3A8LB

Crystal structure of photo-activation state of nitrile hydratase mutant s113a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8lB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8lB02
2PU9B 2DD5A 2QDYB 1V29B 1UGQB 2ZPHB 4ZGJB 2D0QB 3HHTB 2DXCB 3X20B 3QZ5B 4ZGDB 2DXCA 1UGPB 2WSFE 2DXBB 1PSFA 1IREB 3X26B 3QYGB 3QZ9B 2DXBA 2WSCE 3X28B 3LW5E 3VYHB 4XK8E 2ZPEB 2WSEE 3A8OB 2CZ6B 2PVGB 4Y28E 4KT0E 2ZPIB 1DJ7B 3X25B 3VYGB 2O01E 3VYGA 4RKUE 2PUKB 1QP3A 3A8LB 2CZ7B 1GXIE 1AHJB 2ZPFB 4L6V5 2CZ1B 4ZGEB 3QXEB 3WVEB 1PSEA 2ZZDB 2ZCFB 2DD4B 2PUOB 3WVDB 2AHJB 2ZZDA 5L8RE 1UGRB 4OB1B 2ZPBB 2DD4A 3QYHB 2DPPB 1UGSB 1QP2A 1JB0E 2CYZB 2CZ0B 2PVDB 3A8HB 4FM4B 2PVOB 3A8GB 3X24B 4OB0B 4OB3B 4OB2B 2DD5B 3A8MB 2ZPGB
chains in the Genus database with same CATH superfamily
2KR6A 1Y07A 2KRNA 1EZZB 2LJ1A 1VQMT 2P0PA 5CQYA 1U5SA 3WXMB 1YJWQ 3CCRT 1UGQB 4C92E 1K76A 2L2PA 3FIFA 1OQKA 4PJNA 1KQ2A 1KXUA 1W1FA 3JB9H 3MI9B 1IGUA 1VQMA 4F6UB 1QVFA 4C0ZA 2XMFA 4M7AE 2Z0WA 1QWEA 1K0SA 2HL5C 4C8QF 2DXCA 3CCRA 3H0IA 1VA7A 2K7AA 4AI6A 3OYYA 3CPWA 3ZBDA 4DBRA 3RMSA 2LJ0A 2WSCE 5CO7A 3LW5E 2RQTA 3CQTA 3ZL7C 2KT8A 2UZDB 2DE0X 2FZKB 5LJ5d 3TVTA 2CSQA 3FC3A 4IURA 4J7FA 4LUEA 1BKBA 1NJIC 5FU7B 2P4TA 2IW9B 2G3RA 5KYXB 4M78C 4JX4A 4M75G 4F7UA 3C94A 2O01E 4FT4A 2DJZA 4J6WA 2CT3A 4AMCA 3ER0A 5AT1B 1VQPQ 3I5RA 4JJBA 1K9MC 3BLHB 2HMAA 2XG8D 3OYNA 1SHFA 3CD6T 3HFOA 1RADB 3LWHA 1Q82R 1QVGA 1UEBA 2DO3A 1QLBA 1OL1B 3PE0A 4HLQA 1VINA 4C5GA 2K3BA 1S72Q 2DEQA 2IG0A 3BHUB 4IMYB 1Q82C 4BCGB 3L2RA 2FPEA 3I5SA 1D1AA 5GAMj 4ME7A 1SSFA 4IUPA 2DLPA 3SWNC 4FYVB 2EAYA 2UUEB 4JS4A 1RLQC 2E6NA 1QKXA 4A53A 4B6MA 5GMKm 2HBPA 1UFFA 2DM1A 1ZUKA 2J05A 1WA7A 4ELYC 3CCLT 5GAMh 3CC2T 2OTJT 1VQLA 2D6FA 3BW1A 4EC9B 2HQHA 2JMCA 4C92B 1SHGA 3BDLA 2VV5A 3OY9A 3I56Q 2HDAA 2OTJA 4MFEA 4M7AB 3BHTB 1OV3A 1LPLA 2L3PA 1GH6B 1UJ0A 2KR3A 2GFUA 3O0GD 3R6OA 1LCKA 2EGAA 1RAGB 4M78D 3UF4A 2LT4A 3VJPA 4FYWB 3QPHA 1U8RA 1FKMA 1VQ5T 4EC8B 2BZYA 4M75A 2DXBA 1K8AU 1I81A 1D3BB 3OYJA 4J9FA 2VGMA 3RIRA 5A0DA 2RA2A 2NUTB 1N8RR 4KUDK 2GQIA 1VQ5A 2HL3A 2EQMA 5GMKi 2HZYA 3REBB 2GGRA 2LMJA 5DY9A 3OBWA 4XTXA 3TSZA 1YJ9Q 4BY7X 1M2VA 3X25B 3QHWB 4YOOA 1M1KU 4PFPA 2NUPA 2E5QA 1OULA 3N5BB 4J8OA 1JJ2A 5AYFA 5KYNA 2FG0A 2O88A 4JRKA 2W9FA 1TUDA 2OAWA 1H92A 3TNWB 4J9GA 1WXUA 1WDXA 2JMAA 1H24B 1Y0MA 4A4EA 2G6FX 4BCQB 2ZAEA 3WVEB 4AKHA 2VUBA 2A36A 4CXAB 2RJFA 4PJOB 1W2BP 2BTTA 5CKHA 2ZZDA 5LJ5g 2CDTA 1IO6A 2FPFA 1UNGD 1MV3A 1H25B 2B8AA 1LVKA 1I4K1 1ZA1B 4NL3A 2EJGA 2CYZB 1KD1R 2KAFA 3QWYA 4M78F 2EUFA 1SRLA 1KK7A 1VIFA 4CC4B 5KE3A 2LP5A 3G4SQ 1OKWB 4BCIB 1U06A 1PD1A 2DBKA 2XICA 1KD1C 1JEGA 4A4FA 2C5XB 2QA4Q 1RI0A 4FYXB 1IXDA 4M77C 2WHBB 2EQIA 5GMKe 3P8DA 1VQ8T 2RO0A 3O5ZA 1I07A 4ZGJB 4JJNK 3JAME 1X6OA 1YCYA 2DXCB 1M1FA 5CEIB 2QXFA 4C0DB 3BG9A 1T0HA 3JCMJ 1AT1B 2W96A 3VS2A 1UG1A 1IREB 4M75E 4QVCA 3FRNA 1IHWA 2L5QA 2CP5A 4JZ4A 4J9EA 2ECZA 1WHHA 4MZTA 1RLPC 3OB9A 4Z02A 3VKHA 3PIPA 1H641 1YJNT 1QVFP 3V8JA 2O9VA 2WMBB 1GBRA 3JCMh 3PFSA 3CCSQ 1B07A 3GTMS 2QYZA 4F7UB 3TSWA 3CPWP 4F6WB 5IXBA 1K9AA 2XIDA 2HAXA 1WQ7A 1PRLC 1TUCA 5DQVA 5LMKB 3IQLA 1AWOA 1IRXA 1G3YA 1MMDA 4HCZA 1M8MA 2CP6A 1OKVB 3M55A 2C6TB 2AK5A 2GCXA 1V1CA 1VQNT 2RN8A 2BIVA 3CMEQ 4M77D 5GJVB 3OYMA 4HKEA 1ABQA 1ZP2A 3L2VA 1VQNA 4R0KA 1QVGP 3C95A 1JB0E 3CCQA 2AZSA 1CKBA 5HK0A 2BZXA 4LN2A 1Z9QA 5GAOq 4PK4A 3RR6A 5A0GA 2ENMA 2K5IA 4LE9A 4ZN1A 3SDZA 2Y4XA 3G33B 2VC8A 5LJ5e 4MDWA 5KCHA 2KMTA 5KE2A 1TH7A 1QCFA 2QQAA 1WPYA 2KYBA 1GBQA 3I55T 1VQ9Q 4RTWA 5IDPB 1U1TA 2NUZA 3GBQA 2AIRB 1BIBA 4HCBA 3T9NA 3I55A 2CREA 5FLXE 4M75B 3EHQA 1UGPB 4LDUA 2K4YA 4E7SA 3PTAA 2DKGA 2DXBB 4KUIA 2VVKA 3TQ7P 1HXDA 4LD9K 4G6LB 1RAAB 3NTHA 4OMLA 4C8QG 5GANe 3BY7A 1VQKT 4BY6C 2RM4A 1Q81U 1NLOC 4DEYA 2DRKA 1UDLA 5GMKl 3OW2S 2MI6A 1M2VB 2ZPIB 3JCMc 4M77F 3HFNA 5EFQB 3KFVA 3PVLA 4J5YA 2JT4A 2DJQA 2NUPB 3V8LA 1EFNA 1S1NA 3ASKA 5FWCA 2W9ZA 2J6KA 3SB2A 2RK1A 3VU3C 2NLUA 2EGCA 2R58A 2X4JA 3CC7T 2DK3A 2LCLA 4J9HA 1OIUB 2DF6A 1Y57A 3E19A 2RPNA 2WEVB 2DVEA 3CC7A 4E7LA 2GTOA 2HD0A 4M7AG 3A5ZB 4MFDA 4BCNB 4F7LB 2EFIA 2RI3A 2RJEA 2ZZDB 3TW7A 1HSQA 2EYYA 2CUBA 1H4LD 4EOQB 4AG2C 3VKGA 3PMTA 2EYWA 1JJ2P 5GAN6 1OL2B 2YUPA 2RJCA 2KBTA 4J7IA 4XU2A 4PLLA 3G6EQ 3KHIA 3G71A 3OYFA 2BZ8A 2HEQA 3OYIA 5M9OA 4RCBA 3OW2A 1YJWT 2L3RA 3HRUA 2OAUA 1MV0B 1JXMA 5GAN8 1QQJA 1Y96A 1YFNA 5CK9A 4OB2B 3CBMA 4Y91A 1AWJA 2WMAB 3OS5A 2HKQB 4QKUA 2J6FA 1RAIB 1YJWA 1OU9A 4YOZA 2DD5A 4C8QA 5FU7C 2QTXA 3QJ6A 5HVYB 4QVDA 5GAN3 4LDYA 2JZ2A 2OX7A 1ARKA 1CKAA 3JB9D 1G83A 3JSCA 2F5KA 3CMAA 4HT9A 1D09B 3U23A 2PK9B 4XTZA 2MF2A 2B86A 3HSBA 2C0TA 3H0HA 1VQ6Q 3CC4Q 2FZCB 3V8KA 2E5KA 2HNIA 1KHIA 1GCQC 4ELJA 4X34A 4E7JA 5HNBB 1X43A 1H8KA 4F14A 1VQPT 2KT1A 3V7RA 2JW4A 2UZEB 2HBWA 4CFUB 2A08A 5KYUA 1NBEB 3QO3A 3JCMP 5L23A 3RMQA 2XD0A 4E7KA 3JV3A 2LT1A 4XTVA 2DYBA 1S72T 4OGRB 3LH0A 1QVPA 3M9QA 4CI0C 2SEMA 1WIEA 2YWWA 3THKA 1JU5C 5IXFA 1TG0A 2RHZA 4C92C 1NLPC 2DEUA 5GAMf 1H27B 4J9IA 2GF7A 1OPLA 5IDNB 2QQ8A 1NG2A 3QG1A 3LGFA 4FW1A 2L3SA 4MMKA 4BI3A 3QYHB 1QMCA 5LJ3e 2W10A 1HYOA 2JVVA 1KQ1A 3HP9A 2CZ0B 4HA8A 3QUIA 3VS1A 1E7OA 1N9RA 2KDSA 1B34A 1X2QA 2FHDA 3I56T 4M78G 2C06A 5C0MA 1LOJA 4OF1A 2R5MA 4AKIA 1WLPB 4YC3B 4Z8AA 5GANf 3L2WA 2EVRA 2QQSA 2ZPFB 3H6ZA 3EOCB 3M58A 2D0NA 4C8QE 2FO0A 3MP8A 1K73R 2EYXA 2GNCA 4JX6A 1XO2A 1VOLA 4KRCB 1YITQ 3OS2A 4FT2A 1JBMA 4EOOB 4IIMA 2QEXQ 3X20B 1ZBXA 3M56A 1K73C 3M5AA 5HBHB 1WI7A 2PMIB 1YJ9T 1VQOA 3OYLA 4JPBW 3X26B 3OYBA 4B9WA 4PJOC 2HCKA 3H4CA 2WSEE 1UUEA 1VQ7Q 2YHTA 1YJ9A 1M90U 1GRIA 2FVUA 1W98B 2COYA 1OI9B 2HQXA 2G77A 2JNGA 1SF9A 1BIAA 3CCVQ 5GMKh 3HRTA 4JUVA 4KH0B 2Y4YA 5ICPB 3VYGA 4KULA 1ZLMA 1YI2T 3EH2A 5L2WB 2BKDN 4BCOB 4XTUA 1BU1A 2CH4A 1NJIR 1VQ4Q 3A8LB 2OI3A 3EAEA 1HD3A 3P8BB 4A4KA 1AD5A 1Q95G 1H28B 2A37A 1YWPA 4ESRA 4PL6A 4UN0A 4XTWA 1YI2A 3OSVA 4IKFA 4EONB 3QXEB 4M78A 5FU6B 3Q1JA 4HNTA 4XTYA 2DFUA 3QHSA 1K9MR 1UHCA 2V22B 5CKBA 3G4ST 5L8RE 1ACMB 1C6VX 4ELZC 4EOJB 3CCMT 4IUQA 3HO8A 2BS2A 2M1HA 2DPPB 1RABB 4QW2A 1GUXA 4CC7A 3I35A 4E7IA 3LYIA 3G4SA 3CCMA 4M7DD 2LQKA 3GOXA 1Y96B 1M1GA 1WHGA 4HCKA 5GANd 2CJMB 4Z6YA 3S3MA 1UNLD 1FYNA 5HK3A 5I2MA 2QQBA 3J80E 3LX7A 3UWNA 3CD6A 4HT8A 4OMPA 2CT4A 2DD5B 2SRCA 4C8QB 3HTRA 1PKTA 2O31A 5CKEA 2ROLA 4PJOD 2RQRA 1I5OB 1Y7XA 3SWNA 3OW2P 4JZ3A 3LH5A 3QHRB 1LJOA 2E3HA 2ZPHB 2YUOA 2QQ9A 2OTLT 1QMZB 1FX7A 4AFUC 3TW6A 1OIYB 2GBQA 4J83A 2K79A 3META 1Q81C 3CCST 1KC8U 4MIMA 4DQ2A 2FYKA 2OTLA 3E9GA 5LJ5j 1Q86U 2FZGB 4LDVA 5LQFB 9ATCB 3G1JA 4BI4A 4XAXB 3CCSA 3CCLA 5KYUB 4N0AA 3CC2A 1X01A 2LCCA 2IW6B 4RTUA 5I5ZB 3ZFJA 2JN0A 5LJ5h 5IH2A 2VGNA 5LJ3f 4OP0A 1TUGB 1PCXA 1GY3B 1E6HA 1W4SA 2LQNA 1YN8A 3NTKA 4FCYA 4M7DF 1V76A 5CCAA 3M0RA 4HVUA 3M4GA 4A4GA 2K5LA 2WIPB 4ATOA 3FJPA 2H3JA 1AWWA 4RTYA 2L89A 1PSEA 4F7NB 4M78E 2RMOA 2D9TA 1M30A 2WPAB 2AHJB 3A98A 4WCIA 1XQHA 4OB1B 4DBFA 1TOVA 3HKSA 3RBBB 1H1SB 3OYGA 4QVZA 1B34B 1YBYA 4R56A 1ENWA 1RI9A 2YLCA 5ECAA 4FYYB 3QWXX 4QSHA 