3A8LB

Crystal structure of photo-activation state of nitrile hydratase mutant s113a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8lB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8lB02
5L8RE 4ZGEB 2PUOB 2ZPHB 3A8HB 2PVOB 3X26B 1AHJB 2DXCA 3VYGB 3X24B 2PU9B 4ZGDB 2DXBA 2ZPBB 2DD4A 3QZ9B 1UGSB 1UGRB 2DXCB 2CZ7B 2CZ6B 2DXBB 2DPPB 4OB3B 2D0QB 3A8GB 2CYZB 3WVDB 4OB1B 3X28B 2PUKB 2WSEE 2DD5A 2ZPFB 1QP2A 3VYHB 2O01E 4XK8E 1V29B 3X25B 2CZ0B 4FM4B 4OB2B 4OB0B 3A8OB 2WSFE 1PSFA 2ZPEB 4Y28E 3QYHB 2ZCFB 3A8LB 1GXIE 3QXEB 1UGQB 2AHJB 2PVGB 1QP3A 2DD5B 1UGPB 3QZ5B 3WVEB 2ZZDA 2PVDB 2DD4B 2CZ1B 3X20B 2WSCE 2QDYB 1DJ7B 1IREB 3HHTB 3QYGB 2ZPGB 4ZGJB 4L6V5 2ZZDB 1PSEA 4RKUE 3A8MB 2ZPIB 1JB0E 4KT0E 3VYGA 3LW5E
chains in the Genus database with same CATH superfamily
2LVMA 1Y96A 3AHUA 4BCPB 2G9XB 2KROA 4ZTJA 1M2VB 2JT4A 4PJJA 5GJWB 2PUOB 2Y90A 5GAOr 1M9SA 4N0AC 3CEYA 2E10A 6AT1B 4EOQB 3JRZA 2A08A 1KQ2A 2BS4A 2QFZA 1RAEB 1A0NB 1YHQQ 2XI9A 3DKMA 2CT4A 3OYLA 3NTHA 5CKHA 4OGEA 3G6EA 1JQQA 1OIUB 1K9MR 4BCJB 4F14A 2MWPA 1OKWB 1WX6A 2CZ6B 4M78C 2RQWA 3LGFA 1VQPA 2IPOB 1WNLA 2XMFA 2D0QB 4EOLB 2W99A 1X27A 1VINA 1I8FA 4CFUD 1WXBA 4XQ3A 4EOMB 3J81E 2FPEA 3OYAA 2GTOA 5C6SA 2RHZA 2LX7A 3QG1A 2V22B 2X35A 1JXMA 4V2SA 1WQ7A 3TNWB 3KHIA 2DL5A 3CCRQ 3VKHA 5L2WB 1LNXA 2ENMA 1PC0A 2K57A 2CDTA 3CD6Q 1HJDA 2M0OA 1Y96B 2LNVA 3E2UA 2FG0A 2AIRB 1CKAA 5HBHB 1BIBA 2MYSA 2K5LA 1NLPC 1K9MC 1QW1A 1YJ9A 2DFUA 2J7IA 2ZZDA 3I56Q 4LN2A 2RB6A 2HSPA 1H641 1Z9QA 1KIKA 4CXAB 2WSCE 1M90C 3CCLA 2LT1A 1Y0MA 2MPXC 1VQPQ 1YCYA 2WPAB 3JCMg 3CCEA 4DOWA 3VKIA 5FROA 5LJ3j 4RKUE 2VGNA 3KBGA 4E7KA 2K6DA 1IZ6A 2J6FA 2GNCA 3MJXA 1AWOA 2OX7A 2VASA 2XD0A 1K8AU 1BIAA 2DO3A 2O88A 2BZ8A 3SDZA 1R77A 4E7ZA 2VB6A 2D9TA 3GNGA 1ZUYA 4JJDA 3V8KA 2FPFA 1RAAB 2E65A 3CCQT 3TQ7P 3G4SQ 1M8VA 4C8QG 5GAN4 4CFWB 2O31A 2L3PA 4CC3A 1K73C 4WCIA 5D7UA 1IB8A 2CZ7B 3SWNC 5FRNA 3QIIA 1M30A 2P4TA 1ZUUA 3IQLA 3RKWA 4BDYA 1X75C 4J9DA 2C5NB 1VQLT 3CCVQ 1VQ6T 1CKBA 3EGDA 5IHYA 4EMHA 4LE9A 3S3OA 1H1RB 3QJYA 2VXFA 2HSEB 1I4K1 3P8HA 3G33B 4M7DC 1OYXA 1PHTA 1ZQ1A 4F7SB 4P5NA 4M77D 2KMTA 1YWPA 1KHCA 1PNJA 2DVEA 1M1KR 3CCUA 2KDSA 2QXFA 5CKDA 4OB0B 1SF9A 3A8OB 5KH6A 1OU8A 2FZCB 3CCVA 3WXMB 2YT6A 2JN0A 1NEGA 3TREA 4DBHA 1D3UB 3M56A 4D6WA 1VQPT 3A8LB 2DL4A 4HVWA 1N8RC 1UGQB 3OYFA 2QQ9A 1SHGA 1IGUA 1B07A 1IHWA 1UE9A 3UA6A 3EGUA 2O4XB 5IHNA 4ELZC 4F6WB 1VIEA 2YDLA 5EC7A 3O0GD 3QYGB 2ZPGB 2KRNA 4C5GA 1TUGB 1W6XA 4TTHA 2HKQB 3MPUB 3CPWA 1MV0B 2QA4Q 2CCIB 2C06A 2GBQA 1QVFS 4PL6A 1I5OB 3JCMV 1W98B 3E9FA 2JGZB 1TG0A 4OGRB 3EG2A 1VQ7T 5IN1A 4FYWB 3CCJQ 1VQ9T 3ER0A 3M4GA 1JKWA 2LRQA 4FYVB 1PM3A 2MF2A 2BKZB 2BZXA 2EYXA 3HB9A 1FKMA 1QWFA 4BE1A 2XKOC 3NGPA 2W2HA 3GNFB 5FU7B 2EPDA 1M1KC 4FT4A 1R0BG 2DXBB 2JM9A 2KY9A 2QA4A 1OGUB 4XU1A 4E7HA 3MEAA 4MMKA 2KRMA 4OB3B 2L3SA 5EJCA 4Z88A 5DY9A 5GAN7 2DNUA 1LPLA 2CH4W 4OF1A 2QQBA 3CCRA 2WSEE 2DD5A 3M55A 4MDXA 1VQ6Q 5LJ3d 1BI0A 3VYHB 4M78E 4XTXA 3B57A 4NL3A 1YJNQ 1WHHA 2DIQA 1YJWT 1FINB 1ZSZC 2L0AA 3I55T 1N4MA 3TSZA 4C92C 3VKGA 4FW1A 1KC8U 4OP0A 2EJGA 3KFVA 2KNBB 3M4YA 1XO2A 3M53A 2JM8A 2JXBA 4CRIA 4C92B 4F7UE 2QEXQ 4M75G 2HBWA 2I0NA 3DLLA 3EIDB 1WI7A 2GTJA 1VQ4Q 2COYA 1ABQA 1YCSB 1S72T 2LT4A 3M0SA 1D0ZA 2KEAA 2PNIA 4LUEA 1ZSZA 2PQWA 4FX3B 2EGAA 3ZL7C 5HVYB 1H25B 4ELLA 4X9DA 3QBYA 4BCOB 3VS5A 3JB9F 4EIKA 3EAEA 2B9RA 3MIAB 4JX4A 2W96A 2P4RA 1Q82U 1YWOA 2K4YA 2OTJQ 3CCSQ 2Z0WA 3TCJA 4IUUA 1OX8A 3MEUA 4BCFB 5GANf 1KHIA 1YJ9T 5CKFA 2I53A 4JJBA 1QVPA 1OV3A 1ZUKA 2RMOA 1UDLA 1YJNA 4J9BA 2DL7A 4BI3A 3EG9B 4XTZA 2EKHA 2QTXA 3H0HA 3J80E 1BU2A 3A8HB 3CXCP 5J3BA 4Q5WA 4EC8B 2JNGA 2QYZA 4CI0C 3C95A 3L2RA 3CPWP 2YRCA 1G5VA 3VYGB 1K0SA 4OMPA 2CKKA 1UECA 3OW2A 2RJCA 1FMVA 3M59A 4BE2A 3CD6T 2D8JA 3LGLA 2W10A 3HRTA 2H3EB 4YOOA 2LQ8A 4NS5A 5GMKi 5J39A 3MP6A 2EUFA 3H4CA 2YSQA 2HL5C 1SKUB 4Z02A 3V8LA 5LJ3h 5KYYA 2JUFA 4RTUA 3CCEQ 5KYUA 4E47A 3I55Q 1O75A 1ZBXA 1BYMA 2QGSA 3FJ5A 4AMCA 2GCXA 1YJ9Q 1VQ9A 4J7FA 4MZMA 2ZGWA 1M8MA 1GY3B 4WTOB 4FM4B 3DB4A 1WIEA 2DYIA 1W2BP 1BKBA 3I5RA 2JJ9A 1LJOA 3A98A 3JCMc 1PSFA 2OJ2A 4LDYA 3M54A 2RHXA 1AOJA 4QVDA 3ZEHA 1HD3A 4EONB 3OYBA 1X6GA 1H27B 4BCMB 2CSIA 2E64A 2A7YA 1AZGB 5GAN5 2L3RA 3OBYA 3THKA 3G6EQ 4JRQA 1ABOA 4OR5B 2YUNA 3QDRB 5CAIA 3JCMd 3HZJA 4KULA 3OS2A 3JB9I 1KD1C 2FVUA 1MNEA 2KYBA 2K79A 2ESWA 1WGSA 2GF7A 1M3BA 1I07A 3MY1B 3BY7A 4Y92A 2DX1A 2RH2A 1TS9A 4FSSA 5A0GA 3SWNB 5GAMf 2ZZDB 2KI7A 1QMZB 4M7DF 4MZTA 4KT0E 5GAMh 2KQWA 2IVWA 1QVGA 3PMIA 1NYFA 2DETA 3E9GA 3RGFB 5CK9A 3O8VA 3PNWC 1C9BA 4XTWA 1MMAA 2LTOA 4F7UA 1IO6A 2ZPHB 2IW8B 2OTLT 2V8KA 1YHQT 2QTVA 2XDBA 4C0DB 3OYEA 1TU0B 4Z8AA 3Q1JA 2FO0A 3FLGA 1H3ZA 1BCOA 2IW9B 2X4JA 4FYYB 1YFNA 3JCMX 4PJLA 1G3YA 4CFMB 4JPBW 3CXCA 2C0IA 4BACA 2DYBA 3CQTA 1H1PB 4CFXB 3CBMA 3DJBA 2DPPB 2COZA 4QQ6A 1H26B 2ED0A 2CYZB 4KRDB 4BBSM 3M0UA 1KG1A 2V1RA 1PKSA 4LDUA 2LJ1A 4AFZC 2CSQA 2F2WA 4ELJA 5AYFA 4RTZA 2O9SA 4R0KA 3OS1A 1YP5A 2R57A 5KCOA 3CBOA 3UATA 4PJOB 1G8XA 4ANJA 2DJQA 4A4HA 5KYNA 1RAHB 3P8DA 3CCRT 3X25B 2LQWA 3M03A 1FWZA 5LJ3f 1VQOT 1GFDA 1OI9B 2K9GA 3GBQA 1D0XA 4RG8A 1JOWA 1WXTA 2P84A 3FRNA 4HL4A 3CCQQ 1OZ2A 4HXJA 3EFOB 4M7AB 3EHQA 2L89A 2MI6A 2HEQA 1N9RA 2X9HA 3M0QA 4C92F 3HBLA 2RO0A 1I5LA 3HKSA 4HVUA 1H8KA 4ZTFA 1Q7YR 1SSFA 3OB9A 2DD4B 2BS2A 1RAGB 3EFOA 3R6OA 3UPUA 1BU1A 1NPRA 1FMWA 2YWWA 1LVKA 1N27A 1QKXA 3OW2S 1R0CB 3H8ZA 5LJ5f 2OTLQ 4OMLA 2L3QA 3EFRA 3OS0A 2PMIB 3CCUT 3V8JA 4JJNK 5L8RE 1OIYB 5IH2A 1TSFA 1KD1R 1MUZA 4M7DE 1CSKA 4BY7X 4PJNA 2IG0A 2W0ZA 4YOZA 3QWYA 5GAOn 4M7DG 2KR6A 3RERA 4F70B 4XAXB 5GAN2 2LMJA 2EVRA 5GANg 1PD0A 5GAMj 3M5AA 2EYWA 1ZSGA 2DL3A 1OL1B 2BE9B 4DQ2A 4JS5A 2H8HA 3H41A 5IT9E 1VQ5Q 4MFEA 1VIFA 1W70A 2RPNA 2EQKA 1YITA 2LCSA 3HO8A 4BDZA 5IDNB 2E70A 2NUPB 2JTFA 3VS6A 3CCST 2HKNA 4A4FA 2WIPB 4BCGB 2HL3A 5KE2A 5KE3A 3C12A 5HQ0B 1MMNA 4RTVA 2EAYA 2OTLA 5CQXA 2FHDA 1T3LA 2JS0A 3L2UA 2FRWA 2B8AA 4RTTA 4M7DB 3A5ZB 4OB2B 2DK3A 4M75B 3DL1A 2YHTA 3V7RA 3JAME 1Q86U 1JJ2P 2DERA 1JO8A 3AT1B 2OAWA 5DLOA 3ASKA 5CKEA 1AT1B 5GANd 1OULA 4KH0B 5GAOp 5I2MA 4GY5A 3UT1A 3EG0A 3KXTA 2WFYB 2RM4A 2AHJB 1PKDB 4J9CA 2LX9A 1PWTA 2PVDB 5CCAA 4NOYA 3MHXA 1P5EB 3BDLA 4PJOD 3GLXA 2KXCA 1D09B 4RTXA 3LH0A 2WXVB 3SB2A 2KYMA 4B9XA 4NC6A 3A8MB 3QWLA 3BG3A 1H1SB 3TNHB 2CREA 5CR2A 4HCCA 2WMAB 3TW6A 2LCLA 3GOXA 5GMKl 5LJ3g 1M1GA 1O9SA 4QKUA 3POMA 1X43A 2DXCA 1RACB 2UZEB 3VS0A 1W2BA 3CPWS 1WJQA 2EYZA 5ICPB 4RG2A 1ZX6A 2K7AA 5GANj 4Z6YA 5DLQE 4EPCA 1UGRB 1OKVB 2LZ6B 3UDCA 2LC4A 3C0CA 2MWOA 2G6FX 1IGQA 3LLRA 1GUXB 4DA4A 4M77C 2RF0A 4CC2A 1VQMA 1AZEA 4C5HA 4RODA 4C8QA 3M57A 3WVDB 1BBZA 1QMCA 2LJ0A 4B9WA 2EQUA 4C8QF 3I55A 3JV3A 3BG9A 5I5ZB 3EG9A 4BCHB 3DOGB 1QP2A 2K2VA 4JDSA 4YOSA 2JTMA 1BK2A 1QKWA 2E3HA 3MKDA 5IXFA 5J26A 2M9UA 3QKJA 5IHKA 2CP5A 1QVGP 4MDWA 3CC7Q 3MP8A 1W2BS 2ZPEB 2QQRA 2K5FA 5HBEB 3JB9H 2KR3A 3S6WA 4N0AA 1VOLA 2HBPA 1C1AA 1G3WA 5FU6B 2ZCFB 1YIJQ 5GAMd 1EIFA 2WJ9A 1Q95G 2X3XD 5GANe 1YI2Q 2E5KA 1X6BA 