1KXUA

Cyclin h, a positive regulatory subunit of cdk activating kinase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
276
structure length
276
Chain Sequence
WTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Regulatory protein
molecule keywords CYCLIN H
publication title Three-dimensional structure of human cyclin H, a positive regulator of the CDK-activating kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1996-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00134 Cyclin_N Cyclin, N-terminal domain
A PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1kxuA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1kxuA01
5ICPB 1OIYB 4KRCB 2W96A 4F6UB 1D3UB 3RGFB 4F6WB 1AISB 4EOJB 4EOPB 1FVVB 4CFNB 5CYIB 4EOLB 1O9KA 5HBEB 2F2CA 2G9XB 1VYWB 3MI9B 3EOCB 3EJ1B 3H4CA 4F7SB 2W2HA 1JKWA 1FINB 4F7NB 2C6TB 2IVXA 3TNWB 4NSTB 4F6SB 1ZP2A 4ROCA 4BCMB 2PK2A 3BLQB 2WEVB 4BCOB 4I3ZB 4BCHB 3BLRB 1GUXA 2UUEB 1GY3B 2W99A 5EFQB 4TTHA 4IMYB 4G6LB 1H27B 4EOSB 1PKDB 2C5XB 1C9BA 1JSUB 1H26B 2C5VB 2WIPB 2WMBB 3K7AM 2R7GA 4EC9B 1GH6B 1N4MA 4YOZA 4YOOA 4EONB 1O9KB 4BCND 2WIHB 2C4GB 5I5ZB 2I40B 1UNHD 2PHGA 5HQ0B 4CXAB 1KXUA 1UNGD 4EC8B 5IDNB 2UZLB 2UZDB 3MIAB 5HVYB 4II5B 2C5OB 2PMIB 1E9HB 3TNHB 1TFBA 3DDQB 1H1PB 4UN0A 4RODA 1P5EB 4BCGB 1OGUB 1GUXB 1OKWB 2IW9B 2V22B 4EOIB 1URCB 5ACBA 4BCFB 4BCKB 4BCIB 1JSTB 2IW6B 4Y72B 2EUFA 2WHBB 1H25B 1VOLA 2W9FA 3BHVB 5LQFB 4CFXB 2QDJA 2I53A 1H4LD 4EOOB 5HNBB 3TN8B 4F7LB 1VINA 2B9RA 5IF1B 4BCJB 2CJMB 4YOSA 1F5QB 2JGZB 3BLHB 4BCQD 1W98B 1H1QB 5HBJB 1H1RB 1XO2A 4OGRB 1JOWA 4BCPB 4EORB 1H24B 2W9ZA 4ROEA 3BHUB 4EOMB 2WPAB 5BNJB 3LQ5B 1OIUB 3QHWB 4CFUD 2WXVB 3MY5B 4OR5B 1OKVB 4CFMB 4YC3B 1OL1B 2CCHB 2UZEB 4EOQB 2CCIB 5IDPB 1BU2A 1QMZB 2IW8B 3F5XB 3POMA 5L2WB 2X1NB 4EOKB 1OI9B 3O0GD 4KRDB 2UZBB 4ELLA 1G3NC 4CFWB 4BCNB 1AD6A 1OL2B 5FGKB 3QHRB 2BPMB 4F7JB 4FX3B 3BHTB 3MY1B 4BCQB 3TNIB 1H1SB 2WFYB 3G33B 4BCMD 3DDPB 5CEIB 4CRLB 3DOGB 3EIDB 5LMKB 2WMAB 1H28B 4F70B 3M03A 4ELJA 4CFUB 5HBHB 2C5NB 1UNLD 2BKZB 4CFVB 2PK9B
chains in the Genus database with same CATH superfamily
