXT A;  3VRZ A;  4HCB A;  2BS2 A;  2CP7 A;  3L1A A;  1N6A A;  2G3R A;  2DAQ A;  1ZP2 A;  1NPP A;  2SEM A;  2VGM A;  3TSZ A;  2LMJ A;  5CVI A;  3VYG B;  1X2K A;  7AT1 B;  2D8H A;  3PTA A;  5IF1 B;  3VS2 A;  2JS0 A;  4L5G A;  2UZL B;  2PHG A;  4JZ3 A;  4PKC C;  3M58 A;  2F2W A;  4J9H A;  1JSU B;  4V2S A;  2BTT A;  3P8H A;  1FWZ A;  3CMA Q;  2MF2 A;  4R55 A;  1UE9 A;  1U8R A;  1T0H A;  2DA9 A;  2AKL A;  3DLM A;  1QCO A;  3OBW A;  1PSE A;  2IVX A;  5GAM g;  1R0C B;  4FX3 B;  3BLQ B;  1VQN T;  1K9M C;  2W10 A;  1T3L A;  5FRM A;  4HLQ A;  3F5X B;  1TUC A;  1I5O B;  3LW5 E;  1NBE B;  3RNJ A;  3EG3 A;  3CBM A;  5LJ3 g;  3G1J A;  4AKH A;  2HKQ B;  2M0O A;  4M7D D;  3SEM A;  5LL6 S;  4M7D C;  1LVK A;  2W99 A;  4JPB W;  4C92 F;  3C4S A;  3JCM V;  2RJE A;  2ZPH B;  2LT1 A;  1QVG A;  2YLC A;  1UGQ B;  1RLP C;  4M75 G;  1TUD A;  5I22 A;  2W2H A;  3KFV A;  1YHQ A;  1QVF P;  2KBT A;  1YHQ T;  1PRL C;  2G9X B;  3OYI A;  4BY7 X;  1W1F A;  2AZV A;  3JCM X;  4J9D A;  2F1L A;  2CS7 A;  3EID B;  3WVD B;  3X26 B;  2JT4 A;  4LUE A;  1PKS A;  4KRT A;  1OPK A;  4BCI B;  4ROD A;  4QVC A;  2DL7 A;  4BUG A;  5ICP B;  5GAN j;  2ROL A;  1QP2 A;  2M1H A;  2E5K A;  1RAD B;  4M77 B;  2L3Q A;  5FU6 B;  1PKD B;  4JRK A;  2FZG B;  3CD6 T;  4DBF A;  5CO7 A;  1ZBX A;  3OYK A;  4BXX X;  1H25 B;  5GAN d;  4BCG B;  1UNG D;  2XIC A;  5GAN e;  4OB2 B;  4CFV B;  3M54 A;  5CKE A;  1WHM A;  2C0T A;  1M2V B;  2PJQ A;  1QVG P;  2EUF A;  1I81 A;  2FZC B;  1J3T A;  2AK5 A;  2DFU A;  3CCU A;  3RGF B;  1KJW A;  3CCU T;  1QLB A;  4OMO A;  1ZHI A;  2FPF A;  4JJC A;  1JJ2 S;  4NST B;  2GQI A;  4JX5 A;  5GAM f;  1VQ9 T;  4A54 A;  2PNI A;  5A0L A;  5GAO r;  4M78 B;  3CCV A;  2COZ A;  4YOO A;  3OS0 A;  1WZO A;  3NGP A;  5L8R E;  2KXC A;  4Z89 A;  4PJN A;  4II5 B;  3JCM g;  5LJ3 f;  3KBG A;  2K3Y A;  3KXT A;  4II1 A;  2WIH B;  2DXB B;  2KNB B;  4F7U G;  2MWP A;  3GBQ A;  1BKB A;  1HXD A;  4G6L B;  2OX7 A;  3VS4 A;  4QQD A;  5KYW B;  3EH1 A;  2ZGW A;  4N4G A;  1H27 B;  1PCX A;  1YIT A;  3EGX A;  2QEX T;  5HQ0 B;  1IZ6 A;  2EQK