1NPRA 3X24B 4BCMB 2QGGA 3DKMA 5FWBA 1VQ9T 2RF0A 3TNHB 1BI1A 1T3LA 3EGDA 1JQQA 3JCMX 2EWNA 1FINB 1RACB 5I11A 2I0NA 3GLXA 1AISB 1Y71A 2RHUA 1VOMA 1VQ9A 4EOSB 2M0OA 1H1RB 4L5GA 4XU1A 4F16A 3PO3S 5GJWB 3R6NA 3OSSC 3FEOA 4BXXX 4J6XA 8ATCB 2QG9B 1WZOA 4QQ6A 2JM9A 1T3SA 1QCOA 2EW3A 1M4ZA 1J3TA 2X1NB 4M77A 2CP2A 5HBJB 2G9XB 4LNPA 2QGSA 3ZEHA 5GANg 3X28B 4EORB 1KSWA 1UTIA 2M02A 1G3SA 4J9DA 4XK8E 4BD3A 3A8OB 3OS1A 4ZN3A 3BDUA 3H9NA 5LJ3d 4E7HA 1IGQA 3A1PA 4C5HA 1VQ8A 1OU8A 1E9HB 3VYGB 1NPPA 2O2OA 3M0PA 1RL2A 2EPDA 2C0IA 2LTOA 2UZLB 3VKIA 3VS6A 5KCOA 3M59A 3NPFA 1EIFA 2LVMA 3DJBA 1ZSZA 2RI2A 1GXIE 3G6ET 4OR5B 4BBRM 4M78B 4RG8A 3M0QA 2IVWA 3HRSA 5CVIA 2DL5A 2VXFA 5IHYA 1G8XA 1YJNA 4BE2A 1GUXB 4D6WA 3E2UA 3E9FA 1D0ZA 5CIUA 1R8OB 1VQLQ 2LC4A 3PT9A 2C4GB 4KRDB 5EJCA 5CKFA 1GL5A 2XK0A 3H0FA 1URCB 2OTJQ 1TXQA 2K5FA 1ZSGA 4OMQA 3MHXA 1AZEA 2X4XA 1MMNA 2PK2A 3EH1A 6AT1B 3SWNB 4CRLB 1G2BA 3VRYA 3QKJA 2E6ZA 2YLBA 1VQ6T 3CC4T 3S3OA 2CP7A 2JS0A 1M90R 2F5TX 2CP0A 2WACA 1VQ5Q 2P4RA 3BG3A 1U1SA 4EIKA 2K6DA 2BPMB 1PSFA 4XU0A 1M90C 2L0AA 5GAMe 4M77E 4EMKC 2MIOA 3EG2A 4HL4A 2W0ZA 4RCCA 1OI1A 2EYQA 4Y28E 4E6RA 2A28A 3TN8B 2LX9A 4KT0E 4K11A 2YRCA 4BCJB 2KQWA 1ZUUA 1A0NB 4WF2A 2FPDA 1X6BA 2PZ1A 2VKNA 3RKWA 4F70B 1MMAA 1M3AA 2MWOA 2JTEA 5C6SA 1TD6A 4CFWB 2PUKB 3L42A 5IN1A 3F5XB 3FDRA 1Q82U 2X9HA 3POMA 3OYEA 4ZNXA 4DBQA 2DAQA 3OYKA 3V7SA 2MWPA 2X35A 4C5EA 4HNUA 1O75A 3KXTA 1AVZC 4ZGEB 1VQKA 3M54A 3CCEQ 3SFMA 3JB9J 2V8IA 5IHIA 1MNEA 1AEYA 5IHNA 3MP1A 2JXBA 3MPUB 2RI5A 4C0GA 1VYWB 1I8FA 4OVAA 4NC6A 2AT1B 1X75C 5I21A 1NZ9A 5LJ3g 5CKDA 3BLRB 3HB9A 2DZ9A 1JOWA 1N5ZA 1B3QA 4JX5A 2BS3A 2KNBB 3EGDB 4IUUA 3M4YA 2DMOA 5CYIB 1ABOA 1MGQA 2GFAA 4UC4A 1P92A 3MJXA 1YITT 4BCFB 2V8JA 4BI8B 3EG1A 1ZHIA 2HSPA 4FSXA 4PFZA 3RESA 1N6AA 2C5NB 4BUGA 3QWLA 1NE8A 4JLGA 2MMPA 2XHCA 4X9CA 2DXUA 1D0XA 2CP3A 4CC3A 3NGPA 4HVWA 1B7TA 2K9GA 2YDLA 5FRMA 1VQ7T 5GAN4 5IT9E 2CS7A 5BNJB 2AKKA 2J6OA 4M77B 3L1AA 2KYMA 1Q86C 1OX8A 2V1RA 1C9BA 2KSSA 1WJSA 5KYXA 1JSTB 1MHNA 2DL8A 1YHQQ 1BB9A 1N8RU 2QTVA 4Q5WA 3CCVT 2KXDA 1I0CA 1G3NC 1K8AR 2JJ9A 4RG2A 1PD0A 3HZJA 2DRMA 2MAMA 3DB3A 3MIAB 4PNOA 1VQ4T 4ORZA 3CCVA 4TTHA 2CCIB 3L2QA 4DA4A 2ESWA 1K8AC 1KFZA 1OYXA 1E7PA 2M51A 4HVVA 1JRIA 1VQ4A 2E12A 3PIOA 1ZSZB 4AKGA 4CFMB 1M1KR 1OZ3A 5I22A 3NFCA 2E4HA 4M7DG 2LNHB 4GBQA 4IIOA 3SEMA 3B57A 2RB6A 2F1LA 2OJ2A 4JS5A 3CCQQ 1M1KC 1NYFA 3JCMe 2M0YA 2ED1A 2PUOB 1W2BS 1VQPA 4RMOA 3OBYA 4J9BA 4M4ZA 2HKNA 3EJ1B 1UECA 1N9SA 1R0CB 3CBPA 4JRQA 1KD1U 3RNJA 4BACA 1RUWA 1QP2A 2EJ9A 2I40B 1OGUB 2K3XA 3OQ5A 4WTOB 1ZUYA 2BS4A 2JUFA 2X3XD 1S72A 3OYDA 1N27A 4AFQC 4AFZC 2ED0A 3FLGA 4C0FA 3MEUA 5HQ0B 2CH4W 2XU8A 3NMZC 2IW8B 3HBLA 2CGHA 2JTFA 2C5OB 2MYSA 4QQDA 4M7AC 4RTTA 3A8MB 1VUBA 3I55Q 4M6VA 1WFWA 4MZMA 3MEAA 2QDYB 1H1PB 4BBSM 1G5VA 5HCKA 3JB9F 3EG0A 2F2CA 2LDMA 3RDVA 3EG9A 1F5QB 1BU2A 1SG5A 5CAIA 2KROA 2DNUA 5EC7A 3VS4A 4QQGA 4JJDA 3PNWC 2QGFB 1SEMA 4N4HA 2KRSA 1FXXA 1BCOA 2P84A 2DZCA 5J3BA 3I56A 3M0TA 3L2UA 3QSUA 1OEBA 4R55A 1LNXA 2KE9A 4A4HA 2PQWA 1OOTA 1OPKA 4M7DA 1PG5B 2XKOC 5KYYA 3RKYA 5LL6S 1QVFS 3M03A 2J7IA 3S3NA 2B9RA 4EOMB 3M57A 1K1ZA 2MK5A 1I1JA 3GNFB 4II1A 4BY6B 4LD6A 3CPWS 3SD4A 2KXCA 1MMGA 4BE0A 1BI0A 4RKUE 5J26A 1CSKA 1KJWA 5GMKj 2RQUA 4C92D 1WNLA 1AZGB 3QYBA 1TSFA 1YCSB 5GAOm 2DL3A 2WFYB 4LOCA 1FMWA 2IIMA 4OMNA 3G71Q 5FW9A 2UZBB 3GPLA 3INZA 4KBMB 4M7AD 3QDFA 1E6GA 2PJQA 3MP6A 1UE9A 2ZPBB 2H8HA 5DM7R 1QLYA 2COZA 4PFOA 2L3QA 1QVGS 4AG1C 4FIBA 4DOVA 5GAOp 2QAZA 5GAMd 2RNAA 3I9QA 3MEWA 1RAFB 1JSUB 3CCJQ 1AOJA 1D3UB 3FJ5A 2DXTA 2AKLA 2QK0A 2PU9B 3E1SA 2QF7A 3BFMA 1YP5A 5EG2A 1YWOA 2X3WD 4C0DC 3CMAQ 2X4YA 1V29B 2QA4T 1TU0B 4GLMA 2W99A 2RQWA 2KMGA 2WIHB 4J6YA 1AWXA 3CCUQ 3VRZA 2XDBA 2QDJA 1NEGA 1VYVA 1XOVA 2QA4A 3QZ5B 2LW4A 4BCMD 4JDSA 2WSFE 4BCQD 2DTIA 5FROA 4ELLA 1MUZA 3ME9A 4C92F 3H8ZA 1SRMA 3RUXA 2K2VA 3VYHB 2E41A 4FSSA 3VV0A 4PLIA 2E3IA 2HSEB 4M7AF 2CSIA 2DILA 3S6WA 4M7DE 1R77A 1Q81R 4YTLA 3JCMf 2CCHB 2X51A 2FRYA 3GF5A 4Y72B 4A63B 4BY1X 2A7YA 1HK9A 3VS5A 4PJOE 1X2KA 5FGKB 1PHTA 1WXTA 2YT6A 4CFVB 3DOGB 3O8VA 3ULRB 2DIQA 1F1BB 4ZTFA 5GAN2 2D1XA 1XJWB 4HXJA 3GNGA 5IF1B 3C4SA 8AT1B 3BLQB 2HQEA 1WHJA 1VQLT 4C5IA 3P8HA 5A0LA 2M9UA 4RTZA 4FX3B 5FRNA 1YIJQ 1FMKA 3OYAA 2ZCFB 2LJ3A 3EFOA 4Z88A 1BI2A 4M77G 1XNIA 4QT7A 3DL1A 1JKWA 3CPFA 5HKCA 5HBEB 3JB9I 4RTVA 1JJ2S 3CMET 2P0KA 3JCMW 5GANj 1M8VA 2YSQA 1QKWA 2PVOB 2A0FB 4N0AC 3CMEA 4E2FB 1H3HA 1TTHB 4PJOF 2NYSA 4FW2A 3OA6A 2QDLA 3VS3A 4JRIA 1TFBA 5GANh 2E65A 4E7ZA 2J06A 4I3ZB 1QCNA 1BI3A 4P5NA 4ROEA 4Z89A 2K3YA 3F70A 4M75C 1VQOQ 4CFXB 3EG9B 3DTOA 3LQ5B 2R5AA 1UNHD 4Y92A 1NM7A 1UJYA 2F2VA 5D6WA 5ACBA 1WYXA 2EYZA 4O5VA 1O9KA 1OZ2A 2EKHA 1GFDA 1D0YA 3MKDA 4CFNB 2P0QA 2QASA 3HPWA 1N8RC 3MY1B 4YOSA 2RHIA 2RD1A 3RERA 1M5Q1 4F7UE 1VQMQ 4NOYA 3QZ9B 2EQJA 5GAMg 3EHRA 3CCRQ 4M7DB 1PM3A 4V2SA 5KYYB 2DL4A 4F04B 3JCMd 5GAOn 1P5EB 4KH1B 2IVXA 1KHCA 4EOKB 1M9SA 1BCMA 2RHXA 3J7AF 3UT1A 1NYGA 2EIFA 1O9SA 2O9SA 2KI7A 3DLLA 4D8KA 4PJMA 2F2WA 3UDCA 1YI2Q 2BUDA 3CCET 2JGZB 4RODA 4KGXB 5IAYA 4GLKA 3D7SB 2R7GA 2V26A 2RHYA 3CCEA 2FL7A 3NHNA 3NDQA 2E10A 2MCNA 2DBMA 4L6V5 2EBPA 1M2OA 2EKOA 4BE1A 3UPUA 4F7UF 3CCMQ 1QWFA 4L59A 4BDZA 3KUFA 4FL6A 1BYMA 1PKSA 1AD6A 2FRWA 5IHKA 2Y90A 5CQXA 2DD4A 4M75D 1ZQ1A 3CD6Q 1K4US 5GAN5 3CXCS 4IUTA 3AHUA 3QJYA 3EFRA 4MDXA 4FM4B 1VYTA 2DIGA 1KIKA 4B9XA 3A8GB 1I5LA 3VS7A 2VYTA 3C12A 4OB3B 4GY5A 3EIDB 1VYUA 2E64A 1RAEB 4OMFB 2YUQA 4BCHB 2BE9B 3TEEA 3G6EA 3K7AM 1FWZA 3QDRB 2DERA 2WJ9A 1BBZA 1K73U 2K2MA 1YNZA 2QQRA 5GAOl 1IHVA 1YHQT 1Q7YU 2OTLQ 1KQSS 1WHMA 1M27C 5GAN7 1ZSZC 1NEBA 1K0XA 3CEYA 2LQWA 5I2SA 1WHLA 3JB9G 2XDDA 1JO8A 3CCLQ 3CC2Q 3OMCA 1YHQA 1N4MA 4ZGDB 2PTKA 3J81E 1UGVA 4EDUA 4BCKB 4OMMA 4TVRA 2D8JA 1T0JA 4BCND 5GAOr 3EGXA 1C0MA 3QYGB 1GFCA 2EJFA 4DEXA 2DL7A 4LUDA 2PNIA 3PVQA 3MY5B 4E47A 2O4XA 3CXCA 4JLIA 5LJ3j 4AFSC 5D7UA 2DX1A 1PKDB 1PWTA 4KGVB 4OGEA 4RTXA 1RAHB 4M75F 1FVVB 3M0UA 4EOPB 3RKXA 1VQ6A 3CCQT 4EMKA 3CC4A 1WXBA 2X4WA 1G3TA 4VUBA 4JRPA 3PGGA 1W6XA 5LJ3h 1NJIU 2COWA 4LDXA 2WXVB 1UHFA 3JCMV 2E70A 2KK4A 2JM8A 2CZ7B 5DLQE 2VWFA 1AHJB 2QI2A 2XDPA 5KYWA 1KQSA 3UA7A 4NSTB 4NL2A 4A54A 2CZ1B 1TWBA 4F7SB 2CKKA 1K9MU 3EFOB 5CR2A 1ZBJA 2W2HA 2LNVA 3QIIA 3JCMg 4EMHA 3H41A 1H1QB 3MCAB 3OYCA 3PMIA 2RQVA 4BDYA 2PVDB 4ANJA 2EGEA 4XQ3A 4N4IA 3KBGA 3UATA 4OB0B 3VUBA 1Q7YC 1EX4A 2RH2A 4CC2A 2RJDA 2KGTA 4KRTA 2LX7A 1WJRA 4CFUD 2DTOA 1GCPA 3M0SA 2C0OA 3EG3A 4KGZB 3VUZA 5D6YA 2DETA 1MNDA 1UB4A 1C1AA 4EMGA 3C0CA 4BB7A 3REAB 1IZ6A 1TS9A 3CBOA 4PKCC 4F7JB 4PJLA 1O9KB 1BK2A 1WQWA 7AT1B 2D0QB 4II5B 1Z9ZA 2V8KA 1ZX6A 3LGLA 3OMGA 2ABLA 3NTIA 2PHGA 1W70A 3HL8A 3TREA 5KH6A 2QEXT 2FEIA 2F2XA 1WHKA 1VQ8Q 4EPCA 1WGSA 1KC8R 2DTHA 3JCMQ 3DLMA 1YITA 4C92G 2ATCB 2CUDA 2QEXA 1Q86R 4ZTJA 3SHWA 1KC8C 3BHVB 2H3EB 1PNJA 2XI9A 4JJCA 1X6GA 3G71T 1D1BA 2YRDA 4AT1B 3FB9A 3GIBA 4OGCA 2M16A 2BKZB 4XU3A 1VQ7A 5FU6C 2IPOB 1QP3A 2KY9A 1YJNQ 1H3ZA 1H26B 1M3BA 1ZA2B 4O6JA 1JXOA 2BE7D 2LRQA 3DB4A 4LDWA 2I2LA 2KEAA 4X1VA 1U3OA 2DD4B 2GTJA 1VIEA 1UGRB 1XTDA 5DQWA 3CCJT 2C5VB 1GCQA 2NWMA 1WX6A 2DA9A 3G7ZA 2DYIA 4LXCA 4C8QC 3V7CA 3OS0A 3DDQB 3CMAT 2L8DA 3AT1B 1WJQA 2DVJA 3CCJA 1VQNQ 1D1CA 5D6XA 2V1QA 3CCUT 4PJJA 1KG1A 2RK2A 1M3CA 1R0BG 2LQ8A 2VXEA 2ZPGB 3M53A 4MZPA 4PJOG 4J9CA 2JS2A 2FB7A 3GP8A 3CCUA 4C92A 2EQKA 1X27A 2F69A 2E1HA 5A2QE 4ROCA 3HHTB 2R57A 2QFZA 4M7AA 4HCCA 4CRIA 2DMEA 4BCPB 3EGXB 1X69A 2D8HA 3TNIB 4RUGA 2LZ6B 4EOLB 3JRZA 3UA6A 2O4XB 1IB8A 4FU6A 3VS0A 2IN3A 3RGFB 3TCJA 2ZPEB 3JCMb 1PC0A 1SKUB 1D3BA 3EFSA 2CZ6B 2NUTA 1SSHA 2PVGB 3L2ZA 5J39A 3OYHA 2YXYA 4DOWA 1DJ7B 1SPKA 4EMKB 2K57A 4IUVA 5LJ5f 2YUNA 3QYEA 1VQKQ 2AZVA 2VASA 4NS5A 1W2BA 1YIJT 3MO8A 2JOYA 3CXCP 2VB6A 4C8QD 3BE3A 3LWIA 4D8DA 5KYWB 2YRVA 5DLOA 1YIJA 3TU4K 3EGUA 2A3LA 2MPXC 1QW1A 4X9DA 1PRMC 4N4GA 5HY6A 3BG5A 1FMVA 2MOXA 3WVDB 2JTMA 3CC7Q 4F7UG 4DBHA 4PJOA 3QBYA 2LCSA 3DDPB 4F6SB 1UGSB 1HJDA 3MEVA 1OX9A 1KQSP 3A8HB 2KVQG 1Q7YR 4M7DC 1VQOT 3URGA 4HNVA 1G3WA 2ZGWA 4OMOA 2GQVA 4EOIB 2ROTA 3LLRA 4F17A 4MMLA 2EQUA 2KRMA 2I53A
chains in the Genus database with same CATH topology
5GANh 1YJWA 2E65A 2KR6A 3SWNB 2DD5A 4C8QA 5FU7C 1BI3A 4P5NA 1Y07A 2QTXA 3QJ6A 2K3YA 3F70A 3QKJA 4M75C 2E6ZA 1VQMT 2YLBA 2P0PA 5CQYA 3WXMB 2R5AA 4QVDA 5GAN3 1VQ6T 4LDYA 3CCRT 1UGQB 4C92E 3CC4T 2JZ2A 3FIFA 3S3OA 1KQ2A 5D6WA 4O5VA 1OZ2A 3JB9H 2F5TX 2WACA 2P0QA 1VQMA 1QVFA 3JB9D 3HPWA 4C0ZA 1N8RC 4M7AE 3BG3A 4C8QF 2DXCA 3CCRA 3JSCA 2F5KA 3CMAA 4HT9A 4AI6A 1U1SA 2MF2A 2RHIA 3OYYA 2RD1A 1PSFA 4XTZA 3CPWA 3ZBDA 3RERA 1M5Q1 4XU0A 4F7UE 1M90C 5GAMe 4M77E 3QZ9B 2EQJA 4NOYA 3RMSA 4EMKC 2WSCE 5CO7A 5GAMg 3LW5E 4M7DB 3V8KA 2HNIA 4V2SA 3JCMd 4HL4A 1KHIA 5GAOn 4ELJA 4X34A 4E7JA 1KHCA 4RCCA 1M9SA 1OI1A 5LJ5d 1VQPT 2RHXA 2EYQA 3V7RA 3J7AF 3UT1A 4Y28E 4KT0E 2LX9A 2EIFA 1O9SA 3QO3A 3FC3A 2KQWA 3JCMP 4IURA 3RMQA 3DLLA 4J7FA 1BKBA 1NJIC 2XD0A 4WF2A 5FU7B 3UDCA 2P4TA 4E7KA 2G3RA 2LT1A 2BUDA 4M78C 3CCET 4XTVA 4JX4A 3RKWA 4M75G 4F7UA 1S72T 2MWOA 5IAYA 3C94A 2O01E 5C6SA 4FT4A 2DJZA 4J6WA 3LH0A 4GLKA 1QVPA 3M9QA 3ER0A 4CI0C 2PUKB 3L42A 5IN1A 3FDRA 1Q82U 1K9MC 3OYEA 2RHYA 2XG8D 2FL7A 3OYNA 3CCEA 2E10A 3CD6T 3HFOA 2DAQA 2RHZA 3OYKA 3V7SA 3LWHA 1QVGA 1UEBA 2DO3A 2MWPA 2X35A 4L6V5 1QLBA 4C5EA 4C92C 2EKOA 4HNUA 1O75A 4BE1A 3KXTA 4HLQA 1VQKA 4ZGEB 3UPUA 3M54A 4C5GA 4F7UF 3SFMA 3JB9J 2V8IA 2DEQA 2IG0A 5GAMf 4L59A 4BDZA 3KUFA 4FL6A 1BYMA 3MP1A 1Q82C 2GF7A 2QQ8A 2RI5A 3QG1A 3LGFA 4MMKA 4BI3A 4C0GA 3L2RA 2Y90A 5CQXA 2DD4A 3QYHB 4M75D 1I8FA 1ZQ1A 4OVAA 4NC6A 5LJ3e 1X75C 5I21A 1NZ9A 5LJ3g 4IUTA 5GAN5 3CXCS 3QJYA 5CKDA 3AHUA 3QSUA 5GAMj 3HB9A 2DZ9A 4ME7A 2JVVA 1SSFA 1KQ1A 3EFRA 4IUPA 4MDXA 3HP9A 2CZ0B 4HA8A 4FM4B 3QUIA 3SWNC 2DIGA 4JX5A 2BS3A 2EAYA 1N9RA 2KDSA 4B9XA 1B34A 3A8GB 4IUUA 4JS4A 1I5LA 2VYTA 3M4YA 2E6NA 2FHDA 3C12A 3I56T 4A53A 4OB3B 4M78G 4GY5A 2C06A 5C0MA 1LOJA 2HBPA 5GMKm 4OF1A 2R5MA 1MGQA 2E64A 4AKIA 1P92A 2GFAA 4UC4A 1YITT 4OMFB 2V8JA 5GANf 3L2WA 2QQSA 4ELYC 4BI8B 5GAMh 2ZPFB 3TEEA 1ZHIA 4FSXA 3G6EA 3CCLT 3H6ZA 3CC2T 1VQLA 1FWZA 2D6FA 3QDRB 1N6AA 3BW1A 3RESA 3M58A 4BUGA 2WJ9A 3QWLA 4C92B 1K73U 1NE8A 4C8QE 4JLGA 2QQRA 2MMPA 3BDLA 2VV5A 2XHCA 4X9CA 2DXUA 3MP8A 5GAOl 3OY9A 1YHQT 1Q7YU 4M7DA 1KQSS 2OTJA 4MFEA 5GAN7 4JX6A 4M7AB 3CEYA 3OS2A 4FT2A 5I2SA 5FRMA 1VQ7T 1JBMA 3JB9G 2GFUA 3X20B 3R6OA 2XDDA 5GAN4 5IT9E 3OMCA 2CS7A 4ZGDB 1ZBXA 1YHQA 3J81E 4M77B 3L1AA 3M56A 4M78D 1Q86C 1K73C 2LT4A 3VJPA 4EDUA 3M5AA 4TVRA 2KSSA 3QPHA 1WJSA 1YJ9T 1FKMA 5GAOr 1U8RA 1VQ5T 4M75A 1MHNA 3OYLA 1VQOA 3X26B 3OYBA 3QYGB 4B9WA 2EJFA 2DXBA 1K8AU 1I81A 1N8RU 4PJOC 1D3BB 3CCVT 4Q5WA 3OYJA 4E47A 2VGMA 3RIRA 5A0DA 2O4XA 2RA2A 3CXCA 4JLIA 3H4CA 4RG2A 2WSEE 5LJ3j 4KUDK 3HZJA 2YHTA 1YJ9A 1VQ5A 1M90U 2MAMA 2EQMA 5GMKi 3DB3A 2FVUA 4PNOA 1VQ4T 3CCVA 5DY9A 4OGEA 3L2QA 3OBWA 4XTXA 4M75F 4DA4A 2HQXA 1K8AC 1OYXA 2G77A 1E7PA 3HSBA 3X25B 2JNGA 3RKXA 1VQ6A 3CCQT 1BIAA 4EMKA 3CC4A 2X4WA 4VUBA 1G3TA 1JRIA 5GMKh 3PGGA 4JRPA 5LJ3h 1VQ4A 3HRTA 4JUVA 1M1KU 2E12A 2OTJT 2E5QA 2Y4YA 3PIOA 3VYGA 4KULA 1YI2T 1NJIU 4LDXA 4AKGA 3N5BB 2BKDN 4XTUA 1OZ3A 4J8OA 3JCMV 1JJ2A 5AYFA 3NFCA 2E70A 2KK4A 4M7DG 3A8LB 2CZ7B 3EAEA 3P8BB 4A4KA 4JRKA 2RB6A 5DLQE 1AHJB 2QI2A 2XDPA 1KQSA 4NL2A 4PL6A 4A54A 4JS5A 2CZ1B 4XTWA 4A4EA 1YI2A 2CKKA 3OSVA 4IKFA 1K9MU 3QXEB 5CR2A 1M1KC 4M78A 3WVEB 4AKHA 5FU6B 2VUBA 3Q1JA 4HNTA 4XTYA 2LNVA 3QHSA 3QIIA 2RJFA 3JCMg 4EMHA 3JCMe 4PJOB 1W2BS 2PUOB 5CKBA 5CKHA 3G4ST 2ZZDA 5L8RE 1VQPA 4ELZC 3MCAB 4RMOA 5LJ5g 3OBYA 3CCMT 3OYCA 4IUQA 3HO8A 3PMIA 1N9SA 2BS2A 3CBPA 2M1HA 4JRQA 1KD1U 4BACA 2DPPB 2B8AA 1QP2A 2EJ9A 2K3XA 4QW2A 1I4K1 3OQ5A 4NL3A 2EJGA 4E7IA 3LYIA 2CYZB 3G4SA 4BDYA 2PVDB 2BS4A 2JUFA 2KAFA 4M78F 3CCMA 1S72A 4XQ3A 2LQKA 4N4IA 3OYDA 3GOXA 1N27A 4M7DD 1Y96B 3KBGA 1VIFA 1M1GA 3FLGA 5GANd 5KE3A 4OB0B 3VUBA 4Z6YA 4C0FA 3S3MA 5HK3A 2RH2A 3MEUA 5I2MA 2RJDA 2XU8A 2QQBA 3HBLA 2CGHA 2JTFA 3J80E 2XICA 3LX7A 1KD1C 1WJRA 4QQDA 3UWNA 4HT8A 2DTOA 3CD6A 4M7AC 2DD5B 4C8QB 4A4FA 3A8MB 3VUZA 1RI0A 1VUBA 5D6YA 5CKEA 4PJOD 4M6VA 1UB4A 4MZMA 4M77C 4EMGA 5GMKe 3MEAA 1Y7XA 3SWNA 2QDYB 3P8DA 4BB7A 1IZ6A 3CBOA 4PKCC 1VQ8T 4BBSM 1G5VA 2RO0A 3JB9F 1LJOA 2ZPHB 4ZGJB 2LDMA 4JJNK 1WQWA 3JAME 2D0QB 1X6OA 2V8KA 5CAIA 3LGLA 1YCYA 2DXCB 2QQ9A 2OTLT 1M1FA 3OMGA 3NTIA 2QXFA 1FX7A 3TW6A 4QQGA 4C0DB 3BG9A 3PNWC 4J83A 4N4HA 3HL8A 3META 3TREA 5KH6A 3JCMJ 1FXXA 2QEXT 1Q81C 3CCST 1KC8U 4MIMA 1IREB 2FYKA 4DQ2A 2OTLA 3E9GA 2DZCA 4M75E 5J3BA 1WGSA 4EPCA 2DTHA 4QVCA 3JCMQ 5LJ5j 3FRNA 3I56A 3L2UA 3DLMA 1Q86U 4R55A 1LNXA 2L5QA 4A4HA 1YITA 4LDVA 4C92G 2PQWA 4MZTA 2QEXA 4BI4A 4XAXB 3CCSA 3OB9A 4Z02A 2XKOC 4N0AA 4ZTJA 1X01A 3VKHA 3CC2A 3CCLA 2LCCA 3PIPA 3RKYA 1H641 1YJNT 5LL6S 3V8JA 1QVFS 1KC8C 3S3NA 3JCMh 3PFSA 3M57A 2XI9A 3G71T 3GNFB 4F7UB 4II1A 3ZFJA 4LD6A 2JN0A 4BY6B 5LJ5h 3FB9A 3CPWS 2VGNA 2XIDA 3SD4A 2HAXA 5LJ3f 4OGCA 3GIBA 2M16A 4OP0A 1WQ7A 4BE0A 1W4SA 1BI0A 3NTKA 4XU3A 5FU6C 1VQ7A 4M7DF 5CCAA 4RKUE 5J26A 1QP3A 2KY9A 1H3ZA 5GMKj 1G3YA 3M4GA 4A4GA 2K5LA 4C92D 1WNLA 4ATOA 3QYBA 4HCZA 4O6JA 3FJPA 2LRQA 5GAOm 4LOCA 3M55A 2H3JA 3DB4A 4LDWA 2I2LA 3GPLA 3INZA 2L89A 2GCXA 1PSEA 4KBMB 4M7AD 1VQNT 4M78E 2D9TA 2DD4B 2AHJB 2BIVA 1VIEA 1UGRB 1XQHA 3MP6A 1XTDA 4OB1B 4M77D 2ZPBB 3CCJT 3OYMA 4HKEA 5DM7R 3HKSA 3L2VA 3OYGA 3G7ZA 1VQNA 3C95A 4QVZA 4C8QC 1JB0E 1QVGS 3V7CA 1B34B 1YBYA 3CCQA 3OS0A 4R56A 3CMAT 2L8DA 4FIBA 2YLCA 4DOVA 5HK0A 5GAOp 1WJQA 3CCJA 4QSHA 1NPRA 3X24B 3DKMA 5GAMd 1VQ9T 3MEWA 5D6XA 1BI1A 5GAOq 3JCMX 2EWNA 5A0GA 3CCUT 2K5IA 4M7AG 1KG1A 2RK2A 4ZN1A 3GLXA 3SDZA 2DXTA 2LQ8A 2Y4XA 2VXEA 1Y71A 2ZPGB 2PU9B 2RHUA 2VC8A 3E1SA 3M53A 4MZPA 2QF7A 3BFMA 5LJ5e 1VQ9A 4MDWA 5KCHA 2FB7A 5EG2A 2M0OA 4C0DC 3GP8A 2KMTA 5KE2A 3CCUA 1TH7A 2X4YA 1V29B 4L5GA 2QQAA 4XU1A 1WPYA 2QA4T 3I55T 4C92A 2EQKA 2KMGA 1U1TA 2F69A 3OSSC 4J6YA 3FEOA 2XDBA 1BIBA 2E1HA 4J6XA 5A2QE 4HCBA 3HHTB 2QDJA 3T9NA 2R57A 4QQ6A 2QFZA 4M7AA 1XOVA 2QA4A 3QZ5B 4HCCA 4CRIA 3I55A 4JDSA 