3OMGA 2OTJT 2AKKA 4L5GA 3OW2P 3HL8A 1K9MU 1PCXA 2RN8A 4BCMD 4ORZA 2SRCA 1K0XA 3HFNA 3CMET 2G77A 3L42A 5IHIA 4OMOA 1UNHD 5D6YA 3L2ZA 1JRIA 4PKCC 1VQ8T 1KQSA 3CC7T 2YUPA 1PRMC 1RLQC 2ABLA 1M4ZA 4II1A 4RTYA 1Q86C 4ROEA 2B86A 4IUVA 2P0KA 4VUBA 1YJWA 1RAIB 1WFWA 1U1SA 4UC4A 4GBQA 2Y4YA 2WMBB 4GLMA 1YNZA 4PJOG 3RNJA 2CP7A 1Q81U 2M51A 3TU4K 2RJEA 3OA6A 3H6ZA 4IUTA 5KYWA 2ED1A 3KUFA 2LQKA 2X51A 2E41A 2KRSA 4QQGA 2CUBA 4R55A 3V7SA 1RI0A 4OB1B 4KUIA 3T9NA 3CCJA 1Q82C 5GMKe 2F2CA 4II5B 4LXCA 2O01E 1QWEA 3JCMP 2C4GB 4M7AE 2HCKA 2XHCA 3NDQA 4M78D 1M1FA 4OMNA 5I22A 3J7AF 3REAB 2EWNA 2CT3A 1KSWA 2E6NA 3LYIA 3MI9B 3QHWB 1VYVA 3G71A 2WACA 2CCHB 4J5YA 4FU6A 2KXDA 1KC8R 1VYUA 2M0YA 1QVFP 4AKHA 2I40B 1RADB 4ME7A 4A63B 3N5BB 2RJFA 1UHCA 2DRKA 4M77G 2CP2A 3F70A 1YI2T 4DBQA 2F5TX 3I35A 3CBPA 2DVJA 2C0TA 3L2VA 5M9OA 5GJVB 3GTMS 1YN8A 4JUVA 4ROCA 3BDUA 4ELYC 5A0DA 2ROTA 2HZYA 1JB0E 1HSQA 4IUPA 2D1XA 3TEEA 4BCNB 4AKGA 2PK9B 4F04B 4C8QB 4M7DD 2DZCA 1BB9A 4IIMA 4KUDK 5IF1B 2WIHB 1TUDA 4ZGEB 5CIUA 3RDVA 2JMCA 2RQTA 4JZ3A 2RK1A 4KGXB 2L2PA 4N4GA 2PTKA 2K3XA 3X24B 1E6GA 1UNGD 2EJ9A 4CC4B 5A2QE 5A0LA 1TXQA 2P0QA 1Q86R 2EQJA 2YUQA 4EOKB 1E7OA 5CYIB 3RESA 1N8RU 3SWNA 3VV0A 2BZYA 2A3LA 4F7UF 1U1TA 2E4HA 4X1VA 2RJDA 1VYWB 1K4US 2M1HA 1B7TA 5I11A 4M77B 4DEYA 1TOVA 3CC7A 2HDAA 2DTIA 4PJOF 1H1QB 2FL7A 3RBBB 4RMOA 3META 1KQSS 2M16A 3RR6A 3ZFJA 2MAMA 2X1NB 4B6MA 1SPKA 1Q82R 3SEMA 2J06A 3REBB 3GF5A 4YC3B 4RCCA 2WSFE 1NLOC 1SHFA 3CMAQ 3HRSA 2PHGA 2KGTA 1X01A 4KRCB 1VQMQ 3K7AM 4Y28E 5DQVA 2D0NA 4YTLA 2NLUA 3TNIB 2E6ZA 3EGXB 1HXDA 4DOVA 5I2SA 1NJIU 1U3OA 2JW4A 4PJOE 1NJIC 1VQLQ 3VS2A 4M78A 1WYXA 3QYBA 4M75E 3VS7A 3CCSA 5IDPB 2RA2A 1VQ5T 2GFAA 1GH6B 3HHTB 2JMAA 1Y71A 2GQIA 3QUIA 1B34B 1VQKT 3OYGA 2UZBB 3BG5A 1MGQA 2DEUA 2FB7A 5GAOl 4EOOB 1JXOA 1M3CA 4M77F 3DDPB 3QHSA 2DMEA 1K8AC 1I1JA 2QDLA 1N9SA 3M9QA 2LJ3A 1Q7YU 3PMTA 5KYXB 4M7AG 4AFQC 2NUTB 3CMAT 3G71T 4HNUA 4F7NB 1OI1A 2KE9A 1J3TA 5FW9A 2R5AA 2FZGB 2CP0A 2PU9B 2EYYA 1AEYA 2XICA 3SHWA 4BB7A 1WLPB 1XNIA 3FC3A 4LD6A 3EG1A 3VUZA 4AI6A 1WHLA 2NUPA 2EIFA 3G4SA 1AD6A 3NTIA 2DL8A 3U23A 3NMZC 5D6XA 3VRYA 2XG8D 1GFCA 4QT7A 3X28B 1KJWA 2COWA 3FJPA 4QSHA 1TWBA 1B3QA 1OZ3A 2FEIA 2AK5A 4OMMA 3VU3C 2K3BA 4TVRA 5LJ5g 1D3BB 1WJSA 5ACBA 3RMQA 3OYKA 2DAQA 2JS2A 1G3TA 1IHVA 4A4EA 3MEWA 3G71Q 3CC4Q 1WPYA 4F7LB 3OMCA 4EOIB 1U06A 3OSVA 5HKCA 2E12A 1KQSP 3LQ5B 3JCMJ 1D3BA 3TVTA 3OQ5A 2J6KA 4EOPB 1MMGA 2BS3A 2D8HA 1QCOA 2X3WD 3I56A 2BPMB 1UEBA 3NHNA 4D8DA 4J9FA 2E5QA 4E7IA 1M1KU 2IVXA 1NBEB 3QJ6A 3RKYA 1VQMT 4J9IA 2V1QA 4JRPA 3RKXA 2DD5B 4QVCA 4BD3A 4OVAA 4PFZA 2LP5A 3F5XB 8AT1B 2DA9A 4BE0A 2DEQA 1MMDA 2KBTA 1Z9ZA 4M75D 5FRMA 1ZA2B 5LJ5j 4EORB 1E9HB 4BCND 3CC2T 3JCMW 1BCMA 3TSWA 3JB9G 3BE3A 2I2LA 1KC8C 1AISB 3RUXA 4BI8B 1EX4A 1GCQC 4RCBA 1YJWQ 5DM7R 2PVOB 2RQVA 1RI9A 1I81A 2GFUA 2ROLA 4ZN3A 4QW2A 1NZ9A 3M0RA 3HP9A 2VV5A 1IRXA 4X34A 2XU8A 4QQDA 4J8OA 4M6VA 2QQ8A 4IURA 2GGRA 5CKBA 3CCMA 1N8RR 5IAYA 2L8DA 3PIPA 3CCET 1GCQA 1XJWB 1VQKA 4C0FA 2NUZA 2DRMA 3VS1A 1SG5A 4BXXX 5LJ5h 8ATCB 4DBRA 4EMKA 3L2WA 4GLKA 5LJ5e 4EDUA 3GP8A 2YRDA 1VQ8A 4E7LA 1H24B 5FGKB 5LJ5d 4D8KA 1Q7YC 3GPLA 2HMAA 1PKTA 2JTEA 3VUBA 4EMKB 2EFIA 1VA7A 2CP6A 2LNHB 1VQ7Q 4EOJB 2EGEA 4XK8E 4A54A 2PK2A 1B34A 5CVIA 2CJMB 4FCYA 1ZBJA 1ZSZB 3OS5A 4QVZA 1GL5A 2OTJA 3EH1A 1NEBA 2EQIA 3LH5A 2X4XA 3ME9A 4C92D 1URCB 2A28A 2WHBB 4DEXA 2HQHA 3DLMA 3OSSC 2PVGB 1VQ6A 1UJ0A 1XTDA 3OYJA 2KVQG 4BCKB 4K11A 1OPKA 2EYQA 2BTTA 2E3IA 2DKGA 5GMKh 2RHIA 3OBWA 4M7AA 3SFMA 3INZA 3L2QA 1IREB 4IIOA 2NWMA 1OPLA 2QAZA 1O9KA 4JJCA 2SEMA 4AKIA 2BE7D 5GANh 1VQ5A 4R56A 3JCMh 1OEBA 3VYGA 4IUQA 4LDVA 1M27C 4F6SB 2AT1B 2EJFA 1NG2A 2CGHA 4JX6A 4CFUB 1W4SA 3MCAB 1VQ8Q 4A4GA 3PFSA 1OU9A 1XQHA 4J9HA 1YIJT 4J9GA 1ZP2A 4E2FB 3JCMe 3MO8A 3PO3S 1FX7A 2V8JA 1OOTA 4M75A 3DB3A 1NE8A 1H3HA 1PG5B 3QPHA 4PK4A 3CCQA 1AWWA 3HTRA 3MEVA 1ZLMA 4AG2C 1FXXA 3M0PA 4IMYB 1VQNA 3HRUA 4O6JA 4NSTB 2V8IA 3EOCB 4HT8A 5HBJB 2RQRA 1UTIA 1AWXA 5KYXA 2BUDA 2YLBA 2AZSA 2YUOA 2YRVA 2DF6A 3OYNA 2EKOA 2VUBA 3MP1A 3EJ1B 1R8OB 1VQLA 1RL2A 5L23A 1XOVA 3VRZA 2RHYA 1X2QA 2A0FB 2DBKA 4RUGA 2F69A 3VS4A 3VS3A 1E7PA 2RQUA 4HCZA 5I21A 1QCFA 2XDDA 1ENWA 2ECZA 1QLYA 1UG1A 2K2MA 3G1JA 5DQWA 3QYHB 1G2BA 9ATCB 4LDWA 3E19A 3EH2A 3VJPA 4A4KA 1F1BB 1MHNA 1VQOQ 3C94A 1VQ4A 2Y4XA 1M3AA 2H3JA 3PVQA 1M2OA 5CEIB 4PNOA 2D6FA 2CZ1B 2VGMA 2QDYB 2UZDB 4LUDA 2HAXA 5FU7C 1NJIR 1WA7A 2QK0A 1T0HA 2JZ2A 2VVKA 2LDMA 4M75C 3RIRA 3CC4A 3BHTB 3ZBDA 4C92A 1BI2A 4C8QE 2DMOA 1RUWA 3OY9A 1SSHA 3URGA 3M58A 1M5Q1 4ZNXA 1S72A 1KXUA 4J9EA 4IKFA 4LOCA 2RI3A 2FYKA 2DXBA 4J6YA 2F2VA 3QYEA 1AD5A 4LDXA 2DD4A 2VC8A 1GBQA 5KYYB 3JB9J 3BHVB 3RMSA 4KGVB 2R58A 2A36A 1H92A 2EGCA 1JSTB 2DXCB 4O5VA 3I5SA 3OYCA 4CC7A 4HNTA 2QDJA 3PT9A 4MZPA 4M78G 1WJRA 2C0OA 2QEXA 4C0GA 1K73R 3QSUA 3UA7A 3CCMT 2WEVB 4MIMA 1VYTA 3BW1A 2QASA 2QGFB 4LNPA 3G7ZA 4JLIA 1Y7XA 4M7DA 4M77E 2AZVA 3QDFA 2KT1A 2LQNA 4BY1X 1V29B 4BCQB 3DDQB 2VWFA 4BY6C 1RAFB 1S1NA 3JCMb 1VQNQ 3OYYA 4F6UB 4JLGA 1P92A 4DBFA 4C5EA 1WQWA 3OYMA 7AT1B 3G4ST 1MNDA 5LL6S 4PJMA 1G3NC 4N4HA 4HNVA 2DIGA 2DTHA 2MCNA 4XU2A 4XU3A 3BLRB 1M90U 2DTOA 4HKEA 3WVEB 5HY6A 1HK9A 3G6ET 5IXBA 1JEGA 1VOMA 2RHUA 2GQVA 3A1PA 5LQFB 3JB9D 1X2KA 4C8QC 5KCHA 1NM7A 3CCLQ 1N6AA 4ZGJB 4L6V5 1TTHB 4M78B 1PSEA 2UZLB 1MV3A 3L1AA 4J6WA 1RABB 2J6OA 1C6VX 3LW5E 5FU6C 1WDXA 4OMQA 4Y91A 1WHJA 1OX9A 4M7AC 5GMKm 1OL2B 4F17A 5HNBB 1Y57A 3I9QA 3CXCS 4EC9B 1PRLC 1K9AA 4JZ4A 5HK0A 1UHFA 4UN0A 4MMLA 4PLLA 2JVVA 4PFPA 4JX5A 1FYNA 5HK3A 1ACMB 3EHRA 2DLPA 3TW7A 3NTKA 3GIBA 1WZOA 1U8RA 1FVVB 2VYTA 4AG1C 1GRIA 2JOYA 1FMKA 1LOJA 1AVZC 3PVLA 4EMGA 2MIOA 3CC4T 4PJOC 1VQKQ 3M0TA 1UJYA 2DXUA 2BKDN 3PGGA 4HT9A 2DM1A 3CCUQ 4NL2A 4BCIB 3C4SA 4KBMB 3CCLT 2IW6B 4BY6B 3DTOA 4E6RA 4F7UG 4J6XA 4M78F 1K76A 1V1CA 1G83A 3QHRB 5BNJB 3CMEA 4C92G 1V76A 5GAN8 1OQKA 4C92E 2OI3A 3JCMf 2CH4A 3H0FA 4AFSC 2NYSA 1D1CA 2CP3A 2LW4A 3BLHB 1T3SA 2DJZA 4HLQA 1YITQ 2RNAA 4M4ZA 4XTYA 2O4XA 3NPFA 3LX7A 4ZN1A 3HPWA 4PLIA 2O2OA 5GAMe 1KFZA 1UNLD 3FIFA 1QQJA 1U5SA 5FWCA 1QP3A 4E7JA 3QZ5B 3CCVT 1JSUB 1K73U 4HVVA 3CC2A 2EQMA 3S3NA 1KD1U 4M75F 3PTAA 2F5KA 3D7SB 1DJ7B 4M7AF 2R5MA 3TN8B 1UGVA 1EZZB 3JSCA 1N5ZA 5D6WA 2K5IA 1ZA1B 5AT1B 2HQEA 4MFDA 2F2XA 2K3YA 2UUEB 1AWJA 1UB4A 1RLPC 5CO7A 1H4LD 1JJ2S 3CCJT 1VQ9Q 4HCKA 2X4YA 2HD0A 4AT1B 1I0CA 2MOXA 2MMPA 2QG9B 4Z89A 1QVFA 2P0PA 2W9ZA 3MY5B 3OYHA 3CC2Q 3HFOA 2QA4T 2RI5A 1X69A 5GAOq 5GAMg 3QZ9B 1M2VA 4XTUA 1UGSB 4A53A 1QVGS 2HQXA 3FB9A 4F7UB 3H0IA 1JBMA 4LD9K 3I56T 3FEOA 2XIDA 1YHQA 3OYDA 3H9NA 2VKNA 1TH7A 2QQSA 1SRMA 5GAOm 5GMKj 3A8GB 3EGXA 4PFOA 2DZ9A 2IIMA 5LJ3e 5GAN6 2OAUA 2KAFA 2QQAA 2ATCB 4N4IA 3CMEQ 1YJNT 4HCBA 4M7AD 1NYGA 1YI2A 5CQYA 5KYWB 1KK7A 3V7CA 2V26A 2CS7A 2ZAEA 1JJ2A 1K8AR 2KT8A 1ARKA 2QEXT 3OYIA 2KSSA 4CRLB 2DBMA 5KYUB 2C5OB 1SRLA 4EOSB 2CUDA 5FWBA 4BCQD 4WF2A 3PIOA 4OMFB 4X9CA 1EFNA 4XU0A 1TFBA 1D1AA 1QCNA 4FIBA 1D0YA 4JRKA 2QGGA 3EFSA 3QO3A 4CFNB 