1KXUA

Cyclin h, a positive regulatory subunit of cdk activating kinase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
276
Chain Sequence
b'WTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN H
publication title Three-dimensional structure of human cyclin H, a positive regulator of the CDK-activating kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Regulatory protein
total genus 96
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1996-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00134 Cyclin_N Cyclin, N-terminal domain
A PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1kxuA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1kxuA01
3K7AM 4F7NB 5LMKB 3MY1B 1QMZB 2IVXA 2W9FA 2WMBB 1FINB 4BCGB 1GH6B 1PKDB 3BHVB 3EOCB 4BCMB 2WEVB 3MY5B 5IDPB 2PHGA 4G6LB 2WIHB 3DDQB 3DDPB 4EOSB 3BLHB 3QHWB 1H28B 1JOWA 3TNIB 4F7JB 2G9XB 1H1RB 2B9RA 1JSTB 2UZLB 4KRCB 3G33B 5CYIB 4EORB 5CEIB 1XO2A 2CCIB 4BCJB 1OKWB 3EIDB 4YOOA 5L2WB 5LQFB 4BCPB 4BCHB 2PMIB 3BHUB 3BLQB 2I40B 4EOMB 1OIYB 4TTHA 1W98B 4IMYB 2CCHB 4BCKB 4YC3B 4YOZA 4BCMD 1KXUA 5HBEB 2WFYB 1H1SB 2WXVB 2WMAB 2IW6B 2C5OB 4CFVB 2C5XB 3F5XB 1JKWA 2EUFA 4CXAB 4BCNB 5BNJB 1VYWB 5HNBB 1H25B 2C5NB 1H24B 4OR5B 4EC8B 2W2HA 5ACBA 3TNWB 4BCQB 2I53A 1O9KA 1UNGD 1GUXA 3LQ5B 4CFMB 2W99A 1UNLD 1OI9B 4CFUB 1N4MA 4UN0A 3RGFB 3TN8B 1UNHD 2F2CA 4F7SB 3BLRB 1BU2A 2JGZB 4FX3B 3POMA 4EC9B 1F5QB 5HVYB 2BPMB 4EOPB 4CFWB 4F6UB 4EOLB 1O9KB 2WIPB 1GUXB 2QDJA 4BCND 4RODA 5IDNB 3MI9B 5IF1B 2UZDB 4YOSA 5HBJB 4EOKB 4BCQD 4Y72B 2WHBB 4F7LB 1ZP2A 1URCB 3EJ1B 1OGUB 4CFUD 4CFXB 1C9BA 1AISB 3DOGB 2UZBB 2W9ZA 3O0GD 5FGKB 1P5EB 4CRLB 1VINA 4F70B 4EONB 4EOIB 4I3ZB 4ROEA 1H4LD 3TNHB 3MIAB 2UZEB 4EOJB 3QHRB 2C5VB 1D3UB 4EOOB 1H26B 4ELLA 2BKZB 2X1NB 1VOLA 1G3NC 2R7GA 5HBHB 1OL2B 2UUEB 2C4GB 4II5B 4ELJA 3M03A 4BCIB 1OIUB 4F6WB 2WPAB 1E9HB 4ROCA 2C6TB 4EOQB 1FVVB 4NSTB 5EFQB 2CJMB 1JSUB 3H4CA 4KRDB 1H1QB 3BHTB 1OL1B 5I5ZB 5ICPB 2PK2A 1H27B 5HQ0B 1H1PB 1OKVB 4BCOB 1GY3B 2V22B 4OGRB 2IW8B 1AD6A 1TFBA 4F6SB 2PK9B 4BCFB 4CFNB 2W96A 2IW9B
chains in the Genus database with same CATH superfamily
