3A8LB

Crystal structure of photo-activation state of nitrile hydratase mutant s113a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8lB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8lB02
2ZPIB 4L6V5 1DJ7B 2CZ6B 3QXEB 3A8MB 2DXCB 3X25B 1V29B 2PU9B 4OB0B 1IREB 2PUKB 2ZCFB 2ZZDB 4OB1B 5L8RE 1PSEA 1QP2A 2PUOB 4RKUE 2QDYB 2CZ7B 3HHTB 4ZGDB 2O01E 2D0QB 4KT0E 2CZ1B 3A8OB 2ZZDA 2AHJB 3QZ9B 2WSEE 3VYHB 4ZGJB 2DD4A 3A8GB 3QZ5B 2WSCE 3X26B 4ZGEB 3WVEB 2ZPBB 2DD4B 3QYGB 1UGSB 2WSFE 1GXIE 3WVDB 2ZPGB 2ZPHB 2ZPEB 1JB0E 4FM4B 3LW5E 1UGQB 3QYHB 2ZPFB 2DPPB 4OB2B 3A8HB 3X28B 1QP3A 4OB3B 1AHJB 2CYZB 1UGRB 2PVDB 2CZ0B 3X20B 3X24B 4XK8E 3VYGA 2DXBA 2DD5A 3A8LB 3VYGB 2DXBB 2DXCA 1PSFA 2PVOB 1UGPB 2DD5B 4Y28E 2PVGB
chains in the Genus database with same CATH superfamily
1BIAA 2KT1A 2FHDA 1AOJA 2X4XA 3H8ZA 2XDDA 2RJFA 2EAYA 2DMOA 3JV3A 3CCQA 3VS0A 3CCLT 1JO8A 4PFOA 2E65A 3K7AM 2FRYA 3INZA 2DBMA 2ZGWA 4XU3A 3CCSQ 1VQNQ 4AFUC 5GMKm 4M7DA 2NWMA 4XTWA 4R56A 1H4LD 3DDQB 1W70A 4F7UF 2CH4W 3G6ET 4KT0E 2R7GA 3DTOA 5LL6S 2QG9B 1ZHIA 2HAXA 3A8OB 1QMCA 4C92B 2IW9B 4Y91A 1AWWA 1HXDA 4L5GA 3C95A 2LQKA 2DD4A 4C8QB 4F7LB 2VGNA 5AT1B 3QZ5B 4BCPB 1N4MA 2MIOA 3H0FA 3DB3A 4RCCA 3OW2S 2H3EB 3FIFA 1EFNA 4HA8A 3M59A 4M7AF 4CFUB 3OW2P 2J6FA 1I5OB 2LZ6B 4II1A 1NYGA 3H0IA 1OI1A 2ZPGB 1H25B 2DF6A 2KQWA 2SEMA 2YUQA 3UATA 4FM4B 3LW5E 3MKDA 4J9GA 1M90C 2RK2A 1VQPA 5HVYB 1YCYA 5CKDA 2DPPB 3LGLA 4HL4A 1RAIB 2OTLA 3BLRB 1IHVA 5FU7C 4LOCA 2RJDA 2JZ2A 3MPUB 4BCND 2K5LA 4BI4A 2J06A 2M9UA 3WXMB 1NLPC 4EPCA 3TQ7P 2KYMA 4A4HA 3PT9A 4BE0A 3OYHA 1RI0A 4M78D 1KC8U 2DZ9A 3BY7A 2AIRB 1RLPC 3G71A 4FYYB 3QWYA 3CCJT 3BW1A 2DXBB 2D8HA 2H8HA 1VYVA 1VQ9T 3MJXA 5FRMA 4M6VA 1VA7A 1VOLA 2LT4A 3M53A 2A28A 2LJ3A 1XTDA 4BCJB 5HBEB 2VWFA 3QDRB 4RMOA 4PLLA 4OP0A 2K6DA 5GANj 2UZEB 1X2QA 2E6NA 4AKHA 5I21A 2GTOA 1G8XA 1WX6A 2L5QA 3HFNA 3OYKA 1VUBA 3EH1A 1BKBA 4LNPA 4JRKA 2A3LA 2JUFA 1N8RR 4A54A 4M78C 3CXCP 3CD6T 3H4CA 3CC2T 4M7DF 3A8GB 2V8KA 2DYBA 1TOVA 2CT4A 1D3UB 1KD1C 1D0XA 2C5NB 3UDCA 1EX4A 4C5HA 1RLQC 2DL3A 2HCKA 2OI3A 4D8KA 1C6VX 5CQYA 1J3TA 5FWBA 2CUDA 2LP5A 1JXOA 4Z88A 2HBPA 2LDMA 3CMAQ 3NTIA 4QQDA 3V7CA 2DXTA 1UUEA 1UGQB 3E9GA 2EVRA 1GH6B 2HQEA 3Q1JA 2HKQB 4JZ4A 1YJ9A 2QTVA 3QWLA 5IHNA 3QG1A 4PJMA 3M58A 4X1VA 3X28B 3M4YA 5FROA 4AFSC 1YITA 2KVQG 2O9SA 3QWXX 4E47A 3DDPB 4C5IA 5GAOp 1ZSZB 3EOCB 3BDUA 2VV5A 3I5RA 1VQMA 3JB9F 1WHGA 3PO3S 3DKMA 2LRQA 3CPWA 2FEIA 4WCIA 2C4GB 1LJOA 3HRSA 3JRZA 1X75C 1TG0A 1ZQ1A 8ATCB 2D1XA 5GAN8 1UB4A 4JRQA 3MHXA 2O4XA 1YJNT 1JSTB 2DBKA 2KE9A 1D0ZA 4IUUA 4K11A 1YP5A 4LE9A 2MYSA 2D0NA 2PTKA 1M1KU 1OPKA 3OS5A 4WF2A 4I3ZB 2PU9B 3LWIA 2YHTA 3OQ5A 1T3LA 1ARKA 1M1FA 2MK5A 1JSUB 3I55A 5KCHA 3RKWA 1CKBA 4AKIA 1W1FA 3NHNA 4LDWA 2EIFA 2DK3A 3CCUQ 3M56A 1N5ZA 2CZ1B 4BY7X 3F70A 5GJVB 5FU6B 4OMFB 3CPWS 4EC8B 2EJGA 3EG9A 1K4US 1K0XA 3RMQA 4BCMB 2W99A 1WDXA 1Q81U 3CC4A 3UF4A 4PLIA 3CCQT 1VQOA 2KR3A 4C92D 3EHRA 3QYGB 1ZUKA 4QSHA 4C8QD 2E1HA 2RA2A 3EGDA 1M8VA 4F7JB 2KROA 2FRWA 4CFUD 1M3CA 3GTMS 4OMNA 4X9CA 1AZGB 2RQTA 4JPBW 4N0AA 4JX6A 3BG3A 2Z0WA 5IH2A 2DXUA 4GLMA 4ROCA 3G1JA 1R0BG 4UN0A 1Y71A 1PKSA 1VQ6Q 2I40B 2CP3A 3OB9A 1VQKQ 1QLYA 5HKCA 1UHCA 4HCCA 1Y96B 2V1QA 4JLIA 1MMAA 2EYQA 2UZBB 2DA9A 2DTIA 2EYXA 1I8FA 4CRLB 3EAEA 1MGQA 2W2HA 3EFOA 5GMKl 4M4ZA 1NPPA 3M0UA 1JU5C 2DLPA 4C92C 3EG2A 4FSSA 1M2OA 3OYIA 1LCKA 3URGA 1M4ZA 3MEWA 4C8QC 1HK9A 2WIPB 3EIDB 1QVGA 4Q5WA 2GQVA 2CREA 4BBRM 2KRMA 3CCLA 4EMHA 4MZTA 4V2SA 3R6OA 2VASA 3M55A 3S6WA 2LX9A 4IURA 2RI5A 2IG0A 1VQ8A 2PUKB 4ELZC 2ZCFB 1WHMA 3SWNB 1K73U 1AT1B 2E70A 4F6SB 3TNIB 3EG1A 3G6EA 1D3BA 3EG9B 4CRIA 2OTJT 2K3BA 4PNOA 2XD0A 1SF9A 4RG8A 3I35A 3ME9A 4HKEA 2JM9A 2QEXT 1VQ4Q 3UA6A 1RABB 4DBHA 1TSFA 3M03A 2CSIA 1OYXA 5LJ5g 2X35A 3G71T 2K9GA 2WJ9A 1AEYA 4XQ3A 4FYVB 3HRUA 3QHSA 2QQ8A 3VYHB 4ZGJB 1VQLA 2DM1A 3NPFA 5LJ3e 1X01A 3CCMQ 1H1SB 4BE2A 4EOPB 1M2VB 3L2RA 2X9HA 3VS4A 4IKFA 2V26A 2J6KA 1WLPB 4KBMB 5I2MA 3A5ZB 1Z9ZA 2DYIA 2L3RA 3JCMP 3CC7Q 4KGVB 3BG9A 4MFEA 4HVWA 2LVMA 1X27A 4Z8AA 1TUCA 2PHGA 2VXEA 1QVGS 2EUFA 3HSBA 2LQWA 1QVGP 5IN1A 3M0QA 4ZN1A 2NLUA 1VQ7T 1QVFP 4EOQB 3EJ1B 4R0KA 1SHGA 2MMPA 3IQLA 1YIJQ 5GAOn 1FWZA 2MI6A 1TS9A 4EMKA 4OB2B 1OI9B 1NZ9A 5DM7R 2JMCA 3OS0A 2M02A 5KYWB 1WGSA 2DJZA 2X51A 2YUOA 3E19A 2D6FA 1VYTA 2FPFA 3OYDA 1Q82C 3QHRB 1KD1R 2VGMA 4HXJA 3FEOA 3TCJA 5D7UA 3DOGB 3C0CA 3X24B 5GANh 2B9RA 3KUFA 2DAQA 4E7LA 2ED1A 3CCJA 2V22B 4LXCA 1MV0B 3REBB 4CC4B 3OS1A 3H0HA 1VINA 1G3NC 3CCSA 3POMA 2EFIA 1VQ9A 1B07A 5HK0A 1S1NA 3L1AA 3JCMe 1YJWQ 3OA6A 2DNUA 1H92A 4PJOE 2DD5B 2LX7A 1VIFA 5GAN4 2RQWA 5GANg 3VS5A 1RAHB 5C6SA 4A53A 2DVEA 2RQUA 4AFZC 1U8RA 5GANf 4E2FB 2C06A 2EQMA 1JKWA 3NGPA 4JDSA 2LJ1A 4YOZA 1BI2A 1E9HB 5DY9A 2E4HA 4M77A 2Y4YA 2RMOA 2KYBA 2W9FA 4IIOA 4TVRA 3CD6A 4EC9B 3CC2A 4B6MA 4HT8A 5GMKh 5CKBA 2G6FX 2JN0A 1UJ0A 2O88A 1GFCA 4FIBA 1ZSZC 2EKHA 4JJBA 1E6GA 4M78E 4JJNK 3PVLA 4GBQA 9ATCB 2EW3A 2CP6A 1FINB 1H24B 2C5OB 1M9SA 1TFBA 5J26A 4A4FA 4EORB 1YCSB 3AHUA 4BCMD 5GANd 1X6GA 1NE8A 4OMLA 3G33B 3QHWB 2EGAA 2NUPB 1Q86C 4J9DA 2FB7A 1C0MA 3CBOA 3GNFB 4A63B 2COYA 2Y4XA 1Q7YR 2CT3A 3NTHA 2YLCA 4M75A 3H41A 4FYXB 1OZ2A 4FYWB 1KIKA 2WFYB 2K4YA 1WI7A 2OJ2A 1UGRB 2CP0A 1G83A 1WHLA 3V7SA 1UJYA 4ME7A 3TU4K 4Z6YA 3HZJA 2HNIA 2FL7A 1ACMB 2O31A 2QA4Q 2DRMA 1GCQA 4Z02A 2CH4A 1PHTA 1YJNA 4LD9K 1W2BP 4OGRB 4M7AG 5FU6C 2F1LA 3E9FA 3VYGB 5D6YA 1GCPA 4M75G 4O5VA 4FL6A 4XU1A 1S72T 1QMZB 2W10A 3HFOA 1M1GA 3OYBA 2CCIB 1OKVB 1OQKA 4OB0B 5EFQB 3CMEQ 2P0KA 2X4WA 3NFCA 4OR5B 1VQ5Q 4BDYA 1H28B 2YT6A 2AK5A 1AZEA 2FPEA 2K2MA 4CI0C 3OSVA 2RB6A 3QSUA 5AYFA 1GBRA 2KI7A 2A7YA 1RADB 1K1ZA 2FO0A 2HQHA 3QKJA 2O9VA 5A0DA 3CCET 2ZZDA 4ELJA 4VUBA 1RUWA 2LW4A 2AHJB 1Q95G 3I9QA 4M7AB 4IMYB 1YI2Q 4M77F 1MNDA 2W0ZA 3MIAB 2ROTA 5IXFA 1AWOA 1TUDA 3VS3A 1K9MU 4M75B 2DL4A 4IUPA 4QVCA 2EWNA 3EG0A 1IXDA 1VQ8T 4RTVA 2VB6A 2QDJA 1GXIE 1SG5A 3TEEA 1UNGD 3TSWA 4F7UE 2EPDA 4DOWA 1KQ2A 5DQWA 4KUDK 1TH7A 1OU8A 3C12A 4G6LB 2YLBA 2ABLA 3F5XB 3OYYA 4AKGA 4ELLA 2KGTA 2M0YA 2JMAA 2XDPA 5M9OA 1AWJA 1SRLA 4PJOD 1TWBA 3SWNC 1X2KA 2QASA 2QK0A 4A4KA 2AKLA 1VQLT 2PK2A 2UZDB 1V76A 2EQIA 3OSSC 1C9BA 2CZ0B 1FYNA 2I2LA 4M75F 1G3TA 2E41A 3JCMb 4WTOB 4M7DG 1N9SA 4NSTB 2VUBA 4J8OA 2IIMA 4PFPA 3HP9A 3GP8A 4HCBA 3I56T 4JS5A 2A08A 3LGFA 1Z9QA 2GF7A 1BU1A 4JZ3A 3MO8A 4C92E 2CZ6B 2GFAA 4C8QE 2DXCB 3CXCA 2JJ9A 1VOMA 1OGUB 3VS7A 3MY1B 2V8IA 2OTJA 1IREB 2YUPA 3EHQA 4JX4A 1Q82R 2ZZDB 2RI2A 5KE3A 4EOMB 5IAYA 4DQ2A 2QEXA 1G5VA 2V1RA 1KSWA 3C94A 4PJOC 3QUIA 2XIDA 3OYAA 3LQ5B 2KEAA 1KHIA 3JB9G 1H26B 1D1AA 1H3HA 2FPDA 3BE3A 1YHQQ 4KRTA 4M7DB 3CCST 1VQNT 2VVKA 1TTHB 3REAB 4BXXX 1MNEA 1MUZA 1JEGA 5I5ZB 1H1RB 3N5BB 1KXUA 4XTYA 1WA7A 4FT4A 4YOOA 2DIQA 2FYKA 1B3QA 2EYYA 3OBWA 1QKWA 2YDLA 1QCNA 2DD4B 2LNVA 1U06A 3BDLA 1QW1A 1OEBA 1WZOA 1VQ7A 3RKYA 2DMEA 3NTKA 1UTIA 1YWPA 1FMWA 1WPYA 2XICA 1SPKA 1XO2A 4J9BA 3CXCS 3A98A 3FC3A 2P84A 2X3WD 2KDSA 4F04B 3QYHB 2HZYA 3A1PA 3G4SQ 