4HA8A 1VQOA 1GXIE 1BI1A 1YITT 2J05A 2O9VA 3PE0A 1C0MA 2PJQA 1TD6A 4BUGA 3BFMA 2FRYA 4CFVB 1WXUA 1K1ZA 1S72Q 2YLCA 2HNIA 3O5ZA 5FLXE 4OGCA 1WHMA 1PD1A 2QI2A 4J83A 4BI4A 4ESRA 4XTVA 4C8QD 3CCMQ 2ZPIB 3S3MA 2BIVA 4KRTA 1LCKA 3LWIA 2FPDA 2EBPA 2F1LA 3CD6A 5ECAA 2DILA 4I3ZB 3FDRA 2MK5A 3R6NA 4ATOA 1WHKA 2AKLA 4FT2A 4PJOA 1Q81R 3X26B 1AHJB 3E1SA 2KMGA 1GCPA 4F16A 4ZGDB 1VQ4T 3SD4A 2X4WA 1X6OA 3JCMQ 1TUCA 1VQNT 2ZPBB 3NFCA 2QF7A 1NPPA 2DXTA 3EGDB 4BBRM 3UWNA 2A37A 4FSXA 2RD1A 1WHGA 1JU5C 2XK0A 4C0ZA 3LWHA 2EW3A 2VXEA 3CPFA 3EG3A 1SEMA 4Y72B 2C6TB 4JS4A 3BLQB 2PUKB 2XDPA 4EMKC 4C5IA 4F7JB 1HYOA 2W9FA 2NUTA 2ZPFB 1GUXA 3P8BB 2IN3A 2G3RA 5EG2A 1H28B 2M02A 1QLBA 5GAN3 2PZ1A 4AFUC 2CZ0B 5EFQB 2R7GA 4KGZB 1VUBA 5C0MA 1O9KB 2DE0X 1G3SA 2LCCA 3QWXX 4KH1B 1ZHIA 2L5QA 1F5QB 3CMAA 2FZKB 2RK2A 3ULRB 4L59A 5LMKB 3HSBA 1E6HA 3QXEB 1UUEA 4RTWA 1M90R 1YBYA 3BHUB 1YIJA 4M77A 1IXDA 4C0DC 1Y07A 1UGPB 2KK4A 1Q81C 2C5VB 4J7IA 3X20B 1W1FA 2YXYA 1BI3A 4FW2A 3UF4A 4E7SA 4JRIA 4G6LB 4FL6A 1GBRA 1VQ7A 2C5XB 2RI2A 1UFFA 5HCKA 2E1HA 4FYXB 1T0JA 1KQ1A 1D1BA
chains in the Genus database with same CATH topology
1BI2A 2LVMA 3E9GA 5CK9A 1Y96A 4C8QE 4KUDK 3O8VA 3AHUA 3PNWC 3OY9A 4ZTJA 4XTWA 4ZGEB 5CIUA 2LTOA 4F7UA 1N8RU 2PUOB 2Y90A 3URGA 5GAOr 3M58A 2ZPHB 1M5Q1 1M9SA 4N0AC 3CEYA 2RK1A 2OTLT 1S72A 2E10A 2V8KA 1YHQT 2XDBA 4C0DB 4N4GA 3OYEA 4IKFA 4LOCA 2K3XA 3X24B 2RI3A 2FYKA 2DXBA 3Q1JA 2EJ9A 4J6YA 5A2QE 3JRZA 3QYEA 1KQ2A 4LDXA 5A0LA 1YJ9T 2BS4A 2QFZA 2DD4A 2P0QA 3FLGA 1H3ZA 2XI9A 2VC8A 3DKMA 3OYLA 2EQJA 3NTHA 5CKHA 4OGEA 3G6EA 3JB9J 3RMSA 2X4JA 2R58A 3JCMX 1G3YA 2DXCB 2MWPA 4O5VA 3RESA 3CXCA 3OYCA 4M78C 3SWNA 2CZ6B 3VV0A 4HNTA 2QDJA 2A3LA 3PT9A 3LGFA 4MZPA 4F7UF 1U1TA 1VQPA 4M78G 3CBMA 2DPPB 1WJRA 1WNLA 4C92A 2QEXA 4QQ6A 4C0GA 2D0QB 2RJDA 2CYZB 2M1HA 3QSUA 4BBSM 3CCMT 1KG1A 4MIMA 3BW1A 4LDUA 4M77B 4ELJA 3G7ZA 4JLIA 1Y7XA 1I8FA 2DTIA 5AYFA 4PJOF 2FL7A 3OS1A 4M7DA 4RMOA 3META 2R57A 4M77E 4XQ3A 5KCOA 3CBOA 1KQSS 4PJOB 2M16A 3J81E 3OYAA 3ZFJA 5C6SA 2RHZA 3QG1A 4A4HA 2MAMA 2X35A 3P8DA 3CCRT 1V29B 3X25B 1FWZA 4V2SA 5LJ3f 3GF5A 1VQOT 1WQ7A 4BY6C 3KHIA 4RCCA 2WSFE 3VKHA 1LNXA 4RG8A 3JCMb 2K57A 3OYYA 3HRSA 4JLGA 1X01A 1P92A 3FRNA 2M0OA 4C5EA 4HL4A 4Y28E 1Y96B 1WQWA 2LNVA 1OZ2A 4YTLA 3OYMA 3G4ST 4M7AB 2NLUA 5LJ3e 2L89A 2E6ZA 2MI6A 5LL6S 1BIBA 1HXDA 4N4HA 1N9RA 4DOVA 5I2SA 1NJIU 4HNVA 2DIGA 2K5LA 4C92F 3HBLA 2DTHA 2RO0A 1I5LA 1K9MC 4PJOE 3HKSA 4XU2A 1QW1A 4XU3A 1M1KU 1NJIC 1YJ9A 2DTOA 4ZTFA 4M78A 1M90U 3QYBA 2ZZDA 3WVEB 1SSFA 4HKEA 4M75E 1HK9A 5HY6A 2RB6A 3G6ET 3OB9A 2DD4B 1H641 2BS2A 3CCSA 2RA2A 1VQ5T 2GFAA 2WSCE 1M90C 3R6OA 3CCLA 2RHUA 3UPUA 2GQVA 1NPRA 2LT1A 3JB9D 3HHTB 1YCYA 1Y71A 3CCEA 3JCMg 1N27A 4C8QC 3QUIA 4DOWA 1B34B 5KCHA 1VQKT 1N6AA 3OYGA 3BG5A 4ZGJB 4L6V5 1MGQA 3OW2S 2FB7A 4M78B 3VKIA 1PSEA 5FROA 5LJ3j 3H8ZA 2VGNA 4RKUE 5LJ5f 5GAOl 3KBGA 4E7KA 1IZ6A 3EFRA 3L1AA 3OS0A 3CCUT 4J6WA 4M77F 3V8JA 1VQPT 3QHSA 1K8AC 1N9SA 3M9QA 4JJNK 3LW5E 5FU6C 1Q7YU 5L8RE 2XD0A 3PMTA 4M7AG 4Y91A 1K8AU 4M7AC 3CMAT 5GMKm 1BIAA 3G71T 4HNUA 2DO3A 3CXCS 1OI1A 3SDZA 1N8RC 2D9TA 3GNGA 3V8KA 4M7DE 2E65A 2R5AA 2IG0A 5GAOn 3CCQT 4M7DG 2PU9B 2KR6A 5HK0A 3RERA 2XICA 4XAXB 4MMLA 5GAN2 1M8VA 4BB7A 4PLLA 5GANg 4C8QG 5GAN4 1XNIA 5GAMj 2JVVA 3M5AA 4JX5A 5HK3A 3FC3A 4LD6A 3VUZA 1K73C 4AI6A 4DQ2A 4JS5A 2CZ7B 3SWNC 5FRNA 3TW7A 3NTKA 2EIFA 5IT9E 3QIIA 3GIBA 2P4TA 3G4SA 4MFEA 1VIFA 1U8RA 3NTIA 2VYTA 3RKWA 4BDYA 2JOYA 1X75C 2EQKA 1LOJA 5D6XA 1YITA 1VQLT 4BDZA 3HO8A 2XG8D 4EMGA 1VQ6T 2E70A 3CC4T 4PJOC 3X28B 4EMHA 3S3OA 2DXUA 3FJPA 4QSHA 2BKDN 2JTFA 2VXFA 3QJYA 3PGGA 1OZ3A 4HT9A 3CCST 3VU3C 1I4K1 3P8HA 4NL2A 4A4FA 3C4SA 4KBMB 5KE2A 4TVRA 5KE3A 1D3BB 3C12A 5LJ5g 3CCLT 1WJSA 1OYXA 4M7DC 4BY6B 3RMQA 4F7UG 3OYKA 2DAQA 4J6XA 1G3TA 4M78F 2EAYA 4A4EA 3MEWA 2OTLA 5CQXA 1ZQ1A 1WPYA 4P5NA 2FHDA 2KMTA 3OMCA 4M77D 3L2UA 5HKCA 1KHCA 2B8AA 3OSVA 2E12A 4C92G 5GAN8 2DVEA 3CMEA 4M7DB 3A5ZB 3CCUA 2KDSA 2QXFA 4OB2B 2DK3A 4OB0B 1D3BA 4M75B 3OQ5A 3A8OB 4C92E 5CKDA 5KH6A 3JCMf 3DL1A 2YHTA 3V7RA 3JAME 1Q86U 2BS3A 2DJZA 3I56A 3CCVA 3WXMB 4HLQA 2JN0A 1UEBA 3TREA 4XTYA 5DLOA 3ASKA 5CKEA 3M56A 2E5QA 2O4XA 4D6WA 5GANd 3LX7A 5GAOp 4ZN1A 3HPWA 4GY5A 3A8LB 4PLIA 5I2MA 3UT1A 3QJ6A 4E7IA 3RKYA 5GAMe 3KXTA 1VQMT 1UGQB 3FIFA 2RM4A 3OYFA 2QQ9A 2AHJB 4JRPA 1QP3A 4E7JA 3RKXA 2DD5B 2LX9A 3QZ5B 3CCVT 4QVCA 1K73U 2PVDB 4BD3A 4OVAA 5CCAA 4NOYA 3CC2A 2EQMA 3S3NA 3MHXA 2O4XB 1KD1U 4M75F 4ELZC 3PTAA 2F5KA 1DJ7B 4BE0A 1VIEA 3BDLA 2R5MA 2DEQA 4M7AF 3GLXA 4PJOD 3QYGB 2ZPGB 3JSCA 3LH0A 5D6WA 3SB2A 4M75D 4C5GA 5FRMA 4B9XA 4NC6A 2K5IA 2HQEA 5LJ5j 4MFDA 3A8MB 3QWLA 3CPWA 2K3YA 3CC2T 3JCMW 3BG3A 1UB4A 5CO7A 2C06A 1QVFS 3JB9G 1JJ2S 3CCJT 4PL6A 5CR2A 3JCMV 2I2LA 2X4YA 2HD0A 3RUXA 1KC8C 3E9FA 4HCCA 3TW6A 4BI8B 2LCLA 2MMPA 4RCBA 3GOXA 5GMKl 5LJ3g 5IN1A 5DM7R 1VQ9T 1VQ7T 1M1GA 1O9SA 1QVFA 2P0PA 2PVOB 3ER0A 3M4GA 2LRQA 1I81A 2GFUA 2DXCA 3OYHA 3HFOA 1W2BA 4ZN3A 3CPWS 1WJQA 4QW2A 2RI5A 2QA4T 4RG2A 2MF2A 1NZ9A 3HP9A 5GAOq 2VV5A 5GAMg 4BE1A 3HB9A 1FKMA 3QZ9B 4X34A 4XTUA 1UGSB 2XU8A 4A53A 2HQXA 2XKOC 4Z6YA 3FB9A 4J8OA 4QQDA 4F7UB 5DLQE 5GANj 4M6VA 1JBMA 2QQ8A 3GNFB 4IURA 4EPCA 5FU7B 5CKBA 1UGRB 3CCMA 4LD9K 3UDCA 2LC4A 3I56T 2MWOA 3FEOA 2XIDA 1YHQA 3OYDA 5IAYA 1M1KC 4FT4A 2L8DA 3PIPA 2DXBB 3LLRA 2KY9A 2QA4A 3CCET 4DA4A 1TH7A 4M77C 1VQKA 4XU1A 4C0FA 4E7HA 3MEAA 2QQSA 4MMKA 5GAOm 1VQMA 5LJ5h 4C5HA 4OB3B 5DY9A 5EJCA 5GMKj 3A8GB 5GAN7 4EMKA 3L2WA 4GLKA 2DZ9A 4C8QA 5LJ5e 3WVDB 3M57A 4B9WA 2OAUA 2KAFA 2QQAA 4OF1A 2EQUA 2QQBA 4N4IA 4C8QF 5GAN6 3I55A 4EDUA 3GP8A 3CCRA 3BG9A 1YJNT 1VQ8A 4E7LA 2WSEE 4HCBA 4M7AD 2DD5A 3M55A 4MDXA 1YI2A 5CQYA 1QP2A 5LJ5d 5LJ3d 2K2VA 4JDSA 2JTMA 3V7CA 1BI0A 2CS7A 3VYHB 4M78E 4XTXA 4NL3A 3GPLA 1Q7YC 1JJ2A 3VUBA 2QEXT 3OYIA 2KSSA 4EMKB 2EFIA 5J26A 2DIQA 2M9UA 3QKJA 1YJWT 4A54A 4XK8E 3I55T 1B34A 4C92C 3VKGA 5CVIA 4MDWA 4WF2A 3PIOA 3MP8A 1KC8U 4OMFB 4OP0A 2EJGA 4X9CA 1W2BS 2ZPEB 2QQRA 2K5FA 3M4YA 3M53A 4XU0A 3OS5A 4QVZA 3JB9H 3S6WA 4CRIA 2OTJA 4N0AA 4C92B 4F7UE 4M75G 2HBPA 3DLLA 2X4XA 1G3WA 4FIBA 5FU6B 3ME9A 4JRKA 4C92D 3EFSA 2ZCFB 3QO3A 5GAMd 1EIFA 1S72T 2WJ9A 4HA8A 1VQOA 2LT4A 1BI1A 1GXIE 5GANe 1YITT 3DLMA 3OSSC 2PVGB 1VQ6A 3CC7A 2PQWA 1XTDA 3OMGA 4X9DA 2OTJT 3OYJA 3QBYA 2KVQG 4L5GA 4BUGA 3HL8A 2EYQA 3JB9F 3BFMA 1K9MU 3EAEA 5GMKh 2DKGA 4JX4A 2RHIA 3OBWA 3SFMA 4M7AA 3INZA 2K4YA 3L2QA 1Q82U 1IREB 4IUUA 3TCJA 2YLCA 2HNIA 5FLXE 4OGCA 3MEUA 5GANf 2QI2A 1KHIA 4J83A 4BI4A 5CKFA 3HFNA 4XTVA 4C8QD 3CMET 2G77A 2ZPIB 4AKIA 3L42A 3S3MA 5GANh 2BIVA 1VQ5A 1QVPA 4R56A 5D6YA 3L2ZA 3JCMh 3VYGA 1JRIA 4PKCC 1YJNA 3LWIA 1KQSA 1VQ8T 4IUQA 4LDVA 3CC7T 3CD6A 4BI3A 2EJFA 4XTZA 2CGHA 1M4ZA 4II1A 4JX6A 2QTXA 1W4SA 3FDRA 3MCAB 1Q86C 3J80E 4ATOA 4IUVA 2P0KA 4FT2A 3A8HB 4A4GA 3PFSA 5J3BA 4Q5WA 4PJOA 4VUBA 2JNGA 1YJWA 3X26B 4CI0C 3C95A 1AHJB 1XQHA 3L2RA 3E1SA 1U1SA 1G5VA 2KMGA 3VYGB 4ZGDB 1VQ4T 4UC4A 2CKKA 2X4WA 3SD4A 1YIJT 1X6OA 3JCMQ 3OW2A 2RJCA 