3A8LB

Crystal structure of photo-activation state of nitrile hydratase mutant s113a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8lB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8lB02
2ZZDA 4OB2B 2QDYB 2ZPEB 3VYGA 3X26B 2ZZDB 4OB3B 4OB0B 3VYGB 2DD5A 1GXIE 2DD4A 3X20B 1UGPB 2ZPIB 2DD4B 2PVGB 2ZPFB 1PSEA 4ZGDB 5L8RE 2DXCA 2ZPHB 2PUOB 1UGRB 2CZ6B 4KT0E 2DPPB 1DJ7B 2DXBA 2DXCB 3X25B 2CYZB 2PUKB 2DXBB 1PSFA 3A8LB 2ZPBB 2WSEE 2DD5B 1JB0E 2O01E 2AHJB 2CZ0B 2CZ7B 3A8OB 3WVDB 3X28B 4RKUE 4ZGEB 3HHTB 3QZ9B 2PU9B 1QP2A 4L6V5 4FM4B 2WSCE 2D0QB 2WSFE 3QXEB 4XK8E 1UGSB 3A8GB 2PVDB 3X24B 3QZ5B 3A8HB 2ZPGB 3A8MB 4Y28E 2ZCFB 1V29B 4OB1B 3LW5E 2CZ1B 1QP3A 3QYHB 3VYHB 4ZGJB 1UGQB 3WVEB 1IREB 1AHJB 3QYGB 2PVOB
chains in the Genus database with same CATH superfamily
4B9WA 2RPNA 5FU7C 3URGA 5DLQE 1OULA 1M2VB 4B9XA 3NTHA 4OMMA 4PFOA 1RABB 2VVKA 3RNJA 3G7ZA 1H92A 1YCYA 4BCNB 1UECA 3JCMh 2KQWA 3CCQT 4C8QC 5HBHB 4M77F 2IVWA 3G71T 4ZGDB 2JM8A 4JUVA 2CH4W 2VYTA 4M4ZA 3EG3A 2EFIA 3CCET 2E1HA 2DXBA 2KRNA 4M78A 5A2QE 1VQMA 1YI2A 1YN8A 4LDYA 1XTDA 1BU2A 2KRMA 3JCMc 1BU1A 1KD1U 3A8LB 1Q7YC 2CH4A 3FJPA 3VRYA 3OYJA 2E5QA 3JCMb 1YHQT 1FMWA 1OV3A 1ACMB 4Z88A 2CP7A 1X2KA 1UE9A 5KYYB 1U06A 3SWNB 2EKHA 1ZUYA 2DK3A 2E5KA 2I0NA 3JCMV 5LJ5f 2IW9B 5CKEA 1VQKQ 2O88A 2IIMA 1YP5A 1O75A 2UUEB 2RHYA 1OU9A 4BY7X 1QP2A 1WHMA 1VYUA 1VYTA 1W1FA 3G1JA 3TQ7P 4LDVA 4HCKA 2RD1A 1NPPA 3TN8B 1YIJT 3OW2S 2EJ9A 4UN0A 2LJ1A 1GCQA 4J6YA 5GMKe 2K5FA 4AFQC 1HSQA 3O5ZA 1OPKA 4M77G 3QWXX 3DKMA 2WIHB 1K76A 2XDDA 2RO0A 2KT8A 4BCMD 3VV0A 4OMNA 4OMPA 2XMFA 1AVZC 2L3SA 4LNPA 2LCSA 5CKBA 2V1RA 2FPFA 3RDVA 3RR6A 2EQIA 1ZLMA 2XD0A 4OB3B 3LGFA 3VS2A 3HTRA 1QVPA 1K73R 2DYBA 4BB7A 3DTOA 3G4SQ 3CQTA 5M9OA 2LZ6B 2C6TB 2LX9A 1PC0A 5IXFA 1RI9A 4HT9A 2AIRB 1OX9A 3FEOA 4HVWA 2EGCA 4XTYA 3DOGB 4EOJB 2DERA 2K3YA 7AT1B 2LC4A 4N4HA 2LCCA 2DO3A 2ZAEA 4M75A 1AWOA 1NJIU 1BI3A 1M2OA 2MCNA 3PMTA 3BG3A 3R6OA 5CCAA 2D8HA 1PSFA 3GNGA 5LJ3d 4BCOB 2EQMA 2WIPB 2FPDA 4Q5WA 4EOKB 2XG8D 1HYOA 4MDXA 2EWNA 1B3QA 3SEMA 2CZ0B 4IKFA 3CCQA 1ZUKA 4PJOC 2DF6A 2KI7A 2KAFA 2CZ7B 2LQ8A 3ULRB 3G71A 2FO0A 3CC7Q 4QT7A 4ATOA 3RMSA 2J6KA 2BIVA 3CCEA 3CCQQ 2BZ8A 3EIDB 4C92C 1LCKA 4XTUA 2W9ZA 2YUPA 2K9GA 4N0AA 3D7SB 2MMPA 1YHQA 5I2SA 4A4FA 1VQ4Q 4JJNK 3CCEQ 4FL6A 4LE9A 1RAAB 1TTHB 1GUXA 5IDPB 3QJYA 3OYYA 2M0YA 4BI4A 4M77D 5LJ5g 1H28B 2RJFA 2QEXT 2E6ZA 2KMTA 1UJ0A 4YOZA 5KE2A 1V1CA 2HKNA 3M4GA 5LMKB 5LJ5j 2GTJA 1YIJA 2BE7D 1F1BB 5ACBA 2K79A 3UF4A 1M1KC 4R56A 1K9MU 1NYFA 1N6AA 2YDLA 4EOIB 5CQYA 3CBPA 3A1PA 1GRIA 1OYXA 3THKA 1UGPB 1K8AC 3MI9B 1YIJQ 1D3UB 2JTEA 3UA6A 4RTXA 1HJDA 1O9KB 2HL5C 4V2SA 2QQ9A 2RH2A 1NEBA 4TVRA 4Z8AA 1UFFA 1NEGA 4XU0A 3TSWA 1XO2A 4QKUA 3CEYA 1GFDA 2DBMA 5IDNB 3VS3A 4BI8B 2DEUA 1OI1A 2DVJA 2QQAA 4AFSC 4RCBA 2C5VB 1VQ9T 4IUUA 6AT1B 1GBRA 2RK1A 3JCMe 2YRDA 3I9QA 1U1SA 1BBZA 2O2OA 1N5ZA 3CC4T 1M1FA 2GF7A 1PHTA 5GAMh 2IG0A 5LJ3f 2JXBA 4HNVA 4DOVA 4E7KA 1VOLA 1BCOA 1TG0A 4KUDK 4I3ZB 2UZLB 3CBOA 2HBWA 4ME7A 3V7CA 3O8VA 2E70A 3CD6T 2HQHA 1Q86C 1AT1B 2YUNA 1NPRA 4M7AC 3HSBA 4UC4A 2F5KA 4BCQD 1P92A 1UB4A 2FPEA 3EGXA 4IIOA 2F2CA 3EFOB 2LRQA 1W2BA 4BY6B 3JB9I 3BW1A 3L2ZA 1UGQB 2V1QA 2DMOA 3TNWB 1GCPA 1M5Q1 1VQ5T 1AWXA 3QYBA 2B9RA 5GAN3 3VYGA 2WMAB 1OX8A 4AG1C 1RADB 4F7UF 3QPHA 5IT9E 2C0TA 1ZSZC 2CGHA 4C92B 3OYIA 4AFUC 1RAFB 4F17A 2ZGWA 1H4LD 4JLIA 3E2UA 3OYEA 2GGRA 1FWZA 2ZPFB 3HFOA 4OMQA 2C5NB 2QEXA 1HK9A 4C0GA 5L2WB 5FU6B 3TW7A 3OYNA 4JRQA 2PK2A 3PVLA 1IZ6A 4KT0E 4PJNA 1UUEA 2G77A 1XOVA 2LJ3A 3EG9B 3NFCA 1RAIB 1W98B 2O9VA 5D6YA 4WTOB 2QEXQ 4BE1A 2E3HA 4CC4B 2NYSA 4LDXA 3CXCA 2DD5B 2LX7A 4M7DC 3N5BB 1OI9B 1OGUB 2NUPB 3S3OA 2VC8A 1PWTA 4C5GA 1UTIA 5IHIA 1G3TA 1QQJA 4EDUA 3VS5A 3V8KA 3EH1A 3MO8A 3X28B 3KBGA 1RLQC 3FDRA 1Y0MA 3V7SA 3CCLT 1AWJA 3M0PA 3CXCP 4EMKB 4KGZB 2KK4A 2LJ0A 4MFEA 1NM7A 3MJXA 3VUZA 2ENMA 4HVVA 1EFNA 4E7JA 4PKCC 1F5QB 3M55A 4OMOA 3OYAA 4O6JA 3BLRB 5IHNA 4M77A 4M78D 2YT6A 3HRUA 1M3AA 2MWPA 2ESWA 1LJOA 3JCMJ 3QDFA 4OGRB 2HL3A 4F7UG 2DL7A 3A8HB 3I55T 3PE0A 1W2BS 1V76A 4PLIA 1VQ9A 5GJVB 2WFYB 3UA7A 1G5VA 4FYWB 1OQKA 4RTYA 3CC4A 1OOTA 1P5EB 4F7SB 4J9GA 4NS5A 2BS4A 3M58A 3CCST 1M8VA 2YRCA 1VQ9Q 4JS4A 1YFNA 2PMIB 5GANh 3HKSA 4ROEA 3CC4Q 3X26B 3CD6A 2E4HA 2VWFA 5HK3A 5C0MA 2OAWA 1K73U 3S6WA 1I1JA 1OZ2A 2VASA 1WI7A 1IHVA 2YUOA 4FT2A 1H1SB 3CD6Q 5FRNA 1XQHA 4NL3A 1YCSB 3UDCA 2WHBB 1QVFS 1D1CA 3Q1JA 3K7AM 3TSZA 4CFVB 1D09B 1VQ5A 3SWNC 3EG1A 4PJJA 4M78E 2DXBB 2L0AA 3TU4K 3A5ZB 1VQKT 1WHLA 4CC7A 2X4JA 4ELYC 3OA6A 2BZXA 2WSEE 2LCLA 4FT4A 1M4ZA 4XU3A 2L89A 2LNHB 2GFUA 4HVUA 4DA4A 2YSQA 1VQ5Q 2L2PA 5CYIB 3OSVA 1AZEA 1VQNT 1BB9A 2KRSA 3PIPA 1YJWT 1TU0B 2NLUA 1NBEB 3CPWS 4JX4A 5LJ5d 2AZSA 1IGQA 3QZ9B 2EKOA 2W99A 2OX7A 3VU3C 2PZ1A 2CJMB 5CAIA 2WJ9A 1WZOA 5GAOr 4OGCA 5DQVA 2RMOA 4M75D 1IRXA 3FJ5A 5DM7R 2KE9A 4XK8E 4C8QF 1KQSS 1BYMA 4N4GA 1AISB 4ZTFA 3M0SA 2EGAA 5GAN4 3EGUA 3CCLA 2MAMA 1Q81C 4XTZA 1FYNA 3G4ST 2QYZA 1N27A 2QDJA 2CKKA 2RA2A 3G6ET 2KNBB 2DMEA 2CP3A 2EYYA 3RGFB 1S72T 4C0DB 2PQWA 2CT4A 3PGGA 2QGFB 3MEAA 1OIYB 3OW2A 3NPFA 1GXIE 3I55A 3QUIA 2DD4A 4RTVA 2JOYA 3S3NA 4CFWB 1MHNA 1MNDA 5EG2A 1XNIA 1RAHB 3CMAT 1ENWA 2F2WA 2RI2A 2E41A 4QVCA 3I55Q 1D3BA 2K7AA 1U3OA 3CCSA 5IAYA 4XTVA 4M75E 1Q82R 4M75B 5KH6A 5GMKj 2PUKB 4OGEA 2YLBA 4RTWA 3INZA 3CC7T 3QSUA 2GQIA 5FW9A 1KIKA 3DLLA 4CFUD 2HCKA 4PJLA 2OAUA 3CCSQ 3BFMA 1K0XA 2LQWA 1VIEA 2AHJB 4C8QG 2V8IA 4WCIA 3CCUT 3OBYA 2ROLA 3I5RA 1M90C 1QW1A 3A8OB 1VA7A 3OYFA 1WHHA 1VQ4T 1I4K1 2QG9B 3CCRQ 4G6LB 1M9SA 2E12A 3UT1A 3EGDB 1EIFA 1K9AA 3R6NA 5DLOA 3MP6A 4FW1A 2EUFA 2JZ2A 4FM4B 4ORZA 3ZEHA 4M6VA 2FRYA 1VQKA 3QXEB 3I5SA 4Y72B 3BG5A 3KFVA 4RTTA 3BHUB 5KYUA 4X1VA 2IW8B 3OYMA 1VOMA 1Q7YR 5LJ5h 2I2LA 2I53A 2RI3A 1H641 2FZKB 5J3BA 1GUXB 1YJWA 1QP3A 2W10A 4F7NB 1FKMA 5CK9A 1E6GA 2A0FB 3GPLA 3M56A 4ZGJB 1AHJB 4KGVB 1VQNQ 5GMKm 4CFUB 1QKWA 1YJWQ 4PK4A 2DL8A 2X35A 3LGLA 4PJOF 2Y90A 4EOQB 3WXMB 3CPFA 2BS2A 2OJ2A 1I5OB 2X3XD 2A3LA 1YBYA 4PL6A 2QGSA 4C5HA 4BD3A 2HQXA 2QF7A 1AD6A 3M03A 2KR3A 4ANJA 3G4SA 3PTAA 4C92F 4RMOA 2WXVB 3G6EA 5KYWA 1S72A 1WQ7A 4RG8A 3BHTB 2RB6A 5GANe 2HKQB 3G6EQ 4J9FA 3V8LA 2XICA 2DYIA 2QDLA 1URCB 1FMVA 5KYNA 4BBRM 4KGXB 1S72Q 4JX6A 3CMAA 2XDPA 1Z9ZA 1TUDA 2DJZA 4NSTB 4J8OA 1MMNA 5HBJB 5CEIB 1LVKA 1H1QB 4TTHA 2JUFA 1VQ7T 2CDTA 4BCIB 3TNIB 2DBKA 1D1BA 5I21A 3CMAQ 4A53A 4BY1X 3CC2T 1ZX6A 5HQ0B 2FYKA 3CC7A 3QHRB 2L3PA 4PJMA 1WA7A 2CS7A 2QGGA 1SSHA 4FYXB 3MEVA 4GLKA 4BY6C 1JRIA 3QZ5B 4AKGA 2GFAA 2YLCA 4XTXA 4PJOG 1W4SA 4RODA 2XIDA 3CCUA 3VS7A 1VQ8Q 2KSSA 3BDUA 1VQPT 4BCMB 2J7IA 2JNGA 3TREA 4AT1B 2BKDN 2F2VA 2LT1A 1VQ4A 2CZ1B 3DLMA 2K5LA 2VV5A 3EGXB 4EMHA 2DL5A 5GAN5 2EJFA 3POMA 3CCUQ 4A54A 4C92G 5HCKA 1H25B 2FVUA 1H24B 2KEAA 3LH5A 4E47A 1UHCA 3TVTA 1KG1A 1YJNT 2G6FX 2VXFA 1E7PA 2V22B 2DA9A 3FLGA 4XAXB 5FU6C 2XU8A 3VYGB 3NMZC 1PG5B 4BCFB 1UNHD 4OMLA 2BKZB 4ZN1A 2FL7A 1N8RC 1UHFA 2P0KA 2ZPIB 4A4EA 1UNGD 5CKDA 4CI0C 4EOLB 3ZL7C 1X2QA 1AEYA 