4ZGJB 3WVEB 1FINB 4BCGB 3EOCB 4BCMB 2PHGA 3DDPB 3QHWB 4JX4A 4F7JB 4KRCB 3G33B 5CEIB 4M6VA 3X25B 5LQFB 4BCHB 5DQVA 2WJ9A 1KXUA 3QZ9B 2IN3A 2C5XB 5BNJB 1H25B 2DMEA 4HNVA 2W2HA 5ACBA 2CYZB 4CFMB 1UNLD 5DQWA 2F2CA 1BU2A 4EC9B 2BPMB 4EOPB 1UGPB 2WIPB 4BCND 2LW4A 2UZDB 5HBJB 4BCQD 4Y72B 1ZP2A 4CFUD 1AISB 2KR6A 2W9ZA 3BG3A 1P5EB 3QZ5B 4CRLB 1VINA 4MFDA 4EONB 4ROEA 1H4LD 3TNHB 2UZEB 3QYGB 2C5VB 1D3UB 4Z6YA 2BKZB 5HBHB 2UUEB 2C4GB 4II5B 3M03A 4F6WB 4ROCA 4FM4B 4NSTB 4BBRM 2DXBB 1H1QB 1ENWA 1OL1B 5ICPB 1H27B 2BS2A 1H1PB 3NDQA 4AI6A 4F6SB 2CZ1B 2W96A 1JSUB 2ZPGB 3MY1B 2PJQA 2WMBB 1PKDB 4G6LB 4EOSB 3BLHB 4ZGEB 1H28B 3TNIB 4OB2B 2B9RA 1JSTB 2UZLB 5CYIB 1XO2A 2CCIB 1OKWB 5L2WB 3HB9A 2ZPFB 3TW7A 4BCPB 3BLQB 4BBSM 1W98B 4IMYB 3VKHA 4YC3B 2WXVB 2C5OB 3A8GB 1JKWA 4CXAB 1VYWB 4EC8B 3VYGB 1O9KA 1GUXA 4AKGA 2D0QB 2W99A 1OI9B 2DPPB 1N4MA 1TD6A 4F7SB 2JGZB 1F5QB 5HVYB 2ZZDB 1O9KB 1GUXB 3X28B 5IF1B 3HBLA 4HNUA 2WHBB 1OGUB 4CFXB 2DXCB 3HO8A 3DOGB 2UZBB 5FGKB 3X26B 2BS4A 3A8HB 1V29B 5EJCA 3DTOA 4NC6A 4EOJB 4EOOB 4ELLA 2X1NB 1G3NC 4OB1B 4ZGDB 1FVVB 3BHTB 2PK2A 1OKVB 1GY3B 3KHIA 1AD6A 4HLQA 2PK9B 4CFNB 3B57A 2IW9B 4F7NB 1QMZB 2IVXA 2W9FA 1QLBA 2CZ7B 3MY5B 5IDPB 3VKGA 1JOWA 2G9XB 1E7PA 4YOOA 2PMIB 4EOMB 1OIYB 2G77A 4BCKB 4YOZA 4BCMD 1AHJB 5HBEB 1H1SB 4CFVB 3X20B 5IHYA 3DJBA 2EUFA 4BCNB 5HNBB 2C5NB 1H24B 4OR5B 4BCQB 1UNGD 2CZ6B 3BG9A 4CFUB 4UN0A 3RGFB 2QF7A 4BXXX 3TW6A 4FX3B 3POMA 4CFWB 1UGSB 3QWLA 4EOLB 4HL4A 2ZPHB 2QDJA 4MIMA 2ZPEB 3WVDB 4F7LB 4BY1X 2AHJB 1UGRB 1URCB 3EJ1B 3QYBA 3DL1A 3HHTB 3O0GD 3X24B 4HNTA 4BY7X 4I3ZB 3MIAB 2DD4B 1H26B 2QQ8A 1UGQB 2QDYB 4BCIB 1OIUB 4QSHA 2WPAB 1E9HB 3A8OB 5EFQB 2CJMB 3VYHB 5I5ZB 5HQ0B 4BCOB 3K7AM 5LMKB 1GH6B 3BHVB 4LOCA 2WEVB 2CZ0B 2WIHB 3DDQB 1IREB 2QFZA 4AKIA 1H1RB 2BS3A 3QYHB 4EORB 4BCJB 3EIDB 3BHUB 2I40B 2ZPIB 4TTHA 3GTMS 4JX6A 2CCHB 4OB0B 2WFYB 2WMAB 2IW6B 4AKHA 3F5XB 3QYEA 3TNWB 2I53A 3LQ5B 3A8MB 4MFEA 3TN8B 1UNHD 3BLRB 4JX5A 3A8LB 4F6UB 3HZJA 4RODA 5IDNB 3MI9B 4YOSA 4EOKB 2DD5B 2ZCFB 4OB3B 1C9BA 3BG5A 4F70B 3PO3S 2KMGA 3QXEB 4EOIB 3QHRB 1VOLA 2R7GA 1OL2B 2ZPBB 4ELJA 1FKMA 4EOQB 2C6TB 4KRDB 3H4CA 2QGSA 2V22B 4OGRB 2IW8B 1TFBA 4BCFB
chains in the Genus database with same CATH topology
