2CZ7B

Fe-type nhase photo-activated for 75min at 105k
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Center Structures of Photo-reactive Nitrile Hydratase during its Photo-activation Process
rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2cz7B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cz7B02
2ZPBB 1QP3A 2D0QB 2DD4B 2CYZB 2O01E 2ZPFB 4OB3B 3X26B 3X24B 2DD5B 3QXEB 2ZZDB 3A8HB 2DXBA 5L8RE 2ZPHB 4L6V5 4XK8E 2AHJB 2CZ0B 1UGQB 3QYGB 2ZCFB 1QP2A 1IREB 1DJ7B 2PVOB 3X20B 3A8OB 4RKUE 1UGPB 2DPPB 2CZ7B 1GXIE 3HHTB 1UGRB 1V29B 1AHJB 3A8LB 4OB1B 3WVDB 1JB0E 4ZGJB 2DD5A 3LW5E 4ZGDB 3WVEB 2WSCE 2PUOB 3VYHB 2QDYB 2DXBB 2ZZDA 2WSEE 3QZ9B 3X25B 2DXCB 2PVDB 2PUKB 4OB0B 2DD4A 4FM4B 2ZPGB 2ZPEB 3A8GB 4ZGEB 3X28B 1UGSB 2WSFE 3QYHB 3VYGB 2CZ1B 4Y28E 1PSFA 2PVGB 2CZ6B 2ZPIB 1PSEA 4OB2B 3VYGA 2PU9B 3QZ5B 3A8MB 4KT0E 2DXCA
chains in the Genus database with same CATH superfamily
5GAMh 1T3LA 1ZSZC 5GAN6 2FO0A 2CJMB 2LQWA 2K5IA 2NYSA 2VVKA 4IUTA 3DDQB 2LRQA 5L2WB 1Q81R 3X24B 1NPRA 3CCQT 2XMFA 3CCEA 4F6UB 3D7SB 2BE9B 3JCMP 1M30A 4XTXA 3EGDA 2KRSA 4FYWB 5HBEB 4RCBA 1M1KC 5GMKj 1QWFA 3EFOA 2CZ0B 3CCSA 2UZDB 2ZCFB 1ARKA 5KYNA 1UNGD 3QWYA 3E9GA 1WPYA 2UZBB 3I9QA 1MMAA 4BY6C 1KHCA 1WX6A 5CK9A 2KK4A 4BI4A 1AISB 3DL1A 3HHTB 3VKGA 3CPFA 3KFVA 2L3SA 2LT1A 3FB9A 4HT8A 4PJOE 2BS3A 2EYZA 1Q86R 2CT3A 3RUXA 2BKDN 4XQ3A 4BY6B 3KBGA 1N6AA 2LT4A 3WVEB 1CKBA 4QW2A 1Q86C 1RADB 1GCQA 2PZ1A 1W1FA 4OGCA 2JOYA 4F7UA 3VS3A 1JJ2P 1KQ1A 2PVDB 2AKKA 5I11A 1H3ZA 3CMEQ 1OX8A 5KYXA 1ABOA 2PUKB 4FM4B 1UECA 2GNCA 9ATCB 2WEVB 1QVFS 3MHXA 1VQ5Q 2OAUA 1M1KR 4JZ3A 3RKXA 3HP9A 4Q5WA 3CC7Q 4D8DA 4C0DC 1VQ7T 4M7AF 1HSQA 5D6YA 3UDCA 2K9GA 1QCNA 2XU8A 1WJQA 3E1SA 5LJ5e 1UHCA 2HQEA 4JJNK 4EMKC 3CXCS 2R5MA 3EG0A 1VQLA 4C8QD 3L2UA 2HSPA 5HVYB 4YOOA 2V8IA 2L3PA 4RG8A 3HTRA 5LL6S 3UATA 2DX1A 1W2BA 4XU3A 1VQNT 4MMLA 4C8QB 5I22A 2X4WA 3A8MB 2KVQG 3OYEA 1TU0B 5DLQE 2K57A 4EIKA 1NJIC 2GQIA 2IIMA 3EGUA 3CD6A 1I1JA 5CR2A 3CCRQ 3EG9B 2EGAA 4HL4A 2AKLA 5KE2A 3OYLA 2F2WA 1FVVB 2GBQA 4Z02A 5LJ3d 1KC8C 1NE8A 1TS9A 2QQAA 5CAIA 3UWNA 4DA4A 4B9WA 2ZPHB 2CDTA 1KC8U 3E2UA 4DBRA 1J3TA 4ROCA 3LX7A 3NHNA 1H92A 3JSCA 3OS5A 1G3WA 2DM1A 5CKBA 3VKIA 4JUVA 3TVTA 4MZMA 1UNHD 2D0NA 5IDPB 1M2VA 4KRDB 2P4RA 2KRMA 1KXUA 2X1NB 1ZUKA 4JDSA 1WNLA 4EOMB 1IB8A 4M78F 1HYOA 3G1JA 4PJOB 2DMOA 2Y4YA 2A0FB 1WJSA 2QGGA 1NPPA 4Z89A 4E7LA 1C9BA 1V29B 2DL4A 2FHDA 2QDLA 2A08A 3CCUQ 1LNXA 2RNAA 4FYXB 3SFMA 1QMCA 2DJZA 2BZXA 1YITT 2FPDA 3HRUA 3V7SA 1KQSP 1UTIA 4E7HA 2E5QA 3EG9A 2CCIB 1H1PB 2UUEB 4UC4A 3RIRA 2HAXA 2ESWA 1C0MA 3LWHA 2C4GB 5DLOA 4IUQA 5CKDA 1VOLA 5CVIA 3H0IA 5GJWB 1HD3A 1A0NB 3QYBA 1RAFB 4C8QA 4ME7A 2PK2A 2YRVA 2KMGA 3EG1A 2CZ1B 3UA7A 3I5RA 3G71A 1YIJA 3JCMX 2JS0A 4C92F 2LQNA 4A54A 3LQ5B 1I5OB 4GBQA 5KYYB 1GFCA 3CCRA 4M77E 1WHLA 1K0SA 2I40B 4A4HA 3TNHB 2J6OA 5M9OA 1VQKQ 4UN0A 1Q7YU 4HVWA 1U5SA 1UFFA 5A0DA 1VQ6A 3IQLA 3FDRA 1KQSA 2RI5A 4LDXA 1YWOA 3META 4J9EA 3CCST 1YCSB 5FRNA 3DDPB 2EQIA 2DILA 5CQXA 4OGRB 2LCCA 5HY6A 3SWNC 1O9KA 1X75C 2KXDA 1TFBA 4EOSB 2YXYA 2YRCA 1VQLT 3VS1A 2RF0A 2YWWA 1FKMA 1ZA1B 3CCMT 4F7UG 5GAOp 4PJOA 1FX7A 3G33B 3MP1A 3FLGA 4NL3A 1DJ7B 4FW2A 1YJWA 2O31A 1B34B 4RKUE 3JB9J 2OTLT 5GMKi 2EW3A 3M53A 4M78C 2EJ9A 3OS2A 3EFOB 3QUIA 2KT8A 1AHJB 1O75A 4J9GA 3T9NA 5GAMg 1JRIA 3URGA 5GAMf 8AT1B 2DK3A 5GAOm 3CCRT 2KGTA 2L2PA 5HBJB 1WXUA 1OULA 3EGDB 1VQMQ 1RABB 1OGUB 1BI0A 2PUOB 1K8AC 5LJ5h 2X4JA 3EFRA 2WSEE 4HNTA 4F17A 3NMZC 3I55A 3POMA 2G3RA 2RI2A 4X34A 2C5NB 1U8RA 3SHWA 2COWA 3ZFJA 2LNVA 2RHUA 2J7IA 1VQ7Q 1Q81U 2JM8A 4MFDA 3S3MA 3MP6A 2KYBA 3PVLA 3PIPA 4Y28E 1OI1A 2UZLB 3UF4A 4FSXA 1R0BG 3CMET 3LH5A 1PSEA 3PIOA 2ED1A 4M75G 1D0XA 1RACB 3MY1B 1OV3A 4VUBA 4KT0E 4OMNA 1FMVA 2LZ6B 3PNWC 3QO3A 2ZPBB 4XTYA 1VQ4Q 1NLOC 4D6WA 1ZBJA 2JJ9A 2KNBB 2GGRA 2RA2A 2ZPFB 3G4SA 4ROEA 1MV0B 1PWTA 1XO2A 3CD6Q 1OZ3A 1Q86U 2EQKA 4XU2A 2DO3A 2FB7A 2D8JA 2G6FX 4CXAB 4N4HA 4ZN3A 3CCQA 4HLQA 2QXFA 1MMGA 2BPMB 1KFZA 1WHJA 1H28B 2L89A 3OBWA 1OZ2A 2ZGWA 4N4GA 1WIEA 4J6XA 2FRWA 1VQ5A 4JPBW 2KROA 4D8KA 4E7ZA 3TSZA 4M75B 3OSSC 1IO6A 4M7DC 3CCLA 7AT1B 2PJQA 3ME9A 1S72T 1M1KU 3JCMg 3TN8B 2QA4A 2MF2A 3OYJA 1VQ9T 5GANj 3A8LB 2EYQA 4M7AB 4ELYC 3WVDB 2MCNA 3JCMh 2J06A 2Y90A 4XTZA 3NTIA 2QI2A 4QVZA 4R55A 3QHSA 3CCJA 2LJ1A 4A4KA 4BCND 1WHMA 4R0KA 3LW5E 3L1AA 4ZGDB 2AZVA 2XG8D 4M78D 4EOIB 1UGVA 5IAYA 2QDYB 5KYUB 1OI9B 4G6LB 4J9HA 1X01A 2CH4W 2H3EB 2DD4A 4BCHB 3GLXA 2ZPGB 3VRYA 4M77A 3HFOA 2EYXA 3CCVT 2LVMA 1KK7A 3JCMe 4FL6A 2F5KA 2DRMA 3CMAT 2VB6A 4LDUA 1X2QA 1MNEA 2IW9B 4C92A 4IUUA 3GNGA 2RN8A 4CC4B 1KC8R 3PVQA 5ACBA 3M0QA 2IW6B 1M8MA 2QDJA 2VUBA 1TOVA 4OMFB 3VS2A 4OMMA 2NUPB 4PJJA 3R6NA 2EIFA 4JJCA 4OMQA 4C5GA 1VQPA 4PLLA 3BFMA 3NFCA 2COYA 4PJOF 4E7SA 3CD6T 1TUDA 3THKA 4F7SB 4DBFA 1HK9A 5GANg 1YJNT 3E9FA 2J6KA 1N8RU 3CC4Q 3X26B 1VIFA 1PM3A 4JLGA 3VUBA 3EJ1B 4C0GA 2DBMA 2FVUA 3O0GD 5I5ZB 3HBLA 1R8OB 2GF7A 3QYEA 2JGZB 4F7JB 2CP6A 1SSFA 2K3YA 5GANh 4A4EA 3CCUT 1QW1A 1O9KB 1OU8A 4XK8E 5GAOn 1K73U 1VQOQ 3RERA 4EPCA 1QQJA 4CC2A 2CP5A 4A63B 4OMOA 3CC2T 5I2SA 1KD1R 3X20B 3M54A 1U1SA 2ABLA 4M7DF 4M7AE 1PCXA 2VV5A 5IHKA 4AI6A 4CFUD 4WTOB 1UGRB 3PFSA 5KYWA 2IPOB 3JCMW 2FYKA 2RD1A 2NUTB 4E7KA 4EMHA 1AD6A 2L3RA 1C1AA 4C8QC 3JB9F 1BU2A 1VQ8Q 4PJLA 2LTOA 1GCQC 1OX9A 2HSEB 4L59A 3OYGA 2OJ2A 5LJ5j 1M9SA 2I2LA 3EG2A 1M5Q1 3CCMA 1CSKA 3EHRA 2O4XB 2LJ3A 4BBRM 4MMKA 4JX5A 4RTXA 1BYMA 3L2VA 2CUBA 4OP0A 5KH6A 4RODA 1G3TA 4LD9K 5GAN8 4M7DE 1M3BA 2OX7A 2CUDA 3M0PA 3VJPA 1ZQ1A 1UJYA 2QEXA 3M03A 2DYBA 2LJ0A 1EZZB 3VYGA 1QMZB 2PU9B 4XTUA 1EX4A 3DJBA 5LJ3h 1N9RA 3EIDB 2CSQA 3UA6A 3I35A 4PK4A 4J9DA 4HCCA 3KHIA 2QK0A 3MKDA 5LJ3g 3HPWA 3M59A 3CBOA 4HCKA 1BKBA 1GCPA 1OYXA 4LE9A 3PT9A 2F1LA 3I55Q 5L8RE 4BBSM 2CSIA 2P84A 2DL7A 2L8DA 1VQKT 3BY7A 3KXTA 3G7ZA 2WPAB 5CKHA 3TREA 1YHQA 3QYGB 3GPLA 4F16A 3LYIA 5KYYA 2JXBA 1G3YA 2YHTA 2FZKB 3EAEA 1UB4A 1IZ6A 2DJQA 4HCZA 4PFOA 1GXIE 1S1NA 3I55T 4CFUB 2FZCB 2KYMA 2ROTA 1QCFA 1UUEA 3M55A 4C8QF 4X1VA 2HMAA 3GBQA 3VU3C 3QG1A 1M90C 5FU6C 3BLQB 2NUTA 4M77F 2L5QA 1G3NC 4Z88A 4C5IA 4JJDA 1OKVB 4KULA 5FU7B 5D6WA 4KRTA 6AT1B 3M58A 1NG2A 4M75C 4GLKA 1Y96A 4C92G 2CP7A 2IG0A 3L2WA 4O6JA 2X3XD 2XDPA 4RCCA 1VQKA 4C0DB 2JUFA 2PMIB 2CZ6B 1MMNA 2E3IA 4LUEA 3H6ZA 1PRMC 3GNFB 1QCOA 3C94A 2EPDA 2XDDA 2EWNA 3BG9A 2G77A 4M7AD 4ZN1A 1TWBA 2DXCA 1VQ6Q 1H1RB 3S6WA 4FX3B 3CCJQ 5GAMd 2V1QA 3M57A 4EMGA 2KQWA 1WYXA 1I07A 2D9TA 3J80E 5AT1B 5LJ5f 2K2MA 5FGKB 4IIMA 2IVXA 1ZBXA 3A8HB 1URCB 1N4MA 3EGXB 1D1CA 4M78E 5C0MA 4FU6A 1VQNQ 2EYWA 3C0CA 5FWBA 5GMKh 5FU6B 1QP2A 4M78G 2PVOB 1VQOT 1VQOA 2DL5A 1VYWB 2EFIA 2OTJT 1OKWB 2PHGA 3I56A 2MIOA 3MPUB 2D8HA 5HKCA 4LDYA 4J9BA 2E41A 1G3SA 2WACA 3EHQA 5KYUA 1VOMA 1YN8A 4A4FA 3CMAA 1BU1A 4KGXB 5IHNA 3R6OA 1XTDA 3TU4K 5GAN5 2K79A 1VQ4A 2GTOA 3DOGB 1Q82U 3MIAB 3OMCA 3OS1A 1JU5C 3DLLA 1Q82C 5GAOq 1D0YA 1T0JA 2NUZA 4PNOA 1QVGP 4KH0B 2GQVA 1AT1B 2E5KA 4BE2A 3L2QA 2C6TB 1YI2A 4JLIA 2F2VA 1YHQT 4E6RA 3OYKA 5KYWB 