3A8LB

Crystal structure of photo-activation state of nitrile hydratase mutant s113a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8lB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8lB02
1UGQB 4OB3B 3WVEB 3LW5E 4KT0E 2ZPFB 3X20B 2PU9B 5L8RE 4ZGJB 1UGPB 1IREB 2AHJB 1PSEA 3HHTB 2ZPEB 1GXIE 2PVOB 2CZ1B 2CZ7B 3X25B 2WSCE 1UGSB 2DD5A 3QYHB 2O01E 1JB0E 2DXBB 2D0QB 2WSFE 4OB2B 1QP2A 3A8HB 2DPPB 3X26B 4XK8E 4L6V5 3QZ9B 3VYGA 3A8LB 4ZGDB 3WVDB 2PVGB 2DD4B 2ZPBB 2DXCB 2DD5B 3QZ5B 3A8GB 4Y28E 4RKUE 2CZ0B 2PVDB 2PUOB 4OB1B 2ZZDA 3X28B 2ZCFB 3QXEB 3VYGB 3A8MB 4FM4B 4ZGEB 2ZPGB 2CYZB 2ZPIB 1V29B 3X24B 2QDYB 3VYHB 2ZZDB 2ZPHB 2DXBA 2WSEE 1PSFA 3QYGB 2PUKB 1UGRB 1DJ7B 3A8OB 4OB0B 2DD4A 2CZ6B 1QP3A 1AHJB 2DXCA
chains in the Genus database with same CATH superfamily
2KT8A 4QQ6A 4DEXA 3QKJA 4GBQA 3GBQA 4QT7A 3PVLA 5CCAA 2DETA 1F5QB 3VS1A 4F6SB 1M9SA 1BI2A 1K76A 2JXBA 2F69A 2LDMA 3TVTA 4E7IA 2QA4Q 2FPEA 3A5ZB 3CPWP 2KK4A 2X9HA 1O9KB 2HQHA 4CFMB 5I2SA 2DAQA 4MFEA 1TFBA 3ZBDA 5KYYA 2RI2A 3EG2A 1HYOA 1RABB 2YUQA 5GANd 5EC7A 2SRCA 2EYWA 3I56A 3EJ1B 4AKGA 3RDVA 5A0LA 3DKMA 3OYMA 1GBQA 2H3JA 2P4RA 1FYNA 4RTZA 1M90C 2D0QB 2QASA 5LJ3e 3TNHB 3WVDB 3RKWA 3MEAA 1VQKA 5LJ5e 3QYEA 4OP0A 5GJVB 2E3IA 1WHGA 2EKHA 3HRSA 4Z88A 2K5IA 4EPCA 2PVDB 2D6FA 2PUOB 4HNVA 2KSSA 1VQPT 1KG1A 2R57A 2CP5A 1WGSA 4J83A 3CCVA 3QSUA 2W99A 2KI7A 1YWOA 5KYWA 3CCMA 4O5VA 4J9CA 1YIJA 4CC2A 4RG2A 4KH1B 4OMQA 1R0CB 2RPNA 1GCPA 2QTVA 4UC4A 2DRKA 3DJBA 2E12A 2QQSA 4NOYA 4KRDB 4JRKA 4M75D 2FHDA 1IGUA 2BE7D 2JS2A 4E7HA 1UDLA 2HNIA 2ECZA 4C0DC 2ZZDB 1S72Q 4AFSC 2VWFA 1KXUA 2AZSA 2MIOA 5CQXA 1K0SA 3H0HA 4A4EA 3M0PA 3QBYA 3OW2S 1W2BS 3MEUA 1K73U 1H8KA 3I56T 1OGUB 3BG5A 2A7YA 3B57A 2LQNA 1QVGP 2RQTA 3HBLA 3LW5E 4C92A 3KBGA 1WHJA 2BZXA 1YI2Q 2IW8B 4M6VA 4C8QE 1VQKT 1PHTA 8ATCB 2L8DA 3CC7A 1VQ5A 1B34A 4E7ZA 1AZGB 2HSEB 1F1BB 4GY5A 2EKOA 5LJ3j 1NJIU 3CC4A 2HL3A 2PTKA 4JJNK 2KEAA 2V8IA 3H0IA 5LJ5j 2EGCA 1MUZA 1IHVA 4F7SB 2OAWA 3QYHB 1MMNA 1PKSA 2V1QA 3IQLA 1RLPC 3ME9A 3SDZA 3CCMT 1YIJT 3OYHA 1H27B 3MI9B 1YCSB 3V8JA 5IHKA 2WSFE 2RA2A 4RCCA 2JNGA 1Q7YR 1SRMA 1Q82U 3M0SA 5CYIB 1K9MR 2B86A 1AWWA 4MZTA 5HVYB 1U5SA 1D3BA 2X4JA 2O9SA 2EYQA 3CBPA 4PJNA 3S3MA 2UZBB 4XTZA 1D0YA 3VS0A 3VKGA 1T3SA 4BDZA 2LT4A 3CCLT 4HCCA 3QPHA 5M9OA 4QVCA 1FVVB 3OBYA 4FT4A 2YT6A 2HSPA 1D3UB 3UATA 3UT1A 3NTIA 1TXQA 1D1BA 2DKGA 2L3QA 3VS6A 5C0MA 5ECAA 1FKMA 2XDPA 5CQYA 5KYYB 2RH2A 2CYZB 4OMPA 4ELYC 3G71Q 2EAYA 2HCKA 1JO8A 1ZA1B 1UNGD 4CC4B 1GFCA 3LH5A 5GMKm 3G6EA 1WA7A 2DXBA 1H28B 1BCMA 1MGQA 3JRZA 3CC4T 2A0FB 3JCMW 4DQ2A 2IN3A 4M7DF 3CMEQ 4CI0C 1YP5A 2EUFA 1QW1A 2OJ2A 3EGXA 2BIVA 4RTTA 4QKUA 3JCMP 2K9GA 1QWEA 3PNWC 1OU9A 3EGUA 2FEIA 5CK9A 3EOCB 3FJ5A 4LN2A 3P8BB 2XDDA 1XNIA 1Q81R 1X75C 4C8QD 4D8KA 2ZPFB 1YJNT 1PRMC 5GMKl 5GAOn 1M8MA 2C5VB 4FW1A 2QAZA 4WF2A 2OTJA 2C0IA 5L8RE 3TREA 4BDYA 5KYWB 1BKBA 4M77B 3OBWA 3SD4A 1M1GA 3OSSC 4EC9B 1ARKA 1UTIA 5CR2A 4QVDA 1QQJA 1ZA2B 1UGSB 2E65A 3QJYA 3VS2A 4JS5A 3ZL7C 4PJOA 2O01E 5A0DA 9ATCB 3FDRA 4J6XA 3LYIA 1YITQ 4JLIA 3RKYA 2P84A 1WX6A 5GANg 1AZEA 2F5TX 3I9QA 2LCLA 5ACBA 1RUWA 4JZ4A 1KC8U 3A8LB 1Q7YC 1X6GA 3VUBA 1K9MC 2WHBB 1Q86U 3QDFA 3G1JA 2M0OA 5DLQE 1KK7A 3NFCA 3CCSQ 2DL7A 2X4YA 1RAFB 2XG8D 2P0KA 1N9RA 4C92B 1AT1B 4J7IA 5GAN6 3MPUB 1H24B 4JX4A 3QJ6A 3OMGA 2C5XB 4ELZC 1B34B 4CFXB 4JX5A 2RJCA 3JCMc 2AZVA 2QEXT 3MIAB 1E7PA 2NUPA 5FU7B 1YJWA 3KFVA 2QQ8A 4M7DE 1A0NB 3X24B 2QDYB 3PIOA 1KD1R 1X2KA 2OTJT 2FG0A 2K6DA 1KQSA 5IAYA 4NL2A 2NYSA 4ZTFA 1RADB 2H3EB 1YJ9Q 2KMTA 2JUFA 4BCJB 2JJ9A 5GAN7 3MHXA 4C8QC 1NBEB 1SEMA 4F7UB 2IIMA 3CPWS 1D3BB 5GAN8 1VQ6Q 2DZCA 2E70A 3CCJA 1UGQB 1VOMA 2LP5A 2D1XA 3FC3A 3RKXA 2HQXA 2EQIA 3DLMA 3THKA 4HLQA 2RQVA 4M78G 2IPOB 2C5NB 1LNXA 3M56A 4KT0E 2JS0A 1QMZB 4Y72B 1M2VA 1OZ2A 2DM1A 1Q81C 2PU9B 3UPUA 2ED0A 5GMKi 2AHJB 1ZSZC 2EPDA 3CBOA 2VB6A 3GTMS 4ZN3A 2EYXA 5EJCA 2E6ZA 2KDSA 4Z02A 2LQKA 4RMOA 3QYBA 2Z0WA 3UA6A 1VYUA 2CKKA 4EOOB 2KAFA 1X6BA 2X4WA 4ZN1A 2O88A 4M7AB 4JUVA 2DF6A 3CCQQ 1LVKA 2DXBB 4PJJA 1JU5C 4V2SA 3JV3A 3OB9A 4M78C 2EJ9A 1T0JA 2KYBA 4WTOB 4M75B 3CC2A 2EQMA 1S1NA 2W96A 1VUBA 3EGXB 1QCOA 3POMA 3EIDB 4EOKB 1MV3A 2X3WD 3PVQA 1VQ4Q 1AD6A 1D09B 2D9TA 2LMJA 2CDTA 4E6RA 1ZBJA 3CCJT 4R56A 4KULA 2RHXA 1VQ8T 3CCUQ 2JTMA 3RESA 3LX7A 2DEQA 5LJ3d 4IMYB 1VQOQ 4M7DD 2X35A 2CP0A 5LJ5d 5FRNA 1K8AR 3I55Q 5D6WA 3VYHB 2GFAA 1Z9QA 2CCHB 2FZKB 3CCRT 1KD1C 3HB9A 1D1CA 2DBKA 4X34A 3REAB 3QYGB 5HK3A 4FYXB 2VXFA 2JOYA 4EOSB 3BLHB 1N8RU 4MZPA 2QGGA 1GCQA 3BG3A 3M0RA 3VU3C 4A4HA 3TQ7P 1TSFA 2CT3A 2DXCA 4J9FA 5FROA 1VQ9Q 4LDXA 2AT1B 5LJ5h 2XMFA 1Z9ZA 4E2FB 4EORB 2CGHA 4EMKA 4AT1B 1E6HA 3X20B 4BI4A 2KRSA 4ZGJB 5KCOA 4AG2C 1GFDA 2RK1A 3CD6T 1X69A 2NUPB 3NHNA 1Y57A 2PVOB 3BY7A 2ABLA 4EONB 3PFSA 1KHCA 1BU2A 2DK3A 1W6XA 4YC3B 4BXXX 4BCQB 3NGPA 2OX7A 3QG1A 2QQ9A 8AT1B 2A28A 3BLRB 3OYIA 4FYVB 4LNPA 3BHVB 1VINA 4J6WA 3M53A 2NUTB 5KE2A 2KRNA 3HP9A 1E9HB 4KBMB 1CKAA 1OKWB 2I2LA 2LNHB 2Y4YA 3CEYA 1GBRA 3OA6A 4EC8B 1Q95G 4A4KA 1NE8A 1EFNA 2CP2A 3V8KA 1X01A 3OY9A 2ZZDA 3E9GA 4PLIA 5DLOA 2PK2A 4BCHB 1G83A 3VYGB 1AWOA 2MMPA 2C0OA 2VC8A 4J9IA 1VQPQ 1V29B 3TNWB 1WHHA 4FW2A 2B8AA 4QVZA 1K8AC 2E1HA 5J39A 3FRNA 4JLGA 3LWIA 5I5ZB 1GL5A 2HBPA 3I5RA 5CO7A 1QVFA 5IN1A 4C5IA 2FVUA 1KQSP 4LXCA 2DMEA 3RGFB 3OS1A 2EGEA 2DXUA 2KVQG 1BI3A 2RM4A 2YUPA 2A3LA 5LJ3f 1M3AA 1U8RA 3RIRA 1OIUB 1H641 3HL8A 3RBBB 5LJ5f 5GAOp 3I56Q 1BCOA 2WACA 1SKUB 4XU2A 1PSEA 3HHTB 5J3BA 4Y91A 3TCJA 3TW6A 3V7RA 2D0NA 2AIRB 4FYWB 4IURA 3SB2A 2LTOA 2RNAA 2DX1A 2DL3A 2F5KA 3P8HA 1VQKQ 1ZSGA 3ER0A 1JB0E 1QKWA 1Q82R 4BB7A 4EDUA 4IUQA 3QZ9B 2GBQA 1JJ2S 2VV5A 3E2UA 1PRLC 2PVGB 3EFRA 4HA8A 2DL4A 3EFOB 5FRMA 2DXCB 1ZP2A 3CCMQ 4JDSA 4BE0A 4C8QF 4TTHA 3M59A 1ABOA 2CZ0B 5D7UA 4E7JA 3ZFJA 5CAIA 3BE3A 4L59A 2PMIB 4EMKB 4RUGA 3RERA 2K57A 1WDXA 1OPKA 3PMTA 2LJ3A 3G4SA 2DVJA 4BE1A 1R0BG 1O75A 2YDLA 3C95A 4ROEA 3R6OA 4X1VA 2LCSA 3QWYA 3FLGA 2RHIA 3MCAB 4OMOA 3CCLQ 1IO6A 2C5OB 2ZPIB 3REBB 3CMAA 2OI3A 1XOVA 5LJ3g 4LE9A 4MDWA 4Y92A 2IVWA 1K9AA 1KHIA 2LNVA 3EH2A 2DYBA 2AKLA 2CP3A 1FMVA 2HQEA 3MO8A 5LJ5g 4XU0A 1RAIB 3OQ5A 4OB0B 3WXMB 4M77A 2DD4A 3QHRB 5I11A 1H1QB 2DMOA 1WNLA 4M78F 3JSCA 3KXTA 2QA4A 2R5MA 2CS7A 3CC4Q 4J8OA 2WIHB 4R55A 4CC7A 1M90U 5FU6C 2K2MA 1R8OB 1UGPB 3L2RA 3CPFA 2XI9A 3DTOA 2DLPA 3HZJA 2LX7A 2EBPA 1VQ7Q 3DL1A 3VS5A 2OAUA 2L3RA 4BY7X 2WSCE 1H1SB 1YJNQ 2GF7A 3CXCA 2MI6A 3G4ST 2DNUA 3JCMb 2V1RA 2YLCA 2R58A 1OZ3A 5GAN2 1WHKA 2FRWA 3DB3A 3L2ZA 2JM9A 1OIYB 1GH6B 1ABQA 4E7LA 1JXOA 3HO8A 5IT9E 3M5AA 1IGQA 3AT1B 2CP7A 4HKEA 3C4SA 3CCVT 5IDNB 1GUXB 1VOLA 3Q1JA 5KYXA 1OX8A 5FLXE 4FT2A 2DIGA 4OMLA 1JRIA 2JTEA 2DXTA 1AWXA 5KH6A 1J3TA 2X1NB 3UF4A 2FRYA 5KCHA 1U06A 3PO3S 4RODA 1ZUKA 2YHTA 4F7UA 3OYFA 3OYBA 2K79A 2QA4T 1MNEA 1I5OB 5KYUB 1S72A 2W10A 2RJDA 1X6OA 3URGA 4BCKB 3TU4K 3QWLA 4CRIA 2LRQA 1YHQA 3MKDA 3L2WA 2KT1A 4E7SA 5IHYA 1YWPA 2D8JA 2K5FA 1RLQC 2EQUA 2ATCB 4M78E 2YRCA 4BCIB 1M30A 1B7TA 1DJ7B 2QEXQ 