2Y4YA 1VQNT 2ZPBB 3M59A 4BE2A 3CD6T 3JCMe 3NFCA 3MO8A 2QF7A 1NPPA 1FX7A 2V8JA 3LGLA 2DXTA 4M75A 3HRTA 3DB3A 4BBRM 4PJOG 1NE8A 3UWNA 4FSXA 1Q81U 2RD1A 3TU4K 2LQ8A 3QPHA 2RJEA 3OA6A 3CCQA 3H6ZA 4NS5A 5GMKi 4IUTA 3MEVA 2XK0A 3MP6A 4C0ZA 3H4CA 5J39A 3LWHA 1FXXA 2VXEA 3CPFA 3KUFA 2LQKA 4Z02A 3V8LA 1VQNA 3HRUA 4O6JA 2V8IA 5LJ3h 2E41A 1QVGS 2JUFA 4QQGA 4R55A 3V7SA 4HT8A 1RI0A 4OB1B 4E47A 4JS4A 2PUKB 2XDPA 4KUIA 4EMKC 3T9NA 4C5IA 1O75A 1ZBXA 3CCJA 1Q82C 1BYMA 5GMKe 2BUDA 2ZPFB 2YLBA 3P8BB 2YRVA 3OYNA 2GCXA 2EKOA 2VUBA 2G3RA 3MP1A 5EG2A 1R8OB 1VQLA 1RL2A 2O01E 4J7FA 1VQ9A 1QLBA 5GAN3 4MZMA 3JCMP 2ZGWA 4M7AE 1XOVA 2RHYA 2XHCA 2CZ0B 4FM4B 3DB4A 4M78D 1VUBA 1M1FA 2F69A 5C0MA 1E7PA 1BKBA 4HCZA 5I21A 1LJOA 2XDDA 3JCMc 1G3SA 1PSFA 2LCCA 3J7AF 2EWNA 4LDYA 3M54A 1ZHIA 2L5QA 2RHXA 2E6NA 3LYIA 4QVDA 3ZEHA 3CMAA 3JCMJ 2RK2A 3OYBA 3G71A 3QYHB 2WACA 4LDWA 3E19A 4L59A 4J5YA 4FU6A 3HSBA 3VJPA 4A4KA 2E64A 3QXEB 1MHNA 4AKHA 2A7YA 5GAN5 2L3RA 3OBYA 4JRQA 1YBYA 3C94A 3QDRB 1VQ4A 1YIJA 2Y4XA 4ME7A 3HZJA 2RJFA 3N5BB 4KULA 4M77A 5CAIA 4C0DC 3JCMd 3JB9I 3OS2A 1KD1C 4M77G 1Y07A 2H3JA 1UGPB 2FVUA 2KK4A 3F70A 2D6FA 4PNOA 1Q81C 2CZ1B 2VGMA 4J7IA 1YI2T 3X20B 2F5TX 2QDYB 3CBPA 1BI3A 1WGSA 2GF7A 3L2VA 2HAXA 5FU7C 5M9OA 3BY7A 2RH2A 5A0GA 4JRIA 2JZ2A 4FL6A 3BDUA 4JUVA 4ELYC 3SWNB 5GAMf 5A0DA 1VQ7A 2LDMA 2ZZDB 4M75C 3RIRA 4M7DF 4BACA 2RI2A 1JB0E 4MZTA 3CC4A 4IUPA 4KT0E 5GAMh 2E1HA 3TEEA 2KQWA 4AKGA 1KQ1A 4C8QB 2IVWA 3ZBDA 1QVGA 3PMIA 4M7DD 2DZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R E;  4ZGE B;  2PUO B;  2ZPH B;  3A8H B;  2PVO B;  3X26 B;  1AHJ B;  2DXC A;  3VYG B;  3X24 B;  2PU9 B;  4ZGD B;  2DXB A;  2ZPB B;  2DD4 A;  3QZ9 B;  1UGS B;  1UGR B;  2DXC B;  2CZ7 B;  2CZ6 B;  2DXB B;  2DPP B;  4OB3 B;  2D0Q B;  3A8G B;  2CYZ B;  3WVD B;  4OB1 B;  3X28 B;  2PUK B;  2WSE E;  2DD5 A;  2ZPF B;  1QP2 A;  3VYH B;  2O01 E;  4XK8 E;  1V29 B;  3X25 B;  2CZ0 B;  4FM4 B;  4OB2 B;  4OB0 B;  3A8O B;  2WSF E;  1PSF A;  2ZPE B;  4Y28 E;  3QYH B;  2ZCF B;  3A8L B;  1GXI E;  3QXE B;  1UGQ B;  2AHJ B;  2PVG B;  1QP3 A;  2DD5 B;  1UGP B;  3QZ5 B;  3WVE B;  2ZZD A;  2PVD B;  2DD4 B;  2CZ1 B;  3X20 B;  2WSC E;  2QDY B;  1DJ7 B;  1IRE B;  3HHT B;  3QYG B;  2ZPG B;  4ZGJ B;  4L6V 5;  2ZZD B;  1PSE A;  4RKU E;  3A8M B;  2ZPI B;  1JB0 E;  4KT0 E;  3VYG A;  3LW5 E; 
#chains in the Genus database with same CATH topology
 2LVM A;  1Y96 A;  3AHU A;  4BCP B;  2G9X B;  2KRO A;  4ZTJ A;  1M2V B;  2JT4 A;  4PJJ A;  5GJW B;  2PUO B;  2Y90 A;  5GAO r;  1M9S A;  4N0A C;  3CEY A;  2E10 A;  6AT1 B;  4EOQ B;  3JRZ A;  2A08 A;  1KQ2 A;  2BS4 A;  2QFZ A;  1RAE B;  1A0N B;  1YHQ Q;  2XI9 A;  3DKM A;  2CT4 A;  3OYL A;  3NTH A;  5CKH A;  4OGE A;  3G6E A;  1JQQ A;  1OIU B;  1K9M R;  4BCJ B;  4F14 A;  2MWP A;  1OKW B;  1WX6 A;  2CZ6 B;  4M78 C;  2RQW A;  3LGF A;  1VQP A;  2IPO B;  1WNL A;  2XMF A;  2D0Q B;  4EOL B;  2W99 A;  1X27 A;  1VIN A;  1I8F A;  4CFU D;  1WXB A;  4XQ3 A;  4EOM B;  3J81 E;  2FPE A;  3OYA A;  2GTO A;  5C6S A;  2RHZ A;  2LX7 A;  3QG1 A;  2V22 B;  2X35 A;  1JXM A;  4V2S A;  1WQ7 A;  3TNW B;  3KHI A;  2DL5 A;  3CCR Q;  3VKH A;  5L2W B;  1LNX A;  2ENM A;  1PC0 A;  2K57 A;  2CDT A;  3CD6 Q;  1HJD A;  2M0O A;  1Y96 B;  2LNV A;  3E2U A;  2FG0 A;  2AIR B;  1CKA A;  5HBH B;  1BIB A;  2MYS A;  2K5L A;  1NLP C;  1K9M C;  1QW1 A;  1YJ9 A;  2DFU A;  2J7I A;  2ZZD A;  3I56 Q;  4LN2 A;  2RB6 A;  2HSP A;  1H64 1;  1Z9Q A;  1KIK A;  4CXA B;  2WSC E;  1M90 C;  3CCL A;  2LT1 A;  1Y0M A;  2MPX C;  1VQP Q;  1YCY A;  2WPA B;  3JCM g;  3CCE A;  4DOW A;  3VKI A;  5FRO A;  5LJ3 j;  4RKU E;  2VGN A;  3KBG A;  4E7K A;  2K6D A;  1IZ6 A;  2J6F A;  2GNC A;  3MJX A;  1AWO A;  2OX7 A;  2VAS A;  2XD0 A;  1K8A U;  1BIA A;  2DO3 A;  2O88 A;  2BZ8 A;  3SDZ A;  1R77 A;  4E7Z A;  2VB6 A;  2D9T A;  3GNG A;  1ZUY A;  4JJD A;  3V8K A;  2FPF A;  1RAA B;  2E65 A;  3CCQ T;  3TQ7 P;  3G4S Q;  1M8V A;  4C8Q G;  5GAN 4;  4CFW B;  2O31 A;  2L3P A;  4CC3 A;  1K73 C;  4WCI A;  5D7U A;  1IB8 A;  2CZ7 B;  3SWN C;  5FRN A;  3QII A;  1M30 A;  2P4T A;  1ZUU A;  3IQL A;  3RKW A;  4BDY A;  1X75 C;  4J9D A;  2C5N B;  1VQL T;  3CCV Q;  1VQ6 T;  1CKB A;  3EGD A;  5IHY A;  4EMH A;  4LE9 A;  3S3O A;  1H1R B;  3QJY A;  2VXF A;  2HSE B;  1I4K 1;  3P8H A;  3G33 B;  4M7D C;  1OYX A;  1PHT A;  1ZQ1 A;  4F7S B;  4P5N A;  4M77 D;  2KMT A;  1YWP A;  1KHC A;  1PNJ A;  2DVE A;  1M1K R;  3CCU A;  2KDS A;  2QXF A;  5CKD A;  4OB0 B;  1SF9 A;  3A8O B;  5KH6 A;  1OU8 A;  2FZC B;  3CCV A;  3WXM B;  2YT6 A;  2JN0 A;  1NEG A;  3TRE A;  4DBH A;  1D3U B;  3M56 A;  4D6W A;  1VQP T;  3A8L B;  2DL4 A;  4HVW A;  1N8R C;  1UGQ B;  3OYF A;  2QQ9 A;  1SHG A;  1IGU A;  1B07 A;  1IHW A;  1UE9 A;  3UA6 A;  3EGU A;  2O4X B;  5IHN A;  4ELZ C;  4F6W B;  1VIE A;  2YDL A;  5EC7 A;  3O0G D;  3QYG B;  2ZPG B;  2KRN A;  4C5G A;  1TUG B;  1W6X A;  4TTH A;  2HKQ B;  3MPU B;  3CPW A;  1MV0 B;  2QA4 Q;  2CCI B;  2C06 A;  2GBQ A;  1QVF S;  4PL6 A;  1I5O B;  3JCM V;  1W98 B;  3E9F A;  2JGZ B;  1TG0 A;  4OGR B;  3EG2 A;  1VQ7 T;  5IN1 A;  4FYW B;  3CCJ Q;  1VQ9 T;  3ER0 A;  3M4G A;  1JKW A;  2LRQ A;  4FYV B;  1PM3 A;  2MF2 A;  2BKZ B;  2BZX A;  2EYX A;  3HB9 A;  1FKM A;  1QWF A;  4BE1 A;  2XKO C;  3NGP A;  2W2H A;  3GNF B;  5FU7 B;  2EPD A;  1M1K C;  4FT4 A;  1R0B G;  2DXB B;  2JM9 A;  2KY9 A;  2QA4 A;  1OGU B;  4XU1 A;  4E7H A;  3MEA A;  4MMK A;  2KRM A;  4OB3 B;  2L3S A;  5EJC A;  4Z88 A;  5DY9 A;  5GAN 7;  2DNU A;  1LPL A;  2CH4 W;  4OF1 A;  2QQB A;  3CCR A;  2WSE E;  2DD5 A;  3M55 A;  4MDX A;  1VQ6 Q;  5LJ3 d;  1BI0 A;  3VYH B;  4M78 E;  4XTX A;  3B57 A;  4NL3 A;  1YJN Q;  1WHH A;  2DIQ A;  1YJW T;  1FIN B;  1ZSZ C;  2L0A A;  3I55 T;  1N4M A;  3TSZ A;  4C92 C;  3VKG A;  4FW1 A;  1KC8 U;  4OP0 A;  2EJG A;  3KFV A;  2KNB B;  3M4Y A;  1XO2 A;  3M53 A;  2JM8 A;  2JXB A;  4CRI A;  4C92 B;  4F7U E;  2QEX Q;  4M75 G;  2HBW A;  2I0N A;  3DLL A;  3EID B;  1WI7 A;  2GTJ A;  1VQ4 Q;  2COY A;  1ABQ A;  1YCS B;  1S72 T;  2LT4 A;  3M0S A;  1D0Z A;  2KEA A;  2PNI A;  4LUE A;  1ZSZ A;  2PQW A;  4FX3 B;  2EGA A;  3ZL7 C;  5HVY B;  1H25 B;  4ELL A;  4X9D A;  3QBY A;  4BCO B;  3VS5 A;  3JB9 F;  4EIK A;  3EAE A;  2B9R A;  3MIA B;  4JX4 A;  2W96 A;  2P4R A;  1Q82 U;  1YWO A;  2K4Y A;  2OTJ Q;  3CCS Q;  2Z0W A;  3TCJ A;  4IUU A;  1OX8 A;  3MEU A;  4BCF B;  5GAN f;  1KHI A;  1YJ9 T;  5CKF A;  2I53 A;  4JJB A;  1QVP A;  1OV3 A;  1ZUK A;  2RMO A;  1UDL A;  1YJN A;  4J9B A;  2DL7 A;  4BI3 A;  3EG9 B;  4XTZ A;  2EKH A;  2QTX A;  3H0H A;  3J80 E;  1BU2 A;  3A8H B;  3CXC P;  5J3B A;  4Q5W A;  4EC8 B;  2JNG A;  2QYZ A;  4CI0 C;  3C95 A;  3L2R A;  3CPW P;  2YRC A;  1G5V A;  3VYG B;  1K0S A;  4OMP A;  2CKK A;  1UEC A;  3OW2 A;  2RJC A;  1FMV A;  3M59 A;  4BE2 A;  3CD6 T;  2D8J A;  3LGL A;  2W10 A;  3HRT A;  2H3E B;  4YOO A;  2LQ8 A;  4NS5 A;  5GMK i;  5J39 A;  3MP6 A;  2EUF