1OKWB 4ZN3A 3ZBDA 2K6DA 5I5ZB 4AFZC 4RTZA 2CYZB 2DEQA 2LNVA 4CRLB 4J6XA 1NE8A 5CQXA 3GOXA 5GAN2 2P4RA 4EMKC 5ICPB 4J9CA 4M7AF 5I11A 1NLPC 3PNWC 4FCYA 1ZBXA 3JB9J 4ELJA 3EHQA 1UDLA 3DB3A 1M1KR 1GY3B 2IPOB 2XK0A 1FX7A 5IXBA 4N4IA 4MFDA 1K8AR 3KUFA 3HHTB 5LQFB 5IHYA 3KXTA 1WHGA 2RQVA 2GBQA 3J81E 2WSCE 4LXCA 5I22A 5L23A 5GAN6 2WMBB 4OF1A 3EJ1B 1WXUA 2LP5A 3H4CA 3QWYA 3C95A 4E6RA 3A8GB 4D6WA 2X4XA 3X24B 1WQWA 4C0ZA 4ZTJA 4PJOD 4M77E 1PKDB 4M77B 2R58A 3VRZA 4HNTA 2WEVB 2UZBB 3DL1A 1R0BG 4JJBA 5LJ3h 3RKYA 3S3MA 1H1RB 3GIBA 1WLPB 1N9RA 2K2VA 3P8BB 4OMFB 1VQ7A 3OB9A 1E9HB 1IGUA 1KD1C 3QYGB 4EC9B 2X9HA 4F7JB 2BZYA 4K11A 4M7DF 3CC2A 2P84A 3QHSA 1PRMC 1WHJA 4JRIA 2C5XB 3HL8A 3OQ5A 4D8KA 1PCXA 3V8JA 4JDSA 1VQ7Q 4MMKA 4OB0B 4GLMA 1M30A 4M7AG 3LLRA 2OTLT 1UG1A 2AZVA 2DTOA 4HL4A 4MMLA 3CC2Q 1HXDA 1QCOA 2OI3A 2P0PA 1VQPA 2KMGA 3NHNA 1VYVA 1B34A 2HAXA 4M78C 1Q86R 2PHGA 5LJ5e 4EOOB 2EGEA 1KHCA 2RNAA 5HBEB 3SB2A 2NUTA 2DXCA 2MOXA 2FEIA 3O0GD 2FZGB 4C8QA 1Q82U 1W2BP 1VQPQ 2VGNA 1KC8R 4BACA 3X25B 4AKHA 3OMCA 1IB8A 1JO8A 1W6XA 2KGTA 3PIOA 3L2RA 1ZP2A 1OU8A 3QO3A 2ZPBB 1YJNA 2FG0A 4PJOE 2KXCA 4ESRA 1H27B 1GFCA 3FRNA 2YRVA 3M53A 2M9UA 5KYXA 4YTLA 1SRLA 1QMZB 1N9SA 1YJNQ 3QG1A 5IH2A 3M54A 5D7UA 2E65A 2RQUA 2DE0X 2RI5A 3KHIA 2HEQA 5IF1B 3OSSC 2FZCB 2KYBA 4QVDA 1GCQC 4JJCA 2H3JA 1H3ZA 2EYXA 3OYHA 3L2VA 3JCMX 1QVFA 2AKLA 2BTTA 2K2MA 4M7DG 3CBMA 3DJBA 3M4YA 2JTMA 4BCQB 4J9BA 2M51A 2X3WD 2PVDB 3OYGA 1T0JA 1Q7YU 4HCBA 1VYWB 4Y28E 2COWA 2QTXA 1QVFP 4E7HA 4OR5B 4C0DC 2R7GA 1KFZA 1D0ZA 4ELZC 1NYGA 2D0NA 1BK2A 3OS0A 3QYHB 1ZA1B 2LDMA 5GAOl 4DQ2A 3CCMT 1NJIC 4YOOA 1VINA 4E7IA 3MP8A 2DX1A 3RKWA 2OTJT 3CPWA 3WVEB 2V8KA 1GL5A 3EHRA 1K0SA 3OMGA 3VKHA 4FYYB 3TW6A 3I35A 3EH2A 2ZZDA 3PO3S 1BI1A 2QDYB 1Y96A 2R57A 8ATCB 1U1TA 2K5IA 1TXQA 4HT8A 2HSEB 1RAGB 4KRCB 4J9HA 2A7YA 1X27A 4JPBW 3QWLA 4FIBA 4A63B 3CPWP 2B86A 3BY7A 3H0IA 5KE3A 2R5MA 1Q95G 1KQSA 3CCVT 1WHKA 1PRLC 4M75C 1QWEA 1MGQA 2DD4B 4JJDA 2XHCA 1M8MA 3P8HA 1QVGS 1YJ9Q 1GH6B 4A4KA 4EOPB 1KQSP 1UGRB 3MEWA 4FSXA 1IXDA 1D3BB 2JN0A 3NTKA 2UZEB 1RACB 3CCRT 1RI0A 2KY9A 4B6MA 1CKAA 3GBQA 4X9DA 4E7SA 5HNBB 1JB0E 2DXUA 4DBFA 5GAMg 4X34A 2O01E 2OTLA 5AYFA 4BBSM 2WACA 1TUGB 4RTUA 5A0DA 1JSUB 2ATCB 1BIBA 4HCZA 4LDUA 3MY1B 3RUXA 4IUVA 1OL1B 3IQLA 3QKJA 1BI0A 4LUEA 4RKUE 5GAMj 4ZGEB 1VIFA 5HY6A 1QCNA 2OTLQ 1G3WA 4Y91A 3L2QA 4PJOA 4N0AC 3C4SA 1WJSA 4M78B 5IN1A 3VS4A 4YOSA 2DZCA 1ZBJA 3VUBA 1MNEA 4M7DD 1K9MC 1QMCA 4EC8B 2DL4A 4JZ3A 1KSWA 1FMKA 3FC3A 4JZ4A 4OVAA 4LUDA 3NDQA 3TEEA 3H0FA 4KUIA 3REAB 4C92A 2EBPA 3A98A 1RUWA 2YUQA 4OP0A 5KYUB 4ROCA 4Z02A 2K4YA 3MHXA 3C12A 2LQKA 2PJQA 1UJYA 4BCPB 4FYVB 1WPYA 4HLQA 3M0UA 4KBMB 1ZUUA 1QLBA 2CP6A 3OYDA 3OYCA 4NOYA 2RQWA 3VKIA 4KH0B 1IHWA 3MIAB 3MPUB 4LD9K 1Z9QA 4KULA 2DTHA 2DD5A 4E7ZA 2X1NB 2QA4Q 3F70A 2H3EB 3OS2A 4L5GA 2EW3A 2ROTA 4LDWA 2PVGB 1RLPC 2FRWA 4GBQA 1WXTA 4IUQA 1WNLA 3CCMA 3ASKA 4BCND 5LJ3e 2DRMA 2OTJA 1D0YA 3SDZA 2EYQA 1Q81R 2HQEA 1E7OA 2RJCA 4C5IA 2JJ9A 4QQGA 3PT9A 5KYWB 3CCMQ 4LOCA 1MMDA 3JCMW 2C0IA 2A08A 2GQVA 2OTJQ 3H0HA 3MKDA 4J6WA 3CCVA 4EOMB 2EIFA 1M1KU 3OW2P 4BUGA 1EZZB 2EQUA 3TNHB 1C9BA 2F69A 2LT4A 1K8AU 2DFUA 2P0QA 3M5AA 4KRDB 4QQDA 1YWOA 1VQ8T 3GF5A 3CCVQ 4XU1A 1X75C 1FVVB 4L6V5 4BCKB 4F7UE 4O5VA 5HKCA 3CCRA 3JCMP 3H6ZA 2WSFE 3JCMQ 3JB9F 3M0RA 1FINB 1D0XA 1SF9A 1R8OB 1CKBA 4J5YA 2D6FA 4F04B 2JMCA 1G83A 4DBRA 3NTIA 2W0ZA 1AD5A 5HVYB 4PFPA 4R55A 5CR2A 4CRIA 1R0CB 2BE9B 5GANg 4DOWA 1NZ9A 2ZCFB 2MYSA 1V29B 3AT1B 3JV3A 5EC7A 1H26B 2L3QA 3JCMf 1M90R 1ZSGA 4M7AA 1QCFA 5GANj 2J6FA 1T3SA 3SHWA 1T3LA 2CUBA 1QLYA 1KHIA 4LD6A 3RIRA 4XTWA 2RHIA 1MMAA 2CP0A 4Z89A 3UWNA 1VQNA 3LH0A 4ZNXA 5FGKB 3HFNA 2AK5A 3FB9A 3CMET 2F5TX 4RUGA 5GAOq 1Q86U 3GTMS 1VUBA 5CO7A 4AMCA 1ZSZA 3EAEA 4J9DA 1VQMQ 1YI2Q 2E10A 3OYKA 5GMKi 1KJWA 4CFXB 2PUOB 1H8KA 2CSIA 3DB4A 5J26A 3QYEA 2DPPB 1KC8U 2MIOA 1JQQA 1JJ2S 5FWBA 2HZYA 1G3YA 2E6NA 3B57A 3JB9G 1K4US 2KVQG 2RQTA 4HA8A 5CKFA 4ELLA 2JW4A 5FROA 3HPWA 3TCJA 4BCHB 1TFBA 2M0OA 3WVDB 4M7DA 3GLXA 1I8FA 4BDYA 2D9TA 1UNLD 1ABOA 1MUZA 2CREA 3QBYA 3SD4A 1LOJA 3REBB 4BI3A 1EX4A 4M77C 3DDPB 4KRTA 2RJEA 2A37A 2R5AA 1JXOA 3E1SA 4DEXA 2RK2A 2BUDA 2FHDA 2EAYA 2K57A 1K73C 1ZHIA 3VS1A 4C8QD 5KCHA 4MDWA 3LX7A 2X4WA 4BXXX 2W2HA 2ZPGB 1RL2A 2LVMA 5GMKl 3LQ5B 1YWPA 3P8DA 4VUBA 3E19A 3OS5A 3QIIA 4CC2A 5CKHA 4F7UA 2RJDA 4EIKA 1MMGA 2QAZA 1VQ8A 2SEMA 2O4XA 3L2WA 3MP1A 4F6WB 1WDXA 4WF2A 3PVQA 1H1PB 1GBQA 3PMIA 4JS5A 5C6SA 1JBMA 1Y07A 1M2VA 4J9IA 4OB2B 4NC6A 2ZPEB 2Z0WA 1TUCA 2KR6A 3HB9A 3HRSA 2JS2A 5GAMd 9ATCB 4IMYB 1G8XA 4FX3B 2COZA 3EFSA 1VQ6T 5FU7B 3JCMg 1B34B 5L8RE 3LWIA 1N4MA 1PD1A 1WXBA 1Y7XA 3EGDA 3JSCA 1YNZA 2NUTB 2DXCB 3M57A 4F14A 4C8QE 3GP8A 4C8QB 2RHZA 3C94A 1M27C 4IUTA 3LYIA 1BIAA 1CSKA 2AKKA 2PNIA 4DEYA 3JB9D 2P4TA 1XJWB 3G71Q 1PNJA 4JX5A 5KYYA 3SWNA 2MWOA 2C4GB 1PKSA 4FU6A 3CMEA 1X01A 1SHGA 2VKNA 2QXFA 4CC3A 1BCMA 2GTOA 2CCIB 4J7FA 5KYXB 4A4GA 3L2UA 1ARKA 1IO6A 1K1ZA 1N8RR 1WJRA 3SFMA 2LQNA 3CMEQ 1KQ1A 2PU9B 5BNJB 1YHQQ 2DKGA 3L1AA 4R0KA 1NLOC 4JLGA 1VQOT 2EQJA 1JU5C 4FW2A 2D0QB 3UATA 5DQWA 5AT1B 2C06A 4II5B 1UGSB 2K3XA 4P5NA 1C1AA 5FLXE 4M78F 2C0OA 2O9SA 2QTVA 5GAN7 1WFWA 2QQSA 2L5QA 4HCCA 2HSPA 1VQLT 1MV0B 5EFQB 2F1LA 2DXTA 4KH1B 5CVIA 2HD0A 5GAN8 2D1XA 2JT4A 2KROA 2RQRA 4J83A 1PKTA 2DM1A 1UEBA 2J06A 3BG9A 1U5SA 2J6OA 2BPMB 4XU2A 3ER0A 4JRKA 2COYA 3CCJT 2DTIA 1YJ9T 3AHUA 2RN8A 1M3CA 4EOSB 2O31A 2ZZDB 1X6BA 1C6VX 1Y96B 1AWWA 2EVRA 3BE3A 5EJCA 4QW2A 2XDBA 3LWHA 2E64A 3X20B 3HZJA 1X6OA 1SSFA 1D1AA 2A28A 4L59A 2HBPA 2RHUA 3E9GA 4XQ3A 4C92D 3QDRB 4MZMA 1SPKA 2Y4YA 1OIUB 1E6HA 3VS6A 2KBTA 1RAEB 1Q81U 1SG5A 3L42A 1G3SA 4RCCA 2UZDB 5ECAA 1Y57A 1X6GA 5GAMf 4CFNB 1JOWA 1KD1R 4QQ6A 3ZFJA 2JTFA 4MZPA 4EONB 4C5EA 1TD6A 1NG2A 4BDZA 5D6XA 2ECZA 1R77A 5KCOA 4M78G 1SEMA 2PTKA 4AG2C 1VQ6A 4HXJA 5GANd 3J7AF 2ED1A 4BE2A 3RMQA 4MZTA 8AT1B 4A4HA 1C0MA 2IW6B 1QVGA 3H9NA 1KC8C 4PJOB 4E2FB 2HNIA 1JKWA 3OS1A 1VQ6Q 3RESA 2IVXA 4F6SB 2VXEA 3BHVB 4M75F 4LN2A 1KXUA 2RF0A 1TS9A 4DBQA 4Y92A 1OKVB 5J39A 1QVGP 2X4YA 3RERA 3E9FA 3UPUA 2EYZA 3MCAB 1X69A 3OBWA 2QQ8A 1I81A 2DNUA 3I56T 2KXDA 2W9FA 4C92E 4IUPA 2DILA 5GAOm 4J7IA 1M90U 2GNCA 1I07A 2CUDA 1WIEA 1ZA2B 2QA4T 3VYHB 5CIUA 3QHWB 1O9SA 2LTOA 4AI6A 3EFRA 2DZ9A 3QJ6A 1VQOA 4F70B 2X51A 1M3BA 2ABLA 3META 1PD0A 1WJQA 2VUBA 3JB9H 4C0FA 1TWBA 2KDSA 4AKIA 2DAQA 2E3IA 1QWFA 1VQOQ 2K3BA 1PM3A 4Z6YA 2AT1B 3H41A 3NGPA 2CT3A 2CSQA 1VQLA 2V8JA 1O9KA 2DVEA 1PSEA 5GJWB 2DETA 2CZ6B 3PFSA 2D8JA 4PFZA 1Y71A 2NUZA 2Y4XA 3JRZA 1NJIR 1BI2A 1VQLQ 4JRPA 3CCJA 4M7AD 1YJ9A 5GMKh 5GAOp 4EMGA 1A0NB 4BE0A 4MIMA 2DRKA 3HP9A 2M16A 1YITT 3DDQB 1T0HA 4M75G 2C5OB 2BS3A 2LW4A 2VB6A 1HD3A 1OPLA 2SRCA 2L3RA 3HO8A 2QK0A 1KK7A 2YHTA 3CCJQ 2XI9A 1B7TA 4FSSA 1SKUB 4J9EA 4BCJB 2KT1A 2M02A 1U8RA 1G2BA 3H8ZA 2MF2A 1B07A 1SRMA 3MY5B 3M0QA 2QI2A 2RM4A 1J3TA 4EPCA 3C0CA 5LJ3g 2DIGA 4X9CA 3VJPA 3JAME 2EYWA 5D6WA 3M9QA 1JSTB 2VGMA 2QQBA 3J80E 5GANf 1W70A 