2OAWA 3E19A 2M0OA 1O9SA 2EQMA 2YLCA 3HZJA 3I5SA 3TCJA 2HQXA 2BTTA 2BE7D 4B6MA 4BCOB 5IHIA 2AK5A 1GUXA 1R0CB 4P5NA 4M4ZA 3HB9A 2HKNA 4HT9A 1KD1U 4KUIA 3VS0A 3SD4A 4F7NB 3HL8A 2C0TA 2WMBB 2E70A 2H3JA 2JNGA 1B7TA 4X9CA 3C4SA 4F7UB 3CMAQ 1KD1C 1PC0A 3DB3A 4DEYA 2G9XB 2JMAA 5AYFA 3H8ZA 2DRKA 2EJFA 1H8KA 1VQNA 2KY9A 1VQ9Q 2YUNA 1RAHB 1XOVA 1Y7XA 1ZA2B 1RAIB 1KG1A 2RHXA 2K3BA 4II1A 1SRLA 1LVKA 5HNBB 3QDRB 4RTVA 4M75E 3OYMA 2COZA 4RTWA 1EIFA 1K8AR 3V8KA 4EOJB 3HFNA 5DY9A 2BUDA 1IREB 3G6EA 3TEEA 2KSSA 2RB6A 3MO8A 4EOLB 4HKEA 3G71Q 1YIJQ 2FPFA 2XK0A 4KBMB 4C0FA 3QWXX 2K7AA 2LX9A 3H0HA 4PL6A 4XAXB 3A1PA 1GBRA 4NS5A 3N5BB 1NYGA 1JBMA 1TG0A 5A0LA 4LDWA 2IVWA 3J81E 3M4GA 1ZP2A 2DD5A 2X4YA 1JJ2A 1UJ0A 4FCYA 2R57A 2RK2A 4QVCA 1RAEB 4XTWA 4N4IA 2X51A 3QZ9B 4BCQB 4HCBA 3HSBA 1H1QB 1VQMA 2EBPA 1TD6A 1UHFA 2W9FA 5KCHA 2M1HA 1AWOA 3INZA 4JRPA 4BDZA 2BKZB 5J26A 1BK2A 3DTOA 2WSFE 1TTHB 3M56A 4M77D 4M7AC 2R58A 1VYTA 2KI7A 1RAGB 2DAQA 2JTFA 1WHGA 1D1BA 2BS2A 2RJFA 2KMTA 1IXDA 2WJ9A 3OBYA 1JKWA 5EJCA 4M75A 2BS4A 4BXXX 4EMKA 4F7LB 2PTKA 2CGHA 2RQVA 3SWNB 2ZAEA 3JCMd 1QLBA 2XDBA 1LCKA 1H25B 1KQ2A 2XHCA 5GMKe 1OQKA 1W6XA 3AT1B 3OYAA 5GANd 2HQHA 4F70B 3HO8A 4QVDA 1UNLD 1K76A 2O2OA 4QQDA 3BHTB 2KAFA 4FT2A 4QQGA 2ZZDB 2DXBA 2LC4A 4MFEA 2MI6A 3CCJT 2KEAA 3NDQA 1ZLMA 2HEQA 3TNIB 4TVRA 1XQHA 2OTLQ 1N8RR 1UDLA 3JV3A 1MHNA 4OR5B 2FZGB 3C95A 1WQ7A 1MNDA 4M78B 1BI3A 1YJ9Q 1NJIU 2JMCA 2HZYA 3JCMV 3K7AM 3G6EQ 3A8OB 4C5EA 2DPPB 5DM7R 1K73R 4YOSA 4LXCA 2CZ7B 4J9IA 1VINA 1OOTA 2J6FA 4OF1A 1OIUB 2YUOA 3CCVQ 3MEVA 4CFMB 2DZCA 3JB9I 5FW9A 2CH4A 4E7JA 1IGQA 4L5GA 3CCUA 1G2BA 1PKTA 3REBB 1LOJA 4BY1X 4BCKB 1YCYA 1WZOA 1Y57A 1I0CA 1RL2A 3VYHB 1UG1A 2E12A 4II5B 4IMYB 3X25B 1WLPB 4CRLB 2I0NA 5D7UA 3SB2A 4CC7A 5IN1A 4JRIA 3ZBDA 2CT4A 2W2HA 2LP5A 3SEMA 3FJ5A 1BI1A 5LJ3f 4A53A 5D6XA 3UT1A 2XKOC 4DEXA 5LJ3j 1K9MU 1OIYB 1M1FA 4ELJA 4FW1A 5GAN4 4JRKA 3TSWA 2LNHB 3I56T 2ZPIB 2QA4T 1U3OA 2V26A 4EOPB 2JW4A 1Y96B 5HK3A 1S72A 4AFZC 1D3BB 4B9XA 4HXJA 5GAOr 1FMKA 1M27C 4N0AA 3CCVA 3GF5A 4HVUA 2RHIA 3H9NA 1QP3A 3BW1A 2CYZB 1VQ4T 4AG2C 1KQSS 3AHUA 2DE0X 3MEUA 3MY5B 4OB3B 2VYTA 1X6OA 2V8JA 2JS2A 2DIGA 4JZ4A 3JCMb 1ZSGA 2WXVB 4L6V5 4NOYA 3G4ST 3QWLA 1I8FA 5I2MA 1RI9A 4BE1A 4DQ2A 2D1XA 2X9HA 1VQ9A 2C0OA 1Y07A 2DTIA 3MJXA 2J05A 4RTZA 1VQPT 1BBZA 1WDXA 1PHTA 4MDWA 1PKDB 2DKGA 3OYNA 1YWPA 3A5ZB 2BZYA 5CIUA 4ATOA 5KCOA 2EJGA 4MZTA 4EORB 5IDNB 4M78A 3PTAA 1K1ZA 4OB1B 5CCAA 3H0FA 2W0ZA 1H641 3NTKA 1U06A 1M1GA 4AMCA 1D3UB 1GL5A 1ZSZA 4CC3A 2BZ8A 2QASA 2EQJA 2MMPA 1AZEA 2DMEA 2DXBB 2ZZDA 1GBQA 1EFNA 4WF2A 4X9DA 2DZ9A 2AZSA 2X4XA 3CC4A 2K4YA 5L23A 5GANf 1VQ6T 2ECZA 2Z0WA 2WFYB 2QAZA 2XIDA 1D0ZA 1UE9A 2E4HA 1MMDA 1YJWT 5ECAA 4JX4A 1BIAA 3PMTA 3JCMf 4XU0A 2F69A 4EMKB 1NEBA 4CFWB 4AKGA 3DLMA 4BY7X 4J5YA 4BE0A 4C8QE 1V1CA 2XI9A 1PG5B 3GOXA 2WIHB 2QFZA 2JM9A 2DERA 4A4GA 2DA9A 2X3WD 3PGGA 1YNZA 3OW2P 2K6DA 2C5OB 4PLIA 1N27A 5GMKl 1VQ5T 2E64A 2DD4B 3TQ7P 3PO3S 4BI8B 1GFDA 2R5AA 1ZSZB 3G4SQ 3ASKA 1SG5A 4BCQD 3QKJA 3QXEB 1SRMA 5FU7C 4ESRA 1RLQC 4I3ZB 1OU9A 4K11A 2C06A 4EOQB 1W2BS 1AVZC 3V8LA 1M90U 2HBPA 2QGFB 3REAB 2GTJA 1MV3A 2YUQA 2P0QA 4Z6YA 2Y4XA 2OTLA 1WI7A 1GY3B 4Z8AA 3CCLQ 1JEGA 3QDFA 4RTYA 5HCKA 2RK1A 2QA4Q 3GTMS 3I56Q 5GANe 2KXCA 4GLMA 5I21A 1X6GA 3C12A 3G71T 1YIJT 3L2RA 3DB4A 3CEYA 5FROA 3EG3A 2JT4A 1H4LD 2BIVA 4FT4A 2XICA 4BCIB 3VS4A 4Y91A 2SEMA 2X35A 5CO7A 1YJNA 2QG9B 2GCXA 3QIIA 4IURA 4FSSA 4CFVB 5A0GA 1W70A 2NWMA 3CCMQ 2ZPEB 3BLHB 3A8GB 5IT9E 4PJNA 4JS5A 4CFNB 2EGCA 1Q82R 4QQ6A 1F1BB 1V76A 3JCMc 1SKUB 3MCAB 1I5LA 5GJVB 5GMKm 3TW7A 3KUFA 3J7AF 4BCNB 2K3XA 4Y92A 2HCKA 5CEIB 2FG0A 4C92C 3BG5A 1N9SA 2RQTA 3CCET 4LDVA 3P8DA 3H4CA 3EH1A 5DQVA 4CFXB 4LD6A 1VA7A 2A28A 3G6ET 2F5TX 3OW2A 1OL1B 2P4TA 1Z9QA 3SWNA 1JXMA 2O9VA 3VS7A 1H27B 4KGZB 2HD0A 1SSHA 4PJOD 2DETA 2RMOA 1N5ZA 2WIPB 3JB9H 3RR6A 2QTXA 2KT1A 4F6SB 2DVJA 2EQUA 5IXBA 1Y0MA 1G8XA 1RAAB 1YJ9T 1UGQB 5EFQB 3L2ZA 2EAYA 2C5VB 2MYSA 1YHQQ 1VQ7A 1K9AA 1TUCA 3ZL7C 4ZTJA 4KH1B 3VRZA 3VS6A 3TW6A 4HNVA 3OS0A 3CXCP 1I4K1 1I81A 4EC8B 4LUDA 3V7RA 1SHGA 1K9MR 1WXBA 2V1RA 2RPNA 1K8AU 2QEXT 1AOJA 1Q81C 3V7CA 2RO0A 4IIOA 2F2XA 5CKFA 3FJPA 2E6ZA 4IKFA 3CPWS 5IH2A 1T0HA 3RKYA 5GAN7 1BCOA 3CMEA 2RJEA 2QQSA 3EGXA 1PD1A 4V2SA 3RDVA 1E6HA 2E3HA 2GFUA 1YJNQ 2DVEA 3LWIA 4FYVB 5LJ5d 1JOWA 4Y72B 1VQMT 1WHHA 2IW8B 1B07A 1RI0A 1Z9ZA 3X28B 3FRNA 2CCHB 4O5VA 3OSVA 1H1SB 2M16A 1SEMA 4DOVA 4JRQA 3O8VA 1GUXB 4FIBA 2NLUA 3EFSA 1W2BP 1G5VA 1OPLA 1ZHIA 3QJ6A 2WMAB 3HRTA 2DYIA 3ER0A 3NGPA 1RLPC 3OYBA 3GP8A 1BB9A 1D1AA 2JN0A 4M7DB 1LPLA 3QHRB 4E2FB 5ICPB 2VXEA 2O9SA 2M9UA 4NC6A 4M75D 1ACMB 2C0IA 4J83A 2W96A 1ABQA 4M77G 1NYFA 3P8BB 2KE9A 5CQYA 1NM7A 2L3QA 3BG3A 2MPXC 3HKSA 3OY9A 3EOCB 2DD5B 2W9ZA 2H8HA 2DXUA 3BE3A 4OVAA 4C8QG 3BDLA 3MI9B 2YT6A 1QVPA 4LNPA 1YI2Q 4ZNXA 3O5ZA 1YJ9A 5GAN3 2MK5A 1AWWA 1WHKA 2DNUA 1K0XA 4CRIA 1CKAA 4E47A 1X27A 3CCEQ 2P0KA 2E10A 1YI2T 4RTTA 2VC8A 5GAN2 4BCFB 2KR6A 2VXFA 1AZGB 3PMIA 1TH7A 2IN3A 3OYYA 4XU1A 4JS4A 1FMWA 3CCSQ 3BDUA 5A2QE 3S3OA 4FYYB 1AWXA 4RG2A 4KGVB 2DL3A 1M2VB 1NJIR 3M0UA 4PFZA 3M0TA 2VWFA 4PFPA 3B57A 2DTHA 1P92A 4ZGJB 2MAMA 4OMPA 3RESA 4WCIA 1R77A 2RM4A 4XTVA 2VASA 4R56A 2JZ2A 1BIBA 5EC7A 1NBEB 2RI3A 1XJWB 1X43A 1U1TA 2DFUA 2RJDA 4M77C 1NEGA 2DF6A 1PRLC 3DKMA 3SDZA 3LLRA 3JCMJ 1B34A 4C92D 3LGFA 2HL5C 2CKKA 2V22B 1AD5A 1UGSB 3M4YA 3CC7A 1KHIA 2W10A 3VYGB 1JSTB 4CI0C 1YP5A 4NSTB 2B9RA 4EC9B 1PNJA 4C5HA 4M7AG 1JO8A 5HQ0B 4BCGB 1K73C 1M90R 4C0ZA 1N8RC 4OB2B 2K5LA 1GRIA 4AKIA 4J7IA 3TNWB 1M3CA 2QYZA 4PJMA 2YUPA 2HBWA 3VS5A 4EOKB 2I53A 2FPEA 2QTVA 4BUGA 3A98A 4PJOC 2CP0A 2QQBA 4YTLA 5KYXB 2FEIA 4BCPB 3M0SA 2DL8A 2HL3A 5DQWA 3RMQA 2OTJQ 3JB9G 2KR3A 3F5XB 3OMGA 2MWOA 1JSUB 1M8VA 1YBYA 4RUGA 3M0RA 1YJWQ 2DEQA 2OI3A 4F04B 1JXOA 1VQ8T 3CBPA 4J9FA 1K4US 3OA6A 1M4ZA 5CYIB 1QVGA 3LH0A 1X2KA 4AKHA 1W4SA 4M7DG 2DTOA 1UGPB 1TSFA 2ENMA 4E7IA 2KRNA 2CREA 4AT1B 2LDMA 1GH6B 3RKWA 3RGFB 4ANJA 1Y71A 2RHZA 4MIMA 2RH2A 1W98B 2QQRA 3OQ5A 2AT1B 5EG2A 4DOWA 4ORZA 1D09B 3QJYA 2K2VA 1OPKA 2QQ9A 1JB0E 2LCLA 1FWZA 2XD0A 3JCMQ 4LOCA 1WGSA 3UPUA 4N0AC 3F70A 1E7PA 1T3SA 1WJRA 2DXCB 2YLBA 2QF7A 3FIFA 3Q1JA 4J7FA 4BACA 1MUZA 2CS7A 1VYVA 1SF9A 5LMKB 2JVVA 3QSUA 4ZGEB 2MWPA 4HA8A 2RQRA 1OEBA 1X69A 2E6NA 4EOOB 5C6SA 2LW4A 2NUPA 4JJBA 3OYHA 1IRXA 4IUPA 3RMSA 1QVGS 2PK9B 1Q7YR 4NL2A 3NTHA 3U23A 4OGEA 3VV0A 1NLPC 2QEXQ 4HVVA 3P8HA 1TUGB 1NZ9A 1Q7YC 2YDLA 1WXTA 3H41A 4EDUA 3ULRB 1AEYA 5IF1B 2D6FA 1MGQA 2R7GA 5IHYA 3QPHA 2PNIA 4F14A 4M77B 5J39A 1IHWA 3WXMB 2HKQB 3CBMA 3CCQQ 2O01E 1UEBA 3CCLT 2EGEA 2M0YA 1C6VX 2C5XB 1IHVA 1FINB 4AFUC 2DLPA 1YITQ 8ATCB 2UZEB 4YOZA 1BI2A 1ZUYA 3BHVB 1WQWA 5FWCA 5GAMe 3CXCA 2QGSA 3QHWB 2DIQA 3BLRB 1D3BA 2O4XA 4C92E 4MZPA 2CP3A 2HDAA 3V8JA 2EVRA 2ED0A 1QVFA 4YC3B 2B8AA 4KUDK 2A3LA 4M7DD 4J9CA 4GY5A 2EKOA 5GAMj 2WHBB 3QBYA 3M9QA 5FRMA 4QKUA 4TTHA 2QQ8A 1JQQA 2WSCE 2EKHA 2YRDA 1H26B 5FLXE 1QVFP 1H24B 4DBQA 3RBBB 4BCJB 2E65A 4PKCC 1KJWA 