A;  3H4C A;  2YSQ A;  2HL5 C;  1SKU B;  4Z02 A;  3V8L A;  5LJ3 h;  5KYY A;  2JUF A;  4RTU A;  3CCE Q;  5KYU A;  4E47 A;  3I55 Q;  1O75 A;  1ZBX A;  1BYM A;  2QGS A;  3FJ5 A;  4AMC A;  2GCX A;  1YJ9 Q;  1VQ9 A;  4J7F A;  4MZM A;  2ZGW A;  1M8M A;  1GY3 B;  4WTO B;  4FM4 B;  3DB4 A;  1WIE A;  2DYI A;  1W2B P;  1BKB A;  3I5R A;  2JJ9 A;  1LJO A;  3A98 A;  3JCM c;  1PSF A;  2OJ2 A;  4LDY A;  3M54 A;  2RHX A;  1AOJ A;  4QVD A;  3ZEH A;  1HD3 A;  4EON B;  3OYB A;  1X6G A;  1H27 B;  4BCM B;  2CSI A;  2E64 A;  2A7Y A;  1AZG B;  5GAN 5;  2L3R A;  3OBY A;  3THK A;  3G6E Q;  4JRQ A;  1ABO A;  4OR5 B;  2YUN A;  3QDR B;  5CAI A;  3JCM d;  3HZJ A;  4KUL A;  3OS2 A;  3JB9 I;  1KD1 C;  2FVU A;  1MNE A;  2KYB A;  2K79 A;  2ESW A;  1WGS A;  2GF7 A;  1M3B A;  1I07 A;  3MY1 B;  3BY7 A;  4Y92 A;  2DX1 A;  2RH2 A;  1TS9 A;  4FSS A;  5A0G A;  3SWN B;  5GAM f;  2ZZD B;  2KI7 A;  1QMZ B;  4M7D F;  4MZT A;  4KT0 E;  5GAM h;  2KQW A;  2IVW A;  1QVG A;  3PMI A;  1NYF A;  2DET A;  3E9G A;  3RGF B;  5CK9 A;  3O8V A;  3PNW C;  1C9B A;  4XTW A;  1MMA A;  2LTO A;  4F7U A;  1IO6 A;  2ZPH B;  2IW8 B;  2OTL T;  2V8K A;  1YHQ T;  2QTV A;  2XDB A;  4C0D B;  3OYE A;  1TU0 B;  4Z8A A;  3Q1J A;  2FO0 A;  3FLG A;  1H3Z A;  1BCO A;  2IW9 B;  2X4J A;  4FYY B;  1YFN A;  3JCM X;  4PJL A;  1G3Y A;  4CFM B;  4JPB W;  3CXC A;  2C0I A;  4BAC A;  2DYB A;  3CQT A;  1H1P B;  4CFX B;  3CBM A;  3DJB A;  2DPP B;  2COZ A;  4QQ6 A;  1H26 B;  2ED0 A;  2CYZ B;  4KRD B;  4BBS M;  3M0U A;  1KG1 A;  2V1R A;  1PKS A;  4LDU A;  2LJ1 A;  4AFZ C;  2CSQ A;  2F2W A;  4ELJ A;  5AYF A;  4RTZ A;  2O9S A;  4R0K A;  3OS1 A;  1YP5 A;  2R57 A;  5KCO A;  3CBO A;  3UAT A;  4PJO B;  1G8X A;  4ANJ A;  2DJQ A;  4A4H A;  5KYN A;  1RAH B;  3P8D A;  3CCR T;  3X25 B;  2LQW A;  3M03 A;  1FWZ A;  5LJ3 f;  1VQO T;  1GFD A;  1OI9 B;  2K9G A;  3GBQ A;  1D0X A;  4RG8 A;  1JOW A;  1WXT A;  2P84 A;  3FRN A;  4HL4 A;  3CCQ Q;  1OZ2 A;  4HXJ A;  3EFO B;  4M7A B;  3EHQ A;  2L89 A;  2MI6 A;  2HEQ A;  1N9R A;  2X9H A;  3M0Q A;  4C92 F;  3HBL A;  2RO0 A;  1I5L A;  3HKS A;  4HVU A;  1H8K A;  4ZTF A;  1Q7Y R;  1SSF A;  3OB9 A;  2DD4 B;  2BS2 A;  1RAG B;  3EFO A;  3R6O A;  3UPU A;  1BU1 A;  1NPR A;  1FMW A;  2YWW A;  1LVK A;  1N27 A;  1QKX A;  3OW2 S;  1R0C B;  3H8Z A;  5LJ5 f;  2OTL Q;  4OML A;  2L3Q A;  3EFR A;  3OS0 A;  2PMI B;  3CCU T;  3V8J A;  4JJN K;  5L8R E;  1OIY B;  5IH2 A;  1TSF A;  1KD1 R;  1MUZ A;  4M7D E;  1CSK A;  4BY7 X;  4PJN A;  2IG0 A;  2W0Z A;  4YOZ A;  3QWY A;  5GAO n;  4M7D G;  2KR6 A;  3RER A;  4F70 B;  4XAX B;  5GAN 2;  2LMJ A;  2EVR A;  5GAN g;  1PD0 A;  5GAM j;  3M5A A;  2EYW A;  1ZSG A;  2DL3 A;  1OL1 B;  2BE9 B;  4DQ2 A;  4JS5 A;  2H8H A;  3H41 A;  5IT9 E;  1VQ5 Q;  4MFE A;  1VIF A;  1W70 A;  2RPN A;  2EQK A;  1YIT A;  2LCS A;  3HO8 A;  4BDZ A;  5IDN B;  2E70 A;  2NUP B;  2JTF A;  3VS6 A;  3CCS T;  2HKN A;  4A4F A;  2WIP B;  4BCG B;  2HL3 A;  5KE2 A;  5KE3 A;  3C12 A;  5HQ0 B;  1MMN A;  4RTV A;  2EAY A;  2OTL A;  5CQX A;  2FHD A;  1T3L A;  2JS0 A;  3L2U A;  2FRW A;  2B8A A;  4RTT A;  4M7D B;  3A5Z B;  4OB2 B;  2DK3 A;  4M75 B;  3DL1 A;  2YHT A;  3V7R A;  3JAM E;  1Q86 U;  1JJ2 P;  2DER A;  1JO8 A;  3AT1 B;  2OAW A;  5DLO A;  3ASK A;  5CKE A;  1AT1 B;  5GAN d;  1OUL A;  4KH0 B;  5GAO p;  5I2M A;  4GY5 A;  3UT1 A;  3EG0 A;  3KXT A;  2WFY B;  2RM4 A;  2AHJ B;  1PKD B;  4J9C A;  2LX9 A;  1PWT A;  2PVD B;  5CCA A;  4NOY A;  3MHX A;  1P5E B;  3BDL A;  4PJO D;  3GLX A;  2KXC A;  1D09 B;  4RTX A;  3LH0 A;  2WXV B;  3SB2 A;  2KYM A;  4B9X A;  4NC6 A;  3A8M B;  3QWL A;  3BG3 A;  1H1S B;  3TNH B;  2CRE A;  5CR2 A;  4HCC A;  2WMA B;  3TW6 A;  2LCL A;  3GOX A;  5GMK l;  5LJ3 g;  1M1G A;  1O9S A;  4QKU A;  3POM A;  1X43 A;  2DXC A;  1RAC B;  2UZE B;  3VS0 A;  1W2B A;  3CPW S;  1WJQ A;  2EYZ A;  5ICP B;  4RG2 A;  1ZX6 A;  2K7A A;  5GAN j;  4Z6Y A;  5DLQ E;  4EPC A;  1UGR B;  1OKV B;  2LZ6 B;  3UDC A;  2LC4 A;  3C0C A;  2MWO A;  2G6F X;  1IGQ A;  3LLR A;  1GUX B;  4DA4 A;  4M77 C;  2RF0 A;  4CC2 A;  1VQM A;  1AZE A;  4C5H A;  4ROD A;  4C8Q A;  3M57 A;  3WVD B;  1BBZ A;  1QMC A;  2LJ0 A;  4B9W A;  2EQU A;  4C8Q F;  3I55 A;  3JV3 A;  3BG9 A;  5I5Z B;  3EG9 A;  4BCH B;  3DOG B;  1QP2 A;  2K2V A;  4JDS A;  4YOS A;  2JTM A;  1BK2 A;  1QKW A;  2E3H A;  3MKD A;  5IXF A;  5J26 A;  2M9U A;  3QKJ A;  5IHK A;  2CP5 A;  1QVG P;  4MDW A;  3CC7 Q;  3MP8 A;  1W2B S;  2ZPE B;  2QQR A;  2K5F A;  5HBE B;  3JB9 H;  2KR3 A;  3S6W A;  4N0A A;  1VOL A;  2HBP A;  1C1A A;  1G3W A;  5FU6 B;  2ZCF B;  1YIJ Q;  5GAM d;  1EIF A;  2WJ9 A;  1Q95 G;  2X3X D;  5GAN e;  1YI2 Q;  2E5K A;  1X6B A;  3OMG A;  2OTJ T;  2AKK A;  4L5G A;  3OW2 P;  3HL8 A;  1K9M U;  1PCX A;  2RN8 A;  4BCM D;  4ORZ A;  2SRC A;  1K0X A;  3HFN A;  3CME T;  2G77 A;  3L42 A;  5IHI A;  4OMO A;  1UNH D;  5D6Y A;  3L2Z A;  1JRI A;  4PKC C;  1VQ8 T;  1KQS A;  3CC7 T;  2YUP A;  1PRM C;  1RLQ C;  2ABL A;  1M4Z A;  4II1 A;  4RTY A;  1Q86 C;  4ROE A;  2B86 A;  4IUV A;  2P0K A;  4VUB A;  1YJW A;  1RAI B;  1WFW A;  1U1S A;  4UC4 A;  4GBQ A;  2Y4Y A;  2WMB B;  4GLM A;  1YNZ A;  4PJO G;  3RNJ A;  2CP7 A;  1Q81 U;  2M51 A;  3TU4 K;  2RJE A;  3OA6 A;  3H6Z A;  4IUT A;  5KYW A;  2ED1 A;  3KUF A;  2LQK A;  2X51 A;  2E41 A;  2KRS A;  4QQG A;  2CUB A;  4R55 A;  3V7S A;  1RI0 A;  4OB1 B;  4KUI A;  3T9N A;  3CCJ A;  1Q82 C;  5GMK e;  2F2C A;  4II5 B;  4LXC A;  2O01 E;  1QWE A;  3JCM P;  2C4G B;  4M7A E;  2HCK A;  2XHC A;  3NDQ A;  4M78 D;  1M1F A;  4OMN A;  5I22 A;  3J7A F;  3REA B;  2EWN A;  2CT3 A;  1KSW A;  2E6N A;  3LYI A;  3MI9 B;  3QHW B;  1VYV A;  3G71 A;  2WAC A;  2CCH B;  4J5Y A;  4FU6 A;  2KXD A;  1KC8 R;  1VYU A;  2M0Y A;  1QVF P;  4AKH A;  2I40 B;  1RAD B;  4ME7 A;  4A63 B;  3N5B B;  2RJF A;  1UHC A;  2DRK A;  4M77 G;  2CP2 A;  3F70 A;  1YI2 T;  4DBQ A;  2F5T X;  3I35 A;  3CBP A;  2DVJ A;  2C0T A;  3L2V A;  5M9O A;  5GJV B;  3GTM S;  1YN8 A;  4JUV A;  4ROC A;  3BDU A;  4ELY C;  5A0D A;  2ROT A;  2HZY A;  1JB0 E;  1HSQ A;  4IUP A;  2D1X A;  3TEE A;  4BCN B;  4AKG A;  2PK9 B;  4F04 B;  4C8Q B;  4M7D D;  2DZC A;  1BB9 A;  4IIM A;  4KUD K;  5IF1 B;  2WIH B;  1TUD A;  4ZGE B;  5CIU A;  3RDV A;  2JMC A;  2RQT A;  4JZ3 A;  2RK1 A;  4KGX B;  2L2P A;  4N4G A;  2PTK A;  2K3X A;  3X24 B;  1E6G A;  1UNG D;  2EJ9 A;  4CC4 B;  5A2Q E;  5A0L A;  1TXQ A;  2P0Q A;  1Q86 R;  2EQJ A;  2YUQ A;  4EOK B;  1E7O A;  5CYI B;  3RES A;  1N8R U;  3SWN A;  3VV0 A;  2BZY A;  2A3L A;  4F7U F;  1U1T A;  2E4H A;  4X1V A;  2RJD A;  1VYW B;  1K4U S;  2M1H A;  1B7T A;  5I11 A;  4M77 B;  4DEY A;  1TOV A;  3CC7 A;  2HDA A;  2DTI A;  4PJO F;  1H1Q B;  2FL7 A;  3RBB B;  4RMO A;  3MET A;  1KQS S;  2M16 A;  3RR6 A;  3ZFJ A;  2MAM A;  2X1N B;  4B6M A;  1SPK A;  1Q82 R;  3SEM A;  2J06 A;  3REB B;  3GF5 A;  4YC3 B;  4RCC A;  2WSF E;  1NLO C;  1SHF A;  3CMA Q;  3HRS A;  2PHG A;  2KGT A;  