4F6UB 3RGFB 4MIMA 4EOLB 2IN3A 2ZPBB 3MI9B 4JX4A 2BS2A 2W2HA 2IVXA 3TNWB 4ROCA 4BCMB 4BCOB 2WEVB 2CYZB 4BCHB 3BLRB 4LOCA 1GY3B 4HLQA 1C9BA 1PKDB 4Z6YA 2WMBB 2R7GA 1GH6B 4YOZA 4BXXX 1O9KB 4BBSM 2C4GB 5I5ZB 1UNHD 4CXAB 1UNGD 1E9HB 3TNHB 4RODA 2V22B 4ZGJB 4BCIB 2IW6B 1E7PA 3BHVB 4OB0B 4CFXB 3TN8B 4F7LB 2B9RA 5IF1B 4YOSA 4AI6A 1H1QB 2AHJB 5HBJB 1H1RB 3BHUB 3LQ5B 4CFMB 4EOQB 2ZPFB 2CCIB 5IDPB 3O0GD 5DQWA 5FGKB 3QHRB 2ZPEB 3BHTB 3MY1B 4BCQB 3TNIB 3G33B 2WFYB 4BCMD 3DDPB 3DOGB 1H28B 1TD6A 2W96A 3DTOA 1ENWA 2BS4A 4EOJB 3A8OB 1FVVB 4F7NB 4MFEA 4NSTB 3BLQB 4JX5A 2UUEB 4TTHA 1H27B 3HO8A 5EJCA 3QYHB 4OB3B 2I40B 2PHGA 4HL4A 5HQ0B 3QYBA 3DL1A 3MIAB 1TFBA 3DDQB 1AHJB 3QYGB 2QDYB 1GUXB 1OKWB 3A8GB 5ACBA 4BCKB 2EUFA 4ZGEB 2CZ0B 4HNUA 5HNBB 1UGSB 3TW7A 4BCQD 4HNVA 1W98B 1JOWA 4EORB 3B57A 2CZ7B 2DD5B 2WPAB 5BNJB 4OR5B 1OKVB 4YC3B 1OL1B 1UGPB 1BU2A 3QZ9B 5L2WB 2X1NB 1OI9B 2UZBB 4ELLA 3GTMS 1OL2B 4F7JB 4FX3B 3HBLA 1H1SB 4QSHA 4CRLB 2ZPIB 3EIDB 2WMAB 4M6VA 1FKMA 2ZZDB 4CFUB 2BKZB 3HB9A 4BBRM 1D3UB 4EOPB 4CFNB 1O9KA 2DXBB 5HBEB 2F2CA 4MFDA 3EOCB 4F7SB 2C6TB 3DJBA 2PK2A 4I3ZB 2PJQA 2W99A 4IMYB 4G6LB 4EOSB 4AKGA 1JSUB 1H26B 2C5VB 3K7AM 4EC9B 4YOOA 1N4MA 4EONB 2WIHB 1KXUA 5HVYB 5IDNB 2UZLB 2QFZA 4HNTA 2PMIB 1UGRB 3WVEB 3QXEB 1H1PB 3X25B 2IW9B 4EOIB 1URCB 4BCFB 2ZPHB 4Y72B 1H25B 1VOLA 2W9FA 5LQFB 1UGQB 2I53A 1H4LD 4EOOB 2CJMB 1F5QB 3BLHB 3VYHB 3QZ5B 1H24B 2W9ZA 2KR6A 4NC6A 4CFUD 2WXVB 3A8MB 2D0QB 2CCHB 2QF7A 2ZPGB 2IW8B 2DPPB 3F5XB 4EOKB 4KRDB 4CFWB 4JX6A 3TW6A 3WVDB 2LW4A 4FM4B 3BG3A 2G77A 4F70B 3M03A 4ELJA 5HBHB 2C5NB 3QWLA 1UNLD 3X28B 3A8HB 5ICPB 1OIYB 4KRCB 5DQVA 4BY1X 4F6WB 1AISB 3X20B 5CYIB 2WJ9A 2G9XB 1VYWB 2DXCB 3EJ1B 3H4CA 3HHTB 1JKWA 1FINB 2CZ1B 3QYEA 3PO3S 3X24B 4F6SB 1ZP2A 2CZ6B 3VKGA 3BG5A 1GUXA 5EFQB 1V29B 2DMEA 4OB2B 2C5XB 2WIPB 4BCND 3KHIA 4EC8B 2UZDB 2BS3A 4II5B 2C5OB 2KMGA 4UN0A 3BG9A 1P5EB 4BCGB 1OGUB 2ZCFB 1JSTB 2WHBB 4BY7X 5IHYA 3HZJA 2QDJA 4OB1B 4AKHA 1VINA 1QLBA 4BCJB 2JGZB 1XO2A 4OGRB 4BCPB 4ROEA 4EOMB 4ZGDB 4AKIA 1OIUB 3QHWB 1IREB 3MY5B 2UZEB 2QGSA 1QMZB 3POMA 2QQ8A 1G3NC 4BCNB 1AD6A 3NDQA 2BPMB 5CEIB 3A8LB 3VKHA 5LMKB 2DD4B 3VYGB 3X26B 4CFVB 2PK9B
chains in the Genus database with same CATH topology
