3G33B

Crystal structure of cdk4/cyclin d3
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
232
structure length
229
Chain Sequence
GDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGMSGDELTELLAGITGTEVDCLRACQEQIEAALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 4
publication title The structure of CDK4/cyclin D3 has implications for models of CDK activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 79
structure length 229
sequence length 232
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3g33B02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3g33B01
2C5OB 4IMYB 4YOOA 4UN0A 1URCB 5L2WB 3BHVB 3TNWB 2WIPB 5HBHB 3H4CA 3QHRB 4ROCA 4KRDB 1UNHD 4CFNB 4EOOB 1P5EB 3LQ5B 3POMA 4G6LB 1OGUB 2B9RA 2C5NB 4YOZA 2QDJA 1O9KA 5LQFB 2WMAB 4F7NB 3MIAB 1VINA 1GUXA 2W99A 2IW6B 1AISB 4F7LB 4F70B 4BCHB 4BCOB 4CFMB 4EC9B 1O9KB 2UZEB 1UNGD 2CCIB 1GUXB 1JOWA 1TFBA 3DDQB 3QHWB 3BLQB 2X1NB 5IF1B 1OKWB 3EOCB 5HBJB 2CJMB 2WXVB 3EJ1B 1FINB 3TN8B 1H1SB 3M03A 1H4LD 1H1RB 3MI9B 3MY1B 1G3NC 1OIYB 4CXAB 5ACBA 5IDPB 4BCPB 5HNBB 1H1PB 1OKVB 4ROEA 2C6TB 2IVXA 4I3ZB 1JSTB 4BCIB 2UZBB 5HVYB 1OL2B 1OL1B 2G9XB 2W9ZA 1C9BA 5CEIB 4CFUD 5EFQB 4CFVB 1W98B 2WFYB 4EONB 2BKZB 2BPMB 1UNLD 2V22B 1XO2A 4BCND 4ELLA 4F6WB 3BHUB 5HQ0B 3O0GD 4BCFB 1KXUA 3BLHB 5ICPB 4BCKB 4ELJA 4F7JB 4CFUB 1JSUB 1PKDB 3F5XB 1BU2A 2C4GB 4BCNB 2I53A 4II5B 2WIHB 1GY3B 4EOIB 4BCMD 3BLRB 1AD6A 4EOQB 4F6SB 2JGZB 2WMBB 4BCGB 3K7AM 4EOPB 3TNHB 5CYIB 1N4MA 1F5QB 2UZLB 4NSTB 5LMKB 1H25B 2UUEB 1JKWA 2C5VB 2W9FA 3RGFB 2WPAB 1FVVB 4BCMB 3DOGB 2C5XB 5I5ZB 1QMZB 5BNJB 2WHBB 2CCHB 3EIDB 4TTHA 1H24B 4BCQD 4YOSA 2IW9B 1VYWB 4EOLB 4OR5B 2EUFA 2F2CA 2I40B 2R7GA 1GH6B 3MY5B 1H1QB 3G33B 4EOJB 1D3UB 4BCQB 4F7SB 1OI9B 4KRCB 4OGRB 2PMIB 4Y72B 1VOLA 4EOKB 2PK2A 4YC3B 2W2HA 1ZP2A 4FX3B 4EC8B 5HBEB 4RODA 5FGKB 4CFWB 4EORB 4EOMB 1E9HB 2W96A 2WEVB 4CRLB 2PK9B 1H27B 4CFXB 3TNIB 1OIUB 3BHTB 3DDPB 5IDNB 2PHGA 4BCJB 2UZDB 4EOSB 2IW8B 4F6UB 1H26B 1H28B
chains in the Genus database with same CATH superfamily