4E7KA 1M3CA 2FZGB 3SFMA 1MMDA 1Y7XA 2M9UA 5D6XA 1H3HA 4JRIA 2E6NA 1UJ0A 1IB8A 2COZA 2DL5A 2OTJQ 1FXXA 3V7SA 1VIEA 2O4XA 3EHRA 4YOOA 2GFUA 4IIOA 4M7AA 1VQ5T 3CC7T 1WXUA 1OEBA 1M2OA 2ED1A 5GAMe 4PJOG 1RAAB 1TUGB 3BDUA 4OGRB 2L5QA 3M03A 1X27A 4EMHA 2RQWA 4M75A 1RI9A 1MV0B 3DOGB 1M3BA 2MAMA 2JGZB 4ELJA 1ACMB 3V7CA 3EG1A 2K4YA 2DJQA 3E1SA 1UNHD 1M8VA 3TEEA 2XD0A 1U1TA 2CH4A 4E47A 2RJEA 1SSFA 4ESRA 3AHUA 1SF9A 3X26B 3I5SA 4L6V5 4PJOC 1GY3B 1M1KR 1W70A 2DD4B 1AISB 1YHQT 2ZPBB 4YOZA 5HBEB 4HCBA 4MMLA 4RTXA 4FSXA 4QSHA 5I2MA 4BY6C 2BS2A 4Y28E 4DBRA 1PKTA 1NM7A 3QDRB 1YNZA 3TN8B 4IUUA 5L2WB 2RB6A 2F2CA 1V76A 1NLOC 1WHLA 1VQNQ 4MZMA 3G71A 4AMCA 2KQWA 1NYGA 1WI7A 1PC0A 2P0PA 2BKDN 4XU3A 5GANe 1RAEB 3G6ET 1K1ZA 4FL6A 1N4MA 1UGVA 4CXAB 4DEYA 2QQRA 3CMEA 1KSWA 1RACB 2MK5A 3JCMJ 4M78D 2BZYA 2PHGA 2EYZA 1VQ8Q 3META 2J7IA 3MJXA 1JKWA 1CKBA 1M27C 4N0AA 5A0GA 4C0DB 1HXDA 3MEVA 1JSUB 2UZLB 1G3SA 3H41A 2C6TB 3VJPA 5IH2A 1B3QA 2WMBB 2EJFA 2DYIA 3CCRQ 4DOVA 5FWBA 2EQJA 4J9EA 1NG2A 5KYXB 1UHCA 1WJRA 1M4ZA 4PK4A 4JPBW 3M55A 1ZX6A 4YOSA 1LPLA 1Q7YU 2QDJA 5DY9A 2NUTA 4HXJA 5BNJB 1JQQA 1K9MU 1YITA 2UZDB 3LQ5B 2F2XA 3TW7A 1MHNA 2CZ7B 1I0CA 2EWNA 3LGFA 4Q5WA 3EG0A 1HSQA 1G3TA 2G3RA 1VQMA 1WZOA 1NLPC 1WYXA 4AKHA 3BDLA 3CD6Q 2PK9B 3UWNA 2GNCA 1BK2A 4HCZA 1JXMA 3VYGA 2DJZA 3I35A 3K7AM 3S6WA 2F2WA 3CXCP 3OS2A 3CCSA 3VS3A 2DBMA 1M1KC 2O4XB 1TUDA 2V8KA 3LH0A 1VQLQ 1OI9B 4C8QA 1TOVA 4ZNXA 3QZ5B 3HRTA 4BI3A 3BG9A 3KHIA 4BCPB 4BI8B 4F70B 4OMNA 3GLXA 1BB9A 1BIBA 4XTUA 5FWCA 3X28B 1AEYA 2LJ0A 2EGAA 1YJWT 1ZQ1A 2LC4A 2L89A 1WXTA 3JAME 2R5AA 4BCOB 2W9ZA 4HT8A 1W98B 1YJ9A 3U23A 3CPWA 2HZYA 1ZSZA 1TTHB 4C0ZA 4IIMA 4PLLA 4JZ3A 1VQ6A 3DDQB 3VRYA 1UGRB 5HBJB 3JCMh 1Q81U 4HT9A 1UHFA 5CKBA 2HMAA 2HKNA 3M4GA 4GLKA 3OYJA 2G77A 1UG1A 3C12A 3MP1A 1VQMT 2JM8A 2JMAA 4OF1A 3EFSA 2WIPB 1BYMA 3UDCA 2QK0A 3BHTB 2I40B 2ROLA 3FB9A 1WJQA 5CKFA 1I4K1 2YLBA 3EGDA 3OYLA 2GTJA 1QVGS 2LCCA 4C0FA 1ZUUA 3JB9J 4OMMA 5HCKA 2DL8A 5CKHA 1C1AA 2W2HA 5HY6A 4FCYA 3G33B 2GQIA 4A4GA 4XQ3A 1IXDA 4CFVB 3EFOA 1VYWB 1P5EB 2UUEB 4DBHA 1WHMA 2OTLQ 2JMCA 4OGEA 4FX3B 1EIFA 2FO0A 4M77E 3ZEHA 1T0HA 2EQKA 2ESWA 1EZZB 5GAOm 2HL5C 2G9XB 2RI3A 3CC2T 4NL3A 1NPRA 2WJ9A 3A8HB 4EIKA 5KYNA 4KUDK 1M5Q1 5ICPB 3NPFA 2CH4W 5GAN5 4MDXA 2J6KA 1X43A 1C9BA 4A53A 1UUEA 3D7SB 5I22A 1RAGB 1VQ6T 1PG5B 2LZ6B 3SHWA 1JSTB 2K3XA 4IUVA 1Y71A 1G3WA 3CCUA 2WXVB 2FYKA 3SWNA 1KD1U 5GAOl 3C0CA 2DO3A 2DTHA 3TSZA 1RL2A 4DA4A 4EOPB 4RTVA 4IKFA 2DIQA 4C92E 3QO3A 2DRMA 1H26B 1LCKA 4RTUA 4RTYA 1N5ZA 2YSQA 5GMKe 4BUGA 3CCEA 5C6SA 2QGFB 3QWXX 1SRLA 2VGNA 1I5LA 3GNGA 1SSHA 1PM3A 2X51A 2GTOA 1VQ9A 1VYVA 3INZA 2J06A 2M1HA 3H9NA 3BFMA 4OMFB 2LVMA 3JCMQ 1QP3A 2X3XD 2E64A 2XU8A 4N4IA 4LDUA 4C8QB 4EMGA 4OB3B 4PJOF 2DFUA 2KGTA 1M1FA 1H1PB 3BLQB 2RF0A 3E19A 1K73R 4M7DA 2C0TA 2WEVB 3NTHA 3NDQA 1TG0A 1Y96A 2VASA 4C5HA 4ZTJA 1ZSZB 3ASKA 2M0YA 1R77A 2A37A 1GUXA 2HAXA 1IRXA 4AFQC 4BBSM 1KQ1A 3QHSA 4M7AE 3NTKA 3LWHA 4KH0B 2DPPB 4XK8E 3MP6A 1NJIR 1AOJA 3CCET 3OSVA 2EVRA 3G4SQ 4PFZA 5KYUA 2A36A 4WCIA 2LQWA 2SEMA 2I53A 2E5QA 3EGDB 4AKIA 5HKCA 1K8AU 4OVAA 2RHZA 2MWPA 1QCNA 4OB1B 2PQWA 4Z8AA 2G6FX 4AI6A 3JCMe 1BI0A 1WLPB 1UE9A 4FIBA 5GAMh 4RCBA 4C92D 1VQPA 2RJFA 1G5VA 1TS9A 2RQUA 1P92A 1FMWA 2RHYA 4LDVA 5D6YA 3CCVQ 2WFYB 1OPLA 2E4HA 2QQAA 4II5B 1E7OA 2BE9B 2NLUA 2J6OA 3QHWB 4M77G 3J80E 3M4YA 1YIJQ 1PD0A 5HNBB 1UNLD 2L0AA 4J9GA 2F1LA 1ZLMA 3TSWA 2A08A 3PMIA 1QCFA 4PJOE 2YXYA 4CFNB 4F7JB 2RD1A 4NS5A 4N4HA 2K5LA 3PGGA 4F14A 4TVRA 2YUOA 4B9XA 1JBMA 3WVEB 5GAN3 2VVKA 2E41A 4L5GA 1T3LA 2W0ZA 4M77C 1HK9A 4F6UB 4YTLA 1G3NC 3SWNB 5DM7R 2XIDA 4DBFA 4BCMD 1U1SA 4AFUC 4C92G 1BU1A 1K73C 2JTFA 1WQWA 2EYYA 2LQ8A 4KGXB 2CJMB 4ATOA 3JB9G 3CXCS 2BS4A 2GCXA 1VQ5Q 3CC7Q 4F7LB 1JJ2A 4D8DA 3X25B 5GANh 1TU0B 5CVIA 1G2BA 2IG0A 2AK5A 1OX9A 4AG1C 4M7AD 4OR5B 2KYMA 4OB2B 1OQKA 4XTYA 2K3YA 2M16A 1PWTA 3OYEA 5KE3A 4FU6A 4XAXB 1NJIC 1N27A 1KJWA 4C92C 3EHQA 4F7UG 2DD5B 3MY1B 1UEBA 2L3PA 3GIBA 4Z89A 2JW4A 3A8GB 2BTTA 3G7ZA 1OL1B 3C94A 3EAEA 3OYGA 1QLBA 1QKXA 1UJYA 5FU7C 3KUFA 4JJBA 5DQVA 1KC8R 2DVEA 3CCLA 3QXEB 1I8FA 2KR6A 1KQ2A 4F6WB 1Q82C 1YHQQ 4M7DB 5GAOq 1B07A 2ZAEA 1Q86R 4HVWA 3CMAT 1BI1A 1Y96B 2RHUA 1K0XA 1GRIA 4ZGEB 4ROCA 3M57A 4LUEA 5GAMf 3OYYA 1TUCA 2MPXC 2KBTA 2ROTA 3M58A 5GAOr 2EFIA 2JN0A 1LJOA 1W1FA 5HQ0B 4GLMA 5J26A 3OYKA 1SHFA 4PKCC 4M7AG 2AKKA 4PJOD 3DB4A 1BBZA 3V8LA 2QG9B 2VUBA 3JCMg 2HDAA 1TH7A 2X4XA 3G6EQ 4K11A 2CUBA 1OKVB 4MFDA 3OW2A 1W2BA 4OGCA 2KMGA 4C5GA 4M75G 2QTXA 4EOLB 4CFWB 2DERA 2J6FA 3GNFB 2EW3A 4XU1A 4BCFB 2YUNA 1OL2B 4I3ZB 1ZHIA 5AT1B 1VQ7A 3VKIA 4LD9K 4JRPA 4MMKA 4PJMA 4HNUA 2RQRA 2Y90A 4M7AC 1AD5A 2H8HA 1YJNA 2ZPEB 5LQFB 2CCIB 1VYTA 4O6JA 3EG9B 1YI2A 4BCND 1ZBXA 2VYTA 4KUIA 5L23A 2PJQA 4DOWA 1LOJA 4FSSA 3E9FA 4M75C 2BZ8A 1NEGA 1QVFP 2DTOA 1QP2A 4BCQD 2CREA 3CBMA 4VUBA 5GANf 2P0QA 3F5XB 2FL7A 3H4CA 2L2PA 2B9RA 3N5BB 4ANJA 5GAMg 1WIEA 1SG5A 3DLLA 1CSKA 1SPKA 4J9HA 2VKNA 5HBHB 3OYCA 2PZ1A 3H6ZA 4NSTB 3MY5B 3PTAA 3PIPA 1X2QA 3JCMV 4PFPA 1C6VX 3A1PA 2PNIA 2XK0A 2ZCFB 4F04B 2RK2A 1FX7A 2ENMA 1KFZA 2QGSA 1YN8A 2M02A 2LT1A 1S72T 4EOMB 1KC8C 5IXBA 5EFQB 4FM4B 4ELLA 3GP8A 1Q86C 3HPWA 5CIUA 1IZ6A 2JT4A 1YCYA 2ZPGB 1VQ7T 2KRMA 2O9VA 1I81A 2QEXA 4QQGA 1PNJA 1YJWQ 2LW4A 3RMSA 1NZ9A 4MIMA 1FINB 4EOIB 2WSEE 2FZCB 2PUKB 1HD3A 2E5KA 1YI2T 2RMOA 4KRTA 4X9CA 3T9NA 1RI0A 4CFUD 3HRUA 2DILA 4PL6A 1NPPA 2RN8A 1KQSS 1N9SA 1W4SA 1H92A 1UFFA 3M0UA 1XJWB 3M0TA 1C0MA 4N0AC 2KNBB 3GPLA 1H1RB 4A4FA 3CCJQ 2COYA 1N8RR 4F17A 4XTVA 5GAMj 1VQMQ 4CC3A 2YRDA 2MF2A 4BY1X 1PCXA 1G8XA 3QUIA 2YRVA 4DBQA 2W9FA 4AFZC 5FU6B 2VGMA 1GXIE 2CZ1B 2KROA 1D0XA 2O31A 4KGVB 2QFZA 5GMKh 4C0GA 1AWJA 4C5EA 2XDBA 2XICA 1WXBA 5GJWB 1WPYA 4C8QG 4JJDA 4ORZA 2MWOA 3RMQA 4HCKA 4BACA 1JJ2P 2P4TA 2DTIA 4PFOA 4JX6A 3L2UA 5FGKB 2LJ1A 2BS3A 4J7FA 2K7AA 2MOXA 3VS7A 1Y07A 1YFNA 1V1CA 4LUDA 4IUTA 1K4US 1VQNA 4JJCA 3CC2Q 2KY9A 1FMKA 3G71T 2MYSA 2V26A 3H0FA 1I1JA 1Y0MA 4EOJB 3RR6A 4JS4A 2KXCA 1PD1A 3R6NA 3L1AA 4A63B 4M77F 2C06A 2RI5A 3DDPB 3CMET 4BE2A 2O2OA 1VQ8A 3J81E 4IUPA 4LDWA 4BCMB 5GANj 2F2VA 1D0ZA 2FPDA 1G3YA 2RO0A 4PNOA 1NEBA 3H8ZA 1PSFA 2CT4A 1XTDA 2VXEA 3UA7A 3JCMd 3CCRA 4HL4A 2EIFA 1BIAA 2UZEB 5CEIB 2FPFA 2BKZB 5IXFA 1H3ZA 2CZ6B 3GOXA 1HJDA 5LL6S 3S3NA 2KXDA 1ZUYA 4LDYA 2E10A 4KGZB 1WFWA 4B9WA 4C92F 3OW2P 3JB9I 4NC6A 4QW2A 4BD3A 1W2BP 2XKOC 1YITT 1N8RC 3JB9F 1IREB 2QDLA 3QIIA 1OU8A 1OV3A 3P8DA 1VQNT 1MMAA 2E3HA 2QI2A 4HNTA 4HVUA 1M1KU 2FB7A 3CD6A 4M78A 6AT1B 1VIFA 3MP8A 5CKEA 4PJLA 3OS0A 5IDPB 4UN0A 4ME7A 4J5YA 1GCQC 3OMCA 1I07A 2D8HA 2HD0A 3F70A 3JCMX 3CCST 3J7AF 2LX9A 2K2VA 1VA7A 1RAHB 1VQLA 1URCB 4F7UF 7AT1B 2DEUA 3HTRA 4BBRM 1QMCA 3M0QA 4HVVA 5EG2A 3CCQA 4J9BA 4EMKC 3O5ZA 1TWBA 1XO2A 3JB9H 4BCGB 4PJOB 2GQVA 2DE0X 4RKUE 1O9SA 2CP6A 5A2QE 3PT9A 3M54A 3CCEQ 3BHUB 4LOCA 5HK0A 5GAN4 2C4GB 4BY6B 2BUDA 1OI1A 4Z6YA 2KR3A 1YJ9T 1O9KA 4X9DA 4XTXA 5LJ3h 1VQ4A 3EG3A 3SWNC 2DA9A 1WQ7A 3HFOA 1EX4A 3SEMA 