1I5LA 3A8MB 5I2MA 1WX6A 1TH7A 5LJ3j 2DJQA 1ZQ1A 4RG2A 1QKXA 2MI6A 3EFOA 2PK9B 4II1A 4OB1B 4BCGB 1WYXA 3GNFB 1S1NA 4CXAB 2G9XB 4IURA 3JCMd 2RHXA 3HBLA 3U23A 3EG2A 4M7AE 2CP5A 2QFZA 4M7AB 1VQMT 1YI2T 1MV3A 2W96A 3F5XB 3VKGA 1FXXA 2MPXC 4IIMA 5LL6S 3CXCS 3HRTA 1OZ3A 3BLQB 1KQ2A 2B8AA 2JM9A 1LPLA 2EJGA 1K9MR 3M59A 1TSFA 3I56A 3FIFA 2ED0A 5IHKA 1UGVA 3EOCB 5DY9A 3OYLA 2YWWA 4E7LA 1X43A 3RKXA 4F7LB 2QA4A 1ZSZB 2JMAA 2ZPHB 2DLPA 4QVZA 1TOVA 2YXYA 3MEUA 1SHFA 5A0GA 3EG9A 1DJ7B 1I0CA 2J05A 3I56Q 1JEGA 4PNOA 1AZGB 3OY9A 1WGSA 4F16A 2GCXA 2DL3A 2NUPA 1ABQA 2JVVA 3G33B 1M1GA 3BLHB 2HDAA 2JGZB 2CCHB 2L8DA 2M1HA 2FB7A 2EPDA 2XKOC 4EMKA 4QSHA 4HNUA 3M0TA 3RBBB 2V26A 2HMAA 3VS0A 1N8RU 5GAOn 2QQRA 2DIQA 4M7DE 3T9NA 4M7DB 2WPAB 2KYMA 3BDLA 3V7RA 2A36A 1LNXA 1OL2B 1JXMA 4D8DA 1AOJA 2CP2A 2F2XA 1JJ2A 2JS0A 4DBHA 5GAMe 2I40B 3CCLQ 1OEBA 1YITA 4EORB 4CFMB 5FRMA 5A0LA 2G3RA 4F6UB 2QASA 4GY5A 4YC3B 2EQKA 5FWCA 2H8HA 1G3NC 1JJ2P 3LW5E 1BKBA 3ME9A 1Q82C 1YITQ 4F7UB 2LMJA 4NL2A 4HKEA 5HK0A 3OYBA 2MK5A 4PLLA 1IREB 1H3HA 2PVOB 2NWMA 3EG0A 2O4XB 2IN3A
chains in the Genus database with same CATH topology
4B9WA 4OB2B 3HKSA 3QHSA 5GANh 4NC6A 4JRIA 2ZPEB 3OQ5A 3HL8A 5FU7C 3URGA 3X26B 3CD6A 5DLQE 2KR6A 3HB9A 3HRSA 3V8JA 4B9XA 4JDSA 5HK3A 3NTHA 4MMKA 5C0MA 4OB0B 1K73U 3S6WA 4M7AG 1OZ2A 3LLRA 3G7ZA 5GAMd 2OTLT 1YCYA 2DTOA 4HL4A 4MMLA 3JCMh 2KQWA 1HXDA 3CCQT 1VQPA 2P0PA 2KMGA 3EFSA 4C8QC 4FT2A 4M7DF 1B34A 2HAXA 4M77F 1VQ6T 2IVWA 4M78C 5LJ5e 3G71T 5FU7B 5FRNA 1KHCA 3JCMg 1XQHA 4ZGDB 4NL3A 1B34B 4JUVA 5L8RE 3LWIA 3SB2A 3UDCA 1Y7XA 2DXCA 2VYTA 2EFIA 4C8QA 1Q82U 3CCET 2E1HA 3JSCA 2DXBA 1QVFS 4M78A 5A2QE 2VGNA 1VQMA 2DXCB 3M57A 3X25B 3Q1JA 4BACA 3GP8A 4C8QE 4AKHA 4LDYA 1XTDA 3OMCA 2RHZA 3SWNC 4C8QB 1VQ5A 3PIOA 4M78E 2DXBB 3C94A 3JCMc 3L2RA 1KD1U 3TU4K 3A8LB 3A5ZB 3LYIA 1BIAA 3QO3A 2ZPBB 4IUTA 1YJNA 1Q7YC 1VQKT 4PJOE 3FJPA 3JB9D 2X4JA 3OYJA 4ELYC 3OA6A 2P4TA 2WSEE 3FRNA 2E5QA 4JX5A 2LCLA 2YRVA 3JCMb 1YHQT 4FT4A 1M4ZA 3M53A 2M9UA 4XU3A 2L89A 3SWNA 2MWOA 2GFUA 4FU6A 4DA4A 3CMEA 1X01A 4YTLA 3OSVA 3SWNB 2QXFA 1N9SA 4J7FA 1VQNT 4A4GA 3L2UA 3QG1A 3M54A 2DK3A 3PIPA 1YJWT 2E65A 2NLUA 3JCMV 5LJ5f 2RI5A 3CPWS 5CKEA 4JX4A 3KHIA 3OSSC 1WJRA 5LJ5d 3SFMA 1O75A 3QZ9B 4QVDA 1YI2A 2EKOA 2RHYA 1KQ1A 2H3JA 1H3ZA 2PU9B 1QP2A 3VU3C 2DKGA 3L1AA 5CAIA 2WJ9A 3OYHA 4JLGA 1VQOT 2EQJA 3L2VA 4OGCA 3JCMX 4LDVA 2D0QB 4M75D 2RD1A 5GAOr 1NPPA 1QVFA 5DM7R 3CBMA 4M7DG 3M4YA 2JTMA 1YIJT 3OW2S 2EJ9A 2C06A 4XK8E 1UGSB 2K3XA 4P5NA 3OYGA 2PVDB 4C8QF 1KQSS 5FLXE 1BYMA 4J6YA 4N4GA 5GMKe 4M78F 1Q7YU 2K5FA 4HCBA 4Y28E 5GAN7 2QTXA 4ZTFA 2QQSA 2L5QA 4HCCA 4E7HA 5GAN4 4C0DC 3CCLA 2MAMA 4ELZC 1VQLT 3OS0A 2DXTA 5CVIA 2HD0A 5GAN8 4M77G 3QYHB 2LDMA 1Q81C 4XTZA 5GAOl 3DKMA 4DQ2A 3CCMT 3G4ST 1NJIC 4J83A 2XDDA 4E7IA 3MP8A 1N27A 2QDJA 1UEBA 2CKKA 2RA2A 2RO0A 3RKWA 3VV0A 3G6ET 3CPWA 3BG9A 3WVEB 2V8KA 2OTJT 3OMGA 3VKHA 3TW6A 4XU2A 3ER0A 2ZZDA 4JRKA 5CKBA 4C0DB 1BI1A 2QDYB 1Y96A 2R57A 3CCJT 1S72T 1U1TA 2DTIA 2K5IA 2PQWA 1YJ9T 4HT8A 3AHUA 3PGGA 2A7YA 2ZZDB 3QWLA 3MEAA 1Y96B 4OB3B 4FIBA 2XD0A 3LGFA 3BY7A 3OW2A 5KE3A 1GXIE 2R5MA 5EJCA 3I55A 1QVPA 3QUIA 4QW2A 4BB7A 3LWHA 2XDBA 2DD4A 2E64A 1KQSA 3X20B 3CCVT 3HZJA 1X6OA 2JOYA 5M9OA 1MHNA 4M75C 5EG2A 3S3NA 1XNIA 2LX9A 1SSFA 3CMAT 1MGQA 4HT9A 4M7AC 2DD4B 4L59A 3FEOA 2RI2A 2HBPA 2E41A 4QVCA 2RHUA 3E9GA 4XQ3A 4XTYA 2XHCA 3QDRB 4C92D 4MZMA 2K3YA 2Y4YA 3P8HA 2LC4A 4N4HA 2LCCA 1QVGS 2DO3A 4A4KA 4M75A 1D3BA 1UGRB 3CCSA 3MEWA 5IAYA 1Q81U 4FSXA 4XTVA 1NJIU 1BI3A 3L42A 4M75E 1G3SA 4M75B 1D3BB 4RCCA 5KH6A 3PMTA 3BG3A 2JN0A 2PUKB 3NTKA 3R6OA 4OGEA 2YLBA 5CCAA 5GMKj 3CCRT 3CC7T 1RI0A 1PSFA 2KY9A 3GNGA 3INZA 5GAMf 5LJ3d 3QSUA 2EQMA 3DLLA 4QQ6A 4X9DA 3ZFJA 2JTFA 4MZPA 4C5EA 1JB0E 2DXUA 4Q5WA 2OAUA 5GAMg 4X34A 2XG8D 2O01E 2OTLA 5AYFA 3BFMA 4BBSM 4BDZA 1VIEA 2EWNA 2AHJB 2WACA 5D6XA 4C8QG 4MDXA 2V8IA 2CZ0B 5A0DA 5KCOA 3CCUT 4M78G 4IKFA 3OBYA 3CCQA 1BIBA 1M90C 4PJOC 4HCZA 4LDUA 1QW1A 2CZ7B 3A8OB 2KAFA 2LQ8A 4IUVA 3RUXA 1VQ6A 5GANd 3G71A 3J7AF 3QKJA 1BI0A 3OYFA 1VQ4T 1I4K1 4BE2A 4RKUE 3RMQA 5GAMj 4ZGEB 1VIFA 4MZTA 1M9SA 2E12A 5HY6A 4ATOA 3RMSA 3UT1A 4A4HA 1G3WA 1EIFA 4Y91A 3L2QA 4N0AC 4PJOA 2BIVA 3C4SA 3CCEA 1WJSA 4M78B 5IN1A 1QVGA 5DLOA 3MP6A 1KC8C 2DZCA 2JZ2A 4FM4B 4PJOB 3VUBA 3OS1A 2HNIA 4C92C 4XTUA 3RESA 3ZEHA 4M6VA 1K9MC 4M7DD 1VQKA 3QXEB 2VXEA 4N0AA 2MMPA 4M75F 3FC3A 3BG5A 4OVAA 3TEEA 5J39A 5I2SA 4A4FA 1YHQA 2X4YA 4JJNK 3RERA 4FL6A 3E9FA 4KUIA 3OYMA 3UPUA 4C92A 3MCAB 3OBWA 4OP0A 5LJ5h 2QQ8A 2I2LA 1I81A 2RI3A 3I56T 4Z02A 2K4YA 4C92E 3MHXA 4IUPA 1H641 3QJYA 5GAOm 3C12A 3OYYA 5J3BA 1YJWA 4J7IA 4BI4A 2LQKA 4M77D 1QP3A 5LJ5g 2RJFA 1M90U 1FKMA 5CK9A 2QEXT 2QA4T 3VYHB 1WPYA 4HLQA 5CIUA 2E6ZA 4KBMB 1O9SA 3GPLA 2LTOA 3M56A 4AI6A 4ZGJB 2KMTA 1AHJB 3EFRA 1QLBA 2DZ9A 5KE2A 3QJ6A 1VQOA 3OYDA 3OYCA 5GMKm 4NOYA 3M4GA 5LJ5j 2X35A 3VKIA 1YIJA 3META 3LGLA 4PJOF 1WJQA 4KULA 2VUBA 1M1KC 4R56A 4LD9K 3JB9H 1K9MU 2Y90A 2DTHA 2DD5A 1N6AA 3WXMB 3CPFA 4C0FA 5CQYA 2BS2A 2KDSA 4AKIA 3F70A 3CBPA 2DAQA 3OS2A 2A3LA 1YBYA 4PL6A 4L5GA 4Z6YA 1OYXA 1UGPB 1K8AC 4C5HA 4LDWA 4BD3A 2PVGB 2HQXA 3HSBA 2QF7A 1VQLA 2V8JA 4IUQA 2DVEA 1WNLA 1PSEA 3CCMA 3ASKA 3G4SA 3PTAA 5LJ3e 4C92F 4RMOA 3G6EA 4V2SA 2OTJA 2CZ6B 2QQ9A 2RH2A 3PFSA 4TVRA 3SDZA 1Y71A 2EYQA 2HQEA 2Y4XA 3JRZA 4XU0A 2RJCA 1S72A 1BI2A 3CEYA 4C5IA 4JRPA 3CCJA 1WQ7A 4M7AD 4RG8A 1YJ9A 4QQGA 3PT9A 5GMKh 5GAOp 4EMGA 4LOCA 4BI8B 4MIMA 4BE0A 2RB6A 5GANe 3JCMW 3HP9A 2GQVA 2M16A 2XICA 3V8LA 1YITT 4M75G 1OI1A 4J6WA 2BS3A 2QQAA 4BBRM 3CCVA 2EIFA 1M1KU 2L3RA 3HO8A 4JX6A 4BUGA 2XDPA 4RCBA 3CMAA 1VQ9T 2YHTA 4IUUA 2XI9A 2EQUA 2DJZA 2RK1A 4J8OA 3JCMe 1U1SA 2F69A 1U8RA 3H8ZA 2LT4A 2MF2A 2P0QA 3CC4T 1K8AU 3M5AA 1M1FA 2GF7A 4QQDA 2JUFA 1VQ7T 1VQ8T 5GAMh 3GF5A 2IG0A 4XU1A 5LJ3f 4HNVA 4DOVA 1X75C 2QI2A 5I21A 4E7KA 2RM4A 4KUDK 4L6V5 4F7UE 4A53A 4EPCA 3CBOA 4O5VA 3CC2T 5HKCA 2FYKA 4ME7A 5LJ3g 3CC7A 3V7CA 3CCRA 2DIGA 3JCMP 3H6ZA 2WSFE 3O8VA 4X9CA 3VJPA 3JCMQ 3JAME 2CS7A 3JB9F 2E70A 5D6WA 1R8OB 4J5YA 2D6FA 3CD6T 3M9QA 2VGMA 3MEVA 4GLKA 4BY6C 3NTIA 1JRIA 3QZ5B 2QQBA 3J80E 4AKGA 2GFAA 2YLCA 4XTXA 4PJOG 1W4SA 5GANf 4R55A 1I5LA 1Q86C 3A8MB 5I2MA 5CR2A 2XIDA 3CCUA 1TH7A 4CRIA 1NPRA 5LJ3j 2KSSA 1ZQ1A 3BDUA 4RG2A 4UC4A 2F5KA 5C6SA 2MI6A 1P92A 4DOWA 1UB4A 5GANg 1VQPT 2JNGA 1NZ9A 3TREA 4II1A 2ZCFB 2BKDN 1V29B 4OB1B 2LT1A 1VQ4A 2CZ1B 3DLMA 2K5LA 3GNFB 2VV5A 4EMHA 3JCMf 2LRQA 1W2BA 4IURA 4BY6B 3JCMd 5GAN5 2RHXA 2EJFA 3HBLA 3JB9I 4M7AA 3BW1A 3L2ZA 1UGQB 4A54A 4C92G 5GANj 4M7AE 2QFZA 1M5Q1 4M7AB 1VQMT 1YI2T 2FVUA 1VQ5T 3VKGA 3QYBA 1FXXA 5LL6S 5GAN3 1KHIA 4E47A 4LD6A 3CXCS 3VYGA 1KG1A 3HRTA 1OZ3A 1YJNT 2VXFA 3RIRA 1E7PA 3FLGA 3QPHA 4XTWA 2B8AA 2RHIA 4XAXB 5FU6C 5IT9E 1KQ2A 2XU8A 3VYGB 2CGHA 2EJGA 3UWNA 4C92B 3M59A 1VQNA 3OYIA 3LH0A 2ZGWA 3HFNA 3FB9A 2FL7A 4ZN1A 3CMET 4JLIA 3I56A 2F5TX 1N8RC 3FIFA 5GAOq 2P0KA 2ZPIB 4A4EA 3OYEA 1VUBA 1Q86U 5CO7A 5CKDA 3EAEA 5DY9A 1FWZA 4CI0C 2ZPFB 3HFOA 