A;  3RBB B;  2YSQ A;  3QO3 A;  4CFN B;  5DY9 A;  1T0J A;  4BCN B;  1SRM A;  1IHV A;  3SD4 A;  3CPW S;  2HCK A;  2H3E B;  5KCO A;  2DNU A;  2NYS A;  2QA4 Q;  1WHK A;  4QW2 A;  1QWF A;  3PT9 A;  4NL3 A;  2LQN A;  1CKA A;  2XG8 D;  3M57 A;  1K9A A;  3M53 A;  3MPU B;  4BI3 A;  2FPD A;  5IDP B;  1RAH B;  3RMQ A;  1Q95 G;  4X9C A;  3FLG A;  4E7H A;  4OMQ A;  2A0F B;  2RM4 A;  3B57 A;  1H1Q B;  1KD1 R;  2DXU A;  2W0Z A;  2J05 A;  4OP0 A;  4ESR A;  3H0F A;  2XU8 A;  4C5E A;  1OKW B;  2X35 A;  2UZD B;  2A3L A;  2OTJ T;  3VJP A;  3CCQ T;  5GAN 7;  3J7A F;  3BHV B;  3CCJ Q;  3TSW A;  4B9X A;  2LNH B;  2K2M A;  4QT7 A;  1YJW A;  2CDT A;  1BYM A;  1UGR B;  2DL8 A;  1M1K C;  3OY9 A;  9ATC B;  3BG3 A;  4OB0 B;  4MMK A;  1RAI B;  5AT1 B;  2LQK A;  2PVO B;  1UEB A;  1D3B B;  2QQ8 A;  3EG9 B;  3GNF B;  4A4G A;  4L59 A;  4J9I A;  1D1A A;  3CCM A;  2D1X A;  3I35 A;  4F14 A;  1AWJ A;  1I4K 1;  3LWI A;  1M1K U;  4M75 C;  2KYB A;  2RQV A;  3HSB A;  2FB7 A;  4RKU E;  3PGG A;  3TNI B;  3GPL A;  1G3T A;  2QGS A;  3CPF A;  3EFO B;  2FPE A;  3LH5 A;  1UTI A;  2HKN A;  3G4S T;  3HRU A;  1ZSZ B;  1VQM T;  1OYX A;  1WA7 A;  2FO0 A;  3BLR B;  4BE1 A;  2LC4 A;  2RHX A;  3HO8 A;  4ATO A;  4RTW A;  5IXF A;  2LTO A;  4BD3 A;  4Y72 B;  1V76 A;  4EOM B;  5GJV B;  3OYN A;  2CH4 W;  3GOX A;  1X43 A;  5GAN 4;  2WMB B;  2HL3 A;  4FSX A;  1WIE A;  3QUI A;  2EW3 A;  3SWN C;  5IAY A;  2E41 A;  5GAO m;  2OI3 A;  4CRI A;  4FCY A;  1MND A;  1YJN A;  1YJN T;  3CEY A;  2DER A;  4C92 D;  2K9G A; 
#chains in the Genus database with same CATH homology
 5A0D A;  3X28 B;  3GP8 A;  2QQA A;  1M1F A;  3E9F A;  2QEX A;  4XTX A;  2QFZ A;  2IVW A;  1YI2 T;  1YBY A;  1H64 1;  4J6W A;  4OF1 A;  4JX4 A;  4PNO A;  3RES A;  2H3J A;  4LD6 A;  3SDZ A;  2HNI A;  2R58 A;  4E7L A;  4ZGD B;  4M6V A;  4C5G A;  3PNW C;  1X01 A;  2E12 A;  3EFR A;  2EJF A;  3P8B B;  3TW7 A;  4PJO G;  4GY5 A;  4XTU A;  3UT1 A;  2M9U A;  4A4K A;  4C8Q A;  2RJD A;  2RK2 A;  4XTZ A;  2YLB A;  4EMH A;  3C12 A;  4HCZ A;  4M7D G;  4C0F A;  5EG2 A;  3CXC A;  2KY9 