3K7AM 4F7NB 5LMKB 3MY1B 1QMZB 2IVXA 2W9FA 2WMBB 1FINB 4BCGB 1GH6B 1PKDB 3BHVB 3EOCB 4BCMB 2WEVB 3MY5B 5IDPB 2PHGA 4G6LB 2WIHB 3DDQB 3DDPB 4EOSB 3BLHB 3QHWB 1H28B 1JOWA 3TNIB 4F7JB 2G9XB 1H1RB 2B9RA 1JSTB 2UZLB 4KRCB 3G33B 5CYIB 4EORB 5CEIB 1XO2A 2CCIB 4BCJB 1OKWB 3EIDB 4YOOA 5L2WB 5LQFB 4BCPB 4BCHB 2PMIB 3BHUB 3BLQB 2I40B 4EOMB 1OIYB 4TTHA 1W98B 4IMYB 2CCHB 4BCKB 4YC3B 4YOZA 4BCMD 1KXUA 5HBEB 2WFYB 1H1SB 2WXVB 2WMAB 2IW6B 2C5OB 4CFVB 2C5XB 3F5XB 1JKWA 2EUFA 4CXAB 4BCNB 5BNJB 1VYWB 5HNBB 1H25B 2C5NB 1H24B 4OR5B 4EC8B 2W2HA 5ACBA 3TNWB 4BCQB 2I53A 1O9KA 1UNGD 1GUXA 3LQ5B 4CFMB 2W99A 1UNLD 1OI9B 4CFUB 1N4MA 4UN0A 3RGFB 3TN8B 1UNHD 2F2CA 4F7SB 3BLRB 1BU2A 2JGZB 4FX3B 3POMA 4EC9B 1F5QB 5HVYB 2BPMB 4EOPB 4CFWB 4F6UB 4EOLB 1O9KB 2WIPB 1GUXB 2QDJA 4BCND 4RODA 5IDNB 3MI9B 5IF1B 2UZDB 4YOSA 5HBJB 4EOKB 4BCQD 4Y72B 2WHBB 4F7LB 1ZP2A 1URCB 3EJ1B 1OGUB 4CFUD 4CFXB 1C9BA 1AISB 3DOGB 2UZBB 2W9ZA 3O0GD 5FGKB 1P5EB 4CRLB 1VINA 4F70B 4EONB 4EOIB 4I3ZB 4ROEA 1H4LD 3TNHB 3MIAB 2UZEB 4EOJB 3QHRB 2C5VB 1D3UB 4EOOB 1H26B 4ELLA 2BKZB 2X1NB 1VOLA 1G3NC 2R7GA 5HBHB 1OL2B 2UUEB 2C4GB 4II5B 4ELJA 3M03A 4BCIB 1OIUB 4F6WB 2WPAB 1E9HB 4ROCA 2C6TB 4EOQB 1FVVB 4NSTB 5EFQB 2CJMB 1JSUB 3H4CA 4KRDB 1H1QB 3BHTB 1OL1B 5I5ZB 5ICPB 2PK2A 1H27B 5HQ0B 1H1PB 1OKVB 4BCOB 1GY3B 2V22B 4OGRB 2IW8B 1AD6A 1TFBA 4F6SB 2PK9B 4BCFB 4CFNB 2W96A 2IW9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A M;  4F7N B;  5LMK B;  3MY1 B;  1QMZ B;  2IVX A;  2W9F A;  2WMB B;  1FIN B;  4BCG B;  1GH6 B;  1PKD B;  3BHV B;  3EOC B;  4BCM B;  2WEV B;  3MY5 B;  5IDP B;  2PHG A;  4G6L B;  2WIH B;  3DDQ B;  3DDP B;  4EOS B;  3BLH B;  3QHW B;  1H28 B;  1JOW A;  3TNI B;  4F7J B;  2G9X B;  1H1R B;  2B9R A;  1JST B;  2UZL B;  4KRC B;  3G33 B;  5CYI B;  4EOR B;  5CEI B;  1XO2 A;  2CCI B;  4BCJ B;  1OKW B;  3EID B;  4YOO A;  5L2W B;  5LQF B;  4BCP B;  4BCH B;  2PMI B;  3BHU B;  3BLQ B;  2I40 B;  4EOM B;  1OIY B;  4TTH A;  1W98 B;  4IMY B;  2CCH B;  4BCK B;  4YC3 B;  4YOZ A;  4BCM D;  1KXU A;  5HBE B;  2WFY B;  1H1S B;  2WXV B;  2WMA B;  2IW6 B;  2C5O B;  4CFV B;  2C5X B;  3F5X B;  1JKW A;  2EUF A;  4CXA B;  4BCN B;  5BNJ B;  1VYW B;  5HNB B;  1H25 B;  2C5N B;  1H24 B;  4OR5 B;  4EC8 B;  2W2H A;  5ACB A;  3TNW B;  4BCQ B;  2I53 A;  1O9K A;  1UNG D;  