3LH5A 4QT7A 1IHWA 4BACA 2CYZB 3FJPA 5IT9E 5L23A 2IVWA 1I07A 1JJ2P 2DFUA 3GNGA 3OYFA 3ZEHA 3LLRA 2XG8D 1WQ7A 2BZ8A 2XHCA 2J05A 4BI8B 2RH2A 4D8DA 3FDRA 4BY6C 2O2OA 4IUTA 8AT1B 1N27A 3SFMA 3OYEA 5GAMj 1GUXA 1Q86R 5FRNA 4ROEA 4F6UB 4DBQA 1PSFA 1OOTA 1XQHA 3RNJA 3EGXA 1K9MC 4DOVA 4F17A 1PD1A 4HT9A 1NJIR 3CCVA 1UECA 5KCOA 2CSQA 1KQSP 1WIEA 4EOSB 2HD0A 4F70B 1OIYB 2RHIA 2VYTA 4FU6A 2E3IA 2F5KA 2QDYB 1WJQA 2LC4A 4A4EA 2BKZB 5I11A 5LJ3j 1B34A 1PNJA 1FKMA 3BLQB 2BE7D 2JVVA 2L3QA 2X3XD 2EBPA 3RKXA 2K2VA 5LJ5e 4LDXA 1KJWA 1UE9A 2KR6A 1QCFA 3H9NA 4OGCA 1C1AA 4BY1X 3PNWC 2CP7A 1U5SA 2RPNA 2KRSA 3WVEB 2HEQA 1PKDB 3M57A 4UC4A 5HCKA 4BCOB 4M7AD 4JRPA 4RCBA 3U23A 5IDPB 2QGGA 3L2UA 4CFMB 3S3OA 1GBQA 3QJ6A 1HSQA 3P8BB 2IVXA 3QBYA 4J7IA 1ZLMA 2KMTA 4RTTA 3OYMA 5IF1B 2BKDN 2QXFA 2KT8A 1VQPQ 2DERA 1YWOA 2NUZA 3CMAT 2OTLQ 5KYYA 2WIHB 3A8HB 2W9ZA 3RERA 5IHIA 1KC8C 3JCMc 1R77A 2XKOC 2EYWA 1I81A 4XK8E 2COZA 2GCXA 1MHNA 3A8LB 1V1CA 2CS7A 4J6WA 2JGZB 3HB9A 3G71Q 1S72A 4M7AC 3CBMA 4BCKB 4XTXA 1N6AA 3MP1A 2ZPIB 4L6V5 5GAOr 1CSKA 2O4XB 5IXBA 1V29B 1B34B 4BUGA 4MFDA 3JCMJ 5GAOq 5CKEA 3RMSA 5A0LA 1IRXA 4JJDA 2XI9A 1AVZC 3LYIA 1R0CB 3KXTA 4ANJA 1SSHA 3ZFJA 1N8RU 2JOYA 2BS2A 4MMLA 3CCEA 2E5KA 1B7TA 1QVPA 3VV0A 2L2PA 1ABOA 3CEYA 1M90R 1BIBA 2C0OA 4BCQB 4RTXA 1QKXA 5GAN3 1QVFA 2GFUA 4QVDA 2JTEA 2HSEB 5GAMe 3NMZC 3RESA 3CCUT 1NYFA 3ASKA 5I22A 4M7DD 3EFSA 4QQGA 1CKAA 2J6OA 1FMKA 2WHBB 3MCAB 2VKNA 2E6ZA 1P92A 5KYNA 5KYYB 1WHHA 1PKTA 4RODA 4J9EA 5IHKA 2GQIA 3RIRA 1D1CA 4ORZA 2ZPEB 4AT1B 1QLBA 4C0DB 3EGDB 4DBFA 3L2QA 2P0PA 4J83A 4XAXB 1YJ9Q 3SDZA 1TD6A 5EJCA 2BUDA 1W6XA 2E10A 2QI2A 2LNHB 4M78A 4BDZA 2I53A 1T3SA 1W98B 4KUIA 3TSZA 1YITQ 4AFQC 3SB2A 3HRTA 5GMKi 1VQMQ 2LCLA 4NL2A 1UNHD 3I56A 1VQ6T 1VQKT 3JB9D 5KYUA 3JCMW 1QVFS 1G3WA 1M1KC 1BI0A 4AMCA 4M7DC 4HVVA 1UHFA 2YSQA 5HBHB 5HBJB 2K79A 2LMJA 3VRZA 1Y57A 3EFOB 1JRIA 2JTFA 3MI9B 2GBQA 3E2UA 2X4JA 4OMMA 4TTHA 2QGFB 5DQVA 4C5GA 4ZTJA 3X25B 3M0PA 2EKOA 4M78G 1K8AU 5ICPB 2DL5A 3J7AF 5IDNB 4FSXA 3SEMA 4ZN3A 1RL2A 4KH0B 5FW9A 3VJPA 3L2VA 3DL1A 2RHYA 4AI6A 1VQNA 3I55Q 4MZMA 1JOWA 3CCRQ 1Q81C 1D3BB 5J39A 3GLXA 3LX7A 2E5QA 2O01E 1WJRA 4L59A 1GY3B 1UG1A 4J7FA 1H1QB 4IUQA 3OYJA 2RK1A 1VQ4T 1OV3A 4XU2A 1IZ6A 1BK2A 2LT1A 3CCVT 1BU2A 3CC4Q 2A0FB 4N4GA 1VQOQ 5DLQE 5CAIA 4M78B 1G2BA 3CCMT 1OX9A 1ZUYA 4EOJB 4C0ZA 2JM8A 1F1BB 2QQSA 4CFWB 1WHKA 1EIFA 1W2BA 3CC7T 4JX5A 4LDUA 3VKIA 3RR6A 2RJCA 5GAOm 3PVQA 4BCHB 1Y7XA 1JBMA 1TUGB 4D6WA 4FT2A 4KH1B 2KNBB 3HTRA 1K9AA 2Y90A 4C0GA 1Y07A 1WQWA 1I0CA 3SD4A 1YN8A 1YIJT 1KG1A 4QQ6A 4EMKB 4MDWA 3VUBA 4HNUA 2DTOA 4X9DA 3QJYA 4PFZA 4M77G 4X34A 5FGKB 5GAMf 2DZCA 3TREA 4M78F 5LJ3h 2D8JA 4N4IA 3EGUA 2CKKA 2RNAA 3OYCA 5CKFA 2PVOB 2MCNA 1UGPB 1K73C 2PVGB 2NYSA 3JB9I 1ZUUA 3CQTA 1OU9A 3CCLQ 5GAN2 4B9XA 2JNGA 1YJWT 2PJQA 4Y92A 4RTUA 3D7SB 2HMAA 1KC8R 1U3OA 4HCZA 1IB8A 1VQ8Q 1XNIA 1W2BS 2NUTA 1EZZB 2CDTA 4OB1B 3JCMV 5LJ3f 2KK4A 3G6EQ 2W96A 1ZA2B 2MF2A 2PK9B 1RAEB 2YUNA 3TW7A 2EJFA 1YBYA 2C5XB 4M77B 3PIOA 3EG3A 1RI9A 4PL6A 4C92A 3MEVA 1WHJA 2M16A 4F7SB 4C8QA 1T0HA 2FZCB 1MMGA 1BYMA 3I5SA 4HVUA 1FXXA 2LJ0A 1VQLQ 3G7ZA 1X6BA 3JCMh 2QQ9A 4JRIA 5LQFB 1NM7A 1OULA 3PMTA 1UGSB 4XTUA 2KMGA 4BI3A 4E7JA 4XU0A 4YC3B 2BTTA 1WXUA 3RUXA 3E1SA 2HQXA 2QQAA 3CMAA 2YRCA 2DKGA 2MOXA 1KD1U 3JCMg 5LJ3d 1VIEA 1UEBA 4P5NA 4MZPA 1K8AC 2P0QA 3HL8A 3OYNA 1H641 1ENWA 2ZPFB 2ZAEA 1BCOA 4F6WB 4CFXB 4J9IA 3JCMf 1OPLA 1TXQA 1PRMC 3PE0A 4A4GA 1SEMA 2FVUA 3ZL7C 4HNTA 1NEBA 3QPHA 2B8AA 1G3SA 2JS2A 2LTOA 2MPXC 3J81E 1JXMA 4R55A 2UUEB 3CCJQ 2B86A 2DVJA 2EYZA 2DXBA 1X69A 2QA4T 2WMAB 2G3RA 2NUTB 3RBBB 1VQ9Q 4LN2A 5CO7A 2C5VB 1BCMA 1PC0A 1XOVA 1D0YA 1FX7A 4M7AE 2D9TA 3THKA 4J9HA 2RQRA 4M75E 2G77A 4OMOA 5J3BA 4II5B 1BBZA 4OVAA 4EOOB 3UA7A 3JCMd 1PSEA 5LJ5j 4LUDA 1E7OA 2VXFA 1M1KR 5ECAA 1E6HA 4C0DC 1WXTA 1OX8A 4DEYA 3CMET 3MEAA 2ED0A 4RUGA 2YWWA 1WFWA 3CCUA 1VQ5T 3CD6Q 3JB9J 3CC2Q 3GF5A 3FLGA 1OZ3A 2FZGB 5GAN6 4N0AC 3TN8B 2IW6B 3BG5A 3VS2A 2WSEE 4LUEA 3TVTA 2K5FA 4LDYA 2M51A 4C92F 3X26B 1Q7YU 1JJ2A 1YI2T 5HK3A 4E7SA 3VKGA 3M0SA 3V8JA 4C8QF 2FG0A 3TNWB 2A36A 2X1NB 5CKHA 4HCKA 2SRCA 4ELYC 3GPLA 2P4TA 4MMKA 2DX1A 3QYBA 2JW4A 2C0TA 1IGUA 1Q81R 2PNIA 2JXBA 2GNCA 1ZP2A 3NDQA 4J6XA 2EQJA 1NG2A 4N4HA 1LVKA 1URCB 1QWFA 1ZSZA 1VQ6A 1VQKA 1HD3A 2OAUA 2DIGA 4C5EA 1KQSA 2CUBA 4RTYA 3DLLA 3PTAA 2LCCA 3M54A 5FWCA 2DRKA 3OBYA 1ABQA 4GLKA 3VS6A 1I5LA 1LOJA 2EQKA 1YJNQ 3HPWA 1VYWB 1PM3A 4DA4A 4E6RA 4F14A 4M7DE 2DEQA 1OL1B 2L3PA 3OS2A 1JJ2S 2KXDA 3OMCA 4EOKB 3OYLA 4EDUA 2AKKA 4AG1C 3BHVB 3HO8A 3M4GA 5L2WB 1ZX6A 2XMFA 4B9WA 3OY9A 2M0OA 5L8RE 3TW6A 2DILA 3BFMA 3M5AA 3PFSA 4ESRA 4RKUE 4OF1A 2DTHA 2R57A 3VKHA 2BZXA 3DJBA 1HJDA 2QYZA 1PRLC 1VQ4A 7AT1B 1PCXA 1KK7A 1H27B 4Y72B 2WXVB 5GAN7 1A0NB 3ULRB 3BLHB 5GAOl 1K73R 1RACB 1KQSS 2FZKB 3CCQQ 4EMKC 2K7AA 2WMBB 4BCGB 2RI3A 1YHQT 5BNJB 3KHIA 4M77D 5GMKj 4EONB 1PWTA 2WPAB 1KQ1A 1O9SA 4OMQA 2RN8A 1RAGB 2MWPA 3CCMA 1OIUB 2F2WA 3MY5B 4ZGEB 3FJ5A 1LPLA 2I0NA 2QF7A 3CC7A 1LNXA 2ENMA 4PJNA 4E7KA 1UNLD 2RQVA 3SHWA 2XDBA 1BI1A 3KFVA 1SSFA 4KGZB 1I4K1 1JB0E 5CEIB 1IGQA 2QDLA 3HKSA 1AWXA 2R5AA 1YIJA 1HYOA 3VS1A 1H8KA 1Y96A 1NLOC 2F2VA 5GJWB 2PQWA 4KGXB 2IN3A 1UDLA 3G4ST 4OGEA 2E3HA 4EMGA 3V7RA 1X6OA 3L2ZA 2QQRA 3PGGA 2OX7A 4M75D 1NBEB 4BBSM 2RD1A 4M77C 4MIMA 1U1TA 2HSPA 3BHUB 2KSSA 3RDVA 4FW1A 2YRVA 4XTVA 1Q82U 1YJWA 2QQBA 5LMKB 4CC3A 3JAME 1K8AR 3CCRA 4F7NB 4HNVA 1GUXB 2ATCB 5ACBA 1FVVB 1PG5B 3V8LA 1Q7YC 1M3AA 1XJWB 5KH6A 5D6WA 3EGXB 3SWNA 2DE0X 3VU3C 2F2CA 1AD6A 2OTJQ 3UT1A 3CPWP 2EQUA 4RG2A 2QEXQ 5HQ0B 2CGHA 4RTWA 2AZSA 3L42A 1YFNA 4XTZA 1GL5A 2YXYA 2LQNA 2L0AA 3OMGA 4NS5A 2RHXA 3HHTB 4ZGDB 2D0QB 2ECZA 4M75C 5A0GA 4QW2A 2RHZA 5GANe 1M27C 6AT1B 1M2VA 2EGCA 2PZ1A 4GY5A 5CR2A 2BS3A 2WSCE 4F16A 4JS4A 2ZPBB 2IPOB 2RHUA 1M5Q1 3LH0A 1ZBXA 1WYXA 5KE2A 1GCQC 1VQ7Q 2HDAA 3WVDB 4KRCB 4PJOA 1O75A 2DL7A 4KULA 2KRNA 3S3NA 1W4SA 2WACA 2AZVA 4CXAB 1GFDA 2K3XA 4FCYA 2RF0A 2IW8B 1K0SA 2E64A 5KYWA 1O9KA 1NPRA 2C6TB 4FX3B 2COWA 4JUVA 2V8JA 1QP3A 1Q86U 4ZTFA 1MMDA 3S3MA 3OYGA 3EH2A 1VQPT 2DL8A 3X20B 2OTLT 5CQXA 4HLQA 2MWOA 4DBRA 4Z89A 2HKNA 1KFZA 4EIKA 5LJ5h 2QA4A 4BE1A 5GMKe 1AD5A 4BCFB 5CCAA 2G9XB 2ESWA 3BHTB 3MP8A 4LD6A 4O6JA 5EC7A 4PJOG 1NJIU 1H1PB 2OAWA 2HBWA 2DD5A 2BS4A 4ATOA 3R6NA 5KYXA 1MV3A 3LWHA 2HL3A 4Y28E 1IO6A 2RJEA 3FRNA 1H3ZA 3QXEB 2JS0A 4C0FA 3CCVQ 1X43A 3O8VA 2DJQA 3AT1B 4LDVA 4J5YA 3MEUA 2RO0A 5LJ5f 3CMEA 1I1JA 2L8DA 5FU7B 3M0RA 4MDXA 1GRIA 1VQ5A 2PUOB 3QYEA 1R8OB 1T0JA 2QAZA 2CZ7B 1QCOA 2CJMB 3RGFB 1D09B 2EGEA 4PJOB 3QDFA 2X4YA 1YI2A 3META 3QZ9B 2L3SA 3T9NA 2GGRA 5IHYA 2ROLA 3FB9A 3CBPA 1SKUB 1UGVA 1Y0MA 3GOXA 2K3YA 1M30A 2EJ9A 1O9KB 1OKWB 2QFZA 2WSFE 1SRMA 1VYUA 2NUPA 1E7PA 2BIVA 4YTLA 4CC2A 1FMVA 3CPFA 5LJ5d 3UPUA 2JT4A 2E12A 5CVIA 1K9MR 5HNBB 4BCNB 4DEXA 5FLXE 5D6XA 4BB7A 1RAAB 3M0TA 2DETA 1MMNA 3P8DA 2JTMA 4PJOF 4E7IA 1AHJB 3J80E 2GTJA 4PJLA 2UZLB 1WXBA 2R5MA 3KBGA 5EG2A 3ZBDA 4ZNXA 5KYXB 1YJ9T 