1X01 A;  4KRC B;  1VQM Q;  3K7A M;  4Y28 E;  5DQV A;  2D0N A;  4YTL A;  2NLU A;  3TNI B;  2E6Z A;  3EGX B;  1HXD A;  4DOV A;  5I2S A;  1NJI U;  1U3O A;  2JW4 A;  4PJO E;  1NJI C;  1VQL Q;  3VS2 A;  4M78 A;  1WYX A;  3QYB A;  4M75 E;  3VS7 A;  3CCS A;  5IDP B;  2RA2 A;  1VQ5 T;  2GFA A;  1GH6 B;  3HHT B;  2JMA A;  1Y71 A;  2GQI A;  3QUI A;  1B34 B;  1VQK T;  3OYG A;  2UZB B;  3BG5 A;  1MGQ A;  2DEU A;  2FB7 A;  5GAO l;  4EOO B;  1JXO A;  1M3C A;  4M77 F;  3DDP B;  3QHS A;  2DME A;  1K8A C;  1I1J A;  2QDL A;  1N9S A;  3M9Q A;  2LJ3 A;  1Q7Y U;  3PMT A;  5KYX B;  4M7A G;  4AFQ C;  2NUT B;  3CMA T;  3G71 T;  4HNU A;  4F7N B;  1OI1 A;  2KE9 A;  1J3T A;  5FW9 A;  2R5A A;  2FZG B;  2CP0 A;  2PU9 B;  2EYY A;  1AEY A;  2XIC A;  3SHW A;  4BB7 A;  1WLP B;  1XNI A;  3FC3 A;  4LD6 A;  3EG1 A;  3VUZ A;  4AI6 A;  1WHL A;  2NUP A;  2EIF A;  3G4S A;  1AD6 A;  3NTI A;  2DL8 A;  3U23 A;  3NMZ C;  5D6X A;  3VRY A;  2XG8 D;  1GFC A;  4QT7 A;  3X28 B;  1KJW A;  2COW A;  3FJP A;  4QSH A;  1TWB A;  1B3Q A;  1OZ3 A;  2FEI A;  2AK5 A;  4OMM A;  3VU3 C;  2K3B A;  4TVR A;  5LJ5 g;  1D3B B;  1WJS A;  5ACB A;  3RMQ A;  3OYK A;  2DAQ A;  2JS2 A;  1G3T A;  1IHV A;  4A4E A;  3MEW A;  3G71 Q;  3CC4 Q;  1WPY A;  4F7L B;  3OMC A;  4EOI B;  1U06 A;  3OSV A;  5HKC A;  2E12 A;  1KQS P;  3LQ5 B;  3JCM J;  1D3B A;  3TVT A;  3OQ5 A;  2J6K A;  4EOP B;  1MMG A;  2BS3 A;  2D8H A;  1QCO A;  2X3W D;  3I56 A;  2BPM B;  1UEB A;  3NHN A;  4D8D A;  4J9F A;  2E5Q A;  4E7I A;  1M1K U;  2IVX A;  1NBE B;  3QJ6 A;  3RKY A;  1VQM T;  4J9I A;  2V1Q A;  4JRP A;  3RKX A;  2DD5 B;  4QVC A;  4BD3 A;  4OVA A;  4PFZ A;  2LP5 A;  3F5X B;  8AT1 B;  2DA9 A;  4BE0 A;  2DEQ A;  1MMD A;  2KBT A;  1Z9Z A;  4M75 D;  5FRM A;  1ZA2 B;  5LJ5 j;  4EOR B;  1E9H B;  4BCN D;  3CC2 T;  3JCM W;  1BCM A;  3TSW A;  3JB9 G;  3BE3 A;  2I2L A;  1KC8 C;  1AIS B;  3RUX A;  4BI8 B;  1EX4 A;  1GCQ C;  4RCB A;  1YJW Q;  5DM7 R;  2PVO B;  2RQV A;  1RI9 A;  1I81 A;  2GFU A;  2ROL A;  4ZN3 A;  4QW2 A;  1NZ9 A;  3M0R A;  3HP9 A;  2VV5 A;  1IRX A;  4X34 A;  2XU8 A;  4QQD A;  4J8O A;  4M6V A;  2QQ8 A;  4IUR A;  2GGR A;  5CKB A;  3CCM A;  1N8R R;  5IAY A;  2L8D A;  3PIP A;  3CCE T;  1GCQ A;  1XJW B;  1VQK A;  4C0F A;  2NUZ A;  2DRM A;  3VS1 A;  1SG5 A;  4BXX X;  5LJ5 h;  8ATC B;  4DBR A;  4EMK A;  3L2W A;  4GLK A;  5LJ5 e;  4EDU A;  3GP8 A;  2YRD A;  1VQ8 A;  4E7L A;  1H24 B;  5FGK B;  5LJ5 d;  4D8K A;  1Q7Y C;  3GPL A;  2HMA A;  1PKT A;  2JTE A;  3VUB A;  4EMK B;  2EFI A;  1VA7 A;  2CP6 A;  2LNH B;  1VQ7 Q;  4EOJ B;  2EGE A;  4XK8 E;  4A54 A;  2PK2 A;  1B34 A;  5CVI A;  2CJM B;  4FCY A;  1ZBJ A;  1ZSZ B;  3OS5 A;  4QVZ A;  1GL5 A;  2OTJ A;  3EH1 A;  1NEB A;  2EQI A;  3LH5 A;  2X4X A;  3ME9 A;  4C92 D;  1URC B;  2A28 A;  2WHB B;  4DEX A;  2HQH A;  3DLM A;  3OSS C;  2PVG B;  1VQ6 A;  1UJ0 A;  1XTD A;  3OYJ A;  2KVQ G;  4BCK B;  4K11 A;  1OPK A;  2EYQ A;  2BTT A;  2E3I A;  2DKG A;  5GMK h;  2RHI A;  3OBW A;  4M7A A;  3SFM A;  3INZ A;  3L2Q A;  1IRE B;  4IIO A;  2NWM A;  1OPL A;  2QAZ A;  1O9K A;  4JJC A;  2SEM A;  4AKI A;  2BE7 D;  5GAN h;  1VQ5 A;  4R56 A;  3JCM h;  1OEB A;  3VYG A;  4IUQ A;  4LDV A;  1M27 C;  4F6S B;  2AT1 B;  2EJF A;  1NG2 A;  2CGH A;  4JX6 A;  4CFU B;  1W4S A;  3MCA B;  1VQ8 Q;  4A4G A;  3PFS A;  1OU9 A;  1XQH A;  4J9H A;  1YIJ T;  4J9G A;  1ZP2 A;  4E2F B;  3JCM e;  3MO8 A;  3PO3 S;  1FX7 A;  2V8J A;  1OOT A;  4M75 A;  3DB3 A;  1NE8 A;  1H3H A;  1PG5 B;  3QPH A;  4PK4 A;  3CCQ A;  1AWW A;  3HTR A;  3MEV A;  1ZLM A;  4AG2 C;  1FXX A;  3M0P A;  4IMY B;  1VQN A;  3HRU A;  4O6J A;  4NST B;  2V8I A;  3EOC B;  4HT8 A;  5HBJ B;  2RQR A;  1UTI A;  1AWX A;  5KYX A;  2BUD A;  2YLB A;  2AZS A;  2YUO A;  2YRV A;  2DF6 A;  3OYN A;  2EKO A;  2VUB A;  3MP1 A;  3EJ1 B;  1R8O B;  1VQL A;  1RL2 A;  5L23 A;  1XOV A;  3VRZ A;  2RHY A;  1X2Q A;  2A0F B;  2DBK A;  4RUG A;  2F69 A;  3VS4 A;  3VS3 A;  1E7P A;  2RQU A;  4HCZ A;  5I21 A;  1QCF A;  2XDD A;  1ENW A;  2ECZ A;  1QLY A;  1UG1 A;  2K2M A;  3G1J A;  5DQW A;  3QYH B;  1G2B A;  9ATC B;  4LDW A;  3E19 A;  3EH2 A;  3VJP A;  4A4K A;  1F1B B;  1MHN A;  1VQO Q;  3C94 A;  1VQ4 A;  2Y4X A;  1M3A A;  2H3J A;  3PVQ A;  1M2O A;  5CEI B;  4PNO A;  2D6F A;  2CZ1 B;  2VGM A;  2QDY B;  2UZD B;  4LUD A;  2HAX A;  5FU7 C;  1NJI R;  1WA7 A;  2QK0 A;  1T0H A;  2JZ2 A;  2VVK A;  2LDM A;  4M75 C;  3RIR A;  3CC4 A;  3BHT B;  3ZBD A;  4C92 A;  1BI2 A;  4C8Q E;  2DMO A;  1RUW A;  3OY9 A;  1SSH A;  3URG A;  3M58 A;  1M5Q 1;  4ZNX A;  1S72 A;  1KXU A;  4J9E A;  4IKF A;  4LOC A;  2RI3 A;  2FYK A;  2DXB A;  4J6Y A;  2F2V A;  3QYE A;  1AD5 A;  4LDX A;  2DD4 A;  2VC8 A;  1GBQ A;  5KYY B;  3JB9 J;  3BHV B;  3RMS A;  4KGV B;  2R58 A;  2A36 A;  1H92 A;  2EGC A;  1JST B;  2DXC B;  4O5V A;  3I5S A;  3OYC A;  4CC7 A;  4HNT A;  2QDJ A;  3PT9 A;  4MZP A;  4M78 G;  1WJR A;  2C0O A;  2QEX A;  4C0G A;  1K73 R;  3QSU A;  3UA7 A;  3CCM T;  2WEV B;  4MIM A;  1VYT A;  3BW1 A;  2QAS A;  2QGF B;  4LNP A;  3G7Z A;  4JLI A;  1Y7X A;  4M7D A;  4M77 E;  2AZV A;  3QDF A;  2KT1 A;  2LQN A;  4BY1 X;  1V29 B;  4BCQ B;  3DDQ B;  2VWF A;  4BY6 C;  1RAF B;  1S1N A;  3JCM b;  1VQN Q;  3OYY A;  4F6U B;  4JLG A;  1P92 A;  4DBF A;  4C5E A;  1WQW A;  3OYM A;  7AT1 B;  3G4S T;  1MND A;  5LL6 S;  4PJM A;  1G3N C;  4N4H A;  4HNV A;  2DIG A;  2DTH A;  2MCN A;  4XU2 A;  4XU3 A;  3BLR B;  1M90 U;  2DTO A;  4HKE A;  3WVE B;  5HY6 A;  1HK9 A;  3G6E T;  5IXB A;  1JEG A;  1VOM A;  2RHU A;  2GQV A;  3A1P A;  5LQF B;  3JB9 D;  1X2K A;  4C8Q C;  5KCH A;  1NM7 A;  3CCL Q;  1N6A A;  4ZGJ B;  4L6V 5;  1TTH B;  4M78 B;  1PSE A;  2UZL B;  1MV3 A;  3L1A A;  4J6W A;  1RAB B;  2J6O A;  1C6V X;  3LW5 E;  5FU6 C;  1WDX A;  4OMQ A;  4Y91 A;  1WHJ A;  1OX9 A;  4M7A C;  5GMK m;  1OL2 B;  4F17 A;  5HNB B;  1Y57 A;  3I9Q A;  3CXC S;  4EC9 B;  1PRL C;  1K9A A;  4JZ4 A;  5HK0 A;  1UHF A;  4UN0 A;  4MML A;  4PLL A;  2JVV A;  4PFP A;  4JX5 A;  1FYN A;  5HK3 A;  1ACM B;  3EHR A;  2DLP A;  3TW7 A;  3NTK A;  3GIB A;  1WZO A;  1U8R A;  1FVV B;  2VYT A;  4AG1 C;  1GRI A;  2JOY A;  1FMK A;  1LOJ A;  1AVZ C;  3PVL A;  4EMG A;  2MIO A;  3CC4 T;  4PJO C;  1VQK Q;  3M0T A;  1UJY A;  2DXU A;  2BKD N;  3PGG A;  4HT9 A;  2DM1 A;  3CCU Q;  4NL2 A;  4BCI B;  3C4S A;  4KBM B;  3CCL T;  2IW6 B;  4BY6 B;  3DTO A;  4E6R A;  4F7U G;  4J6X A;  4M78 F;  1K76 A;  1V1C A;  1G83 A;  3QHR B;  5BNJ B;  3CME A;  4C92 G;  1V76 A;  5GAN 8;  1OQK A;  4C92 E;  2OI3 A;  3JCM f;  2CH4 A;  3H0F A;  4AFS C;  2NYS A;  1D1C A;  2CP3 A;  2LW4 A;  3BLH B;  1T3S A;  2DJZ A;  4HLQ A;  1YIT Q;  2RNA A;  4M4Z A;  4XTY A;  2O4X A;  3NPF A;  3LX7 A;  4ZN1 A;  3HPW A;  4PLI A;  2O2O A;  5GAM e;  1KFZ A;  1UNL D;  3FIF A;  1QQJ A;  1U5S A;  5FWC A;  1QP3 A;  4E7J A;  3QZ5 B;  3CCV T;  1JSU B;  1K73 U;  4HVV A;  3CC2 A;  2EQM A;  3S3N A;  1KD1 U;  4M75 F;  3PTA A;  2F5K A;  