3A8LB

Crystal structure of photo-activation state of nitrile hydratase mutant s113a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8lB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8lB02
4ZGEB 3X28B 3WVDB 3QZ5B 1QP3A 2CZ6B 2DXBA 3X24B 4RKUE 1UGSB 2DD5B 3WVEB 3A8GB 3VYGA 2PU9B 4XK8E 4Y28E 2DXCB 2CZ0B 2WSCE 4OB3B 2CZ7B 4OB1B 3QYGB 4L6V5 2PUOB 2ZPGB 1V29B 2DXBB 2ZZDA 1QP2A 3QYHB 2DD5A 3VYGB 3X25B 1DJ7B 2O01E 2DD4A 2ZZDB 5L8RE 2D0QB 2AHJB 2ZPEB 2CYZB 2QDYB 3A8OB 4OB0B 3A8LB 2PVDB 2WSFE 2PUKB 2DD4B 3HHTB 2WSEE 1IREB 3LW5E 1UGRB 3X26B 3A8MB 1GXIE 4KT0E 2ZPFB 1PSEA 3A8HB 4ZGDB 2PVGB 3QZ9B 1PSFA 2DPPB 1UGPB 2PVOB 1UGQB 4FM4B 2ZPHB 4ZGJB 4OB2B 3X20B 1JB0E 3VYHB 2ZCFB 2DXCA 2ZPIB 2CZ1B 3QXEB 2ZPBB 1AHJB
chains in the Genus database with same CATH superfamily
2I2LA 2XDPA 2CKKA 1ZA1B 1OYXA 2FPEA 4XTUA 1VQMA 2V26A 2GCXA 4ZTJA 4JS5A 4E7KA 2EIFA 2QA4Q 2LT4A 1W70A 3NPFA 1KC8C 3HFOA 2D9TA 3RNJA 4F6WB 5KYUA 2A08A 2QQ8A 2QGFB 2F5TX 1G3TA 3QUIA 1WJQA 2CREA 4KBMB 3UWNA 4KGZB 3OYGA 4LDVA 1G5VA 3OMGA 2RJEA 2HZYA 2MI6A 3MO8A 2YRDA 3F70A 3GIBA 4RTXA 2AIRB 1SF9A 1OU9A 1YHQA 2MF2A 1WX6A 3G71A 1ZBJA 2IIMA 2VB6A 1X75C 2HKQB 3BG9A 1R8OB 4JX6A 5LJ5f 3N5BB 3HKSA 4CFUD 4R55A 5LQFB 1KSWA 3JCMQ 1YBYA 2WFYB 4E7ZA 2B86A 1E7PA 1RABB 3OSVA 1LPLA 1GH6B 4LOCA 1N8RR 1QVPA 1H4LD 3JB9H 1X2KA 1ACMB 4KGVB 3SFMA 4PJOD 1AD6A 1K8AC 2CUBA 2CH4W 4ME7A 4LD9K 4OMMA 2ED0A 4J6WA 1MNEA 2DBMA 2X9HA 2XK0A 5GANg 4FYXB 5GAMh 1OKVB 5IDPB 4C92F 3EOCB 2ROLA 2RH2A 4E7HA 1UGPB 2FHDA 3EGXA 4FM4B 1VQLT 2MWPA 1GCQA 1YHQT 4MMLA 2M02A 5KE3A 4C8QD 2K5FA 3J7AF 4BCHB 2VASA 7AT1B 4M7AB 1UUEA 4KGXB 2XIDA 5FGKB 1M27C 4CI0C 2DTOA 1FINB 3WVDB 1YJWT 1WI7A 1MUZA 2M0YA 3PFSA 2DX1A 5I2SA 3OYHA 4OMQA 4AFQC 2HSPA 3QYEA 3H0HA 3C94A 5FROA 3PVLA 3E1SA 4AFSC 1FMVA 2FPFA 3M9QA 4TVRA 4HNTA 1WQ7A 4YTLA 1K9MC 1SSHA 5GAN5 2CJMB 1QVFS 3CPFA 1UECA 1VQ9A 3PMTA 5KYWB 4PJOE 2ZPGB 1V29B 2DXBB 1VQ7T 4IKFA 2K7AA 4EC8B 4F7UG 3JCMe 2HDAA 1Y96A 2X35A 1OI9B 3M0SA 2MWOA 4WF2A 2XMFA 2RNAA 2QG9B 1VQ4T 1QCOA 4KUIA 2GQIA 4EOJB 2L3SA 1Y7XA 1XJWB 5DQWA 1H92A 5LJ3j 4C92A 2LTOA 3ER0A 3M53A 4AMCA 3OYDA 3DLLA 5BNJB 4F04B 3TNWB 5I2MA 3EH2A 4OMPA 2EKHA 3A8LB 4C92G 4C8QE 1ZQ1A 1QVFP 3L2ZA 5KE2A 1VQ9T 1KHIA 3RERA 2O9SA 1GCQC 1GBRA 2RF0A 2GTJA 2EJFA 1GXIE 2EYWA 1ZSZA 3A5ZB 4BACA 1O9SA 1ABQA 1N9RA 2HQHA 1PNJA 3O0GD 1Q82U 2PVGB 4C0GA 1BIBA 2MAMA 2IVXA 1QKXA 1RUWA 2JXBA 2COYA 2E1HA 1S72Q 3MP8A 2ZPHB 1QMCA 3CCEA 3UA7A 1BI3A 3OYBA 2H8HA 5GJVB 1VQNT 2DXCA 2WXVB 4M7DB 1P92A 2LCSA 4RTZA 2E3IA 1TTHB 1ZLMA 2OI3A 2LQNA 4CC7A 1BI2A 3L1AA 4Z02A 1AVZC 4QQDA 1KD1U 5LJ5g 2I53A 1YITA 3SB2A 2VXEA 4XK8E 2WMAB 1NPPA 3RKWA 2CZ0B 2KXCA 5DM7R 1KQ1A 4PKCC 3EJ1B 2L89A 1G8XA 3RDVA 2BS4A 1JXMA 1XTDA 3H9NA 3QWYA 2HL3A 1ZUKA 4OGCA 2JMCA 3FC3A 1AWOA 1AWJA 4NL2A 2ZGWA 1ZUYA 4F16A 4BCGB 1ZP2A 2ESWA 2CGHA 2K6DA 1QWFA 2QQBA 1Z9QA 4MIMA 4FSXA 4Z89A 4RG8A 2DD4A 2HCKA 3MJXA 2D8HA 3GOXA 3TU4K 3I35A 2L0AA 5DLQE 1M1GA 1VQOT 3JCMV 1M1KU 2QEXT 3CPWS 2BE7D 1I07A 1M3AA 2KVQG 1WFWA 1NPRA 2K3BA 3C4SA 2PHGA 3LWIA 3WXMB 2EFIA 1VQKA 3C0CA 4EOSB 3X26B 1KD1C 2DE0X 3OS1A 1H25B 1MHNA 1VQ4A 2K5LA 2UZDB 2DL7A 2JUFA 1T0JA 2HBWA 3QBYA 3M0PA 4NOYA 1NBEB 2EW3A 2DM1A 1YJNQ 1TUCA 3HB9A 4PFPA 1VQOA 1VQ7A 3CMAA 1AISB 3E9GA 3M58A 3QZ9B 5FRNA 5HKCA 4IUTA 1GY3B 1OIYB 4E47A 1ENWA 3X20B 1M90R 5GAOl 3S3NA 5HVYB 4KH0B 3FJ5A 4PJJA 4M7AF 2CP6A 1NJIC 1OULA 4EIKA 4CFNB 3I56A 1Q86R 1BKBA 2HMAA 1D3UB 1ZX6A 4OMFB 5ECAA 1URCB 2E65A 1WZOA 4BCJB 4EMKA 2CP7A 4J9HA 1UJ0A 1VYTA 1N5ZA 3LYIA 2A37A 4C5GA 4AFZC 5C0MA 1D1AA 4ZNXA 4J5YA 3CBMA 4L6V5 4CC2A 4PNOA 2P0KA 4DOWA 5J3BA 2JM9A 4X1VA 1W6XA 5CKDA 2R58A 1KG1A 4XTXA 3OBWA 3X25B 5GAOp 1UTIA 1IXDA 3OYJA 3RUXA 3S3MA 3EHRA 5IHNA 3RMSA 4EOPB 1WHGA 2PMIB 3I56Q 1GL5A 4FIBA 1WIEA 1VQMQ 1KQSP 1RLQC 1BU1A 4OGRB 2JT4A 4KH1B 3OW2S 2O4XB 2QA4A 1H27B 4II5B 1M2OA 3SHWA 1HK9A 2DO3A 3OYFA 3DKMA 4XU1A 3V7RA 4F7UF 1FWZA 1B34A 2JN0A 4PLIA 2CYZB 2M0OA 5A2QE 1RAIB 3EG1A 2RJDA 1WXTA 5IH2A 4NC6A 3OYNA 3SWNA 3EG3A 2DD4B 1I4K1 1UDLA 2WSEE 3CD6T 2LNVA 4C5IA 4LDXA 2DKGA 4XTYA 1SRLA 4BCFB 1N8RU 3EG0A 2NUTB 4NS5A 2LQKA 4M77B 5GAMf 1NLPC 5LJ3e 2NYSA 2E6NA 5GAOq 4M75G 4EONB 4AKHA 3QSUA 1HYOA 1YJ9A 3CMAQ 3RESA 2VXFA 5A0DA 1QVGA 1C9BA 3SD4A 4BBRM 1FMWA 2QTVA 4HCKA 4N0AA 3FB9A 4XTZA 3LH5A 3BLQB 4A4HA 3CCLA 4M77F 3MY1B 2EKOA 2CS7A 1I1JA 1PKTA 3CCMA 3CCMQ 2BKZB 4LUEA 2ZPIB 2KDSA 3QXEB 2ZPBB 3CCET 1K73C 3KBGA 4A63B 1TG0A 3G6EQ 4O6JA 1YI2T 4JJBA 1ZUUA 2W0ZA 3GF5A 3LGLA 3V8JA 4FSSA 1PRLC 3WVEB 1GCPA 3CXCS 2K3YA 4AG1C 1OV3A 3KFVA 2W99A 4M7DG 1KFZA 3OYLA 2J05A 2EQIA 3REAB 5GAMd 3HTRA 1XOVA 2C5NB 1RACB 4C92B 1Q7YR 1NLOC 1GRIA 5M9OA 2VC8A 4EMKB 3ME9A 1FVVB 1J3TA 3QYHB 2CT4A 1M2VB 2MCNA 4YOSA 2YUQA 3VYGB 3CCUQ 2E12A 5HK3A 3SWNC 4M7AG 2X3XD 4PJOA 1TUDA 3VUZA 1UNHD 1CKBA 1BYMA 2L3QA 3RKYA 1DJ7B 1IGUA 2P4TA 2P4RA 2V8JA 4BY7X 4IMYB 4QSHA 1CSKA 4NSTB 2XI9A 4LE9A 1OOTA 2LQ8A 4M77A 4BI4A 3V8KA 1WJRA 2QDJA 2K57A 4LN2A 1QKWA 3V7SA 4HLQA 4MFDA 2Y4XA 1VQ9Q 1NZ9A 1G3SA 1I5LA 1OX8A 3F5XB 2F2XA 1Y0MA 5AT1B 3RR6A 2CH4A 5CKHA 2MPXC 3PIPA 4AT1B 2ATCB 1X27A 2KYMA 4J9IA 3MEVA 2JS0A 4M78A 3DB3A 4N4GA 4JLGA 3QO3A 1SSFA 5GAN8 3RIRA 2AK5A 2JTFA 3G4SQ 4OMOA 2X4YA 1D0ZA 1IGQA 3VS6A 3HPWA 3LGFA 4GBQA 2EJGA 3OQ5A 5IF1B 4HNUA 4F7LB 1RAEB 5GANd 5CKBA 1ZSZB 2QASA 3CMEQ 4JJCA 3OS2A 3CCST 1O75A 5LJ5d 5CCAA 1NYGA 1OU8A 1ARKA 3X28B 4ZN3A 3O5ZA 4X9CA 4E7LA 4EMHA 4F17A 4IURA 3X24B 2JMAA 2KAFA 4JX4A 4PL6A 4ELJA 4BBSM 1M1FA 2PK2A 2AKKA 3OS0A 4WTOB 2XU8A 3J80E 3JCMX 2ZAEA 4M78E 2WPAB 3GNGA 4EOKB 3HRSA 3I55A 4OP0A 4ROEA 3L42A 5FWBA 4BCOB 1MNDA 2HD0A 1KQSS 2YRCA 1YJ9T 1OPLA 2DL8A 5HBHB 2QK0A 4ELYC 3JB9F 1JEGA 3QG1A 1E7OA 3PT9A 5FRMA 4QKUA 1JOWA 1WNLA 2NLUA 1YHQQ 4C0FA 4OMLA 1T3SA 3M0RA 1OKWB 4F7NB 1IRXA 2VYTA 4J9GA 5LJ5h 5HCKA 4M77C 2C6TB 2D0QB 4JZ3A 4J6XA 3R6NA 2H3JA 3HSBA 4C8QG 1KK7A 1K1ZA 2KT8A 1RLPC 2NUPA 3C95A 4M78B 3EGUA 1PCXA 3VKGA 3ULRB 1IREB 1NYFA 4EMGA 1I8FA 4YOZA 4G6LB 1OL1B 5LJ3d 2RI2A 4EMKC 3NTHA 1OPKA 4JRPA 2BZYA 5EJCA 4XU0A 3PO3S 1CKAA 2C5OB 1LOJA 2QA4T 1H3ZA 2QQAA 4ZGDB 4C8QA 2LNHB 4OR5B 5HQ0B 2QEXQ 5IAYA 5L23A 1RADB 2FYKA 4BCKB 1M1KC 5GMKe 1VQPQ 3EG2A 8AT1B 1VQ5T 3QIIA 1BK2A 2LP5A 4Z88A 4BI3A 2LT1A 3TCJA 1YP5A 3FJPA 3VJPA 3GP8A 4HA8A 4LD6A 1D09B 2FL7A 1OZ3A 1UNLD 5GANf 3QYBA 2DXBA 2WMBB 3P8HA 3OYKA 1X6BA 1UGSB 3SEMA 2KGTA 1RAGB 4BCND 2XG8D 4FT2A 2VKNA 4XAXB 2OTLT 3DDPB 1K0XA 4JRQA 2L2PA 4OB3B 2VGNA 1ZBXA 3BFMA 3M0UA 1RAAB 1D1BA 1NEBA 4Y91A 2WIHB 1YWPA 3BLRB 1IO6A 4D8DA 1W2BP 5CAIA 1WPYA 5J26A 2HNIA 1FKMA 1P5EB 1MV0B 1ZA2B 4C92E 1AZEA 3G71T 4BCQB 3G4ST 2QDLA 3MP1A 1X01A 1TSFA 1W2BS 1NJIR 3CXCP 1D0XA 1Q86C 3AHUA 4FYYB 2O01E 2RK2A 1M30A 4C0DB 3H0IA 1X6GA 2HBPA 3HL8A 1GUXA 2AHJB 3JCMW 2RHZA 4FW2A 4OB0B 3HFNA 3CC4Q 5CQYA 3JCMP 2DXUA 3CEYA 4MZMA 1RAHB 2UZLB 1YWOA 1WQWA 2DF6A 3VS7A 4F7UE 5FW9A 1EIFA 1FXXA 2ENMA 5GAMe 3VU3C 5D6YA 5I21A 5CVIA 4DEYA 1YJWA 1YITQ 1H641 2KR6A 2BKDN 2RI3A 2NUPB 5L2WB 2CP5A 2X4WA 