2QGSA 3DL1A 3TNWB 4ROCA 3A8OB 1UNHD 1TD6A 4G6LB 1OGUB 2B9RA 3X28B 2D0QB 3B57A 1VINA 3TW7A 4CFMB 3X25B 1O9KB 2UZEB 1GUXB 4QSHA 2DXCB 3BLQB 5DQVA 2X1NB 3EOCB 2WXVB 3TN8B 3M03A 3MY1B 5ACBA 2AHJB 2IVXA 1JSTB 2ZPFB 4BCIB 2G9XB 4CFUD 5EFQB 4F6WB 3O0GD 1KXUA 4BCKB 3F5XB 2C4GB 4BCNB 1UGRB 2WIHB 4EOIB 3VKGA 2JGZB 4NSTB 2C5VB 3RGFB 1FVVB 2C5XB 2DD5B 3HBLA 2CZ7B 4OB2B 1H24B 4YOSA 2IW9B 2F2CA 4BCQB 1OI9B 4KRCB 4Y72B 2W2HA 2CZ6B 4CFWB 4EORB 2ZZDB 3KHIA 2QQ8A 2PHGA 4EOSB 4ZGDB 3BG3A 4IMYB 1URCB 1IREB 2KMGA 3BHVB 5HBHB 4ZGEB 3LQ5B 3HB9A 2WMAB 3QYHB 4NC6A 2W99A 3A8MB 4BCHB 1JOWA 4MFDA 1TFBA 3QHWB 3QWLA 5IF1B 2IN3A 1OKWB 2CJMB 1FINB 4HLQA 4OB0B 1H1RB 2G77A 5IDPB 4AI6A 3X24B 2C6TB 4I3ZB 4MFEA 1OL2B 4BBSM 5CEIB 4HNUA 4MIMA 2WFYB 2BPMB 1UNLD 4BCND 4ELLA 2ZPBB 5HQ0B 2DPPB 3NDQA 2CZ1B 4Z6YA 2I53A 1GY3B 1AD6A 4F6SB 2WMBB 3TW6A 2KR6A 4EOPB 1H25B 3X20B 2WPAB 5IHYA 4BCMB 5BNJB 4AKIA 3EIDB 4TTHA 4BCQD 4OB1B 3QZ5B 4EOLB 2QFZA 1QLBA 2ZPGB 2EUFA 4EOJB 2PMIB 1ZP2A 4FX3B 5HBEB 4RODA 2ZPIB 2W96A 4CRLB 2PK9B 3DDPB 4BCJB 3WVEB 3DTOA 2IW8B 1H26B 4HNVA 2C5OB 1FKMA 4UN0A 5L2WB 2WIPB 3H4CA 3QHRB 4KRDB 3VYGB 3HZJA 3POMA 4YOZA 4BY7X 4BY1X 1O9KA 4JX5A 3MIAB 1GUXA 2LW4A 2IW6B 1UGSB 3HHTB 4F7LB 3X26B 3QYGB 1UNGD 3GTMS 2DMEA 3EJ1B 4HL4A 1H1SB 3MI9B 1G3NC 1OIYB 3PO3S 4BCPB 2ZCFB 1H1PB 2DXBB 2UZBB 5HVYB 1V29B 4CFVB 4EONB 1W98B 2V22B 3BHUB 4BCFB 3BLHB 4ELJA 1JSUB 2WJ9A 1PKDB 2PJQA 4BCMD 3BLRB 3A8LB 3TNHB 1N4MA 2UZLB 2UUEB 1JKWA 3VYHB 3DOGB 3QXEB 1QMZB 3QYBA 4LOCA 2CZ0B 1VYWB 2ZPHB 1UGPB 1GH6B 3MY5B 4ZGJB 1H1QB 3G33B 1AHJB 1D3UB 4BBRM 4OGRB 1VOLA 2PK2A 4YC3B 5EJCA 3HO8A 1E9HB 4HNTA 3BHTB 4OB3B 2UZDB 4BXXX 1UGQB 1H28B 4YOOA 2BS4A 2CYZB 3QYEA 4CFNB 4EOOB 1P5EB 3BG5A 2C5NB 3BG9A 3A8HB 2QDJA 5LQFB 4F7NB 3A8GB 1AISB 4F70B 4BCOB 4EC9B 2CCIB 2QF7A 3DDQB 4AKHA 5HBJB 1H4LD 4CXAB 3WVDB 5HNBB 1OKVB 4FM4B 4ROEA 1OL1B 2W9ZA 1C9BA 3DJBA 2DD4B 4JX6A 2BKZB 1XO2A 2ZPEB 5ICPB 4F7JB 4CFUB 1BU2A 4II5B 4EOQB 5DQWA 4BCGB 3K7AM 5CYIB 1F5QB 5LMKB 2W9FA 4M6VA 5I5ZB 2WHBB 3VKHA 2CCHB 4OR5B 2R7GA 2BS3A 2I40B 3QZ9B 4F7SB 4EOKB 4JX4A 4EC8B 4AKGA 5FGKB 2BS2A 2QDYB 4EOMB 4CFXB 2WEVB 1H27B 3TNIB 1OIUB 5IDNB 4F6UB 1E7PA 1ENWA
chains in the Genus database with same CATH topology