3OYLA 4E7LA 2E10A 3RKXA 1HK9A 4C0GA 5GMKi 3OYKA 2QEXA 5FU6B 2QA4A 4ZN3A 3TW7A 3OYNA 3ZBDA 4JRQA 2ZPHB 2PUOB 1IZ6A 4KT0E 4QVZA 3MEUA 3DB4A 5J26A 3QYEA 2DPPB 2G77A 1DJ7B 5A0GA 1KC8U 1XOVA 4PNOA 2CYZB 2DEQA 2LNVA 1JJ2S 3OY9A 3NFCA 1WGSA 4J6XA 1G3YA 1NE8A 5CQXA 2GCXA 5D6YA 3GOXA 2E6NA 5GAN2 4BE1A 4EMKC 2JVVA 3JB9G 4LDXA 4M7AF 3PNWC 1ZBXA 2DD5B 3CXCA 4M7DC 3N5BB 1M1GA 2KVQG 4HA8A 3JB9J 5CKFA 4ELJA 2L8DA 2VC8A 4C5GA 2M1HA 3S3OA 5KCHA 2FB7A 5FROA 3HPWA 2XKOC 3TCJA 1G3TA 3DB3A 4EDUA 4EMKA 2M0OA 3V8KA 3WVDB 1FX7A 4QSHA 2XK0A 3MO8A 3X28B 4HNUA 3KBGA 3FDRA 3GLXA 3V7SA 3CCLT 4M7DA 4N4IA 4EMKB 1N8RU 2KK4A 5GAOn 4MFDA 2QQRA 1I8FA 2DIQA 4BDYA 2D9TA 4M7DE 3T9NA 4M7DB 3KUFA 3QBYA 3SD4A 4BI3A 4MFEA 1LOJA 3HHTB 4M77C 3VUZA 3KXTA 3BDLA 3V7RA 4E7JA 2RJEA 3J81E 2R5AA 2WSCE 4PKCC 3M55A 5GAN6 3E1SA 4OF1A 1LNXA 2RK2A 2BUDA 2FHDA 2EAYA 2K57A 4O6JA 1ZHIA 3OYAA 4C8QD 3H4CA 1K73C 1JJ2A 4M77A 4MDWA 3LX7A 3C95A 2X4WA 3A8GB 4M78D 5GAMe 3HRUA 4D6WA 2X4XA 2MWPA 1LJOA 3X24B 3JCMJ 1WQWA 4C0ZA 4ZTJA 1YITA 4PJOD 4M77E 4F7UG 5FRMA 4M77B 3A8HB 5A0LA 2ZPGB 1RL2A 2G3RA 2LVMA 5GMKl 3I55T 1W2BS 3P8DA 2R58A 4GY5A 4PLIA 4VUBA 4HNTA 3E19A 2EQKA 3OS5A 1VQ9A 3QIIA 3DL1A 1G5VA 5CKHA 5LJ3h 4F7UA 2RJDA 3RKYA 3LW5E 3S3MA 1BKBA 3GIBA 1N9RA 3ME9A 1Q82C 3CC4A 4F7UF 2K2VA 4F7UB 3P8BB 4OMFB 1VQ7A 4NL2A 1VQ8A 3OB9A 4NS5A 2BS4A 2O4XA 3M58A 4HKEA 5HK0A 3MP1A 4PLLA 3OYBA 1IREB 3L2WA 3CCST 3QYGB 1KD1C 1M8VA 2PVOB 4WF2A 4JS4A 4JS5A 3PMIA 3CC2A 2O4XB 1JBMA 1Y07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZD A;  4OB2 B;  2QDY B;  2ZPE B;  3VYG A;  3X26 B;  2ZZD B;  4OB3 B;  4OB0 B;  3VYG B;  2DD5 A;  1GXI E;  2DD4 A;  3X20 B;  1UGP B;  2ZPI B;  2DD4 B;  2PVG B;  2ZPF B;  1PSE A;  4ZGD B;  5L8R E;  2DXC A;  2ZPH B;  2PUO B;  1UGR B;  2CZ6 B;  4KT0 E;  2DPP B;  1DJ7 B;  2DXB A;  2DXC B;  3X25 B;  2CYZ B;  2PUK B;  2DXB B;  1PSF A;  3A8L B;  2ZPB B;  2WSE E;  2DD5 B;  1JB0 E;  2O01 E;  2AHJ B;  2CZ0 B;  2CZ7 B;  3A8O B;  3WVD B;  3X28 B;  4RKU E;  4ZGE B;  3HHT B;  3QZ9 B;  2PU9 B;  1QP2 A;  4L6V 5;  4FM4 B;  2WSC E;  2D0Q B;  2WSF E;  3QXE B;  4XK8 E;  1UGS B;  3A8G B;  2PVD B;  3X24 B;  3QZ5 B;  3A8H B;  2ZPG B;  3A8M B;  4Y28 E;  2ZCF B;  1V29 B;  4OB1 B;  3LW5 E;  2CZ1 B;  1QP3 A;  3QYH B;  3VYH B;  4ZGJ B;  1UGQ B;  3WVE B;  1IRE B;  1AHJ B;  3QYG B;  2PVO B; 
#chains in the Genus database with same CATH topology
 4B9W A;  2RPN A;  5FU7 C;  3URG A;  5DLQ E;  1OUL A;  1M2V B;  4B9X A;  3NTH A;  4OMM A;  4PFO A;  1RAB B;  2VVK A;  3RNJ A;  3G7Z A;  1H92 A;  1YCY A;  4BCN B;  1UEC A;  3JCM h;  2KQW A;  3CCQ T;  4C8Q C;  5HBH B;  4M77 F;  2IVW A;  3G71 T;  4ZGD B;  2JM8 A;  4JUV A;  2CH4 W;  2VYT A;  4M4Z A;  3EG3 A;  2EFI A;  3CCE T;  2E1H A;  2DXB A;  2KRN A;  4M78 A;  5A2Q E;  1VQM A;  1YI2 A;  1YN8 A;  4LDY A;  1XTD A;  1BU2 A;  2KRM A;  3JCM c;  1BU1 A;  1KD1 U;  3A8L B;  1Q7Y C;  2CH4 A;  3FJP A;  3VRY A;  3OYJ A;  2E5Q A;  3JCM b;  1YHQ T;  1FMW A;  1OV3 A;  1ACM B;  4Z88 A;  2CP7 A;  1X2K A;  1UE9 A;  5KYY B;  1U06 A;  3SWN B;  2EKH A;  1ZUY A;  2DK3 A;  2E5K A;  2I0N A;  3JCM V;  5LJ5 f;  2IW9 B;  5CKE A;  1VQK Q;  2O88 A;  2IIM A;  1YP5 A;  1O75 A;  2UUE B;  2RHY A;  1OU9 A;  4BY7 X;  1QP2 A;  1WHM A;  1VYU A;  1VYT A;  1W1F A;  3G1J A;  3TQ7 P;  4LDV A;  4HCK A;  2RD1 A;  1NPP A;  3TN8 B;  1YIJ T;  3OW2 S;  2EJ9 A;  4UN0 A;  2LJ1 A;  1GCQ A;  4J6Y A;  5GMK e;  2K5F A;  4AFQ C;  1HSQ A;  3O5Z A;  1OPK A;  4M77 G;  3QWX X;  3DKM A;  2WIH B;  1K76 A;  2XDD A;  2RO0 A;  2KT8 A;  4BCM D;  3VV0 A;  4OMN A;  4OMP A;  2XMF A;  1AVZ C;  2L3S A;  4LNP A;  2LCS A;  5CKB A;  2V1R A;  2FPF A;  3RDV A;  3RR6 A;  2EQI A;  1ZLM A;  2XD0 A;  4OB3 B;  3LGF A;  3VS2 A;  3HTR A;  1QVP A;  1K73 R;  2DYB A;  4BB7 A;  3DTO A;  3G4S Q;  3CQT A;  5M9O A;  2LZ6 B;  2C6T B;  2LX9 A;  1PC0 A;  5IXF A;  1RI9 A;  4HT9 A;  2AIR B;  1OX9 A;  3FEO A;  4HVW A;  2EGC A;  4XTY A;  3DOG B;  4EOJ B;  2DER A;  2K3Y A;  7AT1 B;  2LC4 A;  4N4H A;  2LCC A;  2DO3 A;  2ZAE A;  4M75 A;  1AWO A;  1NJI U;  1BI3 A;  1M2O A;  2MCN A;  3PMT A;  3BG3 A;  3R6O A;  5CCA A;  2D8H A;  1PSF A;  3GNG A;  5LJ3 d;  4BCO B;  2EQM A;  2WIP B;  2FPD A;  4Q5W A;  4EOK B;  2XG8 D;  1HYO A;  4MDX A;  2EWN A;  1B3Q A;  3SEM A;  2CZ0 B;  4IKF A;  3CCQ A;  1ZUK A;  4PJO C;  2DF6 A;  2KI7 A;  2KAF A;  2CZ7 B;  2LQ8 A;  3ULR B;  3G71 A;  2FO0 A;  3CC7 Q;  4QT7 A;  4ATO A;  3RMS A;  2J6K A;  2BIV A;  3CCE A;  3CCQ Q;  2BZ8 A;  3EID B;  4C92 C;  1LCK A;  4XTU A;  2W9Z A;  2YUP A;  2K9G A;  4N0A A;  3D7S B;  2MMP A;  1YHQ A;  5I2S A;  4A4F A;  1VQ4 Q;  4JJN K;  3CCE Q;  4FL6 A;  4LE9 A;  1RAA B;  1TTH B;  1GUX A;  5IDP B;  3QJY A;  3OYY A;  2M0Y A;  4BI4 A;  4M77 D;  5LJ5 g;  1H28 B;  2RJF A;  2QEX T;  2E6Z A;  2KMT A;  1UJ0 A;  4YOZ A;  5KE2 A;  1V1C A;  2HKN A;  3M4G A;  5LMK B;  5LJ5 j;  2GTJ A;  1YIJ A;  2BE7 D;  1F1B B;  5ACB A;  2K79 A;  3UF4 A;  1M1K C;  4R56 A;  1K9M U;  1NYF A;  1N6A A;  2YDL A;  4EOI B;  5CQY A;  3CBP A;  3A1P A;  1GRI A;  1OYX A;  3THK A;  1UGP B;  1K8A C;  3MI9 B;  1YIJ Q;  1D3U B;  2JTE A;  3UA6 A;  4RTX A;  1HJD A;  1O9K B;  2HL5 C;  4V2S A;  2QQ9 A;  2RH2 A;  1NEB A;  4TVR A;  4Z8A A;  1UFF A;  1NEG A;  4XU0 A;  3TSW A;  1XO2 A;  4QKU A;  3CEY A;  1GFD A;  2DBM A;  5IDN B;  3VS3 A;  4BI8 B;  2DEU A;  1OI1 A;  2DVJ A;  2QQA A;  4AFS C;  4RCB A;  2C5V B;  1VQ9 T;  4IUU A;  6AT1 B;  1GBR A;  2RK1 A;  3JCM e;  2YRD A;  3I9Q A;  1U1S A;  1BBZ A;  2O2O A;  1N5Z A;  3CC4 T;  1M1F A;  2GF7 A;  1PHT A;  5GAM h;  2IG0 A;  5LJ3 f;  2JXB A;  4HNV A;  4DOV A;  4E7K A;  1VOL A;  1BCO A;  1TG0 A;  4KUD K;  4I3Z B;  2UZL B;  3CBO A;  2HBW A;  4ME7 A;  3V7C A;  3O8V A;  2E70 A;  3CD6 T;  2HQH A;  1Q86 C;  1AT1 B;  2YUN A;  1NPR A;  4M7A C;  3HSB A;  4UC4 A;  2F5K A;  4BCQ D;  1P92 A;  1UB4 A;  2FPE A;  3EGX A;  4IIO A;  2F2C A;  3EFO B;  2LRQ A;  1W2B A;  4BY6 B;  3JB9 I;  3BW1 A;  3L2Z A;  1UGQ B;  2V1Q A;  2DMO A;  3TNW B;  1GCP A;  1M5Q 1;  1VQ5 T;  1AWX A;  3QYB A;  2B9R A;  5GAN 3;  3VYG A;  2WMA B;  1OX8 A;  4AG1 C;  1RAD B;  4F7U F;  3QPH A;  5IT9 E;  2C0T A;  1ZSZ C;  2CGH A;  4C92 B;  3OYI A;  4AFU C;  1RAF B;  4F17 A;  2ZGW A;  1H4L D;  4JLI A;  3E2U A;  3OYE A;  2GGR A;  1FWZ A;  2ZPF B;  3HFO A;  4OMQ A;  2C5N B;  2QEX A;  1HK9 A;  4C0G A;  5L2W B;  5FU6 B;  3TW7 A;  3OYN A;  4JRQ A;  2PK2 A;  3PVL A;  1IZ6 A;  4KT0 E;  4PJN A;  1UUE A;  2G77 A;  1XOV A;  2LJ3 A;  3EG9 B;  3NFC A;  1RAI B;  1W98 B;  2O9V A;  5D6Y A;  4WTO B;  2QEX Q;  4BE1 A;  2E3H A;  4CC4 B;  2NYS A;  4LDX A;  3CXC A;  2DD5 B;  2LX7 A;  4M7D C;  3N5B B;  1OI9 B;  1OGU B;  2NUP B;  3S3O A;  2VC8 A;  1PWT A;  4C5G A;  1UTI A;  5IHI A;  1G3T A;  1QQJ A;  4EDU A;  3VS5 A;  3V8K A;  3EH1 A;  3MO8 A;  3X28 B;  3KBG A;  1RLQ C;  3FDR A;  1Y0M A;  3V7S A;  3CCL T;  1AWJ A;  3M0P A;  3CXC P;  4EMK B;  4KGZ B;  2KK4 A;  