5FLXE 4M75B 1M4ZA 1UGPB 4LDUA 2K4YA 3PTAA 2WSFE 2DKGA 2DXBB 2DTIA 4KUIA 1HXDA 4M77A 5FROA 4LD9K 3NTHA 4C8QG 3JRZA 3ME9A 4C92F 2O4XB 3H8ZA 4FU6A 3ZEHA 3BY7A 5GANe 5GANg 1VQKT 3X28B 1G3SA 2K2VA 3VYHB 2E41A 4XK8E 3RUXA 4BY6C 3TCJA 4BD3A 2ZPEB 2RM4A 4PLIA 3VV0A 3JCMb 1Q81U 1D3BA 3EFSA 3A8OB 4M7AF 2CZ6B 3S6WA 5GMKl 3OW2S 4M7DE 3OS1A 4ZN3A 5J39A 3BDUA 2PVGB 2MI6A 3L2ZA 4YTLA 3OYHA 3JCMf 5LJ3d 2ZPIB 3JCMc 4DOWA 1DJ7B 4E7HA 4M77F 4EMKB 2K57A 4IUVA 5LJ5f 3HFNA 4C5HA 4J5YA 3QYEA 1VQ8A 3GF5A 3V8LA 3VYGB 1NPPA 2A7YA 3ASKA 1HK9A 1RL2A 4NS5A 1W2BA 3SB2A 2LTOA 2RK1A 2NLUA 3MO8A 2JOYA 3VU3C 2R58A 1YIJT 2X4JA 4PJOE 3CC7T 2DK3A 2LCLA 3VKIA 4C8QD 5KCOA 3LWIA 3O8VA 3M59A 2DIQA 1EIFA 4ZTFA 2YRVA 5GAN2 2LVMA 2RI2A 3GNGA 5DLOA 3C4SA 1GXIE 2HQEA 1YIJA 3G6ET 4BBRM 4M78B 1VQLT 4RG8A 3E19A 4C5IA 3TU4K 3P8HA 2DVEA 3CC7A 4E7LA 5A0LA 2IVWA 2HD0A 2A3LA 2M9UA 3A5ZB 4MFDA 3HRSA 1QW1A 2EFIA 2RI3A 2RJEA 4N4GA 2ZZDB 4X9DA 5CVIA 5HY6A 5FRNA 3TW7A 2VXFA 3BG5A 2ZCFB 3OYAA 1BI2A 3WVDB 2JTMA 4F7UG 4M77G 1XNIA 1YJNA 4PJOA 3VKGA 3QBYA 3DL1A 3CPFA 4D6WA 3PMTA 4BE2A 5HKCA 3E9FA 5GAN6 3JB9I 1JJ2S 4J7IA 2RJCA 5CIUA 4XU2A 4PLLA 1UGSB 3CMET 3KHIA 1R8OB 2P0KA 3MEVA 3G71A 2LC4A 3JCMW 3PT9A 5GANj 3OYFA 1M8VA 5EJCA 3A8HB 2KVQG 3OYIA 2PVOB 5CKFA 4M7DC 5M9OA 1VQOT 4N0AC 4RCBA 3OW2A 1YJWT 2L3RA 3HRUA 3URGA 4HNVA 1G3WA 2XK0A 2OAUA 3CMEA 5GAN8 2K5FA 2ZGWA 1Y96A 2GQVA 4PJOF 3MHXA 4OB2B 5CK9A 3LLRA 4PJOG 2X4XA 3CBMA 4MMLA 4Y91A 3OA6A 2EQUA 4JRIA 1Q7YC 3OS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PU9 B;  2DD5 A;  2QDY B;  1V29 B;  1UGQ B;  2ZPH B;  4ZGJ B;  2D0Q B;  3HHT B;  2DXC B;  3X20 B;  3QZ5 B;  4ZGD B;  2DXC A;  1UGP B;  2WSF E;  2DXB B;  1PSF A;  1IRE B;  3X26 B;  3QYG B;  3QZ9 B;  2DXB A;  2WSC E;  3X28 B;  3LW5 E;  3VYH B;  4XK8 E;  2ZPE B;  2WSE E;  3A8O B;  2CZ6 B;  2PVG B;  4Y28 E;  4KT0 E;  2ZPI B;  1DJ7 B;  3X25 B;  3VYG B;  2O01 E;  3VYG A;  4RKU E;  2PUK B;  1QP3 A;  3A8L B;  2CZ7 B;  1GXI E;  1AHJ B;  2ZPF B;  4L6V 5;  2CZ1 B;  4ZGE B;  3QXE B;  3WVE B;  1PSE A;  2ZZD B;  2ZCF B;  2DD4 B;  2PUO B;  3WVD B;  2AHJ B;  2ZZD A;  5L8R E;  1UGR B;  4OB1 B;  2ZPB B;  2DD4 A;  3QYH B;  2DPP B;  1UGS B;  1QP2 A;  1JB0 E;  2CYZ B;  2CZ0 B;  2PVD B;  3A8H B;  4FM4 B;  2PVO B;  3A8G B;  3X24 B;  4OB0 B;  4OB3 B;  4OB2 B;  2DD5 B;  3A8M B;  2ZPG B; 
#chains in the Genus database with same CATH topology
 2KR6 A;  1Y07 A;  2KRN A;  1EZZ B;  2LJ1 A;  1VQM T;  2P0P A;  5CQY A;  1U5S A;  3WXM B;  1YJW Q;  3CCR T;  1UGQ B;  4C92 E;  1K76 A;  2L2P A;  3FIF A;  1OQK A;  4PJN A;  1KQ2 A;  1KXU A;  1W1F A;  3JB9 H;  3MI9 B;  1IGU A;  1VQM A;  4F6U B;  1QVF A;  4C0Z A;  2XMF A;  4M7A E;  2Z0W A;  1QWE A;  1K0S A;  2HL5 C;  4C8Q F;  2DXC A;  3CCR A;  3H0I A;  1VA7 A;  2K7A A;  4AI6 A;  3OYY A;  3CPW A;  3ZBD A;  4DBR A;  3RMS A;  2LJ0 A;  2WSC E;  5CO7 A;  3LW5 E;  2RQT A;  3CQT A;  3ZL7 C;  2KT8 A;  2UZD B;  2DE0 X;  2FZK B;  5LJ5 d;  3TVT A;  2CSQ A;  3FC3 A;  4IUR A;  4J7F A;  4LUE A;  1BKB A;  1NJI C;  5FU7 B;  2P4T A;  2IW9 B;  2G3R A;  5KYX B;  4M78 C;  4JX4 A;  4M75 G;  4F7U A;  3C94 A;  2O01 E;  4FT4 A;  2DJZ A;  4J6W A;  2CT3 A;  4AMC A;  3ER0 A;  5AT1 B;  1VQP Q;  3I5R A;  4JJB A;  1K9M C;  3BLH B;  2HMA A;  2XG8 D;  3OYN A;  1SHF A;  3CD6 T;  3HFO A;  1RAD B;  3LWH A;  1Q82 R;  1QVG A;  1UEB A;  2DO3 A;  1QLB A;  1OL1 B;  3PE0 A;  4HLQ A;  1VIN A;  4C5G A;  2K3B A;  1S72 Q;  2DEQ A;  2IG0 A;  3BHU B;  4IMY B;  1Q82 C;  4BCG B;  3L2R A;  2FPE A;  3I5S A;  1D1A A;  5GAM j;  4ME7 A;  1SSF A;  4IUP A;  2DLP A;  3SWN C;  4FYV B;  2EAY A;  2UUE B;  4JS4 A;  1RLQ C;  2E6N A;  1QKX A;  4A53 A;  4B6M A;  5GMK m;  2HBP A;  1UFF A;  2DM1 A;  1ZUK A;  2J05 A;  1WA7 A;  4ELY C;  3CCL T;  5GAM h;  3CC2 T;  2OTJ T;  1VQL A;  2D6F A;  3BW1 A;  4EC9 B;  2HQH A;  2JMC A;  4C92 B;  1SHG A;  3BDL A;  2VV5 A;  3OY9 A;  3I56 Q;  2HDA A;  2OTJ A;  4MFE A;  4M7A B;  3BHT B;  1OV3 A;  1LPL A;  2L3P A;  1GH6 B;  1UJ0 A;  2KR3 A;  2GFU A;  3O0G D;  3R6O A;  1LCK A;  2EGA A;  1RAG B;  4M78 D;  3UF4 A;  2LT4 A;  3VJP A;  4FYW B;  3QPH A;  1U8R A;  1FKM A;  1VQ5 T;  4EC8 B;  2BZY A;  4M75 A;  2DXB A;  1K8A U;  1I81 A;  1D3B B;  3OYJ A;  4J9F A;  2VGM A;  3RIR A;  5A0D A;  2RA2 A;  2NUT B;  1N8R R;  4KUD K;  2GQI A;  1VQ5 A;  2HL3 A;  2EQM A;  5GMK i;  2HZY A;  3REB B;  2GGR A;  2LMJ A;  5DY9 A;  3OBW A;  4XTX A;  3TSZ A;  1YJ9 Q;  4BY7 X;  1M2V A;  3X25 B;  3QHW B;  4YOO A;  1M1K U;  4PFP A;  2NUP A;  2E5Q A;  1OUL A;  3N5B B;  4J8O A;  1JJ2 A;  5AYF A;  5KYN A;  2FG0 A;  2O88 A;  4JRK A;  2W9F A;  1TUD A;  2OAW A;  1H92 A;  3TNW B;  4J9G A;  1WXU A;  1WDX A;  2JMA A;  1H24 B;  1Y0M A;  4A4E A;  2G6F X;  4BCQ B;  2ZAE A;  3WVE B;  4AKH A;  2VUB A;  2A36 A;  4CXA B;  2RJF A;  4PJO B;  1W2B P;  2BTT A;  5CKH A;  2ZZD A;  5LJ5 g;  2CDT A;  1IO6 A;  2FPF A;  1UNG D;  1MV3 A;  1H25 B;  2B8A A;  1LVK A;  1I4K 1;  1ZA1 B;  4NL3 A;  2EJG A;  2CYZ B;  1KD1 R;  2KAF A;  3QWY A;  4M78 F;  2EUF A;  1SRL A;  1KK7 A;  1VIF A;  4CC4 B;  5KE3 A;  2LP5 A;  3G4S Q;  1OKW B;  4BCI B;  1U06 A;  1PD1 A;  2DBK A;  2XIC A;  1KD1 C;  1JEG A;  4A4F A;  2C5X B;  2QA4 Q;  1RI0 A;  4FYX B;  1IXD A;  4M77 C;  2WHB B;  2EQI A;  5GMK e;  3P8D A;  1VQ8 T;  2RO0 A;  3O5Z A;  1I07 A;  4ZGJ B;  4JJN K;  3JAM E;  1X6O A;  1YCY A;  2DXC B;  1M1F A;  5CEI B;  2QXF A;  4C0D B;  3BG9 A;  1T0H A;  3JCM J;  1AT1 B;  2W96 A;  3VS2 A;  1UG1 A;  1IRE B;  4M75 E;  4QVC A;  3FRN A;  1IHW A;  2L5Q A;  2CP5 A;  4JZ4 A;  4J9E A;  2ECZ A;  1WHH A;  4MZT A;  1RLP C;  3OB9 A;  4Z02 A;  3VKH A;  3PIP A;  1H64 1;  1YJN T;  1QVF P;  3V8J A;  2O9V A;  2WMB B;  1GBR A;  3JCM h;  3PFS A;  3CCS Q;  1B07 A;  3GTM S;  2QYZ A;  4F7U B;  3TSW A;  3CPW P;  4F6W B;  5IXB A;  1K9A A;  2XID A;  2HAX A;  1WQ7 A;  1PRL C;  1TUC A;  5DQV A;  5LMK B;  3IQL A;  1AWO A;  1IRX A;  1G3Y A;  1MMD A;  4HCZ A;  1M8M A;  2CP6 A;  1OKV B;  3M55 A;  2C6T B;  2AK5 A;  2GCX A;  1V1C A;  1VQN T;  2RN8 A;  2BIV A;  3CME Q;  4M77 D;  5GJV B;  3OYM A;  4HKE A;  1ABQ A;  1ZP2 A;  3L2V A;  1VQN A;  4R0K A;  1QVG P;  3C95 A;  1JB0 E;  3CCQ A;  2AZS A;  1CKB A;  5HK0 A;  2BZX A;  4LN2 A;  1Z9Q A;  5GAO q;  4PK4 A;  3RR6 A;  5A0G A;  2ENM A;  2K5I A;  4LE9 A;  4ZN1 A;  3SDZ A;  2Y4X A;  3G33 B;  2VC8 A;  5LJ5 e;  4MDW A;  5KCH A;  2KMT A;  5KE2 A;  1TH7 A;  1QCF A;  2QQA A;  1WPY A;  2KYB A;  1GBQ A;  3I55 T;  1VQ9 Q;  4RTW A;  5IDP B;  1U1T A;  2NUZ A;  3GBQ A;  2AIR B;  1BIB A;  4HCB A;  3T9N A;  3I55 A;  2CRE A;  5FLX E;  4M75 B;  3EHQ A;  1UGP B;  4LDU A;  2K4Y A;  4E7S A;  3PTA A;  2DKG A;  2DXB B;  4KUI A;  2VVK A;  3TQ7 P;  1HXD A;  4LD9 K;  4G6L B;  1RAA B;  3NTH A;  4OML A;  4C8Q G;  5GAN e;  3BY7 A;  1VQK T;  4BY6 C;  2RM4 A;  1Q81 U;  1NLO C;  4DEY A;  2DRK A;  1UDL A;  5GMK l;  3OW2 S;  2MI6 A;  1M2V B;  2ZPI B;  3JCM c;  4M77 F;  3HFN A;  