2C5OB 4IMYB 4YOOA 4UN0A 1URCB 5L2WB 3BHVB 3TNWB 2WIPB 5HBHB 3H4CA 3QHRB 4ROCA 4KRDB 1UNHD 4CFNB 4EOOB 1P5EB 3LQ5B 3POMA 4G6LB 1OGUB 2B9RA 2C5NB 4YOZA 2QDJA 1O9KA 5LQFB 2WMAB 4F7NB 3MIAB 1VINA 1GUXA 2W99A 2IW6B 1AISB 4F7LB 4F70B 4BCHB 4BCOB 4CFMB 4EC9B 1O9KB 2UZEB 1UNGD 2CCIB 1GUXB 1JOWA 1TFBA 3DDQB 3QHWB 3BLQB 2X1NB 5IF1B 1OKWB 3EOCB 5HBJB 2CJMB 2WXVB 3EJ1B 1FINB 3TN8B 1H1SB 3M03A 1H4LD 1H1RB 3MI9B 3MY1B 1G3NC 1OIYB 4CXAB 5ACBA 5IDPB 4BCPB 5HNBB 1H1PB 1OKVB 4ROEA 2C6TB 2IVXA 4I3ZB 1JSTB 4BCIB 2UZBB 5HVYB 1OL2B 1OL1B 2G9XB 2W9ZA 1C9BA 5CEIB 4CFUD 5EFQB 4CFVB 1W98B 2WFYB 4EONB 2BKZB 2BPMB 1UNLD 2V22B 1XO2A 4BCND 4ELLA 4F6WB 3BHUB 5HQ0B 3O0GD 4BCFB 1KXUA 3BLHB 5ICPB 4BCKB 4ELJA 4F7JB 4CFUB 1JSUB 1PKDB 3F5XB 1BU2A 2C4GB 4BCNB 2I53A 4II5B 2WIHB 1GY3B 4EOIB 4BCMD 3BLRB 1AD6A 4EOQB 4F6SB 2JGZB 2WMBB 4BCGB 3K7AM 4EOPB 3TNHB 5CYIB 1N4MA 1F5QB 2UZLB 4NSTB 5LMKB 1H25B 2UUEB 1JKWA 2C5VB 2W9FA 3RGFB 2WPAB 1FVVB 4BCMB 3DOGB 2C5XB 5I5ZB 1QMZB 5BNJB 2WHBB 2CCHB 3EIDB 4TTHA 1H24B 4BCQD 4YOSA 2IW9B 1VYWB 4EOLB 4OR5B 2EUFA 2F2CA 2I40B 2R7GA 1GH6B 3MY5B 1H1QB 3G33B 4EOJB 1D3UB 4BCQB 4F7SB 1OI9B 4KRCB 4OGRB 2PMIB 4Y72B 1VOLA 4EOKB 2PK2A 4YC3B 2W2HA 1ZP2A 4FX3B 4EC8B 5HBEB 4RODA 5FGKB 4CFWB 4EORB 4EOMB 1E9HB 2W96A 2WEVB 4CRLB 2PK9B 1H27B 4CFXB 3TNIB 1OIUB 3BHTB 3DDPB 5IDNB 2PHGA 4BCJB 2UZDB 4EOSB 2IW8B 4F6UB 1H26B 1H28B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5O B;  4IMY B;  4YOO A;  4UN0 A;  1URC B;  5L2W B;  3BHV B;  3TNW B;  2WIP B;  5HBH B;  3H4C A;  3QHR B;  4ROC A;  4KRD B;  1UNH D;  4CFN B;  4EOO B;  1P5E B;  3LQ5 B;  3POM A;  4G6L B;  1OGU B;  2B9R A;  2C5N B;  4YOZ A;  2QDJ A;  1O9K A;  5LQF B;  2WMA B;  4F7N B;  3MIA B;  1VIN A;  1GUX A;  2W99 A;  2IW6 B;  1AIS B;  4F7L B;  4F70 B;  4BCH B;  4BCO B;  4CFM B;  4EC9 B;  1O9K B;  2UZE B;  1UNG D;  2CCI B;  1GUX B;  1JOW A;  1TFB A;  3DDQ B;  3QHW B;  3BLQ B;  2X1N B;  5IF1 B;  1OKW B;  3EOC B;  5HBJ B;  2CJM B;  2WXV B;  3EJ1 B;  1FIN B;  3TN8 B;  1H1S B;  3M03 A;  1H4L D;  1H1R B;  3MI9 B;  3MY1 B;  1G3N C;  1OIY B;  4CXA B;  5ACB A;  5IDP B;  4BCP