2LJ0 A;  4MFE A;  1NM7 A;  3MJX A;  3VUZ A;  2ENM A;  4HVV A;  1EFN A;  4E7J A;  4PKC C;  1F5Q B;  3M55 A;  4OMO A;  3OYA A;  4O6J A;  3BLR B;  5IHN A;  4M77 A;  4M78 D;  2YT6 A;  3HRU A;  1M3A A;  2MWP A;  2ESW A;  1LJO A;  3JCM J;  3QDF A;  4OGR B;  2HL3 A;  4F7U G;  2DL7 A;  3A8H B;  3I55 T;  3PE0 A;  1W2B S;  1V76 A;  4PLI A;  1VQ9 A;  5GJV B;  2WFY B;  3UA7 A;  1G5V A;  4FYW B;  1OQK A;  4RTY A;  3CC4 A;  1OOT A;  1P5E B;  4F7S B;  4J9G A;  4NS5 A;  2BS4 A;  3M58 A;  3CCS T;  1M8V A;  2YRC A;  1VQ9 Q;  4JS4 A;  1YFN A;  2PMI B;  5GAN h;  3HKS A;  4ROE A;  3CC4 Q;  3X26 B;  3CD6 A;  2E4H A;  2VWF A;  5HK3 A;  5C0M A;  2OAW A;  1K73 U;  3S6W A;  1I1J A;  1OZ2 A;  2VAS A;  1WI7 A;  1IHV A;  2YUO A;  4FT2 A;  1H1S B;  3CD6 Q;  5FRN A;  1XQH A;  4NL3 A;  1YCS B;  3UDC A;  2WHB B;  1QVF S;  1D1C A;  3Q1J A;  3K7A M;  3TSZ A;  4CFV B;  1D09 B;  1VQ5 A;  3SWN C;  3EG1 A;  4PJJ A;  4M78 E;  2DXB B;  2L0A A;  3TU4 K;  3A5Z B;  1VQK T;  1WHL A;  4CC7 A;  2X4J A;  4ELY C;  3OA6 A;  2BZX A;  2WSE E;  2LCL A;  4FT4 A;  1M4Z A;  4XU3 A;  2L89 A;  2LNH B;  2GFU A;  4HVU A;  4DA4 A;  2YSQ A;  1VQ5 Q;  2L2P A;  5CYI B;  3OSV A;  1AZE A;  1VQN T;  1BB9 A;  2KRS A;  3PIP A;  1YJW T;  1TU0 B;  2NLU A;  1NBE B;  3CPW S;  4JX4 A;  5LJ5 d;  2AZS A;  1IGQ A;  3QZ9 B;  2EKO A;  2W99 A;  2OX7 A;  3VU3 C;  2PZ1 A;  2CJM B;  5CAI A;  2WJ9 A;  1WZO A;  5GAO r;  4OGC A;  5DQV A;  2RMO A;  4M75 D;  1IRX A;  3FJ5 A;  5DM7 R;  2KE9 A;  4XK8 E;  4C8Q F;  1KQS S;  1BYM A;  4N4G A;  1AIS B;  4ZTF A;  3M0S A;  2EGA A;  5GAN 4;  3EGU A;  3CCL A;  2MAM A;  1Q81 C;  4XTZ A;  1FYN A;  3G4S T;  2QYZ A;  1N27 A;  2QDJ A;  2CKK A;  2RA2 A;  3G6E T;  2KNB B;  2DME A;  2CP3 A;  2EYY A;  3RGF B;  1S72 T;  4C0D B;  2PQW A;  2CT4 A;  3PGG A;  2QGF B;  3MEA A;  1OIY B;  3OW2 A;  3NPF A;  1GXI E;  3I55 A;  3QUI A;  2DD4 A;  4RTV A;  2JOY A;  3S3N A;  4CFW B;  1MHN A;  1MND A;  5EG2 A;  1XNI A;  1RAH B;  3CMA T;  1ENW A;  2F2W A;  2RI2 A;  2E41 A;  4QVC A;  3I55 Q;  1D3B A;  2K7A A;  1U3O A;  3CCS A;  5IAY A;  4XTV A;  4M75 E;  1Q82 R;  4M75 B;  5KH6 A;  5GMK j;  2PUK B;  4OGE A;  2YLB A;  4RTW A;  3INZ A;  3CC7 T;  3QSU A;  2GQI A;  5FW9 A;  1KIK A;  3DLL A;  4CFU D;  2HCK A;  4PJL A;  2OAU A;  3CCS Q;  3BFM A;  1K0X A;  2LQW A;  1VIE A;  2AHJ B;  4C8Q G;  2V8I A;  4WCI A;  3CCU T;  3OBY A;  2ROL A;  3I5R A;  1M90 C;  1QW1 A;  3A8O B;  1VA7 A;  3OYF A;  1WHH A;  1VQ4 T;  1I4K 1;  2QG9 B;  3CCR Q;  4G6L B;  1M9S A;  2E12 A;  3UT1 A;  3EGD B;  1EIF A;  1K9A A;  3R6N A;  5DLO A;  3MP6 A;  4FW1 A;  2EUF A;  2JZ2 A;  4FM4 B;  4ORZ A;  3ZEH A;  4M6V A;  2FRY A;  1VQK A;  3QXE B;  3I5S A;  4Y72 B;  3BG5 A;  3KFV A;  4RTT A;  3BHU B;  5KYU A;  4X1V A;  2IW8 B;  3OYM A;  1VOM A;  1Q7Y R;  5LJ5 h;  2I2L A;  2I53 A;  2RI3 A;  1H64 1;  2FZK B;  5J3B A;  1GUX B;  1YJW A;  1QP3 A;  2W10 A;  4F7N B;  1FKM A;  5CK9 A;  1E6G A;  2A0F B;  3GPL A;  3M56 A;  4ZGJ B;  1AHJ B;  4KGV B;  1VQN Q;  5GMK m;  4CFU B;  1QKW A;  1YJW Q;  4PK4 A;  2DL8 A;  2X35 A;  3LGL A;  4PJO F;  2Y90 A;  4EOQ B;  3WXM B;  3CPF A;  2BS2 A;  2OJ2 A;  1I5O B;  2X3X D;  2A3L A;  1YBY A;  4PL6 A;  2QGS A;  4C5H A;  4BD3 A;  2HQX A;  2QF7 A;  1AD6 A;  3M03 A;  2KR3 A;  4ANJ A;  3G4S A;  3PTA A;  4C92 F;  4RMO A;  2WXV B;  3G6E A;  5KYW A;  1S72 A;  1WQ7 A;  4RG8 A;  3BHT B;  2RB6 A;  5GAN e;  2HKQ B;  3G6E Q;  4J9F A;  3V8L A;  2XIC A;  2DYI A;  2QDL A;  1URC B;  1FMV A;  5KYN A;  4BBR M;  4KGX B;  1S72 Q;  4JX6 A;  3CMA A;  2XDP A;  1Z9Z A;  1TUD A;  2DJZ A;  4NST B;  4J8O A;  1MMN A;  5HBJ B;  5CEI B;  1LVK A;  1H1Q B;  4TTH A;  2JUF A;  1VQ7 T;  2CDT A;  4BCI B;  3TNI B;  2DBK A;  1D1B A;  5I21 A;  3CMA Q;  4A53 A;  4BY1 X;  3CC2 T;  1ZX6 A;  5HQ0 B;  2FYK A;  3CC7 A;  3QHR B;  2L3P A;  4PJM A;  1WA7 A;  2CS7 A;  2QGG A;  1SSH A;  4FYX B;  3MEV A;  4GLK A;  4BY6 C;  1JRI A;  3QZ5 B;  4AKG A;  2GFA A;  2YLC A;  4XTX A;  4PJO G;  1W4S A;  4ROD A;  2XID A;  3CCU A;  3VS7 A;  1VQ8 Q;  2KSS A;  3BDU A;  1VQP T;  4BCM B;  2J7I A;  2JNG A;  3TRE A;  4AT1 B;  2BKD N;  2F2V A;  2LT1 A;  1VQ4 A;  2CZ1 B;  3DLM A;  2K5L A;  2VV5 A;  3EGX B;  4EMH A;  2DL5 A;  5GAN 5;  2EJF A;  3POM A;  3CCU Q;  4A54 A;  4C92 G;  5HCK A;  1H25 B;  2FVU A;  1H24 B;  2KEA A;  3LH5 A;  4E47 A;  1UHC A;  3TVT A;  1KG1 A;  1YJN T;  2G6F X;  2VXF A;  1E7P A;  2V22 B;  2DA9 A;  3FLG A;  4XAX B;  5FU6 C;  2XU8 A;  3VYG B;  3NMZ C;  1PG5 B;  4BCF B;  1UNH D;  4OML A;  2BKZ B;  4ZN1 A;  2FL7 A;  1N8R C;  1UHF A;  2P0K A;  2ZPI B;  4A4E A;  1UNG D;  5CKD A;  4CI0 C;  4EOL B;  3ZL7 C;  1X2Q A;  1AEY A;  1OKW B;  4ZN3 A;  3ZBD A;  2K6D A;  5I5Z B;  4AFZ C;  4RTZ A;  2CYZ B;  2DEQ A;  2LNV A;  4CRL B;  4J6X A;  1NE8 A;  5CQX A;  3GOX A;  5GAN 2;  2P4R A;  4EMK C;  5ICP B;  4J9C A;  4M7A F;  5I11 A;  1NLP C;  3PNW C;  4FCY A;  1ZBX A;  3JB9 J;  4ELJ A;  3EHQ A;  1UDL A;  3DB3 A;  1M1K R;  1GY3 B;  2IPO B;  2XK0 A;  1FX7 A;  5IXB A;  4N4I A;  4MFD A;  1K8A R;  3KUF A;  3HHT B;  5LQF B;  5IHY A;  3KXT A;  1WHG A;  2RQV A;  2GBQ A;  3J81 E;  2WSC E;  4LXC A;  5I22 A;  5L23 A;  5GAN 6;  2WMB B;  4OF1 A;  3EJ1 B;  1WXU A;  2LP5 A;  3H4C A;  3QWY A;  3C95 A;  4E6R A;  3A8G B;  4D6W A;  2X4X A;  3X24 B;  1WQW A;  4C0Z A;  4ZTJ A;  4PJO D;  4M77 E;  1PKD B;  4M77 B;  2R58 A;  3VRZ A;  4HNT A;  2WEV B;  2UZB B;  3DL1 A;  1R0B G;  4JJB A;  5LJ3 h;  3RKY A;  3S3M A;  1H1R B;  3GIB A;  1WLP B;  1N9R A;  2K2V A;  3P8B B;  4OMF B;  1VQ7 A;  3OB9 A;  1E9H B;  1IGU A;  1KD1 C;  3QYG B;  4EC9 B;  2X9H A;  4F7J B;  2BZY A;  4K11 A;  4M7D F;  3CC2 A;  2P84 A;  3QHS A;  1PRM C;  1WHJ A;  4JRI A;  2C5X B;  3HL8 A;  3OQ5 A;  4D8K A;  1PCX A;  3V8J A;  4JDS A;  1VQ7 Q;  4MMK A;  4OB0 B;  4GLM A;  1M30 A;  4M7A G;  3LLR A;  2OTL T;  1UG1 A;  2AZV A;  2DTO A;  4HL4 A;  4MML A;  3CC2 Q;  1HXD A;  1QCO A;  2OI3 A;  2P0P A;  1VQP A;  2KMG A;  3NHN A;  1VYV A;  1B34 A;  2HAX A;  4M78 C;  1Q86 R;  2PHG A;  5LJ5 e;  4EOO B;  2EGE A;  1KHC A;  2RNA A;  5HBE B;  3SB2 A;  2NUT A;  2DXC A;  2MOX A;  2FEI A;  3O0G D;  2FZG B;  4C8Q A;  1Q82 U;  1W2B P;  1VQP Q;  2VGN A;  1KC8 R;  4BAC A;  3X25 B;  4AKH A;  3OMC A;  1IB8 A;  1JO8 A;  1W6X A;  2KGT A;  3PIO A;  3L2R A;  1ZP2 A;  1OU8 A;  3QO3 A;  2ZPB B;  1YJN A;  2FG0 A;  4PJO E;  2KXC A;  4ESR A;  1H27 B;  1GFC A;  3FRN A;  2YRV A;  3M53 A;  2M9U A;  5KYX A;  4YTL A;  1SRL A;  1QMZ B;  1N9S A;  1YJN Q;  3QG1 A;  5IH2 A;  3M54 A;  5D7U A;  2E65 A;  2RQU A;  2DE0 X;  2RI5 A;  3KHI A;  2HEQ A;  5IF1 B;  3OSS C;  2FZC B;  2KYB A;  4QVD A;  1GCQ C;  4JJC A;  2H3J A;  1H3Z A;  2EYX A;  3OYH A;  3L2V A;  3JCM X;  1QVF A;  2AKL A;  2BTT A;  2K2M A;  4M7D G;  3CBM A;  3DJB A;  3M4Y A;  2JTM A;  4BCQ B;  4J9B A;  2M51 A;  2X3W D;  2PVD B;  3OYG A;  1T0J A;  1Q7Y U;  4HCB A;  1VYW B;  4Y28 E;  2COW A;  2QTX A;  1QVF P;  