A;  3H8Z A;  1KQ1 A;  1M90 C;  4B9W A;  4ZTJ A;  3DKM A;  1XOV A;  4YTL A;  2M16 A;  3I55 T;  2CZ0 B;  1KD1 C;  5A2Q E;  3HP9 A;  2FVU A;  4RG2 A;  3CMA A;  3MEU A;  2DXC B;  4JX6 A;  2RD1 A;  4C92 E;  2RHU A;  4ELY C;  4C8Q G;  5GAN 5;  3OBY A;  3JCM Q;  5C6S A;  1VQL A;  4FU6 A;  1VQL T;  2DD5 A;  2OAU A;  1JRI A;  4BDZ A;  1VQ6 A;  4XU0 A;  1N8R U;  3QWL A;  4IUU A;  3KUF A;  2KQW A;  4ME7 A;  1I5L A;  2PU9 B;  2R5A A;  3VV0 A;  4BE2 A;  3C94 A;  2OTL A;  2WSE E;  4N4H A;  2QQ9 A;  4KUD K;  4LDX A;  4A53 A;  4HT9 A;  2JZ2 A;  4A4E A;  4XU2 A;  1K8A C;  4NOY A;  5KE3 A;  4HCC A;  2DXB A;  2BUD A;  1M90 U;  3QYE A;  1O9S A;  1EIF A;  1I8F A;  2QA4 T;  5D6X A;  1Q86 C;  2X4X A;  3GNG A;  2QQR A;  2E5Q A;  2OTJ A;  3DB4 A;  5KH6 A;  3CCQ A;  3MO8 A;  2RK1 A;  2PVD B;  3M9Q A;  3M4G A;  3PMT A;  4E7K A;  1VQO T;  2E70 A;  4QQ6 A;  4M77 E;  1JB0 E;  4Y91 A;  2K3X A;  2VV5 A;  3OSS C;  4JUV A;  3DL1 A;  3MEA A;  2E1H A;  4M78 D;  1S72 T;  1QVF S;  2DZC A;  4EMK A;  5KE2 A;  5I2S A;  4BY6 B;  5DM7 R;  1K9M U;  2D9T A;  3FC3 A;  3S3M A;  1U1S A;  5FRO A;  1KC8 U;  1RL2 A;  5CCA A;  3JCM b;  5GAN 3;  5GAO q;  2XDP A;  2JN0 A;  1Q82 C;  1XQH A;  1VQ7 A;  1RI0 A;  3VKH A;  1V29 B;  5GMK j;  1MHN A;  3X25 B;  2CYZ B;  3OQ5 A;  4F7U B;  1QW1 A;  2LDM A;  2NLU A;  2E6Z A;  5J26 A;  1B34 B;  3V8J A;  4ELJ A;  1VIE A;  3CC7 T;  3OS2 A;  3LX7 A;  2RJC A;  3ME9 A;  2KR6 A;  2D0Q B;  3HRT A;  4IUT A;  3RIR A;  5GAN h;  2CZ6 B;  3QYG B;  1BIA A;  3L2W A;  4KUI A;  3CCJ A;  3CCL A;  4OMF B;  3BG9 A;  2DKG A;  2K57 A;  2RI5 A;  3CCJ T;  2LVM A;  1WNL A;  3EAE A;  3FRN A;  4IUV A;  1P92 A;  4M7A B;  4JRP A;  5GMK e;  4M75 D;  4JJN K;  2PVG B;  1Y96 A;  4HKE A;  4M78 E;  1YIJ A;  4M77 F;  1NE8 A;  1U1T A;  3ZBD A;  1G3Y A;  1ZQ1 A;  5GAN g;  3CC2 T;  2XD0 A;  1M8V A;  2VYT A;  4VUB A;  4Y28 E;  3CC7 A;  4A4H A;  1K73 U;  4FIB A;  2GCX A;  3OS5 A;  4RCB A;  3CCE A;  3CCS A;  3QJ6 A;  1Q82 U;  4PLI A;  3QYB A;  2XID A;  3P8D A;  3G6E T;  1OZ3 A;  2ZPI B;  2KVQ G;  1QVG S;  3SWN A;  4PJO