1PSFA 3MCAB 3V8LA 2DFUA 3BW1A 3UA6A 3LH0A 4HCBA 4BY1X 4AKIA 3CC2Q 4EOMB 4XU3A 4ZGJB 4JJDA 1VQ6A 2K5IA 1PC0A 1K0SA 4FL6A 4N4HA 3CC4A 4JRKA 4HT9A 4ZGEB 4J9BA 3I5SA 2JZ2A 2FZGB 1K9MU 2QYZA 1N4MA 4CXAB 2DRKA 2C0OA 5EFQB 1BCMA 1T3LA 4CC3A 2L3PA 4C92C 3EHQA 4BDYA 1WHHA 2DXTA 1ZSZC 3NHNA 2GFUA 1O9KB 4F6UB 3TNIB 1YIJT 1ABOA 4QVZA 3MKDA 2DZCA 1QCFA 2EYQA 2LX9A 5D7UA 3OW2P 4J8OA 1JSUB 3CCRT 3CCJQ 2IG0A 3CCJA 4C0DC 4BDZA 3T9NA 4EOQB 1SHFA 2ABLA 3CQTA 4PJMA 3JSCA 3AT1B 4IUVA 2JVVA 3MEAA 2QXFA 3VKIA 4B9WA 1UFFA 1VQKQ 3E2UA 1NM7A 3EAEA 4ZTFA 3TNHB 2PNIA 4M4ZA 3JCMh 5A0LA 3JCMd 5GMKl 2RPNA 4LDWA 2A3LA 2DMEA 2JM8A 1KJWA 3A8MB 2IW8B 4JLIA 1PWTA 4N0AC 2ZPFB 1PSEA 1WHMA 1VQMT 1YJNA 5FLXE 3BG5A 5IHKA 2FRYA 1YFNA 3M54A 3VS4A 2KT1A 2GNCA 5FU7B 2HL5C 2YRVA 1MMDA 1EFNA 3EFRA 3VRZA 4FU6A 2CZ1B 1Q82C 1Q82R 1U8RA 4C5HA 4RTWA 4QVCA 3EGXB 3FEOA 2CP2A 4EPCA 2CZ6B 4IUUA 2W9ZA 5GAOn 4LXCA 2QQ9A 2QGGA 5GAOm 2RHYA 1K8AU 1SRMA 2C4GB 2QQRA 5IN1A 2B8AA 1QLYA 2DVEA 2RB6A 3OW2A 4BY6C 3BG3A 3REBB 3L2RA 2KRSA 2WSCE 2RM4A 2EJ9A 2KQWA 3M55A 1H1RB 1A0NB 3VKHA 2X3WD 4RUGA 3BHTB 3RGFB 3JCMf 4A4KA 3NFCA 4AKGA 3A98A 1VQ6T 5GAN4 4P5NA 4RTUA 1T0HA 1VUBA 1C1AA 4DBFA 2DD5A 4PJNA 4A4EA 1UE9A 4X9DA 2MK5A 1EZZB 5GAMg 1WA7A 2GFAA 1H26B 3RMQA 1I0CA 4ELZC 1IHWA 3G6ET 4BE2A 1UGVA 3G7ZA 1H8KA 2D6FA 4J9EA 1VQ8A 2EVRA 1VQ8Q 3G33B 4M78D 3G4SA 1KQSA 2BUDA 3L2QA 1C0MA 4OGEA 5IXFA 4GY5A 5GANe 4AG2C 2KRNA 3A8OB 4YC3B 1GFCA 2PQWA 4DBQA 2HQEA 2WSFE 1NE8A 5HY6A 2LQWA 2K2VA 3HHTB 3G6EA 2RQVA 5GMKm 1UGRB 2CP0A 1R0CB 4MZPA 3EGDA 3GBQA 4F7UA 1H24B 5I11A 5CO7A 4BB7A 4M7DE 3P8BB 1TWBA 2RQUA 1QCNA 3EH1A 3HP9A 2FZCB 1VOMA 1Q7YC 4M7AD 3CXCA 2YWWA 2SEMA 3ZL7C 1PD1A 3K7AM 2GF7A 2X4JA 1AD5A 1I81A 1G3WA 4A53A 5GANh 4C8QB 4ANJA 1K9AA 4FX3B 1BI1A 5AYFA 2DK3A 1U5SA 1M8MA 4EORB 5HNBB 4F70B 2SRCA 3EFOB 2EGCA 2GGRA 4MDXA 2COZA 1OZ2A 3I5RA 4JZ4A 4Q5WA 4M7DF 2QEXA 3EIDB 4CRIA 4BCQD 4M75F 2QGSA 5LJ5j 3UT1A 3OB9A 3KUFA 2LC4A 1S72A 2RQRA 5A0GA 1PRMC 3CMAT 1D3BB 1U06A 4WCIA 3CMET 2BZ8A 3INZA 1VQLA 1QLBA 4XTWA 1RI0A 3URGA 4HT8A 1KIKA 4BUGA 2WACA 4D8KA 2XICA 2HAXA 1AEYA 2CDTA 2NWMA 4AI6A 4RCBA 1Y57A 3G71Q 1VYWB 1K4US 2KMTA 2G9XB 2PK9B 1VQNQ 3VS1A 2ZZDB 4MMKA 1M2VA 3JB9G 1HXDA 3QDRB 1YI2Q 3RKXA 1S72T 2RQTA 3CCVA 3CCVQ 3DDQB 2LJ0A 1OX9A 4QQGA 3CMEA 2JTEA 2KROA 2BS2A 1WHJA 3CBOA 1TH7A 3KHIA 4LDYA 3CCRA 2RMOA 3BY7A 3I56T 5GJWB 1OEBA 2HQXA 4PJOC 2DERA 3VUBA 2WJ9A 4V2SA 2AZVA 1BU2A 2DVJA 1R77A 4EDUA 2F2CA 1UHFA 1H1SB 1VQ8T 2B9RA 2E5KA 1XO2A 2R5MA 4RODA 2EBPA 2UZBB 4QVDA 5GAN3 2CCIB 2CSIA 4EOLB 1AZGB 2OJ2A 4KRTA 1YJNT 3QDFA 3QPHA 1BBZA 4F7SB 1VQ6Q 4OB2B 1E6HA 3O8VA 4AFUC 2ZCFB 2COWA 4EOIB 5ACBA 4UN0A 1RI9A 4FT4A 4J83A 4B9XA 2V1RA 1W2BA 1WLPB 1OQKA 2E4HA 1AHJB 2DL5A 1OI1A 2YUPA 3JV3A 1TU0B 1XNIA 2XDDA 2E41A 1E9HB 2KXDA 2DIQA 2XD0A 1D3BA 3JB9J 2Y90A 1VQ4Q 3QWLA 2C0IA 4M7AA 1BIAA 1JKWA 3A8GB 4CFVB 1Y96B 3CBPA 1WJSA 1UHCA 1YN8A 4JRIA 1U3OA 3I55Q 1FX7A 1KQ2A 4L59A 2PUOB 3QHWB 3VS5A 5IHIA 1QP2A 3TSWA 2VV5A 2V22B 4F6SB 1VQKT 3OY9A 2DEUA 4JDSA 4B6MA 5IDNB 3TN8B 3FDRA 5EG2A 4J9DA 5KYWA 5DLOA 3DLMA 2ECZA 3TW7A 3SWNB 2CUDA 4JPBW 4FYWB 4J9CA 1AOJA 1XQHA 1LNXA 4DA4A 2A0FB 2QFZA 2D1XA 1YI2A 4R56A 1TS9A 3R6OA 1JO8A 2DIGA 2X1NB 4DOVA 2KNBB 5EC7A 3H6ZA 4RTVA 2HEQA 4J7FA 2M51A 4C5EA 1KHCA 3LW5E 1WXUA 1N9SA 3M4YA 4PLLA 2DYIA 4M75A 1B34B 2DL3A 5LL6S 2QI2A 1YCSB 4J9FA 4M78G 3TW6A 2MYSA 3TQ7P 2UUEB 2LW4A 3OYIA 2I0NA 2QTXA 1M1KR 2NUTA 4M77G 2KK4A 3L2UA 2XKOC 3VS2A 2D0NA 4RG2A 1WHKA 2YUNA 2KE9A 3M5AA 3CC7A 2LCLA 3A1PA 2M1HA 1MMGA 5CK9A 2DL4A 3FRNA 3MY5B 3BDLA 3PIOA 2KMGA 4K11A 1PG5B 5GAOr 1X6OA 2RHIA 3CCSQ 1MMNA 1PD0A 1K9MR 4LUDA 3CCVT 2R5AA 1W1FA 2A36A 3DTOA 4OVAA 2OTJA 5KCHA 2DTIA 2DNUA 1VYUA 2F5KA 2DXCB 2Y4YA 1VQ7Q 3CD6Q 2DYBA 2JGZB 2KRMA 1BI0A 1QW1A 4M7AC 5KYNA 2A28A 3FLGA 1M8VA 2RD1A 2DETA 2UZEB 2R57A 1KC8R 4IIMA 4NL3A 2KEAA 1UJYA 1U1TA 2IN3A 1YJWQ 1G2BA 3CC7Q 3PGGA 4EC9B 3S6WA 3POMA 1YJ9Q 5LMKB 1MV3A 2G3RA 5C6SA 3ASKA 2OTJT 3DB4A 2P84A 3PNWC 2K2MA 3TREA 1JJ2S 3CCSA 3OS5A 5GAMj 3TSZA 4HCCA 1AT1B 2FVUA 5I5ZB 2OAUA 4Y92A 2EUFA 2ZPEB 2V1QA 1IHVA 1N6AA 4FW1A 1NJIU 4ZN1A 3CCQQ 1VYVA 1GBQA 2FPDA 3TVTA 3CPWP 5D6XA 5IT9E 2JNGA 5CEIB 4GLKA 5GAN7 2J7IA 3I55T 1HD3A 4IIOA 2FG0A 2O9VA 3CCUA 3META 4KULA 1UG1A 2EPDA 1UB4A 2BIVA 3RBBB 4KRDB 6AT1B 4PJLA 2K4YA 2EQMA 4CFMB 1VQOQ 3VV0A 5LJ3h 4C0ZA 1G3NC 2RK1A 2YHTA 2DZ9A 1M3CA 3C12A 1H3HA 4ROCA 4RTYA 2C5VB 2LX7A 1Q7YU 2L8DA 1WDXA 2QAZA 1BCOA 4M7DD 2E6ZA 1FMKA 2JJ9A 2WEVB 2NUZA 3CCUT 2V8KA 2XHCA 2EAYA 3BDUA 1B7TA 2KY9A 2DLPA 1NEGA 2E64A 1QMZB 2FO0A 2GTOA 4M6VA 9ATCB 1WXBA 1AWXA 4E2FB 3VS0A 2EQUA 2I40B 2PU9B 4Y28E 1JU5C 3HRUA 2OX7A 2F1LA 8ATCB 2LCCA 1QVFA 4PFZA 2RI5A 4CFWB 2A7YA 5IXBA 2CZ7B 4HVVA 2BS3A 2LZ6B 2VGMA 5I22A 1SG5A 4BCIB 1QQJA 1SPKA 3UDCA 4HKEA 5FU7C 2O4XA 2CSQA 2QQSA 5IHYA 1VQ5A 3BLHB 4IUQA 4JX5A 1YITT 2O31A 1O9KA 2HSEB 2J6OA 1W98B 2RN8A 5CKEA 3EG9B 1PHTA 2C0TA 3JCMb 4BI8B 2L5QA 5CR2A 3M57A 2QF7A 2E3HA 4M77D 3V7CA 2W10A 1SKUB 4IUPA 3GLXA 2QDYB 2VUBA 4BCMD 1PM3A 2MMPA 3OMCA 2LVMA 1K73U 2PVDB 3LQ5B 2PZ1A 2PUKB 2YLBA 2OTLA 1OGUB 1D0YA 5GAN6 1W4SA 1AWWA 4M75E 5LJ3f 1M3BA 1UNGD 3THKA 5J39A 5HK0A 5LJ5e 1Q81R 3M56A 3KXTA 1OL2B 4M7DC 4BCPB 4OF1A 2DA9A 3QHSA 2E5QA 1X69A 2DPPB 3HO8A 1MGQA 2YDLA 3L2VA 4E6RA 2KI7A 4O5VA 3UPUA 3JCMJ 4A4GA 5KH6A 2RA2A 1ZHIA 2LJ3A 1HSQA 3HBLA 1YNZA 1JQQA 3OBYA 2C5XB 3JB9D 4RTTA 4PJOF 1M9SA 4JUVA 3CCRQ 2YUOA 3ZFJA 3SDZA 4RKUE 4HL4A 4M77E 2GBQA 2LDMA 3OYEA 1M5Q1 4C92D 2EQJA 2DD5B 3CCQT 1LVKA 3VYGA 4BD3A 2P0QA 4BXXX 1VIFA 4M7DA 4RMOA 4CRLB 1M4ZA 4OB1B 3QYGB 3GPLA 2OTLQ 1UEBA 2X4XA 3E9FA 3OSSC 1Q95G 2RJCA 2FZKB 1B07A 2KR3A 4PK4A 3CCJT 4X34A 3B57A 2O88A 1QVGP 4CFUB 2LRQA 4ATOA 1B3QA 1GUXB 5CQXA 4F7JB 3DJBA 1FYNA 3I9QA 4PFOA 3BHUB 2FEIA 5HBJB 3GNFB 1Y07A 4XQ3A 1X43A 2CP3A 5L8RE 3LX7A 4XTVA 3JCMg 1QVGS 2E70A 1G3YA 1N8RC 1OIUB 3U23A 2M9UA 3J81E 2EGEA 1QWEA 1WGSA 2MOXA 1F5QB 1GFDA 4M78F 4BE0A 5GANj 5KYXB 4YOOA 1VINA 3TEEA 2DEQA 2VWFA 3UATA 2J06A 3QJ6A 4FCYA 4KT0E 2F2WA 3H41A 3NGPA 5FU6B 5KYYA 2CCHB 2IVWA 5HBEB 3D7SB 3NTKA 2KYBA 4M78C 4D6WA 2X51A 1Q86U 2BZXA 3Q1JA 3JRZA 2PVOB 1VIEA 1VQNA 3H0FA 3H8ZA 3CPWA 2YSQA 1UGQB 2JW4A 1RL2A 1VQPA 1IB8A 3PMIA 3MHXA 2G77A 1IZ6A 3CCEQ 4M75B 2FRWA 3QHRB 4F7UB 5D6WA 3M03A 2K79A 3JAME 1JRIA 2K9GA 1VQLQ 3DOGB 3H4CA 4A4FA 4OMNA 4MFEA 3OYMA 3IQLA 1M90C 2RHUA 2EYYA 2EYZA 1E6GA 2WHBB 4BCNB 1H1PB 4I3ZB 1HJDA 3GTMS 3VS3A 2OTJQ 4C8QF 3MP6A 5CKFA 3BHVB 3CC2T 1N27A 4J6YA 5CIUA 4CC4B 4XU2A 3L2WA 3ZEHA 2IW9B 3HZJA 2Z0WA 2DRMA 4M75C 3CCMT 4TTHA 2YLCA 4GLMA 1V1CA 4II1A 3MPUB 2ZZDA 3FIFA 1JJ2A 3HRTA 1TXQA 1Q81U 1S1NA 2M16A 1U1SA 1LJOA 3M0TA 1V76A 2FB7A 1F1BB 3MI9B 4LDUA 3M59A 5FU6C 2LMJA 2VVKA 1LCKA 2DMOA 3QKJA 2W2HA 3UF4A 3E19A 5FWCA 2RQWA 3MEUA 4E7JA 4E7IA 3DL1A 5KYYB 4C8QC 1JSTB 4LNPA 2IPOB 1C6VX 1YIJQ 2RJFA 1WHLA 1Q81C 4HVUA 4ELLA 1MMAA 2CT3A 3PTAA 2V8IA 1VOLA 5CYIB 1KXUA 2O2OA 4FYVB 4BE1A 3OYCA 1PKDB 2AKLA 2JS2A 5ICPB 2EGAA 3LLRA 4MZTA 