4E7H A;  4OR5 B;  4C0D C;  2R7G A;  1KFZ A;  1D0Z A;  4ELZ C;  1NYG A;  2D0N A;  1BK2 A;  3OS0 A;  3QYH B;  1ZA1 B;  2LDM A;  5GAO l;  4DQ2 A;  3CCM T;  1NJI C;  4YOO A;  1VIN A;  4E7I A;  3MP8 A;  2DX1 A;  3RKW A;  2OTJ T;  3CPW A;  3WVE B;  2V8K A;  1GL5 A;  3EHR A;  1K0S A;  3OMG A;  3VKH A;  4FYY B;  3TW6 A;  3I35 A;  3EH2 A;  2ZZD A;  3PO3 S;  1BI1 A;  2QDY B;  1Y96 A;  2R57 A;  8ATC B;  1U1T A;  2K5I A;  1TXQ A;  4HT8 A;  2HSE B;  1RAG B;  4KRC B;  4J9H A;  2A7Y A;  1X27 A;  4JPB W;  3QWL A;  4FIB A;  4A63 B;  3CPW P;  2B86 A;  3BY7 A;  3H0I A;  5KE3 A;  2R5M A;  1Q95 G;  1KQS A;  3CCV T;  1WHK A;  1PRL C;  4M75 C;  1QWE A;  1MGQ A;  2DD4 B;  4JJD A;  2XHC A;  1M8M A;  3P8H A;  1QVG S;  1YJ9 Q;  1GH6 B;  4A4K A;  4EOP B;  1KQS P;  1UGR B;  3MEW A;  4FSX A;  1IXD A;  1D3B B;  2JN0 A;  3NTK A;  2UZE B;  1RAC B;  3CCR T;  1RI0 A;  2KY9 A;  4B6M A;  1CKA A;  3GBQ A;  4X9D A;  4E7S A;  5HNB B;  1JB0 E;  2DXU A;  4DBF A;  5GAM g;  4X34 A;  2O01 E;  2OTL A;  5AYF A;  4BBS M;  2WAC A;  1TUG B;  4RTU A;  5A0D A;  1JSU B;  2ATC B;  1BIB A;  4HCZ A;  4LDU A;  3MY1 B;  3RUX A;  4IUV A;  1OL1 B;  3IQL A;  3QKJ A;  1BI0 A;  4LUE A;  4RKU E;  5GAM j;  4ZGE B;  1VIF A;  5HY6 A;  1QCN A;  2OTL Q;  1G3W A;  4Y91 A;  3L2Q A;  4PJO A;  4N0A C;  3C4S A;  1WJS A;  4M78 B;  5IN1 A;  3VS4 A;  4YOS A;  2DZC A;  1ZBJ A;  3VUB A;  1MNE A;  4M7D D;  1K9M C;  1QMC A;  4EC8 B;  2DL4 A;  4JZ3 A;  1KSW A;  1FMK A;  3FC3 A;  4JZ4 A;  4OVA A;  4LUD A;  3NDQ A;  3TEE A;  3H0F A;  4KUI A;  3REA B;  4C92 A;  2EBP A;  3A98 A;  1RUW A;  2YUQ A;  4OP0 A;  5KYU B;  4ROC A;  4Z02 A;  2K4Y A;  3MHX A;  3C12 A;  2LQK A;  2PJQ A;  1UJY A;  4BCP B;  4FYV B;  1WPY A;  4HLQ A;  3M0U A;  4KBM B;  1ZUU A;  1QLB A;  2CP6 A;  3OYD A;  3OYC A;  4NOY A;  2RQW A;  3VKI A;  4KH0 B;  1IHW A;  3MIA B;  3MPU B;  4LD9 K;  1Z9Q A;  4KUL A;  2DTH A;  2DD5 A;  4E7Z A;  2X1N B;  2QA4 Q;  3F70 A;  2H3E B;  3OS2 A;  4L5G A;  2EW3 A;  2ROT A;  4LDW A;  2PVG B;  1RLP C;  2FRW A;  4GBQ A;  1WXT A;  4IUQ A;  1WNL A;  3CCM A;  3ASK A;  4BCN D;  5LJ3 e;  2DRM A;  2OTJ A;  1D0Y A;  3SDZ A;  2EYQ A;  1Q81 R;  2HQE A;  1E7O A;  2RJC A;  4C5I A;  2JJ9 A;  4QQG A;  3PT9 A;  5KYW B;  3CCM Q;  4LOC A;  1MMD A;  3JCM W;  2C0I A;  2A08 A;  2GQV A;  2OTJ Q;  3H0H A;  3MKD A;  4J6W A;  3CCV A;  4EOM B;  2EIF A;  1M1K U;  3OW2 P;  4BUG A;  1EZZ B;  2EQU A;  3TNH B;  1C9B A;  2F69 A;  2LT4 A;  1K8A U;  2DFU A;  2P0Q A;  3M5A A;  4KRD B;  4QQD A;  1YWO A;  1VQ8 T;  3GF5 A;  3CCV Q;  4XU1 A;  1X75 C;  1FVV B;  4L6V 5;  4BCK B;  4F7U E;  4O5V A;  5HKC A;  3CCR A;  3JCM P;  3H6Z A;  2WSF E;  3JCM Q;  3JB9 F;  3M0R A;  1FIN B;  1D0X A;  1SF9 A;  1R8O B;  1CKB A;  4J5Y A;  2D6F A;  4F04 B;  2JMC A;  1G83 A;  4DBR A;  3NTI A;  2W0Z A;  1AD5 A;  5HVY B;  4PFP A;  4R55 A;  5CR2 A;  4CRI A;  1R0C B;  2BE9 B;  5GAN g;  4DOW A;  1NZ9 A;  2ZCF B;  2MYS A;  1V29 B;  3AT1 B;  3JV3 A;  5EC7 A;  1H26 B;  2L3Q A;  3JCM f;  1M90 R;  1ZSG A;  4M7A A;  1QCF A;  5GAN j;  2J6F A;  1T3S A;  3SHW A;  1T3L A;  2CUB A;  1QLY A;  1KHI A;  4LD6 A;  3RIR A;  4XTW A;  2RHI A;  1MMA A;  2CP0 A;  4Z89 A;  3UWN A;  1VQN A;  3LH0 A;  4ZNX A;  5FGK B;  3HFN A;  2AK5 A;  3FB9 A;  3CME T;  2F5T X;  4RUG A;  5GAO q;  1Q86 U;  3GTM S;  1VUB A;  5CO7 A;  4AMC A;  1ZSZ A;  3EAE A;  4J9D A;  1VQM Q;  1YI2 Q;  2E10 A;  3OYK A;  5GMK i;  1KJW A;  4CFX B;  2PUO B;  1H8K A;  2CSI A;  3DB4 A;  5J26 A;  3QYE A;  2DPP B;  1KC8 U;  2MIO A;  1JQQ A;  1JJ2 S;  5FWB A;  2HZY A;  1G3Y A;  2E6N A;  3B57 A;  3JB9 G;  1K4U S;  2KVQ G;  2RQT A;  4HA8 A;  5CKF A;  4ELL A;  2JW4 A;  5FRO A;  3HPW A;  3TCJ A;  4BCH B;  1TFB A;  2M0O A;  3WVD B;  4M7D A;  3GLX A;  1I8F A;  4BDY A;  2D9T A;  1UNL D;  1ABO A;  1MUZ A;  2CRE A;  3QBY A;  3SD4 A;  1LOJ A;  3REB B;  4BI3 A;  1EX4 A;  4M77 C;  3DDP B;  4KRT A;  2RJE A;  2A37 A;  2R5A A;  1JXO A;  3E1S A;  4DEX A;  2RK2 A;  2BUD A;  2FHD A;  2EAY A;  2K57 A;  1K73 C;  1ZHI A;  3VS1 A;  4C8Q D;  5KCH A;  4MDW A;  3LX7 A;  2X4W A;  4BXX X;  2W2H A;  2ZPG B;  1RL2 A;  2LVM A;  5GMK l;  3LQ5 B;  1YWP A;  3P8D A;  4VUB A;  3E19 A;  3OS5 A;  3QII A;  4CC2 A;  5CKH A;  4F7U A;  2RJD A;  4EIK A;  1MMG A;  2QAZ A;  1VQ8 A;  2SEM A;  2O4X A;  3L2W A;  3MP1 A;  4F6W B;  1WDX A;  4WF2 A;  3PVQ A;  1H1P B;  1GBQ A;  3PMI A;  4JS5 A;  5C6S A;  1JBM A;  1Y07 A;  1M2V A;  4J9I A;  4OB2 B;  4NC6 A;  2ZPE B;  2Z0W A;  1TUC A;  2KR6 A;  3HB9 A;  3HRS A;  2JS2 A;  5GAM d;  9ATC B;  4IMY B;  1G8X A;  4FX3 B;  2COZ A;  3EFS A;  1VQ6 T;  5FU7 B;  3JCM g;  1B34 B;  5L8R E;  3LWI A;  1N4M A;  1PD1 A;  1WXB A;  1Y7X A;  3EGD A;  3JSC A;  1YNZ A;  2NUT B;  2DXC B;  3M57 A;  4F14 A;  4C8Q E;  3GP8 A;  4C8Q B;  2RHZ A;  3C94 A;  1M27 C;  4IUT A;  3LYI A;  1BIA A;  1CSK A;  2AKK A;  2PNI A;  4DEY A;  3JB9 D;  2P4T A;  1XJW B;  3G71 Q;  1PNJ A;  4JX5 A;  5KYY A;  3SWN A;  2MWO A;  2C4G B;  1PKS A;  4FU6 A;  3CME A;  1X01 A;  1SHG A;  2VKN A;  2QXF A;  4CC3 A;  1BCM A;  2GTO A;  2CCI B;  4J7F A;  5KYX B;  4A4G A;  3L2U A;  1ARK A;  1IO6 A;  1K1Z A;  1N8R R;  1WJR A;  3SFM A;  2LQN A;  3CME Q;  1KQ1 A;  2PU9 B;  5BNJ B;  1YHQ Q;  2DKG A;  3L1A A;  4R0K A;  1NLO C;  4JLG A;  1VQO T;  2EQJ A;  1JU5 C;  4FW2 A;  2D0Q B;  3UAT A;  5DQW A;  5AT1 B;  2C06 A;  4II5 B;  1UGS B;  2K3X A;  4P5N A;  1C1A A;  5FLX E;  4M78 F;  2C0O A;  2O9S A;  2QTV A;  5GAN 7;  1WFW A;  2QQS A;  2L5Q A;  4HCC A;  2HSP A;  1VQL T;  1MV0 B;  5EFQ B;  2F1L A;  2DXT A;  4KH1 B;  5CVI A;  2HD0 A;  5GAN 8;  2D1X A;  2JT4 A;  2KRO A;  2RQR A;  4J83 A;  1PKT A;  2DM1 A;  1UEB A;  2J06 A;  3BG9 A;  1U5S A;  2J6O A;  2BPM B;  4XU2 A;  3ER0 A;  4JRK A;  2COY A;  3CCJ T;  2DTI A;  1YJ9 T;  3AHU A;  2RN8 A;  1M3C A;  4EOS B;  2O31 A;  2ZZD B;  1X6B A;  1C6V X;  1Y96 B;  1AWW A;  2EVR A;  3BE3 A;  5EJC A;  4QW2 A;  2XDB A;  3LWH A;  2E64 A;  3X20 B;  3HZJ A;  1X6O A;  1SSF A;  1D1A A;  2A28 A;  4L59 A;  2HBP A;  2RHU A;  3E9G A;  4XQ3 A;  4C92 D;  3QDR B;  4MZM A;  1SPK A;  2Y4Y A;  1OIU B;  1E6H A;  3VS6 A;  2KBT A;  1RAE B;  1Q81 U;  1SG5 A;  3L42 A;  1G3S A;  4RCC A;  2UZD B;  5ECA A;  1Y57 A;  1X6G A;  5GAM f;  4CFN B;  1JOW A;  1KD1 R;  4QQ6 A;  3ZFJ A;  2JTF A;  4MZP A;  4EON B;  4C5E A;  1TD6 A;  1NG2 A;  4BDZ A;  5D6X A;  2ECZ A;  1R77 A;  5KCO A;  4M78 G;  1SEM A;  2PTK A;  4AG2 C;  1VQ6 A;  4HXJ A;  5GAN d;  3J7A F;  2ED1 A;  4BE2 A;  3RMQ A;  4MZT A;  8AT1 B;  4A4H A;  1C0M A;  2IW6 B;  1QVG A;  3H9N A;  1KC8 C;  4PJO B;  4E2F B;  2HNI A;  1JKW A;  3OS1 A;  1VQ6 Q;  3RES A;  2IVX A;  4F6S B;  2VXE A;  3BHV B;  4M75 F;  4LN2 A;  1KXU A;  2RF0 A;  1TS9 A;  4DBQ A;  4Y92 A;  1OKV B;  5J39 A;  1QVG P;  2X4Y A;  3RER A;  3E9F A;  3UPU A;  2EYZ A;  3MCA B;  1X69 A;  3OBW A;  2QQ8 A;  1I81 A;  2DNU A;  3I56 T;  2KXD A;  2W9F A;  4C92 E;  4IUP A;  2DIL A;  