2PVDB 3HBLA 2F69A 3M9QA 1QQJA 1ZBJA 5GAMh 2RM4A 1YITT 1AISB 4CFNB 2YRDA 3VYGA 2P4RA 1VQMT 3GIBA 5KYUB 1M8MA 4E7HA 2C0IA 3QO3A 1S72Q 4PK4A 4NC6A 1D1BA 4EOLB 2XK0A 4J9FA 4E7ZA 1DJ7B 2KAFA 2VC8A 1N8RC 1BI3A 3GBQA 3A8MB 4BY6B 5GAMg 2XU8A 4QVZA 2K5IA 1RAFB 4KRDB 1NEGA 3L2WA 3ER0A 1M90U 4F7UA 2KXCA 2F5TX 1U1SA 1K76A 1ZA1B 2H3JA 1BB9A 1N9RA 2DEUA 1QP2A 5DLOA 3JCMQ 1QWEA 1UFFA 3CCEQ 4BD3A 2K57A 3EFRA 1G3YA 1OL2B 2M1HA 3DLMA 1YHQA 3H6ZA 4M7AA 1SHFA 3VRYA 3UWNA 1M3BA 2HL5C 3I55T 3VUZA 3C4SA 3CCRT 2BE9B 5LJ3g 3PMIA 2BZYA 2LCSA 2PMIB 4YOSA 2QTXA 4RTZA 1JQQA 4J6YA 2A37A 2WEVB 3MP6A 4F7UG 4NOYA 1F5QB 3O0GD 1NJIC 1ZSGA 4AG2C 2CP5A 4EOIB 4JJCA 2J7IA 3CC4T 1KHCA 3DB4A 3JCMX 1VQOT 1YNZA 1PD0A 2ZPHB 5GAMd 4PJJA 2LQ8A 2DO3A 3QIIA 2BPMB 2CCHB 3G4SA 2L89A 4IUVA 3TNHB 4BCQD 3P8HA 4NL3A 4OB3B 4CFVB 2CP2A 3V8KA 3PIPA 5GAN5 5I2SA 2KBTA 1TU0B 5CYIB 1P5EB 5CK9A 1WNLA 3O5ZA 3JB9H 3B57A 4J9CA 5CIUA 3JSCA 3I56Q 2F2XA 5HY6A 4QKUA 2R58A 4PKCC 2AT1B 5A2QE 4BCIB 1WJSA 4C92G 3OW2A 5C0MA 4F7UB 4M77E 4FW2A 4OMPA 4C8QG 2KY9A 4JLGA 2DXCA 4CC7A 2MAMA 2QGSA 4IIMA
chains in the Genus database with same CATH topology
3MP1A 2ZPIB 1BIAA 3OS2A 4L6V5 1JJ2S 5GAOr 1VIFA 2FHDA 2X4XA 3OMCA 3H8ZA 5GAN4 2XDDA 5GANg 2RJFA 3OYLA 5C6SA 2O4XB 2EAYA 4EDUA 1V29B 4A53A 3HO8A 1B34B 2DVEA 3M4GA 4BUGA 4MFDA 3CCQA 1U8RA 3JCMJ 5GAOq 4B9WA 3OY9A 5CKEA 2M0OA 5GANf 3RMSA 5A0LA 3CCLT 2C06A 2XI9A 2EQMA 3LYIA 3KXTA 4JDSA 5L8RE 3TW6A 2E65A 3ZFJA 3BFMA 3INZA 3M5AA 3PFSA 2ZGWA 1BI2A 4XU3A 2JOYA 5DY9A 1N8RU 2BS2A 4M77A 4MMLA 4OF1A 4RKUE 2Y4YA 2DTHA 2R57A 1QVPA 3VKHA 3VV0A 5GMKm 3CCEA 4M7DA 4XTWA 4R56A 3CEYA 1VQ4A 4TVRA 4F7UF 1BIBA 3CD6A 3CC2A 3G6ET 4KT0E 5GAN7 4HT8A 5LL6S 5GMKh 5GAN3 5GAOl 1ZHIA 1QVFA 2GFUA 1KQSS 2HAXA 3A8OB 5CKBA 4QVDA 2JN0A 4C92B 4EMKC 5GAMe 4Y91A 4FIBA 3RESA 2RI3A 3CCUT 3ASKA 1YHQT 1HXDA 4L5GA 3C95A 3KHIA 2LQKA 4M77D 5GMKj 2DD4A 4C8QB 1KQ1A 1O9SA 2VGNA 4M78E 3QZ5B 4JJNK 4M7DD 3EFSA 3CCMA 2MWPA 3DB3A 4QQGA 4RCCA 3OW2S 3MCAB 4ZGEB 3FIFA 4HA8A 4M7AF 2E6ZA 3M59A 2QF7A 3CC7A 1LNXA 1P92A 1M9SA 4E7KA 5J26A 4II1A 4A4FA 3AHUA 1OI1A 2ZPGB 2XDBA 1BI1A 5GANd 1SSFA 1NE8A 3RIRA 1I4K1 2ZPEB 1JB0E 2KQWA 1Q86C 3HKSA 1QLBA 1KG1A 4FM4B 2FB7A 3CBOA 3GNFB 4C0DB 2R5AA 3LW5E 2Y4XA 3L2QA 2P0PA 3NTHA 2YLCA 4J83A 4M75A 4XAXB 1YIJA 1M90C 2RK2A 3SDZA 1VQPA 5EJCA 1YCYA 2BUDA 5CKDA 2DPPB 1OZ2A 3LGLA 2QI2A 2E10A 4HL4A 1Y96A 4M78A 4BDZA 2OTLA 5FU7C 4LOCA 2K4YA 2PQWA 2RJDA 4KUIA 2JZ2A 1UGRB 3G4ST 3SB2A 4OGEA 3HRTA 4EMGA 5GMKi 2K5LA 4BI4A 2M9UA 3V7RA 3V7SA 2LCLA 1X6OA 3L2ZA 4ME7A 4NL2A 4Z6YA 3WXMB 3TU4K 3HZJA 2HNIA 2FL7A 2QQRA 3PGGA 3I56A 3JB9D 1VQKT 1VQ6T 4M75D 4EPCA 4BBSM 2RD1A 4M77C 4Z02A 1G3WA 3JCMW 1BI0A 1M1KC 1QVFS 1YJNA 4MIMA 1U1TA 4M7DC 4A4HA 3PT9A 4LD9K 4BE0A 3OYHA 1RI0A 4M78D 4M7AG 1KC8U 2KSSA 2DZ9A 3BY7A 5FU6C 2YRVA 3E9FA 4XTVA 1Q82U 1YJWA 3G71A 3VYGB 2QQBA 3JAME 3CCJT 1JRIA 2DXBB 3BW1A 3CCRA 4HNVA 5D6YA 4M75G 2JTFA 4O5VA 2X4JA 3V8LA 1Q7YC 4FL6A 1VQ9T 4C5GA 4XU1A 1S72T 4ZTJA 5FRMA 4M6VA 3X25B 4M78G 2EKOA 1K8AU 5KH6A 3HFOA 1M1GA 5D6WA 3SWNA 3OYBA 3J7AF 2LT4A 3M53A 3VU3C 4OB0B 4FSXA 3UT1A 1XTDA 4ZN3A 3QDRB 2P0KA 1RL2A 2EQUA 2X4WA 3NFCA 4RMOA 4PLLA 4OP0A 4RG2A 5GANj 2CGHA 3VJPA 3DL1A 3L2VA 2RHYA 4BDYA 4AI6A 2E6NA 4AKHA 3L42A 5I21A 1VQNA 4XTZA 4CI0C 4MZMA 3OSVA 2RB6A 3QSUA 5AYFA 1Q81C 2A7YA 1D3BB 2L5QA 3OMGA 2RHXA 3HHTB 4NS5A 5J39A 3GLXA 3HFNA 2E5QA 3LX7A 3OYKA 4ZGDB 1VUBA 2D0QB 1BKBA 1WJRA 2O01E 3QKJA 4J7FA 4L59A 4M75C 5A0DA 3CCET 4IUQA 2ZZDA 4ELJA 2A3LA 2JUFA 4JRKA 4QW2A 4VUBA 5A0GA 2RHZA 2AHJB 2RK1A 5GANe 3OYJA 4A54A 4M7AB 4M78C 1VQ4T 4M77F 3CD6T 3H4CA 4XU2A 3CC2T 1IZ6A 4M7DF 2LT1A 3A8GB 2V8KA 4GY5A 2BS3A 2WSCE 5CR2A 2OTLT 3CCVT 1K9MU 4JS4A 4M75B 4N4GA 4IUPA 1KD1C 2ZPBB 4QVCA 2EWNA 1VQ8T 2RHUA 3UDCA 1M5Q1 3LH0A 5DLQE 1ZBXA 4C5HA 2QDJA 5CAIA 4M78B 5KE2A 1GXIE 3CCMT 3WVDB 5CQYA 3TEEA 4PJOA 1O75A 4C0ZA 4KULA 4DOWA 4F7UE 2QQSA 1KQ2A 3S3NA 1W4SA 2WACA 1EIFA 1W2BA 2HBPA 3CC7T 4JX5A 2LDMA 4KUDK 4LDUA 3VKIA 1TH7A 2K3XA 3NTIA 4QQDA 3V7CA 2RJCA 3C12A 2DXTA 2YLBA 5GAOm 1UGQB 3E9GA 1Y7XA 2E64A 1JBMA 1NPRA 2HQEA 3Q1JA 1YJ9A 3OYYA 4AKGA 4D6WA 4FT2A 3QWLA 3QG1A 3M58A 4JUVA 2XDPA 2V8JA 3X28B 1QP3A 2Y90A 4C0GA 5M9OA 3M4YA 1Y07A 1WQWA 4PJOD 3SWNC 3SD4A 5FROA 1YITA 1YIJT 4A4KA 2KVQG 1Q86U 4QQ6A 4EMKB 4ZTFA 3S3MA 4MDWA 3OYGA 1VQPT 1VQLT 4E47A 3VUBA 3OSSC 4C5IA 4HNUA 2DTOA 5GAOp 4X9DA 3BDUA 2CZ0B 3X20B 2VV5A 5CQXA 4HLQA 3QJYA 1VQMA 2I2LA 2MWOA 3DKMA 4M75F 2LRQA 1G3TA 2E41A 4M77G 3JCMb 5LJ5h 3CPWA 2QA4A 4BE1A 5GMKe 4M7DG 1N9SA 4X34A 2VUBA 5GAMf 2DZCA 5CCAA 4J8OA 3TREA 4M78F 4LD6A 4O6JA 3MP8A 5LJ3h 3HP9A 1LJOA 3HRSA 4PJOG 3JRZA 3GP8A 1NJIU 1X75C 4N4IA 4HCBA 2CKKA 2DD5A 2BS4A 1ZQ1A 4ATOA 3I56T 3OYCA 5CKFA 3LGFA 4JS5A 2GF7A 2MAMA 5GAN8 1UB4A 4JRQA 3MHXA 2O4XA 3LWHA 1YJNT 2PVOB 1UGPB 3MO8A 4Y28E 2PVGB 4C92E 4IUUA 1K73C 3JB9I 2RJEA 3FRNA 2CZ6B 2GFAA 1H3ZA 3QXEB 1M1KU 5GAN2 4B9XA 4C8QE 2JNGA 2DXCB 3OS5A 3CXCA 1YJWT 4C0FA 4WF2A 3O8VA 2PU9B 2V8IA 4HCZA 4LDVA 3LWIA 4J5YA 1IREB 2OTJA 4JX4A 2RO0A 2YHTA 3MEUA 5LJ5f 1XNIA 3OQ5A 3CMEA 1W2BS 2L8DA 5FU7B 2ZZDB 2RI2A 5KE3A 4MDXA 5IAYA 4OB1B 3JCMV 4DQ2A 2QEXA 1G5VA 5LJ3f 1VQ5A 1M1FA 2KK4A 2PUOB 3C94A 4PJOC 3QYEA 1R8OB 3QUIA 2XIDA 3OYAA 3I55A 5KCHA 1KHIA 2MF2A 3RKWA 3TW7A 4AKIA 2CZ7B 2EJFA 3JB9G 1YBYA 4LDWA 2EIFA 4M77B 2DK3A 3PIOA 4PL6A 4C92A 3MEVA 4M7DB 3CCST 3M56A 2CZ1B 2M16A 1VQNT 3F70A 4C8QA 5FU6B 4PJOB 1BYMA 2X4YA 4OMFB 3CPWS 1YI2A 3META 3QZ9B 3T9NA 2EJGA 1FXXA 3N5BB 4XTYA 3FB9A 3G7ZA 4FT4A 3RMQA 3CBPA 2DIQA 2FYKA 3JCMh 3GOXA 1Q81U 3CC4A 2QQ9A 4JRIA 2K3YA 4PLIA 3CCQT 3OBWA 1VQOA 2EJ9A 2DD4B 2LNVA 4C92D 3QYGB 3PMTA 3BDLA 2QFZA 1UGSB 4XTUA 2KMGA 4QSHA 1QW1A 2WSFE 4BI3A 4E7JA 1VQ7A 3RKYA 3NTKA 1E7PA 2BIVA 2E1HA 4XU0A 4C8QD 2RA2A 4YTLA 3RUXA 1WPYA 2XICA 3CPFA 5LJ5d 1M8VA 3E1SA 2HQXA 3UPUA 2QQAA 2E12A 3CXCS 3CMAA 5CVIA 3FC3A 2DKGA 1KD1U 3JCMg 5LJ3d 1VIEA 4X9CA 1UEBA 2KDSA 4MZPA 4P5NA 1K8AC 3QYHB 2P0QA 5FLXE 3HL8A 5D6XA 4N0AA 3OYNA 1H641 4JX6A 3BG3A 4BB7A 2ZPFB 2DXUA 3P8DA 2JTMA 4PJOF 4BACA 3JCMf 4E7IA 1Y71A 1AHJB 3J80E 3OB9A 2CYZB 3FJPA 2R5MA 4A4GA 5IT9E 3KBGA 2IVWA 5EG2A 3ZBDA 5HKCA 1YJ9T 4HCCA 1Y96B 2PVDB 3GNGA 4JLIA 2FVUA 3HBLA 2F69A 3M9QA 3ZEHA 3LLRA 3OYFA 4HNTA 3QPHA 2EYQA 2B8AA 1G3SA 2XG8D 1WQ7A 2LTOA 5GAMh 2DTIA 2XHCA 2RM4A 3J81E 1I8FA 4R55A 1YITT 3EAEA 4BI8B 2RH2A 1MGQA 3FDRA 4BY6C 3VYGA 4IUTA 1N27A 5GMKl 2DXBA 1VQMT 3SFMA 3GIBA 1NPPA 3OYEA 5GAMj 2QA4T 4E7HA 5FRNA 2G3RA 3QO3A 4C92C 3OYIA 5CO7A 4NC6A 2XK0A 3URGA 1M4ZA 1PSFA 1XOVA 1FX7A 3MEWA 4C8QC 1XQHA 1HK9A 1QVGA 4M7AE 1DJ7B 2D9TA 2KAFA 2GQVA 4Q5WA 4BBRM 2VC8A 1N8RC 1K9MC 1BI3A 4BY6B 3A8MB 4DOVA 4EMHA 5GAMg 3CCLA 2XU8A 4MZTA 4V2SA 4HT9A 4QVZA 2K5IA 3R6OA 3L2WA 3CCVA 3M55A 3S6WA 2LX9A 3ER0A 5KCOA 1M90U 4M75E 2G77A 5J3BA 4F7UA 4IURA 2RI5A 2IG0A 2F5TX 1VQ8A 2PUKB 4ELZC 1U1SA 2HD0A 2H3JA 2ZCFB 4OVAA 1N9RA 3SWNB 1K73U 3JCMd 2E70A 2RHIA 1PSEA 1QP2A 5DLOA 5LJ5j 3JCMQ 2VYTA 1D3BA 2VXFA 4CRIA 4FU6A 4C0DC 3G6EA 