4L5GA 4HNVA 1ZSGA 4DBHA 5GMKi 3MEWA 2YT6A 1H1QB 4JJNK 5KYXA 4DQ2A 3CC7T 2YXYA 3JCMc 2DILA 3VYHB 2XDBA 3S3OA 1Z9ZA 1YIJA 2P0PA 3M4GA 2H3EB 1TOVA 1K73R 3QZ5B 1QP3A 2EYXA 4J7IA 4DEXA 4M75D 3EFSA 4EOOB 5KCOA 1JJ2P 2OAWA 2LJ1A 1D1CA 3G1JA 1K8AR 2W96A 3NDQA 2W9FA 4UC4A 1Y71A 2KSSA 4QW2A 3P8DA 2D8JA 4KRCB 3VRYA 3QWXX 1YCYA 2PTKA 2EWNA 2BE9B 3OYAA 2F69A 3CCQA 2BPMB 1SEMA 2E10A 3EG9A 3CC4T 2RO0A 3CCLT 3PE0A 1G83A 1NG2A 2ED1A 5GMKj 1RAFB 1JXOA 4CFXB 4ESRA 2JOYA 2HKNA 1K76A 1R0BG 4HXJA 1TD6A 2K3XA 2KBTA 4VUBA 4BY6B 5KYUB 2EQKA 3MIAB 3PVQA 2RHXA 3OA6A 5GMKh 2AT1B 2ROTA 4RCCA 3NMZC 1TUGB 5GAN2 3ZBDA 4R0KA 1X2QA 1BB9A 4ORZA 4Z6YA 1JBMA 3CC2A 3M0QA 3EGDB 2IW6B 4KUDK 3CCLQ 3CD6A 4PJOB 2F2VA 3JB9I 2DAQA 1I5OB 4Y72B 2DTHA 1SHGA 2PJQA 3OYYA 1VA7A 4QQ6A 2J6FA 4JS4A 2MIOA 1KD1R 2L3RA 4F14A 4DBRA 4HCZA 1WYXA 5DY9A 4QT7A 4Z8AA 4A54A 4BCMB 1TFBA 2AZSA 3A8HB 4HVWA 1EX4A 2DJZA 2J6KA 1H28B 2WIPB 5LJ3g 5DQVA 2DBKA 1KC8U 2BTTA 2C06A 4M7AE 1PKSA 2GQVA 2G6FX 2R7GA 2DJQA 3EFOA 1M90U 3BE3A 1JB0E 4MDWA 4PJOG 1VQPT 1VQ5Q 4N4IA 2JTMA 3NTIA 3LWHA 3QJYA 4E7SA
chains in the Genus database with same CATH topology
2I2LA 2XDPA 2CKKA 2EAYA 3BDUA 3KBGA 4QVCA 1VQ6T 3FEOA 1OYXA 4XTUA 1VQMA 4O6JA 2KY9A 2GCXA 4EPCA 2CZ6B 2E64A 4IUUA 4ZTJA 1YI2T 5GAOn 4JS5A 2QQ9A 4M6VA 3GF5A 5GAOm 2RHYA 3LGLA 2EIFA 5IN1A 3V8JA 2QQRA 4E7KA 2B8AA 2LT4A 1K8AU 2DVEA 3WVEB 2EQUA 3CXCS 2K3YA 2PU9B 4Y28E 2RB6A 3OW2A 1KC8C 3HRUA 3HFOA 2LCCA 4BY6C 2D9TA 3BG3A 1QVFA 4M7DG 3OYLA 2RI5A 3L2RA 2WSCE 2A7YA 2RM4A 2CZ7B 5GAMd 2EJ9A 1XOVA 2KQWA 2QQ8A 3M55A 2BS3A 2VGMA 3VKHA 3JCMf 3UDCA 4A4KA 3NFCA 4AKGA 4HKEA 4C92B 5GAN4 2F5TX 1G3TA 4P5NA 3QUIA 5FU7C 5M9OA 1VUBA 2VC8A 4EMKB 3ME9A 2O4XA 1WJQA 3QYHB 2DD5A 4KBMB 3UWNA 3VYGB 4A4EA 2E12A 4X9DA 4LDVA 5HK3A 3OYGA 1G5VA 3OMGA 2RJEA 3SWNC 2MI6A 2GFAA 2QQSA 3MO8A 3F70A 3RMQA 5GAMg 1VQ5A 4M7AG 4ELZC 3GIBA 3VUZA 4PJOA 3G6ET 4BE2A 4IUQA 1BYMA 4JX5A 3RKYA 3G7ZA 1YITT 1DJ7B 2P4TA 2V8JA 1YHQA 2D6FA 1VQ8A 2MF2A 5CKEA 3G71A 4QSHA 4M78D 3G4SA 1X75C 1KQSA 2BUDA 3BG9A 1R8OB 4JX6A 2XI9A 5LJ5f 3N5BB 3L2QA 2LQ8A 3HKSA 4R55A 3JCMb 4OGEA 4BI8B 3JCMQ 4GY5A 5GANe 2L5QA 1YBYA 4M77A 3M57A 4BI4A 5CR2A 2QF7A 3V8KA 1WJRA 4M77D 3V7CA 4IUPA 2QDJA 3GLXA 2QDYB 3A8OB 2VUBA 2K57A 2MMPA 3OMCA 2LVMA 3V7SA 1K73U 1E7PA 4HLQA 4MFDA 2Y4XA 2PQWA 2PVDB 2HQEA 2WSFE 1NE8A 3OSVA 2PUKB 5HY6A 1NZ9A 2YLBA 2OTLA 1G3SA 2K2VA 3HHTB 4LOCA 1I5LA 1QVPA 3G6EA 5GAN6 1W4SA 5GMKm 3JB9H 1UGRB 4M75E 5LJ3f 3SFMA 4MZPA 4PJOD 5CKHA 5J39A 5HK0A 5LJ5e 3PIPA 4F7UA 1K8AC 4ME7A 4LD9K 5CO7A 4BB7A 3MEVA 3M56A 3KXTA 4M7DC 4M7DE 3P8BB 4J6WA 2XK0A 4M78A 3DB3A 4N4GA 4OF1A 4JLGA 5GAMh 5GANg 3QO3A 1SSFA 3QHSA 4C92F 5GAN8 2E5QA 3RIRA 2RH2A 2JTFA 2DPPB 1UGPB 4E7HA 2FHDA 2X4YA 3HO8A 3HP9A 4FM4B 1MGQA 1VQLT 1Q7YC 4M7AD 3L2VA 3CXCA 3HPWA 2MWPA 1YHQT 3LGFA 4MMLA 5KE3A 2EJGA 3OQ5A 4O5VA 4C8QD 3UPUA 2K5FA 3JCMJ 3J7AF 4A4GA 5KH6A 2GF7A 2RA2A 2X4JA 1I81A 4HNUA 1ZHIA 4M7AB 1G3WA 2XIDA 4A53A 5GANd 5CKBA 3HBLA 3OBYA 5GANh 4C8QB 4CI0C 2DTOA 3CCST 3OS2A 3JB9D 1O75A 5LJ5d 4PJOF 5CCAA 1M9SA 3X28B 3WVDB 1YJWT 1BI1A 3PFSA 4ZN3A 4X9CA 5AYFA 4JUVA 2DK3A 5I2SA 4E7LA 3OYHA 4EMHA 4IURA 3ZFJA 3SDZA 3X24B 4HL4A 4M77E 4RKUE 2LDMA 3OYEA 3QYEA 2KAFA 1M5Q1 4JX4A 4C92D 4PL6A 4ELJA 4BBSM 1M1FA 2EQJA 3C94A 2DD5B 5FROA 3OS0A 3E1SA 3CCQT 4MDXA 3VYGA 3M9QA 1OZ2A 4TVRA 4BD3A 4HNTA 2XU8A 3J80E 2P0QA 1WQ7A 4YTLA 3JCMX 4Q5WA 1VIFA 1K9MC 4M78E 4CRIA 5GAN5 2QEXA 4M7DF 4M7DA 4RMOA 3GNGA 4M75F 1QVFS 1M4ZA 3CPFA 1VQ9A 3PMTA 5LJ5j 3UT1A 4OB1B 3HRSA 3QYGB 3KUFA 3OB9A 4OP0A 3I55A 3GPLA 4PJOE 2ZPGB 1V29B 1UEBA 2DXBB 2LC4A 2X4XA 3E9FA 3OSSC 5A0GA 1S72A 1VQ7T 3CMAT 4IKFA 1D3BB 3L42A 4F7UG 2RJCA 2HD0A 1KQSS 3CCUT 1YJ9T 3CCJT 4ELYC 4X34A 3JCMe 3CMET 3JB9F 1Y96A 3INZA 2X35A 3QG1A 1VQLA 2LRQA 1QLBA 4XTWA 2MWOA 4ATOA 1RI0A 4WF2A 3URGA 4HT8A 4BUGA 3PT9A 2WACA 5CQXA 1VQ4T 5FRMA 2XICA 4KUIA 1WNLA 2NLUA 2HAXA 1Y7XA 4C0FA 4AI6A 4RCBA 3GNFB 1Y07A 5LJ3j 4C92A 2LTOA 4XQ3A 2KMTA 3ER0A 2ZZDB 3M53A 2VYTA 4MMKA 3QJYA 3OYDA 3DLLA 5L8RE 3JB9G 1HXDA 3LX7A 5LJ5h 4XTVA 3JCMg 1QVGS 3QDRB 4M77C 2E70A 2D0QB 1G3YA 4J6XA 3RKXA 1S72T 1N8RC 3CCVA 5I2MA 2M9UA 2H3JA 3HSBA 4C8QG 4QQGA 3J81E 3A8LB 3C95A 3CMEA 4M78B 3VKGA 4C92G 2BS2A 4C8QE 1WGSA 1ZQ1A 1IREB 1TH7A 3KHIA 3CBOA 1I8FA 4LDYA 4M78F 3BY7A 4EMGA 3I56T 3CCRA 3L2ZA 4BE0A 5LJ3d 5KE2A 2HQXA 5GANj 4PJOC 1VQ9T 1KHIA 3RERA 2RI2A 3VUBA 4EMKC 3TEEA 2DEQA 2WJ9A 3NTHA 3QJ6A 4V2SA 2EJFA 1GXIE 4KT0E 4JRPA 5EJCA 5FU6B 4XU0A 4EDUA 1LOJA 2IVWA 2QA4T 1VQ8T 2QQAA 1H3ZA 3A5ZB 4ZGDB 3NTKA 4BACA 4C8QA 1O9SA 4M78C 1N9RA 1Q82U 2PVGB 4D6WA 5IAYA 4C0GA 1BIBA 2MAMA 1Q86U 2R5MA 3Q1JA 4QVDA 5GAN3 3JRZA 2PVOB 1VIEA 1VQNA 3H8ZA 2FYKA 3CPWA 1UGQB 1YJNT 1RL2A 2E1HA 3QPHA 3MP8A 2ZPHB 1VQPA 1M1KC 5GMKe 1VQ5T 3PMIA 3MHXA 3QIIA 2G77A 1IZ6A 4BI3A 3CCEA 4M75B 2LT1A 4F7UB 5D6WA 4OB2B 1BI3A 3TCJA 3OYBA 3O8VA 3JAME 1VQNT 1JRIA 2ZCFB 4B9XA 3FJPA 4FT4A 3VJPA 4J83A 2DXCA 3GP8A 1W2BA 3H4CA 4A4FA 4M7DB 1P92A 1AHJB 4HA8A 4LD6A 1OI1A 1OZ3A 2FL7A 4MFEA 1XNIA 2XDDA 3OYMA 1BI2A 3L1AA 4Z02A 1M90C 2E41A 3QYBA 2RHUA 2DXBA 5GANf 3P8HA 3OYKA 2DIQA 4QQDA 2XD0A 1D3BA 3JB9J 2Y90A 1KD1U 1UGSB 5LJ5g 3QWLA 1YITA 3SB2A 4M7AA 1BIAA 2VXEA 3A8GB 1Y96B 4C8QF 4XK8E 3MP6A 5CKFA 2XG8D 4FT2A 4XAXB 2OTLT 1NPPA 3RKWA 2CZ0B 1N27A 3CBPA 4J6YA 5CIUA 5DM7R 3L2WA 4XU2A 4JRQA 1KQ1A 1WJSA 4PKCC 2L89A 4OB3B 2VGNA 3ZEHA 1ZBXA 4JRIA 3HZJA 3BFMA 2BS4A 4M75C 1XTDA 1FX7A 4Y91A 3CCMT 1KQ2A 4L59A 2PUOB 2YLCA 4II1A 4OGCA 3FC3A 5CAIA 1WPYA 2ZZDA 4NL2A 5J26A 1QP2A 2HNIA 3FIFA 1FKMA 2VV5A 2ZGWA 1JJ2A 3HRTA 1Q81U 4C92E 2M16A 1U1SA 1LJOA 1VQKT 2FB7A 3G71T 3OY9A 3G4ST 2CGHA 3MP1A 2QQBA 1X01A 4JDSA 4LDUA 1W2BS 4MIMA 3M59A 1Q86C 3FDRA 4FSXA 5EG2A 5FU6C 5DLOA 3AHUA 3DLMA 3TW7A 4RG8A 2O01E 2RK2A 3SWNB 4C0DB 2DD4A 3QKJA 3GOXA 3TU4K 5DLQE 3E19A 1XQHA 1LNXA 1M1GA 4DA4A 3MEUA 1VQOT 2HBPA 2QFZA 3JCMV 1M1KU 2QEXT 3CPWS 4E7JA 4E7IA 1YI2A 3DL1A 4R56A 2KVQG 3HL8A 3JCMW 2AHJB 3R6OA 4C8QC 1NPRA 2DIGA 4DOVA 2RHZA 4OB0B 3C4SA 3HFNA 3H6ZA 5CQYA 2RJFA 3JCMP 3LWIA 2DXUA 3WXMB 2EFIA 3CEYA 1VQKA 4J7FA 4MZMA 1Q81C 4C5EA 1KHCA 1WQWA 3LW5E 4F7UE 3X26B 3PTAA 1KD1C 1N9SA 1EIFA 1FXXA 2V8IA 3M4YA 4PLLA 1MHNA 3VU3C 5GAMe 3OS1A 2K5LA 1VQ4A 5D6YA 4BE1A 5I21A 4M75A 2JUFA 1B34B 5CVIA 1YJWA 3QBYA 3OYCA 1H641 4NOYA 5LL6S 2QI2A 2KR6A 2BKDN 2RI3A 4M78G 1VQ7A 3HB9A 1VQOA 3TW6A 3LLRA 3CMAA 4MZTA 4L5GA 4HNVA 2X4WA 3E9GA 5GMKi 3M58A 3QZ9B 3MEWA 1PSFA 3MCAB 3V8LA 5HKCA 5FRNA 4IUTA 3BW1A 3OYIA 3LH0A 4JJNK 4HCBA 2QTXA 4E47A 4DQ2A 4M77G 3CC7T 4AKIA 3JCMc 2KK4A 3L2UA 4XU3A 2XKOC 4ZGJB 1VQ6A 2K5IA 3X20B 3VYHB 4RG2A 5GAOl 2XDBA 3S3NA 4FL6A 3S3OA 3M5AA 3CC7A 4N4HA 2LCLA 1YIJA 3CC4A 4M7AF 4JRKA 2P0PA 3M4GA 4HT9A 1NJIC 2M1HA 4ZGEB 5CK9A 3I56A 1BKBA 3FRNA 2JZ2A 3BDLA 3QZ5B 3PIOA 1K9MU 2KMGA 1QP3A 4J7IA 4OMFB 5GAOr 1X6OA 2RHIA 2E65A 4M75D 3EFSA 3CCVT 2R5AA 5KCOA 4EMKA 4OVAA 2OTJA 5KCHA 4C92C 3LYIA 2DTIA 4C5GA 2F5KA 4UC4A 1Y71A 2DXCB 2KSSA 2Y4YA 5C0MA 2DXTA 4QW2A 4BDYA 3P8DA 