5LMKB 2I0NA 2COWA 4J9DA 1FWZA 2CUDA 4FYYB 4M7AF 5I21A 3VV0A 1QVPA 4M4ZA 2ZPHB 2XHCA 1VQOA 2Y4XA 4R0KA 1QVGA 1IHWA 3HSBA 4BCNB 5FW9A 3O0GD 3FEOA 3VKHA 3I55A 4M75F 4M7DG 1OYXA 4JRQA 5DQWA 3PE0A 3L2VA 1OOTA 1E6GA 4B6MA 3L2QA 1VQLT 3LLRA 3VRZA 1H25B 2DZ9A 2WPAB 4II1A 1JEGA 5AYFA 2QF7A 1QVFS 4G6LB 3CCQT 1XQHA 3GF5A 1MNDA 3BW1A 3RNJA 2OTLA 1U3OA 3LGLA 3MEWA 4RG8A 1WJSA 1JOWA 2IW9B 1UB4A 2GGRA 1KIKA 4RTWA 2KE9A 2CSIA 3S3OA 2IW6B 1QWFA 3JCMf 4F7UE 4M7DC 4EOQB 1SHGA 2DD5A 3O8VA 3L42A 3ULRB 1YBYA 1M90R 3OYAA 1PKDB 2NUZA 4LD6A 1M2VB 1VQ4T 5IF1B 2WMAB 1QLYA 5CKDA 3FIFA 1OULA 4ZGDB 3OS5A 1ENWA 4F16A 4KRCB 3M9QA 1N6AA 3CCUT 4CRLB 4A54A 2HEQA 3VUZA 4P5NA 2ZGWA 2JZ2A 4D6WA 4M77D 2HBWA 4J6YA 1VQOT 4QQDA 2M51A 3VS4A 3RUXA 2L3SA 2V8JA 1MMGA 2MCNA 2YWWA 3I55T 4CFUB 2QXFA 3HFNA 2V22B 5GAMd 2R7GA 3A8MB 2JVVA 2NWMA 3HKSA 3TNIB 5IHNA 1H4LD 2EJGA 3NMZC 4M78B 1TD6A 2QYZA 3CQTA 4M75E 5GMKj 3OYDA 1VQ9T 2OTLT 5IHIA 2IVXA 3FJPA 3OYNA 1AVZC 4F7NB 3CMAQ 2K3BA 2J05A 3A8OB 2CSQA 2QQBA 1UECA 4XTWA 1AHJB 3EH1A 4N4GA 3JB9D 1D1AA 3A98A 1NYFA 2HKQB 3EG9A 2BPMB
chains in the Genus database with same CATH topology
4M75G 2QTXA 2EJFA 5LJ5h 4QQ6A 3QKJA 4DOVA 5CCAA 2EQJA 3GNFB 2CGHA 4XU1A 1M9SA 4EMKA 1BI2A 1ZHIA 1VQ7A 1WJRA 3VKIA 1M4ZA 4LD9K 2F69A 3X20B 2LDMA 4JRPA 4BI4A 4MMKA 3M55A 4HNUA 4E7IA 3A5ZB 4ZGJB 5KCOA 2Y90A 2KK4A 4M7AC 2RK1A 3CD6T 1YJNA 2QDJA 5DY9A 5I2SA 2ZPEB 1Q7YU 2DAQA 4MFEA 1K9MU 3ZBDA 1YITA 2PVOB 3BY7A 4O6JA 1YI2A 3PFSA 3TW7A 1KHCA 2RI2A 1MHNA 2DK3A 2CZ7B 1ZBXA 2EWNA 3LGFA 4Q5WA 5HK0A 2VYTA 4KUIA 5GANd 3I56A 4DOWA 1G3TA 2G3RA 4AKGA 5A0LA 1LOJA 1VQMA 3DKMA 3E9FA 4M75C 3OYMA 2DTOA 2H3JA 3QG1A 4AKHA 3BDLA 1M90C 2D0QB 2QQ9A 1QP2A 3UWNA 3OYIA 3CBMA 4VUBA 5GANf 4HCZA 2P0QA 2FL7A 4J6WA 3VYGA 2DJZA 3H4CA 5LJ3e 3M53A 5KE2A 3S6WA 3CCSA 3OS2A 5GAMh 3WVDB 3HP9A 3N5BB 3RKWA 3MEAA 4KBMB 5GAMg 1VQKA 2I2LA 2Y4YA 3CEYA 5LJ5e 3QYEA 4OP0A 3DLLA 1M1KC 2O4XB 3HRSA 2V8KA 3LH0A 3OYCA 3OA6A 4C8QA 2K5IA 4EPCA 3QZ5B 3H6ZA 3HRTA 4BI3A 5GAN4 4A4KA 3BG9A 3KHIA 1NE8A 3PTAA 2PVDB 2D6FA 3PIPA 3V8KA 2PUOB 1X01A 4HNVA 2KSSA 3JCMV 4BI8B 3GLXA 3OY9A 1VQPT 1BIBA 2XK0A 1KG1A 2R57A 2ZZDA 4XTUA 3X28B 2ZCFB 2RK2A 3E9GA 4PLIA 1WGSA 4J83A 3CCVA 1ZQ1A 1YJWT 1FX7A 5DLOA 3QSUA 2LT1A 2LC4A 3VYGB 1S72T 3CCMA 4O5VA 1YIJA 2L89A 1KC8C 2MMPA 3JAME 2VC8A 4FM4B 2R5AA 4RG2A 3GP8A 1Q86C 3HPWA 5CIUA 1IZ6A 4HT8A 1YCYA 2ZPGB 1YJ9A 4UC4A 2QQSA 1VQ7T 2E12A 4NOYA 3CPWA 4JRKA 1V29B 4M75D 2B8AA 1I81A 2FHDA 2QEXA 4C0ZA 4QVZA 4QQGA 4E7HA 2HNIA 3RMSA 1K8AC 4C0DC 2ZZDB 2E1HA 4PLLA 5J39A 1NZ9A 3FRNA 4MIMA 2WSEE 4JLGA 3LWIA 1VQ6A 2HBPA 2PUKB 5M9OA 1UGRB 1Q81U 3JCMh 5CQXA 4HT9A 5CO7A 4A4EA 1YI2T 3QBYA 3OW2S 1W2BS 5CKBA 3M4GA 3MEUA 1K73U 4X9CA 4GLKA 3T9NA 5IN1A 3OYJA 4C5IA 1QVFA 2G77A 1RI0A 2FVUA 3I56T 3C12A 3HRUA 3BG5A 3MP1A 4PL6A 1VQMT 3OS1A 2A7YA 4OF1A 3EFSA 1NPPA 1KQSS 1N9SA 1W4SA 1BYMA 3UDCA 2DXUA 2KVQG 1BI3A 2RM4A 5CKFA 3HBLA 3FB9A 1WJQA 3OYLA 1I4K1 2YLBA 4N0AC 2A3LA 3LW5E 5LJ3f 3KBGA 4C92A 2LCCA 1QVGS 3GPLA 1U8RA 4A4FA 4C0FA 4M6VA 3RIRA 1H641 4C8QE 3JB9J 3HL8A 1VQKT 2L8DA 3CC7A 1VQ5A 1B34A 4XTVA 5LJ5f 5GAOp 5GAMj 5CKHA 2WACA 2MF2A 5HY6A 4XU2A 1PSEA 3HHTB 4GY5A 2EKOA 3QUIA 5J3BA 4Y91A 4XQ3A 4A4GA 2YRVA 3TW6A 3TCJA 5LJ3j 1NJIU 3CC4A 1GXIE 5FU6B 2VGMA 2CZ1B 3V7RA 4JJNK 2V8IA 4OGEA 5LJ5j 1EIFA 2QFZA 4M77E 3ZEHA 4C0GA 4IURA 5GMKh 3SB2A 3QYHB 2EQKA 2LTOA 4C5EA 2XDBA 3P8HA 2F5KA 2XICA 5GAOm 3ME9A 3SDZA 3CCMT 1W2BA 1YIJT 3ER0A 3OYHA 1JB0E 1WPYA 4C8QG 3V8JA 3RMQA 2MWOA 2RI3A 2WSFE 1NPRA 2RA2A 4BB7A 4NL3A 3CC2T 2WJ9A 4BACA 3A8HB 2JNGA 4RCCA 2P4TA 4EDUA 4KUDK 2DTIA 4IUQA 4JX6A 3L2UA 1M5Q1 1Q82U 5GAN5 4MDXA 3QZ9B 2BS3A 4MZTA 4J7FA 1JJ2S 1D3BA 2VV5A 2PVGB 2X4JA 3EFRA 4HA8A 2EYQA 4A53A 1Y07A 3CBPA 3S3MA 5FRMA 2DXCB 4XTZA 1VQ6T 4IUTA 3VKGA 4JDSA 4BE0A 1VQNA 4BDZA 4C8QF 2LT4A 2KY9A 3M59A 3CCLT 2CZ0B 4HCCA 2K3XA 3G71T 3QPHA 1Y71A 1G3WA 4IUVA 3ZFJA 4QVCA 5CAIA 2FYKA 3SWNA 4L59A 3CCUA 1KD1U 4EMKB 3OBYA 4FT4A 5GAOl 3RERA 2K57A 2DO3A 2DTHA 4JS4A 3UT1A 1RL2A 3NTIA 4DA4A 3PMTA 3G4SA 4BE1A 4IKFA 2DIQA 1O75A 4C92E 2DKGA 3C95A 3QO3A 5C0MA 3L1AA 3R6OA 4M77F 1FKMA 2C06A 2RI5A 2XDPA 3FLGA 2RHIA 5CQYA 3CMET 4BE2A 3MCAB 2RH2A 2CYZB 5GMKe 4BUGA 4ELYC 1VQ8A 2EAYA 2ZPIB 3CCEA 3CMAA 5C6SA 1XOVA 3J81E 4IUPA 4LDWA 5GANj 5LJ3g 1G3YA 2VGNA 2RO0A 2IVWA 4MDWA 4PNOA 1I5LA 1KHIA 5GMKm 2LNVA 3GNGA 3G6EA 2DXBA 3H8ZA 1PSFA 1MGQA 2HQEA 3MO8A 5LJ5g 1XTDA 3JRZA 4XU0A 2VXEA 3CC4T 1VQ9A 3JCMd 4DQ2A 3JCMW 3INZA 4M7DF 3CCRA 3OQ5A 4CI0C 2M1HA 4HL4A 4OB0B 1BIAA 2EIFA 1QW1A 3WXMB 4M77A 1H3ZA 3BFMA 4OMFB 2BIVA 2LVMA 2DD4A 2CZ6B 1QP3A 3JCMQ 3GOXA 2E64A 5LL6S 3JCMP 2XU8A 3S3NA 1WNLA 3PNWC 4N4IA 4M78F 4LDUA 4LDYA 4C8QB 3JSCA 3KXTA 5CK9A 4EMGA 4OB3B 2E10A 2QA4A 4PJOF 2R5MA 2CS7A 3P8BB 4J8OA 2XDDA 1XNIA 1X75C 4C8QD 4B9WA 4C92F 4R55A 1M90U 2ZPFB 1YJNT 1M1FA 5FU6C 5GMKl 5GAOn 3JB9I 3E19A 4NC6A 4QW2A 4BD3A 1R8OB 2OTJA 4WF2A 2XKOC 1YITT 1N8RC 3TREA 5L8RE 4M7DA 4BDYA 1IREB 1UGPB 3QIIA 3L2RA 3JB9F 3CPFA 3NTHA 1BKBA 2XI9A 3OBWA 3P8DA 4M77B 1Y96A 3SD4A 1VQNT 3HZJA 2QI2A 1M1GA 3OSSC 3DL1A 4HNTA 2OAUA 2L3RA 4C5HA 1M1KU 2FB7A 5CR2A 3CD6A 4M78A 4QVDA 2WSCE 1VIFA 3MP8A 1UGSB 2E65A 3QJYA 4JS5A 4ZTJA 4PJOA 5CKEA 3ASKA 3OS0A 2GF7A 2O01E 3CXCA 2MI6A 4ME7A 3G4ST 4J5YA 5A0DA 2HAXA 3FDRA 4J6XA 3OMCA 3JCMb 3LYIA 4BBSM 2HD0A 3F70A 3JCMX 1KQ1A 3QHSA 4JLIA 3CCST 3J7AF 2YLCA 3RKYA 2LX9A 2R58A 1OZ3A 2K2VA 3NTKA 5GANg 5GAN2 2F5TX 3LWHA 4M7AE 2DPPB 2LCLA 4XK8E 1VQLA 3MP6A 3CCET 1KC8U 3DB3A 3A8LB 3L2ZA 3OSVA 4F7UF 1Q7YC 4BBRM 5EG2A 3VUBA 4E7LA 1K9MC 3CCQA 1Q86U 3HO8A 4EMKC 5IT9E 3M5AA 2M0OA 4HKEA 3JB9H 5DLQE 4PJOB 3C4SA 2GQVA 3NFCA 2X4YA 2E5QA 4RKUE 1O9SA 3CCVT 2XG8D 4AKIA 5HKCA 2P0KA 5A2QE 1N9RA 3Q1JA 2RHZA 3PT9A 2MWPA 4OVAA 4C92B 3M54A 4J7IA 4OB1B 2PQWA 5GAN6 5FLXE 4FT2A 4JX4A 4LOCA 4AI6A 2DIGA 1BI0A 1JRIA 3QJ6A 4FIBA 2DXTA 4BY6B 3OMGA 3JCMe 4RCBA 2BUDA 1B34B 1OI1A 4ELZC 5KH6A 4C92D 5KCHA 1VQPA 4Z6YA 1YJ9T 4JX5A 2RJFA 1G5VA 4X9DA 2RJCA 2YHTA 4F7UA 3JCMc 4XTXA 5LJ3h 3OYFA 3OYBA 2QA4T 1K8AU 1P92A 2QEXT 2RHYA 1E7PA 4LDVA 5D6YA 5FU7B 3SWNC 1VQ4A 1YJWA 2QQ8A 1WQ7A 3HFOA 1S72A 4M7DE 2QQAA 2NLUA 1X6OA 2RJDA 3URGA 4M77G 3J80E 3M4YA 3TU4K 3X24B 2QDYB 1FWZA 3QWLA 3PIOA 4M7AF 2OTJT 5I21A 3VV0A 2LRQA 4CRIA 1YHQA 3L2WA 1KQSA 5IAYA 4NL2A 4ZTFA 1QVPA 2ZPHB 2K5FA 2XHCA 2KMTA 2EQUA 2JUFA 4M78E 3PMIA 1VQOA 1DJ7B 2Y4XA 4PJOE 4E7KA 1QVGA 5GAN7 3HSBA 2RD1A 3MHXA 4C8QC 3SFMA 4NS5A 4F7UB 4N4HA 1Y7XA 2K5LA 2M9UA 3FEOA 3PGGA 3VKHA 5D6XA 3I55A 1D3BB 4JRIA 4M75F 5GAN8 3CPWS 2E6NA 4M7DG 1OYXA 2DZCA 4JRQA 2E70A 1FXXA 3V7SA 3CCJA 4TVRA 1VIEA 2O4XA 4B9XA 3L2VA 1UGQB 1JBMA 3FC3A 2GFUA 3RKXA 4M7AA 2HQXA 3WVEB 5GAN3 3L2QA 1VQ5T 2E41A 3CC7T 4L5GA 3DLMA 1VQLT 4HLQA 3LLRA 4M78G 4M77C 2DZ9A 1HK9A 4YTLA 3M56A 1LNXA 3SWNB 5GAMe 4II1A 5DM7R 4KT0E 4PJOG 2XIDA 5AYFA 2QF7A 1QVFS 1Q81C 1OZ2A 1U1SA 1XQHA 3GF5A 3BDUA 2PU9B 3BW1A 3CCQT 3UPUA 4C92G 2OTLA 2L5QA 3LGLA 2AHJB 5GMKi 4EMHA 3CBOA 1K73C 2JTFA 1WQWA 4M75A 4ZN3A 