2OTJT 3CMET 2F5KA 3MEAA 4PNOA 2QDYB 4BD3A 1WJQA 2LC4A 4A4EA 2K57A 4RG8A 3EFRA 5LJ3j 2XD0A 3ME9A 1B34A 1G3YA 1FKMA 4HKEA 2QEXT 3CCUA 1VQ5T 2M1HA 3DLMA 3JB9J 2JVVA 3GF5A 3H6ZA 3FLGA 1YHQA 1OYXA 5LJ5g 4M7AA 3UWNA 2X35A 1OZ3A 5GAN6 3I55T 3G71T 4N0AC 3RKXA 3VUZA 3C4SA 2WJ9A 3CCRT 2K2VA 3BG5A 4XQ3A 5LJ3g 5LJ5e 3PMIA 4LDXA 2WSEE 3HRUA 3QHSA 2QQ8A 2KR6A 3VYHB 4ZGJB 1VQLA 2K5FA 2QTXA 5LJ3e 4J6YA 4OGCA 1X01A 4LDYA 4IKFA 4BE2A 3PNWC 3MP6A 3L2RA 4C92F 3X26B 4F7UG 3M57A 1Q7YU 3WVEB 4NOYA 1JJ2A 4UC4A 1YI2T 5HK3A 1NJIC 4KBMB 5I2MA 3VKGA 3A5ZB 2L3RA 3JCMP 4JRPA 4M7AD 3V8JA 4C8QF 4RCBA 3BG9A 4MFEA 5CKHA 1KHCA 2LVMA 3DB4A 3CC4T 3S3OA 3L2UA 3JCMX 4ELYC 2VXEA 1QVGS 3GPLA 1VQOT 3HSBA 2P4TA 4MMKA 2ZPHB 3QYBA 3QJ6A 5GAMd 5IN1A 3JB9F 3P8BB 4ZN1A 2LQ8A 2NLUA 3QBYA 1VQ7T 2DO3A 3QIIA 4J7IA 2KMTA 3OYMA 2BKDN 2QXFA 4J6XA 2EQJA 2MMPA 3G4SA 2L89A 4IUVA 5GAOn 1FWZA 2MI6A 4N4HA 4EMKA 4OB2B 1NZ9A 3P8HA 5DM7R 4NL3A 3CMAT 3A8HB 3OS0A 4OB3B 3V8KA 3PIPA 5GAN5 1VQ6A 1WGSA 2DJZA 5I2SA 1VQKA 3RERA 2OAUA 1KC8C 3E19A 2D6FA 2DIGA 4C5EA 5CK9A 3OYDA 1Q82C 1KQSA 2VGMA 1WNLA 3FEOA 3TCJA 3JB9H 3DLLA 3PTAA 3X24B 5CIUA 3JSCA 5GANh 3JCMc 2LCCA 3M54A 5HY6A 2R58A 3KUFA 2DAQA 2XKOC 3OBYA 4GLKA 4PKCC 4E7LA 1I5LA 1LOJA 5A2QE 2EQKA 1I81A 3CCJA 4XK8E 1WJSA 3HPWA 4C92G 3OW2A 5C0MA 4F7UB 2GCXA 3OS1A 4M77E 4DA4A 1MHNA 3A8LB 4M7DE 2CS7A 4J6WA 3CCSA 2EFIA 1VQ9A 5HK0A 3JCMe 2DEQA 3HB9A 3L1AA 4C8QG 1S72A 3OA6A 4M7AC 2KY9A 3CBMA 4JLGA 2DXCA 4PJOE 2DD5B 4XTXA 1N6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPI B;  4L6V 5;  1DJ7 B;  2CZ6 B;  3QXE B;  3A8M B;  2DXC B;  3X25 B;  1V29 B;  2PU9 B;  4OB0 B;  1IRE B;  2PUK B;  2ZCF B;  2ZZD B;  4OB1 B;  5L8R E;  1PSE A;  1QP2 A;  2PUO B;  4RKU E;  2QDY B;  2CZ7 B;  3HHT B;  4ZGD B;  2O01 E;  2D0Q B;  4KT0 E;  2CZ1 B;  3A8O B;  2ZZD A;  2AHJ B;  3QZ9 B;  2WSE E;  3VYH B;  4ZGJ B;  2DD4 A;  3A8G B;  3QZ5 B;  2WSC E;  3X26 B;  4ZGE B;  3WVE B;  2ZPB B;  2DD4 B;  3QYG B;  1UGS B;  2WSF E;  1GXI E;  3WVD B;  2ZPG B;  2ZPH B;  2ZPE B;  1JB0 E;  4FM4 B;  3LW5 E;  1UGQ B;  3QYH B;  2ZPF B;  2DPP B;  4OB2 B;  3A8H B;  3X28 B;  1QP3 A;  4OB3 B;  1AHJ B;  2CYZ B;  1UGR B;  2PVD B;  2CZ0 B;  3X20 B;  3X24 B;  4XK8 E;  3VYG A;  2DXB A;  2DD5 A;  3A8L B;  3VYG B;  2DXB B;  2DXC A;  1PSF A;  2PVO B;  1UGP B;  2DD5 B;  4Y28 E;  2PVG B; 
#chains in the Genus database with same CATH topology
 1BIA A;  2KT1 A;  2FHD A;  1AOJ A;  2X4X A;  3H8Z A;  2XDD A;  2RJF A;  2EAY A;  2DMO A;  3JV3 A;  3CCQ A;  3VS0 A;  3CCL T;  1JO8 A;  4PFO A;  2E65 A;  3K7A M;  2FRY A;  3INZ A;  2DBM A;  2ZGW A;  4XU3 A;  3CCS Q;  1VQN Q;  4AFU C;  5GMK m;  4M7D A;  2NWM A;  4XTW A;  4R56 A;  1H4L D;  3DDQ B;  1W70 A;  4F7U F;  2CH4 W;  3G6E T;  4KT0 E;  2R7G A;  3DTO A;  5LL6 S;  2QG9 B;  1ZHI A;  2HAX A;  3A8O B;  1QMC A;  4C92 B;  2IW9 B;  4Y91 A;  1AWW A;  1HXD A;  4L5G A;  3C95 A;  2LQK A;  2DD4 A;  4C8Q B;  4F7L B;  2VGN A;  5AT1 B;  3QZ5 B;  4BCP B;  1N4M A;  2MIO A;  3H0F A;  3DB3 A;  4RCC A;  3OW2 S;  2H3E B;  3FIF A;  1EFN A;  4HA8 A;  3M59 A;  4M7A F;  4CFU B;  3OW2 P;  2J6F A;  1I5O B;  2LZ6 B;  4II1 A;  1NYG A;  3H0I A;  1OI1 A;  2ZPG B;  1H25 B;  2DF6 A;  2KQW A;  2SEM A;  2YUQ A;  3UAT A;  4FM4 B;  3LW5 E;  3MKD A;  4J9G A;  1M90 C;  2RK2 A;  1VQP A;  5HVY B;  1YCY A;  5CKD A;  2DPP B;  3LGL A;  4HL4 A;  1RAI B;  2OTL A;  3BLR B;  1IHV A;  5FU7 C;  4LOC A;  2RJD A;  2JZ2 A;  3MPU B;  4BCN D;  2K5L A;  4BI4 A;  2J06 A;  2M9U A;  3WXM B;  1NLP C;  4EPC A;  3TQ7 P;  2KYM A;  4A4H A;  3PT9 A;  4BE0 A;  3OYH A;  1RI0 A;  4M78 D;  1KC8 U;  2DZ9 A;  3BY7 A;  2AIR B;  1RLP C;  3G71 A;  4FYY B;  3QWY A;  3CCJ T;  3BW1 A;  2DXB B;  2D8H A;  2H8H A;  1VYV A;  1VQ9 T;  3MJX A;  5FRM A;  4M6V A;  1VA7 A;  1VOL A;  2LT4 A;  3M53 A;  2A28 A;  2LJ3 A;  1XTD A;  4BCJ B;  5HBE B;  2VWF A;  3QDR B;  4RMO A;  4PLL A;  4OP0 A;  2K6D A;  5GAN j;  2UZE B;  1X2Q A;  2E6N A;  4AKH A;  5I21 A;  2GTO A;  1G8X A;  1WX6 A;  2L5Q A;  3HFN A;  3OYK A;  1VUB A;  3EH1 A;  1BKB A;  4LNP A;  4JRK A;  2A3L A;  2JUF A;  1N8R R;  4A54 A;  4M78 C;  3CXC P;  3CD6 T;  3H4C A;  3CC2 T;  4M7D F;  3A8G B;  2V8K A;  2DYB A;  1TOV A;  2CT4 A;  1D3U B;  1KD1 C;  1D0X A;  2C5N B;  3UDC A;  1EX4 A;  4C5H A;  1RLQ C;  2DL3 A;  2HCK A;  2OI3 A;  4D8K A;  1C6V X;  5CQY A;  1J3T A;  5FWB A;  2CUD A;  2LP5 A;  1JXO A;  4Z88 A;  2HBP A;  2LDM A;  3CMA Q;  3NTI A;  4QQD A;  3V7C A;  2DXT A;  1UUE A;  1UGQ B;  3E9G A;  2EVR A;  1GH6 B;  2HQE A;  3Q1J A;  2HKQ B;  4JZ4 A;  1YJ9 A;  2QTV A;  3QWL A;  5IHN A;  3QG1 A;  4PJM A;  3M58 A;  4X1V A;  3X28 B;  3M4Y A;  5FRO A;  4AFS C;  1YIT A;  2KVQ G;  2O9S A;  3QWX X;  4E47 A;  3DDP B;  4C5I A;  5GAO p;  1ZSZ B;  3EOC B;  3BDU A;  2VV5 A;  3I5R A;  1VQM A;  3JB9 F;  1WHG A;  3PO3 S;  3DKM A;  2LRQ A;  3CPW A;  2FEI A;  4WCI A;  2C4G B;  1LJO A;  3HRS A;  3JRZ A;  1X75 C;  1TG0 A;  1ZQ1 A;  8ATC B;  2D1X A;  5GAN 8;  1UB4 A;  4JRQ A;  3MHX A;  2O4X A;  1YJN T;  1JST B;  2DBK A;  2KE9 A;  1D0Z A;  4IUU A;  4K11 A;  1YP5 A;  4LE9 A;  2MYS A;  2D0N A;  2PTK A;  1M1K U;  1OPK A;  3OS5 A;  4WF2 A;  4I3Z B;  2PU9 B;  3LWI A;  2YHT A;  3OQ5 A;  1T3L A;  1ARK A;  1M1F A;  2MK5 A;  1JSU B;  3I55 A;  5KCH A;  3RKW A;  1CKB A;  4AKI A;  1W1F A;  3NHN A;  4LDW A;  2EIF A;  2DK3 A;  3CCU Q;  3M56 A;  1N5Z A;  2CZ1 B;  4BY7 X;  3F70 A;  5GJV B;  5FU6 B;  4OMF B;  3CPW S;  4EC8 B;  2EJG A;  3EG9 A;  1K4U S;  1K0X A;  3RMQ A;  4BCM B;  2W99 A;  1WDX A;  1Q81 U;  3CC4 A;  3UF4 A;  4PLI A;  3CCQ T;  1VQO A;  2KR3 A;  4C92 D;  3EHR A;  3QYG B;  1ZUK A;  4QSH A;  4C8Q D;  2E1H A;  2RA2 A;  3EGD A;  1M8V A;  4F7J B;  2KRO A;  2FRW A;  4CFU D;  1M3C A;  3GTM S;  4OMN A;  4X9C A;  1AZG B;  2RQT A;  4JPB W;  4N0A A;  4JX6 A;  3BG3 A;  2Z0W A;  5IH2 A;  2DXU A;  4GLM A;  4ROC A;  3G1J A;  1R0B G;  4UN0 A;  1Y71 A;  1PKS A;  1VQ6 Q;  2I40 B;  2CP3 A;  3OB9 A;  1VQK Q;  1QLY A;  5HKC A;  1UHC A;  4HCC A;  1Y96 B;  2V1Q A;  4JLI A;  1MMA A;  2EYQ A;  2UZB B;  2DA9 A;  2DTI A;  2EYX A;  1I8F A;  4CRL B;  3EAE A;  1MGQ A;  2W2H A;  3EFO A;  5GMK l;  4M4Z A;  1NPP A;  3M0U A;  1JU5 C;  2DLP A;  4C92 C;  3EG2 A;  4FSS A;  1M2O A;  3OYI A;  1LCK A;  3URG A;  1M4Z A;  3MEW A;  4C8Q C;  1HK9 A;  2WIP B;  3EID B;  1QVG A;  4Q5W A;  2GQV A;  2CRE A;  4BBR M;  2KRM A;  3CCL A;  4EMH A;  4MZT A;  4V2S A;  3R6O A;  2VAS A;  3M55 A;  3S6W A;  2LX9 A;  4IUR A;  2RI5 A;  2IG0 A;  1VQ8 A;  2PUK B;  4ELZ C;  2ZCF B;  1WHM A;  3SWN B;  1K73 U;  1AT1 B;  2E70 A;  4F6S B;  3TNI B;  3EG1 A;  3G6E A;  1D3B A;  3EG9 B;  4CRI A;  2OTJ T;  2K3B A;  4PNO A;  2XD0 A;  1SF9 A;  4RG8 A;  3I35 A;  3ME9 A;  4HKE A;  2JM9 A;  2QEX T;  1VQ4 Q;  3UA6 A;  1RAB B;  4DBH A;  1TSF A;  3M03 A;  2CSI A;  1OYX A;  5LJ5 g;  2X35 A;  3G71 T;  2K9G A;  2WJ9 A;  1AEY A;  4XQ3 A;  4FYV B;  3HRU A;  3QHS A;  2QQ8 A;  