5EFQ B;  3KFV A;  3PVL A;  4J5Y A;  2JT4 A;  2DJQ A;  2NUP B;  3V8L A;  1EFN A;  1S1N A;  3ASK A;  5FWC A;  2W9Z A;  2J6K A;  3SB2 A;  2RK1 A;  3VU3 C;  2NLU A;  2EGC A;  2R58 A;  2X4J A;  3CC7 T;  2DK3 A;  2LCL A;  4J9H A;  1OIU B;  2DF6 A;  1Y57 A;  3E19 A;  2RPN A;  2WEV B;  2DVE A;  3CC7 A;  4E7L A;  2GTO A;  2HD0 A;  4M7A G;  3A5Z B;  4MFD A;  4BCN B;  4F7L B;  2EFI A;  2RI3 A;  2RJE A;  2ZZD B;  3TW7 A;  1HSQ A;  2EYY A;  2CUB A;  1H4L D;  4EOQ B;  4AG2 C;  3VKG A;  3PMT A;  2EYW A;  1JJ2 P;  5GAN 6;  1OL2 B;  2YUP A;  2RJC A;  2KBT A;  4J7I A;  4XU2 A;  4PLL A;  3G6E Q;  3KHI A;  3G71 A;  3OYF A;  2BZ8 A;  2HEQ A;  3OYI A;  5M9O A;  4RCB A;  3OW2 A;  1YJW T;  2L3R A;  3HRU A;  2OAU A;  1MV0 B;  1JXM A;  5GAN 8;  1QQJ A;  1Y96 A;  1YFN A;  5CK9 A;  4OB2 B;  3CBM A;  4Y91 A;  1AWJ A;  2WMA B;  3OS5 A;  2HKQ B;  4QKU A;  2J6F A;  1RAI B;  1YJW A;  1OU9 A;  4YOZ A;  2DD5 A;  4C8Q A;  5FU7 C;  2QTX A;  3QJ6 A;  5HVY B;  4QVD A;  5GAN 3;  4LDY A;  2JZ2 A;  2OX7 A;  1ARK A;  1CKA A;  3JB9 D;  1G83 A;  3JSC A;  2F5K A;  3CMA A;  4HT9 A;  1D09 B;  3U23 A;  2PK9 B;  4XTZ A;  2MF2 A;  2B86 A;  3HSB A;  2C0T A;  3H0H A;  1VQ6 Q;  3CC4 Q;  2FZC B;  3V8K A;  2E5K A;  2HNI A;  1KHI A;  1GCQ C;  4ELJ A;  4X34 A;  4E7J A;  5HNB B;  1X43 A;  1H8K A;  4F14 A;  1VQP T;  2KT1 A;  3V7R A;  2JW4 A;  2UZE B;  2HBW A;  4CFU B;  2A08 A;  5KYU A;  1NBE B;  3QO3 A;  3JCM P;  5L23 A;  3RMQ A;  2XD0 A;  4E7K A;  3JV3 A;  2LT1 A;  4XTV A;  2DYB A;  1S72 T;  4OGR B;  3LH0 A;  1QVP A;  3M9Q A;  4CI0 C;  2SEM A;  1WIE A;  2YWW A;  3THK A;  1JU5 C;  5IXF A;  1TG0 A;  2RHZ A;  4C92 C;  1NLP C;  2DEU A;  5GAM f;  1H27 B;  4J9I A;  2GF7 A;  1OPL A;  5IDN B;  2QQ8 A;  1NG2 A;  3QG1 A;  3LGF A;  4FW1 A;  2L3S A;  4MMK A;  4BI3 A;  3QYH B;  1QMC A;  5LJ3 e;  2W10 A;  1HYO A;  2JVV A;  1KQ1 A;  3HP9 A;  2CZ0 B;  4HA8 A;  3QUI A;  3VS1 A;  1E7O A;  1N9R A;  2KDS A;  1B34 A;  1X2Q A;  2FHD A;  3I56 T;  4M78 G;  2C06 A;  5C0M A;  1LOJ A;  4OF1 A;  2R5M A;  4AKI A;  1WLP B;  4YC3 B;  4Z8A A;  5GAN f;  3L2W A;  2EVR A;  2QQS A;  2ZPF B;  3H6Z A;  3EOC B;  3M58 A;  2D0N A;  4C8Q E;  2FO0 A;  3MP8 A;  1K73 R;  2EYX A;  2GNC A;  4JX6 A;  1XO2 A;  1VOL A;  4KRC B;  1YIT Q;  3OS2 A;  4FT2 A;  1JBM A;  4EOO B;  4IIM A;  2QEX Q;  3X20 B;  1ZBX A;  3M56 A;  1K73 C;  3M5A A;  5HBH B;  1WI7 A;  2PMI B;  1YJ9 T;  1VQO A;  3OYL A;  4JPB W;  3X26 B;  3OYB A;  4B9W A;  4PJO C;  2HCK A;  3H4C A;  2WSE E;  1UUE A;  1VQ7 Q;  2YHT A;  1YJ9 A;  1M90 U;  1GRI A;  2FVU A;  1W98 B;  2COY A;  1OI9 B;  2HQX A;  2G77 A;  2JNG A;  1SF9 A;  1BIA A;  3CCV Q;  5GMK h;  3HRT A;  4JUV A;  4KH0 B;  2Y4Y A;  5ICP B;  3VYG A;  4KUL A;  1ZLM A;  1YI2 T;  3EH2 A;  5L2W B;  2BKD N;  4BCO B;  4XTU A;  1BU1 A;  2CH4 A;  1NJI R;  1VQ4 Q;  3A8L B;  2OI3 A;  3EAE A;  1HD3 A;  3P8B B;  4A4K A;  1AD5 A;  1Q95 G;  1H28 B;  2A37 A;  1YWP A;  4ESR A;  4PL6 A;  4UN0 A;  4XTW A;  1YI2 A;  3OSV A;  4IKF A;  4EON B;  3QXE B;  4M78 A;  5FU6 B;  3Q1J A;  4HNT A;  4XTY A;  2DFU A;  3QHS A;  1K9M R;  1UHC A;  2V22 B;  5CKB A;  3G4S T;  5L8R E;  1ACM B;  1C6V X;  4ELZ C;  4EOJ B;  3CCM T;  4IUQ A;  3HO8 A;  2BS2 A;  2M1H A;  2DPP B;  1RAB B;  4QW2 A;  1GUX A;  4CC7 A;  3I35 A;  4E7I A;  3LYI A;  3G4S A;  3CCM A;  4M7D D;  2LQK A;  3GOX A;  1Y96 B;  1M1G A;  1WHG A;  4HCK A;  5GAN d;  2CJM B;  4Z6Y A;  3S3M A;  1UNL D;  1FYN A;  5HK3 A;  5I2M A;  2QQB A;  3J80 E;  3LX7 A;  3UWN A;  3CD6 A;  4HT8 A;  4OMP A;  2CT4 A;  2DD5 B;  2SRC A;  4C8Q B;  3HTR A;  1PKT A;  2O31 A;  5CKE A;  2ROL A;  4PJO D;  2RQR A;  1I5O B;  1Y7X A;  3SWN A;  3OW2 P;  4JZ3 A;  3LH5 A;  3QHR B;  1LJO A;  2E3H A;  2ZPH B;  2YUO A;  2QQ9 A;  2OTL T;  1QMZ B;  1FX7 A;  4AFU C;  3TW6 A;  1OIY B;  2GBQ A;  4J83 A;  2K79 A;  3MET A;  1Q81 C;  3CCS T;  1KC8 U;  4MIM A;  4DQ2 A;  2FYK A;  2OTL A;  3E9G A;  5LJ5 j;  1Q86 U;  2FZG B;  4LDV A;  5LQF B;  9ATC B;  3G1J A;  4BI4 A;  4XAX B;  3CCS A;  3CCL A;  5KYU B;  4N0A A;  3CC2 A;  1X01 A;  2LCC A;  2IW6 B;  4RTU A;  5I5Z B;  3ZFJ A;  2JN0 A;  5LJ5 h;  5IH2 A;  2VGN A;  5LJ3 f;  4OP0 A;  1TUG B;  1PCX A;  1GY3 B;  1E6H A;  1W4S A;  2LQN A;  1YN8 A;  3NTK A;  4FCY A;  4M7D F;  1V76 A;  5CCA A;  3M0R A;  4HVU A;  3M4G A;  4A4G A;  2K5L A;  2WIP B;  4ATO A;  3FJP A;  2H3J A;  1AWW A;  4RTY A;  2L89 A;  1PSE A;  4F7N B;  4M78 E;  2RMO A;  2D9T A;  1M30 A;  2WPA B;  2AHJ B;  3A98 A;  4WCI A;  1XQH A;  4OB1 B;  4DBF A;  1TOV A;  3HKS A;  3RBB B;  1H1S B;  3OYG A;  4QVZ A;  1B34 B;  1YBY A;  4R56 A;  1ENW A;  1RI9 A;  2YLC A;  5ECA A;  4FYY B;  3QWX X;  4QSH A;  1NPR A;  3X24 B;  4BCM B;  2QGG A;  3DKM A;  5FWB A;  1VQ9 T;  2RF0 A;  3TNH B;  1BI1 A;  1T3L A;  3EGD A;  1JQQ A;  3JCM X;  2EWN A;  1FIN B;  1RAC B;  5I11 A;  2I0N A;  3GLX A;  1AIS B;  1Y71 A;  2RHU A;  1VOM A;  1VQ9 A;  4EOS B;  2M0O A;  1H1R B;  4L5G A;  4XU1 A;  4F16 A;  3PO3 S;  5GJW B;  3R6N A;  3OSS C;  3FEO A;  4BXX X;  4J6X A;  8ATC B;  2QG9 B;  1WZO A;  4QQ6 A;  2JM9 A;  1T3S A;  1QCO A;  2EW3 A;  1M4Z A;  1J3T A;  2X1N B;  4M77 A;  2CP2 A;  5HBJ B;  2G9X B;  4LNP A;  2QGS A;  3ZEH A;  5GAN g;  3X28 B;  4EOR B;  1KSW A;  1UTI A;  2M02 A;  1G3S A;  4J9D A;  4XK8 E;  4BD3 A;  3A8O B;  3OS1 A;  4ZN3 A;  3BDU A;  3H9N A;  5LJ3 d;  4E7H A;  1IGQ A;  3A1P A;  4C5H A;  1VQ8 A;  1OU8 A;  1E9H B;  3VYG B;  1NPP A;  2O2O A;  3M0P A;  1RL2 A;  2EPD A;  2C0I A;  2LTO A;  2UZL B;  3VKI A;  3VS6 A;  5KCO A;  3M59 A;  3NPF A;  1EIF A;  2LVM A;  3DJB A;  1ZSZ A;  2RI2 A;  1GXI E;  3G6E T;  4OR5 B;  4BBR M;  4M78 B;  4RG8 A;  3M0Q A;  2IVW A;  3HRS A;  5CVI A;  2DL5 A;  2VXF A;  5IHY A;  1G8X A;  1YJN A;  4BE2 A;  1GUX B;  4D6W A;  3E2U A;  3E9F A;  1D0Z A;  5CIU A;  1R8O B;  1VQL Q;  2LC4 A;  3PT9 A;  2C4G B;  4KRD B;  5EJC A;  5CKF A;  1GL5 A;  2XK0 A;  3H0F A;  1URC B;  2OTJ Q;  1TXQ A;  2K5F A;  1ZSG A;  4OMQ A;  3MHX A;  1AZE A;  2X4X A;  1MMN A;  2PK2 A;  3EH1 A;  6AT1 B;  3SWN B;  4CRL B;  1G2B A;  3VRY A;  3QKJ A;  2E6Z A;  2YLB A;  1VQ6 T;  3CC4 T;  3S3O A;  2CP7 A;  2JS0 A;  1M90 R;  2F5T X;  2CP0 A;  2WAC A;  1VQ5 Q;  2P4R A;  3BG3 A;  1U1S A;  4EIK A;  2K6D A;  2BPM B;  1PSF A;  4XU0 A;  1M90 C;  2L0A A;  5GAM e;  4M77 E;  4EMK C;  2MIO A;  3EG2 A;  4HL4 A;  2W0Z A;  4RCC A;  1OI1 A;  2EYQ A;  4Y28 E;  4E6R A;  2A28 A;  3TN8 B;  2LX9 A;  4KT0 E;  4K11 A;  2YRC A;  4BCJ B;  2KQW A;  1ZUU A;  1A0N B;  4WF2 A;  2FPD A;  1X6B A;  2PZ1 A;  2VKN A;  3RKW A;  4F70 B;  1MMA A;  1M3A A;  2MWO A;  2JTE A;  5C6S A;  1TD6 A;  4CFW B;  2PUK B;  3L42 A;  5IN1 A;  3F5X B;  3FDR A;  1Q82 U;  2X9H A;  3POM A;  3OYE A;  4ZNX A;  4DBQ A;  2DAQ A;  3OYK A;  3V7S A;  2MWP A;  2X35 A;  4C5E A;  4HNU A;  1O75 A;  3KXT A;  1AVZ C;  4ZGE B;  1VQK A;  3M54 A;  3CCE Q;  3SFM A;  3JB9 J;  2V8I A;  5IHI A;  1MNE A;  1AEY A;  5IHN A;  3MP1 A;  