B;  3QPH A;  2HAX A;  3LYI A;  3VKG A;  2DTI A;  4C5I A;  2QI2 A;  5LJ5 j;  3I56 A;  2EJ9 A;  2L8D A;  3I56 T;  3G4S A;  4M7D B;  2EAY A;  5C0M A;  5A0G A;  2DTO A;  4HA8 A;  1UGP B;  1N27 A;  3JB9 H;  2KAF A;  4PL6 A;  1W2B S;  1VQM A;  4C92 A;  2RO0 A;  1O75 A;  1KQ2 A;  5DLQ E;  4C8Q F;  3JB9 I;  2YRV A;  3E19 A;  1PSF A;  2WAC A;  3A8L B;  3RKY A;  4M75 E;  3A8G B;  2VXF A;  3OYE A;  2BS4 A;  4O5V A;  4Z02 A;  4XU1 A;  2E64 A;  2KMG A;  3FJP A;  3OYY A;  3CCR A;  4ZN1 A;  3GF5 A;  4LD9 K;  2E10 A;  3CME T;  5FRN A;  2O4X B;  4C92 G;  4NL2 A;  4XU3 A;  3PMI A;  3VU3 C;  2Y4X A;  3G7Z A;  3HL8 A;  3JCM h;  1NPR A;  4J6Y A;  3CCV T;  3MHX A;  3A8O B;  3NTH A;  4XAX B;  3HHT B;  3M5A A;  3M55 A;  4ZGE B;  3V8L A;  4HCB A;  2QF7 A;  2DD4 A;  3UPU A;  4HT8 A;  3JB9 F;  3A8H B;  3LGF A;  2BS2 A;  3VUB A;  3BFM A;  3OMC A;  3L1A A;  1N6A A;  1D3B A;  3HFO A;  2R5M A;  2V8K A;  1DJ7 B;  2G3R A;  3V8K A;  5GAO p;  4R56 A;  1YI2 A;  4UC4 A;  2DAQ A;  2LCC A;  1NPP A;  3FB9 A;  2DTH A;  5D6W A;  3OYC A;  2QDY B;  2VGM A;  3INZ A;  4MZM A;  5CVI A;  3VYG B;  4BE0 A;  4OB1 B;  1KG1 A;  3QBY A;  3CBO A;  4LDW A;  4M77 G;  2QDJ A;  1N8R C;  3BDL A;  3PTA A;  2ZPE B;  3L2V A;  2X4J A;  2V8I A;  3EFS A;  2L89 A;  4L5G A;  2FYK A;  4PKC C;  3QJY A;  1Q81 C;  4BY6 C;  2K5F A;  3M58 A;  4P5N A;  1QP3 A;  5GAM h;  2DJZ A;  5DLO A;  3PIO A;  4V2S A;  3P8H A;  2JOY A;  3DB3 A;  2E6N A;  1FWZ A;  3OB9 A;  2CGH A;  5CQX A;  4DOW A;  1YIT T;  2MF2 A;  2RJF A;  4IUP A;  4OGE A;  4R55 A;  3I55 A;  5J39 A;  1U8R A;  1G3W A;  4AKI A;  2FHD A;  1BIB A;  4IUR A;  3TU4 K;  2OTJ T;  4LDV A;  4M78 A;  1VQK T;  1BI3 A;  1VQP T;  3DLM A;  4Q5W A;  4EMG A;  3OBW A;  1PSE A;  5GAM g;  2GQV A;  3RKW A;  5AYF A;  2QQB A;  3H6Z A;  4RCC A;  2DPP B;  1VQN T;  1K9M C;  2AHJ B;  5LJ3 h;  2RHZ A;  5FRM A;  4M7A D;  5GAO n;  2DZ9 A;  1M5Q 1;  4HLQ A;  2DVE A;  3OW2 S;  3JCM J;  1Q81 U;  1KC8 C;  2Y90 A;  4MZP A;  5GAN f;  2XDD A;  4M7A C;  4M78 G;  4IKF A;  2RI2 A;  3LWH A;  1LOJ A;  3DLL A;  4XTW A;  3X24 B;  