2GFUA 1BI0A 4J5YA 1YCYA 2EWNA 1QW1A 4M7AC 3OYAA 2F69A 3FLGA 3CBMA 3CCQA 1M8VA 2RD1A 4L6V5 2R57A 2E10A 4PNOA 2P0KA 2RO0A 4QVZA 5J3BA 4DOWA 3CC4T 3CCLT 5CKDA 1YIJT 2R58A 4NL3A 5GMKj 1KG1A 4XTXA 3OBWA 2JOYA 2DZCA 3X25B 1U1TA 5GAOp 2K3XA 2EYQA 3OYJA 2LX9A 4VUBA 3RUXA 3S3MA 3RMSA 4BY6B 3PGGA 4J8OA 2EQKA 3S6WA 3CCRT 2G3RA 2IG0A 3CCJA 5C6SA 4ZTFA 2RHXA 4C0DC 3ASKA 2OTJT 4BDZA 3DB4A 3T9NA 3PNWC 4FIBA 3OA6A 3TREA 1JJ2S 5GMKh 3CCSA 4RCCA 3OS5A 5GAMj 5GAN2 3ZBDA 3OW2S 2O4XB 2QA4A 1HK9A 2DO3A 3OYFA 4HCCA 4Z6YA 3DKMA 1JBMA 3CC2A 3JSCA 4XU1A 4IUVA 2JVVA 3V7RA 2FVUA 4F7UF 1FWZA 2OAUA 4KUDK 1B34A 2JN0A 3MEAA 3CD6A 4PJOB 4PLIA 2ZPEB 2QXFA 3VKIA 2CYZB 2M0OA 4B9WA 5A2QE 1N6AA 3JB9I 1NJIU 2DAQA 2RJDA 3CCET 4ZN1A 4NC6A 3OYNA 3SWNA 4QQ6A 2DTHA 2DD4B 3OYYA 1I4K1 3EAEA 5D6XA 4JS4A 3JCMh 2WSEE 5A0LA 2LNVA 5IT9E 4C5IA 2JNGA 4LDXA 2DKGA 3JCMd 5GMKl 3CD6T 4XTYA 4GLKA 2L3RA 4LDWA 1N8RU 2A3LA 4HCZA 5GAN7 3A8MB 5DY9A 4NS5A 3I55T 4JLIA 4N0AC 2LQKA 3META 4M77B 5GAMf 4KULA 4C5HA 3CCUA 4A54A 5LJ3e 2ZPFB 2E6NA 5GAOq 1PSEA 4M75G 1UB4A 3CC2T 4AKHA 2BIVA 1VQMT 1YJ9A 1YJNA 3QSUA 2K4YA 3A8HB 2EQMA 5FLXE 3VV0A 5LJ3h 2DJZA 3BG5A 4C0ZA 2RK1A 2YHTA 5LJ3g 2DZ9A 3C12A 3M54A 1KC8U 3RESA 2C06A 2VXFA 5A0DA 4M7AE 1QVGA 5FU7B 2GQVA 3SD4A 4BBRM 4N0AA 2YRVA 3FB9A 4XTZA 1Q7YU 1M90U 2L8DA 4A4HA 3CCLA 4M77F 2EKOA 2CS7A 1JB0E 4M7DD 3EFRA 2E6ZA 4MDWA 4PJOG 3CCMA 4FU6A 1VQPT 2ZPIB 2CZ1B 2JTMA 2KDSA 3QXEB 4N4IA 2ZPBB 1Q82C 3NTIA 1U8RA 2V8KA 3LWHA 2XHCA 1K73C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGE B;  3X28 B;  3WVD B;  3QZ5 B;  1QP3 A;  2CZ6 B;  2DXB A;  3X24 B;  4RKU E;  1UGS B;  2DD5 B;  3WVE B;  3A8G B;  3VYG A;  2PU9 B;  4XK8 E;  4Y28 E;  2DXC B;  2CZ0 B;  2WSC E;  4OB3 B;  2CZ7 B;  4OB1 B;  3QYG B;  4L6V 5;  2PUO B;  2ZPG B;  1V29 B;  2DXB B;  2ZZD A;  1QP2 A;  3QYH B;  2DD5 A;  3VYG B;  3X25 B;  1DJ7 B;  2O01 E;  2DD4 A;  2ZZD B;  5L8R E;  2D0Q B;  2AHJ B;  2ZPE B;  2CYZ B;  2QDY B;  3A8O B;  4OB0 B;  3A8L B;  2PVD B;  2WSF E;  2PUK B;  2DD4 B;  3HHT B;  2WSE E;  1IRE B;  3LW5 E;  1UGR B;  3X26 B;  3A8M B;  1GXI E;  4KT0 E;  2ZPF B;  1PSE A;  3A8H B;  4ZGD B;  2PVG B;  3QZ9 B;  1PSF A;  2DPP B;  1UGP B;  2PVO B;  1UGQ B;  4FM4 B;  2ZPH B;  4ZGJ B;  4OB2 B;  3X20 B;  1JB0 E;  3VYH B;  2ZCF B;  2DXC A;  2ZPI B;  2CZ1 B;  3QXE B;  2ZPB B;  1AHJ B; 
#chains in the Genus database with same CATH topology
 2I2L A;  2XDP A;  2CKK A;  1ZA1 B;  1OYX A;  2FPE A;  4XTU A;  1VQM A;  2V26 A;  2GCX A;  4ZTJ A;  4JS5 A;  4E7K A;  2EIF A;  2QA4 Q;  2LT4 A;  1W70 A;  3NPF A;  1KC8 C;  3HFO A;  2D9T A;  3RNJ A;  4F6W B;  5KYU A;  2A08 A;  2QQ8 A;  2QGF B;  2F5T X;  1G3T A;  3QUI A;  1WJQ A;  2CRE A;  4KBM B;  3UWN A;  4KGZ B;  3OYG A;  4LDV A;  1G5V A;  3OMG A;  2RJE A;  2HZY A;  2MI6 A;  3MO8 A;  2YRD A;  3F70 A;  3GIB A;  4RTX A;  2AIR B;  1SF9 A;  1OU9 A;  1YHQ A;  2MF2 A;  1WX6 A;  3G71 A;  1ZBJ A;  2IIM A;  2VB6 A;  1X75 C;  2HKQ B;  3BG9 A;  1R8O B;  4JX6 A;  5LJ5 f;  3N5B B;  3HKS A;  4CFU D;  4R55 A;  5LQF B;  1KSW A;  3JCM Q;  1YBY A;  2WFY B;  4E7Z A;  2B86 A;  1E7P A;  1RAB B;  3OSV A;  1LPL A;  1GH6 B;  4LOC A;  1N8R R;  1QVP A;  1H4L D;  3JB9 H;  1X2K A;  1ACM B;  4KGV B;  3SFM A;  4PJO D;  1AD6 A;  1K8A C;  2CUB A;  2CH4 W;  4ME7 A;  4LD9 K;  4OMM A;  2ED0 A;  4J6W A;  1MNE A;  2DBM A;  2X9H A;  2XK0 A;  5GAN g;  4FYX B;  5GAM h;  1OKV B;  5IDP B;  4C92 F;  3EOC B;  2ROL A;  2RH2 A;  4E7H A;  1UGP B;  2FHD A;  3EGX A;  4FM4 B;  1VQL T;  2MWP A;  1GCQ A;  1YHQ T;  4MML A;  2M02 A;  5KE3 A;  4C8Q D;  2K5F A;  3J7A F;  4BCH B;  2VAS A;  7AT1 B;  4M7A B;  1UUE A;  4KGX B;  2XID A;  5FGK B;  1M27 C;  4CI0 C;  2DTO A;  1FIN B;  3WVD B;  1YJW T;  1WI7 A;  1MUZ A;  2M0Y A;  3PFS A;  2DX1 A;  5I2S A;  3OYH A;  4OMQ A;  4AFQ C;  2HSP A;  3QYE A;  3H0H A;  3C94 A;  5FRO A;  3PVL A;  3E1S A;  4AFS C;  1FMV A;  2FPF A;  3M9Q A;  4TVR A;  4HNT A;  1WQ7 A;  4YTL A;  1K9M C;  1SSH A;  5GAN 5;  2CJM B;  1QVF S;  3CPF A;  1UEC A;  1VQ9 A;  3PMT A;  5KYW B;  4PJO E;  2ZPG B;  1V29 B;  2DXB B;  1VQ7 T;  4IKF A;  2K7A A;  4EC8 B;  4F7U G;  3JCM e;  2HDA A;  1Y96 A;  2X35 A;  1OI9 B;  3M0S A;  2MWO A;  4WF2 A;  2XMF A;  2RNA A;  2QG9 B;  1VQ4 T;  1QCO A;  4KUI A;  2GQI A;  4EOJ B;  2L3S A;  1Y7X A;  1XJW B;  5DQW A;  1H92 A;  5LJ3 j;  4C92 A;  2LTO A;  3ER0 A;  3M53 A;  4AMC A;  3OYD A;  3DLL A;  5BNJ B;  4F04 B;  3TNW B;  5I2M A;  3EH2 A;  4OMP A;  2EKH A;  3A8L B;  4C92 G;  4C8Q E;  1ZQ1 A;  1QVF P;  3L2Z A;  5KE2 A;  1VQ9 T;  1KHI A;  3RER A;  2O9S A;  1GCQ C;  1GBR A;  2RF0 A;  2GTJ A;  2EJF A;  1GXI E;  2EYW A;  1ZSZ A;  3A5Z B;  4BAC A;  1O9S A;  1ABQ A;  1N9R A;  2HQH A;  1PNJ A;  3O0G D;  1Q82 U;  2PVG B;  4C0G A;  1BIB A;  2MAM A;  2IVX A;  1QKX A;  1RUW A;  2JXB A;  2COY A;  2E1H A;  1S72 Q;  3MP8 A;  2ZPH B;  1QMC A;  3CCE A;  3UA7 A;  1BI3 A;  3OYB A;  2H8H A;  5GJV B;  1VQN T;  2DXC A;  2WXV B;  4M7D B;  1P92 A;  2LCS A;  4RTZ A;  2E3I A;  1TTH B;  1ZLM A;  2OI3 A;  2LQN A;  4CC7 A;  1BI2 A;  3L1A A;  4Z02 A;  1AVZ C;  4QQD A;  1KD1 U;  5LJ5 g;  2I53 A;  1YIT A;  3SB2 A;  2VXE A;  4XK8 E;  2WMA B;  1NPP A;  3RKW A;  2CZ0 B;  2KXC A;  5DM7 R;  1KQ1 A;  4PKC C;  3EJ1 B;  2L89 A;  1G8X A;  3RDV A;  2BS4 A;  1JXM A;  1XTD A;  3H9N A;  3QWY A;  2HL3 A;  1ZUK A;  4OGC A;  2JMC A;  3FC3 A;  1AWO A;  1AWJ A;  4NL2 A;  2ZGW A;  1ZUY A;  4F16 A;  4BCG B;  1ZP2 A;  2ESW A;  2CGH A;  2K6D A;  1QWF A;  2QQB A;  1Z9Q A;  4MIM A;  4FSX A;  4Z89 A;  4RG8 A;  2DD4 A;  2HCK A;  3MJX A;  2D8H A;  3GOX A;  3TU4 K;  3I35 A;  2L0A A;  5DLQ E;  1M1G A;  1VQO T;  3JCM V;  1M1K U;  2QEX T;  3CPW S;  2BE7 D;  1I07 A;  1M3A A;  2KVQ G;  1WFW A;  1NPR A;  2K3B A;  3C4S A;  2PHG A;  3LWI A;  3WXM B;  2EFI A;  1VQK A;  3C0C A;  4EOS B;  3X26 B;  1KD1 C;  2DE0 X;  3OS1 A;  1H25 B;  1MHN A;  1VQ4 A;  2K5L A;  2UZD B;  2DL7 A;  2JUF A;  1T0J A;  2HBW A;  3QBY A;  3M0P A;  4NOY A;  1NBE B;  2EW3 A;  2DM1 A;  1YJN Q;  1TUC A;  3HB9 A;  4PFP A;  1VQO A;  1VQ7 A;  3CMA A;  1AIS B;  3E9G A;  3M58 A;  3QZ9 B;  5FRN A;  5HKC A;  4IUT A;  1GY3 B;  1OIY B;  4E47 A;  1ENW A;  3X20 B;  1M90 R;  5GAO l;  3S3N A;  5HVY B;  4KH0 B;  3FJ5 A;  4PJJ A;  4M7A F;  2CP6 A;  1NJI C;  1OUL A;  4EIK A;  4CFN B;  3I56 A;  1Q86 R;  1BKB A;  2HMA A;  1D3U B;  1ZX6 A;  4OMF B;  5ECA A;  1URC B;  2E65 A;  1WZO A;  4BCJ B;  4EMK A;  2CP7 A;  4J9H A;  1UJ0 A;  1VYT A;  1N5Z A;  3LYI A;  2A37 A;  4C5G A;  4AFZ C;  5C0M A;  1D1A A;  4ZNX A;  4J5Y A;  3CBM A;  4L6V 5;  4CC2 A;  4PNO A;  2P0K A;  4DOW A;  5J3B A;  2JM9 A;  4X1V A;  1W6X A;  5CKD A;  2R58 A;  1KG1 A;  4XTX A;  3OBW A;  3X25 B;  5GAO p;  1UTI A;  1IXD A;  3OYJ A;  3RUX A;  3S3M A;  3EHR A;  5IHN A;  3RMS A;  4EOP B;  1WHG A;  2PMI B;  3I56 Q;  1GL5 A;  4FIB A;  1WIE A;  1VQM Q;  1KQS P;  1RLQ C;  1BU1 A;  4OGR B;  2JT4 A;  4KH1 B;  3OW2 S;  