3VYH B;  4ZGJ B;  1VQL A;  2DM1 A;  3NPF A;  5LJ3 e;  1X01 A;  3CCM Q;  1H1S B;  4BE2 A;  4EOP B;  1M2V B;  3L2R A;  2X9H A;  3VS4 A;  4IKF A;  2V26 A;  2J6K A;  1WLP B;  4KBM B;  5I2M A;  3A5Z B;  1Z9Z A;  2DYI A;  2L3R A;  3JCM P;  3CC7 Q;  4KGV B;  3BG9 A;  4MFE A;  4HVW A;  2LVM A;  1X27 A;  4Z8A A;  1TUC A;  2PHG A;  2VXE A;  1QVG S;  2EUF A;  3HSB A;  2LQW A;  1QVG P;  5IN1 A;  3M0Q A;  4ZN1 A;  2NLU A;  1VQ7 T;  1QVF P;  4EOQ B;  3EJ1 B;  4R0K A;  1SHG A;  2MMP A;  3IQL A;  1YIJ Q;  5GAO n;  1FWZ A;  2MI6 A;  1TS9 A;  4EMK A;  4OB2 B;  1OI9 B;  1NZ9 A;  5DM7 R;  2JMC A;  3OS0 A;  2M02 A;  5KYW B;  1WGS A;  2DJZ A;  2X51 A;  2YUO A;  3E19 A;  2D6F A;  1VYT A;  2FPF A;  3OYD A;  1Q82 C;  3QHR B;  1KD1 R;  2VGM A;  4HXJ A;  3FEO A;  3TCJ A;  5D7U A;  3DOG B;  3C0C A;  3X24 B;  5GAN h;  2B9R A;  3KUF A;  2DAQ A;  4E7L A;  2ED1 A;  3CCJ A;  2V22 B;  4LXC A;  1MV0 B;  3REB B;  4CC4 B;  3OS1 A;  3H0H A;  1VIN A;  1G3N C;  3CCS A;  3POM A;  2EFI A;  1VQ9 A;  1B07 A;  5HK0 A;  1S1N A;  3L1A A;  3JCM e;  1YJW Q;  3OA6 A;  2DNU A;  1H92 A;  4PJO E;  2DD5 B;  2LX7 A;  1VIF A;  5GAN 4;  2RQW A;  5GAN g;  3VS5 A;  1RAH B;  5C6S A;  4A53 A;  2DVE A;  2RQU A;  4AFZ C;  1U8R A;  5GAN f;  4E2F B;  2C06 A;  2EQM A;  1JKW A;  3NGP A;  4JDS A;  2LJ1 A;  4YOZ A;  1BI2 A;  1E9H B;  5DY9 A;  2E4H A;  4M77 A;  2Y4Y A;  2RMO A;  2KYB A;  2W9F A;  4IIO A;  4TVR A;  3CD6 A;  4EC9 B;  3CC2 A;  4B6M A;  4HT8 A;  5GMK h;  5CKB A;  2G6F X;  2JN0 A;  1UJ0 A;  2O88 A;  1GFC A;  4FIB A;  1ZSZ C;  2EKH A;  4JJB A;  1E6G A;  4M78 E;  4JJN K;  3PVL A;  4GBQ A;  9ATC B;  2EW3 A;  2CP6 A;  1FIN B;  1H24 B;  2C5O B;  1M9S A;  1TFB A;  5J26 A;  4A4F A;  4EOR B;  1YCS B;  3AHU A;  4BCM D;  5GAN d;  1X6G A;  1NE8 A;  4OML A;  3G33 B;  3QHW B;  2EGA A;  2NUP B;  1Q86 C;  4J9D A;  2FB7 A;  1C0M A;  3CBO A;  3GNF B;  4A63 B;  2COY A;  2Y4X A;  1Q7Y R;  2CT3 A;  3NTH A;  2YLC A;  4M75 A;  3H41 A;  4FYX B;  1OZ2 A;  4FYW B;  1KIK A;  2WFY B;  2K4Y A;  1WI7 A;  2OJ2 A;  1UGR B;  2CP0 A;  1G83 A;  1WHL A;  3V7S A;  1UJY A;  4ME7 A;  3TU4 K;  4Z6Y A;  3HZJ A;  2HNI A;  2FL7 A;  1ACM B;  2O31 A;  2QA4 Q;  2DRM A;  1GCQ A;  4Z02 A;  2CH4 A;  1PHT A;  1YJN A;  4LD9 K;  1W2B P;  4OGR B;  4M7A G;  5FU6 C;  2F1L A;  3E9F A;  3VYG B;  5D6Y A;  1GCP A;  4M75 G;  4O5V A;  4FL6 A;  4XU1 A;  1S72 T;  1QMZ B;  2W10 A;  3HFO A;  1M1G A;  3OYB A;  2CCI B;  1OKV B;  1OQK A;  4OB0 B;  5EFQ B;  3CME Q;  2P0K A;  2X4W A;  3NFC A;  4OR5 B;  1VQ5 Q;  4BDY A;  1H28 B;  2YT6 A;  2AK5 A;  1AZE A;  2FPE A;  2K2M A;  4CI0 C;  3OSV A;  2RB6 A;  3QSU A;  5AYF A;  1GBR A;  2KI7 A;  2A7Y A;  1RAD B;  1K1Z A;  2FO0 A;  2HQH A;  3QKJ A;  2O9V A;  5A0D A;  3CCE T;  2ZZD A;  4ELJ A;  4VUB A;  1RUW A;  2LW4 A;  2AHJ B;  1Q95 G;  3I9Q A;  4M7A B;  4IMY B;  1YI2 Q;  4M77 F;  1MND A;  2W0Z A;  3MIA B;  2ROT A;  5IXF A;  1AWO A;  1TUD A;  3VS3 A;  1K9M U;  4M75 B;  2DL4 A;  4IUP A;  4QVC A;  2EWN A;  3EG0 A;  1IXD A;  1VQ8 T;  4RTV A;  2VB6 A;  2QDJ A;  1GXI E;  1SG5 A;  3TEE A;  1UNG D;  3TSW A;  4F7U E;  2EPD A;  4DOW A;  1KQ2 A;  5DQW A;  4KUD K;  1TH7 A;  1OU8 A;  3C12 A;  4G6L B;  2YLB A;  2ABL A;  3F5X B;  3OYY A;  4AKG A;  4ELL A;  2KGT A;  2M0Y A;  2JMA A;  2XDP A;  5M9O A;  1AWJ A;  1SRL A;  4PJO D;  1TWB A;  3SWN C;  1X2K A;  2QAS A;  2QK0 A;  4A4K A;  2AKL A;  1VQL T;  2PK2 A;  2UZD B;  1V76 A;  2EQI A;  3OSS C;  1C9B A;  2CZ0 B;  1FYN A;  2I2L A;  4M75 F;  1G3T A;  2E41 A;  3JCM b;  4WTO B;  4M7D G;  1N9S A;  4NST B;  2VUB A;  4J8O A;  2IIM A;  4PFP A;  3HP9 A;  3GP8 A;  4HCB A;  3I56 T;  4JS5 A;  2A08 A;  3LGF A;  1Z9Q A;  2GF7 A;  1BU1 A;  4JZ3 A;  3MO8 A;  4C92 E;  2CZ6 B;  2GFA A;  4C8Q E;  2DXC B;  3CXC A;  2JJ9 A;  1VOM A;  1OGU B;  3VS7 A;  3MY1 B;  2V8I A;  2OTJ A;  1IRE B;  2YUP A;  3EHQ A;  4JX4 A;  1Q82 R;  2ZZD B;  2RI2 A;  5KE3 A;  4EOM B;  5IAY A;  4DQ2 A;  2QEX A;  1G5V A;  2V1R A;  1KSW A;  3C94 A;  4PJO C;  3QUI A;  2XID A;  3OYA A;  3LQ5 B;  2KEA A;  1KHI A;  3JB9 G;  1H26 B;  1D1A A;  1H3H A;  2FPD A;  3BE3 A;  1YHQ Q;  4KRT A;  4M7D B;  3CCS T;  1VQN T;  2VVK A;  1TTH B;  3REA B;  4BXX X;  1MNE A;  1MUZ A;  1JEG A;  5I5Z B;  1H1R B;  3N5B B;  1KXU A;  4XTY A;  1WA7 A;  4FT4 A;  4YOO A;  2DIQ A;  2FYK A;  1B3Q A;  2EYY A;  3OBW A;  1QKW A;  2YDL A;  1QCN A;  2DD4 B;  2LNV A;  1U06 A;  3BDL A;  1QW1 A;  1OEB A;  1WZO A;  1VQ7 A;  3RKY A;  2DME A;  3NTK A;  1UTI A;  1YWP A;  1FMW A;  1WPY A;  2XIC A;  1SPK A;  1XO2 A;  4J9B A;  3CXC S;  3A98 A;  3FC3 A;  2P84 A;  2X3W D;  2KDS A;  4F04 B;  3QYH B;  2HZY A;  3A1P A;  3G4S Q;  3LH5 A;  4QT7 A;  1IHW A;  4BAC A;  2CYZ B;  3FJP A;  5IT9 E;  5L23 A;  2IVW A;  1I07 A;  1JJ2 P;  2DFU A;  3GNG A;  3OYF A;  3ZEH A;  3LLR A;  2XG8 D;  1WQ7 A;  2BZ8 A;  2XHC A;  2J05 A;  4BI8 B;  2RH2 A;  4D8D A;  3FDR A;  4BY6 C;  2O2O A;  4IUT A;  8AT1 B;  1N27 A;  3SFM A;  3OYE A;  5GAM j;  1GUX A;  1Q86 R;  5FRN A;  4ROE A;  4F6U B;  4DBQ A;  1PSF A;  1OOT A;  1XQH A;  3RNJ A;  3EGX A;  1K9M C;  4DOV A;  4F17 A;  1PD1 A;  4HT9 A;  1NJI R;  3CCV A;  1UEC A;  5KCO A;  2CSQ A;  1KQS P;  1WIE A;  4EOS B;  2HD0 A;  4F70 B;  1OIY B;  2RHI A;  2VYT A;  4FU6 A;  2E3I A;  2F5K A;  2QDY B;  1WJQ A;  2LC4 A;  4A4E A;  2BKZ B;  5I11 A;  5LJ3 j;  1B34 A;  1PNJ A;  1FKM A;  3BLQ B;  2BE7 D;  2JVV A;  2L3Q A;  2X3X D;  2EBP A;  3RKX A;  2K2V A;  5LJ5 e;  4LDX A;  1KJW A;  1UE9 A;  2KR6 A;  1QCF A;  3H9N A;  4OGC A;  1C1A A;  4BY1 X;  3PNW C;  2CP7 A;  1U5S A;  2RPN A;  2KRS A;  3WVE B;  2HEQ A;  1PKD B;  3M57 A;  4UC4 A;  5HCK A;  4BCO B;  4M7A D;  4JRP A;  4RCB A;  3U23 A;  5IDP B;  2QGG A;  3L2U A;  4CFM B;  3S3O A;  1GBQ A;  3QJ6 A;  1HSQ A;  3P8B B;  2IVX A;  3QBY A;  4J7I A;  1ZLM A;  2KMT A;  4RTT A;  3OYM A;  5IF1 B;  2BKD N;  2QXF A;  2KT8 A;  1VQP Q;  2DER A;  1YWO A;  2NUZ A;  3CMA T;  2OTL Q;  5KYY A;  2WIH B;  3A8H B;  2W9Z A;  3RER A;  5IHI A;  1KC8 C;  3JCM c;  1R77 A;  2XKO C;  2EYW A;  1I81 A;  4XK8 E;  2COZ A;  2GCX A;  1MHN A;  3A8L B;  1V1C A;  2CS7 A;  4J6W A;  2JGZ B;  3HB9 A;  3G71 Q;  1S72 A;  4M7A C;  3CBM A;  4BCK B;  4XTX A;  1N6A A;  3MP1 A;  2ZPI B;  4L6V 5;  5GAO r;  1CSK A;  2O4X B;  5IXB A;  1V29 B;  1B34 B;  4BUG A;  4MFD A;  3JCM J;  5GAO q;  5CKE A;  3RMS A;  5A0L A;  1IRX A;  4JJD A;  2XI9 A;  1AVZ C;  3LYI A;  1R0C B;  3KXT A;  4ANJ A;  1SSH A;  3ZFJ A;  1N8R U;  2JOY A;  2BS2 A;  4MML A;  3CCE A;  2E5K A;  1B7T A;  1QVP A;  3VV0 A;  2L2P A;  1ABO A;  3CEY A;  1M90 R;  1BIB A;  2C0O A;  4BCQ B;  4RTX A;  1QKX A;  5GAN 3;  1QVF A;  2GFU A;  4QVD A;  2JTE A;  2HSE B;  5GAM e;  3NMZ C;  3RES A;  3CCU T;  1NYF A;  3ASK A;  5I22 A;  4M7D D;  3EFS A;  4QQG A;  1CKA A;  2J6O A;  1FMK A;  2WHB B;  3MCA B;  2VKN A;  2E6Z A;  1P92 A;  5KYN A;  5KYY B;  1WHH A;  1PKT A;  4ROD A;  4J9E A;  5IHK A;  2GQI A;  