2XI9 A;  2QA4 A;  3LW5 E;  5HY6 A;  4BB7 A;  1Q86 U;  1HK9 A;  1YJ9 T;  2G77 A;  2MMP A;  1OZ2 A;  5GMK m;  3S3N A;  4J83 A;  3CBM A;  3S3O A;  4PJO D;  5CAI A;  1Y71 A;  5LJ3 g;  1VQO A;  3URG A;  1KHI A;  3JB9 G;  4AKH A;  3BDU A;  2P0Q A;  3FDR A;  5GAN 2;  4PJO C;  2M0O A;  4M7D D;  4F7U E;  4M75 A;  3NTI A;  1S72 A;  1WJR A;  5LL6 S;  3MP1 A;  2EKO A;  4M7D C;  5CKB A;  3CC4 T;  2KDS A;  1WGS A;  3RER A;  1GXI E;  4JLI A;  3HKS A;  4C92 F;  3C4S A;  4EDU A;  3JCM V;  3CBP A;  2LNV A;  3QXE B;  2RJE A;  1JBM A;  2ZPH B;  2ZZD B;  3QHS A;  4HNT A;  4X9D A;  3OYH A;  1K73 C;  1H3Z A;  2LT1 A;  1QVG A;  4M7A E;  2DXT A;  2JTM A;  2YLC A;  1UGQ B;  2VGN A;  4M75 G;  3MEW A;  4CI0 C;  3MP8 A;  1BI1 A;  2EJG A;  3MP6 A;  4MZT A;  4DQ2 A;  1FKM A;  1YHQ A;  4JRI A;  1YHQ T;  2CZ1 B;  3VKI A;  3OYI A;  3JCM X;  1W2B A;  3OA6 A;  4IUQ A;  3UWN A;  5HK0 A;  3OYF A;  2CS7 A;  3ER0 A;  3WVD B;  1YJW T;  3E9G A;  3RMS A;  3J7A F;  4M7D E;  3X26 B;  5GAO l;  4E47 A;  2X4W A;  1Y7X A;  2RH2 A;  5J3B A;  2A7Y A;  4QVC A;  5I21 A;  5I2M A;  3CC2 A;  3S6W A;  2JUF A;  2DXC A;  4L6V 5;  2P4T A;  4A4F A;  4BUG A;  5GAN j;  2PUK B;  1QP2 A;  1WPY A;  2M1H A;  3JCM f;  1MGQ A;  4M77 B;  2FL7 A;  5FU6 B;  4OVA A;  2WJ9 A;  3G6E A;  3ASK A;  1UB4 A;  2WSF E;  2HD0 A;  4XTY A;  4JRK A;  4MIM A;  2KMT A;  3CD6 T;  2GFU A;  3L2Q A;  3E1S A;  5CO7 A;  1ZBX A;  5GMK i;  1N9R A;  4KUL A;  3OYK A;  4O6J A;  3CCM T;  5GAN d;  2XIC A;  5GAN e;  3FEO A;  2V8J A;  4N4I A;  4OB2 B;  3M4Y A;  3M54 A;  5LJ5 h;  2Y4Y A;  5CKE A;  3V7R A;  4OB3 B;  4HNU A;  4J7F A;  4PLL A;  2DO3 A;  4JLG A;  2MAM A;  4QVZ A;  1R8O B;  1I81 A;  2BS3 A;  4C8Q B;  1Q7Y C;  3TW6 A;  1VQ4 T;  3T9N A;  1E7P A;  5FU7 B;  3QKJ A;  5FLX E;  3CCU A;  3CCU T;  1QLB A;  2C06 A;  1ZHI A;  1JJ2 S;  2L5Q A;  3CME A;  1LJO A;  2D6F A;  4JX5 A;  5GAM f;  1VQ9 T;  1BI0 A;  3WXM B;  4MDW A;  4M78 F;  4A54 A;  4N0A C;  3QZ5 B;  5A0L A;  4C0D B;  5LJ5 g;  4BAC A;  3TRE A;  2JTF A;  3QZ9 B;  5IT9 E;  5GAO r;  4M78 B;  3CCV A;  2K5I A;  