1GUX A;  3LQ5 B;  4CFM B;  2W99 A;  1UNL D;  1OI9 B;  4CFU B;  1N4M A;  4UN0 A;  3RGF B;  3TN8 B;  1UNH D;  2F2C A;  4F7S B;  3BLR B;  1BU2 A;  2JGZ B;  4FX3 B;  3POM A;  4EC9 B;  1F5Q B;  5HVY B;  2BPM B;  4EOP B;  4CFW B;  4F6U B;  4EOL B;  1O9K B;  2WIP B;  1GUX B;  2QDJ A;  4BCN D;  4ROD A;  5IDN B;  3MI9 B;  5IF1 B;  2UZD B;  4YOS A;  5HBJ B;  4EOK B;  4BCQ D;  4Y72 B;  2WHB B;  4F7L B;  1ZP2 A;  1URC B;  3EJ1 B;  1OGU B;  4CFU D;  4CFX B;  1C9B A;  1AIS B;  3DOG B;  2UZB B;  2W9Z A;  3O0G D;  5FGK B;  1P5E B;  4CRL B;  1VIN A;  4F70 B;  4EON B;  4EOI B;  4I3Z B;  4ROE A;  1H4L D;  3TNH B;  3MIA B;  2UZE B;  4EOJ B;  3QHR B;  2C5V B;  1D3U B;  4EOO B;  1H26 B;  4ELL A;  2BKZ B;  2X1N B;  1VOL A;  1G3N C;  2R7G A;  5HBH B;  1OL2 B;  2UUE B;  2C4G B;  4II5 B;  4ELJ A;  3M03 A;  4BCI B;  1OIU B;  4F6W B;  2WPA B;  1E9H B;  4ROC A;  2C6T B;  4EOQ B;  1FVV B;  4NST B;  5EFQ B;  2CJM B;  1JSU B;  3H4C A;  4KRD B;  1H1Q B;  3BHT B;  1OL1 B;  5I5Z B;  5ICP B;  2PK2 A;  1H27 B;  5HQ0 B;  1H1P B;  1OKV B;  4BCO B;  1GY3 B;  2V22 B;  4OGR B;  2IW8 B;  1AD6 A;  1TFB A;  4F6S B;  2PK9 B;  4BCF B;  4CFN B;  2W96 A;  2IW9 B; 
#chains in the Genus database with same CATH topology
 4ZGJ B;  3WVE B;  1FIN B;  4BCG B;  3EOC B;  4BCM B;  2PHG A;  3DDP B;  3QHW B;  4JX4 A;  4F7J B;  4KRC B;  3G33 B;  5CEI B;  4M6V A;  3X25 B;  5LQF B;  4BCH B;  5DQV A;  2WJ9 A;  1KXU A;  3QZ9 B;  2IN3 A;  2C5X B;  5BNJ B;  1H25 B;  2DME A;  4HNV A;  2W2H A;  5ACB A;  2CYZ B;  4CFM B;  1UNL D;  5DQW A;  2F2C A;  1BU2 A;  4EC9 B;  2BPM B;  4EOP B;  1UGP B;  2WIP B;  4BCN D;  2LW4 A;  2UZD B;  5HBJ B;  4BCQ D;  4Y72 B;  1ZP2 A;  4CFU D;  1AIS B;  2KR6 A;  2W9Z A;  3BG3 A;  1P5E B;  3QZ5 B;  4CRL B;  1VIN A;  4MFD A;  4EON B;  4ROE A;  1H4L D;  3TNH B;  2UZE B;  3QYG B;  2C5V B;  1D3U B;  4Z6Y A;  2BKZ B;  5HBH B;  2UUE B;  2C4G B;  4II5 B;  3M03 A;  4F6W B;  4ROC A;  4FM4 B;  4NST B;  4BBR M;  2DXB B;  1H1Q B;  1ENW A;  1OL1 B;  5ICP B;  1H27 B;  2BS2 A;  1H1P B;  3NDQ A;  4AI6 A;  4F6S B;  2CZ1 B;  2W96 A;  1JSU B;  2ZPG B;  3MY1 B;  2PJQ A;  2WMB B;  1PKD B;  4G6L B;  4EOS B;  3BLH B;  4ZGE B;  1H28 B;  3TNI B;  4OB2 B;  2B9R