2JXB A;  3MPU B;  2RI5 A;  4C0G A;  1VYW B;  1I8F A;  4OVA A;  4NC6 A;  2AT1 B;  1X75 C;  5I21 A;  1NZ9 A;  5LJ3 g;  5CKD A;  3BLR B;  3HB9 A;  2DZ9 A;  1JOW A;  1N5Z A;  1B3Q A;  4JX5 A;  2BS3 A;  2KNB B;  3EGD B;  4IUU A;  3M4Y A;  2DMO A;  5CYI B;  1ABO A;  1MGQ A;  2GFA A;  4UC4 A;  1P92 A;  3MJX A;  1YIT T;  4BCF B;  2V8J A;  4BI8 B;  3EG1 A;  1ZHI A;  2HSP A;  4FSX A;  4PFZ A;  3RES A;  1N6A A;  2C5N B;  4BUG A;  3QWL A;  1NE8 A;  4JLG A;  2MMP A;  2XHC A;  4X9C A;  2DXU A;  1D0X A;  2CP3 A;  4CC3 A;  3NGP A;  4HVW A;  1B7T A;  2K9G A;  2YDL A;  5FRM A;  1VQ7 T;  5GAN 4;  5IT9 E;  2CS7 A;  5BNJ B;  2AKK A;  2J6O A;  4M77 B;  3L1A A;  2KYM A;  1Q86 C;  1OX8 A;  2V1R A;  1C9B A;  2KSS A;  1WJS A;  5KYX A;  1JST B;  1MHN A;  2DL8 A;  1YHQ Q;  1BB9 A;  1N8R U;  2QTV A;  4Q5W A;  3CCV T;  2KXD A;  1I0C A;  1G3N C;  1K8A R;  2JJ9 A;  4RG2 A;  1PD0 A;  3HZJ A;  2DRM A;  2MAM A;  3DB3 A;  3MIA B;  4PNO A;  1VQ4 T;  4ORZ A;  3CCV A;  4TTH A;  2CCI B;  3L2Q A;  4DA4 A;  2ESW A;  1K8A C;  1KFZ A;  1OYX A;  1E7P A;  2M51 A;  4HVV A;  1JRI A;  1VQ4 A;  2E12 A;  3PIO A;  1ZSZ B;  4AKG A;  4CFM B;  1M1K R;  1OZ3 A;  5I22 A;  3NFC A;  2E4H A;  4M7D G;  2LNH B;  4GBQ A;  4IIO A;  3SEM A;  3B57 A;  2RB6 A;  2F1L A;  2OJ2 A;  4JS5 A;  3CCQ Q;  1M1K C;  1NYF A;  3JCM e;  2M0Y A;  2ED1 A;  2PUO B;  1W2B S;  1VQP A;  4RMO A;  3OBY A;  4J9B A;  4M4Z A;  2HKN A;  3EJ1 B;  1UEC A;  1N9S A;  1R0C B;  3CBP A;  4JRQ A;  1KD1 U;  3RNJ A;  4BAC A;  1RUW A;  1QP2 A;  2EJ9 A;  2I40 B;  1OGU B;  2K3X A;  3OQ5 A;  4WTO B;  1ZUY A;  2BS4 A;  2JUF A;  2X3X D;  1S72 A;  3OYD A;  1N27 A;  4AFQ C;  4AFZ C;  2ED0 A;  3FLG A;  4C0F A;  3MEU A;  5HQ0 B;  2CH4 W;  2XU8 A;  3NMZ C;  2IW8 B;  3HBL A;  2CGH A;  2JTF A;  2C5O B;  2MYS A;  4QQD A;  4M7A C;  4RTT A;  3A8M B;  1VUB A;  3I55 Q;  4M6V A;  1WFW A;  4MZM A;  3MEA A;  2QDY B;  1H1P B;  4BBS M;  1G5V A;  5HCK A;  3JB9 F;  3EG0 A;  2F2C A;  2LDM A;  3RDV A;  3EG9 A;  1F5Q B;  1BU2 A;  1SG5 A;  5CAI A;  2KRO A;  2DNU A;  5EC7 A;  3VS4 A;  4QQG A;  4JJD A;  3PNW C;  2QGF B;  1SEM A;  4N4H A;  2KRS A;  1FXX A;  1BCO A;  2P84 A;  2DZC A;  5J3B A;  3I56 A;  3M0T A;  3L2U A;  3QSU A;  1OEB A;  4R55 A;  1LNX A;  2KE9 A;  4A4H A;  2PQW A;  1OOT A;  1OPK A;  4M7D A;  1PG5 B;  2XKO C;  5KYY A;  3RKY A;  5LL6 S;  1QVF S;  3M03 A;  2J7I A;  3S3N A;  2B9R A;  4EOM B;  3M57 A;  1K1Z A;  2MK5 A;  1I1J A;  3GNF B;  4II1 A;  4BY6 B;  4LD6 A;  3CPW S;  3SD4 A;  2KXC A;  1MMG A;  4BE0 A;  1BI0 A;  4RKU E;  5J26 A;  1CSK A;  1KJW A;  5GMK j;  2RQU A;  4C92 D;  1WNL A;  1AZG B;  3QYB A;  1TSF A;  1YCS B;  5GAO m;  2DL3 A;  2WFY B;  4LOC A;  1FMW A;  2IIM A;  4OMN A;  3G71 Q;  5FW9 A;  2UZB B;  3GPL A;  3INZ A;  4KBM B;  4M7A D;  3QDF A;  1E6G A;  2PJQ A;  3MP6 A;  1UE9 A;  2ZPB B;  2H8H A;  5DM7 R;  1QLY A;  2COZ A;  4PFO A;  2L3Q A;  1QVG S;  4AG1 C;  4FIB A;  4DOV A;  5GAO p;  2QAZ A;  5GAM d;  2RNA A;  3I9Q A;  3MEW A;  1RAF B;  1JSU B;  3CCJ Q;  1AOJ A;  1D3U B;  3FJ5 A;  2DXT A;  2AKL A;  2QK0 A;  2PU9 B;  3E1S A;  2QF7 A;  3BFM A;  1YP5 A;  5EG2 A;  1YWO A;  2X3W D;  4C0D C;  3CMA Q;  2X4Y A;  1V29 B;  2QA4 T;  1TU0 B;  4GLM A;  2W99 A;  2RQW A;  2KMG A;  2WIH B;  4J6Y A;  1AWX A;  3CCU Q;  3VRZ A;  2XDB A;  2QDJ A;  1NEG A;  1VYV A;  1XOV A;  2QA4 A;  3QZ5 B;  2LW4 A;  4BCM D;  4JDS A;  2WSF E;  4BCQ D;  2DTI A;  5FRO A;  4ELL A;  1MUZ A;  3ME9 A;  4C92 F;  3H8Z A;  1SRM A;  3RUX A;  2K2V A;  3VYH B;  2E41 A;  4FSS A;  3VV0 A;  4PLI A;  2E3I A;  2HSE B;  4M7A F;  2CSI A;  2DIL A;  3S6W A;  4M7D E;  1R77 A;  1Q81 R;  4YTL A;  3JCM f;  2CCH B;  2X51 A;  2FRY A;  3GF5 A;  4Y72 B;  4A63 B;  4BY1 X;  2A7Y A;  1HK9 A;  3VS5 A;  4PJO E;  1X2K A;  5FGK B;  1PHT A;  1WXT A;  2YT6 A;  4CFV B;  3DOG B;  3O8V A;  3ULR B;  2DIQ A;  1F1B B;  4ZTF A;  5GAN 2;  2D1X A;  1XJW B;  4HXJ A;  3GNG A;  5IF1 B;  3C4S A;  8AT1 B;  3BLQ B;  2HQE A;  1WHJ A;  1VQL T;  4C5I A;  3P8H A;  5A0L A;  2M9U A;  4RTZ A;  4FX3 B;  5FRN A;  1YIJ Q;  1FMK A;  3OYA A;  2ZCF B;  2LJ3 A;  3EFO A;  4Z88 A;  1BI2 A;  4M77 G;  1XNI A;  4QT7 A;  3DL1 A;  1JKW A;  3CPF A;  5HKC A;  5HBE B;  3JB9 I;  4RTV A;  1JJ2 S;  3CME T;  2P0K A;  3JCM W;  5GAN j;  1M8V A;  2YSQ A;  1QKW A;  2PVO B;  2A0F B;  4N0A C;  3CME A;  4E2F B;  1H3H A;  1TTH B;  4PJO F;  2NYS A;  4FW2 A;  3OA6 A;  2QDL A;  3VS3 A;  4JRI A;  1TFB A;  5GAN h;  2E65 A;  4E7Z A;  2J06 A;  4I3Z B;  1QCN A;  1BI3 A;  4P5N A;  4ROE A;  4Z89 A;  2K3Y A;  3F70 A;  4M75 C;  1VQO Q;  4CFX B;  3EG9 B;  3DTO A;  3LQ5 B;  2R5A A;  1UNH D;  4Y92 A;  1NM7 A;  1UJY A;  2F2V A;  5D6W A;  5ACB A;  1WYX A;  2EYZ A;  4O5V A;  1O9K A;  1OZ2 A;  2EKH A;  1GFD A;  1D0Y A;  3MKD A;  4CFN B;  2P0Q A;  2QAS A;  3HPW A;  1N8R C;  3MY1 B;  4YOS A;  2RHI A;  2RD1 A;  3RER A;  1M5Q 1;  4F7U E;  1VQM Q;  4NOY A;  3QZ9 B;  2EQJ A;  5GAM g;  3EHR A;  3CCR Q;  4M7D B;  1PM3 A;  4V2S A;  5KYY B;  2DL4 A;  4F04 B;  3JCM d;  5GAO n;  1P5E B;  4KH1 B;  2IVX A;  1KHC A;  4EOK B;  1M9S A;  1BCM A;  2RHX A;  3J7A F;  3UT1 A;  1NYG A;  2EIF A;  1O9S A;  2O9S A;  2KI7 A;  3DLL A;  4D8K A;  4PJM A;  2F2W A;  3UDC A;  1YI2 Q;  2BUD A;  3CCE T;  2JGZ B;  4ROD A;  4KGX B;  5IAY A;  4GLK A;  3D7S B;  2R7G A;  2V26 A;  2RHY A;  3CCE A;  2FL7 A;  3NHN A;  3NDQ A;  2E10 A;  2MCN A;  2DBM A;  4L6V 5;  2EBP A;  1M2O A;  2EKO A;  4BE1 A;  3UPU A;  4F7U F;  3CCM Q;  1QWF A;  4L59 A;  4BDZ A;  3KUF A;  4FL6 A;  1BYM A;  1PKS A;  1AD6 A;  2FRW A;  5IHK A;  2Y90 A;  5CQX A;  2DD4 A;  4M75 D;  1ZQ1 A;  3CD6 Q;  1K4U S;  5GAN 5;  3CXC S;  4IUT A;  3AHU A;  3QJY A;  3EFR A;  4MDX A;  4FM4 B;  1VYT A;  2DIG A;  1KIK A;  4B9X A;  3A8G B;  1I5L A;  3VS7 A;  2VYT A;  3C12 A;  4OB3 B;  4GY5 A;  3EID B;  1VYU A;  2E64 A;  1RAE B;  4OMF B;  2YUQ A;  4BCH B;  2BE9 B;  3TEE A;  3G6E A;  3K7A M;  1FWZ A;  3QDR B;  2DER A;  2WJ9 A;  1BBZ A;  1K73 U;  2K2M A;  1YNZ A;  2QQR A;  5GAO l;  1IHV A;  1YHQ T;  1Q7Y U;  2OTL Q;  1KQS S;  1WHM A;  1M27 C;  5GAN 7;  1ZSZ C;  1NEB A;  1K0X A;  3CEY A;  2LQW A;  5I2S A;  1WHL A;  3JB9 G;  2XDD A;  1JO8 A;  3CCL Q;  3CC2 Q;  3OMC A;  1YHQ A;  1N4M A;  4ZGD B;  2PTK A;  3J81 E;  1UGV A;  4EDU A;  4BCK B;  4OMM A;  4TVR A;  2D8J A;  1T0J A;  4BCN D;  5GAO r;  3EGX A;  1C0M A;  3QYG B;  1GFC A;  2EJF A;  4DEX A;  2DL7 A;  4LUD A;  2PNI A;  3PVQ A;  3MY5 B;  4E47 A;  2O4X A;  3CXC A;  4JLI A;  5LJ3 j;  4AFS C;  5D7U A;  2DX1 A;  1PKD B;  1PWT A;  4KGV B;  4OGE A;  4RTX A;  1RAH B;  4M75 F;  1FVV B;  3M0U A;  4EOP B;  3RKX A;  1VQ6 A;  3CCQ T;  4EMK A;  3CC4 A;  1WXB A;  2X4W A;  1G3T A;  4VUB A;  4JRP A;  3PGG A;  1W6X A;  5LJ3 h;  1NJI U;  2COW A;  4LDX A;  2WXV B;  1UHF A;  3JCM V;  2E70 A;  2KK4 A;  2JM8 A;  2CZ7 B;  5DLQ E;  2VWF A;  1AHJ B;  2QI2 A;  2XDP A;  5KYW A;  1KQS A;  3UA7 A;  4NST B;  4NL2 A;  