2DIQ A;  2I2L A;  4JS5 A;  1Y07 A;  3QDR B;  2EQU A;  2DD5 B;  3UDC A;  3GLX A;  2K4Y A;  2P0P A;  3OS0 A;  2JNG A;  2F5T X;  3Q1J A;  1IRE B;  2RA2 A;  4FL6 A;  4F7U A;  3BY7 A;  4DA4 A;  1B34 A;  2BIV A;  1TH7 A;  5L8R E;  1VQ5 T;  2F69 A;  3JCM g;  1Q7Y U;  5LJ3 f;  3KBG A;  3QYH B;  2K3Y A;  2DK3 A;  3KXT A;  3MEV A;  3GIB A;  4II1 A;  4MML A;  2DXB B;  1M9S A;  2HQX A;  4AKG A;  3F70 A;  4M7A A;  4XK8 E;  4F7U G;  4D6W A;  2MWP A;  1XNI A;  3RUX A;  3OW2 A;  3OS1 A;  1BKB A;  1HXD A;  4M75 F;  1QVP A;  4OGC A;  4QQD A;  3VUZ A;  2EFI A;  5CKH A;  4M75 B;  2QTX A;  2ZGW A;  3M56 A;  3LH0 A;  3JCM e;  2WSC E;  4EMK B;  4N4G A;  4PJO A;  1YIT A;  3KHI A;  3G71 A;  3G71 T;  4M7A G;  3MET A;  4C92 C;  5GAN 8;  2QEX T;  4J5Y A;  3QSU A;  1AHJ B;  2O01 E;  4M7D A;  4WF2 A;  1IZ6 A;  5CKD A;  1KQS S;  4KT0 E;  1VQK A;  2CKK A;  2EQK A;  2IG0 A;  3X20 B;  2MI6 A;  4BBS M;  4LDY A;  1VQP A;  3ZFJ A;  4ZTF A;  4GLK A;  3QO3 A;  4AI6 A;  5DY9 A;  4ZN3 A;  5CR2 A;  1QVF A;  5GAM j;  3BW1 A;  5CIU A;  2B8A A;  2VXE A;  3SD4 A;  1OI1 A;  3L2U A;  3CPW S;  1VQN A;  2EQM A;  3HB9 A;  2LT4 A;  3OYL A;  4FT2 A;  3OYJ A;  2GF7 A;  1G3S A;  4HL4 A;  2R57 A;  5KCO A;  2P0K A;  3JCM c;  3JB9 J;  1M4Z A;  4QW2 A;  3PT9 A;  5HKC A;  1X6O A;  2O4X A;  4NL3 A;  2L3R A;  4M77 D;  4MFD A;  4RMO A;  1YJ9 A;  5GAM d;  1Y96 B;  2XG8 D;  3M57 A;  3M53 A;  4M77 C;  5FU6 C;  5GAM e;  4BBR M;  4BI3 A;  3CMA T;  4EPC A;  5LJ3 j;  4NS5 A;  5GAN 6;  1X75 C;  3JSC A;  4NC6 A;  3VYH B;  4J8O A;  5KCH A;  4JS4 A;  3RMQ A;  4FM4 B;  4X9C A;  1NJI C;  3HZJ A;  3L42 A;  1VQ6 T;  3FLG A;  4KBM B;  1KHC A;  3SWN B;  3CC4 A;  2XK0 A;  3HPW A;  4E7H A;  4C5H A;  2RM4 A;  1UGS B;  3SFM A;  2K5L A;  3PFS A;  2OTL T;  3JRZ A;  2DXU A;  1SSF A;  5LJ3 d;  2EQJ A;  3VYG A;  4C8Q D;  2LCL A;  4OP0 A;  3L2Z A;  4C92 B;  3BG5 A;  5LJ3 e;  3CXC S;  2XU8 A;  2GFA A;  3HRS A;  3O8V A;  3SB2 A;  4C8Q C;  1N9S A;  4J6X A;  3A5Z B;  4C5E A;  2K2V A;  2VUB A;  2X35 A;  1VQ8 A;  1VQ8 T;  2A3L A;  4QQG A;  5FU7 C;  3VJP A;  1NZ9 