3RIR A;  1D1C A;  4ORZ A;  2ZPE B;  4AT1 B;  1QLB A;  4C0D B;  3EGD B;  4DBF A;  3L2Q A;  2P0P A;  4J83 A;  4XAX B;  1YJ9 Q;  3SDZ A;  1TD6 A;  5EJC A;  2BUD A;  1W6X A;  2E10 A;  2QI2 A;  2LNH B;  4M78 A;  4BDZ A;  2I53 A;  1T3S A;  1W98 B;  4KUI A;  3TSZ A;  1YIT Q;  4AFQ C;  3SB2 A;  3HRT A;  5GMK i;  1VQM Q;  2LCL A;  4NL2 A;  1UNH D;  3I56 A;  1VQ6 T;  1VQK T;  3JB9 D;  5KYU A;  3JCM W;  1QVF S;  1G3W A;  1M1K C;  1BI0 A;  4AMC A;  4M7D C;  4HVV A;  1UHF A;  2YSQ A;  5HBH B;  5HBJ B;  2K79 A;  2LMJ A;  3VRZ A;  1Y57 A;  3EFO B;  1JRI A;  2JTF A;  3MI9 B;  2GBQ A;  3E2U A;  2X4J A;  4OMM A;  4TTH A;  2QGF B;  5DQV A;  4C5G A;  4ZTJ A;  3X25 B;  3M0P A;  2EKO A;  4M78 G;  1K8A U;  5ICP B;  2DL5 A;  3J7A F;  5IDN B;  4FSX A;  3SEM A;  4ZN3 A;  1RL2 A;  4KH0 B;  5FW9 A;  3VJP A;  3L2V A;  3DL1 A;  2RHY A;  4AI6 A;  1VQN A;  3I55 Q;  4MZM A;  1JOW A;  3CCR Q;  1Q81 C;  1D3B B;  5J39 A;  3GLX A;  3LX7 A;  2E5Q A;  2O01 E;  1WJR A;  4L59 A;  1GY3 B;  1UG1 A;  4J7F A;  1H1Q B;  4IUQ A;  3OYJ A;  2RK1 A;  1VQ4 T;  1OV3 A;  4XU2 A;  1IZ6 A;  1BK2 A;  2LT1 A;  3CCV T;  1BU2 A;  3CC4 Q;  2A0F B;  4N4G A;  1VQO Q;  5DLQ E;  5CAI A;  4M78 B;  1G2B A;  3CCM T;  1OX9 A;  1ZUY A;  4EOJ B;  4C0Z A;  2JM8 A;  1F1B B;  2QQS A;  4CFW B;  1WHK A;  1EIF A;  1W2B A;  3CC7 T;  4JX5 A;  4LDU A;  3VKI A;  3RR6 A;  2RJC A;  5GAO m;  3PVQ A;  4BCH B;  1Y7X A;  1JBM A;  1TUG B;  4D6W A;  4FT2 A;  4KH1 B;  2KNB B;  3HTR A;  1K9A A;  2Y90 A;  4C0G A;  1Y07 A;  1WQW A;  1I0C A;  3SD4 A;  1YN8 A;  1YIJ T;  1KG1 A;  4QQ6 A;  4EMK B;  4MDW A;  3VUB A;  4HNU A;  2DTO A;  4X9D A;  3QJY A;  4PFZ A;  4M77 G;  4X34 A;  5FGK B;  5GAM f;  2DZC A;  3TRE A;  4M78 F;  5LJ3 h;  2D8J A;  4N4I A;  3EGU A;  2CKK A;  2RNA A;  3OYC A;  5CKF A;  2PVO B;  2MCN A;  1UGP B;  1K73 C;  2PVG B;  2NYS A;  3JB9 I;  1ZUU A;  3CQT A;  1OU9 A;  3CCL Q;  5GAN 2;  4B9X A;  2JNG A;  1YJW T;  2PJQ A;  4Y92 A;  4RTU A;  3D7S B;  2HMA A;  1KC8 R;  1U3O A;  4HCZ A;  1IB8 A;  1VQ8 Q;  1XNI A;  1W2B S;  2NUT A;  1EZZ B;  2CDT A;  4OB1 B;  3JCM V;  5LJ3 f;  2KK4 A;  3G6E Q;  2W96 A;  1ZA2 B;  2MF2 A;  2PK9 B;  1RAE B;  2YUN A;  3TW7 A;  2EJF A;  1YBY A;  2C5X B;  4M77 B;  3PIO A;  3EG3 A;  1RI9 A;  4PL6 A;  4C92 A;  3MEV A;  1WHJ A;  2M16 A;  4F7S B;  4C8Q A;  1T0H A;  2FZC B;  1MMG A;  1BYM A;  3I5S A;  4HVU A;  1FXX A;  2LJ0 A;  1VQL Q;  3G7Z A;  1X6B A;  3JCM h;  2QQ9 A;  4JRI A;  5LQF B;  1NM7 A;  1OUL A;  3PMT A;  1UGS B;  4XTU A;  2KMG A;  4BI3 A;  4E7J A;  4XU0 A;  4YC3 B;  2BTT A;  1WXU A;  3RUX A;  3E1S A;  2HQX A;  2QQA A;  3CMA A;  2YRC A;  2DKG A;  2MOX A;  1KD1 U;  3JCM g;  5LJ3 d;  1VIE A;  1UEB A;  4P5N A;  4MZP A;  1K8A C;  2P0Q A;  3HL8 A;  3OYN A;  1H64 1;  1ENW A;  2ZPF B;  2ZAE A;  1BCO A;  4F6W B;  4CFX B;  4J9I A;  3JCM f;  1OPL A;  1TXQ A;  1PRM C;  3PE0 A;  4A4G A;  1SEM A;  2FVU A;  3ZL7 C;  4HNT A;  1NEB A;  3QPH A;  2B8A A;  1G3S A;  2JS2 A;  2LTO A;  2MPX C;  3J81 E;  1JXM A;  4R55 A;  2UUE B;  3CCJ Q;  2B86 A;  2DVJ A;  2EYZ A;  2DXB A;  1X69 A;  2QA4 T;  2WMA B;  2G3R A;  2NUT B;  3RBB B;  1VQ9 Q;  4LN2 A;  5CO7 A;  2C5V B;  1BCM A;  1PC0 A;  1XOV A;  1D0Y A;  1FX7 A;  4M7A E;  2D9T A;  3THK A;  4J9H A;  2RQR A;  4M75 E;  2G77 A;  4OMO A;  5J3B A;  4II5 B;  1BBZ A;  4OVA A;  4EOO B;  3UA7 A;  3JCM d;  1PSE A;  5LJ5 j;  4LUD A;  1E7O A;  2VXF A;  1M1K R;  5ECA A;  1E6H A;  4C0D C;  1WXT A;  1OX8 A;  4DEY A;  3CME T;  3MEA A;  2ED0 A;  4RUG A;  2YWW A;  1WFW A;  3CCU A;  1VQ5 T;  3CD6 Q;  3JB9 J;  3CC2 Q;  3GF5 A;  3FLG A;  1OZ3 A;  2FZG B;  5GAN 6;  4N0A C;  3TN8 B;  2IW6 B;  3BG5 A;  3VS2 A;  2WSE E;  4LUE A;  3TVT A;  2K5F A;  4LDY A;  2M51 A;  4C92 F;  3X26 B;  1Q7Y U;  1JJ2 A;  1YI2 T;  5HK3 A;  4E7S A;  3VKG A;  3M0S A;  3V8J A;  4C8Q F;  2FG0 A;  3TNW B;  2A36 A;  2X1N B;  5CKH A;  4HCK A;  2SRC A;  4ELY C;  3GPL A;  2P4T A;  4MMK A;  2DX1 A;  3QYB A;  2JW4 A;  2C0T A;  1IGU A;  1Q81 R;  2PNI A;  2JXB A;  2GNC A;  1ZP2 A;  3NDQ A;  4J6X A;  2EQJ A;  1NG2 A;  4N4H A;  1LVK A;  1URC B;  1QWF A;  1ZSZ A;  1VQ6 A;  1VQK A;  1HD3 A;  2OAU A;  2DIG A;  4C5E A;  1KQS A;  2CUB A;  4RTY A;  3DLL A;  3PTA A;  2LCC A;  3M54 A;  5FWC A;  2DRK A;  3OBY A;  1ABQ A;  4GLK A;  3VS6 A;  1I5L A;  1LOJ A;  2EQK A;  1YJN Q;  3HPW A;  1VYW B;  1PM3 A;  4DA4 A;  4E6R A;  4F14 A;  4M7D E;  2DEQ A;  1OL1 B;  2L3P A;  3OS2 A;  1JJ2 S;  2KXD A;  3OMC A;  4EOK B;  3OYL A;  4EDU A;  2AKK A;  4AG1 C;  3BHV B;  3HO8 A;  3M4G A;  5L2W B;  1ZX6 A;  2XMF A;  4B9W A;  3OY9 A;  2M0O A;  5L8R E;  3TW6 A;  2DIL A;  3BFM A;  3M5A A;  3PFS A;  4ESR A;  4RKU E;  4OF1 A;  2DTH A;  2R57 A;  3VKH A;  2BZX A;  3DJB A;  1HJD A;  2QYZ A;  1PRL C;  1VQ4 A;  7AT1 B;  1PCX A;  1KK7 A;  1H27 B;  4Y72 B;  2WXV B;  5GAN 7;  1A0N B;  3ULR B;  3BLH B;  5GAO l;  1K73 R;  1RAC B;  1KQS S;  2FZK B;  3CCQ Q;  4EMK C;  2K7A A;  2WMB B;  4BCG B;  2RI3 A;  1YHQ T;  5BNJ B;  3KHI A;  4M77 D;  5GMK j;  4EON B;  1PWT A;  2WPA B;  1KQ1 A;  1O9S A;  4OMQ A;  2RN8 A;  1RAG B;  2MWP A;  3CCM A;  1OIU B;  2F2W A;  3MY5 B;  4ZGE B;  3FJ5 A;  1LPL A;  2I0N A;  2QF7 A;  3CC7 A;  1LNX A;  2ENM A;  4PJN A;  4E7K A;  1UNL D;  2RQV A;  3SHW A;  2XDB A;  1BI1 A;  3KFV A;  1SSF A;  4KGZ B;  1I4K 1;  1JB0 E;  5CEI B;  1IGQ A;  2QDL A;  3HKS A;  1AWX A;  2R5A A;  1YIJ A;  1HYO A;  3VS1 A;  1H8K A;  1Y96 A;  1NLO C;  2F2V A;  5GJW B;  2PQW A;  4KGX B;  2IN3 A;  1UDL A;  3G4S T;  4OGE A;  2E3H A;  4EMG A;  3V7R A;  1X6O A;  3L2Z A;  2QQR A;  3PGG A;  2OX7 A;  4M75 D;  1NBE B;  4BBS M;  2RD1 A;  4M77 C;  4MIM A;  1U1T A;  2HSP A;  3BHU B;  2KSS A;  3RDV A;  4FW1 A;  2YRV A;  4XTV A;  1Q82 U;  1YJW A;  2QQB A;  5LMK B;  4CC3 A;  3JAM E;  1K8A R;  3CCR A;  4F7N B;  4HNV A;  1GUX B;  2ATC B;  5ACB A;  1FVV B;  1PG5 B;  3V8L A;  1Q7Y C;  1M3A A;  1XJW B;  5KH6 A;  5D6W A;  3EGX B;  3SWN A;  2DE0 X;  3VU3 C;  2F2C A;  1AD6 A;  2OTJ Q;  3UT1 A;  3CPW P;  2EQU A;  4RG2 A;  2QEX Q;  5HQ0 B;  2CGH A;  4RTW A;  2AZS A;  3L42 A;  1YFN A;  4XTZ A;  1GL5 A;  2YXY A;  2LQN A;  2L0A A;  3OMG A;  4NS5 A;  2RHX A;  3HHT B;  4ZGD B;  2D0Q B;  2ECZ A;  4M75 C;  5A0G A;  4QW2 A;  2RHZ A;  5GAN e;  1M27 C;  6AT1 B;  1M2V A;  2EGC A;  2PZ1 A;  4GY5 A;  5CR2 A;  2BS3 A;  2WSC E;  4F16 A;  4JS4 A;  2ZPB B;  2IPO B;  2RHU A;  1M5Q 1;  3LH0 A;  1ZBX A;  1WYX A;  5KE2 A;  1GCQ C;  1VQ7 Q;  2HDA A;  3WVD B;  4KRC B;  4PJO A;  1O75 A;  2DL7 A;  4KUL A;  2KRN A;  3S3N A;  1W4S A;  2WAC A;  2AZV A;  4CXA B;  1GFD A;  2K3X A;  4FCY A;  2RF0 A;  2IW8 B;  1K0S A;  2E64 A;  5KYW A;  1O9K A;  1NPR A;  2C6T B;  4FX3 B;  2COW A;  4JUV A;  2V8J A;  1QP3 A;  1Q86 U;  4ZTF A;  1MMD A;  3S3M A;  3OYG A;  3EH2 A;  1VQP T;  2DL8 A;  3X20 B;  2OTL T;  5CQX A;  4HLQ A;  2MWO A;  4DBR A;  4Z89 A;  2HKN A;  1KFZ A;  4EIK A;  5LJ5 h;  2QA4 A;  4BE1 A;  