2O4X B;  2QA4 A;  1H27 B;  4II5 B;  1M2O A;  3SHW A;  1HK9 A;  2DO3 A;  3OYF A;  3DKM A;  4XU1 A;  3V7R A;  4F7U F;  1FWZ A;  1B34 A;  2JN0 A;  4PLI A;  2CYZ B;  2M0O A;  5A2Q E;  1RAI B;  3EG1 A;  2RJD A;  1WXT A;  5IH2 A;  4NC6 A;  3OYN A;  3SWN A;  3EG3 A;  2DD4 B;  1I4K 1;  1UDL A;  2WSE E;  3CD6 T;  2LNV A;  4C5I A;  4LDX A;  2DKG A;  4XTY A;  1SRL A;  4BCF B;  1N8R U;  3EG0 A;  2NUT B;  4NS5 A;  2LQK A;  4M77 B;  5GAM f;  1NLP C;  5LJ3 e;  2NYS A;  2E6N A;  5GAO q;  4M75 G;  4EON B;  4AKH A;  3QSU A;  1HYO A;  1YJ9 A;  3CMA Q;  3RES A;  2VXF A;  5A0D A;  1QVG A;  1C9B A;  3SD4 A;  4BBR M;  1FMW A;  2QTV A;  4HCK A;  4N0A A;  3FB9 A;  4XTZ A;  3LH5 A;  3BLQ B;  4A4H A;  3CCL A;  4M77 F;  3MY1 B;  2EKO A;  2CS7 A;  1I1J A;  1PKT A;  3CCM A;  3CCM Q;  2BKZ B;  4LUE A;  2ZPI B;  2KDS A;  3QXE B;  2ZPB B;  3CCE T;  1K73 C;  3KBG A;  4A63 B;  1TG0 A;  3G6E Q;  4O6J A;  1YI2 T;  4JJB A;  1ZUU A;  2W0Z A;  3GF5 A;  3LGL A;  3V8J A;  4FSS A;  1PRL C;  3WVE B;  1GCP A;  3CXC S;  2K3Y A;  4AG1 C;  1OV3 A;  3KFV A;  2W99 A;  4M7D G;  1KFZ A;  3OYL A;  2J05 A;  2EQI A;  3REA B;  5GAM d;  3HTR A;  1XOV A;  2C5N B;  1RAC B;  4C92 B;  1Q7Y R;  1NLO C;  1GRI A;  5M9O A;  2VC8 A;  4EMK B;  3ME9 A;  1FVV B;  1J3T A;  3QYH B;  2CT4 A;  1M2V B;  2MCN A;  4YOS A;  2YUQ A;  3VYG B;  3CCU Q;  2E12 A;  5HK3 A;  3SWN C;  4M7A G;  2X3X D;  4PJO A;  1TUD A;  3VUZ A;  1UNH D;  1CKB A;  1BYM A;  2L3Q A;  3RKY A;  1DJ7 B;  1IGU A;  2P4T A;  2P4R A;  2V8J A;  4BY7 X;  4IMY B;  4QSH A;  1CSK A;  4NST B;  2XI9 A;  4LE9 A;  1OOT A;  2LQ8 A;  4M77 A;  4BI4 A;  3V8K A;  1WJR A;  2QDJ A;  2K57 A;  4LN2 A;  1QKW A;  3V7S A;  4HLQ A;  4MFD A;  2Y4X A;  1VQ9 Q;  1NZ9 A;  1G3S A;  1I5L A;  1OX8 A;  3F5X B;  2F2X A;  1Y0M A;  5AT1 B;  3RR6 A;  2CH4 A;  5CKH A;  2MPX C;  3PIP A;  4AT1 B;  2ATC B;  1X27 A;  2KYM A;  4J9I A;  3MEV A;  2JS0 A;  4M78 A;  3DB3 A;  4N4G A;  4JLG A;  3QO3 A;  1SSF A;  5GAN 8;  3RIR A;  2AK5 A;  2JTF A;  3G4S Q;  4OMO A;  2X4Y A;  1D0Z A;  1IGQ A;  3VS6 A;  3HPW A;  3LGF A;  4GBQ A;  2EJG A;  3OQ5 A;  5IF1 B;  4HNU A;  4F7L B;  1RAE B;  5GAN d;  5CKB A;  1ZSZ B;  2QAS A;  3CME Q;  4JJC A;  3OS2 A;  3CCS T;  1O75 A;  5LJ5 d;  5CCA A;  1NYG A;  1OU8 A;  1ARK A;  3X28 B;  4ZN3 A;  3O5Z A;  4X9C A;  4E7L A;  4EMH A;  4F17 A;  4IUR A;  3X24 B;  2JMA A;  2KAF A;  4JX4 A;  4PL6 A;  4ELJ A;  4BBS M;  1M1F A;  2PK2 A;  2AKK A;  3OS0 A;  4WTO B;  2XU8 A;  3J80 E;  3JCM X;  2ZAE A;  4M78 E;  2WPA B;  3GNG A;  4EOK B;  3HRS A;  3I55 A;  4OP0 A;  4ROE A;  3L42 A;  5FWB A;  4BCO B;  1MND A;  2HD0 A;  1KQS S;  2YRC A;  1YJ9 T;  1OPL A;  2DL8 A;  5HBH B;  2QK0 A;  4ELY C;  3JB9 F;  1JEG A;  3QG1 A;  1E7O A;  3PT9 A;  5FRM A;  4QKU A;  1JOW A;  1WNL A;  2NLU A;  1YHQ Q;  4C0F A;  4OML A;  1T3S A;  3M0R A;  1OKW B;  4F7N B;  1IRX A;  2VYT A;  4J9G A;  5LJ5 h;  5HCK A;  4M77 C;  2C6T B;  2D0Q B;  4JZ3 A;  4J6X A;  3R6N A;  2H3J A;  3HSB A;  4C8Q G;  1KK7 A;  1K1Z A;  2KT8 A;  1RLP C;  2NUP A;  3C95 A;  4M78 B;  3EGU A;  1PCX A;  3VKG A;  3ULR B;  1IRE B;  1NYF A;  4EMG A;  1I8F A;  4YOZ A;  4G6L B;  1OL1 B;  5LJ3 d;  2RI2 A;  4EMK C;  3NTH A;  1OPK A;  4JRP A;  2BZY A;  5EJC A;  4XU0 A;  3PO3 S;  1CKA A;  2C5O B;  1LOJ A;  2QA4 T;  1H3Z A;  2QQA A;  4ZGD B;  4C8Q A;  2LNH B;  4OR5 B;  5HQ0 B;  2QEX Q;  5IAY A;  5L23 A;  1RAD B;  2FYK A;  4BCK B;  1M1K C;  5GMK e;  1VQP Q;  3EG2 A;  8AT1 B;  1VQ5 T;  3QII A;  1BK2 A;  2LP5 A;  4Z88 A;  4BI3 A;  2LT1 A;  3TCJ A;  1YP5 A;  3FJP A;  3VJP A;  3GP8 A;  4HA8 A;  4LD6 A;  1D09 B;  2FL7 A;  1OZ3 A;  1UNL D;  5GAN f;  3QYB A;  2DXB A;  2WMB B;  3P8H A;  3OYK A;  1X6B A;  1UGS B;  3SEM A;  2KGT A;  1RAG B;  4BCN D;  2XG8 D;  4FT2 A;  2VKN A;  4XAX B;  2OTL T;  3DDP B;  1K0X A;  4JRQ A;  2L2P A;  4OB3 B;  2VGN A;  1ZBX A;  3BFM A;  3M0U A;  1RAA B;  1D1B A;  1NEB A;  4Y91 A;  2WIH B;  1YWP A;  3BLR B;  1IO6 A;  4D8D A;  1W2B P;  5CAI A;  1WPY A;  5J26 A;  2HNI A;  1FKM A;  1P5E B;  1MV0 B;  1ZA2 B;  4C92 E;  1AZE A;  3G71 T;  4BCQ B;  3G4S T;  2QDL A;  3MP1 A;  1X01 A;  1TSF A;  1W2B S;  1NJI R;  3CXC P;  1D0X A;  1Q86 C;  3AHU A;  4FYY B;  2O01 E;  2RK2 A;  1M30 A;  4C0D B;  3H0I A;  1X6G A;  2HBP A;  3HL8 A;  1GUX A;  2AHJ B;  3JCM W;  2RHZ A;  4FW2 A;  4OB0 B;  3HFN A;  3CC4 Q;  5CQY A;  3JCM P;  2DXU A;  3CEY A;  4MZM A;  1RAH B;  2UZL B;  1YWO A;  1WQW A;  2DF6 A;  3VS7 A;  4F7U E;  5FW9 A;  1EIF A;  1FXX A;  2ENM A;  5GAM e;  3VU3 C;  5D6Y A;  5I21 A;  5CVI A;  4DEY A;  1YJW A;  1YIT Q;  1H64 1;  2KR6 A;  2BKD N;  2RI3 A;  2NUP B;  5L2W B;  2CP5 A;  2X4W A;  1PSF A;  3MCA B;  3V8L A;  2DFU A;  3BW1 A;  3UA6 A;  3LH0 A;  4HCB A;  4BY1 X;  4AKI A;  3CC2 Q;  4EOM B;  4XU3 A;  4ZGJ B;  4JJD A;  1VQ6 A;  2K5I A;  1PC0 A;  1K0S A;  4FL6 A;  4N4H A;  3CC4 A;  4JRK A;  4HT9 A;  4ZGE B;  4J9B A;  3I5S A;  2JZ2 A;  2FZG B;  1K9M U;  2QYZ A;  1N4M A;  4CXA B;  2DRK A;  2C0O A;  5EFQ B;  1BCM A;  1T3L A;  4CC3 A;  2L3P A;  4C92 C;  3EHQ A;  4BDY A;  1WHH A;  2DXT A;  1ZSZ C;  3NHN A;  2GFU A;  1O9K B;  4F6U B;  3TNI B;  1YIJ T;  1ABO A;  4QVZ A;  3MKD A;  2DZC A;  1QCF A;  2EYQ A;  2LX9 A;  5D7U A;  3OW2 P;  4J8O A;  1JSU B;  3CCR T;  3CCJ Q;  2IG0 A;  3CCJ A;  4C0D C;  4BDZ A;  3T9N A;  4EOQ B;  1SHF A;  2ABL A;  3CQT A;  4PJM A;  3JSC A;  3AT1 B;  4IUV A;  2JVV A;  3MEA A;  2QXF A;  3VKI A;  4B9W A;  1UFF A;  1VQK Q;  3E2U A;  1NM7 A;  3EAE A;  4ZTF A;  3TNH B;  2PNI A;  4M4Z A;  3JCM h;  5A0L A;  3JCM d;  5GMK l;  2RPN A;  4LDW A;  2A3L A;  2DME A;  2JM8 A;  1KJW A;  3A8M B;  2IW8 B;  4JLI A;  1PWT A;  4N0A C;  2ZPF B;  1PSE A;  1WHM A;  1VQM T;  1YJN A;  5FLX E;  3BG5 A;  5IHK A;  2FRY A;  1YFN A;  3M54 A;  3VS4 A;  2KT1 A;  2GNC A;  5FU7 B;  2HL5 C;  2YRV A;  1MMD A;  1EFN A;  3EFR A;  3VRZ A;  4FU6 A;  2CZ1 B;  1Q82 C;  1Q82 R;  1U8R A;  4C5H A;  4RTW A;  4QVC A;  3EGX B;  3FEO A;  2CP2 A;  4EPC A;  2CZ6 B;  4IUU A;  2W9Z A;  5GAO n;  4LXC A;  2QQ9 A;  2QGG A;  5GAO m;  2RHY A;  1K8A U;  1SRM A;  2C4G B;  2QQR A;  5IN1 A;  2B8A A;  1QLY A;  2DVE A;  2RB6 A;  3OW2 A;  4BY6 C;  3BG3 A;  3REB B;  3L2R A;  2KRS A;  2WSC E;  2RM4 A;  2EJ9 A;  2KQW A;  3M55 A;  1H1R B;  1A0N B;  3VKH A;  2X3W D;  4RUG A;  3BHT B;  3RGF B;  3JCM f;  4A4K A;  3NFC A;  4AKG A;  3A98 A;  1VQ6 T;  5GAN 4;  4P5N A;  4RTU A;  1T0H A;  1VUB A;  1C1A A;  4DBF A;  2DD5 A;  4PJN A;  4A4E A;  1UE9 A;  4X9D A;  2MK5 A;  1EZZ B;  5GAM g;  1WA7 A;  2GFA A;  1H26 B;  3RMQ A;  1I0C A;  4ELZ C;  1IHW A;  3G6E T;  4BE2 A;  1UGV A;  3G7Z A;  1H8K A;  2D6F A;  4J9E A;  1VQ8 A;  2EVR A;  1VQ8 Q;  3G33 B;  4M78 D;  3G4S A;  1KQS A;  2BUD A;  3L2Q A;  1C0M A;  4OGE A;  5IXF A;  4GY5 A;  5GAN e;  4AG2 C;  2KRN A;  3A8O B;  4YC3 B;  1GFC A;  2PQW A;  4DBQ A;  2HQE A;  2WSF E;  1NE8 A;  5HY6 A;  2LQW A;  2K2V A;  3HHT B;  3G6E A;  