2EUFA 3M5AA 5GAOl 5IXFA 2FL7A 4RMOA 2LMJA 4QT7A 1PKSA 1QWEA 1JJ2S 1X6BA 3GIBA 5LJ3e 3CPWA 3CC2A 4M75F 5HBHB 2YSQA 1WA7A 2O88A 2AIRB 2RJCA 3OYIA 1YITA 1KSWA 4MDXA 2A36A 1SPKA 2LCSA 4BCMD 1PSFA 4AFQC 1VUBA 4BDYA 2PVGB 4M7AA 4BCMB 4J6YA 2A37A 3CC7T 1ZX6A 2GFAA 1HXDA 4KRCB 3QZ5B 2V8KA 3OB9A 1ZUUA 1VIEA 2M02A 2RQUA 4JX6A 1FYNA 4QSHA 2ROLA 2P0PA 3FC3A 2D0QB 4DBHA 1VQ8A 2K5FA 2FRYA 2VGNA 3OYCA 1FXXA 4J6WA 2RQWA 2DEUA 1QLYA 3JRZA 3S3NA 2EYYA 3OW2S 4C92B 3NPFA 2A7YA 2AHJB 3CPWP 3CC2Q 4ELLA 4HNUA 4ELZC 5LJ5g 2F2CA 2E1HA 4M6VA 2B86A 4M7DA 3VKHA 2LQKA 1Q95G 1VYUA 2JTMA 2LX7A 1RUWA 1P5EB 4EONB 1WFWA 4AFSC 1LJOA 4BD3A 1E6GA 1XNIA 3CC4T 4F7UF 3JAME 2LQ8A 5KE3A 3HRSA 1M3AA 1SHFA 1M2OA 4J8OA 1HJDA 1TXQA 3RNJA 2DBKA 2VKNA 3OYFA 1B3QA 4LN2A 3EH2A 2W99A 4RTUA 3LGLA 4PJOG 3CQTA 2PQWA 2OTJA 5HK0A 2JTEA 3FEOA 4AG1C 1G83A 3BHUB 2RHYA 4OB0B 1IGUA 3PE0A 3OYDA 4ZTFA 1QKWA 2KDSA 2HNIA 1YFNA 2CP2A 5LQFB 2DXTA 1E7OA 1BCMA 3VUZA 2SRCA 3MP8A 1QKXA 4F6WB 1E9HB 1AWJA 5CKEA 4BI3A 1OL2B 4BB7A 5BNJB 4IUVA 1PD0A 1KIKA 3QYHB 1H3HA 3MEAA 3L42A 5J3BA 1VQLQ 3MEWA 3JB9D 2L0AA 1F5QB 4F7UE 2VGMA 2ATCB 2KBTA 1K9MC 1S72Q 1ENWA 3ZEHA 4OMLA 2MOXA 2M51A 1VQPQ
chains in the Genus database with same CATH topology
2XHCA 5GMKe 4PLLA 5GAMh 1VQPA 3BFMA 5GAN6 3NFCA 4M75D 3OYAA 4J83A 5GANd 4PJOF 3CD6T 4M77G 2K5IA 3HO8A 3P8BB 5CQYA 4IUTA 4QVDA 1HK9A 5GANg 1YJNT 3E9FA 2LRQA 4QQDA 1N8RU 3BG3A 3HKSA 3X26B 1VIFA 3OY9A 3X24B 4JLGA 1NPRA 2DD5B 3VUBA 2KAFA 4C0GA 2FVUA 4FT2A 4QQGA 3CCQT 2DXUA 3CCEA 2ZZDB 2DXBA 3HBLA 2LC4A 4MFEA 2MI6A 4OVAA 3BDLA 4C8QG 3CCJT 3JCMP 4XTXA 1QVPA 1R8OB 2GF7A 3QYEA 5GANh 1SSFA 2K3YA 1YJ9A 5GAN3 4A4EA 3CCUT 4RCBA 1QW1A 4TVRA 4XK8E 4CRIA 5GMKj 1XQHA 5GAOn 1K73U 1M1KC 4E47A 2CZ0B 3RERA 4EPCA 3CCSA 2P0KA 1MHNA 2ZCFB 2E10A 3C95A 1YI2T 1WQ7A 2VC8A 5GAN2 2KR6A 4M78B 1BI3A 3E9GA 3CC2T 1WPYA 5I2SA 1NJIU 2VXFA 3X20B 3M54A 1TH7A 1U1SA 3OYYA 3A8OB 3PMIA 4XU1A 3JCMV 4C5EA 2DPPB 4JS4A 5DM7R 4M7DF 4BY6C 1KHCA 3BDUA 2CZ7B 5A2QE 2VV5A 4M7AE 4OF1A 3S3OA 5CK9A 4RG2A 2KK4A 4AI6A 4BI4A 3DL1A 3HHTB 3MEVA 1UGRB 2DZCA 3JB9I 3PFSA 3VKGA 3CPFA 4E7JA 3JCMW 2FYKA 2RD1A 4L5GA 3CCUA 2DTHA 2LT1A 3FB9A 4HT8A 1P92A 4E7KA 2BS3A 4ZGJB 4PJOE 1LOJA 2MAMA 1YCYA 2BKDN 4XQ3A 3RUXA 3RESA 2L3RA 4EMHA 4C8QC 4BY6B 3KBGA 3JB9F 2RM4A 4XTVA 4R56A 1N6AA 2LT4A 3WVEB 2JZ2A 4QW2A 1RL2A 1Q86C 1BIBA 3VYHB 4OGCA 2E12A 2JOYA 2LTOA 4F7UA 2RI3A 1U1TA 3X25B 1KQ1A 2RJDA 4M77C 3SB2A 2PVDB 4L59A 3OYGA 1H3ZA 5LJ5j 5IN1A 1M9SA 2I2LA 3DKMA 4JRIA 2PUKB 3LLRA 3SDZA 3ZBDA 3JCMJ 4FM4B 1B34A 1M5Q1 3CCMA 4C92D 1BI1A 2O4XB 3LGFA 5LJ3f 4A53A 4BBRM 5D6XA 2CKKA 4MMKA 4JX5A 3UT1A 1BYMA 2XKOC 5LJ3j 3L2VA 1K9MU 1QVFS 1UGSB 3MHXA 2OAUA 3M4YA 3RKXA 3HP9A 4OP0A 4Q5WA 5KH6A 3CC7A 4C0DC 1KHIA 1G3TA 1VQ7T 3VYGB 4LD9K 4M7AF 4CI0C 5GAN8 4M7DE 5D6YA 3UDCA 1M1FA 2XU8A 1WJQA 4ELJA 3E1SA 5LJ5e 5GAN4 2HQEA 4JJNK 4C5HA 4JRKA 3VJPA 4EMKC 2R5MA 3CXCS 1ZQ1A 4M7AG 3I56T 1VQLA 4C8QD 3L2UA 2ZPIB 2QEXA 1K73C 2V8IA 4RG8A 4C0ZA 2QA4T 5LL6S 1N8RC 4OB2B 1Y96B 2K5LA 3VYGA 5HK3A 4XU3A 2PU9B 4XTUA 1S72A 1W2BA 1VQNT 4MMLA 4C8QB 1D3BB 4AKIA 4B9XA 4J7IA 2X4WA 3A8MB 2KVQG 3OYEA 5LJ3h 5GAOr 4N0AA 1N9RA 3CCVA 3GF5A 5DLQE 2K57A 1NJIC 3CD6A 5CR2A 2RHIA 4BUGA 1QP3A 4HCCA 3BW1A 3KHIA 4HL4A 4PJOC 2CYZB 5KE2A 1VQ4T 5LJ3g 2QQBA 3HPWA 3M59A 4YTLA 3OYLA 1KQSS 3AHUA 3MEUA 3CBOA 4Z02A 4OB3B 1BKBA 2VYTA 5LJ3d 1X6OA 1OYXA 1KC8C 2V8JA 3PT9A 3RMQA 2DIGA 1NE8A 3JB9G 2QQAA 5CAIA 3UWNA 3JCMb 4DA4A 5L8RE 4B9WA 3OMGA 2ZPHB 4BBSM 2MWOA 1KC8U 1M8VA 1YBYA 4L6V5 2L8DA 4NOYA 1VQKT 3LX7A 2DEQA 3BY7A 3G4ST 3QWLA 1I8FA 3G7ZA 5I2MA 5CKHA 3JSCA 3KXTA 3OS5A 4DQ2A 4BE1A 1VQ9A 1VQ8T 1G3WA 5CKBA 3CBPA 3QYGB 1Y07A 2DTIA 3TREA 3VKIA 3GPLA 1YHQA 4JUVA 3OA6A 1M4ZA 4MZMA 1VQPT 4MDWA 1QVGA 3LYIA 3LH0A 4AKHA 1W4SA 4M7DG 2DKGA 2DTOA 1UGPB 3OYNA 1G3YA 4E7IA 2YHTA 1WNLA 3A5ZB 4JDSA 3EAEA 1UB4A 2LDMA 4M78F 5CIUA 3RKWA 4ATOA 1IZ6A 2Y4YA 4PJOB 5KCOA 1WJSA 1Y71A 2RHZA 1NPPA 2EJGA 4HCZA 4MZTA 1GXIE 3I55T 4MIMA 2RH2A 4E7LA 1V29B 2QQRA 3OQ5A 4M78A 5EG2A 4DOWA 2FHDA 3PTAA 3QJYA 1Q81C 2K2VA 4OB1B 5CCAA 2QQ9A 1JB0E 1H641 1LNXA 3NTKA 2DJZA 3SFMA 3M55A 2LCLA 1YITT 1FWZA 1M1GA 4C8QF 3HRUA 3V7SA 3VU3C 3QG1A 2XD0A 2EQJA 3JCMQ 2MMPA 4LOCA 1WGSA 4E7HA 1M90C 2E5QA 2DXBB 2ZZDA 3F70A 4N0AC 4X9DA 4WF2A 5FU6C 3RIRA 3UPUA 1E7PA 2DZ9A 2X4XA 4UC4A 2HAXA 3CC4A 2K4YA 4M77F 1WJRA 2DXCB 2L5QA 2YLBA 2QF7A 3FIFA 3Q1JA 3LWHA 4J7FA 4BACA 2CS7A 5DLOA 4IUQA 5GANf 1VQ6T 5CKDA 2XIDA 2JVVA 4C5IA 3QSUA 4ZGEB 5CVIA 2MWPA 1YJWT 4KULA 5FU7B 4HA8A 4JX4A 1BIAA 5D6WA 3M58A 3PMTA 4M75C 4XU0A 3JCMf 3QYBA 4C8QA 4GLKA 2E6NA 2F69A 2YRVA 4ME7A 5C6SA 4EMKB 2KMGA 3OYHA 1Y96A 4C92G 4AKGA 4IUPA 2IG0A 3DLMA 2CZ1B 3RMSA 3L2WA 4J5YA 4O6JA 4BE0A 1QVGS 4C8QE 3G71A 2XDPA 4RCCA 1YIJA 4NL2A 2XI9A 3NTHA 3JCMX 3GOXA 1VQKA 4OGEA 4C0DB 2JUFA 4C92F 3VV0A 2CZ6B 4A54A 3P8HA 2QFZA 1NZ9A 4A4GA 1Q7YC 3H6ZA 3GNFB 3CCRA 3PGGA 4M77E 3C94A 4A4HA 2EWNA 3BG9A 5M9OA 4EDUA 2XDDA 2G77A 1Q7YU 4M7AD 4ZN1A 5A0DA 2DXCA 1VQ6A 4PLIA 1N27A 2D6FA 1MGQA 3S6WA 5GMKl 3QPHA 1VQ5T 5GAMd 5J39A 4M77B 2E64A 3FDRA 2RI5A 1KQSA 3META 4LDXA 3WXMB 2DD4B 3M57A 2KQWA 3CBMA 2O01E 4BI8B 4EMGA 1UEBA 2R5AA 3CCLT 5FRNA 2D9TA 3J80E 5LJ5f 3ASKA 5CQXA 2LCCA 3QKJA 5HY6A 3QXEB 3SWNC 1ZBXA 1X75C 3A8HB 5FU7C 1VQLT 4M78E 5C0MA 2C06A 1W2BS 1FKMA 4FU6A 3V8LA 1BI2A 3CCMT 4F7UG 1KQ2A 1WQWA 5GAOp 4PJOA 5GAMe 5GMKh 3CXCA 1M90U 5FU6B 2DIQA 1FX7A 1QP2A 2HBPA 3MP1A 3FLGA 4NL3A 1D3BA 1DJ7B 2O4XA 4M78G 2P0QA 2PVOB 4MZPA 4C92E 1YJWA 1B34B 4RKUE 3JB9J 1VQOT 4Z6YA 2Y4XA 3V8JA 5GMKi 1VQOA 2OTLT 2OTLA 3M53A 4M78C 2EJ9A 2RK1A 1QVFA 3OS2A 2EFIA 3QUIA 2B8AA 4KUDK 2OTJT 3I56A 2A3LA 4M7DD 5GANe 1AHJB 1O75A 3T9NA 5GAMg 1JRIA 4GY5A 2EKOA 3URGA 3C12A 5I21A 5HKCA 4LDYA 5GAMj 3L2RA 3G71T 1YIJT 3QBYA 2E41A 1G3SA 2WACA 3DB4A 3CEYA 5FROA 2DK3A 5GAMf 5GAOm 3CCRT 3M9QA 4A4FA 2BIVA 4FT4A 5FRMA 2XICA 3CMAA 2QQ8A 4Y91A 2WSCE 1BI0A 2X35A 2PUOB 5CO7A 3R6OA 1XTDA 3TU4K 1K8AC 5FLXE 5LJ5h 5GAN5 1YJNA 2X4JA 3EFRA 1VQ4A 2WSEE 4IURA 2GCXA 3QIIA 4HNTA 1Q82U 2E65A 4PKCC 3OMCA 3I55A 3M5AA 2G3RA 2RI2A 5GAOl 5A0GA 3OS1A 4X34A 3DLLA 2FL7A 1U8RA 4RMOA 1Q82C 5GAOq 4PNOA 2ZPEB 3ZFJA 2LNVA 2GQVA 3A8GB 5IT9E 2RHUA 1JJ2S 3GIBA 5LJ3e 4BE2A 4JS5A 3L2QA 1Q81U 3CPWA 3CC2A 4QQ6A 4M75F 4MFDA 3JCMc 3S3MA 3MCAB 1YI2A 2RJCA 3MP6A 4JLIA 3OYIA 1YITA 1I5LA 5GMKm 1YHQT 3OYKA 4MDXA 3TW7A 3PIPA 3E19A 3KUFA 3J7AF 2M0OA 1O9SA 2EQMA 2K3XA 4Y28E 1PSFA 2YLCA 3HZJA 1OI1A 1VUBA 3TCJA 2PVGB 4BDYA 2HQXA 4M7AA 4C92C 4FSXA 3BG5A 1N9SA 4J6YA 3CMET 3PIOA 1PSEA 3CC7T 2GFAA 3CCET 1HXDA 4M75G 4LDVA 4P5NA 3P8DA 3HB9A 3QZ5B 3H4CA 2V8KA 3OB9A 4HT9A 1KD1U 4KUIA 4LD6A 4VUBA 1VIEA 4KT0E 3SD4A 3HL8A 3G6ET 2E70A 2H3JA 2ZPBB 4JX6A 3PNWC 2JNGA 2F5TX 3QO3A 4XTYA 4X9CA 3C4SA 4D6WA 4F7UB 1KD1C 3OW2A 4QSHA 2P4TA 3DB3A 2P0PA 3FC3A 2D0QB 3SWNA 1VQ8A 2K5FA 2RA2A 2ZPFB 2VGNA 3G4SA 3OYCA 5AYFA 3H8ZA 1FXXA 4J6WA 1OZ3A 1VQNA 2EJFA 2HD0A 2KY9A 1Q86U 2EQKA 4XU2A 4PJOD 2DO3A 1XOVA 1Y7XA 2FB7A 1KG1A 3JRZA 2RHXA 4N4HA 