4A54 A;  2CZ1 B;  1TWB A;  4F7S B;  2CKK A;  1K9M U;  3EFO B;  5CR2 A;  1ZBJ A;  2W2H A;  2LNV A;  3QII A;  3JCM g;  4EMH A;  3H41 A;  1H1Q B;  3MCA B;  3OYC A;  3PMI A;  2RQV A;  4BDY A;  2PVD B;  4ANJ A;  2EGE A;  4XQ3 A;  4N4I A;  3KBG A;  3UAT A;  4OB0 B;  3VUB A;  1Q7Y C;  1EX4 A;  2RH2 A;  4CC2 A;  2RJD A;  2KGT A;  4KRT A;  2LX7 A;  1WJR A;  4CFU D;  2DTO A;  1GCP A;  3M0S A;  2C0O A;  3EG3 A;  4KGZ B;  3VUZ A;  5D6Y A;  2DET A;  1MND A;  1UB4 A;  1C1A A;  4EMG A;  3C0C A;  4BB7 A;  3REA B;  1IZ6 A;  1TS9 A;  3CBO A;  4PKC C;  4F7J B;  4PJL A;  1O9K B;  1BK2 A;  1WQW A;  7AT1 B;  2D0Q B;  4II5 B;  1Z9Z A;  2V8K A;  1ZX6 A;  3LGL A;  3OMG A;  2ABL A;  3NTI A;  2PHG A;  1W70 A;  3HL8 A;  3TRE A;  5KH6 A;  2QEX T;  2FEI A;  2F2X A;  1WHK A;  1VQ8 Q;  4EPC A;  1WGS A;  1KC8 R;  2DTH A;  3JCM Q;  3DLM A;  1YIT A;  4C92 G;  2ATC B;  2CUD A;  2QEX A;  1Q86 R;  4ZTJ A;  3SHW A;  1KC8 C;  3BHV B;  2H3E B;  1PNJ A;  2XI9 A;  4JJC A;  1X6G A;  3G71 T;  1D1B A;  2YRD A;  4AT1 B;  3FB9 A;  3GIB A;  4OGC A;  2M16 A;  2BKZ B;  4XU3 A;  1VQ7 A;  5FU6 C;  2IPO B;  1QP3 A;  2KY9 A;  1YJN Q;  1H3Z A;  1H26 B;  1M3B A;  1ZA2 B;  4O6J A;  1JXO A;  2BE7 D;  2LRQ A;  3DB4 A;  4LDW A;  2I2L A;  2KEA A;  4X1V A;  1U3O A;  2DD4 B;  2GTJ A;  1VIE A;  1UGR B;  1XTD A;  5DQW A;  3CCJ T;  2C5V B;  1GCQ A;  2NWM A;  1WX6 A;  2DA9 A;  3G7Z A;  2DYI A;  4LXC A;  4C8Q C;  3V7C A;  3OS0 A;  3DDQ B;  3CMA T;  2L8D A;  3AT1 B;  1WJQ A;  2DVJ A;  3CCJ A;  1VQN Q;  1D1C A;  5D6X A;  2V1Q A;  3CCU T;  4PJJ A;  1KG1 A;  2RK2 A;  1M3C A;  1R0B G;  2LQ8 A;  2VXE A;  2ZPG B;  3M53 A;  4MZP A;  4PJO G;  4J9C A;  2JS2 A;  2FB7 A;  3GP8 A;  3CCU A;  4C92 A;  2EQK A;  1X27 A;  2F69 A;  2E1H A;  5A2Q E;  4ROC A;  3HHT B;  2R57 A;  2QFZ A;  4M7A A;  4HCC A;  4CRI A;  2DME A;  4BCP B;  3EGX B;  1X69 A;  2D8H A;  3TNI B;  4RUG A;  2LZ6 B;  4EOL B;  3JRZ A;  3UA6 A;  2O4X B;  1IB8 A;  4FU6 A;  3VS0 A;  2IN3 A;  3RGF B;  3TCJ A;  2ZPE B;  3JCM b;  1PC0 A;  1SKU B;  1D3B A;  3EFS A;  2CZ6 B;  2NUT A;  1SSH A;  2PVG B;  3L2Z A;  5J39 A;  3OYH A;  2YXY A;  4DOW A;  1DJ7 B;  1SPK A;  4EMK B;  2K57 A;  4IUV A;  5LJ5 f;  2YUN A;  3QYE A;  1VQK Q;  2AZV A;  2VAS A;  4NS5 A;  1W2B A;  1YIJ T;  3MO8 A;  2JOY A;  3CXC P;  2VB6 A;  4C8Q D;  3BE3 A;  3LWI A;  4D8D A;  5KYW B;  2YRV A;  5DLO A;  1YIJ A;  3TU4 K;  3EGU A;  2A3L A;  2MPX C;  1QW1 A;  4X9D A;  1PRM C;  4N4G A;  5HY6 A;  3BG5 A;  1FMV A;  2MOX A;  3WVD B;  2JTM A;  3CC7 Q;  4F7U G;  4DBH A;  4PJO A;  3QBY A;  2LCS A;  3DDP B;  4F6S B;  1UGS B;  1HJD A;  3MEV A;  1OX9 A;  1KQS P;  3A8H B;  2KVQ G;  1Q7Y R;  4M7D C;  1VQO T;  3URG A;  4HNV A;  1G3W A;  2ZGW A;  4OMO A;  2GQV A;  4EOI B;  2ROT A;  3LLR A;  4F17 A;  4MML A;  2EQU A;  2KRM A;  2I53 A; 
#chains in the Genus database with same CATH homology
 5GAN h;  1YJW A;  2E65 A;  2KR6 A;  3SWN B;  2DD5 A;  4C8Q A;  5FU7 C;  1BI3 A;  4P5N A;  1Y07 A;  2QTX A;  3QJ6 A;  2K3Y A;  3F70 A;  3QKJ A;  4M75 C;  2E6Z A;  1VQM T;  2YLB A;  2P0P A;  5CQY A;  3WXM B;  2R5A A;  4QVD A;  5GAN 3;  1VQ6 T;  4LDY A;  3CCR T;  1UGQ B;  4C92 E;  3CC4 T;  2JZ2 A;  3FIF A;  3S3O A;  1KQ2 A;  5D6W A;  4O5V A;  1OZ2 A;  3JB9 H;  2F5T X;  2WAC A;  2P0Q A;  1VQM A;  1QVF A;  3JB9 D;  3HPW A;  4C0Z A;  1N8R C;  4M7A E;  3BG3 A;  4C8Q F;  2DXC A;  3CCR A;  3JSC A;  2F5K A;  3CMA A;  4HT9 A;  4AI6 A;  1U1S A;  2MF2 A;  2RHI A;  3OYY A;  2RD1 A;  1PSF A;  4XTZ A;  3CPW A;  3ZBD A;  3RER A;  1M5Q 1;  4XU0 A;  4F7U E;  1M90 C;  5GAM e;  4M77 E;  3QZ9 B;  2EQJ A;  4NOY A;  3RMS A;  4EMK C;  2WSC E;  5CO7 A;  5GAM g;  3LW5 E;  4M7D B;  3V8K A;  2HNI A;  4V2S A;  3JCM d;  4HL4 A;  1KHI A;  5GAO n;  4ELJ A;  4X34 A;  4E7J A;  1KHC A;  4RCC A;  1M9S A;  1OI1 A;  5LJ5 d;  1VQP T;  2RHX A;  2EYQ A;  3V7R A;  3J7A F;  3UT1 A;  4Y28 E;  4KT0 E;  2LX9 A;  2EIF A;  1O9S A;  3QO3 A;  3FC3 A;  2KQW A;  3JCM P;  4IUR A;  3RMQ A;  3DLL A;  4J7F A;  1BKB A;  1NJI C;  2XD0 A;  4WF2 A;  5FU7 B;  3UDC A;  2P4T A;  4E7K A;  2G3R A;  2LT1 A;  2BUD A;  4M78 C;  3CCE T;  4XTV A;  4JX4 A;  3RKW A;  4M75 G;  4F7U A;  1S72 T;  2MWO A;  5IAY A;  3C94 A;  2O01 E;  5C6S A;  4FT4 A;  2DJZ A;  4J6W A;  3LH0 A;  4GLK A;  1QVP A;  3M9Q A;  3ER0 A;  4CI0 C;  2PUK B;  3L42 A;  5IN1 A;  3FDR A;  1Q82 U;  1K9M C;  3OYE A;  2RHY A;  2XG8 D;  2FL7 A;  3OYN A;  3CCE A;  2E10 A;  3CD6 T;  3HFO A;  2DAQ A;  2RHZ A;  3OYK A;  3V7S A;  3LWH A;  1QVG A;  1UEB A;  2DO3 A;  2MWP A;  2X35 A;  4L6V 5;  1QLB A;  4C5E A;  4C92 C;  2EKO A;  4HNU A;  1O75 A;  4BE1 A;  3KXT A;  4HLQ A;  1VQK A;  4ZGE B;  3UPU A;  3M54 A;  4C5G A;  4F7U F;  3SFM A;  3JB9 J;  2V8I A;  2DEQ A;  2IG0 A;  5GAM f;  4L59 A;  4BDZ A;  3KUF A;  4FL6 A;  1BYM A;  3MP1 A;  1Q82 C;  2GF7 A;  2QQ8 A;  2RI5 A;  3QG1 A;  3LGF A;  4MMK A;  4BI3 A;  4C0G A;  3L2R A;  2Y90 A;  5CQX A;  2DD4 A;  3QYH B;  4M75 D;  1I8F A;  1ZQ1 A;  4OVA A;  4NC6 A;  5LJ3 e;  1X75 C;  5I21 A;  1NZ9 A;  5LJ3 g;  4IUT A;  5GAN 5;  3CXC S;  3QJY A;  5CKD A;  3AHU A;  3QSU A;  5GAM j;  3HB9 A;  2DZ9 A;  4ME7 A;  2JVV A;  1SSF A;  1KQ1 A;  3EFR A;  4IUP A;  4MDX A;  3HP9 A;  2CZ0 B;  4HA8 A;  4FM4 B;  3QUI A;  3SWN C;  2DIG A;  4JX5 A;  2BS3 A;  2EAY A;  1N9R A;  2KDS A;  4B9X A;  1B34 A;  3A8G B;  4IUU A;  4JS4 A;  1I5L A;  2VYT A;  3M4Y A;  2E6N A;  2FHD A;  3C12 A;  3I56 T;  4A53 A;  4OB3 B;  4M78 G;  4GY5 A;  2C06 A;  5C0M A;  1LOJ A;  2HBP A;  5GMK m;  4OF1 A;  2R5M A;  1MGQ A;  2E64 A;  4AKI A;  1P92 A;  2GFA A;  4UC4 A;  1YIT T;  4OMF B;  2V8J A;  5GAN f;  3L2W A;  2QQS A;  4ELY C;  4BI8 B;  5GAM h;  2ZPF B;  3TEE A;  1ZHI A;  4FSX A;  3G6E A;  3CCL T;  3H6Z A;  3CC2 T;  1VQL A;  1FWZ A;  2D6F A;  3QDR B;  1N6A A;  3BW1 A;  3RES A;  3M58 A;  4BUG A;  2WJ9 A;  3QWL A;  4C92 B;  1K73 U;  1NE8 A;  4C8Q E;  4JLG A;  2QQR A;  2MMP A;  3BDL A;  2VV5 A;  2XHC A;  4X9C A;  2DXU A;  3MP8 A;  5GAO l;  3OY9 A;  1YHQ T;  1Q7Y U;  4M7D A;  1KQS S;  2OTJ A;  4MFE A;  5GAN 7;  4JX6 A;  4M7A B;  3CEY A;  3OS2 A;  4FT2 A;  5I2S A;  5FRM A;  1VQ7 T;  1JBM A;  3JB9 G;  2GFU A;  3X20 B;  3R6O A;  2XDD A;  5GAN 4;  5IT9 E;  3OMC A;  2CS7 A;  4ZGD B;  1ZBX A;  1YHQ A;  3J81 E;  4M77 B;  3L1A A;  3M56 A;  4M78 D;  1Q86 C;  1K73 C;  2LT4 A;  3VJP A;  4EDU A;  3M5A A;  4TVR A;  2KSS A;  3QPH A;  1WJS A;  1YJ9 T;  1FKM A;  5GAO r;  1U8R A;  1VQ5 T;  4M75 A;  1MHN A;  3OYL A;  1VQO A;  3X26 B;  3OYB A;  3QYG B;  4B9W A;  2EJF A;  2DXB A;  1K8A U;  1I81 A;  1N8R U;  4PJO C;  1D3B B;  3CCV T;  4Q5W A;  3OYJ A;  4E47 A;  2VGM A;  3RIR A;  5A0D A;  2O4X A;  2RA2 A;  3CXC A;  4JLI A;  3H4C A;  4RG2 A;  2WSE E;  5LJ3 j;  4KUD K;  3HZJ A;  2YHT A;  1YJ9 A;  1VQ5 A;  1M90 U;  2MAM A;  2EQM A;  5GMK i;  3DB3 A;  2FVU A;  4PNO A;  1VQ4 T;  3CCV A;  5DY9 A;  4OGE A;  3L2Q A;  3OBW A;  4XTX A;  4M75 F;  4DA4 