5GMK e;  1AD5 A;  4BCF B;  5CCA A;  2G9X B;  2ESW A;  3BHT B;  3MP8 A;  4LD6 A;  4O6J A;  5EC7 A;  4PJO G;  1NJI U;  1H1P B;  2OAW A;  2HBW A;  2DD5 A;  2BS4 A;  4ATO A;  3R6N A;  5KYX A;  1MV3 A;  3LWH A;  2HL3 A;  4Y28 E;  1IO6 A;  2RJE A;  3FRN A;  1H3Z A;  3QXE B;  2JS0 A;  4C0F A;  3CCV Q;  1X43 A;  3O8V A;  2DJQ A;  3AT1 B;  4LDV A;  4J5Y A;  3MEU A;  2RO0 A;  5LJ5 f;  3CME A;  1I1J A;  2L8D A;  5FU7 B;  3M0R A;  4MDX A;  1GRI A;  1VQ5 A;  2PUO B;  3QYE A;  1R8O B;  1T0J A;  2QAZ A;  2CZ7 B;  1QCO A;  2CJM B;  3RGF B;  1D09 B;  2EGE A;  4PJO B;  3QDF A;  2X4Y A;  1YI2 A;  3MET A;  3QZ9 B;  2L3S A;  3T9N A;  2GGR A;  5IHY A;  2ROL A;  3FB9 A;  3CBP A;  1SKU B;  1UGV A;  1Y0M A;  3GOX A;  2K3Y A;  1M30 A;  2EJ9 A;  1O9K B;  1OKW B;  2QFZ A;  2WSF E;  1SRM A;  1VYU A;  2NUP A;  1E7P A;  2BIV A;  4YTL A;  4CC2 A;  1FMV A;  3CPF A;  5LJ5 d;  3UPU A;  2JT4 A;  2E12 A;  5CVI A;  1K9M R;  5HNB B;  4BCN B;  4DEX A;  5FLX E;  5D6X A;  4BB7 A;  1RAA B;  3M0T A;  2DET A;  1MMN A;  3P8D A;  2JTM A;  4PJO F;  4E7I A;  1AHJ B;  3J80 E;  2GTJ A;  4PJL A;  2UZL B;  1WXB A;  2R5M A;  3KBG A;  5EG2 A;  3ZBD A;  4ZNX A;  5KYX B;  1YJ9 T;  2PVD B;  3HBL A;  2F69 A;  3M9Q A;  1QQJ A;  1ZBJ A;  5GAM h;  2RM4 A;  1YIT T;  1AIS B;  4CFN B;  2YRD A;  3VYG A;  2P4R A;  1VQM T;  3GIB A;  5KYU B;  1M8M A;  4E7H A;  2C0I A;  3QO3 A;  1S72 Q;  4PK4 A;  4NC6 A;  1D1B A;  4EOL B;  2XK0 A;  4J9F A;  4E7Z A;  1DJ7 B;  2KAF A;  2VC8 A;  1N8R C;  1BI3 A;  3GBQ A;  3A8M B;  4BY6 B;  5GAM g;  2XU8 A;  4QVZ A;  2K5I A;  1RAF B;  4KRD B;  1NEG A;  3L2W A;  3ER0 A;  1M90 U;  4F7U A;  2KXC A;  2F5T X;  1U1S A;  1K76 A;  1ZA1 B;  2H3J A;  1BB9 A;  1N9R A;  2DEU A;  1QP2 A;  5DLO A;  3JCM Q;  1QWE A;  1UFF A;  3CCE Q;  4BD3 A;  2K57 A;  3EFR A;  1G3Y A;  1OL2 B;  2M1H A;  3DLM A;  1YHQ A;  3H6Z A;  4M7A A;  1SHF A;  3VRY A;  3UWN A;  1M3B A;  2HL5 C;  3I55 T;  3VUZ A;  3C4S A;  3CCR T;  2BE9 B;  5LJ3 g;  3PMI A;  2BZY A;  2LCS A;  2PMI B;  4YOS A;  2QTX A;  4RTZ A;  1JQQ A;  4J6Y A;  2A37 A;  2WEV B;  3MP6 A;  4F7U G;  4NOY A;  1F5Q B;  3O0G D;  1NJI C;  1ZSG A;  4AG2 C;  2CP5 A;  4EOI B;  4JJC A;  2J7I A;  3CC4 T;  1KHC A;  3DB4 A;  3JCM X;  1VQO T;  1YNZ A;  1PD0 A;  2ZPH B;  5GAM d;  4PJJ A;  2LQ8 A;  2DO3 A;  3QII A;  2BPM B;  2CCH B;  3G4S A;  2L89 A;  4IUV A;  3TNH B;  4BCQ D;  3P8H A;  4NL3 A;  4OB3 B;  4CFV B;  2CP2 A;  3V8K A;  3PIP A;  5GAN 5;  5I2S A;  2KBT A;  1TU0 B;  5CYI B;  1P5E B;  5CK9 A;  1WNL A;  3O5Z A;  3JB9 H;  3B57 A;  4J9C A;  5CIU A;  3JSC A;  3I56 Q;  2F2X A;  5HY6 A;  4QKU A;  2R58 A;  4PKC C;  2AT1 B;  5A2Q E;  4BCI B;  1WJS A;  4C92 G;  3OW2 A;  5C0M A;  4F7U B;  4M77 E;  4FW2 A;  4OMP A;  4C8Q G;  2KY9 A;  4JLG A;  2DXC A;  4CC7 A;  2MAM A;  2QGS A;  4IIM A; 
#chains in the Genus database with same CATH homology
 3MP1 A;  2ZPI B;  1BIA A;  3OS2 A;  4L6V 5;  1JJ2 S;  5GAO r;  1VIF A;  2FHD A;  2X4X A;  3OMC A;  3H8Z A;  5GAN 4;  2XDD A;  5GAN g;  2RJF A;  3OYL A;  5C6S A;  2O4X B;  2EAY A;  4EDU A;  1V29 B;  4A53 A;  3HO8 A;  1B34 B;  2DVE A;  3M4G A;  4BUG A;  4MFD A;  3CCQ A;  1U8R A;  3JCM J;  5GAO q;  4B9W A;  3OY9 A;  5CKE A;  2M0O A;  5GAN f;  3RMS A;  5A0L A;  3CCL T;  2C06 A;  2XI9 A;  2EQM A;  3LYI A;  3KXT A;  4JDS A;  5L8R E;  3TW6 A;  2E65 A;  3ZFJ A;  3BFM A;  3INZ A;  3M5A A;  3PFS A;  2ZGW A;  1BI2 A;  4XU3 A;  2JOY A;  5DY9 A;  1N8R U;  2BS2 A;  4M77 A;  4MML A;  4OF1 A;  4RKU E;  2Y4Y A;  2DTH A;  2R57 A;  1QVP A;  3VKH A;  3VV0 A;  5GMK m;  3CCE A;  4M7D A;  4XTW A;  4R56 A;  3CEY A;  1VQ4 A;  4TVR A;  4F7U F;  1BIB A;  3CD6 A;  3CC2 A;  3G6E T;  4KT0 E;  5GAN 7;  4HT8 A;  5LL6 S;  5GMK h;  5GAN 3;  5GAO l;  1ZHI A;  1QVF A;  2GFU A;  1KQS S;  2HAX A;  3A8O B;  5CKB A;  4QVD A;  2JN0 A;  4C92 B;  4EMK C;  5GAM e;  4Y91 A;  4FIB A;  3RES A;  2RI3 A;  3CCU T;  3ASK A;  1YHQ T;  1HXD A;  4L5G A;  3C95 A;  3KHI A;  2LQK A;  4M77 D;  5GMK j;  2DD4 A;  4C8Q B;  1KQ1 A;  1O9S A;  2VGN A;  4M78 E;  3QZ5 B;  4JJN K;  4M7D D;  3EFS A;  3CCM A;  2MWP A;  3DB3 A;  4QQG A;  4RCC A;  3OW2 S;  3MCA B;  4ZGE B;  3FIF A;  4HA8 A;  4M7A F;  2E6Z A;  3M59 A;  2QF7 A;  3CC7 A;  1LNX A;  1P92 A;  1M9S A;  4E7K A;  5J26 A;  4II1 A;  4A4F A;  3AHU A;  1OI1 A;  2ZPG B;  2XDB A;  1BI1 A;  5GAN d;  1SSF A;  1NE8 A;  3RIR A;  1I4K 1;  2ZPE B;  1JB0 E;  2KQW A;  1Q86 C;  3HKS A;  1QLB A;  1KG1 A;  4FM4 B;  2FB7 A;  3CBO A;  3GNF B;  4C0D B;  2R5A A;  3LW5 E;  2Y4X A;  3L2Q A;  2P0P A;  3NTH A;  2YLC A;  4J83 A;  4M75 A;  4XAX B;  1YIJ A;  1M90 C;  2RK2 A;  3SDZ A;  1VQP A;  5EJC A;  1YCY A;  2BUD A;  5CKD A;  2DPP B;  1OZ2 A;  3LGL A;  2QI2 A;  2E10 A;  4HL4 A;  1Y96 A;  4M78 A;  4BDZ A;  2OTL A;  5FU7 C;  4LOC A;  2K4Y A;  2PQW A;  2RJD A;  4KUI A;  2JZ2 A;  1UGR B;  3G4S T;  3SB2 A;  4OGE A;  3HRT A;  4EMG A;  5GMK i;  2K5L A;  4BI4 A;  2M9U A;  3V7R A;  3V7S A;  2LCL A;  1X6O A;  3L2Z A;  4ME7 A;  4NL2 A;  4Z6Y A;  3WXM B;  3TU4 K;  3HZJ A;  2HNI A;  2FL7 A;  2QQR A;  3PGG A;  3I56 A;  3JB9 D;  1VQK T;  1VQ6 T;  4M75 D;  4EPC A;  4BBS M;  2RD1 A;  4M77 C;  4Z02 A;  1G3W A;  3JCM W;  1BI0 A;  1M1K C;  1QVF S;  1YJN A;  4MIM A;  1U1T A;  4M7D C;  4A4H A;  3PT9 A;  4LD9 K;  4BE0 A;  3OYH A;  1RI0 A;  4M78 D;  4M7A G;  1KC8 U;  2KSS A;  2DZ9 A;  3BY7 A;  5FU6 C;  2YRV A;  3E9F A;  4XTV A;  1Q82 U;  1YJW A;  3G71 A;  3VYG B;  2QQB A;  3JAM E;  3CCJ T;  1JRI A;  2DXB B;  3BW1 A;  3CCR A;  4HNV A;  5D6Y A;  4M75 G;  2JTF A;  4O5V A;  2X4J A;  3V8L A;  1Q7Y C;  4FL6 A;  1VQ9 T;  4C5G A;  4XU1 A;  1S72 T;  4ZTJ A;  5FRM A;  4M6V A;  3X25 B;  4M78 G;  2EKO A;  1K8A U;  5KH6 A;  3HFO A;  1M1G A;  5D6W A;  3SWN A;  3OYB A;  3J7A F;  2LT4 A;  3M53 A;  3VU3 C;  4OB0 B;  4FSX A;  3UT1 A;  1XTD A;  4ZN3 A;  3QDR B;  2P0K A;  1RL2 A;  2EQU A;  2X4W A;  3NFC A;  4RMO A;  4PLL A;  4OP0 A;  4RG2 A;  5GAN j;  2CGH A;  3VJP A;  3DL1 A;  3L2V A;  2RHY A;  4BDY A;  4AI6 A;  2E6N A;  4AKH A;  3L42 A;  5I21 A;  1VQN A;  4XTZ A;  4CI0 C;  4MZM A;  3OSV A;  2RB6 A;  3QSU A;  5AYF A;  1Q81 C;  2A7Y A;  1D3B B;  2L5Q A;  3OMG A;  2RHX A;  3HHT B;  4NS5 A;  5J39 A;  3GLX A;  3HFN A;  2E5Q A;  3LX7 A;  3OYK A;  4ZGD B;  1VUB A;  2D0Q B;  1BKB A;  1WJR A;  2O01 E;  3QKJ A;  4J7F A;  4L59 A;  4M75 C;  5A0D A;  3CCE T;  4IUQ A;  2ZZD A;  4ELJ A;  2A3L A;  2JUF A;  4JRK A;  4QW2 A;  4VUB A;  5A0G A;  2RHZ A;  2AHJ B;  2RK1 A;  5GAN e;  3OYJ A;  4A54 A;  4M7A B;  4M78 C;  1VQ4 T;  4M77 F;  3CD6 T;  3H4C A;  4XU2 A;  3CC2 T;  1IZ6 A;  4M7D F;  2LT1 A;  3A8G B;  2V8K A;  4GY5 A;  2BS3 A;  2WSC E;  5CR2 A;  2OTL T;  3CCV T;  1K9M U;  4JS4 A;  4M75 B;  4N4G A;  4IUP A;  1KD1 C;  2ZPB B;  4QVC A;  2EWN A;  1VQ8 T;  2RHU A;  3UDC A;  1M5Q 1;  3LH0 A;  5DLQ E;  1ZBX A;  4C5H A;  2QDJ A;  5CAI A;  4M78 B;  5KE2 A;  1GXI E;  3CCM T;  3WVD B;  5CQY