5ICPB 1OIYB 4KRCB 2W96A 4F6UB 1D3UB 3RGFB 4F6WB 1AISB 4EOJB 4EOPB 1FVVB 4CFNB 5CYIB 4EOLB 1O9KA 5HBEB 2F2CA 2G9XB 1VYWB 3MI9B 3EOCB 3EJ1B 3H4CA 4F7SB 2W2HA 1JKWA 1FINB 4F7NB 2C6TB 2IVXA 3TNWB 4NSTB 4F6SB 1ZP2A 4ROCA 4BCMB 2PK2A 3BLQB 2WEVB 4BCOB 4I3ZB 4BCHB 3BLRB 1GUXA 2UUEB 1GY3B 2W99A 5EFQB 4TTHA 4IMYB 4G6LB 1H27B 4EOSB 1PKDB 2C5XB 1C9BA 1JSUB 1H26B 2C5VB 2WIPB 2WMBB 3K7AM 2R7GA 4EC9B 1GH6B 1N4MA 4YOZA 4YOOA 4EONB 1O9KB 4BCND 2WIHB 2C4GB 5I5ZB 2I40B 1UNHD 2PHGA 5HQ0B 4CXAB 1KXUA 1UNGD 4EC8B 5IDNB 2UZLB 2UZDB 3MIAB 5HVYB 4II5B 2C5OB 2PMIB 1E9HB 3TNHB 1TFBA 3DDQB 1H1PB 4UN0A 4RODA 1P5EB 4BCGB 1OGUB 1GUXB 1OKWB 2IW9B 2V22B 4EOIB 1URCB 5ACBA 4BCFB 4BCKB 4BCIB 1JSTB 2IW6B 4Y72B 2EUFA 2WHBB 1H25B 1VOLA 2W9FA 3BHVB 5LQFB 4CFXB 2QDJA 2I53A 1H4LD 4EOOB 5HNBB 3TN8B 4F7LB 1VINA 2B9RA 5IF1B 4BCJB 2CJMB 4YOSA 1F5QB 2JGZB 3BLHB 4BCQD 1W98B 1H1QB 5HBJB 1H1RB 1XO2A 4OGRB 1JOWA 4BCPB 4EORB 1H24B 2W9ZA 4ROEA 3BHUB 4EOMB 2WPAB 5BNJB 3LQ5B 1OIUB 3QHWB 4CFUD 2WXVB 3MY5B 4OR5B 1OKVB 4CFMB 4YC3B 1OL1B 2CCHB 2UZEB 4EOQB 2CCIB 5IDPB 1BU2A 1QMZB 2IW8B 3F5XB 3POMA 5L2WB 2X1NB 4EOKB 1OI9B 3O0GD 4KRDB 2UZBB 4ELLA 1G3NC 4CFWB 4BCNB 1AD6A 1OL2B 5FGKB 3QHRB 2BPMB 4F7JB 4FX3B 3BHTB 3MY1B 4BCQB 3TNIB 1H1SB 2WFYB 3G33B 4BCMD 3DDPB 5CEIB 4CRLB 3DOGB 3EIDB 5LMKB 2WMAB 1H28B 4F70B 3M03A 4ELJA 4CFUB 5HBHB 2C5NB 1UNLD 2BKZB 4CFVB 2PK9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICP B;  1OIY B;  4KRC B;  2W96 A;  4F6U B;  1D3U B;  3RGF B;  4F6W B;  1AIS B;  4EOJ B;  4EOP B;  1FVV B;  4CFN B;  5CYI B;  4EOL B;  1O9K A;  5HBE B;  2F2C A;  2G9X B;  1VYW B;  3MI9 B;  3EOC B;  3EJ1 B;  3H4C A;  4F7S B;  2W2H A;  1JKW A;  1FIN B;  4F7N B;  2C6T B;  2IVX A;  3TNW B;  4NST B;  4F6S B;  1ZP2 A;  4ROC A;  4BCM B;  2PK2 A;  3BLQ B;  2WEV B;  4BCO B;  4I3Z B;  4BCH B;  3BLR B;  1GUX A;  2UUE B;  1GY3 B;  2W99 A;  5EFQ B;  4TTH A;  4IMY B;  4G6L B;  1H27 B;  4EOS B;  1PKD B;  2C5X B;  1C9B A;  1JSU B;  1H26 B;  2C5V B;  2WIP B;  2WMB B;  3K7A M;  2R7G A;  4EC9 B;  1GH6 B;  1N4M A;  4YOZ A;  4YOO A;  4EON B;  1O9K B;  4BCN D;  2WIH B;  2C4G B;  5I5Z B;  2I40 B;  1UNH D;  2PHG A;  5HQ0 B;  4CXA B;  1KXU A;  1UNG D;  4EC8 B;  5IDN B;  2UZL B;  2UZD B;  3MIA B;  5HVY B;  4II5 B;  2C5O B;  2PMI B;  1E9H B;  3TNH B;  1TFB A;  3DDQ B;  