A;  2HQX A;  1K8A C;  1OYX A;  2G77 A;  1E7P A;  3HSB A;  3X25 B;  2JNG A;  3RKX A;  1VQ6 A;  3CCQ T;  1BIA A;  4EMK A;  3CC4 A;  2X4W A;  4VUB A;  1G3T A;  1JRI A;  5GMK h;  3PGG A;  4JRP A;  5LJ3 h;  1VQ4 A;  3HRT A;  4JUV A;  1M1K U;  2E12 A;  2OTJ T;  2E5Q A;  2Y4Y A;  3PIO A;  3VYG A;  4KUL A;  1YI2 T;  1NJI U;  4LDX A;  4AKG A;  3N5B B;  2BKD N;  4XTU A;  1OZ3 A;  4J8O A;  3JCM V;  1JJ2 A;  5AYF A;  3NFC A;  2E70 A;  2KK4 A;  4M7D G;  3A8L B;  2CZ7 B;  3EAE A;  3P8B B;  4A4K A;  4JRK A;  2RB6 A;  5DLQ E;  1AHJ B;  2QI2 A;  2XDP A;  1KQS A;  4NL2 A;  4PL6 A;  4A54 A;  4JS5 A;  2CZ1 B;  4XTW A;  4A4E A;  1YI2 A;  2CKK A;  3OSV A;  4IKF A;  1K9M U;  3QXE B;  5CR2 A;  1M1K C;  4M78 A;  3WVE B;  4AKH A;  5FU6 B;  2VUB A;  3Q1J A;  4HNT A;  4XTY A;  2LNV A;  3QHS A;  3QII A;  2RJF A;  3JCM g;  4EMH A;  3JCM e;  4PJO B;  1W2B S;  2PUO B;  5CKB A;  5CKH A;  3G4S T;  2ZZD A;  5L8R E;  1VQP A;  4ELZ C;  3MCA B;  4RMO A;  5LJ5 g;  3OBY A;  3CCM T;  3OYC A;  4IUQ A;  3HO8 A;  3PMI A;  1N9S A;  2BS2 A;  3CBP A;  2M1H A;  4JRQ A;  1KD1 U;  4BAC A;  2DPP B;  2B8A A;  1QP2 A;  2EJ9 A;  2K3X A;  4QW2 A;  1I4K 1;  3OQ5 A;  4NL3 A;  2EJG A;  4E7I A;  3LYI A;  2CYZ B;  3G4S A;  4BDY A;  2PVD B;  2BS4 A;  2JUF A;  2KAF A;  4M78 F;  3CCM A;  1S72 A;  4XQ3 A;  2LQK A;  4N4I A;  3OYD A;  3GOX A;  1N27 A;  4M7D D;  1Y96 B;  3KBG A;  1VIF A;  1M1G A;  3FLG A;  5GAN d;  5KE3 A;  4OB0 B;  3VUB A;  4Z6Y A;  4C0F A;  3S3M A;  5HK3 A;  2RH2 A;  3MEU A;  5I2M A;  2RJD A;  2XU8 A;  2QQB A;  3HBL A;  2CGH A;  2JTF A;  3J80 E;  2XIC A;  3LX7 A;  1KD1 C;  1WJR A;  4QQD A;  3UWN A;  4HT8 A;  2DTO A;  3CD6 A;  4M7A C;  2DD5 B;  4C8Q B;  4A4F A;  3A8M B;  3VUZ A;  1RI0 A;  1VUB A;  5D6Y A;  5CKE A;  4PJO D;  4M6V A;  1UB4 A;  4MZM A;  4M77 C;  4EMG A;  5GMK e;  3MEA A;  1Y7X A;  3SWN A;  2QDY B;  3P8D A;  4BB7 A;  1IZ6 A;  3CBO A;  4PKC C;  1VQ8 T;  4BBS M;  1G5V A;  2RO0 A;  3JB9 F;  1LJO A;  2ZPH B;  4ZGJ B;  2LDM A;  4JJN K;  1WQW A;  3JAM E;  2D0Q B;  1X6O A;  2V8K A;  5CAI A;  3LGL A;  1YCY A;  2DXC B;  2QQ9 A;  2OTL T;  1M1F A;  3OMG A;  3NTI A;  2QXF A;  1FX7 A;  3TW6 A;  4QQG A;  4C0D B;  3BG9 A;  3PNW C;  4J83 A;  4N4H A;  3HL8 A;  3MET A;  3TRE A;  5KH6 A;  3JCM J;  1FXX A;  2QEX T;  1Q81 C;  3CCS T;  1KC8 U;  4MIM A;  1IRE B;  2FYK A;  4DQ2 A;  2OTL A;  3E9G A;  2DZC A;  4M75 E;  5J3B A;  1WGS A;  4EPC A;  2DTH A;  4QVC A;  3JCM Q;  5LJ5 j;  3FRN A;  3I56 A;  3L2U A;  3DLM A;  1Q86 U;  4R55 A;  1LNX A;  2L5Q A;  4A4H A;  1YIT A;  4LDV A;  4C92 G;  2PQW A;  4MZT A;  2QEX A;  4BI4 A;  4XAX B;  3CCS A;  3OB9 A;  4Z02 A;  2XKO C;  4N0A A;  4ZTJ A;  1X01 A;  3VKH A;  3CC2 A;  3CCL A;  2LCC A;  3PIP A;  3RKY A;  1H64 1;  1YJN T;  5LL6 S;  3V8J A;  1QVF S;  1KC8 C;  3S3N A;  3JCM h;  3PFS A;  3M57 A;  2XI9 A;  3G71 T;  3GNF B;  4F7U B;  4II1 A;  3ZFJ A;  4LD6 A;  2JN0 A;  4BY6 B;  5LJ5 h;  3FB9 A;  3CPW S;  2VGN A;  2XID A;  3SD4 A;  2HAX A;  5LJ3 f;  4OGC A;  3GIB A;  2M16 A;  4OP0 A;  1WQ7 A;  4BE0 A;  1W4S A;  1BI0 A;  3NTK A;  4XU3 A;  5FU6 C;  1VQ7 A;  4M7D F;  5CCA A;  4RKU E;  5J26 A;  1QP3 A;  2KY9 A;  1H3Z A;  5GMK j;  1G3Y A;  3M4G A;  4A4G A;  2K5L A;  4C92 D;  1WNL A;  4ATO A;  3QYB A;  4HCZ A;  4O6J A;  3FJP A;  2LRQ A;  5GAO m;  4LOC A;  3M55 A;  2H3J A;  3DB4 A;  4LDW A;  2I2L A;  3GPL A;  3INZ A;  2L89 A;  2GCX A;  1PSE A;  4KBM B;  4M7A D;  1VQN T;  4M78 E;  2D9T A;  2DD4 B;  2AHJ B;  2BIV A;  1VIE A;  1UGR B;  1XQH A;  3MP6 A;  1XTD A;  4OB1 B;  4M77 D;  2ZPB B;  3CCJ T;  3OYM A;  4HKE A;  5DM7 R;  3HKS A;  3L2V A;  3OYG A;  3G7Z A;  1VQN A;  3C95 A;  4QVZ A;  4C8Q C;  1JB0 E;  1QVG S;  3V7C A;  1B34 B;  1YBY A;  3CCQ A;  3OS0 A;  4R56 A;  3CMA T;  2L8D A;  4FIB A;  2YLC A;  4DOV A;  5HK0 A;  5GAO p;  1WJQ A;  3CCJ A;  4QSH A;  1NPR A;  3X24 B;  3DKM A;  5GAM d;  1VQ9 T;  3MEW A;  5D6X A;  1BI1 A;  5GAO q;  3JCM X;  2EWN A;  5A0G A;  3CCU T;  2K5I A;  4M7A G;  1KG1 A;  2RK2 A;  4ZN1 A;  3GLX A;  3SDZ A;  2DXT A;  2LQ8 A;  2Y4X A;  2VXE A;  1Y71 A;  2ZPG B;  2PU9 B;  2RHU A;  2VC8 A;  3E1S A;  3M53 A;  4MZP A;  2QF7 A;  3BFM A;  5LJ5 e;  1VQ9 A;  4MDW A;  5KCH A;  2FB7 A;  5EG2 A;  2M0O A;  4C0D C;  3GP8 A;  2KMT A;  5KE2 A;  3CCU A;  1TH7 A;  2X4Y A;  1V29 B;  4L5G A;  2QQA A;  4XU1 A;  1WPY A;  2QA4 T;  3I55 T;  4C92 A;  2EQK A;  2KMG A;  1U1T A;  2F69 A;  3OSS C;  4J6Y A;  3FEO A;  2XDB A;  1BIB A;  2E1H A;  4J6X A;  5A2Q E;  4HCB A;  3HHT B;  2QDJ A;  3T9N A;  2R57 A;  4QQ6 A;  2QFZ A;  4M7A A;  1XOV A;  2QA4 A;  3QZ5 B;  4HCC A;  4CRI A;  3I55 A;  4JDS A;  5FLX E;  4M75 B;  1M4Z A;  1UGP B;  4LDU A;  2K4Y A;  3PTA A;  2WSF E;  2DKG A;  2DXB B;  2DTI A;  4KUI A;  1HXD A;  4M77 A;  5FRO A;  4LD9 K;  3NTH A;  4C8Q G;  3JRZ A;  3ME9 A;  4C92 F;  2O4X B;  3H8Z A;  4FU6 A;  3ZEH A;  3BY7 A;  5GAN e;  5GAN g;  1VQK T;  3X28 B;  1G3S A;  2K2V A;  3VYH B;  2E41 A;  4XK8 E;  3RUX A;  4BY6 C;  3TCJ A;  4BD3 A;  2ZPE B;  2RM4 A;  4PLI A;  3VV0 A;  3JCM b;  1Q81 U;  1D3B A;  3EFS A;  3A8O B;  4M7A F;  2CZ6 B;  3S6W A;  5GMK l;  3OW2 S;  4M7D E;  3OS1 A;  4ZN3 A;  5J39 A;  3BDU A;  2PVG B;  2MI6 A;  3L2Z A;  4YTL A;  3OYH A;  3JCM f;  5LJ3 d;  2ZPI B;  3JCM c;  4DOW A;  1DJ7 B;  4E7H A;  4M77 F;  4EMK B;  2K57 A;  4IUV A;  5LJ5 f;  3HFN A;  4C5H A;  4J5Y A;  3QYE A;  1VQ8 A;  3GF5 A;  3V8L A;  3VYG B;  1NPP A;  2A7Y A;  3ASK A;  1HK9 A;  1RL2 A;  4NS5 A;  1W2B A;  3SB2 A;  2LTO A;  2RK1 A;  2NLU A;  3MO8 A;  2JOY A;  3VU3 C;  2R58 A;  1YIJ T;  2X4J A;  4PJO E;  3CC7 T;  2DK3 A;  2LCL A;  3VKI A;  4C8Q D;  5KCO A;  3LWI A;  3O8V A;  3M59 A;  2DIQ A;  1EIF A;  4ZTF A;  2YRV A;  5GAN 2;  2LVM A;  2RI2 A;  3GNG A;  5DLO A;  3C4S A;  1GXI E;  2HQE A;  1YIJ A;  3G6E T;  4BBR M;  4M78 B;  1VQL T;  4RG8 A;  3E19 A;  4C5I A;  3TU4 K;  3P8H A;  2DVE A;  3CC7 A;  4E7L A;  5A0L A;  2IVW A;  2HD0 A;  2A3L A;  2M9U A;  3A5Z B;  4MFD A;  3HRS A;  1QW1 A;  2EFI A;  2RI3 A;  2RJE A;  4N4G A;  2ZZD B;  4X9D A;  5CVI A;  5HY6 A;  5FRN A;  3TW7 A;  2VXF A;  3BG5 A;  2ZCF B;  3OYA A;  1BI2 A;  3WVD B;  2JTM A;  4F7U G;  4M77 G;  1XNI A;  1YJN A;  4PJO A;  3VKG A;  3QBY A;  3DL1 A;  3CPF A;  4D6W A;  3PMT A;  4BE2 A;  5HKC A;  3E9F A;  5GAN 6;  3JB9 I;  1JJ2 S;  4J7I A;  2RJC A;  5CIU A;  4XU2 A;  4PLL A;  1UGS B;  3CME T;  3KHI A;  1R8O B;  2P0K A;  3MEV A;  3G71 A;  2LC4 A;  3JCM W;  3PT9 A;  5GAN j;  3OYF A;  1M8V A;  5EJC A;  3A8H B;  2KVQ G;  3OYI A;  2PVO B;  5CKF A;  4M7D C;  5M9O A;  1VQO T;  4N0A C;  4RCB A;  3OW2 A;  1YJW T;  2L3R A;  3HRU A;  3URG A;  4HNV A;  1G3W A;  2XK0 A;  2OAU A;  3CME A;  5GAN 8;  2K5F A;  2ZGW A;  1Y96 A;  2GQV A;  4PJO F;  3MHX A;  4OB2 B;  5CK9 A;  3LLR A;  4PJO G;  2X4X A;  3CBM A;  4MML A;  4Y91 A;  3OA6 A;  2EQU A;  4JRI A;  1Q7Y C;  3OS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...