A;  5GAN 7;  5LJ5 f;  3CCQ T;  4DOV A;  2XDB A;  2ZCF B;  3QG1 A;  3L2R A;  1W4S A;  4B9X A;  2RB6 A;  5GMK h;  2LX9 A;  2E65 A;  2LRQ A;  1FXX A;  2CZ7 B;  4TVR A;  4C0Z A;  4C0D C;  4JDS A;  1NJI U;  2MWO A;  4PJO E;  3WVE B;  4LDU A;  1YJW A;  3AHU A;  1BYM A;  1UGR B;  4M78 C;  2XKO C;  4E7J A;  2RI3 A;  3HBL A;  3N5B B;  3OY9 A;  1M1K C;  4XQ3 A;  2EYQ A;  2ZPG B;  3TEE A;  3JB9 D;  3BG3 A;  2JVV A;  1K8A U;  4N0A A;  3H4C A;  4F7U F;  4MFE A;  2PQW A;  1JJ2 A;  2PUO B;  4MDX A;  4OB0 B;  4MMK A;  2DD4 B;  1VQ7 T;  2LQK A;  4J7I A;  1LNX A;  2PVO B;  3QII A;  1UEB A;  2X4Y A;  4XTV A;  5EJC A;  2BKD N;  1D3B B;  4C0G A;  2QQ8 A;  4C8Q E;  1M1G A;  3GNF B;  4A4G A;  1WJQ A;  3OYA A;  3CD6 A;  4L59 A;  3JCM P;  4C92 D;  5HK3 A;  3CCL T;  3R6O A;  3CCM A;  4M7A F;  4Z6Y A;  3MCA B;  2ZPF B;  4JRQ A;  1VIF A;  3JAM E;  1I4K 1;  3LWI A;  1WQ7 A;  1M1K U;  5D6Y A;  4M75 C;  3V7S A;  1YIJ T;  4X34 A;  1G5V A;  1VUB A;  3HSB A;  2FB7 A;  2RHY A;  3PGG A;  4RKU E;  2YHT A;  4PJO F;  4EMK C;  3J80 E;  3FIF A;  3GPL A;  4LOC A;  2LQ8 A;  3CCS T;  1VQ4 A;  3CCE T;  3LLR A;  3M59 A;  2ZPB B;  1G3T A;  3CPF A;  3JCM W;  1KD1 U;  3OYD A;  4M7D F;  1VQ9 A;  3LGL A;  2VC8 A;  4FT4 A;  4HNV A;  4RG8 A;  1BI2 A;  1FX7 A;  3NFC A;  3C95 A;  3G4S T;  5IN1 A;  1XTD A;  3HRU A;  2ZZD A;  3OSV A;  4BI8 B;  3RKX A;  4QVD A;  2RHI A;  3V7C A;  1VQM T;  3OYM A;  1WQW A;  2DEQ A;  1OYX A;  5CQY A;  1YCY A;  4QSH A;  1WJS A;  4BE1 A;  3PIP A;  3OYB A;  3NTK A;  5CKF A;  2LC4 A;  1KQS A;  1VQ5 A;  5LJ5 d;  3J81 E;  2RHX A;  3HO8 A;  5LJ5 e;  4ATO A;  3A8M B;  5GMK l;  3CCR T;  2LTO A;  4BD3 A;  2F5K A;  3TCJ A;  3CPW A;  3ZEH A;  4E7I A;  3OYN A;  3GOX A;  2QQS A;  4ZGJ B;  2HQE A;  3HFN A;  2KK4 A;  2EIF A;  5GAN 4;  4ELZ C;  4FSX A;  4BDY A;  5CK9 A;  2QXF A;  3QUI A;  2HBP A;  4BI4 A;  3OMG A;  3SWN C;  5IAY A;  2E41 A;  5GAO m;  4CRI A;  5M9O A;  4M77 A;  1YJN A;  3JCM d;  1YJN T;  3OYG A;  2KSS A;  3CEY A;  2XHC A;  2EWN A;  2DIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...