3MEWA 4RG8A 1WJSA 2KDSA 5EJCA 1UB4A 2E6ZA 2LQ8A 2LQKA 4Z02A 3QYBA 4RMOA 3CXCS 3JB9G 4ATOA 2BS4A 2MAMA 2GCXA 4ELJA 3V7CA 1JJ2A 3S3OA 2CKKA 2KAFA 2X4WA 3X25B 2K4YA 3JCMf 4F7UE 4ZN1A 4M7AB 5GANh 2DD5A 3O8VA 3E1SA 5CVIA 4M7DC 3L42A 4JUVA 1YBYA 1M8VA 3OYAA 2IG0A 3TEEA 4LD6A 2XD0A 2DXBB 1U1TA 4M7AD 1VQ4T 4OB2B 3AHUA 4E47A 2RJEA 1SSFA 3OB9A 4XTYA 4V2SA 4M78C 2EJ9A 2K3YA 2M16A 3X26B 5CKDA 4L6V5 3FIFA 4PJOC 4M75B 3CC2A 3OYEA 2EQMA 4ZGDB 3OS5A 5KE3A 4FU6A 1VUBA 4XAXB 1NJIC 1N27A 2DD4B 4C92C 1YHQT 3M9QA 2ZPBB 4HCBA 4MMLA 1N6AA 4F7UG 4A54A 3CCUT 4FSXA 4E7JA 4QSHA 3VUZA 4P5NA 2ZGWA 2JZ2A 5I2MA 4M77D 4BY6C 2DD5B 1UEBA 2BS2A 4J6YA 4D6WA 1VQOT 3GIBA 4QQDA 3A8GB 4Y28E 3G7ZA 3RUXA 3QDRB 3C94A 2V8JA 3EAEA 2D9TA 3OYGA 1QLBA 4LDXA 5FU7C 4IUUA 3I55T 3KUFA 2RB6A 2QXFA 3HFNA 2DVEA 5GAMd 4MZMA 3CCLA 3QXEB 1I8FA 2KR6A 3G71A 4R56A 3CCJT 4KULA 1Q82C 5GAOq 1KQ2A 4M7DB 2RHXA 1VQ8T 3CMAT 2JTMA 3A8MB 2JVVA 2KQWA 1BI1A 1Y96B 2DEQA 3LX7A 3RESA 5LJ3d 2P0PA 3HKSA 2RHUA 2BKDN 4M7DD 4ZGEB 4XU3A 2X35A 5GANe 2EJGA 3M57A 5GAMf 3G6ET 3OYYA 5LJ5d 4M78B 5FRNA 4FL6A 4M75E 5GMKj 2QQRA 3M58A 3VYHB 2GFAA 5D6WA 3OYDA 3CMEA 2EFIA 2JN0A 5GAOr 1LJOA 1VQ9T 2OTLT 3FJPA 3CCRT 4M78D 3JCMJ 1KD1C 3HB9A 3OYNA 3OYKA 5J26A 4PKCC 4M7AG 3META 4X34A 4PJOD 3QYGB 3DB4A 5HK3A 2VXFA 2JOYA 3V8LA 1N8RU 3A8OB 2VUBA 4MZPA 3BG3A 1TH7A 2QQBA 2X4XA 4N0AA 4C0DB 1HXDA 5A0GA 4XTWA 3MEVA 3VU3C 1AHJB 4N4GA 4A4HA 3JB9D 4MFDA 1G3SA 2DXCA 3JCMg 5FROA 3VJPA 3OW2A 4OGCA 2KMGA 4C5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGQ B;  4OB3 B;  3WVE B;  3LW5 E;  4KT0 E;  2ZPF B;  3X20 B;  2PU9 B;  5L8R E;  4ZGJ B;  1UGP B;  1IRE B;  2AHJ B;  1PSE A;  3HHT B;  2ZPE B;  1GXI E;  2PVO B;  2CZ1 B;  2CZ7 B;  3X25 B;  2WSC E;  1UGS B;  2DD5 A;  3QYH B;  2O01 E;  1JB0 E;  2DXB B;  2D0Q B;  2WSF E;  4OB2 B;  1QP2 A;  3A8H B;  2DPP B;  3X26 B;  4XK8 E;  4L6V 5;  3QZ9 B;  3VYG A;  3A8L B;  4ZGD B;  3WVD B;  2PVG B;  2DD4 B;  2ZPB B;  2DXC B;  2DD5 B;  3QZ5 B;  3A8G B;  4Y28 E;  4RKU E;  2CZ0 B;  2PVD B;  2PUO B;  4OB1 B;  2ZZD A;  3X28 B;  2ZCF B;  3QXE B;  3VYG B;  3A8M B;  4FM4 B;  4ZGE B;  2ZPG B;  2CYZ B;  2ZPI B;  1V29 B;  3X24 B;  2QDY B;  3VYH B;  2ZZD B;  2ZPH B;  2DXB A;  2WSE E;  1PSF A;  3QYG B;  2PUK B;  1UGR B;  1DJ7 B;  3A8O B;  4OB0 B;  2DD4 A;  2CZ6 B;  1QP3 A;  1AHJ B;  2DXC A; 
#chains in the Genus database with same CATH topology
 2KT8 A;  4QQ6 A;  4DEX A;  3QKJ A;  4GBQ A;  3GBQ A;  4QT7 A;  3PVL A;  5CCA A;  2DET A;  1F5Q B;  3VS1 A;  4F6S B;  1M9S A;  1BI2 A;  1K76 A;  2JXB A;  2F69 A;  2LDM A;  3TVT A;  4E7I A;  2QA4 Q;  2FPE A;  3A5Z B;  3CPW P;  2KK4 A;  2X9H A;  1O9K B;  2HQH A;  4CFM B;  5I2S A;  2DAQ A;  4MFE A;  1TFB A;  3ZBD A;  5KYY A;  2RI2 A;  3EG2 A;  1HYO A;  1RAB B;  2YUQ A;  5GAN d;  5EC7 A;  2SRC A;  2EYW A;  3I56 A;  3EJ1 B;  4AKG A;  3RDV A;  5A0L A;  3DKM A;  3OYM A;  1GBQ A;  2H3J A;  2P4R A;  1FYN A;  4RTZ A;  1M90 C;  2D0Q B;  2QAS A;  5LJ3 e;  3TNH B;  3WVD B;  3RKW A;  3MEA A;  1VQK A;  5LJ5 e;  3QYE A;  4OP0 A;  5GJV B;  2E3I A;  1WHG A;  2EKH A;  3HRS A;  4Z88 A;  2K5I A;  4EPC A;  2PVD B;  2D6F A;  2PUO B;  4HNV A;  2KSS A;  1VQP T;  1KG1 A;  2R57 A;  2CP5 A;  1WGS A;  4J83 A;  3CCV A;  3QSU A;  2W99 A;  2KI7 A;  1YWO A;  5KYW A;  3CCM A;  4O5V A;  4J9C A;  1YIJ A;  4CC2 A;  4RG2 A;  4KH1 B;  4OMQ A;  1R0C B;  2RPN A;  1GCP A;  2QTV A;  4UC4 A;  2DRK A;  3DJB A;  2E12 A;  2QQS A;  4NOY A;  4KRD B;  4JRK A;  4M75 D;  2FHD A;  1IGU A;  2BE7 D;  2JS2 A;  4E7H A;  1UDL A;  2HNI A;  2ECZ A;  4C0D C;  2ZZD B;  1S72 Q;  4AFS C;  2VWF A;  1KXU A;  2AZS A;  2MIO A;  5CQX A;  1K0S A;  3H0H A;  4A4E A;  3M0P A;  3QBY A;  3OW2 S;  1W2B S;  3MEU A;  1K73 U;  1H8K A;  3I56 T;  1OGU B;  3BG5 A;  2A7Y A;  3B57 A;  2LQN A;  1QVG P;  2RQT A;  3HBL A;  3LW5 E;  4C92 A;  3KBG A;  1WHJ A;  2BZX A;  1YI2 Q;  2IW8 B;  4M6V A;  4C8Q E;  1VQK T;  1PHT A;  8ATC B;  2L8D A;  3CC7 A;  1VQ5 A;  1B34 A;  4E7Z A;  1AZG B;  2HSE B;  1F1B B;  4GY5 A;  2EKO A;  5LJ3 j;  1NJI U;  3CC4 A;  2HL3 A;  2PTK A;  4JJN K;  2KEA A;  2V8I A;  3H0I A;  5LJ5 j;  2EGC A;  1MUZ A;  1IHV A;  4F7S B;  2OAW A;  3QYH B;  1MMN A;  1PKS A;  2V1Q A;  3IQL A;  1RLP C;  3ME9 A;  3SDZ A;  3CCM T;  1YIJ T;  3OYH A;  1H27 B;  3MI9 B;  1YCS B;  3V8J A;  5IHK A;  2WSF E;  2RA2 A;  4RCC A;  2JNG A;  1Q7Y R;  1SRM A;  1Q82 U;  3M0S A;  5CYI B;  1K9M R;  2B86 A;  1AWW A;  4MZT A;  5HVY B;  1U5S A;  1D3B A;  2X4J A;  2O9S A;  2EYQ A;  3CBP A;  4PJN A;  3S3M A;  2UZB B;  4XTZ A;  1D0Y A;  3VS0 A;  3VKG A;  1T3S A;  4BDZ A;  2LT4 A;  3CCL T;  4HCC A;  3QPH A;  5M9O A;  4QVC A;  1FVV B;  3OBY A;  4FT4 A;  2YT6 A;  2HSP A;  1D3U B;  3UAT A;  3UT1 A;  3NTI A;  1TXQ A;  1D1B A;  2DKG A;  2L3Q A;  3VS6 A;  5C0M A;  5ECA A;  1FKM A;  2XDP A;  5CQY A;  5KYY B;  2RH2 A;  2CYZ B;  4OMP A;  4ELY C;  3G71 Q;  2EAY A;  2HCK A;  1JO8 A;  1ZA1 B;  1UNG D;  4CC4 B;  1GFC A;  3LH5 A;  5GMK m;  3G6E A;  1WA7 A;  2DXB A;  1H28 B;  1BCM A;  1MGQ A;  3JRZ A;  3CC4 T;  2A0F B;  3JCM W;  4DQ2 A;  2IN3 A;  4M7D F;  3CME Q;  4CI0 C;  1YP5 A;  2EUF A;  1QW1 A;  2OJ2 A;  3EGX A;  2BIV A;  4RTT A;  4QKU A;  3JCM P;  2K9G A;  1QWE A;  3PNW C;  1OU9 A;  3EGU A;  2FEI A;  5CK9 A;  3EOC B;  3FJ5 A;  4LN2 A;  3P8B B;  2XDD A;  1XNI A;  1Q81 R;  1X75 C;  4C8Q D;  4D8K A;  2ZPF B;  1YJN T;  1PRM C;  5GMK l;  5GAO n;  1M8M A;  2C5V B;  4FW1 A;  2QAZ A;  4WF2 A;  2OTJ A;  2C0I A;  5L8R E;  3TRE A;  4BDY A;  5KYW B;  1BKB A;  4M77 B;  3OBW A;  3SD4 A;  1M1G A;  3OSS C;  4EC9 B;  1ARK A;  1UTI A;  5CR2 A;  4QVD A;  1QQJ A;  1ZA2 B;  1UGS B;  2E65 A;  3QJY A;  3VS2 A;  4JS5 A;  3ZL7 C;  4PJO A;  2O01 E;  5A0D A;  9ATC B;  3FDR A;  4J6X A;  3LYI A;  1YIT Q;  4JLI A;  3RKY A;  2P84 A;  1WX6 A;  5GAN g;  1AZE A;  2F5T X;  3I9Q A;  2LCL A;  5ACB A;  1RUW A;  4JZ4 A;  1KC8 U;  3A8L B;  1Q7Y C;  1X6G A;  3VUB A;  1K9M C;  2WHB B;  1Q86 U;  3QDF A;  3G1J A;  2M0O A;  5DLQ E;  1KK7 A;  3NFC A;  3CCS Q;  2DL7 A;  2X4Y A;  1RAF B;  2XG8 D;  2P0K A;  1N9R A;  4C92 B;  1AT1 B;  4J7I A;  5GAN 6;  3MPU B;  1H24 B;  4JX4 A;  3QJ6 A;  3OMG A;  2C5X B;  4ELZ C;  1B34 B;  4CFX B;  4JX5 A;  2RJC A;  3JCM c;  2AZV A;  2QEX T;  3MIA B;  1E7P A;  2NUP A;  5FU7 B;  1YJW A;  3KFV A;  2QQ8 A;  4M7D E;  1A0N B;  3X24 B;  2QDY B;  3PIO A;  1KD1 R;  1X2K A;  2OTJ T;  2FG0 A;  2K6D A;  1KQS A;  5IAY A;  4NL2 A;  2NYS A;  4ZTF A;  1RAD B;  2H3E B;  1YJ9 Q;  2KMT A;  2JUF A;  4BCJ B;  2JJ9 A;  5GAN 7;  3MHX A;  4C8Q C;  1NBE B;  1SEM A;  4F7U B;  2IIM A;  3CPW S;  1D3B B;  5GAN 8;  1VQ6 Q;  2DZC A;  2E70 A;  3CCJ A;  1UGQ B;  1VOM A;  2LP5 A;  2D1X A;  3FC3 A;  3RKX A;  2HQX A;  2EQI A;  3DLM A;  3THK A;  4HLQ A;  2RQV A;  4M78 G;  2IPO B;  2C5N B;  1LNX A;  3M56 A;  4KT0 E;  2JS0 A;  1QMZ B;  4Y72 B;  1M2V A;  1OZ2 A;  2DM1 A;  1Q81 C;  2PU9 B;  3UPU A;  2ED0 A;  