3D7S B;  1DJ7 B;  4M7A F;  2R5M A;  3TN8 B;  1UGV A;  1EZZ B;  3JSC A;  1N5Z A;  5D6W A;  2K5I A;  1ZA1 B;  5AT1 B;  2HQE A;  4MFD A;  2F2X A;  2K3Y A;  2UUE B;  1AWJ A;  1UB4 A;  1RLP C;  5CO7 A;  1H4L D;  1JJ2 S;  3CCJ T;  1VQ9 Q;  4HCK A;  2X4Y A;  2HD0 A;  4AT1 B;  1I0C A;  2MOX A;  2MMP A;  2QG9 B;  4Z89 A;  1QVF A;  2P0P A;  2W9Z A;  3MY5 B;  3OYH A;  3CC2 Q;  3HFO A;  2QA4 T;  2RI5 A;  1X69 A;  5GAO q;  5GAM g;  3QZ9 B;  1M2V A;  4XTU A;  1UGS B;  4A53 A;  1QVG S;  2HQX A;  3FB9 A;  4F7U B;  3H0I A;  1JBM A;  4LD9 K;  3I56 T;  3FEO A;  2XID A;  1YHQ A;  3OYD A;  3H9N A;  2VKN A;  1TH7 A;  2QQS A;  1SRM A;  5GAO m;  5GMK j;  3A8G B;  3EGX A;  4PFO A;  2DZ9 A;  2IIM A;  5LJ3 e;  5GAN 6;  2OAU A;  2KAF A;  2QQA A;  2ATC B;  4N4I A;  3CME Q;  1YJN T;  4HCB A;  4M7A D;  1NYG A;  1YI2 A;  5CQY A;  5KYW B;  1KK7 A;  3V7C A;  2V26 A;  2CS7 A;  2ZAE A;  1JJ2 A;  1K8A R;  2KT8 A;  1ARK A;  2QEX T;  3OYI A;  2KSS A;  4CRL B;  2DBM A;  5KYU B;  2C5O B;  1SRL A;  4EOS B;  2CUD A;  5FWB A;  4BCQ D;  4WF2 A;  3PIO A;  4OMF B;  4X9C A;  1EFN A;  4XU0 A;  1TFB A;  1D1A A;  1QCN A;  4FIB A;  1D0Y A;  4JRK A;  2QGG A;  3EFS A;  3QO3 A;  4CFN B;  4HA8 A;  1VQO A;  1GXI E;  1BI1 A;  1YIT T;  2J05 A;  2O9V A;  3PE0 A;  1C0M A;  2PJQ A;  1TD6 A;  4BUG A;  3BFM A;  2FRY A;  4CFV B;  1WXU A;  1K1Z A;  1S72 Q;  2YLC A;  2HNI A;  3O5Z A;  5FLX E;  4OGC A;  1WHM A;  1PD1 A;  2QI2 A;  4J83 A;  4BI4 A;  4ESR A;  4XTV A;  4C8Q D;  3CCM Q;  2ZPI B;  3S3M A;  2BIV A;  4KRT A;  1LCK A;  3LWI A;  2FPD A;  2EBP A;  2F1L A;  3CD6 A;  5ECA A;  2DIL A;  4I3Z B;  3FDR A;  2MK5 A;  3R6N A;  4ATO A;  1WHK A;  2AKL A;  4FT2 A;  4PJO A;  1Q81 R;  3X26 B;  1AHJ B;  3E1S A;  2KMG A;  1GCP A;  4F16 A;  4ZGD B;  1VQ4 T;  3SD4 A;  2X4W A;  1X6O A;  3JCM Q;  1TUC A;  1VQN T;  2ZPB B;  3NFC A;  2QF7 A;  1NPP A;  2DXT A;  3EGD B;  4BBR M;  3UWN A;  2A37 A;  4FSX A;  2RD1 A;  1WHG A;  1JU5 C;  2XK0 A;  4C0Z A;  3LWH A;  2EW3 A;  2VXE A;  3CPF A;  3EG3 A;  1SEM A;  4Y72 B;  2C6T B;  4JS4 A;  3BLQ B;  2PUK B;  2XDP A;  4EMK C;  4C5I A;  4F7J B;  1HYO A;  2W9F A;  2NUT A;  2ZPF B;  1GUX A;  3P8B B;  2IN3 A;  2G3R A;  5EG2 A;  1H28 B;  2M02 A;  1QLB A;  5GAN 3;  2PZ1 A;  4AFU C;  2CZ0 B;  5EFQ B;  2R7G A;  4KGZ B;  1VUB A;  5C0M A;  1O9K B;  2DE0 X;  1G3S A;  2LCC A;  3QWX X;  4KH1 B;  1ZHI A;  2L5Q A;  1F5Q B;  3CMA A;  2FZK B;  2RK2 A;  3ULR B;  4L59 A;  5LMK B;  3HSB A;  1E6H A;  3QXE B;  1UUE A;  4RTW A;  1M90 R;  1YBY A;  3BHU B;  1YIJ A;  4M77 A;  1IXD A;  4C0D C;  1Y07 A;  1UGP B;  2KK4 A;  1Q81 C;  2C5V B;  4J7I A;  3X20 B;  1W1F A;  2YXY A;  1BI3 A;  4FW2 A;  3UF4 A;  4E7S A;  4JRI A;  4G6L B;  4FL6 A;  1GBR A;  1VQ7 A;  2C5X B;  2RI2 A;  1UFF A;  5HCK A;  2E1H A;  4FYX B;  1T0J A;  1KQ1 A;  1D1B A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  2LVM A;  3E9G A;  5CK9 A;  1Y96 A;  4C8Q E;  4KUD K;  3O8V A;  3AHU A;  3PNW C;  3OY9 A;  4ZTJ A;  4XTW A;  4ZGE B;  5CIU A;  2LTO A;  4F7U A;  1N8R U;  2PUO B;  2Y90 A;  3URG A;  5GAO r;  3M58 A;  2ZPH B;  1M5Q 1;  1M9S A;  4N0A C;  3CEY A;  2RK1 A;  2OTL T;  1S72 A;  2E10 A;  2V8K A;  1YHQ T;  2XDB A;  4C0D B;  4N4G A;  3OYE A;  4IKF A;  4LOC A;  2K3X A;  3X24 B;  2RI3 A;  2FYK A;  2DXB A;  3Q1J A;  2EJ9 A;  4J6Y A;  5A2Q E;  3JRZ A;  3QYE A;  1KQ2 A;  4LDX A;  5A0L A;  1YJ9 T;  2BS4 A;  2QFZ A;  2DD4 A;  2P0Q A;  3FLG A;  1H3Z A;  2XI9 A;  2VC8 A;  3DKM A;  3OYL A;  2EQJ A;  3NTH A;  5CKH A;  4OGE A;  3G6E A;  3JB9 J;  3RMS A;  2X4J A;  2R58 A;  3JCM X;  1G3Y A;  2DXC B;  2MWP A;  4O5V A;  3RES A;  3CXC A;  3OYC A;  4M78 C;  3SWN A;  2CZ6 B;  3VV0 A;  4HNT A;  2QDJ A;  2A3L A;  3PT9 A;  3LGF A;  4MZP A;  4F7U F;  1U1T A;  1VQP A;  4M78 G;  3CBM A;  2DPP B;  1WJR A;  1WNL A;  4C92 A;  2QEX A;  4QQ6 A;  4C0G A;  2D0Q B;  2RJD A;  2CYZ B;  2M1H A;  3QSU A;  4BBS M;  3CCM T;  1KG1 A;  4MIM A;  3BW1 A;  4LDU A;  4M77 B;  4ELJ A;  3G7Z A;  4JLI A;  1Y7X A;  1I8F A;  2DTI A;  5AYF A;  4PJO F;  2FL7 A;  3OS1 A;  4M7D A;  4RMO A;  3MET A;  2R57 A;  4M77 E;  4XQ3 A;  5KCO A;  3CBO A;  1KQS S;  4PJO B;  2M16 A;  3J81 E;  3OYA A;  3ZFJ A;  5C6S A;  2RHZ A;  3QG1 A;  4A4H A;  2MAM A;  2X35 A;  3P8D A;  3CCR T;  1V29 B;  3X25 B;  1FWZ A;  4V2S A;  5LJ3 f;  3GF5 A;  1VQO T;  1WQ7 A;  4BY6 C;  3KHI A;  4RCC A;  2WSF E;  3VKH A;  1LNX A;  4RG8 A;  3JCM b;  2K57 A;  3OYY A;  3HRS A;  4JLG A;  1X01 A;  1P92 A;  3FRN A;  2M0O A;  4C5E A;  4HL4 A;  4Y28 E;  1Y96 B;  1WQW A;  2LNV A;  1OZ2 A;  4YTL A;  3OYM A;  3G4S T;  4M7A B;  2NLU A;  5LJ3 e;  2L89 A;  2E6Z A;  2MI6 A;  5LL6 S;  1BIB A;  1HXD A;  4N4H A;  1N9R A;  4DOV A;  5I2S A;  1NJI U;  4HNV A;  2DIG A;  2K5L A;  4C92 F;  3HBL A;  2DTH A;  2RO0 A;  1I5L A;  1K9M C;  4PJO E;  3HKS A;  4XU2 A;  1QW1 A;  4XU3 A;  1M1K U;  1NJI C;  1YJ9 A;  2DTO A;  4ZTF A;  4M78 A;  1M90 U;  3QYB A;  2ZZD A;  3WVE B;  1SSF A;  4HKE A;  4M75 E;  1HK9 A;  5HY6 A;  2RB6 A;  3G6E T;  3OB9 A;  2DD4 B;  1H64 1;  2BS2 A;  3CCS A;  2RA2 A;  1VQ5 T;  2GFA A;  2WSC E;  1M90 C;  3R6O A;  3CCL A;  2RHU A;  3UPU A;  2GQV A;  1NPR A;  2LT1 A;  3JB9 D;  3HHT B;  1YCY A;  1Y71 A;  3CCE A;  3JCM g;  1N27 A;  4C8Q C;  3QUI A;  4DOW A;  1B34 B;  5KCH A;  1VQK T;  1N6A A;  3OYG A;  3BG5 A;  4ZGJ B;  4L6V 5;  1MGQ A;  3OW2 S;  2FB7 A;  4M78 B;  3VKI A;  1PSE A;  5FRO A;  5LJ3 j;  3H8Z A;  2VGN A;  4RKU E;  5LJ5 f;  5GAO l;  3KBG A;  4E7K A;  1IZ6 A;  3EFR A;  3L1A A;  3OS0 A;  3CCU T;  4J6W A;  4M77 F;  3V8J A;  1VQP T;  3QHS A;  1K8A C;  1N9S A;  3M9Q A;  4JJN K;  3LW5 E;  5FU6 C;  1Q7Y U;  5L8R E;  2XD0 A;  3PMT A;  4M7A G;  4Y91 A;  1K8A U;  4M7A C;  3CMA T;  5GMK m;  1BIA A;  3G71 T;  4HNU A;  2DO3 A;  3CXC S;  1OI1 A;  3SDZ A;  1N8R C;  2D9T A;  3GNG A;  3V8K A;  4M7D E;  2E65 A;  2R5A A;  2IG0 A;  5GAO n;  3CCQ T;  4M7D G;  2PU9 B;  2KR6 A;  5HK0 A;  3RER A;  2XIC A;  4XAX B;  4MML A;  5GAN 2;  1M8V A;  4BB7 A;  4PLL A;  5GAN g;  4C8Q G;  5GAN 4;  1XNI A;  5GAM j;  2JVV A;  3M5A A;  4JX5 A;  5HK3 A;  3FC3 A;  4LD6 A;  3VUZ A;  1K73 C;  4AI6 A;  4DQ2 A;  4JS5 A;  2CZ7 B;  3SWN C;  5FRN A;  3TW7 A;  3NTK A;  2EIF A;  5IT9 E;  3QII A;  3GIB A;  2P4T A;  3G4S A;  4MFE A;  1VIF A;  1U8R A;  3NTI A;  2VYT A;  3RKW A;  4BDY A;  2JOY A;  1X75 C;  2EQK A;  1LOJ A;  5D6X A;  1YIT A;  1VQL T;  4BDZ A;  3HO8 A;  2XG8 D;  4EMG A;  1VQ6 T;  2E70 A;  3CC4 T;  4PJO C;  3X28 B;  4EMH A;  3S3O A;  2DXU A;  3FJP A;  4QSH A;  2BKD N;  2JTF A;  2VXF A;  3QJY A;  3PGG A;  1OZ3 A;  4HT9 A;  3CCS T;  3VU3 C;  1I4K 1;  3P8H A;  4NL2 A;  4A4F A;  3C4S A;  4KBM B;  5KE2 A;  4TVR A;  5KE3 A;  1D3B B;  3C12 A;  5LJ5 g;  3CCL T;  1WJS A;  1OYX A;  4M7D C;  4BY6 B;  3RMQ A;  4F7U G;  3OYK A;  2DAQ A;  4J6X A;  1G3T A;  4M78 F;  2EAY A;  4A4E A;  3MEW A;  2OTL A;  5CQX A;  1ZQ1 A;  1WPY A;  4P5N A;  2FHD A;  