4ZN3A 3CCQA 3JB9H 4HLQA 4II1A 2QTXA 3S3NA 2QXFA 3OW2S 4C92B 2EQUA 2A7YA 2L89A 3QDRB 4M75E 3OYMA 2AHJB 3OBWA 1YJ9T 1UGQB 1OZ2A 2EAYA 2ZGWA 3L2ZA 4N4GA 1VQ7A 4J6XA 1EIFA 1VQ5A 4ZTJA 4HNUA 3V8KA 3HFNA 5DY9A 2BUDA 4ELZC 1IREB 5LJ5g 2E1HA 4M6VA 3TW6A 3G6EA 4HNVA 2KSSA 2RB6A 3TEEA 3OS0A 3MO8A 3VKHA 4M7DA 4M75B 4HKEA 2LQKA 3OSSC 1I4K1 1I81A 4M7DC 2XK0A 3V7RA 3CCLA 4KBMB 4C0FA 2JTMA 2LX9A 3ME9A 1S72T 1M1KU 3JCMg 4PL6A 4XAXB 2QEXT 1K8AU 2QA4A 2MF2A 3OYJA 1LJOA 4BD3A 3V7CA 1XNIA 2RO0A 3N5BB 1JBMA 4NS5A 3CC4T 4F7UF 1VQ9T 5A0LA 3JAME 2LQ8A 5KE3A 5CKFA 5GANj 3FJPA 3A8LB 2EYQA 4M7AB 2E6ZA 3WVDB 4LDWA 4ELYC 2IVWA 3CPWS 3J81E 3M4GA 4IKFA 3HRSA 3JCMh 4J8OA 2DD5A 2Y90A 3NTIA 2QI2A 2X4YA 4QVZA 3QHSA 4XTZA 4R55A 1JJ2A 3RKYA 3CCJA 4A4KA 5GAN7 2R57A 2RK2A 3L1AA 3LW5E 4ZGDB 2RJEA 2QQSA 2XG8D 4XTWA 4QVCA 4M78D 3CMEA 3OYFA 5IAYA 4N4IA 2QDYB 4V2SA 2GFUA 2DVEA 3QZ9B 3LWIA 4HCBA 5LJ5d 3LGLA 4PJOG 1X01A 2PQWA 5HK0A 2OTJA 3HSBA 1VQMT 1VQMA 3FEOA 4OB0B 2DD4A 2RHYA 5KCHA 3GLXA 2ZPGB 1RI0A 3OYDA 4ZTFA 4M77A 3HFOA 2M1HA 3CCVT 2KDSA 2HNIA 2LVMA 3X28B 3INZA 2DXTA 3VUZA 4JRPA 3MP8A 3JCMe 4FL6A 4BDZA 3FRNA 2F5KA 4O5VA 3OSVA 5CKEA 5J26A 4BI3A 3CMAT 2M16A 4BB7A 4IUVA 2WSFE 4LDUA 3O8VA 4DOVA 4JRQA 3QYHB 3M56A 4FIBA 4M77D 4M7AC 2NLUA 3MEAA 4C92A 3EFSA 3GNGA 2R58A 4IUUA 3L42A 1G5VA 5J3BA 1ZHIA 3QJ6A 2DAQA 2JTFA 3CCST 3HRTA 2BS2A 2RJFA 3ER0A 3GP8A 3OYBA 2KMTA 3MEWA 2QDJA 2WJ9A 2VUBA 3OBYA 3JB9D 4OMFB 4F7UE 2VGMA 5EJCA 4M75A 2BS4A 2JN0A 1K9MC 4M7DB 4EMKA 2CGHA 3SWNB 2VXEA 3ZEHA 3JCMd 1QLBA 2XDBA 2M9UA 4NC6A 2EIFA 4C5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPB B;  1QP3 A;  2D0Q B;  2DD4 B;  2CYZ B;  2O01 E;  2ZPF B;  4OB3 B;  3X26 B;  3X24 B;  2DD5 B;  3QXE B;  2ZZD B;  3A8H B;  2DXB A;  5L8R E;  2ZPH B;  4L6V 5;  4XK8 E;  2AHJ B;  2CZ0 B;  1UGQ B;  3QYG B;  2ZCF B;  1QP2 A;  1IRE B;  1DJ7 B;  2PVO B;  3X20 B;  3A8O B;  4RKU E;  1UGP B;  2DPP B;  2CZ7 B;  1GXI E;  3HHT B;  1UGR B;  1V29 B;  1AHJ B;  3A8L B;  4OB1 B;  3WVD B;  1JB0 E;  4ZGJ B;  2DD5 A;  3LW5 E;  4ZGD B;  3WVE B;  2WSC E;  2PUO B;  3VYH B;  2QDY B;  2DXB B;  2ZZD A;  2WSE E;  3QZ9 B;  3X25 B;  2DXC B;  2PVD B;  2PUK B;  4OB0 B;  2DD4 A;  4FM4 B;  2ZPG B;  2ZPE B;  3A8G B;  4ZGE B;  3X28 B;  1UGS B;  2WSF E;  3QYH B;  3VYG B;  2CZ1 B;  4Y28 E;  1PSF A;  2PVG B;  2CZ6 B;  2ZPI B;  1PSE A;  4OB2 B;  3VYG A;  2PU9 B;  3QZ5 B;  3A8M B;  4KT0 E;  2DXC A; 
#chains in the Genus database with same CATH topology
 5GAM h;  1T3L A;  1ZSZ C;  5GAN 6;  2FO0 A;  2CJM B;  2LQW A;  2K5I A;  2NYS A;  2VVK A;  4IUT A;  3DDQ B;  2LRQ A;  5L2W B;  1Q81 R;  3X24 B;  1NPR A;  3CCQ T;  2XMF A;  3CCE A;  4F6U B;  3D7S B;  2BE9 B;  3JCM P;  1M30 A;  4XTX A;  3EGD A;  2KRS A;  4FYW B;  5HBE B;  4RCB A;  1M1K C;  5GMK j;  1QWF A;  3EFO A;  2CZ0 B;  3CCS A;  2UZD B;  2ZCF B;  1ARK A;  5KYN A;  1UNG D;  3QWY A;  3E9G A;  1WPY A;  2UZB B;  3I9Q A;  1MMA A;  4BY6 C;  1KHC A;  1WX6 A;  5CK9 A;  2KK4 A;  4BI4 A;  1AIS B;  3DL1 A;  3HHT B;  3VKG A;  3CPF A;  3KFV A;  2L3S A;  2LT1 A;  3FB9 A;  4HT8 A;  4PJO E;  2BS3 A;  2EYZ A;  1Q86 R;  2CT3 A;  3RUX A;  2BKD N;  4XQ3 A;  4BY6 B;  3KBG A;  1N6A A;  2LT4 A;  3WVE B;  1CKB A;  4QW2 A;  1Q86 C;  1RAD B;  1GCQ A;  2PZ1 A;  1W1F A;  4OGC A;  2JOY A;  4F7U A;  3VS3 A;  1JJ2 P;  1KQ1 A;  2PVD B;  2AKK A;  5I11 A;  1H3Z A;  3CME Q;  1OX8 A;  5KYX A;  1ABO A;  2PUK B;  4FM4 B;  1UEC A;  2GNC A;  9ATC B;  2WEV B;  1QVF S;  3MHX A;  1VQ5 Q;  2OAU A;  1M1K R;  4JZ3 A;  3RKX A;  3HP9 A;  4Q5W A;  3CC7 Q;  4D8D A;  4C0D C;  1VQ7 T;  4M7A F;  1HSQ A;  5D6Y A;  3UDC A;  2K9G A;  1QCN A;  2XU8 A;  1WJQ A;  3E1S A;  5LJ5 e;  1UHC A;  2HQE A;  4JJN K;  4EMK C;  3CXC S;  2R5M A;  3EG0 A;  1VQL A;  4C8Q D;  3L2U A;  2HSP A;  5HVY B;  4YOO A;  2V8I A;  2L3P A;  4RG8 A;  3HTR A;  5LL6 S;  3UAT A;  2DX1 A;  1W2B A;  4XU3 A;  1VQN T;  4MML A;  4C8Q B;  5I22 A;  2X4W A;  3A8M B;  2KVQ G;  3OYE A;  1TU0 B;  5DLQ E;  2K57 A;  4EIK A;  1NJI C;  2GQI A;  2IIM A;  3EGU A;  3CD6 A;  1I1J A;  5CR2 A;  3CCR Q;  3EG9 B;  2EGA A;  4HL4 A;  2AKL A;  5KE2 A;  3OYL A;  2F2W A;  1FVV B;  2GBQ A;  4Z02 A;  5LJ3 d;  1KC8 C;  1NE8 A;  1TS9 A;  2QQA A;  5CAI A;  3UWN A;  4DA4 A;  4B9W A;  2ZPH B;  2CDT A;  1KC8 U;  3E2U A;  4DBR A;  1J3T A;  4ROC A;  3LX7 A;  3NHN A;  1H92 A;  3JSC A;  3OS5 A;  1G3W A;  2DM1 A;  5CKB A;  3VKI A;  4JUV A;  3TVT A;  4MZM A;  1UNH D;  2D0N A;  5IDP B;  1M2V A;  4KRD B;  2P4R A;  2KRM A;  1KXU A;  2X1N B;  1ZUK A;  4JDS A;  1WNL A;  4EOM B;  1IB8 A;  4M78 F;  1HYO A;  3G1J A;  4PJO B;  2DMO A;  2Y4Y A;  2A0F B;  1WJS A;  2QGG A;  1NPP A;  4Z89 A;  4E7L A;  1C9B A;  1V29 B;  2DL4 A;  2FHD A;  2QDL A;  2A08 A;  3CCU Q;  1LNX A;  2RNA A;  4FYX B;  3SFM A;  1QMC A;  2DJZ A;  2BZX A;  1YIT T;  2FPD A;  3HRU A;  3V7S A;  1KQS P;  1UTI A;  4E7H A;  2E5Q A;  3EG9 A;  2CCI B;  1H1P B;  2UUE B;  4UC4 A;  3RIR A;  2HAX A;  2ESW A;  1C0M A;  3LWH A;  2C4G B;  5DLO A;  4IUQ A;  5CKD A;  1VOL A;  5CVI A;  3H0I A;  5GJW B;  1HD3 A;  1A0N B;  3QYB A;  1RAF B;  4C8Q A;  4ME7 A;  2PK2 A;  2YRV A;  2KMG A;  3EG1 A;  2CZ1 B;  3UA7 A;  3I5R A;  3G71 A;  1YIJ A;  3JCM X;  2JS0 A;  4C92 F;  2LQN A;  4A54 A;  3LQ5 B;  1I5O B;  4GBQ A;  5KYY B;  1GFC A;  3CCR A;  4M77 E;  1WHL A;  1K0S A;  2I40 B;  4A4H A;  3TNH B;  2J6O A;  5M9O A;  1VQK Q;  4UN0 A;  1Q7Y U;  4HVW A;  1U5S A;  1UFF A;  5A0D A;  1VQ6 A;  3IQL A;  3FDR A;  1KQS A;  2RI5 A;  4LDX A;  1YWO A;  3MET A;  4J9E A;  3CCS T;  1YCS B;  5FRN A;  3DDP B;  2EQI A;  2DIL A;  5CQX A;  4OGR B;  2LCC A;  5HY6 A;  3SWN C;  1O9K A;  1X75 C;  2KXD A;  1TFB A;  4EOS B;  2YXY A;  2YRC A;  1VQL T;  3VS1 A;  2RF0 A;  2YWW A;  1FKM A;  1ZA1 B;  3CCM T;  4F7U G;  5GAO p;  4PJO A;  1FX7 A;  3G33 B;  3MP1 A;  3FLG A;  4NL3 A;  1DJ7 B;  4FW2 A;  1YJW A;  2O31 A;  1B34 B;  4RKU E;  3JB9 J;  2OTL T;  5GMK i;  2EW3 A;  3M53 A;  4M78 C;  2EJ9 A;  3OS2 A;  3EFO B;  3QUI A;  2KT8 A;  1AHJ B;  1O75 A;  4J9G A;  3T9N A;  5GAM g;  1JRI A;  3URG A;  5GAM f;  8AT1 B;  2DK3 A;  5GAO m;  3CCR T;  2KGT A;  2L2P A;  5HBJ B;  1WXU A;  1OUL A;  3EGD B;  1VQM Q;  1RAB B;  1OGU B;  1BI0 A;  2PUO B;  1K8A C;  5LJ5 h;  2X4J A;  3EFR A;  2WSE E;  4HNT A;  4F17 A;  3NMZ C;  3I55 A;  3POM A;  2G3R A;  2RI2 A;  4X34 A;  2C5N B;  1U8R A;  3SHW A;  2COW A;  3ZFJ A;  2LNV A;  2RHU A;  2J7I A;  1VQ7 Q;  1Q81 U;  2JM8 A;  4MFD A;  3S3M A;  3MP6 A;  2KYB A;  3PVL A;  3PIP A;  4Y28 E;  1OI1 A;  2UZL B;  3UF4 A;  4FSX A;  1R0B G;  3CME T;  3LH5 A;  1PSE A;  3PIO A;  2ED1 A;  4M75 G;  1D0X A;  1RAC B;  3MY1 B;  1OV3 A;  4VUB A;  4KT0 E;  4OMN A;  1FMV A;  2LZ6 B;  3PNW C;  3QO3 A;  2ZPB B;  4XTY A;  1VQ4 Q;  1NLO C;  4D6W A;  1ZBJ A;  2JJ9 A;  2KNB B;  2GGR A;  2RA2 A;  2ZPF B;  3G4S A;  4ROE A;  1MV0 B;  1PWT A;  1XO2 A;  3CD6 Q;  1OZ3 A;  1Q86 U;  2EQK A;  4XU2 A;  2DO3 A;  2FB7 A;  2D8J