5GAO m;  4J7I A;  1M90 U;  2GNC A;  1I07 A;  2CUD A;  1WIE A;  1ZA2 B;  2QA4 T;  3VYH B;  5CIU A;  3QHW B;  1O9S A;  2LTO A;  4AI6 A;  3EFR A;  2DZ9 A;  3QJ6 A;  1VQO A;  4F70 B;  2X51 A;  1M3B A;  2ABL A;  3MET A;  1PD0 A;  1WJQ A;  2VUB A;  3JB9 H;  4C0F A;  1TWB A;  2KDS A;  4AKI A;  2DAQ A;  2E3I A;  1QWF A;  1VQO Q;  2K3B A;  1PM3 A;  4Z6Y A;  2AT1 B;  3H41 A;  3NGP A;  2CT3 A;  2CSQ A;  1VQL A;  2V8J A;  1O9K A;  2DVE A;  1PSE A;  5GJW B;  2DET A;  2CZ6 B;  3PFS A;  2D8J A;  4PFZ A;  1Y71 A;  2NUZ A;  2Y4X A;  3JRZ A;  1NJI R;  1BI2 A;  1VQL Q;  4JRP A;  3CCJ A;  4M7A D;  1YJ9 A;  5GMK h;  5GAO p;  4EMG A;  1A0N B;  4BE0 A;  4MIM A;  2DRK A;  3HP9 A;  2M16 A;  1YIT T;  3DDQ B;  1T0H A;  4M75 G;  2C5O B;  2BS3 A;  2LW4 A;  2VB6 A;  1HD3 A;  1OPL A;  2SRC A;  2L3R A;  3HO8 A;  2QK0 A;  1KK7 A;  2YHT A;  3CCJ Q;  2XI9 A;  1B7T A;  4FSS A;  1SKU B;  4J9E A;  4BCJ B;  2KT1 A;  2M02 A;  1U8R A;  1G2B A;  3H8Z A;  2MF2 A;  1B07 A;  1SRM A;  3MY5 B;  3M0Q A;  2QI2 A;  2RM4 A;  1J3T A;  4EPC A;  3C0C A;  5LJ3 g;  2DIG A;  4X9C A;  3VJP A;  3JAM E;  2EYW A;  5D6W A;  3M9Q A;  1JST B;  2VGM A;  2QQB A;  3J80 E;  5GAN f;  1W70 A;  1I5L A;  3A8M B;  5I2M A;  1WX6 A;  1TH7 A;  5LJ3 j;  2DJQ A;  1ZQ1 A;  4RG2 A;  1QKX A;  2MI6 A;  3EFO A;  2PK9 B;  4II1 A;  4OB1 B;  4BCG B;  1WYX A;  3GNF B;  1S1N A;  4CXA B;  2G9X B;  4IUR A;  3JCM d;  2RHX A;  3HBL A;  3U23 A;  3EG2 A;  4M7A E;  2CP5 A;  2QFZ A;  4M7A B;  1VQM T;  1YI2 T;  1MV3 A;  2W96 A;  3F5X B;  3VKG A;  1FXX A;  2MPX C;  4IIM A;  5LL6 S;  3CXC S;  3HRT A;  1OZ3 A;  3BLQ B;  1KQ2 A;  2B8A A;  2JM9 A;  1LPL A;  2EJG A;  1K9M R;  3M59 A;  1TSF A;  3I56 A;  3FIF A;  2ED0 A;  5IHK A;  1UGV A;  3EOC B;  5DY9 A;  3OYL A;  2YWW A;  4E7L A;  1X43 A;  3RKX A;  4F7L B;  2QA4 A;  1ZSZ B;  2JMA A;  2ZPH B;  2DLP A;  4QVZ A;  1TOV A;  2YXY A;  3MEU A;  1SHF A;  5A0G A;  3EG9 A;  1DJ7 B;  1I0C A;  2J05 A;  3I56 Q;  1JEG A;  4PNO A;  1AZG B;  3OY9 A;  1WGS A;  4F16 A;  2GCX A;  2DL3 A;  2NUP A;  1ABQ A;  2JVV A;  3G33 B;  1M1G A;  3BLH B;  2HDA A;  2JGZ B;  2CCH B;  2L8D A;  2M1H A;  2FB7 A;  2EPD A;  2XKO C;  4EMK A;  4QSH A;  4HNU A;  3M0T A;  3RBB B;  2V26 A;  2HMA A;  3VS0 A;  1N8R U;  5GAO n;  2QQR A;  2DIQ A;  4M7D E;  3T9N A;  4M7D B;  2WPA B;  2KYM A;  3BDL A;  3V7R A;  2A36 A;  1LNX A;  1OL2 B;  1JXM A;  4D8D A;  1AOJ A;  2CP2 A;  2F2X A;  1JJ2 A;  2JS0 A;  4DBH A;  5GAM e;  2I40 B;  3CCL Q;  1OEB A;  1YIT A;  4EOR B;  4CFM B;  5FRM A;  5A0L A;  2G3R A;  4F6U B;  2QAS A;  4GY5 A;  4YC3 B;  2EQK A;  5FWC A;  2H8H A;  1G3N C;  1JJ2 P;  3LW5 E;  1BKB A;  3ME9 A;  1Q82 C;  1YIT Q;  4F7U B;  2LMJ A;  4NL2 A;  4HKE A;  5HK0 A;  3OYB A;  2MK5 A;  4PLL A;  1IRE B;  1H3H A;  2PVO B;  2NWM A;  3EG0 A;  2O4X B;  2IN3 A; 
#chains in the Genus database with same CATH homology
 4B9W A;  4OB2 B;  3HKS A;  3QHS A;  5GAN h;  4NC6 A;  4JRI A;  2ZPE B;  3OQ5 A;  3HL8 A;  5FU7 C;  3URG A;  3X26 B;  3CD6 A;  5DLQ E;  2KR6 A;  3HB9 A;  3HRS A;  3V8J A;  4B9X A;  4JDS A;  5HK3 A;  3NTH A;  4MMK A;  5C0M A;  4OB0 B;  1K73 U;  3S6W A;  4M7A G;  1OZ2 A;  3LLR A;  3G7Z A;  5GAM d;  2OTL T;  1YCY A;  2DTO A;  4HL4 A;  4MML A;  3JCM h;  2KQW A;  1HXD A;  3CCQ T;  1VQP A;  2P0P A;  2KMG A;  3EFS A;  4C8Q C;  4FT2 A;  4M7D F;  1B34 A;  2HAX A;  4M77 F;  1VQ6 T;  2IVW A;  4M78 C;  5LJ5 e;  3G71 T;  5FU7 B;  5FRN A;  1KHC A;  3JCM g;  1XQH A;  4ZGD B;  4NL3 A;  1B34 B;  4JUV A;  5L8R E;  3LWI A;  3SB2 A;  3UDC A;  1Y7X A;  2DXC A;  2VYT A;  2EFI A;  4C8Q A;  1Q82 U;  3CCE T;  2E1H A;  3JSC A;  2DXB A;  1QVF S;  4M78 A;  5A2Q E;  2VGN A;  1VQM A;  2DXC B;  3M57 A;  3X25 B;  3Q1J A;  4BAC A;  3GP8 A;  4C8Q E;  4AKH A;  4LDY A;  1XTD A;  3OMC A;  2RHZ A;  3SWN C;  4C8Q B;  1VQ5 A;  3PIO A;  4M78 E;  2DXB B;  3C94 A;  3JCM c;  3L2R A;  1KD1 U;  3TU4 K;  3A8L B;  3A5Z B;  3LYI A;  1BIA A;  3QO3 A;  2ZPB B;  4IUT A;  1YJN A;  1Q7Y C;  1VQK T;  4PJO E;  3FJP A;  3JB9 D;  2X4J A;  3OYJ A;  4ELY C;  3OA6 A;  2P4T A;  2WSE E;  3FRN A;  2E5Q A;  4JX5 A;  2LCL A;  2YRV A;  3JCM b;  1YHQ T;  4FT4 A;  1M4Z A;  3M53 A;  2M9U A;  4XU3 A;  2L89 A;  3SWN A;  2MWO A;  2GFU A;  4FU6 A;  4DA4 A;  3CME A;  1X01 A;  4YTL A;  3OSV A;  3SWN B;  2QXF A;  1N9S A;  4J7F A;  1VQN T;  4A4G A;  3L2U A;  3QG1 A;  3M54 A;  2DK3 A;  3PIP A;  1YJW T;  2E65 A;  2NLU A;  3JCM V;  5LJ5 f;  2RI5 A;  3CPW S;  5CKE A;  4JX4 A;  3KHI A;  3OSS C;  1WJR A;  5LJ5 d;  3SFM A;  1O75 A;  3QZ9 B;  4QVD A;  1YI2 A;  2EKO A;  2RHY A;  1KQ1 A;  2H3J A;  1H3Z A;  2PU9 B;  1QP2 A;  3VU3 C;  2DKG A;  3L1A A;  5CAI A;  2WJ9 A;  3OYH A;  4JLG A;  1VQO T;  2EQJ A;  3L2V A;  4OGC A;  3JCM X;  4LDV A;  2D0Q B;  4M75 D;  2RD1 A;  5GAO r;  1NPP A;  1QVF A;  5DM7 R;  3CBM A;  4M7D G;  3M4Y A;  2JTM A;  1YIJ T;  3OW2 S;  2EJ9 A;  2C06 A;  4XK8 E;  1UGS B;  2K3X A;  4P5N A;  3OYG A;  2PVD B;  4C8Q F;  1KQS S;  5FLX E;  1BYM A;  4J6Y A;  4N4G A;  5GMK e;  4M78 F;  1Q7Y U;  2K5F A;  4HCB A;  4Y28 E;  5GAN 7;  2QTX A;  4ZTF A;  2QQS A;  2L5Q A;  4HCC A;  4E7H A;  5GAN 4;  4C0D C;  3CCL A;  2MAM A;  4ELZ C;  1VQL T;  3OS0 A;  2DXT A;  5CVI A;  2HD0 A;  5GAN 8;  4M77 G;  3QYH B;  2LDM A;  1Q81 C;  4XTZ A;  5GAO l;  3DKM A;  4DQ2 A;  3CCM T;  3G4S T;  1NJI C;  4J83 A;  2XDD A;  4E7I A;  3MP8 A;  1N27 A;  2QDJ A;  1UEB A;  2CKK A;  2RA2 A;  2RO0 A;  3RKW A;  3VV0 A;  3G6E T;  3CPW A;  3BG9 A;  3WVE B;  2V8K A;  2OTJ T;  3OMG A;  3VKH A;  3TW6 A;  4XU2 A;  3ER0 A;  2ZZD A;  4JRK A;  5CKB A;  4C0D B;  1BI1 A;  2QDY B;  1Y96 A;  2R57 A;  3CCJ T;  1S72 T;  1U1T A;  2DTI A;  2K5I A;  2PQW A;  1YJ9 T;  4HT8 A;  3AHU A;  3PGG A;  2A7Y A;  2ZZD B;  3QWL A;  3MEA A;  1Y96 B;  4OB3 B;  4FIB A;  2XD0 A;  3LGF A;  3BY7 A;  3OW2 A;  5KE3 A;  1GXI E;  2R5M A;  5EJC A;  3I55 A;  1QVP A;  3QUI A;  4QW2 A;  4BB7 A;  3LWH A;  2XDB A;  2DD4 A;  2E64 A;  1KQS A;  3X20 B;  3CCV T;  3HZJ A;  1X6O A;  2JOY A;  5M9O A;  1MHN A;  4M75 C;  5EG2 A;  3S3N A;  1XNI A;  2LX9 A;  1SSF A;  3CMA T;  1MGQ A;  4HT9 A;  4M7A C;  2DD4 B;  4L59 A;  3FEO A;  2RI2 A;  2HBP A;  2E41 A;  4QVC A;  2RHU A;  3E9G A;  4XQ3 A;  4XTY A;  2XHC A;  3QDR B;  4C92 D;  4MZM A;  2K3Y A;  2Y4Y A;  3P8H A;  2LC4 A;  4N4H A;  2LCC A;  1QVG S;  2DO3 A;  4A4K A;  4M75 A;  1D3B A;  1UGR B;  3CCS A;  3MEW A;  5IAY A;  1Q81 U;  4FSX A;  4XTV A;  1NJI U;  1BI3 A;  3L42 A;  4M75 E;  1G3S A;  4M75 B;  1D3B B;  4RCC A;  5KH6 A;  3PMT A;  3BG3 A;  2JN0 A;  2PUK B;  3NTK A;  3R6O A;  4OGE A;  2YLB A;  5CCA A;  5GMK j;  3CCR T;  3CC7 T;  1RI0 A;  1PSF A;  2KY9 A;  3GNG A;  3INZ A;  5GAM f;  5LJ3 d;  3QSU A;  2EQM A;  3DLL A;  4QQ6 A;  4X9D A;  3ZFJ A;  2JTF A;  4MZP A;  4C5E A;  1JB0 E;  2DXU A;  4Q5W A;  2OAU A;  5GAM g;  4X34 A;  2XG8 D;  2O01 E;  2OTL A;  5AYF A;  3BFM A;  4BBS M;  4BDZ A;  1VIE A;  2EWN A;  2AHJ B;  2WAC A;  5D6X A;  4C8Q G;  4MDX A;  2V8I A;  2CZ0 B;  5A0D A;  5KCO A;  3CCU T;  4M78 G;  4IKF A;  3OBY A;  3CCQ A;  1BIB A;  1M90 C;  4PJO C;  4HCZ A;  4LDU A;  1QW1 A;  2CZ7 B;  3A8O B;  2KAF A;  2LQ8 A;  4IUV A;  3RUX A;  1VQ6 A;  5GAN d;  3G71 A;  3J7A F;  3QKJ A;  1BI0 A;  3OYF A;  1VQ4 T;  1I4K 1;  4BE2 A;  4RKU E;  3RMQ A;  5GAM j;  4ZGE B;  1VIF A;  4MZT A;  1M9S A;  2E12 A;  5HY6 A;  4ATO A;  3RMS A;  3UT1 A;  4A4H A;  1G3W A;  1EIF A;  4Y91 A;  3L2Q A;  4N0A C;  4PJO A;  2BIV A;  3C4S A;  3CCE A;  1WJS A;  4M78 B;  5IN1 A;  1QVG A;  5DLO A;  3MP6 A;  1KC8 C;  2DZC A;  2JZ2 A;  4FM4 B;  4PJO B;  3VUB A;  3OS1 A;  2HNI A;  4C92 C;  4XTU A;  3RES A;  3ZEH A;  4M6V A;  1K9M C;  4M7D D;  1VQK A;  3QXE B;  2VXE A;  4N0A A;  2MMP A;  4M75 F;  3FC3 A;  3BG5 A;  4OVA A;  3TEE A;  5J39 A;  5I2S A;  4A4F A;  1YHQ A;  2X4Y A;  4JJN K;  3RER A;  4FL6 A;  3E9F A;  4KUI A;  3OYM A;  3UPU A;  4C92 A;  3MCA B;  3OBW A;  4OP0 A;  5LJ5 h;  2QQ8 A;  2I2L A;  1I81 A;  2RI3 A;  3I56 T;  4Z02 A;  2K4Y A;  4C92 E;  3MHX A;  4IUP A;  1H64 1;  3QJY A;  5GAO m;  3C12 A;  3OYY A;  5J3B A;  1YJW A;  4J7I A;  4BI4 A;  2LQK A;  4M77 D;  1QP3 A;  5LJ5 g;  2RJF A;  1M90 U;  1FKM A;  5CK9 A;  2QEX T;  2QA4 T;  3VYH B;  1WPY A;  4HLQ A;  5CIU A;  2E6Z A;  4KBM B;  1O9S A;  3GPL A;  2LTO A;  3M56 A;  4AI6 A;  4ZGJ B;  2KMT A;  1AHJ B;  3EFR A;  1QLB A;  2DZ9 A;  5KE2 A;  3QJ6 A;  1VQO A;  3OYD A;  3OYC A;  5GMK m;  4NOY A;  3M4G A;  5LJ5 j;  2X35 A;  3VKI A;  1YIJ A;  3MET A;  3LGL A;  4PJO F;  1WJQ A;  4KUL A;  2VUB A;  1M1K C;  4R56 A;  4LD9 K;  3JB9 H;  1K9M U;  2Y90 A;  2DTH A;  2DD5 A;  1N6A A;  3WXM B;  3CPF A;  4C0F A;  5CQY A;  2BS2 A;  2KDS A;  4AKI A;  3F70 A;  3CBP A;  2DAQ A;  3OS2 A;  2A3L A;  1YBY A;  4PL6 A;  4L5G A;  4Z6Y A;  1OYX A;  1UGP B;  1K8A C;  4C5H A;  4LDW A;  4BD3 A;  2PVG B;  2HQX A;  3HSB A;  2QF7 A;  1VQL A;  2V8J A;  4IUQ A;  2DVE A;  1WNL A;  1PSE A;  3CCM A;  3ASK A;  3G4S A;  3PTA A;  5LJ3 e;  4C92 F;  4RMO A;  3G6E A;  4V2S A;  2OTJ A;  2CZ6 B;  2QQ9 A;  2RH2 A;  3PFS A;  4TVR A;  3SDZ A;  1Y71 A;  2EYQ A;  2HQE A;  2Y4X A;  3JRZ A;  4XU0 A;  2RJC A;  1S72 A;  1BI2 A;  3CEY A;  4C5I A;  4JRP A;  3CCJ A;  1WQ7 A;  4M7A D;  4RG8 A;  1YJ9 A;  4QQG A;  3PT9 A;  5GMK h;  5GAO p;  4EMG A;  4LOC A;  4BI8 B;  4MIM A;  4BE0 A;  2RB6 A;  5GAN e;  3JCM W;  3HP9 A;  2GQV A;  2M16 A;  2XIC A;  3V8L A;  1YIT T;  4M75 G;  1OI1 A;  4J6W A;  2BS3 A;  2QQA A;  4BBR M;  3CCV A;  2EIF A;  1M1K U;  2L3R A;  3HO8 A;  4JX6 A;  4BUG A;  2XDP A;  4RCB A;  3CMA A;  1VQ9 T;  2YHT A;  4IUU A;  2XI9 A;  2EQU A;  2DJZ A;  2RK1 A;  4J8O A;  3JCM e;  1U1S A;  2F69 A;  1U8R A;  3H8Z A;  2LT4 A;  2MF2 A;  2P0Q A;  3CC4 T;  1K8A U;  3M5A A;  1M1F A;  2GF7 A;  4QQD A;  2JUF A;  1VQ7 T;  1VQ8 T;  5GAM h;  3GF5 A;  2IG0 A;  4XU1 A;  5LJ3 f;  4HNV A;  4DOV A;  1X75 C;  2QI2 A;  5I21 A;  4E7K A;  2RM4 A;  4KUD K;  4L6V 5;  4F7U E;  4A53 A;  4EPC A;  3CBO A;  4O5V A;  3CC2 T;  5HKC A;  2FYK A;  4ME7 A;  5LJ3 g;  3CC7 A;  3V7C A;  3CCR A;  2DIG A;  3JCM P;  3H6Z A;  2WSF E;  3O8V A;  4X9C A;  3VJP A;  3JCM Q;  3JAM E;  2CS7 A;  3JB9 F;  2E70 A;  5D6W A;  1R8O B;  4J5Y A;  2D6F A;  3CD6 T;  3M9Q A;  2VGM A;  3MEV A;  4GLK A;  4BY6 C;  3NTI A;  1JRI A;  3QZ5 B;  2QQB A;  3J80 E;  4AKG A;  2GFA A;  2YLC A;  4XTX A;  4PJO G;  1W4S A;  5GAN f;  4R55 A;  1I5L A;  1Q86 C;  3A8M B;  5I2M A;  5CR2 A;  2XID A;  3CCU A;  1TH7 A;  4CRI A;  1NPR A;  5LJ3 j;  2KSS A;  1ZQ1 A;  3BDU A;  4RG2 A;  4UC4 A;  2F5K A;  5C6S A;  2MI6 A;  1P92 A;  4DOW A;  1UB4 A;  5GAN g;  1VQP T;  2JNG A;  1NZ9 A;  3TRE A;  4II1 A;  2ZCF B;  2BKD N;  1V29 B;  4OB1 B;  2LT1 A;  1VQ4 A;  2CZ1 B;  3DLM A;  2K5L A;  3GNF B;  2VV5 A;  4EMH A;  3JCM f;  2LRQ A;  1W2B A;  4IUR A;  4BY6 B;  3JCM d;  5GAN 5;  2RHX A;  2EJF A;  3HBL A;  3JB9 I;  4M7A A;  3BW1 A;  3L2Z A;  1UGQ B;  4A54 A;  4C92 G;  5GAN j;  4M7A E;  2QFZ A;  1M5Q 1;  4M7A B;  1VQM T;  1YI2 T;  2FVU A;  1VQ5 T;  3VKG A;  3QYB A;  1FXX A;  5LL6 S;  5GAN 3;  1KHI A;  4E47 A;  4LD6 A;  3CXC S;  3VYG A;  1KG1 A;  3HRT A;  1OZ3 A;  1YJN T;  2VXF A;  3RIR A;  1E7P A;  3FLG A;  3QPH A;  4XTW A;  2B8A A;  2RHI A;  4XAX B;  5FU6 C;  5IT9 E;  1KQ2 A;  2XU8 A;  3VYG B;  2CGH A;  2EJG A;  3UWN A;  4C92 B;  3M59 A;  1VQN A;  3OYI A;  3LH0 A;  2ZGW A;  3HFN A;  3FB9 A;  2FL7 A;  4ZN1 A;  3CME T;  4JLI A;  3I56 A;  2F5T X;  1N8R C;  3FIF A;  5GAO q;  2P0K A;  2ZPI B;  4A4E A;  3OYE A;  1VUB A;  1Q86 U;  5CO7 A;  5CKD A;  3EAE A;  5DY9 A;  1FWZ A;  4CI0 C;  2ZPF B;  3HFO A;  3OYL A;  4E7L A;  2E10 A;  3RKX A;  1HK9 A;  4C0G A;  5GMK i;  3OYK A;  2QEX A;  5FU6 B;  2QA4 A;  4ZN3 A;  3TW7 A;  3OYN A;  3ZBD A;  4JRQ A;  2ZPH B;  2PUO B;  1IZ6 A;  4KT0 E;  4QVZ A;  3MEU A;  3DB4 A;  5J26 A;  3QYE A;  2DPP B;  2G77 A;  1DJ7 B;  5A0G A;  1KC8 U;  1XOV A;  4PNO A;  2CYZ B;  2DEQ A;  2LNV A;  1JJ2 S;  3OY9 A;  3NFC A;  1WGS A;  4J6X A;  1G3Y A;  1NE8 A;  5CQX A;  2GCX A;  5D6Y A;  3GOX A;  2E6N A;  5GAN 2;  4BE1 A;  4EMK C;  2JVV A;  3JB9 G;  4LDX A;  4M7A F;  3PNW C;  1ZBX A;  2DD5 B;  3CXC A;  4M7D C;  3N5B B;  1M1G A;  2KVQ G;  4HA8 A;  3JB9 J;  5CKF A;  4ELJ A;  2L8D A;  2VC8 A;  4C5G A;  2M1H A;  3S3O A;  5KCH A;  2FB7 A;  5FRO A;  3HPW A;  2XKO C;  3TCJ A;  1G3T A;  3DB3 A;  4EDU A;  4EMK A;  2M0O A;  3V8K A;  3WVD B;  1FX7 A;  4QSH A;  2XK0 A;  3MO8 A;  3X28 B;  4HNU A;  3KBG A;  3FDR A;  3GLX A;  3V7S A;  3CCL T;  4M7D A;  4N4I A;  4EMK B;  1N8R U;  2KK4 A;  5GAO n;  4MFD A;  2QQR A;  1I8F A;  2DIQ A;  4BDY A;  2D9T A;  4M7D E;  3T9N A;  4M7D B;  3KUF A;  3QBY A;  3SD4 A;  4BI3 A;  4MFE A;  1LOJ A;  3HHT B;  4M77 C;  3VUZ A;  3KXT A;  3BDL A;  3V7R A;  4E7J A;  2RJE A;  3J81 E;  2R5A A;  2WSC E;  4PKC C;  3M55 A;  5GAN 6;  3E1S A;  4OF1 A;  1LNX A;  2RK2 A;  2BUD A;  2FHD A;  2EAY A;  2K57 A;  4O6J A;  1ZHI A;  3OYA A;  4C8Q D;  3H4C A;  1K73 C;  1JJ2 A;  4M77 A;  4MDW A;  3LX7 A;  3C95 A;  2X4W A;  3A8G B;  4M78 D;  5GAM e;  3HRU A;  4D6W A;  2X4X A;  2MWP A;  1LJO A;  3X24 B;  3JCM J;  1WQW A;  4C0Z A;  4ZTJ A;  1YIT A;  4PJO D;  4M77 E;  4F7U G;  5FRM A;  4M77 B;  3A8H B;  5A0L A;  2ZPG B;  1RL2 A;  2G3R A;  2LVM A;  5GMK l;  3I55 T;  1W2B S;  3P8D A;  2R58 A;  4GY5 A;  4PLI A;  4VUB A;  4HNT A;  3E19 A;  2EQK A;  3OS5 A;  1VQ9 A;  3QII A;  3DL1 A;  1G5V A;  5CKH A;  5LJ3 h;  4F7U A;  2RJD A;  3RKY A;  3LW5 E;  3S3M A;  1BKB A;  3GIB A;  1N9R A;  3ME9 A;  1Q82 C;  3CC4 A;  4F7U F;  2K2V A;  4F7U B;  3P8B B;  4OMF B;  1VQ7 A;  4NL2 A;  1VQ8 A;  3OB9 A;  4NS5 A;  2BS4 A;  2O4X A;  3M58 A;  4HKE A;  5HK0 A;  3MP1 A;  4PLL A;  3OYB A;  1IRE B;  3L2W A;  3CCS T;  3QYG B;  1KD1 C;  1M8V A;  2PVO B;  4WF2 A;  4JS4 A;  4JS5 A;  3PMI A;  3CC2 A;  2O4X B;  1JBM A;  1Y07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...