A;  1JST B;  2UZL B;  5CYI B;  1XO2 A;  2CCI B;  1OKW B;  5L2W B;  3HB9 A;  2ZPF B;  3TW7 A;  4BCP B;  3BLQ B;  4BBS M;  1W98 B;  4IMY B;  3VKH A;  4YC3 B;  2WXV B;  2C5O B;  3A8G B;  1JKW A;  4CXA B;  1VYW B;  4EC8 B;  3VYG B;  1O9K A;  1GUX A;  4AKG A;  2D0Q B;  2W99 A;  1OI9 B;  2DPP B;  1N4M A;  1TD6 A;  4F7S B;  2JGZ B;  1F5Q B;  5HVY B;  2ZZD B;  1O9K B;  1GUX B;  3X28 B;  5IF1 B;  3HBL A;  4HNU A;  2WHB B;  1OGU B;  4CFX B;  2DXC B;  3HO8 A;  3DOG B;  2UZB B;  5FGK B;  3X26 B;  2BS4 A;  3A8H B;  1V29 B;  5EJC A;  3DTO A;  4NC6 A;  4EOJ B;  4EOO B;  4ELL A;  2X1N B;  1G3N C;  4OB1 B;  4ZGD B;  1FVV B;  3BHT B;  2PK2 A;  1OKV B;  1GY3 B;  3KHI A;  1AD6 A;  4HLQ A;  2PK9 B;  4CFN B;  3B57 A;  2IW9 B;  4F7N B;  1QMZ B;  2IVX A;  2W9F A;  1QLB A;  2CZ7 B;  3MY5 B;  5IDP B;  3VKG A;  1JOW A;  2G9X B;  1E7P A;  4YOO A;  2PMI B;  4EOM B;  1OIY B;  2G77 A;  4BCK B;  4YOZ A;  4BCM D;  1AHJ B;  5HBE B;  1H1S B;  4CFV B;  3X20 B;  5IHY A;  3DJB A;  2EUF A;  4BCN B;  5HNB B;  2C5N B;  1H24 B;  4OR5 B;  4BCQ B;  1UNG D;  2CZ6 B;  3BG9 A;  4CFU B;  4UN0 A;  3RGF B;  2QF7 A;  4BXX X;  3TW6 A;  4FX3 B;  3POM A;  4CFW B;  1UGS B;  3QWL A;  4EOL B;  4HL4 A;  2ZPH B;  2QDJ A;  4MIM A;  2ZPE B;  3WVD B;  4F7L B;  4BY1 X;  2AHJ B;  1UGR B;  1URC B;  3EJ1 B;  3QYB A;  3DL1 A;  3HHT B;  3O0G D;  3X24 B;  4HNT A;  4BY7 X;  4I3Z B;  3MIA B;  2DD4 B;  1H26 B;  2QQ8 A;  1UGQ B;  2QDY B;  4BCI B;  1OIU B;  4QSH A;  2WPA B;  1E9H B;  3A8O B;  5EFQ B;  2CJM B;  3VYH B;  5I5Z B;  5HQ0 B;  4BCO B;  3K7A M;  5LMK B;  1GH6 B;  3BHV B;  4LOC A;  2WEV B;  2CZ0 B;  2WIH B;  3DDQ B;  1IRE B;  2QFZ A;  4AKI A;  1H1R B;  2BS3 A;  3QYH B;  4EOR B;  4BCJ B;  3EID B;  3BHU B;  2I40 B;  2ZPI B;  4TTH A;  3GTM S;  4JX6 A;  2CCH B;  4OB0 B;  2WFY B;  2WMA B;  2IW6 B;  4AKH A;  3F5X B;  3QYE A;  3TNW B;  2I53 A;  3LQ5 B;  3A8M B;  4MFE A;  3TN8 B;  1UNH D;  3BLR B;  4JX5 A;  3A8L B;  4F6U B;  3HZJ A;  4ROD A;  5IDN B;  3MI9 B;  4YOS A;  4EOK B;  2DD5 B;  2ZCF B;  4OB3 B;  1C9B A;  3BG5 A;  4F70 B;  3PO3 S;  2KMG A;  3QXE B;  4EOI B;  3QHR B;  1VOL A;  2R7G A;  1OL2 B;  2ZPB B;  4ELJ A;  1FKM A;  4EOQ B;  2C6T B;  4KRD B;  3H4C A;  2QGS A;  2V22 B;  4OGR B;  2IW8 B;  1TFB A;  4BCF B; 