5GMK i;  2AHJ B;  1ZSZ C;  2EPD A;  3CBO A;  2VB6 A;  3GTM S;  4ZN3 A;  2EYX A;  5EJC A;  2E6Z A;  2KDS A;  4Z02 A;  2LQK A;  4RMO A;  3QYB A;  2Z0W A;  3UA6 A;  1VYU A;  2CKK A;  4EOO B;  2KAF A;  1X6B A;  2X4W A;  4ZN1 A;  2O88 A;  4M7A B;  4JUV A;  2DF6 A;  3CCQ Q;  1LVK A;  2DXB B;  4PJJ A;  1JU5 C;  4V2S A;  3JV3 A;  3OB9 A;  4M78 C;  2EJ9 A;  1T0J A;  2KYB A;  4WTO B;  4M75 B;  3CC2 A;  2EQM A;  1S1N A;  2W96 A;  1VUB A;  3EGX B;  1QCO A;  3POM A;  3EID B;  4EOK B;  1MV3 A;  2X3W D;  3PVQ A;  1VQ4 Q;  1AD6 A;  1D09 B;  2D9T A;  2LMJ A;  2CDT A;  4E6R A;  1ZBJ A;  3CCJ T;  4R56 A;  4KUL A;  2RHX A;  1VQ8 T;  3CCU Q;  2JTM A;  3RES A;  3LX7 A;  2DEQ A;  5LJ3 d;  4IMY B;  1VQO Q;  4M7D D;  2X35 A;  2CP0 A;  5LJ5 d;  5FRN A;  1K8A R;  3I55 Q;  5D6W A;  3VYH B;  2GFA A;  1Z9Q A;  2CCH B;  2FZK B;  3CCR T;  1KD1 C;  3HB9 A;  1D1C A;  2DBK A;  4X34 A;  3REA B;  3QYG B;  5HK3 A;  4FYX B;  2VXF A;  2JOY A;  4EOS B;  3BLH B;  1N8R U;  4MZP A;  2QGG A;  1GCQ A;  3BG3 A;  3M0R A;  3VU3 C;  4A4H A;  3TQ7 P;  1TSF A;  2CT3 A;  2DXC A;  4J9F A;  5FRO A;  1VQ9 Q;  4LDX A;  2AT1 B;  5LJ5 h;  2XMF A;  1Z9Z A;  4E2F B;  4EOR B;  2CGH A;  4EMK A;  4AT1 B;  1E6H A;  3X20 B;  4BI4 A;  2KRS A;  4ZGJ B;  5KCO A;  4AG2 C;  1GFD A;  2RK1 A;  3CD6 T;  1X69 A;  2NUP B;  3NHN A;  1Y57 A;  2PVO B;  3BY7 A;  2ABL A;  4EON B;  3PFS A;  1KHC A;  1BU2 A;  2DK3 A;  1W6X A;  4YC3 B;  4BXX X;  4BCQ B;  3NGP A;  2OX7 A;  3QG1 A;  2QQ9 A;  8AT1 B;  2A28 A;  3BLR B;  3OYI A;  4FYV B;  4LNP A;  3BHV B;  1VIN A;  4J6W A;  3M53 A;  2NUT B;  5KE2 A;  2KRN A;  3HP9 A;  1E9H B;  4KBM B;  1CKA A;  1OKW B;  2I2L A;  2LNH B;  2Y4Y A;  3CEY A;  1GBR A;  3OA6 A;  4EC8 B;  1Q95 G;  4A4K A;  1NE8 A;  1EFN A;  2CP2 A;  3V8K A;  1X01 A;  3OY9 A;  2ZZD A;  3E9G A;  4PLI A;  5DLO A;  2PK2 A;  4BCH B;  1G83 A;  3VYG B;  1AWO A;  2MMP A;  2C0O A;  2VC8 A;  4J9I A;  1VQP Q;  1V29 B;  3TNW B;  1WHH A;  4FW2 A;  2B8A A;  4QVZ A;  1K8A C;  2E1H A;  5J39 A;  3FRN A;  4JLG A;  3LWI A;  5I5Z B;  1GL5 A;  2HBP A;  3I5R A;  5CO7 A;  1QVF A;  5IN1 A;  4C5I A;  2FVU A;  1KQS P;  4LXC A;  2DME A;  3RGF B;  3OS1 A;  2EGE A;  2DXU A;  2KVQ G;  1BI3 A;  2RM4 A;  2YUP A;  2A3L A;  5LJ3 f;  1M3A A;  1U8R A;  3RIR A;  1OIU B;  1H64 1;  3HL8 A;  3RBB B;  5LJ5 f;  5GAO p;  3I56 Q;  1BCO A;  2WAC A;  1SKU B;  4XU2 A;  1PSE A;  3HHT B;  5J3B A;  4Y91 A;  3TCJ A;  3TW6 A;  3V7R A;  2D0N A;  2AIR B;  4FYW B;  4IUR A;  3SB2 A;  2LTO A;  2RNA A;  2DX1 A;  2DL3 A;  2F5K A;  3P8H A;  1VQK Q;  1ZSG A;  3ER0 A;  1JB0 E;  1QKW A;  1Q82 R;  4BB7 A;  4EDU A;  4IUQ A;  3QZ9 B;  2GBQ A;  1JJ2 S;  2VV5 A;  3E2U A;  1PRL C;  2PVG B;  3EFR A;  4HA8 A;  2DL4 A;  3EFO B;  5FRM A;  2DXC B;  1ZP2 A;  3CCM Q;  4JDS A;  4BE0 A;  4C8Q F;  4TTH A;  3M59 A;  1ABO A;  2CZ0 B;  5D7U A;  4E7J A;  3ZFJ A;  5CAI A;  3BE3 A;  4L59 A;  2PMI B;  4EMK B;  4RUG A;  3RER A;  2K57 A;  1WDX A;  1OPK A;  3PMT A;  2LJ3 A;  3G4S A;  2DVJ A;  4BE1 A;  1R0B G;  1O75 A;  2YDL A;  3C95 A;  4ROE A;  3R6O A;  4X1V A;  2LCS A;  3QWY A;  3FLG A;  2RHI A;  3MCA B;  4OMO A;  3CCL Q;  1IO6 A;  2C5O B;  2ZPI B;  3REB B;  3CMA A;  2OI3 A;  1XOV A;  5LJ3 g;  4LE9 A;  4MDW A;  4Y92 A;  2IVW A;  1K9A A;  1KHI A;  2LNV A;  3EH2 A;  2DYB A;  2AKL A;  2CP3 A;  1FMV A;  2HQE A;  3MO8 A;  5LJ5 g;  4XU0 A;  1RAI B;  3OQ5 A;  4OB0 B;  3WXM B;  4M77 A;  2DD4 A;  3QHR B;  5I11 A;  1H1Q B;  2DMO A;  1WNL A;  4M78 F;  3JSC A;  3KXT A;  2QA4 A;  2R5M A;  2CS7 A;  3CC4 Q;  4J8O A;  2WIH B;  4R55 A;  4CC7 A;  1M90 U;  5FU6 C;  2K2M A;  1R8O B;  1UGP B;  3L2R A;  3CPF A;  2XI9 A;  3DTO A;  2DLP A;  3HZJ A;  2LX7 A;  2EBP A;  1VQ7 Q;  3DL1 A;  3VS5 A;  2OAU A;  2L3R A;  4BY7 X;  2WSC E;  1H1S B;  1YJN Q;  2GF7 A;  3CXC A;  2MI6 A;  3G4S T;  2DNU A;  3JCM b;  2V1R A;  2YLC A;  2R58 A;  1OZ3 A;  5GAN 2;  1WHK A;  2FRW A;  3DB3 A;  3L2Z A;  2JM9 A;  1OIY B;  1GH6 B;  1ABQ A;  4E7L A;  1JXO A;  3HO8 A;  5IT9 E;  3M5A A;  1IGQ A;  3AT1 B;  2CP7 A;  4HKE A;  3C4S A;  3CCV T;  5IDN B;  1GUX B;  1VOL A;  3Q1J A;  5KYX A;  1OX8 A;  5FLX E;  4FT2 A;  2DIG A;  4OML A;  1JRI A;  2JTE A;  2DXT A;  1AWX A;  5KH6 A;  1J3T A;  2X1N B;  3UF4 A;  2FRY A;  5KCH A;  1U06 A;  3PO3 S;  4ROD A;  1ZUK A;  2YHT A;  4F7U A;  3OYF A;  3OYB A;  2K79 A;  2QA4 T;  1MNE A;  1I5O B;  5KYU B;  1S72 A;  2W10 A;  2RJD A;  1X6O A;  3URG A;  4BCK B;  3TU4 K;  3QWL A;  4CRI A;  2LRQ A;  1YHQ A;  3MKD A;  3L2W A;  2KT1 A;  4E7S A;  5IHY A;  1YWP A;  2D8J A;  2K5F A;  1RLQ C;  2EQU A;  2ATC B;  4M78 E;  2YRC A;  4BCI B;  1M30 A;  1B7T A;  1DJ7 B;  2QEX Q;  4E7K A;  1M3C A;  2FZG B;  3SFM A;  1MMD A;  1Y7X A;  2M9U A;  5D6X A;  1H3H A;  4JRI A;  2E6N A;  1UJ0 A;  1IB8 A;  2COZ A;  2DL5 A;  2OTJ Q;  1FXX A;  3V7S A;  1VIE A;  2O4X A;  3EHR A;  4YOO A;  2GFU A;  4IIO A;  4M7A A;  1VQ5 T;  3CC7 T;  1WXU A;  1OEB A;  1M2O A;  2ED1 A;  5GAM e;  4PJO G;  1RAA B;  1TUG B;  3BDU A;  4OGR B;  2L5Q A;  3M03 A;  1X27 A;  4EMH A;  2RQW A;  4M75 A;  1RI9 A;  1MV0 B;  3DOG B;  1M3B A;  2MAM A;  2JGZ B;  4ELJ A;  1ACM B;  3V7C A;  3EG1 A;  2K4Y A;  2DJQ A;  3E1S A;  1UNH D;  1M8V A;  3TEE A;  2XD0 A;  1U1T A;  2CH4 A;  4E47 A;  2RJE A;  1SSF A;  4ESR A;  3AHU A;  1SF9 A;  3X26 B;  3I5S A;  4L6V 5;  4PJO C;  1GY3 B;  1M1K R;  1W70 A;  2DD4 B;  1AIS B;  1YHQ T;  2ZPB B;  4YOZ A;  5HBE B;  4HCB A;  4MML A;  4RTX A;  4FSX A;  4QSH A;  5I2M A;  4BY6 C;  2BS2 A;  4Y28 E;  4DBR A;  1PKT A;  1NM7 A;  3QDR B;  1YNZ A;  3TN8 B;  4IUU A;  5L2W B;  2RB6 A;  2F2C A;  1V76 A;  1NLO C;  1WHL A;  1VQN Q;  4MZM A;  3G71 A;  4AMC A;  2KQW A;  1NYG A;  1WI7 A;  1PC0 A;  2P0P A;  2BKD N;  4XU3 A;  5GAN e;  1RAE B;  3G6E T;  1K1Z A;  4FL6 A;  1N4M A;  1UGV A;  4CXA B;  4DEY A;  2QQR A;  3CME A;  1KSW A;  1RAC B;  2MK5 A;  3JCM J;  4M78 D;  2BZY A;  2PHG A;  2EYZ A;  1VQ8 Q;  3MET A;  2J7I A;  3MJX A;  1JKW A;  1CKB A;  1M27 C;  4N0A A;  5A0G A;  4C0D B;  1HXD A;  3MEV A;  1JSU B;  2UZL B;  1G3S A;  3H41 A;  2C6T B;  3VJP A;  5IH2 A;  1B3Q A;  2WMB B;  2EJF A;  2DYI A;  3CCR Q;  4DOV A;  5FWB A;  2EQJ A;  4J9E A;  1NG2 A;  5KYX B;  1UHC A;  1WJR A;  1M4Z A;  4PK4 A;  4JPB W;  3M55 A;  1ZX6 A;  4YOS A;  1LPL A;  1Q7Y U;  2QDJ A;  5DY9 A;  2NUT A;  4HXJ A;  5BNJ B;  1JQQ A;  1K9M U;  1YIT A;  2UZD B;  3LQ5 B;  2F2X A;  3TW7 A;  1MHN A;  2CZ7 B;  1I0C A;  2EWN A;  3LGF A;  4Q5W A;  3EG0 A;  1HSQ A;  1G3T A;  2G3R A;  1VQM A;  1WZO A;  1NLP C;  1WYX A;  4AKH A;  3BDL A;  3CD6 Q;  2PK9 B;  3UWN A;  2GNC A;  1BK2 A;  4HCZ A;  1JXM A;  3VYG A;  2DJZ A;  3I35 A;  3K7A M;  3S6W A;  2F2W A;  3CXC P;  3OS2 A;  3CCS A;  3VS3 A;  2DBM A;  1M1K C;  2O4X B;  1TUD A;  2V8K A;  3LH0 A;  1VQL Q;  1OI9 B;  4C8Q A;  1TOV A;  4ZNX A;  3QZ5 B;  3HRT A;  4BI3 A;  3BG9 A;  3KHI A;  4BCP B;  4BI8 B;  4F70 B;  4OMN A;  3GLX A;  1BB9 A;  