A;  3TEE A;  4PJO A;  1O75 A;  4C0Z A;  4KUL A;  4DOW A;  4F7U E;  2QQS A;  1KQ2 A;  3S3N A;  1W4S A;  2WAC A;  1EIF A;  1W2B A;  2HBP A;  3CC7 T;  4JX5 A;  2LDM A;  4KUD K;  4LDU A;  3VKI A;  1TH7 A;  2K3X A;  3NTI A;  4QQD A;  3V7C A;  2RJC A;  3C12 A;  2DXT A;  2YLB A;  5GAO m;  1UGQ B;  3E9G A;  1Y7X A;  2E64 A;  1JBM A;  1NPR A;  2HQE A;  3Q1J A;  1YJ9 A;  3OYY A;  4AKG A;  4D6W A;  4FT2 A;  3QWL A;  3QG1 A;  3M58 A;  4JUV A;  2XDP A;  2V8J A;  3X28 B;  1QP3 A;  2Y90 A;  4C0G A;  5M9O A;  3M4Y A;  1Y07 A;  1WQW A;  4PJO D;  3SWN C;  3SD4 A;  5FRO A;  1YIT A;  1YIJ T;  4A4K A;  2KVQ G;  1Q86 U;  4QQ6 A;  4EMK B;  4ZTF A;  3S3M A;  4MDW A;  3OYG A;  1VQP T;  1VQL T;  4E47 A;  3VUB A;  3OSS C;  4C5I A;  4HNU A;  2DTO A;  5GAO p;  4X9D A;  3BDU A;  2CZ0 B;  3X20 B;  2VV5 A;  5CQX A;  4HLQ A;  3QJY A;  1VQM A;  2I2L A;  2MWO A;  3DKM A;  4M75 F;  2LRQ A;  1G3T A;  2E41 A;  4M77 G;  3JCM b;  5LJ5 h;  3CPW A;  2QA4 A;  4BE1 A;  5GMK e;  4M7D G;  1N9S A;  4X34 A;  2VUB A;  5GAM f;  2DZC A;  5CCA A;  4J8O A;  3TRE A;  4M78 F;  4LD6 A;  4O6J A;  3MP8 A;  5LJ3 h;  3HP9 A;  1LJO A;  3HRS A;  4PJO G;  3JRZ A;  3GP8 A;  1NJI U;  1X75 C;  4N4I A;  4HCB A;  2CKK A;  2DD5 A;  2BS4 A;  1ZQ1 A;  4ATO A;  3I56 T;  3OYC A;  5CKF A;  3LGF A;  4JS5 A;  2GF7 A;  2MAM A;  5GAN 8;  1UB4 A;  4JRQ A;  3MHX A;  2O4X A;  3LWH A;  1YJN T;  2PVO B;  1UGP B;  3MO8 A;  4Y28 E;  2PVG B;  4C92 E;  4IUU A;  1K73 C;  3JB9 I;  2RJE A;  3FRN A;  2CZ6 B;  2GFA A;  1H3Z A;  3QXE B;  1M1K U;  5GAN 2;  4B9X A;  4C8Q E;  2JNG A;  2DXC B;  3OS5 A;  3CXC A;  1YJW T;  4C0F A;  4WF2 A;  3O8V A;  2PU9 B;  2V8I A;  4HCZ A;  4LDV A;  3LWI A;  4J5Y A;  1IRE B;  2OTJ A;  4JX4 A;  2RO0 A;  2YHT A;  3MEU A;  5LJ5 f;  1XNI A;  3OQ5 A;  3CME A;  1W2B S;  2L8D A;  5FU7 B;  2ZZD B;  2RI2 A;  5KE3 A;  4MDX A;  5IAY A;  4OB1 B;  3JCM V;  4DQ2 A;  2QEX A;  1G5V A;  5LJ3 f;  1VQ5 A;  1M1F A;  2KK4 A;  2PUO B;  3C94 A;  4PJO C;  3QYE A;  1R8O B;  3QUI A;  2XID A;  3OYA A;  3I55 A;  5KCH A;  1KHI A;  2MF2 A;  3RKW A;  3TW7 A;  4AKI A;  2CZ7 B;  2EJF A;  3JB9 G;  1YBY A;  4LDW A;  2EIF A;  4M77 B;  2DK3 A;  3PIO A;  4PL6 A;  4C92 A;  3MEV A;  4M7D B;  3CCS T;  3M56 A;  2CZ1 B;  2M16 A;  1VQN T;  3F70 A;  4C8Q A;  5FU6 B;  4PJO B;  1BYM A;  2X4Y A;  4OMF B;  3CPW S;  1YI2 A;  3MET A;  3QZ9 B;  3T9N A;  2EJG A;  1FXX A;  3N5B B;  4XTY A;  3FB9 A;  3G7Z A;  4FT4 A;  3RMQ A;  3CBP A;  2DIQ A;  2FYK A;  3JCM h;  3GOX A;  1Q81 U;  3CC4 A;  2QQ9 A;  4JRI A;  2K3Y A;  4PLI A;  3CCQ T;  3OBW A;  1VQO A;  2EJ9 A;  2DD4 B;  2LNV A;  4C92 D;  3QYG B;  3PMT A;  3BDL A;  2QFZ A;  1UGS B;  4XTU A;  2KMG A;  4QSH A;  1QW1 A;  2WSF E;  4BI3 A;  4E7J A;  1VQ7 A;  3RKY A;  3NTK A;  1E7P A;  2BIV A;  2E1H A;  4XU0 A;  4C8Q D;  2RA2 A;  4YTL A;  3RUX A;  1WPY A;  2XIC A;  3CPF A;  5LJ5 d;  1M8V A;  3E1S A;  2HQX A;  3UPU A;  2QQA A;  2E12 A;  3CXC S;  3CMA A;  5CVI A;  3FC3 A;  2DKG A;  1KD1 U;  3JCM g;  5LJ3 d;  1VIE A;  4X9C A;  1UEB A;  2KDS A;  4MZP A;  4P5N A;  1K8A C;  3QYH B;  2P0Q A;  5FLX E;  3HL8 A;  5D6X A;  4N0A A;  3OYN A;  1H64 1;  4JX6 A;  3BG3 A;  4BB7 A;  2ZPF B;  2DXU A;  3P8D A;  2JTM A;  4PJO F;  4BAC A;  3JCM f;  4E7I A;  1Y71 A;  1AHJ B;  3J80 E;  3OB9 A;  2CYZ B;  3FJP A;  2R5M A;  4A4G A;  5IT9 E;  3KBG A;  2IVW A;  5EG2 A;  3ZBD A;  5HKC A;  1YJ9 T;  4HCC A;  1Y96 B;  2PVD B;  3GNG A;  4JLI A;  2FVU A;  3HBL A;  2F69 A;  3M9Q A;  3ZEH A;  3LLR A;  3OYF A;  4HNT A;  3QPH A;  2EYQ A;  2B8A A;  1G3S A;  2XG8 D;  1WQ7 A;  2LTO A;  5GAM h;  2DTI A;  2XHC A;  2RM4 A;  3J81 E;  1I8F A;  4R55 A;  1YIT T;  3EAE A;  4BI8 B;  2RH2 A;  1MGQ A;  3FDR A;  4BY6 C;  3VYG A;  4IUT A;  1N27 A;  5GMK l;  2DXB A;  1VQM T;  3SFM A;  3GIB A;  1NPP A;  3OYE A;  5GAM j;  2QA4 T;  4E7H A;  5FRN A;  2G3R A;  3QO3 A;  4C92 C;  3OYI A;  5CO7 A;  4NC6 A;  2XK0 A;  3URG A;  1M4Z A;  1PSF A;  1XOV A;  1FX7 A;  3MEW A;  4C8Q C;  1XQH A;  1HK9 A;  1QVG A;  4M7A E;  1DJ7 B;  2D9T A;  2KAF A;  2GQV A;  4Q5W A;  4BBR M;  2VC8 A;  1N8R C;  1K9M C;  1BI3 A;  4BY6 B;  3A8M B;  4DOV A;  4EMH A;  5GAM g;  3CCL A;  2XU8 A;  4MZT A;  4V2S A;  4HT9 A;  4QVZ A;  2K5I A;  3R6O A;  3L2W A;  3CCV A;  3M55 A;  3S6W A;  2LX9 A;  3ER0 A;  5KCO A;  1M90 U;  4M75 E;  2G77 A;  5J3B A;  4F7U A;  4IUR A;  2RI5 A;  2IG0 A;  2F5T X;  1VQ8 A;  2PUK B;  4ELZ C;  1U1S A;  2HD0 A;  2H3J A;  2ZCF B;  4OVA A;  1N9R A;  3SWN B;  1K73 U;  3JCM d;  2E70 A;  2RHI A;  1PSE A;  1QP2 A;  5DLO A;  5LJ5 j;  3JCM Q;  2VYT A;  1D3B A;  2VXF A;  4CRI A;  4FU6 A;  4C0D C;  3G6E A;  2OTJ T;  3CME T;  2F5K A;  3MEA A;  4PNO A;  2QDY B;  4BD3 A;  1WJQ A;  2LC4 A;  4A4E A;  2K57 A;  4RG8 A;  3EFR A;  5LJ3 j;  2XD0 A;  3ME9 A;  1B34 A;  1G3Y A;  1FKM A;  4HKE A;  2QEX T;  3CCU A;  1VQ5 T;  2M1H A;  3DLM A;  3JB9 J;  2JVV A;  3GF5 A;  3H6Z A;  3FLG A;  1YHQ A;  1OYX A;  5LJ5 g;  4M7A A;  3UWN A;  2X35 A;  1OZ3 A;  5GAN 6;  3I55 T;  3G71 T;  4N0A C;  3RKX A;  3VUZ A;  3C4S A;  2WJ9 A;  3CCR T;  2K2V A;  3BG5 A;  4XQ3 A;  5LJ3 g;  5LJ5 e;  3PMI A;  4LDX A;  2WSE E;  3HRU A;  3QHS A;  2QQ8 A;  2KR6 A;  3VYH B;  4ZGJ B;  1VQL A;  2K5F A;  2QTX A;  5LJ3 e;  4J6Y A;  4OGC A;  1X01 A;  4LDY A;  4IKF A;  4BE2 A;  3PNW C;  3MP6 A;  3L2R A;  4C92 F;  3X26 B;  4F7U G;  3M57 A;  1Q7Y U;  3WVE B;  4NOY A;  1JJ2 A;  4UC4 A;  1YI2 T;  5HK3 A;  1NJI C;  4KBM B;  5I2M A;  3VKG A;  3A5Z B;  2L3R A;  3JCM P;  4JRP A;  4M7A D;  3V8J A;  4C8Q F;  4RCB A;  3BG9 A;  4MFE A;  5CKH A;  1KHC A;  2LVM A;  3DB4 A;  3CC4 T;  3S3O A;  3L2U A;  3JCM X;  4ELY C;  2VXE A;  1QVG S;  3GPL A;  1VQO T;  3HSB A;  2P4T A;  4MMK A;  2ZPH B;  3QYB A;  3QJ6 A;  5GAM d;  5IN1 A;  3JB9 F;  3P8B B;  4ZN1 A;  2LQ8 A;  2NLU A;  3QBY A;  1VQ7 T;  2DO3 A;  3QII A;  4J7I A;  2KMT A;  3OYM A;  2BKD N;  2QXF A;  4J6X A;  2EQJ A;  2MMP A;  3G4S A;  2L89 A;  4IUV A;  5GAO n;  1FWZ A;  2MI6 A;  4N4H A;  4EMK A;  4OB2 B;  1NZ9 A;  3P8H A;  5DM7 R;  4NL3 A;  3CMA T;  3A8H B;  3OS0 A;  4OB3 B;  3V8K A;  3PIP A;  5GAN 5;  1VQ6 A;  1WGS A;  2DJZ A;  5I2S A;  1VQK A;  3RER A;  2OAU A;  1KC8 C;  3E19 A;  2D6F A;  2DIG A;  4C5E A;  5CK9 A;  3OYD A;  1Q82 C;  1KQS A;  2VGM A;  1WNL A;  3FEO A;  3TCJ A;  3JB9 H;  3DLL A;  3PTA A;  3X24 B;  5CIU A;  3JSC A;  5GAN h;  3JCM c;  2LCC A;  3M54 A;  5HY6 A;  2R58 A;  3KUF A;  2DAQ A;  2XKO C;  3OBY A;  4GLK A;  4PKC C;  4E7L A;  1I5L A;  1LOJ A;  5A2Q E;  2EQK A;  1I81 A;  3CCJ A;  4XK8 E;  1WJS A;  3HPW A;  4C92 G;  3OW2 A;  5C0M A;  4F7U B;  2GCX A;  3OS1 A;  4M77 E;  4DA4 A;  1MHN A;  3A8L B;  4M7D E;  2CS7 A;  4J6W A;  3CCS A;  2EFI A;  1VQ9 A;  5HK0 A;  3JCM e;  2DEQ A;  3HB9 A;  3L1A A;  4C8Q G;  1S72 A;  3OA6 A;  4M7A C;  2KY9 A;  3CBM A;  4JLG A;  2DXC A;  4PJO E;  2DD5 B;  4XTX A;  1N6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...