1H1P B;  4UN0 A;  4ROD A;  1P5E B;  4BCG B;  1OGU B;  1GUX B;  1OKW B;  2IW9 B;  2V22 B;  4EOI B;  1URC B;  5ACB A;  4BCF B;  4BCK B;  4BCI B;  1JST B;  2IW6 B;  4Y72 B;  2EUF A;  2WHB B;  1H25 B;  1VOL A;  2W9F A;  3BHV B;  5LQF B;  4CFX B;  2QDJ A;  2I53 A;  1H4L D;  4EOO B;  5HNB B;  3TN8 B;  4F7L B;  1VIN A;  2B9R A;  5IF1 B;  4BCJ B;  2CJM B;  4YOS A;  1F5Q B;  2JGZ B;  3BLH B;  4BCQ D;  1W98 B;  1H1Q B;  5HBJ B;  1H1R B;  1XO2 A;  4OGR B;  1JOW A;  4BCP B;  4EOR B;  1H24 B;  2W9Z A;  4ROE A;  3BHU B;  4EOM B;  2WPA B;  5BNJ B;  3LQ5 B;  1OIU B;  3QHW B;  4CFU D;  2WXV B;  3MY5 B;  4OR5 B;  1OKV B;  4CFM B;  4YC3 B;  1OL1 B;  2CCH B;  2UZE B;  4EOQ B;  2CCI B;  5IDP B;  1BU2 A;  1QMZ B;  2IW8 B;  3F5X B;  3POM A;  5L2W B;  2X1N B;  4EOK B;  1OI9 B;  3O0G D;  4KRD B;  2UZB B;  4ELL A;  1G3N C;  4CFW B;  4BCN B;  1AD6 A;  1OL2 B;  5FGK B;  3QHR B;  2BPM B;  4F7J B;  4FX3 B;  3BHT B;  3MY1 B;  4BCQ B;  3TNI B;  1H1S B;  2WFY B;  3G33 B;  4BCM D;  3DDP B;  5CEI B;  4CRL B;  3DOG B;  3EID B;  5LMK B;  2WMA B;  1H28 B;  4F70 B;  3M03 A;  4ELJ A;  4CFU B;  5HBH B;  2C5N B;  1UNL D;  2BKZ B;  4CFV B;  2PK9 B; 
#chains in the Genus database with same CATH topology
 4F6U B;  3RGF B;  4MIM A;  4EOL B;  2IN3 A;  2ZPB B;  3MI9 B;  4JX4 A;  2BS2 A;  2W2H A;  2IVX A;  3TNW B;  4ROC A;  4BCM B;  4BCO B;  2WEV B;  2CYZ B;  4BCH B;  3BLR B;  4LOC A;  1GY3 B;  4HLQ A;  1C9B A;  1PKD B;  4Z6Y A;  2WMB B;  2R7G A;  1GH6 B;  4YOZ A;  4BXX X;  1O9K B;  4BBS M;  2C4G B;  5I5Z B;  1UNH D;  4CXA B;  1UNG D;  1E9H B;  3TNH B;  4ROD A;  2V22 B;  4ZGJ B;  4BCI B;  2IW6 B;  1E7P A;  3BHV B;  4OB0 B;  4CFX B;  3TN8 B;  4F7L B;  2B9R A;  5IF1 B;  4YOS A;  4AI6 A;  1H1Q B;  2AHJ B;  5HBJ B;  1H1R B;  3BHU B;  3LQ5 B;  4CFM B;  4EOQ B;  2ZPF B;  2CCI B;  5IDP B;  3O0G D;  5DQW A;  5FGK B;  3QHR B;  2ZPE B;  3BHT B;  3MY1 B;  4BCQ B;  3TNI B;  3G33 B;  2WFY B;  4BCM D;  3DDP B;  3DOG B;  1H28 B;  1TD6 A;  2W96 A;  3DTO A;  1ENW A;  2BS4 A;  4EOJ B;  3A8O B;  1FVV B;  4F7N B;  4MFE A;  4NST B;  3BLQ B;  4JX5 A;  2UUE B;  4TTH A;  1H27 B;  3HO8 A;  5EJC A;  3QYH B;  4OB3 B;  2I40 B;  2PHG A;  4HL4 A;  5HQ0 B;  3QYB A;  3DL1 