1BIB A;  4XTU A;  5FWC A;  3X28 B;  1AEY A;  2LJ0 A;  2EGA A;  1YJW T;  1ZQ1 A;  2LC4 A;  2L89 A;  1WXT A;  3JAM E;  2R5A A;  4BCO B;  2W9Z A;  4HT8 A;  1W98 B;  1YJ9 A;  3U23 A;  3CPW A;  2HZY A;  1ZSZ A;  1TTH B;  4C0Z A;  4IIM A;  4PLL A;  4JZ3 A;  1VQ6 A;  3DDQ B;  3VRY A;  1UGR B;  5HBJ B;  3JCM h;  1Q81 U;  4HT9 A;  1UHF A;  5CKB A;  2HMA A;  2HKN A;  3M4G A;  4GLK A;  3OYJ A;  2G77 A;  1UG1 A;  3C12 A;  3MP1 A;  1VQM T;  2JM8 A;  2JMA A;  4OF1 A;  3EFS A;  2WIP B;  1BYM A;  3UDC A;  2QK0 A;  3BHT B;  2I40 B;  2ROL A;  3FB9 A;  1WJQ A;  5CKF A;  1I4K 1;  2YLB A;  3EGD A;  3OYL A;  2GTJ A;  1QVG S;  2LCC A;  4C0F A;  1ZUU A;  3JB9 J;  4OMM A;  5HCK A;  2DL8 A;  5CKH A;  1C1A A;  2W2H A;  5HY6 A;  4FCY A;  3G33 B;  2GQI A;  4A4G A;  4XQ3 A;  1IXD A;  4CFV B;  3EFO A;  1VYW B;  1P5E B;  2UUE B;  4DBH A;  1WHM A;  2OTL Q;  2JMC A;  4OGE A;  4FX3 B;  1EIF A;  2FO0 A;  4M77 E;  3ZEH A;  1T0H A;  2EQK A;  2ESW A;  1EZZ B;  5GAO m;  2HL5 C;  2G9X B;  2RI3 A;  3CC2 T;  4NL3 A;  1NPR A;  2WJ9 A;  3A8H B;  4EIK A;  5KYN A;  4KUD K;  1M5Q 1;  5ICP B;  3NPF A;  2CH4 W;  5GAN 5;  4MDX A;  2J6K A;  1X43 A;  1C9B A;  4A53 A;  1UUE A;  3D7S B;  5I22 A;  1RAG B;  1VQ6 T;  1PG5 B;  2LZ6 B;  3SHW A;  1JST B;  2K3X A;  4IUV A;  1Y71 A;  1G3W A;  3CCU A;  2WXV B;  2FYK A;  3SWN A;  1KD1 U;  5GAO l;  3C0C A;  2DO3 A;  2DTH A;  3TSZ A;  1RL2 A;  4DA4 A;  4EOP B;  4RTV A;  4IKF A;  2DIQ A;  4C92 E;  3QO3 A;  2DRM A;  1H26 B;  1LCK A;  4RTU A;  4RTY A;  1N5Z A;  2YSQ A;  5GMK e;  4BUG A;  3CCE A;  5C6S A;  2QGF B;  3QWX X;  1SRL A;  2VGN A;  1I5L A;  3GNG A;  1SSH A;  1PM3 A;  2X51 A;  2GTO A;  1VQ9 A;  1VYV A;  3INZ A;  2J06 A;  2M1H A;  3H9N A;  3BFM A;  4OMF B;  2LVM A;  3JCM Q;  1QP3 A;  2X3X D;  2E64 A;  2XU8 A;  4N4I A;  4LDU A;  4C8Q B;  4EMG A;  4OB3 B;  4PJO F;  2DFU A;  2KGT A;  1M1F A;  1H1P B;  3BLQ B;  2RF0 A;  3E19 A;  1K73 R;  4M7D A;  2C0T A;  2WEV B;  3NTH A;  3NDQ A;  1TG0 A;  1Y96 A;  2VAS A;  4C5H A;  4ZTJ A;  1ZSZ B;  3ASK A;  2M0Y A;  1R77 A;  2A37 A;  1GUX A;  2HAX A;  1IRX A;  4AFQ C;  4BBS M;  1KQ1 A;  3QHS A;  4M7A E;  3NTK A;  3LWH A;  4KH0 B;  2DPP B;  4XK8 E;  3MP6 A;  1NJI R;  1AOJ A;  3CCE T;  3OSV A;  2EVR A;  3G4S Q;  4PFZ A;  5KYU A;  2A36 A;  4WCI A;  2LQW A;  2SEM A;  2I53 A;  2E5Q A;  3EGD B;  4AKI A;  5HKC A;  1K8A U;  4OVA A;  2RHZ A;  2MWP A;  1QCN A;  4OB1 B;  2PQW A;  4Z8A A;  2G6F X;  4AI6 A;  3JCM e;  1BI0 A;  1WLP B;  1UE9 A;  4FIB A;  5GAM h;  4RCB A;  4C92 D;  1VQP A;  2RJF A;  1G5V A;  1TS9 A;  2RQU A;  1P92 A;  1FMW A;  2RHY A;  4LDV A;  5D6Y A;  3CCV Q;  2WFY B;  1OPL A;  2E4H A;  2QQA A;  4II5 B;  1E7O A;  2BE9 B;  2NLU A;  2J6O A;  3QHW B;  4M77 G;  3J80 E;  3M4Y A;  1YIJ Q;  1PD0 A;  5HNB B;  1UNL D;  2L0A A;  4J9G A;  2F1L A;  1ZLM A;  3TSW A;  2A08 A;  3PMI A;  1QCF A;  4PJO E;  2YXY A;  4CFN B;  4F7J B;  2RD1 A;  4NS5 A;  4N4H A;  2K5L A;  3PGG A;  4F14 A;  4TVR A;  2YUO A;  4B9X A;  1JBM A;  3WVE B;  5GAN 3;  2VVK A;  2E41 A;  4L5G A;  1T3L A;  2W0Z A;  4M77 C;  1HK9 A;  4F6U B;  4YTL A;  1G3N C;  3SWN B;  5DM7 R;  2XID A;  4DBF A;  4BCM D;  1U1S A;  4AFU C;  4C92 G;  1BU1 A;  1K73 C;  2JTF A;  1WQW A;  2EYY A;  2LQ8 A;  4KGX B;  2CJM B;  4ATO A;  3JB9 G;  3CXC S;  2BS4 A;  2GCX A;  1VQ5 Q;  3CC7 Q;  4F7L B;  1JJ2 A;  4D8D A;  3X25 B;  5GAN h;  1TU0 B;  5CVI A;  1G2B A;  2IG0 A;  2AK5 A;  1OX9 A;  4AG1 C;  4M7A D;  4OR5 B;  2KYM A;  4OB2 B;  1OQK A;  4XTY A;  2K3Y A;  2M16 A;  1PWT A;  3OYE A;  5KE3 A;  4FU6 A;  4XAX B;  1NJI C;  1N27 A;  1KJW A;  4C92 C;  3EHQ A;  4F7U G;  2DD5 B;  3MY1 B;  1UEB A;  2L3P A;  3GIB A;  4Z89 A;  2JW4 A;  3A8G B;  2BTT A;  3G7Z A;  1OL1 B;  3C94 A;  3EAE A;  3OYG A;  1QLB A;  1QKX A;  1UJY A;  5FU7 C;  3KUF A;  4JJB A;  5DQV A;  1KC8 R;  2DVE A;  3CCL A;  3QXE B;  1I8F A;  2KR6 A;  1KQ2 A;  4F6W B;  1Q82 C;  1YHQ Q;  4M7D B;  5GAO q;  1B07 A;  2ZAE A;  1Q86 R;  4HVW A;  3CMA T;  1BI1 A;  1Y96 B;  2RHU A;  1K0X A;  1GRI A;  4ZGE B;  4ROC A;  3M57 A;  4LUE A;  5GAM f;  3OYY A;  1TUC A;  2MPX C;  2KBT A;  2ROT A;  3M58 A;  5GAO r;  2EFI A;  2JN0 A;  1LJO A;  1W1F A;  5HQ0 B;  4GLM A;  5J26 A;  3OYK A;  1SHF A;  4PKC C;  4M7A G;  2AKK A;  4PJO D;  3DB4 A;  1BBZ A;  3V8L A;  2QG9 B;  2VUB A;  3JCM g;  2HDA A;  1TH7 A;  2X4X A;  3G6E Q;  4K11 A;  2CUB A;  1OKV B;  4MFD A;  3OW2 A;  1W2B A;  4OGC A;  2KMG A;  4C5G A;  4M75 G;  2QTX A;  4EOL B;  4CFW B;  2DER A;  2J6F A;  3GNF B;  2EW3 A;  4XU1 A;  4BCF B;  2YUN A;  1OL2 B;  4I3Z B;  1ZHI A;  5AT1 B;  1VQ7 A;  3VKI A;  4LD9 K;  4JRP A;  4MMK A;  4PJM A;  4HNU A;  2RQR A;  2Y90 A;  4M7A C;  1AD5 A;  2H8H A;  1YJN A;  2ZPE B;  5LQF B;  2CCI B;  1VYT A;  4O6J A;  3EG9 B;  1YI2 A;  4BCN D;  1ZBX A;  2VYT A;  4KUI A;  5L23 A;  2PJQ A;  4DOW A;  1LOJ A;  4FSS A;  3E9F A;  4M75 C;  2BZ8 A;  1NEG A;  1QVF P;  2DTO A;  1QP2 A;  4BCQ D;  2CRE A;  3CBM A;  4VUB A;  5GAN f;  2P0Q A;  3F5X B;  2FL7 A;  3H4C A;  2L2P A;  2B9R A;  3N5B B;  4ANJ A;  5GAM g;  1WIE A;  1SG5 A;  3DLL A;  1CSK A;  1SPK A;  4J9H A;  2VKN A;  5HBH B;  3OYC A;  2PZ1 A;  3H6Z A;  4NST B;  3MY5 B;  3PTA A;  3PIP A;  1X2Q A;  3JCM V;  4PFP A;  1C6V X;  3A1P A;  2PNI A;  2XK0 A;  2ZCF B;  4F04 B;  2RK2 A;  1FX7 A;  2ENM A;  1KFZ A;  2QGS A;  1YN8 A;  2M02 A;  2LT1 A;  1S72 T;  4EOM B;  1KC8 C;  5IXB A;  5EFQ B;  4FM4 B;  4ELL A;  3GP8 A;  1Q86 C;  3HPW A;  5CIU A;  1IZ6 A;  2JT4 A;  1YCY A;  2ZPG B;  1VQ7 T;  2KRM A;  2O9V A;  1I81 A;  2QEX A;  4QQG A;  1PNJ A;  1YJW Q;  2LW4 A;  3RMS A;  1NZ9 A;  4MIM A;  1FIN B;  4EOI B;  2WSE E;  2FZC B;  2PUK B;  1HD3 A;  2E5K A;  1YI2 T;  2RMO A;  4KRT A;  4X9C A;  3T9N A;  1RI0 A;  4CFU D;  3HRU A;  2DIL A;  4PL6 A;  1NPP A;  2RN8 A;  1KQS S;  1N9S A;  1W4S A;  1H92 A;  1UFF A;  3M0U A;  1XJW B;  3M0T A;  1C0M A;  4N0A C;  2KNB B;  3GPL A;  1H1R B;  4A4F A;  3CCJ Q;  2COY A;  1N8R R;  4F17 A;  4XTV A;  5GAM j;  1VQM Q;  4CC3 A;  2YRD A;  2MF2 A;  4BY1 X;  1PCX A;  1G8X A;  3QUI A;  2YRV A;  4DBQ A;  2W9F A;  4AFZ C;  5FU6 B;  2VGM A;  1GXI E;  2CZ1 B;  2KRO A;  1D0X A;  2O31 A;  4KGV B;  2QFZ A;  5GMK h;  4C0G A;  1AWJ A;  4C5E A;  2XDB A;  2XIC A;  1WXB A;  5GJW B;  1WPY A;  4C8Q G;  4JJD A;  4ORZ A;  2MWO A;  3RMQ A;  4HCK A;  4BAC A;  1JJ2 P;  2P4T A;  2DTI A;  4PFO A;  4JX6 A;  3L2U A;  5FGK B;  2LJ1 A;  2BS3 A;  4J7F A;  2K7A A;  2MOX A;  3VS7 A;  1Y07 A;  1YFN A;  1V1C A;  4LUD A;  4IUT A;  1K4U S;  1VQN A;  4JJC A;  3CC2 Q;  2KY9 A;  1FMK A;  3G71 T;  2MYS A;  2V26 A;  3H0F A;  1I1J A;  1Y0M A;  4EOJ B;  3RR6 A;  4JS4 A;  2KXC A;  1PD1 A;  3R6N A;  3L1A A;  4A63 B;  4M77 F;  2C06 A;  2RI5 A;  3DDP B;  3CME T;  4BE2 A;  2O2O A;  1VQ8 A;  3J81 E;  4IUP A;  4LDW A;  4BCM B;  5GAN j;  2F2V A;  1D0Z A;  2FPD A;  1G3Y A;  2RO0 A;  4PNO A;  1NEB A;  3H8Z A;  1PSF A;  2CT4 A;  1XTD A;  