2KMT A;  3OMC A;  4M77 D;  3L2U A;  5HKC A;  1KHC A;  2B8A A;  3OSV A;  2E12 A;  4C92 G;  5GAN 8;  2DVE A;  3CME A;  4M7D B;  3A5Z B;  3CCU A;  2KDS A;  2QXF A;  4OB2 B;  2DK3 A;  4OB0 B;  1D3B A;  4M75 B;  3OQ5 A;  3A8O B;  4C92 E;  5CKD A;  5KH6 A;  3JCM f;  3DL1 A;  2YHT A;  3V7R A;  3JAM E;  1Q86 U;  2BS3 A;  2DJZ A;  3I56 A;  3CCV A;  3WXM B;  4HLQ A;  2JN0 A;  1UEB A;  3TRE A;  4XTY A;  5DLO A;  3ASK A;  5CKE A;  3M56 A;  2E5Q A;  2O4X A;  4D6W A;  5GAN d;  3LX7 A;  5GAO p;  4ZN1 A;  3HPW A;  4GY5 A;  3A8L B;  4PLI A;  5I2M A;  3UT1 A;  3QJ6 A;  4E7I A;  3RKY A;  5GAM e;  3KXT A;  1VQM T;  1UGQ B;  3FIF A;  2RM4 A;  3OYF A;  2QQ9 A;  2AHJ B;  4JRP A;  1QP3 A;  4E7J A;  3RKX A;  2DD5 B;  2LX9 A;  3QZ5 B;  3CCV T;  4QVC A;  1K73 U;  2PVD B;  4BD3 A;  4OVA A;  5CCA A;  4NOY A;  3CC2 A;  2EQM A;  3S3N A;  3MHX A;  2O4X B;  1KD1 U;  4M75 F;  4ELZ C;  3PTA A;  2F5K A;  1DJ7 B;  4BE0 A;  1VIE A;  3BDL A;  2R5M A;  2DEQ A;  4M7A F;  3GLX A;  4PJO D;  3QYG B;  2ZPG B;  3JSC A;  3LH0 A;  5D6W A;  3SB2 A;  4M75 D;  4C5G A;  5FRM A;  4B9X A;  4NC6 A;  2K5I A;  2HQE A;  5LJ5 j;  4MFD A;  3A8M B;  3QWL A;  3CPW A;  2K3Y A;  3CC2 T;  3JCM W;  3BG3 A;  1UB4 A;  5CO7 A;  2C06 A;  1QVF S;  3JB9 G;  1JJ2 S;  3CCJ T;  4PL6 A;  5CR2 A;  3JCM V;  2I2L A;  2X4Y A;  2HD0 A;  3RUX A;  1KC8 C;  3E9F A;  4HCC A;  3TW6 A;  4BI8 B;  2LCL A;  2MMP A;  4RCB A;  3GOX A;  5GMK l;  5LJ3 g;  5IN1 A;  5DM7 R;  1VQ9 T;  1VQ7 T;  1M1G A;  1O9S A;  1QVF A;  2P0P A;  2PVO B;  3ER0 A;  3M4G A;  2LRQ A;  1I81 A;  2GFU A;  2DXC A;  3OYH A;  3HFO A;  1W2B A;  4ZN3 A;  3CPW S;  1WJQ A;  4QW2 A;  2RI5 A;  2QA4 T;  4RG2 A;  2MF2 A;  1NZ9 A;  3HP9 A;  5GAO q;  2VV5 A;  5GAM g;  4BE1 A;  3HB9 A;  1FKM A;  3QZ9 B;  4X34 A;  4XTU A;  1UGS B;  2XU8 A;  4A53 A;  2HQX A;  2XKO C;  4Z6Y A;  3FB9 A;  4J8O A;  4QQD A;  4F7U B;  5DLQ E;  5GAN j;  4M6V A;  1JBM A;  2QQ8 A;  3GNF B;  4IUR A;  4EPC A;  5FU7 B;  5CKB A;  1UGR B;  3CCM A;  4LD9 K;  3UDC A;  2LC4 A;  3I56 T;  2MWO A;  3FEO A;  2XID A;  1YHQ A;  3OYD A;  5IAY A;  1M1K C;  4FT4 A;  2L8D A;  3PIP A;  2DXB B;  3LLR A;  2KY9 A;  2QA4 A;  3CCE T;  4DA4 A;  1TH7 A;  4M77 C;  1VQK A;  4XU1 A;  4C0F A;  4E7H A;  3MEA A;  2QQS A;  4MMK A;  5GAO m;  1VQM A;  5LJ5 h;  4C5H A;  4OB3 B;  5DY9 A;  5EJC A;  5GMK j;  3A8G B;  5GAN 7;  4EMK A;  3L2W A;  4GLK A;  2DZ9 A;  4C8Q A;  5LJ5 e;  3WVD B;  3M57 A;  4B9W A;  2OAU A;  2KAF A;  2QQA A;  4OF1 A;  2EQU A;  2QQB A;  4N4I A;  4C8Q F;  5GAN 6;  3I55 A;  4EDU A;  3GP8 A;  3CCR A;  3BG9 A;  1YJN T;  1VQ8 A;  4E7L A;  2WSE E;  4HCB A;  4M7A D;  2DD5 A;  3M55 A;  4MDX A;  1YI2 A;  5CQY A;  1QP2 A;  5LJ5 d;  5LJ3 d;  2K2V A;  4JDS A;  2JTM A;  3V7C A;  1BI0 A;  2CS7 A;  3VYH B;  4M78 E;  4XTX A;  4NL3 A;  3GPL A;  1Q7Y C;  1JJ2 A;  3VUB A;  2QEX T;  3OYI A;  2KSS A;  4EMK B;  2EFI A;  5J26 A;  2DIQ A;  2M9U A;  3QKJ A;  1YJW T;  4A54 A;  4XK8 E;  3I55 T;  1B34 A;  4C92 C;  3VKG A;  5CVI A;  4MDW A;  4WF2 A;  3PIO A;  3MP8 A;  1KC8 U;  4OMF B;  4OP0 A;  2EJG A;  4X9C A;  1W2B S;  2ZPE B;  2QQR A;  2K5F A;  3M4Y A;  3M53 A;  4XU0 A;  3OS5 A;  4QVZ A;  3JB9 H;  3S6W A;  4CRI A;  2OTJ A;  4N0A A;  4C92 B;  4F7U E;  4M75 G;  2HBP A;  3DLL A;  2X4X A;  1G3W A;  4FIB A;  5FU6 B;  3ME9 A;  4JRK A;  4C92 D;  3EFS A;  2ZCF B;  3QO3 A;  5GAM d;  1EIF A;  1S72 T;  2WJ9 A;  4HA8 A;  1VQO A;  2LT4 A;  1BI1 A;  1GXI E;  5GAN e;  1YIT T;  3DLM A;  3OSS C;  2PVG B;  1VQ6 A;  3CC7 A;  2PQW A;  1XTD A;  3OMG A;  4X9D A;  2OTJ T;  3OYJ A;  3QBY A;  2KVQ G;  4L5G A;  4BUG A;  3HL8 A;  2EYQ A;  3JB9 F;  3BFM A;  1K9M U;  3EAE A;  5GMK h;  2DKG A;  4JX4 A;  2RHI A;  3OBW A;  3SFM A;  4M7A A;  3INZ A;  2K4Y A;  3L2Q A;  1Q82 U;  1IRE B;  4IUU A;  3TCJ A;  2YLC A;  2HNI A;  5FLX E;  4OGC A;  3MEU A;  5GAN f;  2QI2 A;  1KHI A;  4J83 A;  4BI4 A;  5CKF A;  3HFN A;  4XTV A;  4C8Q D;  3CME T;  2G77 A;  2ZPI B;  4AKI A;  3L42 A;  3S3M A;  5GAN h;  2BIV A;  1VQ5 A;  1QVP A;  4R56 A;  5D6Y A;  3L2Z A;  3JCM h;  3VYG A;  1JRI A;  4PKC C;  1YJN A;  3LWI A;  1KQS A;  1VQ8 T;  4IUQ A;  4LDV A;  3CC7 T;  3CD6 A;  4BI3 A;  2EJF A;  4XTZ A;  2CGH A;  1M4Z A;  4II1 A;  4JX6 A;  2QTX A;  1W4S A;  3FDR A;  3MCA B;  1Q86 C;  3J80 E;  4ATO A;  4IUV A;  2P0K A;  4FT2 A;  3A8H B;  4A4G A;  3PFS A;  5J3B A;  4Q5W A;  4PJO A;  4VUB A;  2JNG A;  1YJW A;  3X26 B;  4CI0 C;  3C95 A;  1AHJ B;  1XQH A;  3L2R A;  3E1S A;  1U1S A;  1G5V A;  2KMG A;  3VYG B;  4ZGD B;  1VQ4 T;  4UC4 A;  2CKK A;  2X4W A;  3SD4 A;  1YIJ T;  1X6O A;  3JCM Q;  3OW2 A;  2RJC A;  2Y4Y A;  1VQN T;  2ZPB B;  3M59 A;  4BE2 A;  3CD6 T;  3JCM e;  3NFC A;  3MO8 A;  2QF7 A;  1NPP A;  1FX7 A;  2V8J A;  3LGL A;  2DXT A;  4M75 A;  3HRT A;  3DB3 A;  4BBR M;  4PJO G;  1NE8 A;  3UWN A;  4FSX A;  1Q81 U;  2RD1 A;  3TU4 K;  2LQ8 A;  3QPH A;  2RJE A;  3OA6 A;  3CCQ A;  3H6Z A;  4NS5 A;  5GMK i;  4IUT A;  3MEV A;  2XK0 A;  3MP6 A;  4C0Z A;  3H4C A;  5J39 A;  3LWH A;  1FXX A;  2VXE A;  3CPF A;  3KUF A;  2LQK A;  4Z02 A;  3V8L A;  1VQN A;  3HRU A;  4O6J A;  2V8I A;  5LJ3 h;  2E41 A;  1QVG S;  2JUF A;  4QQG A;  4R55 A;  3V7S A;  4HT8 A;  1RI0 A;  4OB1 B;  4E47 A;  4JS4 A;  2PUK B;  2XDP A;  4KUI A;  4EMK C;  3T9N A;  4C5I A;  1O75 A;  1ZBX A;  3CCJ A;  1Q82 C;  1BYM A;  5GMK e;  2BUD A;  2ZPF B;  2YLB A;  3P8B B;  2YRV A;  3OYN A;  2GCX A;  2EKO A;  2VUB A;  2G3R A;  3MP1 A;  5EG2 A;  1R8O B;  1VQL A;  1RL2 A;  2O01 E;  4J7F A;  1VQ9 A;  1QLB A;  5GAN 3;  4MZM A;  3JCM P;  2ZGW A;  4M7A E;  1XOV A;  2RHY A;  2XHC A;  2CZ0 B;  4FM4 B;  3DB4 A;  4M78 D;  1VUB A;  1M1F A;  2F69 A;  5C0M A;  1E7P A;  1BKB A;  4HCZ A;  5I21 A;  1LJO A;  2XDD A;  3JCM c;  1G3S A;  1PSF A;  2LCC A;  3J7A F;  2EWN A;  4LDY A;  3M54 A;  1ZHI A;  2L5Q A;  2RHX A;  2E6N A;  3LYI A;  4QVD A;  3ZEH A;  3CMA A;  3JCM J;  2RK2 A;  3OYB A;  3G71 A;  3QYH B;  2WAC A;  4LDW A;  3E19 A;  4L59 A;  4J5Y A;  4FU6 A;  3HSB A;  3VJP A;  4A4K A;  2E64 A;  3QXE B;  1MHN A;  4AKH A;  2A7Y A;  5GAN 5;  2L3R A;  3OBY A;  4JRQ A;  1YBY A;  3C94 A;  3QDR B;  1VQ4 A;  1YIJ A;  2Y4X A;  4ME7 A;  3HZJ A;  2RJF A;  3N5B B;  4KUL A;  4M77 A;  5CAI A;  4C0D C;  3JCM d;  3JB9 I;  3OS2 A;  1KD1 C;  4M77 G;  1Y07 A;  2H3J A;  1UGP B;  2FVU A;  2KK4 A;  3F70 A;  2D6F A;  4PNO A;  1Q81 C;  2CZ1 B;  2VGM A;  4J7I A;  1YI2 T;  3X20 B;  2F5T X;  2QDY B;  3CBP A;  1BI3 A;  1WGS A;  2GF7 A;  3L2V A;  2HAX A;  5FU7 C;  5M9O A;  3BY7 A;  2RH2 A;  5A0G A;  4JRI A;  2JZ2 A;  4FL6 A;  3BDU A;  4JUV A;  4ELY C;  3SWN B;  5GAM f;  5A0D A;  1VQ7 A;  2LDM A;  2ZZD B;  4M75 C;  3RIR A;  4M7D F;  4BAC A;  2RI2 A;  1JB0 E;  4MZT A;  3CC4 A;  4IUP A;  4KT0 E;  5GAM h;  2E1H A;  3TEE A;  2KQW A;  4AKG A;  1KQ1 A;  4C8Q B;  2IVW A;  3ZBD A;  1QVG A;  3PMI A;  4M7D D;  2DZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...