A;  2G6F X;  4CXA B;  4N4H A;  4ZN3 A;  3CCQ A;  4HLQ A;  2QXF A;  1MMG A;  2BPM B;  1KFZ A;  1WHJ A;  1H28 B;  2L89 A;  3OBW A;  1OZ2 A;  2ZGW A;  4N4G A;  1WIE A;  4J6X A;  2FRW A;  1VQ5 A;  4JPB W;  2KRO A;  4D8K A;  4E7Z A;  3TSZ A;  4M75 B;  3OSS C;  1IO6 A;  4M7D C;  3CCL A;  7AT1 B;  2PJQ A;  3ME9 A;  1S72 T;  1M1K U;  3JCM g;  3TN8 B;  2QA4 A;  2MF2 A;  3OYJ A;  1VQ9 T;  5GAN j;  3A8L B;  2EYQ A;  4M7A B;  4ELY C;  3WVD B;  2MCN A;  3JCM h;  2J06 A;  2Y90 A;  4XTZ A;  3NTI A;  2QI2 A;  4QVZ A;  4R55 A;  3QHS A;  3CCJ A;  2LJ1 A;  4A4K A;  4BCN D;  1WHM A;  4R0K A;  3LW5 E;  3L1A A;  4ZGD B;  2AZV A;  2XG8 D;  4M78 D;  4EOI B;  1UGV A;  5IAY A;  2QDY B;  5KYU B;  1OI9 B;  4G6L B;  4J9H A;  1X01 A;  2CH4 W;  2H3E B;  2DD4 A;  4BCH B;  3GLX A;  2ZPG B;  3VRY A;  4M77 A;  3HFO A;  2EYX A;  3CCV T;  2LVM A;  1KK7 A;  3JCM e;  4FL6 A;  2F5K A;  2DRM A;  3CMA T;  2VB6 A;  4LDU A;  1X2Q A;  1MNE A;  2IW9 B;  4C92 A;  4IUU A;  3GNG A;  2RN8 A;  4CC4 B;  1KC8 R;  3PVQ A;  5ACB A;  3M0Q A;  2IW6 B;  1M8M A;  2QDJ A;  2VUB A;  1TOV A;  4OMF B;  3VS2 A;  4OMM A;  2NUP B;  4PJJ A;  3R6N A;  2EIF A;  4JJC A;  4OMQ A;  4C5G A;  1VQP A;  4PLL A;  3BFM A;  3NFC A;  2COY A;  4PJO F;  4E7S A;  3CD6 T;  1TUD A;  3THK A;  4F7S B;  4DBF A;  1HK9 A;  5GAN g;  1YJN T;  3E9F A;  2J6K A;  1N8R U;  3CC4 Q;  3X26 B;  1VIF A;  1PM3 A;  4JLG A;  3VUB A;  3EJ1 B;  4C0G A;  2DBM A;  2FVU A;  3O0G D;  5I5Z B;  3HBL A;  1R8O B;  2GF7 A;  3QYE A;  2JGZ B;  4F7J B;  2CP6 A;  1SSF A;  2K3Y A;  5GAN h;  4A4E A;  3CCU T;  1QW1 A;  1O9K B;  1OU8 A;  4XK8 E;  5GAO n;  1K73 U;  1VQO Q;  3RER A;  4EPC A;  1QQJ A;  4CC2 A;  2CP5 A;  4A63 B;  4OMO A;  3CC2 T;  5I2S A;  1KD1 R;  3X20 B;  3M54 A;  1U1S A;  2ABL A;  4M7D F;  4M7A E;  1PCX A;  2VV5 A;  5IHK A;  4AI6 A;  4CFU D;  4WTO B;  1UGR B;  3PFS A;  5KYW A;  2IPO B;  3JCM W;  2FYK A;  2RD1 A;  2NUT B;  4E7K A;  4EMH A;  1AD6 A;  2L3R A;  1C1A A;  4C8Q C;  3JB9 F;  1BU2 A;  1VQ8 Q;  4PJL A;  2LTO A;  1GCQ C;  1OX9 A;  2HSE B;  4L59 A;  3OYG A;  2OJ2 A;  5LJ5 j;  1M9S A;  2I2L A;  3EG2 A;  1M5Q 1;  3CCM A;  1CSK A;  3EHR A;  2O4X B;  2LJ3 A;  4BBR M;  4MMK A;  4JX5 A;  4RTX A;  1BYM A;  3L2V A;  2CUB A;  4OP0 A;  5KH6 A;  4ROD A;  1G3T A;  4LD9 K;  5GAN 8;  4M7D E;  1M3B A;  2OX7 A;  2CUD A;  3M0P A;  3VJP A;  1ZQ1 A;  1UJY A;  2QEX A;  3M03 A;  2DYB A;  2LJ0 A;  1EZZ B;  3VYG A;  1QMZ B;  2PU9 B;  4XTU A;  1EX4 A;  3DJB A;  5LJ3 h;  1N9R A;  3EID B;  2CSQ A;  3UA6 A;  3I35 A;  4PK4 A;  4J9D A;  4HCC A;  3KHI A;  2QK0 A;  3MKD A;  5LJ3 g;  3HPW A;  3M59 A;  3CBO A;  4HCK A;  1BKB A;  1GCP A;  1OYX A;  4LE9 A;  3PT9 A;  2F1L A;  3I55 Q;  5L8R E;  4BBS M;  2CSI A;  2P84 A;  2DL7 A;  2L8D A;  1VQK T;  3BY7 A;  3KXT A;  3G7Z A;  2WPA B;  5CKH A;  3TRE A;  1YHQ A;  3QYG B;  3GPL A;  4F16 A;  3LYI A;  5KYY A;  2JXB A;  1G3Y A;  2YHT A;  2FZK B;  3EAE A;  1UB4 A;  1IZ6 A;  2DJQ A;  4HCZ A;  4PFO A;  1GXI E;  1S1N A;  3I55 T;  4CFU B;  2FZC B;  2KYM A;  2ROT A;  1QCF A;  1UUE A;  3M55 A;  4C8Q F;  4X1V A;  2HMA A;  3GBQ A;  3VU3 C;  3QG1 A;  1M90 C;  5FU6 C;  3BLQ B;  2NUT A;  4M77 F;  2L5Q A;  1G3N C;  4Z88 A;  4C5I A;  4JJD A;  1OKV B;  4KUL A;  5FU7 B;  5D6W A;  4KRT A;  6AT1 B;  3M58 A;  1NG2 A;  4M75 C;  4GLK A;  1Y96 A;  4C92 G;  2CP7 A;  2IG0 A;  3L2W A;  4O6J A;  2X3X D;  2XDP A;  4RCC A;  1VQK A;  4C0D B;  2JUF A;  2PMI B;  2CZ6 B;  1MMN A;  2E3I A;  4LUE A;  3H6Z A;  1PRM C;  3GNF B;  1QCO A;  3C94 A;  2EPD A;  2XDD A;  2EWN A;  3BG9 A;  2G77 A;  4M7A D;  4ZN1 A;  1TWB A;  2DXC A;  1VQ6 Q;  1H1R B;  3S6W A;  4FX3 B;  3CCJ Q;  5GAM d;  2V1Q A;  3M57 A;  4EMG A;  2KQW A;  1WYX A;  1I07 A;  2D9T A;  3J80 E;  5AT1 B;  5LJ5 f;  2K2M A;  5FGK B;  4IIM A;  2IVX A;  1ZBX A;  3A8H B;  1URC B;  1N4M A;  3EGX B;  1D1C A;  4M78 E;  5C0M A;  4FU6 A;  1VQN Q;  2EYW A;  3C0C A;  5FWB A;  5GMK h;  5FU6 B;  1QP2 A;  4M78 G;  2PVO B;  1VQO T;  1VQO A;  2DL5 A;  1VYW B;  2EFI A;  2OTJ T;  1OKW B;  2PHG A;  3I56 A;  2MIO A;  3MPU B;  2D8H A;  5HKC A;  4LDY A;  4J9B A;  2E41 A;  1G3S A;  2WAC A;  3EHQ A;  5KYU A;  1VOM A;  1YN8 A;  4A4F A;  3CMA A;  1BU1 A;  4KGX B;  5IHN A;  3R6O A;  1XTD A;  3TU4 K;  5GAN 5;  2K79 A;  1VQ4 A;  2GTO A;  3DOG B;  1Q82 U;  3MIA B;  3OMC A;  3OS1 A;  1JU5 C;  3DLL A;  1Q82 C;  5GAO q;  1D0Y A;  1T0J A;  2NUZ A;  4PNO A;  1QVG P;  4KH0 B;  2GQV A;  1AT1 B;  2E5K A;  4BE2 A;  3L2Q A;  2C6T B;  1YI2 A;  4JLI A;  2F2V A;  1YHQ T;  4E6R A;  3OYK A;  5KYW B;  2OAW A;  3E19 A;  2M0O A;  1O9S A;  2EQM A;  2YLC A;  3HZJ A;  3I5S A;  3TCJ A;  2HQX A;  2BTT A;  2BE7 D;  4B6M A;  4BCO B;  5IHI A;  2AK5 A;  1GUX A;  1R0C B;  4P5N A;  4M4Z A;  3HB9 A;  2HKN A;  4HT9 A;  1KD1 U;  4KUI A;  3VS0 A;  3SD4 A;  4F7N B;  3HL8 A;  2C0T A;  2WMB B;  2E70 A;  2H3J A;  2JNG A;  1B7T A;  4X9C A;  3C4S A;  4F7U B;  3CMA Q;  1KD1 C;  1PC0 A;  3DB3 A;  4DEY A;  2G9X B;  2JMA A;  5AYF A;  3H8Z A;  2DRK A;  2EJF A;  1H8K A;  1VQN A;  2KY9 A;  1VQ9 Q;  2YUN A;  1RAH B;  1XOV A;  1Y7X A;  1ZA2 B;  1RAI B;  1KG1 A;  2RHX A;  2K3B A;  4II1 A;  1SRL A;  1LVK A;  5HNB B;  3QDR B;  4RTV A;  4M75 E;  3OYM A;  2COZ A;  4RTW A;  1EIF A;  1K8A R;  3V8K A;  4EOJ B;  3HFN A;  5DY9 A;  2BUD A;  1IRE B;  3G6E A;  3TEE A;  2KSS A;  2RB6 A;  3MO8 A;  4EOL B;  4HKE A;  3G71 Q;  1YIJ Q;  2FPF A;  2XK0 A;  4KBM B;  4C0F A;  3QWX X;  2K7A A;  2LX9 A;  3H0H A;  4PL6 A;  4XAX B;  3A1P A;  1GBR A;  4NS5 A;  3N5B B;  1NYG A;  1JBM A;  1TG0 A;  5A0L A;  4LDW A;  2IVW A;  3J81 E;  3M4G A;  1ZP2 A;  2DD5 A;  2X4Y A;  1JJ2 A;  1UJ0 A;  4FCY A;  2R57 A;  2RK2 A;  4QVC A;  1RAE B;  4XTW A;  4N4I A;  2X51 A;  3QZ9 B;  4BCQ B;  4HCB A;  3HSB A;  1H1Q B;  1VQM A;  2EBP A;  1TD6 A;  1UHF A;  2W9F A;  5KCH A;  2M1H A;  1AWO A;  3INZ A;  4JRP A;  4BDZ A;  2BKZ B;  5J26 A;  1BK2 A;  3DTO A;  2WSF E;  1TTH B;  3M56 A;  4M77 D;  4M7A C;  2R58 A;  1VYT A;  2KI7 A;  1RAG B;  2DAQ A;  2JTF A;  1WHG A;  1D1B A;  2BS2 A;  2RJF A;  2KMT A;  1IXD A;  2WJ9 A;  3OBY A;  1JKW A;  5EJC A;  4M75 A;  2BS4 A;  4BXX X;  4EMK A;  4F7L B;  2PTK A;  2CGH A;  2RQV A;  3SWN B;  2ZAE A;  3JCM d;  1QLB A;  2XDB A;  1LCK A;  1H25 B;  1KQ2 A;  2XHC A;  5GMK e;  1OQK A;  1W6X A;  3AT1 B;  3OYA A;  5GAN d;  2HQH A;  4F70 B;  3HO8 A;  4QVD A;  1UNL D;  1K76 A;  2O2O A;  4QQD A;  3BHT B;  2KAF A;  4FT2 A;  4QQG A;  2ZZD B;  2DXB A;  2LC4 A;  4MFE A;  2MI6 A;  3CCJ T;  2KEA A;  3NDQ A;  1ZLM A;  2HEQ A;  3TNI B;  4TVR A;  1XQH A;  2OTL Q;  1N8R R;  1UDL A;  3JV3 A;  1MHN A;  4OR5 B;  2FZG B;  3C95 A;  1WQ7 A;  1MND A;  4M78 B;  1BI3 A;  1YJ9 Q;  1NJI U;  2JMC A;  2HZY A;  3JCM V;  3K7A M;  3G6E Q;  3A8O B;  4C5E A;  2DPP B;  5DM7 R;  1K73 R;  4YOS A;  4LXC A;  2CZ7 B;  4J9I A;  1VIN A;  1OOT A;  2J6F A;  4OF1 A;  1OIU B;  2YUO A;  3CCV Q;  3MEV A;  4CFM B;  2DZC A;  3JB9 I;  