2VXE A;  3UA7 A;  3JCM d;  3CCR A;  4HL4 A;  2EIF A;  1BIA A;  2UZE B;  5CEI B;  2FPF A;  2BKZ B;  5IXF A;  1H3Z A;  2CZ6 B;  3GOX A;  1HJD A;  5LL6 S;  3S3N A;  2KXD A;  1ZUY A;  4LDY A;  2E10 A;  4KGZ B;  1WFW A;  4B9W A;  4C92 F;  3OW2 P;  3JB9 I;  4NC6 A;  4QW2 A;  4BD3 A;  1W2B P;  2XKO C;  1YIT T;  1N8R C;  3JB9 F;  1IRE B;  2QDL A;  3QII A;  1OU8 A;  1OV3 A;  3P8D A;  1VQN T;  1MMA A;  2E3H A;  2QI2 A;  4HNT A;  4HVU A;  1M1K U;  2FB7 A;  3CD6 A;  4M78 A;  6AT1 B;  1VIF A;  3MP8 A;  5CKE A;  4PJL A;  3OS0 A;  5IDP B;  4UN0 A;  4ME7 A;  4J5Y A;  1GCQ C;  3OMC A;  1I07 A;  2D8H A;  2HD0 A;  3F70 A;  3JCM X;  3CCS T;  3J7A F;  2LX9 A;  2K2V A;  1VA7 A;  1RAH B;  1VQL A;  1URC B;  4F7U F;  7AT1 B;  2DEU A;  3HTR A;  4BBR M;  1QMC A;  3M0Q A;  4HVV A;  5EG2 A;  3CCQ A;  4J9B A;  4EMK C;  3O5Z A;  1TWB A;  1XO2 A;  3JB9 H;  4BCG B;  4PJO B;  2GQV A;  2DE0 X;  4RKU E;  1O9S A;  2CP6 A;  5A2Q E;  3PT9 A;  3M54 A;  3CCE Q;  3BHU B;  4LOC A;  5HK0 A;  5GAN 4;  2C4G B;  4BY6 B;  2BUD A;  1OI1 A;  4Z6Y A;  2KR3 A;  1YJ9 T;  1O9K A;  4X9D A;  4XTX A;  5LJ3 h;  1VQ4 A;  3EG3 A;  3SWN C;  2DA9 A;  1WQ7 A;  3HFO A;  1EX4 A;  3SEM A;  5LMK B;  2I0N A;  2COW A;  4J9D A;  1FWZ A;  2CUD A;  4FYY B;  4M7A F;  5I21 A;  3VV0 A;  1QVP A;  4M4Z A;  2ZPH B;  2XHC A;  1VQO A;  2Y4X A;  4R0K A;  1QVG A;  1IHW A;  3HSB A;  4BCN B;  5FW9 A;  3O0G D;  3FEO A;  3VKH A;  3I55 A;  4M75 F;  4M7D G;  1OYX A;  4JRQ A;  5DQW A;  3PE0 A;  3L2V A;  1OOT A;  1E6G A;  4B6M A;  3L2Q A;  1VQL T;  3LLR A;  3VRZ A;  1H25 B;  2DZ9 A;  2WPA B;  4II1 A;  1JEG A;  5AYF A;  2QF7 A;  1QVF S;  4G6L B;  3CCQ T;  1XQH A;  3GF5 A;  1MND A;  3BW1 A;  3RNJ A;  2OTL A;  1U3O A;  3LGL A;  3MEW A;  4RG8 A;  1WJS A;  1JOW A;  2IW9 B;  1UB4 A;  2GGR A;  1KIK A;  4RTW A;  2KE9 A;  2CSI A;  3S3O A;  2IW6 B;  1QWF A;  3JCM f;  4F7U E;  4M7D C;  4EOQ B;  1SHG A;  2DD5 A;  3O8V A;  3L42 A;  3ULR B;  1YBY A;  1M90 R;  3OYA A;  1PKD B;  2NUZ A;  4LD6 A;  1M2V B;  1VQ4 T;  5IF1 B;  2WMA B;  1QLY A;  5CKD A;  3FIF A;  1OUL A;  4ZGD B;  3OS5 A;  1ENW A;  4F16 A;  4KRC B;  3M9Q A;  1N6A A;  3CCU T;  4CRL B;  4A54 A;  2HEQ A;  3VUZ A;  4P5N A;  2ZGW A;  2JZ2 A;  4D6W A;  4M77 D;  2HBW A;  4J6Y A;  1VQO T;  4QQD A;  2M51 A;  3VS4 A;  3RUX A;  2L3S A;  2V8J A;  1MMG A;  2MCN A;  2YWW A;  3I55 T;  4CFU B;  2QXF A;  3HFN A;  2V22 B;  5GAM d;  2R7G A;  3A8M B;  2JVV A;  2NWM A;  3HKS A;  3TNI B;  5IHN A;  1H4L D;  2EJG A;  3NMZ C;  4M78 B;  1TD6 A;  2QYZ A;  3CQT A;  4M75 E;  5GMK j;  3OYD A;  1VQ9 T;  2OTL T;  5IHI A;  2IVX A;  3FJP A;  3OYN A;  1AVZ C;  4F7N B;  3CMA Q;  2K3B A;  2J05 A;  3A8O B;  2CSQ A;  2QQB A;  1UEC A;  4XTW A;  1AHJ B;  3EH1 A;  4N4G A;  3JB9 D;  1D1A A;  3A98 A;  1NYF A;  2HKQ B;  3EG9 A;  2BPM B; 
#chains in the Genus database with same CATH homology
 4M75 G;  2QTX A;  2EJF A;  5LJ5 h;  4QQ6 A;  3QKJ A;  4DOV A;  5CCA A;  2EQJ A;  3GNF B;  2CGH A;  4XU1 A;  1M9S A;  4EMK A;  1BI2 A;  1ZHI A;  1VQ7 A;  1WJR A;  3VKI A;  1M4Z A;  4LD9 K;  2F69 A;  3X20 B;  2LDM A;  4JRP A;  4BI4 A;  4MMK A;  3M55 A;  4HNU A;  4E7I A;  3A5Z B;  4ZGJ B;  5KCO A;  2Y90 A;  2KK4 A;  4M7A C;  2RK1 A;  3CD6 T;  1YJN A;  2QDJ A;  5DY9 A;  5I2S A;  2ZPE B;  1Q7Y U;  2DAQ A;  4MFE A;  1K9M U;  3ZBD A;  1YIT A;  2PVO B;  3BY7 A;  4O6J A;  1YI2 A;  3PFS A;  3TW7 A;  1KHC A;  2RI2 A;  1MHN A;  2DK3 A;  2CZ7 B;  1ZBX A;  2EWN A;  3LGF A;  4Q5W A;  5HK0 A;  2VYT A;  4KUI A;  5GAN d;  3I56 A;  4DOW A;  1G3T A;  2G3R A;  4AKG A;  5A0L A;  1LOJ A;  1VQM A;  3DKM A;  3E9F A;  4M75 C;  3OYM A;  2DTO A;  2H3J A;  3QG1 A;  4AKH A;  3BDL A;  1M90 C;  2D0Q B;  2QQ9 A;  1QP2 A;  3UWN A;  3OYI A;  3CBM A;  4VUB A;  5GAN f;  4HCZ A;  2P0Q A;  2FL7 A;  4J6W A;  3VYG A;  2DJZ A;  3H4C A;  5LJ3 e;  3M53 A;  5KE2 A;  3S6W A;  3CCS A;  3OS2 A;  5GAM h;  3WVD B;  3HP9 A;  3N5B B;  3RKW A;  3MEA A;  4KBM B;  5GAM g;  1VQK A;  2I2L A;  2Y4Y A;  3CEY A;  5LJ5 e;  3QYE A;  4OP0 A;  3DLL A;  1M1K C;  2O4X B;  3HRS A;  2V8K A;  3LH0 A;  3OYC A;  3OA6 A;  4C8Q A;  2K5I A;  4EPC A;  3QZ5 B;  3H6Z A;  3HRT A;  4BI3 A;  5GAN 4;  4A4K A;  3BG9 A;  3KHI A;  1NE8 A;  3PTA A;  2PVD B;  2D6F A;  3PIP A;  3V8K A;  2PUO B;  1X01 A;  4HNV A;  2KSS A;  3JCM V;  4BI8 B;  3GLX A;  3OY9 A;  1VQP T;  1BIB A;  2XK0 A;  1KG1 A;  2R57 A;  2ZZD A;  4XTU A;  3X28 B;  2ZCF B;  2RK2 A;  3E9G A;  4PLI A;  1WGS A;  4J83 A;  3CCV A;  1ZQ1 A;  1YJW T;  1FX7 A;  5DLO A;  3QSU A;  2LT1 A;  2LC4 A;  3VYG B;  1S72 T;  3CCM A;  4O5V A;  1YIJ A;  2L89 A;  1KC8 C;  2MMP A;  3JAM E;  2VC8 A;  4FM4 B;  2R5A A;  4RG2 A;  3GP8 A;  1Q86 C;  3HPW A;  5CIU A;  1IZ6 A;  4HT8 A;  1YCY A;  2ZPG B;  1YJ9 A;  4UC4 A;  2QQS A;  1VQ7 T;  2E12 A;  4NOY A;  3CPW A;  4JRK A;  1V29 B;  4M75 D;  2B8A A;  1I81 A;  2FHD A;  2QEX A;  4C0Z A;  4QVZ A;  4QQG A;  4E7H A;  2HNI A;  3RMS A;  1K8A C;  4C0D C;  2ZZD B;  2E1H A;  4PLL A;  5J39 A;  1NZ9 A;  3FRN A;  4MIM A;  2WSE E;  4JLG A;  3LWI A;  1VQ6 A;  2HBP A;  2PUK B;  5M9O A;  1UGR B;  1Q81 U;  3JCM h;  5CQX A;  4HT9 A;  5CO7 A;  4A4E A;  1YI2 T;  3QBY A;  3OW2 S;  1W2B S;  5CKB A;  3M4G A;  3MEU A;  1K73 U;  4X9C A;  4GLK A;  3T9N A;  5IN1 A;  3OYJ A;  4C5I A;  1QVF A;  2G77 A;  1RI0 A;  2FVU A;  3I56 T;  3C12 A;  3HRU A;  3BG5 A;  3MP1 A;  4PL6 A;  1VQM T;  3OS1 A;  2A7Y A;  4OF1 A;  3EFS A;  1NPP A;  1KQS S;  1N9S A;  1W4S A;  1BYM A;  3UDC A;  2DXU A;  2KVQ G;  1BI3 A;  2RM4 A;  5CKF A;  3HBL A;  3FB9 A;  1WJQ A;  3OYL A;  1I4K 1;  2YLB A;  4N0A C;  2A3L A;  3LW5 E;  5LJ3 f;  3KBG A;  4C92 A;  2LCC A;  1QVG S;  3GPL A;  1U8R A;  4A4F A;  4C0F A;  4M6V A;  3RIR A;  1H64 1;  4C8Q E;  3JB9 J;  3HL8 A;  1VQK T;  2L8D A;  3CC7 A;  1VQ5 A;  1B34 A;  4XTV A;  5LJ5 f;  5GAO p;  5GAM j;  5CKH A;  2WAC A;  2MF2 A;  5HY6 A;  4XU2 A;  1PSE A;  3HHT B;  4GY5 A;  2EKO A;  3QUI A;  5J3B A;  4Y91 A;  4XQ3 A;  4A4G A;  2YRV A;  3TW6 A;  3TCJ A;  5LJ3 j;  1NJI U;  3CC4 A;  1GXI E;  5FU6 B;  2VGM A;  2CZ1 B;  3V7R A;  4JJN K;  2V8I A;  4OGE A;  5LJ5 j;  1EIF A;  2QFZ A;  4M77 E;  3ZEH A;  4C0G A;  4IUR A;  5GMK h;  3SB2 A;  3QYH B;  2EQK A;  2LTO A;  4C5E A;  2XDB A;  3P8H A;  2F5K A;  2XIC A;  5GAO m;  3ME9 A;  3SDZ A;  3CCM T;  1W2B A;  1YIJ T;  3ER0 A;  3OYH A;  1JB0 E;  1WPY A;  4C8Q G;  3V8J A;  3RMQ A;  2MWO A;  2RI3 A;  2WSF E;  1NPR A;  2RA2 A;  4BB7 A;  4NL3 A;  3CC2 T;  2WJ9 A;  4BAC A;  3A8H B;  2JNG A;  4RCC A;  2P4T A;  4EDU A;  4KUD K;  2DTI A;  4IUQ A;  4JX6 A;  3L2U A;  1M5Q 1;  1Q82 U;  5GAN 5;  4MDX A;  3QZ9 B;  2BS3 A;  4MZT A;  4J7F A;  1JJ2 S;  1D3B A;  2VV5 A;  2PVG B;  2X4J A;  3EFR A;  4HA8 A;  2EYQ A;  4A53 A;  1Y07 A;  3CBP A;  3S3M A;  5FRM A;  2DXC B;  4XTZ A;  1VQ6 T;  4IUT A;  3VKG A;  4JDS A;  4BE0 A;  1VQN A;  4BDZ A;  4C8Q F;  2LT4 A;  2KY9 A;  3M59 A;  3CCL T;  2CZ0 B;  4HCC