2RQV A;  5GMK m;  1UGR B;  2CP0 A;  1R0C B;  4MZP A;  3EGD A;  3GBQ A;  4F7U A;  1H24 B;  5I11 A;  5CO7 A;  4BB7 A;  4M7D E;  3P8B B;  1TWB A;  2RQU A;  1QCN A;  3EH1 A;  3HP9 A;  2FZC B;  1VOM A;  1Q7Y C;  4M7A D;  3CXC A;  2YWW A;  2SEM A;  3ZL7 C;  1PD1 A;  3K7A M;  2GF7 A;  2X4J A;  1AD5 A;  1I81 A;  1G3W A;  4A53 A;  5GAN h;  4C8Q B;  4ANJ A;  1K9A A;  4FX3 B;  1BI1 A;  5AYF A;  2DK3 A;  1U5S A;  1M8M A;  4EOR B;  5HNB B;  4F70 B;  2SRC A;  3EFO B;  2EGC A;  2GGR A;  4MDX A;  2COZ A;  1OZ2 A;  3I5R A;  4JZ4 A;  4Q5W A;  4M7D F;  2QEX A;  3EID B;  4CRI A;  4BCQ D;  4M75 F;  2QGS A;  5LJ5 j;  3UT1 A;  3OB9 A;  3KUF A;  2LC4 A;  1S72 A;  2RQR A;  5A0G A;  1PRM C;  3CMA T;  1D3B B;  1U06 A;  4WCI A;  3CME T;  2BZ8 A;  3INZ A;  1VQL A;  1QLB A;  4XTW A;  1RI0 A;  3URG A;  4HT8 A;  1KIK A;  4BUG A;  2WAC A;  4D8K A;  2XIC A;  2HAX A;  1AEY A;  2CDT A;  2NWM A;  4AI6 A;  4RCB A;  1Y57 A;  3G71 Q;  1VYW B;  1K4U S;  2KMT A;  2G9X B;  2PK9 B;  1VQN Q;  3VS1 A;  2ZZD B;  4MMK A;  1M2V A;  3JB9 G;  1HXD A;  3QDR B;  1YI2 Q;  3RKX A;  1S72 T;  2RQT A;  3CCV A;  3CCV Q;  3DDQ B;  2LJ0 A;  1OX9 A;  4QQG A;  3CME A;  2JTE A;  2KRO A;  2BS2 A;  1WHJ A;  3CBO A;  1TH7 A;  3KHI A;  4LDY A;  3CCR A;  2RMO A;  3BY7 A;  3I56 T;  5GJW B;  1OEB A;  2HQX A;  4PJO C;  2DER A;  3VUB A;  2WJ9 A;  4V2S A;  2AZV A;  1BU2 A;  2DVJ A;  1R77 A;  4EDU A;  2F2C A;  1UHF A;  1H1S B;  1VQ8 T;  2B9R A;  2E5K A;  1XO2 A;  2R5M A;  4ROD A;  2EBP A;  2UZB B;  4QVD A;  5GAN 3;  2CCI B;  2CSI A;  4EOL B;  1AZG B;  2OJ2 A;  4KRT A;  1YJN T;  3QDF A;  3QPH A;  1BBZ A;  4F7S B;  1VQ6 Q;  4OB2 B;  1E6H A;  3O8V A;  4AFU C;  2ZCF B;  2COW A;  4EOI B;  5ACB A;  4UN0 A;  1RI9 A;  4FT4 A;  4J83 A;  4B9X A;  2V1R A;  1W2B A;  1WLP B;  1OQK A;  2E4H A;  1AHJ B;  2DL5 A;  1OI1 A;  2YUP A;  3JV3 A;  1TU0 B;  1XNI A;  2XDD A;  2E41 A;  1E9H B;  2KXD A;  2DIQ A;  2XD0 A;  1D3B A;  3JB9 J;  2Y90 A;  1VQ4 Q;  3QWL A;  2C0I A;  4M7A A;  1BIA A;  1JKW A;  3A8G B;  4CFV B;  1Y96 B;  3CBP A;  1WJS A;  1UHC A;  1YN8 A;  4JRI A;  1U3O A;  3I55 Q;  1FX7 A;  1KQ2 A;  4L59 A;  2PUO B;  3QHW B;  3VS5 A;  5IHI A;  1QP2 A;  3TSW A;  2VV5 A;  2V22 B;  4F6S B;  1VQK T;  3OY9 A;  2DEU A;  4JDS A;  4B6M A;  5IDN B;  3TN8 B;  3FDR A;  5EG2 A;  4J9D A;  5KYW A;  5DLO A;  3DLM A;  2ECZ A;  3TW7 A;  3SWN B;  2CUD A;  4JPB W;  4FYW B;  4J9C A;  1AOJ A;  1XQH A;  1LNX A;  4DA4 A;  2A0F B;  2QFZ A;  2D1X A;  1YI2 A;  4R56 A;  1TS9 A;  3R6O A;  1JO8 A;  2DIG A;  2X1N B;  4DOV A;  2KNB B;  5EC7 A;  3H6Z A;  4RTV A;  2HEQ A;  4J7F A;  2M51 A;  4C5E A;  1KHC A;  3LW5 E;  1WXU A;  1N9S A;  3M4Y A;  4PLL A;  2DYI A;  4M75 A;  1B34 B;  2DL3 A;  5LL6 S;  2QI2 A;  1YCS B;  4J9F A;  4M78 G;  3TW6 A;  2MYS A;  3TQ7 P;  2UUE B;  2LW4 A;  3OYI A;  2I0N A;  2QTX A;  1M1K R;  2NUT A;  4M77 G;  2KK4 A;  3L2U A;  2XKO C;  3VS2 A;  2D0N A;  4RG2 A;  1WHK A;  2YUN A;  2KE9 A;  3M5A A;  3CC7 A;  2LCL A;  3A1P A;  2M1H A;  1MMG A;  5CK9 A;  2DL4 A;  3FRN A;  3MY5 B;  3BDL A;  3PIO A;  2KMG A;  4K11 A;  1PG5 B;  5GAO r;  1X6O A;  2RHI A;  3CCS Q;  1MMN A;  1PD0 A;  1K9M R;  4LUD A;  3CCV T;  2R5A A;  1W1F A;  2A36 A;  3DTO A;  4OVA A;  2OTJ A;  5KCH A;  2DTI A;  2DNU A;  1VYU A;  2F5K A;  2DXC B;  2Y4Y A;  1VQ7 Q;  3CD6 Q;  2DYB A;  2JGZ B;  2KRM A;  1BI0 A;  1QW1 A;  4M7A C;  5KYN A;  2A28 A;  3FLG A;  1M8V A;  2RD1 A;  2DET A;  2UZE B;  2R57 A;  1KC8 R;  4IIM A;  4NL3 A;  2KEA A;  1UJY A;  1U1T A;  2IN3 A;  1YJW Q;  1G2B A;  3CC7 Q;  3PGG A;  4EC9 B;  3S6W A;  3POM A;  1YJ9 Q;  5LMK B;  1MV3 A;  2G3R A;  5C6S A;  3ASK A;  2OTJ T;  3DB4 A;  2P84 A;  3PNW C;  2K2M A;  3TRE A;  1JJ2 S;  3CCS A;  3OS5 A;  5GAM j;  3TSZ A;  4HCC A;  1AT1 B;  2FVU A;  5I5Z B;  2OAU A;  4Y92 A;  2EUF A;  2ZPE B;  2V1Q A;  1IHV A;  1N6A A;  4FW1 A;  1NJI U;  4ZN1 A;  3CCQ Q;  1VYV A;  1GBQ A;  2FPD A;  3TVT A;  3CPW P;  5D6X A;  5IT9 E;  2JNG A;  5CEI B;  4GLK A;  5GAN 7;  2J7I A;  3I55 T;  1HD3 A;  4IIO A;  2FG0 A;  2O9V A;  3CCU A;  3MET A;  4KUL A;  1UG1 A;  2EPD A;  1UB4 A;  2BIV A;  3RBB B;  4KRD B;  6AT1 B;  4PJL A;  2K4Y A;  2EQM A;  4CFM B;  1VQO Q;  3VV0 A;  5LJ3 h;  4C0Z A;  1G3N C;  2RK1 A;  2YHT A;  2DZ9 A;  1M3C A;  3C12 A;  1H3H A;  4ROC A;  4RTY A;  2C5V B;  2LX7 A;  1Q7Y U;  2L8D A;  1WDX A;  2QAZ A;  1BCO A;  4M7D D;  2E6Z A;  1FMK A;  2JJ9 A;  2WEV B;  2NUZ A;  3CCU T;  2V8K A;  2XHC A;  2EAY A;  3BDU A;  1B7T A;  2KY9 A;  2DLP A;  1NEG A;  2E64 A;  1QMZ B;  2FO0 A;  2GTO A;  4M6V A;  9ATC B;  1WXB A;  1AWX A;  4E2F B;  3VS0 A;  2EQU A;  2I40 B;  2PU9 B;  4Y28 E;  1JU5 C;  3HRU A;  2OX7 A;  2F1L A;  8ATC B;  2LCC A;  1QVF A;  4PFZ A;  2RI5 A;  4CFW B;  2A7Y A;  5IXB A;  2CZ7 B;  4HVV A;  2BS3 A;  2LZ6 B;  2VGM A;  5I22 A;  1SG5 A;  4BCI B;  1QQJ A;  1SPK A;  3UDC A;  4HKE A;  5FU7 C;  2O4X A;  2CSQ A;  2QQS A;  5IHY A;  1VQ5 A;  3BLH B;  4IUQ A;  4JX5 A;  1YIT T;  2O31 A;  1O9K A;  2HSE B;  2J6O A;  1W98 B;  2RN8 A;  5CKE A;  3EG9 B;  1PHT A;  2C0T A;  3JCM b;  4BI8 B;  2L5Q A;  5CR2 A;  3M57 A;  2QF7 A;  2E3H A;  4M77 D;  3V7C A;  2W10 A;  1SKU B;  4IUP A;  3GLX A;  2QDY B;  2VUB A;  4BCM D;  1PM3 A;  2MMP A;  3OMC A;  2LVM A;  1K73 U;  2PVD B;  3LQ5 B;  2PZ1 A;  2PUK B;  2YLB A;  2OTL A;  1OGU B;  1D0Y A;  5GAN 6;  1W4S A;  1AWW A;  4M75 E;  5LJ3 f;  1M3B A;  1UNG D;  3THK A;  5J39 A;  5HK0 A;  5LJ5 e;  1Q81 R;  3M56 A;  3KXT A;  1OL2 B;  4M7D C;  4BCP B;  4OF1 A;  2DA9 A;  3QHS A;  2E5Q A;  1X69 A;  2DPP B;  3HO8 A;  1MGQ A;  2YDL A;  3L2V A;  4E6R A;  2KI7 A;  4O5V A;  3UPU A;  3JCM J;  4A4G A;  5KH6 A;  2RA2 A;  1ZHI A;  2LJ3 A;  1HSQ A;  3HBL A;  1YNZ A;  1JQQ A;  3OBY A;  2C5X B;  3JB9 D;  4RTT A;  4PJO F;  1M9S A;  4JUV A;  3CCR Q;  2YUO A;  3ZFJ A;  3SDZ A;  4RKU E;  4HL4 A;  4M77 E;  2GBQ A;  2LDM A;  3OYE A;  1M5Q 1;  4C92 D;  2EQJ A;  2DD5 B;  3CCQ T;  1LVK A;  3VYG A;  4BD3 A;  2P0Q A;  4BXX X;  1VIF A;  4M7D A;  4RMO A;  4CRL B;  1M4Z A;  4OB1 B;  3QYG B;  3GPL A;  2OTL Q;  1UEB A;  2X4X A;  3E9F A;  3OSS C;  1Q95 G;  2RJC A;  2FZK B;  1B07 A;  2KR3 A;  4PK4 A;  3CCJ T;  4X34 A;  3B57 A;  2O88 A;  1QVG P;  4CFU B;  2LRQ A;  4ATO A;  1B3Q A;  1GUX B;  5CQX A;  4F7J B;  3DJB A;  1FYN A;  3I9Q A;  4PFO A;  3BHU B;  2FEI A;  5HBJ B;  3GNF B;  1Y07 A;  4XQ3 A;  1X43 A;  2CP3 A;  5L8R E;  3LX7 A;  4XTV A;  3JCM g;  1QVG S;  2E70 A;  1G3Y A;  1N8R C;  1OIU B;  3U23 A;  2M9U A;  3J81 E;  2EGE A;  1QWE A;  1WGS A;  2MOX A;  1F5Q B;  1GFD A;  4M78 F;  4BE0 A;  5GAN j;  5KYX B;  4YOO A;  1VIN A;  3TEE A;  2DEQ A;  2VWF A;  3UAT A;  2J06 A;  3QJ6 A;  4FCY A;  4KT0 E;  2F2W A;  3H41 A;  3NGP A;  5FU6 B;  5KYY A;  2CCH B;  2IVW A;  5HBE B;  3D7S B;  3NTK A;  2KYB A;  4M78 C;  4D6W A;  2X51 A;  1Q86 U;  2BZX A;  3Q1J A;  3JRZ A;  2PVO B;  1VIE A;  1VQN A;  3H0F A;  3H8Z A;  3CPW A;  2YSQ A;  