5FW9 A;  2CH4 A;  4E7J A;  1IGQ A;  4L5G A;  3CCU A;  1G2B A;  1PKT A;  3REB B;  1LOJ A;  4BY1 X;  4BCK B;  1YCY A;  1WZO A;  1Y57 A;  1I0C A;  1RL2 A;  3VYH B;  1UG1 A;  2E12 A;  4II5 B;  4IMY B;  3X25 B;  1WLP B;  4CRL B;  2I0N A;  5D7U A;  3SB2 A;  4CC7 A;  5IN1 A;  4JRI A;  3ZBD A;  2CT4 A;  2W2H A;  2LP5 A;  3SEM A;  3FJ5 A;  1BI1 A;  5LJ3 f;  4A53 A;  5D6X A;  3UT1 A;  2XKO C;  4DEX A;  5LJ3 j;  1K9M U;  1OIY B;  1M1F A;  4ELJ A;  4FW1 A;  5GAN 4;  4JRK A;  3TSW A;  2LNH B;  3I56 T;  2ZPI B;  2QA4 T;  1U3O A;  2V26 A;  4EOP B;  2JW4 A;  1Y96 B;  5HK3 A;  1S72 A;  4AFZ C;  1D3B B;  4B9X A;  4HXJ A;  5GAO r;  1FMK A;  1M27 C;  4N0A A;  3CCV A;  3GF5 A;  4HVU A;  2RHI A;  3H9N A;  1QP3 A;  3BW1 A;  2CYZ B;  1VQ4 T;  4AG2 C;  1KQS S;  3AHU A;  2DE0 X;  3MEU A;  3MY5 B;  4OB3 B;  2VYT A;  1X6O A;  2V8J A;  2JS2 A;  2DIG A;  4JZ4 A;  3JCM b;  1ZSG A;  2WXV B;  4L6V 5;  4NOY A;  3G4S T;  3QWL A;  1I8F A;  5I2M A;  1RI9 A;  4BE1 A;  4DQ2 A;  2D1X A;  2X9H A;  1VQ9 A;  2C0O A;  1Y07 A;  2DTI A;  3MJX A;  2J05 A;  4RTZ A;  1VQP T;  1BBZ A;  1WDX A;  1PHT A;  4MDW A;  1PKD B;  2DKG A;  3OYN A;  1YWP A;  3A5Z B;  2BZY A;  5CIU A;  4ATO A;  5KCO A;  2EJG A;  4MZT A;  4EOR B;  5IDN B;  4M78 A;  3PTA A;  1K1Z A;  4OB1 B;  5CCA A;  3H0F A;  2W0Z A;  1H64 1;  3NTK A;  1U06 A;  1M1G A;  4AMC A;  1D3U B;  1GL5 A;  1ZSZ A;  4CC3 A;  2BZ8 A;  2QAS A;  2EQJ A;  2MMP A;  1AZE A;  2DME A;  2DXB B;  2ZZD A;  1GBQ A;  1EFN A;  4WF2 A;  4X9D A;  2DZ9 A;  2AZS A;  2X4X A;  3CC4 A;  2K4Y A;  5L23 A;  5GAN f;  1VQ6 T;  2ECZ A;  2Z0W A;  2WFY B;  2QAZ A;  2XID A;  1D0Z A;  1UE9 A;  2E4H A;  1MMD A;  1YJW T;  5ECA A;  4JX4 A;  1BIA A;  3PMT A;  3JCM f;  4XU0 A;  2F69 A;  4EMK B;  1NEB A;  4CFW B;  4AKG A;  3DLM A;  4BY7 X;  4J5Y A;  4BE0 A;  4C8Q E;  1V1C A;  2XI9 A;  1PG5 B;  3GOX A;  2WIH B;  2QFZ A;  2JM9 A;  2DER A;  4A4G A;  2DA9 A;  2X3W D;  3PGG A;  1YNZ A;  3OW2 P;  2K6D A;  2C5O B;  4PLI A;  1N27 A;  5GMK l;  1VQ5 T;  2E64 A;  2DD4 B;  3TQ7 P;  3PO3 S;  4BI8 B;  1GFD A;  2R5A A;  1ZSZ B;  3G4S Q;  3ASK A;  1SG5 A;  4BCQ D;  3QKJ A;  3QXE B;  1SRM A;  5FU7 C;  4ESR A;  1RLQ C;  4I3Z B;  1OU9 A;  4K11 A;  2C06 A;  4EOQ B;  1W2B S;  1AVZ C;  3V8L A;  1M90 U;  2HBP A;  2QGF B;  3REA B;  2GTJ A;  1MV3 A;  2YUQ A;  2P0Q A;  4Z6Y A;  2Y4X A;  2OTL A;  1WI7 A;  1GY3 B;  4Z8A A;  3CCL Q;  1JEG A;  3QDF A;  4RTY A;  5HCK A;  2RK1 A;  2QA4 Q;  3GTM S;  3I56 Q;  5GAN e;  2KXC A;  4GLM A;  5I21 A;  1X6G A;  3C12 A;  3G71 T;  1YIJ T;  3L2R A;  3DB4 A;  3CEY A;  5FRO A;  3EG3 A;  2JT4 A;  1H4L D;  2BIV A;  4FT4 A;  2XIC A;  4BCI B;  3VS4 A;  4Y91 A;  2SEM A;  2X35 A;  5CO7 A;  1YJN A;  2QG9 B;  2GCX A;  3QII A;  4IUR A;  4FSS A;  4CFV B;  5A0G A;  1W70 A;  2NWM A;  3CCM Q;  2ZPE B;  3BLH B;  3A8G B;  5IT9 E;  4PJN A;  4JS5 A;  4CFN B;  2EGC A;  1Q82 R;  4QQ6 A;  1F1B B;  1V76 A;  3JCM c;  1SKU B;  3MCA B;  1I5L A;  5GJV B;  5GMK m;  3TW7 A;  3KUF A;  3J7A F;  4BCN B;  2K3X A;  4Y92 A;  2HCK A;  5CEI B;  2FG0 A;  4C92 C;  3BG5 A;  1N9S A;  2RQT A;  3CCE T;  4LDV A;  3P8D A;  3H4C A;  3EH1 A;  5DQV A;  4CFX B;  4LD6 A;  1VA7 A;  2A28 A;  3G6E T;  2F5T X;  3OW2 A;  1OL1 B;  2P4T A;  1Z9Q A;  3SWN A;  1JXM A;  2O9V A;  3VS7 A;  1H27 B;  4KGZ B;  2HD0 A;  1SSH A;  4PJO D;  2DET A;  2RMO A;  1N5Z A;  2WIP B;  3JB9 H;  3RR6 A;  2QTX A;  2KT1 A;  4F6S B;  2DVJ A;  2EQU A;  5IXB A;  1Y0M A;  1G8X A;  1RAA B;  1YJ9 T;  1UGQ B;  5EFQ B;  3L2Z A;  2EAY A;  2C5V B;  2MYS A;  1YHQ Q;  1VQ7 A;  1K9A A;  1TUC A;  3ZL7 C;  4ZTJ A;  4KH1 B;  3VRZ A;  3VS6 A;  3TW6 A;  4HNV A;  3OS0 A;  3CXC P;  1I4K 1;  1I81 A;  4EC8 B;  4LUD A;  3V7R A;  1SHG A;  1K9M R;  1WXB A;  2V1R A;  2RPN A;  1K8A U;  2QEX T;  1AOJ A;  1Q81 C;  3V7C A;  2RO0 A;  4IIO A;  2F2X A;  5CKF A;  3FJP A;  2E6Z A;  4IKF A;  3CPW S;  5IH2 A;  1T0H A;  3RKY A;  5GAN 7;  1BCO A;  3CME A;  2RJE A;  2QQS A;  3EGX A;  1PD1 A;  4V2S A;  3RDV A;  1E6H A;  2E3H A;  2GFU A;  1YJN Q;  2DVE A;  3LWI A;  4FYV B;  5LJ5 d;  1JOW A;  4Y72 B;  1VQM T;  1WHH A;  2IW8 B;  1B07 A;  1RI0 A;  1Z9Z A;  3X28 B;  3FRN A;  2CCH B;  4O5V A;  3OSV A;  1H1S B;  2M16 A;  1SEM A;  4DOV A;  4JRQ A;  3O8V A;  1GUX B;  4FIB A;  2NLU A;  3EFS A;  1W2B P;  1G5V A;  1OPL A;  1ZHI A;  3QJ6 A;  2WMA B;  3HRT A;  2DYI A;  3ER0 A;  3NGP A;  1RLP C;  3OYB A;  3GP8 A;  1BB9 A;  1D1A A;  2JN0 A;  4M7D B;  1LPL A;  3QHR B;  4E2F B;  5ICP B;  2VXE A;  2O9S A;  2M9U A;  4NC6 A;  4M75 D;  1ACM B;  2C0I A;  4J83 A;  2W96 A;  1ABQ A;  4M77 G;  1NYF A;  3P8B B;  2KE9 A;  5CQY A;  1NM7 A;  2L3Q A;  3BG3 A;  2MPX C;  3HKS A;  3OY9 A;  3EOC B;  2DD5 B;  2W9Z A;  2H8H A;  2DXU A;  3BE3 A;  4OVA A;  4C8Q G;  3BDL A;  3MI9 B;  2YT6 A;  1QVP A;  4LNP A;  1YI2 Q;  4ZNX A;  3O5Z A;  1YJ9 A;  5GAN 3;  2MK5 A;  1AWW A;  1WHK A;  2DNU A;  1K0X A;  4CRI A;  1CKA A;  4E47 A;  1X27 A;  3CCE Q;  2P0K A;  2E10 A;  1YI2 T;  4RTT A;  2VC8 A;  5GAN 2;  4BCF B;  2KR6 A;  2VXF A;  1AZG B;  3PMI A;  1TH7 A;  2IN3 A;  3OYY A;  4XU1 A;  4JS4 A;  1FMW A;  3CCS Q;  3BDU A;  5A2Q E;  3S3O A;  4FYY B;  1AWX A;  4RG2 A;  4KGV B;  2DL3 A;  1M2V B;  1NJI R;  3M0U A;  4PFZ A;  3M0T A;  2VWF A;  4PFP A;  3B57 A;  2DTH A;  1P92 A;  4ZGJ B;  2MAM A;  4OMP A;  3RES A;  4WCI A;  1R77 A;  2RM4 A;  4XTV A;  2VAS A;  4R56 A;  2JZ2 A;  1BIB A;  5EC7 A;  1NBE B;  2RI3 A;  1XJW B;  1X43 A;  1U1T A;  2DFU A;  2RJD A;  4M77 C;  1NEG A;  2DF6 A;  1PRL C;  3DKM A;  3SDZ A;  3LLR A;  3JCM J;  1B34 A;  4C92 D;  3LGF A;  2HL5 C;  2CKK A;  2V22 B;  1AD5 A;  1UGS B;  3M4Y A;  3CC7 A;  1KHI A;  2W10 A;  3VYG B;  1JST B;  4CI0 C;  1YP5 A;  4NST B;  2B9R A;  4EC9 B;  1PNJ A;  4C5H A;  4M7A G;  1JO8 A;  5HQ0 B;  4BCG B;  1K73 C;  1M90 R;  4C0Z A;  1N8R C;  4OB2 B;  2K5L A;  1GRI A;  4AKI A;  4J7I A;  3TNW B;  1M3C A;  2QYZ A;  4PJM A;  2YUP A;  2HBW A;  3VS5 A;  4EOK B;  2I53 A;  2FPE A;  2QTV A;  4BUG A;  3A98 A;  4PJO C;  2CP0 A;  2QQB A;  4YTL A;  5KYX B;  2FEI A;  4BCP B;  3M0S A;  2DL8 A;  2HL3 A;  5DQW A;  3RMQ A;  2OTJ Q;  3JB9 G;  2KR3 A;  3F5X B;  3OMG A;  2MWO A;  1JSU B;  1M8V A;  1YBY A;  4RUG A;  3M0R A;  1YJW Q;  2DEQ A;  2OI3 A;  4F04 B;  1JXO A;  1VQ8 T;  3CBP A;  4J9F A;  1K4U S;  3OA6 A;  1M4Z A;  5CYI B;  1QVG A;  3LH0 A;  1X2K A;  4AKH A;  1W4S A;  4M7D G;  2DTO A;  1UGP B;  1TSF A;  2ENM A;  4E7I A;  2KRN A;  2CRE A;  4AT1 B;  2LDM A;  1GH6 B;  3RKW A;  3RGF B;  4ANJ A;  1Y71 A;  2RHZ A;  4MIM A;  2RH2 A;  1W98 B;  2QQR A;  3OQ5 A;  2AT1 B;  5EG2 A;  4DOW A;  4ORZ A;  1D09 B;  3QJY A;  2K2V A;  1OPK A;  2QQ9 A;  1JB0 E;  2LCL A;  1FWZ A;  2XD0 A;  3JCM Q;  4LOC A;  1WGS A;  3UPU A;  4N0A C;  3F70 A;  1E7P A;  1T3S A;  1WJR A;  2DXC B;  2YLB A;  2QF7 A;  3FIF A;  3Q1J A;  4J7F A;  4BAC A;  1MUZ A;  2CS7 A;  1VYV A;  1SF9 A;  5LMK B;  2JVV A;  3QSU A;  4ZGE B;  2MWP A;  4HA8 