A;  2K3X A;  3G71 T;  3QPH A;  1Y71 A;  1G3W A;  4IUV A;  3ZFJ A;  4QVC A;  5CAI A;  2FYK A;  3SWN A;  4L59 A;  3CCU A;  1KD1 U;  4EMK B;  3OBY A;  4FT4 A;  5GAO l;  3RER A;  2K57 A;  2DO3 A;  2DTH A;  4JS4 A;  3UT1 A;  1RL2 A;  3NTI A;  4DA4 A;  3PMT A;  3G4S A;  4BE1 A;  4IKF A;  2DIQ A;  1O75 A;  4C92 E;  2DKG A;  3C95 A;  3QO3 A;  5C0M A;  3L1A A;  3R6O A;  4M77 F;  1FKM A;  2C06 A;  2RI5 A;  2XDP A;  3FLG A;  2RHI A;  5CQY A;  3CME T;  4BE2 A;  3MCA B;  2RH2 A;  2CYZ B;  5GMK e;  4BUG A;  4ELY C;  1VQ8 A;  2EAY A;  2ZPI B;  3CCE A;  3CMA A;  5C6S A;  1XOV A;  3J81 E;  4IUP A;  4LDW A;  5GAN j;  5LJ3 g;  1G3Y A;  2VGN A;  2RO0 A;  2IVW A;  4MDW A;  4PNO A;  1I5L A;  1KHI A;  5GMK m;  2LNV A;  3GNG A;  3G6E A;  2DXB A;  3H8Z A;  1PSF A;  1MGQ A;  2HQE A;  3MO8 A;  5LJ5 g;  1XTD A;  3JRZ A;  4XU0 A;  2VXE A;  3CC4 T;  1VQ9 A;  3JCM d;  4DQ2 A;  3JCM W;  3INZ A;  4M7D F;  3CCR A;  3OQ5 A;  4CI0 C;  2M1H A;  4HL4 A;  4OB0 B;  1BIA A;  2EIF A;  1QW1 A;  3WXM B;  4M77 A;  1H3Z A;  3BFM A;  4OMF B;  2BIV A;  2LVM A;  2DD4 A;  2CZ6 B;  1QP3 A;  3JCM Q;  3GOX A;  2E64 A;  5LL6 S;  3JCM P;  2XU8 A;  3S3N A;  1WNL A;  3PNW C;  4N4I A;  4M78 F;  4LDU A;  4LDY A;  4C8Q B;  3JSC A;  3KXT A;  5CK9 A;  4EMG A;  4OB3 B;  2E10 A;  2QA4 A;  4PJO F;  2R5M A;  2CS7 A;  3P8B B;  4J8O A;  2XDD A;  1XNI A;  1X75 C;  4C8Q D;  4B9W A;  4C92 F;  4R55 A;  1M90 U;  2ZPF B;  1YJN T;  1M1F A;  5FU6 C;  5GMK l;  5GAO n;  3JB9 I;  3E19 A;  4NC6 A;  4QW2 A;  4BD3 A;  1R8O B;  2OTJ A;  4WF2 A;  2XKO C;  1YIT T;  1N8R C;  3TRE A;  5L8R E;  4M7D A;  4BDY A;  1IRE B;  1UGP B;  3QII A;  3L2R A;  3JB9 F;  3CPF A;  3NTH A;  1BKB A;  2XI9 A;  3OBW A;  3P8D A;  4M77 B;  1Y96 A;  3SD4 A;  1VQN T;  3HZJ A;  2QI2 A;  1M1G A;  3OSS C;  3DL1 A;  4HNT A;  2OAU A;  2L3R A;  4C5H A;  1M1K U;  2FB7 A;  5CR2 A;  3CD6 A;  4M78 A;  4QVD A;  2WSC E;  1VIF A;  3MP8 A;  1UGS B;  2E65 A;  3QJY A;  4JS5 A;  4ZTJ A;  4PJO A;  5CKE A;  3ASK A;  3OS0 A;  2GF7 A;  2O01 E;  3CXC A;  2MI6 A;  4ME7 A;  3G4S T;  4J5Y A;  5A0D A;  2HAX A;  3FDR A;  4J6X A;  3OMC A;  3JCM b;  3LYI A;  4BBS M;  2HD0 A;  3F70 A;  3JCM X;  1KQ1 A;  3QHS A;  4JLI A;  3CCS T;  3J7A F;  2YLC A;  3RKY A;  2LX9 A;  2R58 A;  1OZ3 A;  2K2V A;  3NTK A;  5GAN g;  5GAN 2;  2F5T X;  3LWH A;  4M7A E;  2DPP B;  2LCL A;  4XK8 E;  1VQL A;  3MP6 A;  3CCE T;  1KC8 U;  3DB3 A;  3A8L B;  3L2Z A;  3OSV A;  4F7U F;  1Q7Y C;  4BBR M;  5EG2 A;  3VUB A;  4E7L A;  1K9M C;  3CCQ A;  1Q86 U;  3HO8 A;  4EMK C;  5IT9 E;  3M5A A;  2M0O A;  4HKE A;  3JB9 H;  5DLQ E;  4PJO B;  3C4S A;  2GQV A;  3NFC A;  2X4Y A;  2E5Q A;  4RKU E;  1O9S A;  3CCV T;  2XG8 D;  4AKI A;  5HKC A;  2P0K A;  5A2Q E;  1N9R A;  3Q1J A;  2RHZ A;  3PT9 A;  2MWP A;  4OVA A;  4C92 B;  3M54 A;  4J7I A;  4OB1 B;  2PQW A;  5GAN 6;  5FLX E;  4FT2 A;  4JX4 A;  4LOC A;  4AI6 A;  2DIG A;  1BI0 A;  1JRI A;  3QJ6 A;  4FIB A;  2DXT A;  4BY6 B;  3OMG A;  3JCM e;  4RCB A;  2BUD A;  1B34 B;  1OI1 A;  4ELZ C;  5KH6 A;  4C92 D;  5KCH A;  1VQP A;  4Z6Y A;  1YJ9 T;  4JX5 A;  2RJF A;  1G5V A;  4X9D A;  2RJC A;  2YHT A;  4F7U A;  3JCM c;  4XTX A;  5LJ3 h;  3OYF A;  3OYB A;  2QA4 T;  1K8A U;  1P92 A;  2QEX T;  2RHY A;  1E7P A;  4LDV A;  5D6Y A;  5FU7 B;  3SWN C;  1VQ4 A;  1YJW A;  2QQ8 A;  1WQ7 A;  3HFO A;  1S72 A;  4M7D E;  2QQA A;  2NLU A;  1X6O A;  2RJD A;  3URG A;  4M77 G;  3J80 E;  3M4Y A;  3TU4 K;  3X24 B;  2QDY B;  1FWZ A;  3QWL A;  3PIO A;  4M7A F;  2OTJ T;  5I21 A;  3VV0 A;  2LRQ A;  4CRI A;  1YHQ A;  3L2W A;  1KQS A;  5IAY A;  4NL2 A;  4ZTF A;  1QVP A;  2ZPH B;  2K5F A;  2XHC A;  2KMT A;  2EQU A;  2JUF A;  4M78 E;  3PMI A;  1VQO A;  1DJ7 B;  2Y4X A;  4PJO E;  4E7K A;  1QVG A;  5GAN 7;  3HSB A;  2RD1 A;  3MHX A;  4C8Q C;  3SFM A;  4NS5 A;  4F7U B;  4N4H A;  1Y7X A;  2K5L A;  2M9U A;  3FEO A;  3PGG A;  3VKH A;  5D6X A;  3I55 A;  1D3B B;  4JRI A;  4M75 F;  5GAN 8;  3CPW S;  2E6N A;  4M7D G;  1OYX A;  2DZC A;  4JRQ A;  2E70 A;  1FXX A;  3V7S A;  3CCJ A;  4TVR A;  1VIE A;  2O4X A;  4B9X A;  3L2V A;  1UGQ B;  1JBM A;  3FC3 A;  2GFU A;  3RKX A;  4M7A A;  2HQX A;  3WVE B;  5GAN 3;  3L2Q A;  1VQ5 T;  2E41 A;  3CC7 T;  4L5G A;  3DLM A;  1VQL T;  4HLQ A;  3LLR A;  4M78 G;  4M77 C;  2DZ9 A;  1HK9 A;  4YTL A;  3M56 A;  1LNX A;  3SWN B;  5GAM e;  4II1 A;  5DM7 R;  4KT0 E;  4PJO G;  2XID A;  5AYF A;  2QF7 A;  1QVF S;  1Q81 C;  1OZ2 A;  1U1S A;  1XQH A;  3GF5 A;  3BDU A;  2PU9 B;  3BW1 A;  3CCQ T;  3UPU A;  4C92 G;  2OTL A;  2L5Q A;  3LGL A;  2AHJ B;  5GMK i;  4EMH A;  3CBO A;  1K73 C;  2JTF A;  1WQW A;  4M75 A;  4ZN3 A;  3MEW A;  4RG8 A;  1WJS A;  2KDS A;  5EJC A;  1UB4 A;  2E6Z A;  2LQ8 A;  2LQK A;  4Z02 A;  3QYB A;  4RMO A;  3CXC S;  3JB9 G;  4ATO A;  2BS4 A;  2MAM A;  2GCX A;  4ELJ A;  3V7C A;  1JJ2 A;  3S3O A;  2CKK A;  2KAF A;  2X4W A;  3X25 B;  2K4Y A;  3JCM f;  4F7U E;  4ZN1 A;  4M7A B;  5GAN h;  2DD5 A;  3O8V A;  3E1S A;  5CVI A;  4M7D C;  3L42 A;  4JUV A;  1YBY A;  1M8V A;  3OYA A;  2IG0 A;  3TEE A;  4LD6 A;  2XD0 A;  2DXB B;  1U1T A;  4M7A D;  1VQ4 T;  4OB2 B;  3AHU A;  4E47 A;  2RJE A;  1SSF A;  3OB9 A;  4XTY A;  4V2S A;  4M78 C;  2EJ9 A;  2K3Y A;  2M16 A;  3X26 B;  5CKD A;  4L6V 5;  3FIF A;  4PJO C;  4M75 B;  3CC2 A;  3OYE A;  2EQM A;  4ZGD B;  3OS5 A;  5KE3 A;  4FU6 A;  1VUB A;  4XAX B;  1NJI C;  1N27 A;  2DD4 B;  4C92 C;  1YHQ T;  3M9Q A;  2ZPB B;  4HCB A;  4MML A;  1N6A A;  4F7U G;  4A54 A;  3CCU T;  4FSX A;  4E7J A;  4QSH A;  3VUZ A;  4P5N A;  2ZGW A;  2JZ2 A;  5I2M A;  4M77 D;  4BY6 C;  2DD5 B;  1UEB A;  2BS2 A;  4J6Y A;  4D6W A;  1VQO T;  3GIB A;  4QQD A;  3A8G B;  4Y28 E;  3G7Z A;  3RUX A;  3QDR B;  3C94 A;  2V8J A;  3EAE A;  2D9T A;  3OYG A;  1QLB A;  4LDX A;  5FU7 C;  4IUU A;  3I55 T;  3KUF A;  2RB6 A;  2QXF A;  3HFN A;  2DVE A;  5GAM d;  4MZM A;  3CCL A;  3QXE B;  1I8F A;  2KR6 A;  3G71 A;  4R56 A;  3CCJ T;  4KUL A;  1Q82 C;  5GAO q;  1KQ2 A;  4M7D B;  2RHX A;  1VQ8 T;  3CMA T;  2JTM A;  3A8M B;  2JVV A;  2KQW A;  1BI1 A;  1Y96 B;  2DEQ A;  3LX7 A;  3RES A;  5LJ3 d;  2P0P A;  3HKS A;  2RHU A;  2BKD N;  4M7D D;  4ZGE B;  4XU3 A;  2X35 A;  5GAN e;  2EJG A;  3M57 A;  5GAM f;  3G6E T;  3OYY A;  5LJ5 d;  4M78 B;  5FRN A;  4FL6 A;  4M75 E;  5GMK j;  2QQR A;  3M58 A;  3VYH B;  2GFA A;  5D6W A;  3OYD A;  3CME A;  2EFI A;  2JN0 A;  5GAO r;  1LJO A;  1VQ9 T;  2OTL T;  3FJP A;  3CCR T;  4M78 D;  3JCM J;  1KD1 C;  3HB9 A;  3OYN A;  3OYK A;  5J26 A;  4PKC C;  4M7A G;  3MET A;  4X34 A;  4PJO D;  3QYG B;  3DB4 A;  5HK3 A;  2VXF A;  2JOY A;  3V8L A;  1N8R U;  3A8O B;  2VUB A;  4MZP A;  3BG3 A;  1TH7 A;  2QQB A;  2X4X A;  4N0A A;  4C0D B;  1HXD A;  5A0G A;  4XTW A;  3MEV A;  3VU3 C;  1AHJ B;  4N4G A;  4A4H A;  3JB9 D;  4MFD A;  1G3S A;  2DXC A;  3JCM g;  5FRO A;  3VJP A;  3OW2 A;  4OGC A;  2KMG A;  4C5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...