1UGQ B;  2JW4 A;  1RL2 A;  1VQP A;  1IB8 A;  3PMI A;  3MHX A;  2G77 A;  1IZ6 A;  3CCE Q;  4M75 B;  2FRW A;  3QHR B;  4F7U B;  5D6W A;  3M03 A;  2K79 A;  3JAM E;  1JRI A;  2K9G A;  1VQL Q;  3DOG B;  3H4C A;  4A4F A;  4OMN A;  4MFE A;  3OYM A;  3IQL A;  1M90 C;  2RHU A;  2EYY A;  2EYZ A;  1E6G A;  2WHB B;  4BCN B;  1H1P B;  4I3Z B;  1HJD A;  3GTM S;  3VS3 A;  2OTJ Q;  4C8Q F;  3MP6 A;  5CKF A;  3BHV B;  3CC2 T;  1N27 A;  4J6Y A;  5CIU A;  4CC4 B;  4XU2 A;  3L2W A;  3ZEH A;  2IW9 B;  3HZJ A;  2Z0W A;  2DRM A;  4M75 C;  3CCM T;  4TTH A;  2YLC A;  4GLM A;  1V1C A;  4II1 A;  3MPU B;  2ZZD A;  3FIF A;  1JJ2 A;  3HRT A;  1TXQ A;  1Q81 U;  1S1N A;  2M16 A;  1U1S A;  1LJO A;  3M0T A;  1V76 A;  2FB7 A;  1F1B B;  3MI9 B;  4LDU A;  3M59 A;  5FU6 C;  2LMJ A;  2VVK A;  1LCK A;  2DMO A;  3QKJ A;  2W2H A;  3UF4 A;  3E19 A;  5FWC A;  2RQW A;  3MEU A;  4E7J A;  4E7I A;  3DL1 A;  5KYY B;  4C8Q C;  1JST B;  4LNP A;  2IPO B;  1C6V X;  1YIJ Q;  2RJF A;  1WHL A;  1Q81 C;  4HVU A;  4ELL A;  1MMA A;  2CT3 A;  3PTA A;  2V8I A;  1VOL A;  5CYI B;  1KXU A;  2O2O A;  4FYV B;  4BE1 A;  3OYC A;  1PKD B;  2AKL A;  2JS2 A;  5ICP B;  2EGA A;  3LLR A;  4MZT A;  4L5G A;  4HNV A;  1ZSG A;  4DBH A;  5GMK i;  3MEW A;  2YT6 A;  1H1Q B;  4JJN K;  5KYX A;  4DQ2 A;  3CC7 T;  2YXY A;  3JCM c;  2DIL A;  3VYH B;  2XDB A;  3S3O A;  1Z9Z A;  1YIJ A;  2P0P A;  3M4G A;  2H3E B;  1TOV A;  1K73 R;  3QZ5 B;  1QP3 A;  2EYX A;  4J7I A;  4DEX A;  4M75 D;  3EFS A;  4EOO B;  5KCO A;  1JJ2 P;  2OAW A;  2LJ1 A;  1D1C A;  3G1J A;  1K8A R;  2W96 A;  3NDQ A;  2W9F A;  4UC4 A;  1Y71 A;  2KSS A;  4QW2 A;  3P8D A;  2D8J A;  4KRC B;  3VRY A;  3QWX X;  1YCY A;  2PTK A;  2EWN A;  2BE9 B;  3OYA A;  2F69 A;  3CCQ A;  2BPM B;  1SEM A;  2E10 A;  3EG9 A;  3CC4 T;  2RO0 A;  3CCL T;  3PE0 A;  1G83 A;  1NG2 A;  2ED1 A;  5GMK j;  1RAF B;  1JXO A;  4CFX B;  4ESR A;  2JOY A;  2HKN A;  1K76 A;  1R0B G;  4HXJ A;  1TD6 A;  2K3X A;  2KBT A;  4VUB A;  4BY6 B;  5KYU B;  2EQK A;  3MIA B;  3PVQ A;  2RHX A;  3OA6 A;  5GMK h;  2AT1 B;  2ROT A;  4RCC A;  3NMZ C;  1TUG B;  5GAN 2;  3ZBD A;  4R0K A;  1X2Q A;  1BB9 A;  4ORZ A;  4Z6Y A;  1JBM A;  3CC2 A;  3M0Q A;  3EGD B;  2IW6 B;  4KUD K;  3CCL Q;  3CD6 A;  4PJO B;  2F2V A;  3JB9 I;  2DAQ A;  1I5O B;  4Y72 B;  2DTH A;  1SHG A;  2PJQ A;  3OYY A;  1VA7 A;  4QQ6 A;  2J6F A;  4JS4 A;  2MIO A;  1KD1 R;  2L3R A;  4F14 A;  4DBR A;  4HCZ A;  1WYX A;  5DY9 A;  4QT7 A;  4Z8A A;  4A54 A;  4BCM B;  1TFB A;  2AZS A;  3A8H B;  4HVW A;  1EX4 A;  2DJZ A;  2J6K A;  1H28 B;  2WIP B;  5LJ3 g;  5DQV A;  2DBK A;  1KC8 U;  2BTT A;  2C06 A;  4M7A E;  1PKS A;  2GQV A;  2G6F X;  2R7G A;  2DJQ A;  3EFO A;  1M90 U;  3BE3 A;  1JB0 E;  4MDW A;  4PJO G;  1VQP T;  1VQ5 Q;  4N4I A;  2JTM A;  3NTI A;  3LWH A;  3QJY A;  4E7S A; 
#chains in the Genus database with same CATH homology
 2I2L A;  2XDP A;  2CKK A;  2EAY A;  3BDU A;  3KBG A;  4QVC A;  1VQ6 T;  3FEO A;  1OYX A;  4XTU A;  1VQM A;  4O6J A;  2KY9 A;  2GCX A;  4EPC A;  2CZ6 B;  2E64 A;  4IUU A;  4ZTJ A;  1YI2 T;  5GAO n;  4JS5 A;  2QQ9 A;  4M6V A;  3GF5 A;  5GAO m;  2RHY A;  3LGL A;  2EIF A;  5IN1 A;  3V8J A;  2QQR A;  4E7K A;  2B8A A;  2LT4 A;  1K8A U;  2DVE A;  3WVE B;  2EQU A;  3CXC S;  2K3Y A;  2PU9 B;  4Y28 E;  2RB6 A;  3OW2 A;  1KC8 C;  3HRU A;  3HFO A;  2LCC A;  4BY6 C;  2D9T A;  3BG3 A;  1QVF A;  4M7D G;  3OYL A;  2RI5 A;  3L2R A;  2WSC E;  2A7Y A;  2RM4 A;  2CZ7 B;  5GAM d;  2EJ9 A;  1XOV A;  2KQW A;  2QQ8 A;  3M55 A;  2BS3 A;  2VGM A;  3VKH A;  3JCM f;  3UDC A;  4A4K A;  3NFC A;  4AKG A;  4HKE A;  4C92 B;  5GAN 4;  2F5T X;  1G3T A;  4P5N A;  3QUI A;  5FU7 C;  5M9O A;  1VUB A;  2VC8 A;  4EMK B;  3ME9 A;  2O4X A;  1WJQ A;  3QYH B;  2DD5 A;  4KBM B;  3UWN A;  3VYG B;  4A4E A;  2E12 A;  4X9D A;  4LDV A;  5HK3 A;  3OYG A;  1G5V A;  3OMG A;  2RJE A;  3SWN C;  2MI6 A;  2GFA A;  2QQS A;  3MO8 A;  3F70 A;  3RMQ A;  5GAM g;  1VQ5 A;  4M7A G;  4ELZ C;  3GIB A;  3VUZ A;  4PJO A;  3G6E T;  4BE2 A;  4IUQ A;  1BYM A;  4JX5 A;  3RKY A;  3G7Z A;  1YIT T;  1DJ7 B;  2P4T A;  2V8J A;  1YHQ A;  2D6F A;  1VQ8 A;  2MF2 A;  5CKE A;  3G71 A;  4QSH A;  4M78 D;  3G4S A;  1X75 C;  1KQS A;  2BUD A;  3BG9 A;  1R8O B;  4JX6 A;  2XI9 A;  5LJ5 f;  3N5B B;  3L2Q A;  2LQ8 A;  3HKS A;  4R55 A;  3JCM b;  4OGE A;  4BI8 B;  3JCM Q;  4GY5 A;  5GAN e;  2L5Q A;  1YBY A;  4M77 A;  3M57 A;  4BI4 A;  5CR2 A;  2QF7 A;  3V8K A;  1WJR A;  4M77 D;  3V7C A;  4IUP A;  2QDJ A;  3GLX A;  2QDY B;  3A8O B;  2VUB A;  2K57 A;  2MMP A;  3OMC A;  2LVM A;  3V7S A;  1K73 U;  1E7P A;  4HLQ A;  4MFD A;  2Y4X A;  2PQW A;  2PVD B;  2HQE A;  2WSF E;  1NE8 A;  3OSV A;  2PUK B;  5HY6 A;  1NZ9 A;  2YLB A;  2OTL A;  1G3S A;  2K2V A;  3HHT B;  4LOC A;  1I5L A;  1QVP A;  3G6E A;  5GAN 6;  1W4S A;  5GMK m;  3JB9 H;  1UGR B;  4M75 E;  5LJ3 f;  3SFM A;  4MZP A;  4PJO D;  5CKH A;  5J39 A;  5HK0 A;  5LJ5 e;  3PIP A;  4F7U A;  1K8A C;  4ME7 A;  4LD9 K;  5CO7 A;  4BB7 A;  3MEV A;  3M56 A;  3KXT A;  4M7D C;  4M7D E;  3P8B B;  4J6W A;  2XK0 A;  4M78 A;  3DB3 A;  4N4G A;  4OF1 A;  4JLG A;  5GAM h;  5GAN g;  3QO3 A;  1SSF A;  3QHS A;  4C92 F;  5GAN 8;  2E5Q A;  3RIR A;  2RH2 A;  2JTF A;  2DPP B;  1UGP B;  4E7H A;  2FHD A;  2X4Y A;  3HO8 A;  3HP9 A;  4FM4 B;  1MGQ A;  1VQL T;  1Q7Y C;  4M7A D;  3L2V A;  3CXC A;  3HPW A;  2MWP A;  1YHQ T;  3LGF A;  4MML A;  5KE3 A;  2EJG A;  3OQ5 A;  4O5V A;  4C8Q D;  3UPU A;  2K5F A;  3JCM J;  3J7A F;  4A4G A;  5KH6 A;  2GF7 A;  2RA2 A;  2X4J A;  1I81 A;  4HNU A;  1ZHI A;  4M7A B;  1G3W A;  2XID A;  4A53 A;  5GAN d;  5CKB A;  3HBL A;  3OBY A;  5GAN h;  4C8Q B;  4CI0 C;  2DTO A;  3CCS T;  3OS2 A;  3JB9 D;  1O75 A;  5LJ5 d;  4PJO F;  5CCA A;  1M9S A;  3X28 B;  3WVD B;  1YJW T;  1BI1 A;  3PFS A;  4ZN3 A;  4X9C A;  5AYF A;  4JUV A;  2DK3 A;  5I2S A;  4E7L A;  3OYH A;  4EMH A;  4IUR A;  3ZFJ A;  3SDZ A;  3X24 B;  4HL4 A;  4M77 E;  4RKU E;  2LDM A;  3OYE A;  3QYE A;  2KAF A;  1M5Q 1;  4JX4 A;  4C92 D;  4PL6 A;  4ELJ A;  4BBS M;  1M1F A;  2EQJ A;  3C94 A;  2DD5 B;  5FRO A;  3OS0 A;  3E1S A;  3CCQ T;  4MDX A;  3VYG A;  3M9Q A;  1OZ2 A;  4TVR A;  4BD3 A;  4HNT A;  2XU8 A;  3J80 E;  2P0Q A;  1WQ7 A;  4YTL A;  3JCM X;  4Q5W A;  1VIF A;  1K9M C;  4M78 E;  4CRI A;  5GAN 5;  2QEX A;  4M7D F;  4M7D A;  4RMO A;  3GNG A;  4M75 F;  1QVF S;  1M4Z A;  3CPF A;  1VQ9 A;  3PMT A;  5LJ5 j;  3UT1 A;  4OB1 B;  3HRS A;  3QYG B;  3KUF A;  3OB9 A;  4OP0 A;  3I55 A;  3GPL A;  4PJO E;  2ZPG B;  1V29 B;  1UEB A;  2DXB B;  2LC4 A;  2X4X A;  3E9F A;  3OSS C;  5A0G A;  1S72 A;  1VQ7 T;  3CMA T;  4IKF A;  1D3B B;  3L42 A;  4F7U G;  2RJC A;  2HD0 A;  1KQS S;  3CCU T;  1YJ9 T;  3CCJ T;  4ELY C;  4X34 A;  3JCM e;  3CME T;  3JB9 F;  1Y96 A;  3INZ A;  2X35 A;  3QG1 A;  1VQL A;  2LRQ A;  1QLB A;  4XTW A;  2MWO A;  4ATO A;  1RI0 A;  4WF2 A;  3URG A;  4HT8 A;  4BUG A;  3PT9 A;  2WAC A;  5CQX A;  