A;  2RQR A;  1OEB A;  1X69 A;  2E6N A;  4EOO B;  5C6S A;  2LW4 A;  2NUP A;  4JJB A;  3OYH A;  1IRX A;  4IUP A;  3RMS A;  1QVG S;  2PK9 B;  1Q7Y R;  4NL2 A;  3NTH A;  3U23 A;  4OGE A;  3VV0 A;  1NLP C;  2QEX Q;  4HVV A;  3P8H A;  1TUG B;  1NZ9 A;  1Q7Y C;  2YDL A;  1WXT A;  3H41 A;  4EDU A;  3ULR B;  1AEY A;  5IF1 B;  2D6F A;  1MGQ A;  2R7G A;  5IHY A;  3QPH A;  2PNI A;  4F14 A;  4M77 B;  5J39 A;  1IHW A;  3WXM B;  2HKQ B;  3CBM A;  3CCQ Q;  2O01 E;  1UEB A;  3CCL T;  2EGE A;  2M0Y A;  1C6V X;  2C5X B;  1IHV A;  1FIN B;  4AFU C;  2DLP A;  1YIT Q;  8ATC B;  2UZE B;  4YOZ A;  1BI2 A;  1ZUY A;  3BHV B;  1WQW A;  5FWC A;  5GAM e;  3CXC A;  2QGS A;  3QHW B;  2DIQ A;  3BLR B;  1D3B A;  2O4X A;  4C92 E;  4MZP A;  2CP3 A;  2HDA A;  3V8J A;  2EVR A;  2ED0 A;  1QVF A;  4YC3 B;  2B8A A;  4KUD K;  2A3L A;  4M7D D;  4J9C A;  4GY5 A;  2EKO A;  5GAM j;  2WHB B;  3QBY A;  3M9Q A;  5FRM A;  4QKU A;  4TTH A;  2QQ8 A;  1JQQ A;  2WSC E;  2EKH A;  2YRD A;  1H26 B;  5FLX E;  1QVF P;  1H24 B;  4DBQ A;  3RBB B;  4BCJ B;  2E65 A;  4PKC C;  1KJW A;  2EUF A;  3M5A A;  5GAO l;  5IXF A;  2FL7 A;  4RMO A;  2LMJ A;  4QT7 A;  1PKS A;  1QWE A;  1JJ2 S;  1X6B A;  3GIB A;  5LJ3 e;  3CPW A;  3CC2 A;  4M75 F;  5HBH B;  2YSQ A;  1WA7 A;  2O88 A;  2AIR B;  2RJC A;  3OYI A;  1YIT A;  1KSW A;  4MDX A;  2A36 A;  1SPK A;  2LCS A;  4BCM D;  1PSF A;  4AFQ C;  1VUB A;  4BDY A;  2PVG B;  4M7A A;  4BCM B;  4J6Y A;  2A37 A;  3CC7 T;  1ZX6 A;  2GFA A;  1HXD A;  4KRC B;  3QZ5 B;  2V8K A;  3OB9 A;  1ZUU A;  1VIE A;  2M02 A;  2RQU A;  4JX6 A;  1FYN A;  4QSH A;  2ROL A;  2P0P A;  3FC3 A;  2D0Q B;  4DBH A;  1VQ8 A;  2K5F A;  2FRY A;  2VGN A;  3OYC A;  1FXX A;  4J6W A;  2RQW A;  2DEU A;  1QLY A;  3JRZ A;  3S3N A;  2EYY A;  3OW2 S;  4C92 B;  3NPF A;  2A7Y A;  2AHJ B;  3CPW P;  3CC2 Q;  4ELL A;  4HNU A;  4ELZ C;  5LJ5 g;  2F2C A;  2E1H A;  4M6V A;  2B86 A;  4M7D A;  3VKH A;  2LQK A;  1Q95 G;  1VYU A;  2JTM A;  2LX7 A;  1RUW A;  1P5E B;  4EON B;  1WFW A;  4AFS C;  1LJO A;  4BD3 A;  1E6G A;  1XNI A;  3CC4 T;  4F7U F;  3JAM E;  2LQ8 A;  5KE3 A;  3HRS A;  1M3A A;  1SHF A;  1M2O A;  4J8O A;  1HJD A;  1TXQ A;  3RNJ A;  2DBK A;  2VKN A;  3OYF A;  1B3Q A;  4LN2 A;  3EH2 A;  2W99 A;  4RTU A;  3LGL A;  4PJO G;  3CQT A;  2PQW A;  2OTJ A;  5HK0 A;  2JTE A;  3FEO A;  4AG1 C;  1G83 A;  3BHU B;  2RHY A;  4OB0 B;  1IGU A;  3PE0 A;  3OYD A;  4ZTF A;  1QKW A;  2KDS A;  2HNI A;  1YFN A;  2CP2 A;  5LQF B;  2DXT A;  1E7O A;  1BCM A;  3VUZ A;  2SRC A;  3MP8 A;  1QKX A;  4F6W B;  1E9H B;  1AWJ A;  5CKE A;  4BI3 A;  1OL2 B;  4BB7 A;  5BNJ B;  4IUV A;  1PD0 A;  1KIK A;  3QYH B;  1H3H A;  3MEA A;  3L42 A;  5J3B A;  1VQL Q;  3MEW A;  3JB9 D;  2L0A A;  1F5Q B;  4F7U E;  2VGM A;  2ATC B;  2KBT A;  1K9M C;  1S72 Q;  1ENW A;  3ZEH A;  4OML A;  2MOX A;  2M51 A;  1VQP Q; 
#chains in the Genus database with same CATH homology
 2XHC A;  5GMK e;  4PLL A;  5GAM h;  1VQP A;  3BFM A;  5GAN 6;  3NFC A;  4M75 D;  3OYA A;  4J83 A;  5GAN d;  4PJO F;  3CD6 T;  4M77 G;  2K5I A;  3HO8 A;  3P8B B;  5CQY A;  4IUT A;  4QVD A;  1HK9 A;  5GAN g;  1YJN T;  3E9F A;  2LRQ A;  4QQD A;  1N8R U;  3BG3 A;  3HKS A;  3X26 B;  1VIF A;  3OY9 A;  3X24 B;  4JLG A;  1NPR A;  2DD5 B;  3VUB A;  2KAF A;  4C0G A;  2FVU A;  4FT2 A;  4QQG A;  3CCQ T;  2DXU A;  3CCE A;  2ZZD B;  2DXB A;  3HBL A;  2LC4 A;  4MFE A;  2MI6 A;  4OVA A;  3BDL A;  4C8Q G;  3CCJ T;  3JCM P;  4XTX A;  1QVP A;  1R8O B;  2GF7 A;  3QYE A;  5GAN h;  1SSF A;  2K3Y A;  1YJ9 A;  5GAN 3;  4A4E A;  3CCU T;  4RCB A;  1QW1 A;  4TVR A;  4XK8 E;  4CRI A;  5GMK j;  1XQH A;  5GAO n;  1K73 U;  1M1K C;  4E47 A;  2CZ0 B;  3RER A;  4EPC A;  3CCS A;  2P0K A;  1MHN A;  2ZCF B;  2E10 A;  3C95 A;  1YI2 T;  1WQ7 A;  2VC8 A;  5GAN 2;  2KR6 A;  4M78 B;  1BI3 A;  3E9G A;  3CC2 T;  1WPY A;  5I2S A;  1NJI U;  2VXF A;  3X20 B;  3M54 A;  1TH7 A;  1U1S A;  3OYY A;  3A8O B;  3PMI A;  4XU1 A;  3JCM V;  4C5E A;  2DPP B;  4JS4 A;  5DM7 R;  4M7D F;  4BY6 C;  1KHC A;  3BDU A;  2CZ7 B;  5A2Q E;  2VV5 A;  4M7A E;  4OF1 A;  3S3O A;  5CK9 A;  4RG2 A;  2KK4 A;  4AI6 A;  4BI4 A;  3DL1 A;  3HHT B;  3MEV A;  1UGR B;  2DZC A;  3JB9 I;  3PFS A;  3VKG A;  3CPF A;  4E7J A;  3JCM W;  2FYK A;  2RD1 A;  4L5G A;  3CCU A;  2DTH A;  2LT1 A;  3FB9 A;  4HT8 A;  1P92 A;  4E7K A;  2BS3 A;  4ZGJ B;  4PJO E;  1LOJ A;  2MAM A;  1YCY A;  2BKD N;  4XQ3 A;  3RUX A;  3RES A;  2L3R A;  4EMH A;  4C8Q C;  4BY6 B;  3KBG A;  3JB9 F;  2RM4 A;  4XTV A;  4R56 A;  1N6A A;  2LT4 A;  3WVE B;  2JZ2 A;  4QW2 A;  1RL2 A;  1Q86 C;  1BIB A;  3VYH B;  4OGC A;  2E12 A;  2JOY A;  2LTO A;  4F7U A;  2RI3 A;  1U1T A;  3X25 B;  1KQ1 A;  2RJD A;  4M77 C;  3SB2 A;  2PVD B;  4L59 A;  3OYG A;  1H3Z A;  5LJ5 j;  5IN1 A;  1M9S A;  2I2L A;  3DKM A;  4JRI A;  2PUK B;  3LLR A;  3SDZ A;  3ZBD A;  3JCM J;  4FM4 B;  1B34 A;  1M5Q 1;  3CCM A;  4C92 D;  1BI1 A;  2O4X B;  3LGF A;  5LJ3 f;  4A53 A;  4BBR M;  5D6X A;  2CKK A;  4MMK A;  4JX5 A;  3UT1 A;  1BYM A;  2XKO C;  5LJ3 j;  3L2V A;  1K9M U;  1QVF S;  1UGS B;  3MHX A;  2OAU A;  3M4Y A;  3RKX A;  3HP9 A;  4OP0 A;  4Q5W A;  5KH6 A;  3CC7 A;  4C0D C;  1KHI A;  1G3T A;  1VQ7 T;  3VYG B;  4LD9 K;  4M7A F;  4CI0 C;  5GAN 8;  4M7D E;  5D6Y A;  3UDC A;  1M1F A;  2XU8 A;  1WJQ A;  4ELJ A;  3E1S A;  5LJ5 e;  5GAN 4;  2HQE A;  4JJN K;  4C5H A;  4JRK A;  3VJP A;  4EMK C;  2R5M A;  3CXC S;  1ZQ1 A;  4M7A G;  3I56 T;  1VQL A;  4C8Q D;  3L2U A;  2ZPI B;  2QEX A;  1K73 C;  2V8I A;  4RG8 A;  4C0Z A;  2QA4 T;  5LL6 S;  1N8R C;  4OB2 B;  1Y96 B;  2K5L A;  3VYG A;  5HK3 A;  4XU3 A;  2PU9 B;  4XTU A;  1S72 A;  1W2B A;  1VQN T;  4MML A;  4C8Q B;  1D3B B;  4AKI A;  4B9X A;  4J7I A;  2X4W A;  3A8M B;  2KVQ G;  3OYE A;  5LJ3 h;  5GAO r;  4N0A A;  1N9R A;  3CCV A;  3GF5 A;  5DLQ E;  2K57 A;  1NJI C;  3CD6 A;  5CR2 A;  2RHI A;  4BUG A;  1QP3 A;  4HCC A;  3BW1 A;  3KHI A;  4HL4 A;  4PJO C;  2CYZ B;  5KE2 A;  1VQ4 T;  5LJ3 g;  2QQB A;  3HPW A;  3M59 A;  4YTL A;  3OYL A;  1KQS S;  3AHU A;  3MEU A;  3CBO A;  4Z02 A;  4OB3 B;  1BKB A;  2VYT A;  5LJ3 d;  1X6O A;  1OYX A;  1KC8 C;  2V8J A;  3PT9 A;  3RMQ A;  2DIG A;  1NE8 A;  3JB9 G;  2QQA A;  5CAI A;  3UWN A;  3JCM b;  4DA4 A;  5L8R E;  4B9W A;  3OMG A;  2ZPH B;  4BBS M;  2MWO A;  1KC8 U;  1M8V A;  1YBY A;  4L6V 5;  2L8D A;  4NOY A;  1VQK T;  3LX7 A;  2DEQ A;  3BY7 A;  3G4S T;  3QWL A;  1I8F A;  3G7Z A;  5I2M A;  5CKH A;  3JSC A;  3KXT A;  3OS5 A;  4DQ2 A;  4BE1 A;  1VQ9 A;  1VQ8 T;  1G3W A;  5CKB A;  3CBP A;  3QYG B;  1Y07 A;  2DTI A;  3TRE A;  3VKI A;  3GPL A;  1YHQ A;  4JUV A;  3OA6 A;  1M4Z A;  4MZM A;  1VQP T;  4MDW A;  1QVG A;  3LYI A;  3LH0 A;  4AKH A;  1W4S A;  4M7D G;  2DKG A;  2DTO A;  1UGP B;  3OYN A;  1G3Y A;  4E7I A;  2YHT A;  1WNL A;  3A5Z B;  4JDS A;  3EAE A;  1UB4 A;  2LDM A;  4M78 F;  5CIU A;  3RKW A;  4ATO A;  1IZ6 A;  2Y4Y A;  4PJO B;  5KCO A;  1WJS A;  1Y71 A;  2RHZ A;  