A;  3MIA B;  1TFB A;  3DDQ B;  1AHJ B;  3QYG B;  2QDY B;  1GUX B;  1OKW B;  3A8G B;  5ACB A;  4BCK B;  2EUF A;  4ZGE B;  2CZ0 B;  4HNU A;  5HNB B;  1UGS B;  3TW7 A;  4BCQ D;  4HNV A;  1W98 B;  1JOW A;  4EOR B;  3B57 A;  2CZ7 B;  2DD5 B;  2WPA B;  5BNJ B;  4OR5 B;  1OKV B;  4YC3 B;  1OL1 B;  1UGP B;  1BU2 A;  3QZ9 B;  5L2W B;  2X1N B;  1OI9 B;  2UZB B;  4ELL A;  3GTM S;  1OL2 B;  4F7J B;  4FX3 B;  3HBL A;  1H1S B;  4QSH A;  4CRL B;  2ZPI B;  3EID B;  2WMA B;  4M6V A;  1FKM A;  2ZZD B;  4CFU B;  2BKZ B;  3HB9 A;  4BBR M;  1D3U B;  4EOP B;  4CFN B;  1O9K A;  2DXB B;  5HBE B;  2F2C A;  4MFD A;  3EOC B;  4F7S B;  2C6T B;  3DJB A;  2PK2 A;  4I3Z B;  2PJQ A;  2W99 A;  4IMY B;  4G6L B;  4EOS B;  4AKG A;  1JSU B;  1H26 B;  2C5V B;  3K7A M;  4EC9 B;  4YOO A;  1N4M A;  4EON B;  2WIH B;  1KXU A;  5HVY B;  5IDN B;  2UZL B;  2QFZ A;  4HNT A;  2PMI B;  1UGR B;  3WVE B;  3QXE B;  1H1P B;  3X25 B;  2IW9 B;  4EOI B;  1URC B;  4BCF B;  2ZPH B;  4Y72 B;  1H25 B;  1VOL A;  2W9F A;  5LQF B;  1UGQ B;  2I53 A;  1H4L D;  4EOO B;  2CJM B;  1F5Q B;  3BLH B;  3VYH B;  3QZ5 B;  1H24 B;  2W9Z A;  2KR6 A;  4NC6 A;  4CFU D;  2WXV B;  3A8M B;  2D0Q B;  2CCH B;  2QF7 A;  2ZPG B;  2IW8 B;  2DPP B;  3F5X B;  4EOK B;  4KRD B;  4CFW B;  4JX6 A;  3TW6 A;  3WVD B;  2LW4 A;  4FM4 B;  3BG3 A;  2G77 A;  4F70 B;  3M03 A;  4ELJ A;  5HBH B;  2C5N B;  3QWL A;  1UNL D;  3X28 B;  3A8H B;  5ICP B;  1OIY B;  4KRC B;  5DQV A;  4BY1 X;  4F6W B;  1AIS B;  3X20 B;  5CYI B;  2WJ9 A;  2G9X B;  1VYW B;  2DXC B;  3EJ1 B;  3H4C A;  3HHT B;  1JKW A;  1FIN B;  2CZ1 B;  3QYE A;  3PO3 S;  3X24 B;  4F6S B;  1ZP2 A;  2CZ6 B;  3VKG A;  3BG5 A;  1GUX A;  5EFQ B;  1V29 B;  2DME A;  4OB2 B;  2C5X B;  2WIP B;  4BCN D;  3KHI A;  4EC8 B;  2UZD B;  2BS3 A;  4II5 B;  2C5O B;  2KMG A;  4UN0 A;  3BG9 A;  1P5E B;  4BCG B;  1OGU B;  2ZCF B;  1JST B;  2WHB B;  4BY7 X;  5IHY A;  3HZJ A;  2QDJ A;  4OB1 B;  4AKH A;  1VIN A;  1QLB A;  4BCJ B;  2JGZ B;  1XO2 A;  4OGR B;  4BCP B;  4ROE A;  4EOM B;  4ZGD B;  4AKI A;  1OIU B;  3QHW B;  1IRE B;  3MY5 B;  2UZE B;  2QGS A;  1QMZ B;  3POM A;  2QQ8 A;  1G3N C;  4BCN B;  1AD6 A;  3NDQ A;  2BPM B;  5CEI B;  3A8L B;  3VKH A;  5LMK B;  2DD4 B;  3VYG B;  3X26 B;  4CFV B;  2PK9 B; 