1VQ4 T;  5FRM A;  2XIC A;  4KUI A;  1WNL A;  2NLU A;  2HAX A;  1Y7X A;  4C0F A;  4AI6 A;  4RCB A;  3GNF B;  1Y07 A;  5LJ3 j;  4C92 A;  2LTO A;  4XQ3 A;  2KMT A;  3ER0 A;  2ZZD B;  3M53 A;  2VYT A;  4MMK A;  3QJY A;  3OYD A;  3DLL A;  5L8R E;  3JB9 G;  1HXD A;  3LX7 A;  5LJ5 h;  4XTV A;  3JCM g;  1QVG S;  3QDR B;  4M77 C;  2E70 A;  2D0Q B;  1G3Y A;  4J6X A;  3RKX A;  1S72 T;  1N8R C;  3CCV A;  5I2M A;  2M9U A;  2H3J A;  3HSB A;  4C8Q G;  4QQG A;  3J81 E;  3A8L B;  3C95 A;  3CME A;  4M78 B;  3VKG A;  4C92 G;  2BS2 A;  4C8Q E;  1WGS A;  1ZQ1 A;  1IRE B;  1TH7 A;  3KHI A;  3CBO A;  1I8F A;  4LDY A;  4M78 F;  3BY7 A;  4EMG A;  3I56 T;  3CCR A;  3L2Z A;  4BE0 A;  5LJ3 d;  5KE2 A;  2HQX A;  5GAN j;  4PJO C;  1VQ9 T;  1KHI A;  3RER A;  2RI2 A;  3VUB A;  4EMK C;  3TEE A;  2DEQ A;  2WJ9 A;  3NTH A;  3QJ6 A;  4V2S A;  2EJF A;  1GXI E;  4KT0 E;  4JRP A;  5EJC A;  5FU6 B;  4XU0 A;  4EDU A;  1LOJ A;  2IVW A;  2QA4 T;  1VQ8 T;  2QQA A;  1H3Z A;  3A5Z B;  4ZGD B;  3NTK A;  4BAC A;  4C8Q A;  1O9S A;  4M78 C;  1N9R A;  1Q82 U;  2PVG B;  4D6W A;  5IAY A;  4C0G A;  1BIB A;  2MAM A;  1Q86 U;  2R5M A;  3Q1J A;  4QVD A;  5GAN 3;  3JRZ A;  2PVO B;  1VIE A;  1VQN A;  3H8Z A;  2FYK A;  3CPW A;  1UGQ B;  1YJN T;  1RL2 A;  2E1H A;  3QPH A;  3MP8 A;  2ZPH B;  1VQP A;  1M1K C;  5GMK e;  1VQ5 T;  3PMI A;  3MHX A;  3QII A;  2G77 A;  1IZ6 A;  4BI3 A;  3CCE A;  4M75 B;  2LT1 A;  4F7U B;  5D6W A;  4OB2 B;  1BI3 A;  3TCJ A;  3OYB A;  3O8V A;  3JAM E;  1VQN T;  1JRI A;  2ZCF B;  4B9X A;  3FJP A;  4FT4 A;  3VJP A;  4J83 A;  2DXC A;  3GP8 A;  1W2B A;  3H4C A;  4A4F A;  4M7D B;  1P92 A;  1AHJ B;  4HA8 A;  4LD6 A;  1OI1 A;  1OZ3 A;  2FL7 A;  4MFE A;  1XNI A;  2XDD A;  3OYM A;  1BI2 A;  3L1A A;  4Z02 A;  1M90 C;  2E41 A;  3QYB A;  2RHU A;  2DXB A;  5GAN f;  3P8H A;  3OYK A;  2DIQ A;  4QQD A;  2XD0 A;  1D3B A;  3JB9 J;  2Y90 A;  1KD1 U;  1UGS B;  5LJ5 g;  3QWL A;  1YIT A;  3SB2 A;  4M7A A;  1BIA A;  2VXE A;  3A8G B;  1Y96 B;  4C8Q F;  4XK8 E;  3MP6 A;  5CKF A;  2XG8 D;  4FT2 A;  4XAX B;  2OTL T;  1NPP A;  3RKW A;  2CZ0 B;  1N27 A;  3CBP A;  4J6Y A;  5CIU A;  5DM7 R;  3L2W A;  4XU2 A;  4JRQ A;  1KQ1 A;  1WJS A;  4PKC C;  2L89 A;  4OB3 B;  2VGN A;  3ZEH A;  1ZBX A;  4JRI A;  3HZJ A;  3BFM A;  2BS4 A;  4M75 C;  1XTD A;  1FX7 A;  4Y91 A;  3CCM T;  1KQ2 A;  4L59 A;  2PUO B;  2YLC A;  4II1 A;  4OGC A;  3FC3 A;  5CAI A;  1WPY A;  2ZZD A;  4NL2 A;  5J26 A;  1QP2 A;  2HNI A;  3FIF A;  1FKM A;  2VV5 A;  2ZGW A;  1JJ2 A;  3HRT A;  1Q81 U;  4C92 E;  2M16 A;  1U1S A;  1LJO A;  1VQK T;  2FB7 A;  3G71 T;  3OY9 A;  3G4S T;  2CGH A;  3MP1 A;  2QQB A;  1X01 A;  4JDS A;  4LDU A;  1W2B S;  4MIM A;  3M59 A;  1Q86 C;  3FDR A;  4FSX A;  5EG2 A;  5FU6 C;  5DLO A;  3AHU A;  3DLM A;  3TW7 A;  4RG8 A;  2O01 E;  2RK2 A;  3SWN B;  4C0D B;  2DD4 A;  3QKJ A;  3GOX A;  3TU4 K;  5DLQ E;  3E19 A;  1XQH A;  1LNX A;  1M1G A;  4DA4 A;  3MEU A;  1VQO T;  2HBP A;  2QFZ A;  3JCM V;  1M1K U;  2QEX T;  3CPW S;  4E7J A;  4E7I A;  1YI2 A;  3DL1 A;  4R56 A;  2KVQ G;  3HL8 A;  3JCM W;  2AHJ B;  3R6O A;  4C8Q C;  1NPR A;  2DIG A;  4DOV A;  2RHZ A;  4OB0 B;  3C4S A;  3HFN A;  3H6Z A;  5CQY A;  2RJF A;  3JCM P;  3LWI A;  2DXU A;  3WXM B;  2EFI A;  3CEY A;  1VQK A;  4J7F A;  4MZM A;  1Q81 C;  4C5E A;  1KHC A;  1WQW A;  3LW5 E;  4F7U E;  3X26 B;  3PTA A;  1KD1 C;  1N9S A;  1EIF A;  1FXX A;  2V8I A;  3M4Y A;  4PLL A;  1MHN A;  3VU3 C;  5GAM e;  3OS1 A;  2K5L A;  1VQ4 A;  5D6Y A;  4BE1 A;  5I21 A;  4M75 A;  2JUF A;  1B34 B;  5CVI A;  1YJW A;  3QBY A;  3OYC A;  1H64 1;  4NOY A;  5LL6 S;  2QI2 A;  2KR6 A;  2BKD N;  2RI3 A;  4M78 G;  1VQ7 A;  3HB9 A;  1VQO A;  3TW6 A;  3LLR A;  3CMA A;  4MZT A;  4L5G A;  4HNV A;  2X4W A;  3E9G A;  5GMK i;  3M58 A;  3QZ9 B;  3MEW A;  1PSF A;  3MCA B;  3V8L A;  5HKC A;  5FRN A;  4IUT A;  3BW1 A;  3OYI A;  3LH0 A;  4JJN K;  4HCB A;  2QTX A;  4E47 A;  4DQ2 A;  4M77 G;  3CC7 T;  4AKI A;  3JCM c;  2KK4 A;  3L2U A;  4XU3 A;  2XKO C;  4ZGJ B;  1VQ6 A;  2K5I A;  3X20 B;  3VYH B;  4RG2 A;  5GAO l;  2XDB A;  3S3N A;  4FL6 A;  3S3O A;  3M5A A;  3CC7 A;  4N4H A;  2LCL A;  1YIJ A;  3CC4 A;  4M7A F;  4JRK A;  2P0P A;  3M4G A;  4HT9 A;  1NJI C;  2M1H A;  4ZGE B;  5CK9 A;  3I56 A;  1BKB A;  3FRN A;  2JZ2 A;  3BDL A;  3QZ5 B;  3PIO A;  1K9M U;  2KMG A;  1QP3 A;  4J7I A;  4OMF B;  5GAO r;  1X6O A;  2RHI A;  2E65 A;  4M75 D;  3EFS A;  3CCV T;  2R5A A;  5KCO A;  4EMK A;  4OVA A;  2OTJ A;  5KCH A;  4C92 C;  3LYI A;  2DTI A;  4C5G A;  2F5K A;  4UC4 A;  1Y71 A;  2DXC B;  2KSS A;  2Y4Y A;  5C0M A;  2DXT A;  4QW2 A;  4BDY A;  3P8D A;  2GFU A;  1BI0 A;  4J5Y A;  1YCY A;  2EWN A;  1QW1 A;  4M7A C;  3OYA A;  2F69 A;  3FLG A;  3CBM A;  3CCQ A;  1M8V A;  2RD1 A;  4L6V 5;  2R57 A;  2E10 A;  4PNO A;  2P0K A;  2RO0 A;  4QVZ A;  5J3B A;  4DOW A;  3CC4 T;  3CCL T;  5CKD A;  1YIJ T;  2R58 A;  4NL3 A;  5GMK j;  1KG1 A;  4XTX A;  3OBW A;  2JOY A;  2DZC A;  3X25 B;  1U1T A;  5GAO p;  2K3X A;  2EYQ A;  3OYJ A;  2LX9 A;  4VUB A;  3RUX A;  3S3M A;  3RMS A;  4BY6 B;  3PGG A;  4J8O A;  2EQK A;  3S6W A;  3CCR T;  2G3R A;  2IG0 A;  3CCJ A;  5C6S A;  4ZTF A;  2RHX A;  4C0D C;  3ASK A;  2OTJ T;  4BDZ A;  3DB4 A;  3T9N A;  3PNW C;  4FIB A;  3OA6 A;  3TRE A;  1JJ2 S;  5GMK h;  3CCS A;  4RCC A;  3OS5 A;  5GAM j;  5GAN 2;  3ZBD A;  3OW2 S;  2O4X B;  2QA4 A;  1HK9 A;  2DO3 A;  3OYF A;  4HCC A;  4Z6Y A;  3DKM A;  1JBM A;  3CC2 A;  3JSC A;  4XU1 A;  4IUV A;  2JVV A;  3V7R A;  2FVU A;  4F7U F;  1FWZ A;  2OAU A;  4KUD K;  1B34 A;  2JN0 A;  3MEA A;  3CD6 A;  4PJO B;  4PLI A;  2ZPE B;  2QXF A;  3VKI A;  2CYZ B;  2M0O A;  4B9W A;  5A2Q E;  1N6A A;  3JB9 I;  1NJI U;  2DAQ A;  2RJD A;  3CCE T;  4ZN1 A;  4NC6 A;  3OYN A;  3SWN A;  4QQ6 A;  2DTH A;  2DD4 B;  3OYY A;  1I4K 1;  3EAE A;  5D6X A;  4JS4 A;  3JCM h;  2WSE E;  5A0L A;  2LNV A;  5IT9 E;  4C5I A;  2JNG A;  4LDX A;  2DKG A;  3JCM d;  5GMK l;  3CD6 T;  4XTY A;  4GLK A;  2L3R A;  4LDW A;  1N8R U;  2A3L A;  4HCZ A;  5GAN 7;  3A8M B;  5DY9 A;  4NS5 A;  3I55 T;  4JLI A;  4N0A C;  2LQK A;  3MET A;  4M77 B;  5GAM f;  4KUL A;  4C5H A;  3CCU A;  4A54 A;  5LJ3 e;  2ZPF B;  2E6N A;  5GAO q;  1PSE A;  4M75 G;  1UB4 A;  3CC2 T;  4AKH A;  2BIV A;  1VQM T;  1YJ9 A;  1YJN A;  3QSU A;  2K4Y A;  3A8H B;  2EQM A;  5FLX E;  3VV0 A;  5LJ3 h;  2DJZ A;  3BG5 A;  4C0Z A;  2RK1 A;  2YHT A;  5LJ3 g;  2DZ9 A;  3C12 A;  3M54 A;  1KC8 U;  3RES A;  2C06 A;  2VXF A;  5A0D A;  4M7A E;  1QVG A;  5FU7 B;  2GQV A;  3SD4 A;  4BBR M;  4N0A A;  2YRV A;  3FB9 A;  4XTZ A;  1Q7Y U;  1M90 U;  2L8D A;  4A4H A;  3CCL A;  4M77 F;  2EKO A;  2CS7 A;  1JB0 E;  4M7D D;  3EFR A;  2E6Z A;  4MDW A;  4PJO G;  3CCM A;  4FU6 A;  1VQP T;  2ZPI B;  2CZ1 B;  2JTM A;  2KDS A;  3QXE B;  4N4I A;  2ZPB B;  1Q82 C;  3NTI A;  1U8R A;  2V8K A;  3LWH A;  2XHC A;  1K73 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...