#chains in the Genus database with same CATH homology
 3K7A M;  4F7N B;  5LMK B;  3MY1 B;  1QMZ B;  2IVX A;  2W9F A;  2WMB B;  1FIN B;  4BCG B;  1GH6 B;  1PKD B;  3BHV B;  3EOC B;  4BCM B;  2WEV B;  3MY5 B;  5IDP B;  2PHG A;  4G6L B;  2WIH B;  3DDQ B;  3DDP B;  4EOS B;  3BLH B;  3QHW B;  1H28 B;  1JOW A;  3TNI B;  4F7J B;  2G9X B;  1H1R B;  2B9R A;  1JST B;  2UZL B;  4KRC B;  3G33 B;  5CYI B;  4EOR B;  5CEI B;  1XO2 A;  2CCI B;  4BCJ B;  1OKW B;  3EID B;  4YOO A;  5L2W B;  5LQF B;  4BCP B;  4BCH B;  2PMI B;  3BHU B;  3BLQ B;  2I40 B;  4EOM B;  1OIY B;  4TTH A;  1W98 B;  4IMY B;  2CCH B;  4BCK B;  4YC3 B;  4YOZ A;  4BCM D;  1KXU A;  5HBE B;  2WFY B;  1H1S B;  2WXV B;  2WMA B;  2IW6 B;  2C5O B;  4CFV B;  2C5X B;  3F5X B;  1JKW A;  2EUF A;  4CXA B;  4BCN B;  5BNJ B;  1VYW B;  5HNB B;  1H25 B;  2C5N B;  1H24 B;  4OR5 B;  4EC8 B;  2W2H A;  5ACB A;  3TNW B;  4BCQ B;  2I53 A;  1O9K A;  1UNG D;  1GUX A;  3LQ5 B;  4CFM B;  2W99 A;  1UNL D;  1OI9 B;  4CFU B;  1N4M A;  4UN0 A;  3RGF B;  3TN8 B;  1UNH D;  2F2C A;  4F7S B;  3BLR B;  1BU2 A;  2JGZ B;  4FX3 B;  3POM A;  4EC9 B;  1F5Q B;  5HVY B;  2BPM B;  4EOP B;  4CFW B;  4F6U B;  4EOL B;  1O9K B;  2WIP B;  1GUX B;  2QDJ A;  4BCN D;  4ROD A;  5IDN B;  3MI9 B;  5IF1 B;  2UZD B;  4YOS A;  5HBJ B;  4EOK B;  4BCQ D;  4Y72 B;  2WHB B;  4F7L B;  1ZP2 A;  1URC B;  3EJ1 B;  1OGU B;  4CFU D;  4CFX B;  1C9B A;  1AIS B;  3DOG B;  2UZB B;  2W9Z A;  3O0G D;  5FGK B;  1P5E B;  4CRL B;  1VIN A;  4F70 B;  4EON B;  4EOI B;  4I3Z B;  4ROE A;  1H4L D;  3TNH B;  3MIA B;  2UZE B;  4EOJ B;  3QHR B;  2C5V B;  1D3U B;  4EOO B;  1H26 B;  4ELL A;  2BKZ B;  2X1N B;  1VOL A;  1G3N C;  2R7G A;  5HBH B;  1OL2 B;  2UUE B;  2C4G B;  4II5 B;  4ELJ A;  3M03 A;  4BCI B;  1OIU B;  4F6W B;  2WPA B;  1E9H B;  4ROC A;  2C6T B;  4EOQ B;  1FVV B;  4NST B;  5EFQ B;  2CJM B;  1JSU B;  3H4C A;  4KRD B;  1H1Q B;  3BHT B;  1OL1 B;  5I5Z B;  5ICP B;  2PK2 A;  1H27 B;  5HQ0 B;  1H1P B;  1OKV B;  4BCO B;  1GY3 B;  2V22 B;  4OGR B;  2IW8 B;  1AD6 A;  1TFB A;  4F6S B;  2PK9 B;  4BCF B;  4CFN B;  2W96 A;  2IW9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...