#chains in the Genus database with same CATH homology
 5ICP B;  1OIY B;  4KRC B;  2W96 A;  4F6U B;  1D3U B;  3RGF B;  4F6W B;  1AIS B;  4EOJ B;  4EOP B;  1FVV B;  4CFN B;  5CYI B;  4EOL B;  1O9K A;  5HBE B;  2F2C A;  2G9X B;  1VYW B;  3MI9 B;  3EOC B;  3EJ1 B;  3H4C A;  4F7S B;  2W2H A;  1JKW A;  1FIN B;  4F7N B;  2C6T B;  2IVX A;  3TNW B;  4NST B;  4F6S B;  1ZP2 A;  4ROC A;  4BCM B;  2PK2 A;  3BLQ B;  2WEV B;  4BCO B;  4I3Z B;  4BCH B;  3BLR B;  1GUX A;  2UUE B;  1GY3 B;  2W99 A;  5EFQ B;  4TTH A;  4IMY B;  4G6L B;  1H27 B;  4EOS B;  1PKD B;  2C5X B;  1C9B A;  1JSU B;  1H26 B;  2C5V B;  2WIP B;  2WMB B;  3K7A M;  2R7G A;  4EC9 B;  1GH6 B;  1N4M A;  4YOZ A;  4YOO A;  4EON B;  1O9K B;  4BCN D;  2WIH B;  2C4G B;  5I5Z B;  2I40 B;  1UNH D;  2PHG A;  5HQ0 B;  4CXA B;  1KXU A;  1UNG D;  4EC8 B;  5IDN B;  2UZL B;  2UZD B;  3MIA B;  5HVY B;  4II5 B;  2C5O B;  2PMI B;  1E9H B;  3TNH B;  1TFB A;  3DDQ B;  1H1P B;  4UN0 A;  4ROD A;  1P5E B;  4BCG B;  1OGU B;  1GUX B;  1OKW B;  2IW9 B;  2V22 B;  4EOI B;  1URC B;  5ACB A;  4BCF B;  4BCK B;  4BCI B;  1JST B;  2IW6 B;  4Y72 B;  2EUF A;  2WHB B;  1H25 B;  1VOL A;  2W9F A;  3BHV B;  5LQF B;  4CFX B;  2QDJ A;  2I53 A;  1H4L D;  4EOO B;  5HNB B;  3TN8 B;  4F7L B;  1VIN A;  2B9R A;  5IF1 B;  4BCJ B;  2CJM B;  4YOS A;  1F5Q B;  2JGZ B;  3BLH B;  4BCQ D;  1W98 B;  1H1Q B;  5HBJ B;  1H1R B;  1XO2 A;  4OGR B;  1JOW A;  4BCP B;  4EOR B;  1H24 B;  2W9Z A;  4ROE A;  3BHU B;  4EOM B;  2WPA B;  5BNJ B;  3LQ5 B;  1OIU B;  3QHW B;  4CFU D;  2WXV B;  3MY5 B;  4OR5 B;  1OKV B;  4CFM B;  4YC3 B;  1OL1 B;  2CCH B;  2UZE B;  4EOQ B;  2CCI B;  5IDP B;  1BU2 A;  1QMZ B;  2IW8 B;  3F5X B;  3POM A;  5L2W B;  2X1N B;  4EOK B;  1OI9 B;  3O0G D;  4KRD B;  2UZB B;  4ELL A;  1G3N C;  4CFW B;  4BCN B;  1AD6 A;  1OL2 B;  5FGK B;  3QHR B;  2BPM B;  4F7J B;  4FX3 B;  3BHT B;  3MY1 B;  4BCQ B;  3TNI B;  1H1S B;  2WFY B;  3G33 B;  4BCM D;  3DDP B;  5CEI B;  4CRL B;  3DOG B;  3EID B;  5LMK B;  2WMA B;  1H28 B;  4F70 B;  3M03 A;  4ELJ A;  4CFU B;  5HBH B;  2C5N B;  1UNL D;  2BKZ B;  4CFV B;  2PK9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...