1NPP A;  2EJG A;  4HCZ A;  4MZT A;  1GXI E;  3I55 T;  4MIM A;  2RH2 A;  4E7L A;  1V29 B;  2QQR A;  3OQ5 A;  4M78 A;  5EG2 A;  4DOW A;  2FHD A;  3PTA A;  3QJY A;  1Q81 C;  2K2V A;  4OB1 B;  5CCA A;  2QQ9 A;  1JB0 E;  1H64 1;  1LNX A;  3NTK A;  2DJZ A;  3SFM A;  3M55 A;  2LCL A;  1YIT T;  1FWZ A;  1M1G A;  4C8Q F;  3HRU A;  3V7S A;  3VU3 C;  3QG1 A;  2XD0 A;  2EQJ A;  3JCM Q;  2MMP A;  4LOC A;  1WGS A;  4E7H A;  1M90 C;  2E5Q A;  2DXB B;  2ZZD A;  3F70 A;  4N0A C;  4X9D A;  4WF2 A;  5FU6 C;  3RIR A;  3UPU A;  1E7P A;  2DZ9 A;  2X4X A;  4UC4 A;  2HAX A;  3CC4 A;  2K4Y A;  4M77 F;  1WJR A;  2DXC B;  2L5Q A;  2YLB A;  2QF7 A;  3FIF A;  3Q1J A;  3LWH A;  4J7F A;  4BAC A;  2CS7 A;  5DLO A;  4IUQ A;  5GAN f;  1VQ6 T;  5CKD A;  2XID A;  2JVV A;  4C5I A;  3QSU A;  4ZGE B;  5CVI A;  2MWP A;  1YJW T;  4KUL A;  5FU7 B;  4HA8 A;  4JX4 A;  1BIA A;  5D6W A;  3M58 A;  3PMT A;  4M75 C;  4XU0 A;  3JCM f;  3QYB A;  4C8Q A;  4GLK A;  2E6N A;  2F69 A;  2YRV A;  4ME7 A;  5C6S A;  4EMK B;  2KMG A;  3OYH A;  1Y96 A;  4C92 G;  4AKG A;  4IUP A;  2IG0 A;  3DLM A;  2CZ1 B;  3RMS A;  3L2W A;  4J5Y A;  4O6J A;  4BE0 A;  1QVG S;  4C8Q E;  3G71 A;  2XDP A;  4RCC A;  1YIJ A;  4NL2 A;  2XI9 A;  3NTH A;  3JCM X;  3GOX A;  1VQK A;  4OGE A;  4C0D B;  2JUF A;  4C92 F;  3VV0 A;  2CZ6 B;  4A54 A;  3P8H A;  2QFZ A;  1NZ9 A;  4A4G A;  1Q7Y C;  3H6Z A;  3GNF B;  3CCR A;  3PGG A;  4M77 E;  3C94 A;  4A4H A;  2EWN A;  3BG9 A;  5M9O A;  4EDU A;  2XDD A;  2G77 A;  1Q7Y U;  4M7A D;  4ZN1 A;  5A0D A;  2DXC A;  1VQ6 A;  4PLI A;  1N27 A;  2D6F A;  1MGQ A;  3S6W A;  5GMK l;  3QPH A;  1VQ5 T;  5GAM d;  5J39 A;  4M77 B;  2E64 A;  3FDR A;  2RI5 A;  1KQS A;  3MET A;  4LDX A;  3WXM B;  2DD4 B;  3M57 A;  2KQW A;  3CBM A;  2O01 E;  4BI8 B;  4EMG A;  1UEB A;  2R5A A;  3CCL T;  5FRN A;  2D9T A;  3J80 E;  5LJ5 f;  3ASK A;  5CQX A;  2LCC A;  3QKJ A;  5HY6 A;  3QXE B;  3SWN C;  1ZBX A;  1X75 C;  3A8H B;  5FU7 C;  1VQL T;  4M78 E;  5C0M A;  2C06 A;  1W2B S;  1FKM A;  4FU6 A;  3V8L A;  1BI2 A;  3CCM T;  4F7U G;  1KQ2 A;  1WQW A;  5GAO p;  4PJO A;  5GAM e;  5GMK h;  3CXC A;  1M90 U;  5FU6 B;  2DIQ A;  1FX7 A;  1QP2 A;  2HBP A;  3MP1 A;  3FLG A;  4NL3 A;  1D3B A;  1DJ7 B;  2O4X A;  4M78 G;  2P0Q A;  2PVO B;  4MZP A;  4C92 E;  1YJW A;  1B34 B;  4RKU E;  3JB9 J;  1VQO T;  4Z6Y A;  2Y4X A;  3V8J A;  5GMK i;  1VQO A;  2OTL T;  2OTL A;  3M53 A;  4M78 C;  2EJ9 A;  2RK1 A;  1QVF A;  3OS2 A;  2EFI A;  3QUI A;  2B8A A;  4KUD K;  2OTJ T;  3I56 A;  2A3L A;  4M7D D;  5GAN e;  1AHJ B;  1O75 A;  3T9N A;  5GAM g;  1JRI A;  4GY5 A;  2EKO A;  3URG A;  3C12 A;  5I21 A;  5HKC A;  4LDY A;  5GAM j;  3L2R A;  3G71 T;  1YIJ T;  3QBY A;  2E41 A;  1G3S A;  2WAC A;  3DB4 A;  3CEY A;  5FRO A;  2DK3 A;  5GAM f;  5GAO m;  3CCR T;  3M9Q A;  4A4F A;  2BIV A;  4FT4 A;  5FRM A;  2XIC A;  3CMA A;  2QQ8 A;  4Y91 A;  2WSC E;  1BI0 A;  2X35 A;  2PUO B;  5CO7 A;  3R6O A;  1XTD A;  3TU4 K;  1K8A C;  5FLX E;  5LJ5 h;  5GAN 5;  1YJN A;  2X4J A;  3EFR A;  1VQ4 A;  2WSE E;  4IUR A;  2GCX A;  3QII A;  4HNT A;  1Q82 U;  2E65 A;  4PKC C;  3OMC A;  3I55 A;  3M5A A;  2G3R A;  2RI2 A;  5GAO l;  5A0G A;  3OS1 A;  4X34 A;  3DLL A;  2FL7 A;  1U8R A;  4RMO A;  1Q82 C;  5GAO q;  4PNO A;  2ZPE B;  3ZFJ A;  2LNV A;  2GQV A;  3A8G B;  5IT9 E;  2RHU A;  1JJ2 S;  3GIB A;  5LJ3 e;  4BE2 A;  4JS5 A;  3L2Q A;  1Q81 U;  3CPW A;  3CC2 A;  4QQ6 A;  4M75 F;  4MFD A;  3JCM c;  3S3M A;  3MCA B;  1YI2 A;  2RJC A;  3MP6 A;  4JLI A;  3OYI A;  1YIT A;  1I5L A;  5GMK m;  1YHQ T;  3OYK A;  4MDX A;  3TW7 A;  3PIP A;  3E19 A;  3KUF A;  3J7A F;  2M0O A;  1O9S A;  2EQM A;  2K3X A;  4Y28 E;  1PSF A;  2YLC A;  3HZJ A;  1OI1 A;  1VUB A;  3TCJ A;  2PVG B;  4BDY A;  2HQX A;  4M7A A;  4C92 C;  4FSX A;  3BG5 A;  1N9S A;  4J6Y A;  3CME T;  3PIO A;  1PSE A;  3CC7 T;  2GFA A;  3CCE T;  1HXD A;  4M75 G;  4LDV A;  4P5N A;  3P8D A;  3HB9 A;  3QZ5 B;  3H4C A;  2V8K A;  3OB9 A;  4HT9 A;  1KD1 U;  4KUI A;  4LD6 A;  4VUB A;  1VIE A;  4KT0 E;  3SD4 A;  3HL8 A;  3G6E T;  2E70 A;  2H3J A;  2ZPB B;  4JX6 A;  3PNW C;  2JNG A;  2F5T X;  3QO3 A;  4XTY A;  4X9C A;  3C4S A;  4D6W A;  4F7U B;  1KD1 C;  3OW2 A;  4QSH A;  2P4T A;  3DB3 A;  2P0P A;  3FC3 A;  2D0Q B;  3SWN A;  1VQ8 A;  2K5F A;  2RA2 A;  2ZPF B;  2VGN A;  3G4S A;  3OYC A;  5AYF A;  3H8Z A;  1FXX A;  4J6W A;  1OZ3 A;  1VQN A;  2EJF A;  2HD0 A;  2KY9 A;  1Q86 U;  2EQK A;  4XU2 A;  4PJO D;  2DO3 A;  1XOV A;  1Y7X A;  2FB7 A;  1KG1 A;  3JRZ A;  2RHX A;  4N4H A;  4ZN3 A;  3CCQ A;  3JB9 H;  4HLQ A;  4II1 A;  2QTX A;  3S3N A;  2QXF A;  3OW2 S;  4C92 B;  2EQU A;  2A7Y A;  2L89 A;  3QDR B;  4M75 E;  3OYM A;  2AHJ B;  3OBW A;  1YJ9 T;  1UGQ B;  1OZ2 A;  2EAY A;  2ZGW A;  3L2Z A;  4N4G A;  1VQ7 A;  4J6X A;  1EIF A;  1VQ5 A;  4ZTJ A;  4HNU A;  3V8K A;  3HFN A;  5DY9 A;  2BUD A;  4ELZ C;  1IRE B;  5LJ5 g;  2E1H A;  4M6V A;  3TW6 A;  3G6E A;  4HNV A;  2KSS A;  2RB6 A;  3TEE A;  3OS0 A;  3MO8 A;  3VKH A;  4M7D A;  4M75 B;  4HKE A;  2LQK A;  3OSS C;  1I4K 1;  1I81 A;  4M7D C;  2XK0 A;  3V7R A;  3CCL A;  4KBM B;  4C0F A;  2JTM A;  2LX9 A;  3ME9 A;  1S72 T;  1M1K U;  3JCM g;  4PL6 A;  4XAX B;  2QEX T;  1K8A U;  2QA4 A;  2MF2 A;  3OYJ A;  1LJO A;  4BD3 A;  3V7C A;  1XNI A;  2RO0 A;  3N5B B;  1JBM A;  4NS5 A;  3CC4 T;  4F7U F;  1VQ9 T;  5A0L A;  3JAM E;  2LQ8 A;  5KE3 A;  5CKF A;  5GAN j;  3FJP A;  3A8L B;  2EYQ A;  4M7A B;  2E6Z A;  3WVD B;  4LDW A;  4ELY C;  2IVW A;  3CPW S;  3J81 E;  3M4G A;  4IKF A;  3HRS A;  3JCM h;  4J8O A;  2DD5 A;  2Y90 A;  3NTI A;  2QI2 A;  2X4Y A;  4QVZ A;  3QHS A;  4XTZ A;  4R55 A;  1JJ2 A;  3RKY A;  3CCJ A;  4A4K A;  5GAN 7;  2R57 A;  2RK2 A;  3L1A A;  3LW5 E;  4ZGD B;  2RJE A;  2QQS A;  2XG8 D;  4XTW A;  4QVC A;  4M78 D;  3CME A;  3OYF A;  5IAY A;  4N4I A;  2QDY B;  4V2S A;  2GFU A;  2DVE A;  3QZ9 B;  3LWI A;  4HCB A;  5LJ5 d;  3LGL A;  4PJO G;  1X01 A;  2PQW A;  5HK0 A;  2OTJ A;  3HSB A;  1VQM T;  1VQM A;  3FEO A;  4OB0 B;  2DD4 A;  2RHY A;  5KCH A;  3GLX A;  2ZPG B;  1RI0 A;  3OYD A;  4ZTF A;  4M77 A;  3HFO A;  2M1H A;  3CCV T;  2KDS A;  2HNI A;  2LVM A;  3X28 B;  3INZ A;  2DXT A;  3VUZ A;  4JRP A;  3MP8 A;  3JCM e;  4FL6 A;  4BDZ A;  3FRN A;  2F5K A;  4O5V A;  3OSV A;  5CKE A;  5J26 A;  4BI3 A;  3CMA T;  2M16 A;  4BB7 A;  4IUV A;  2WSF E;  4LDU A;  3O8V A;  4DOV A;  4JRQ A;  3QYH B;  3M56 A;  4FIB A;  4M77 D;  4M7A C;  2NLU A;  3MEA A;  4C92 A;  3EFS A;  3GNG A;  2R58 A;  4IUU A;  3L42 A;  1G5V A;  5J3B A;  1ZHI A;  3QJ6 A;  2DAQ A;  2JTF A;  3CCS T;  3HRT A;  2BS2 A;  2RJF A;  3ER0 A;  3GP8 A;  3OYB A;  2KMT A;  3MEW A;  2QDJ A;  2WJ9 A;  2VUB A;  3OBY A;  3JB9 D;  4OMF B;  4F7U E;  2VGM A;  5EJC A;  4M75 A;  2BS4 A;  2JN0 A;  1K9M C;  4M7D B;  4EMK A;  2CGH A;  3SWN B;  2VXE A;  3ZEH A;  3JCM d;  1QLB A;  2XDB A;  2M9U A;  4NC6 A;  2EIF A;  4C5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...