B;  5HNB B;  1H1P B;  1OKV B;  4ROE A;  2C6T B;  2IVX A;  4I3Z B;  1JST B;  4BCI B;  2UZB B;  5HVY B;  1OL2 B;  1OL1 B;  2G9X B;  2W9Z A;  1C9B A;  5CEI B;  4CFU D;  5EFQ B;  4CFV B;  1W98 B;  2WFY B;  4EON B;  2BKZ B;  2BPM B;  1UNL D;  2V22 B;  1XO2 A;  4BCN D;  4ELL A;  4F6W B;  3BHU B;  5HQ0 B;  3O0G D;  4BCF B;  1KXU A;  3BLH B;  5ICP B;  4BCK B;  4ELJ A;  4F7J B;  4CFU B;  1JSU B;  1PKD B;  3F5X B;  1BU2 A;  2C4G B;  4BCN B;  2I53 A;  4II5 B;  2WIH B;  1GY3 B;  4EOI B;  4BCM D;  3BLR B;  1AD6 A;  4EOQ B;  4F6S B;  2JGZ B;  2WMB B;  4BCG B;  3K7A M;  4EOP B;  3TNH B;  5CYI B;  1N4M A;  1F5Q B;  2UZL B;  4NST B;  5LMK B;  1H25 B;  2UUE B;  1JKW A;  2C5V B;  2W9F A;  3RGF B;  2WPA B;  1FVV B;  4BCM B;  3DOG B;  2C5X B;  5I5Z B;  1QMZ B;  5BNJ B;  2WHB B;  2CCH B;  3EID B;  4TTH A;  1H24 B;  4BCQ D;  4YOS A;  2IW9 B;  1VYW B;  4EOL B;  4OR5 B;  2EUF A;  2F2C A;  2I40 B;  2R7G A;  1GH6 B;  3MY5 B;  1H1Q B;  3G33 B;  4EOJ B;  1D3U B;  4BCQ B;  4F7S B;  1OI9 B;  4KRC B;  4OGR B;  2PMI B;  4Y72 B;  1VOL A;  4EOK B;  2PK2 A;  4YC3 B;  2W2H A;  1ZP2 A;  4FX3 B;  4EC8 B;  5HBE B;  4ROD A;  5FGK B;  4CFW B;  4EOR B;  4EOM B;  1E9H B;  2W96 A;  2WEV B;  4CRL B;  2PK9 B;  1H27 B;  4CFX B;  3TNI B;  1OIU B;  3BHT B;  3DDP B;  5IDN B;  2PHG A;  4BCJ B;  2UZD B;  4EOS B;  2IW8 B;  4F6U B;  1H26 B;  1H28 B; 
#chains in the Genus database with same CATH topology
 2QGS A;  3DL1 A;  3TNW B;  4ROC A;  3A8O B;  1UNH D;  1TD6 A;  4G6L B;  1OGU B;  2B9R A;  3X28 B;  2D0Q B;  3B57 A;  1VIN A;  3TW7 A;  4CFM B;  3X25 B;  1O9K B;  2UZE B;  1GUX B;  4QSH A;  2DXC B;  3BLQ B;  5DQV A;  2X1N B;  3EOC B;  2WXV B;  3TN8 B;  3M03 A;  3MY1 B;  5ACB A;  2AHJ B;  2IVX A;  1JST B;  2ZPF B;  4BCI B;  2G9X B;  4CFU D;  5EFQ B;  4F6W B;  3O0G D;  1KXU A;  4BCK B;  3F5X B;  2C4G B;  4BCN B;  1UGR B;  2WIH B;  4EOI B;  3VKG A;  2JGZ B;  4NST B;  2C5V B;  3RGF B;  1FVV B;  2C5X B;  2DD5 B;  3HBL A;  2CZ7 B;  4OB2 B;  1H24 B;  4YOS A;  2IW9 B;  2F2C A;  4BCQ B;  1OI9 B;  4KRC B;  4Y72 B;  2W2H A;  2CZ6 B;  4CFW B;  4EOR B;  2ZZD B;  3KHI A;  2QQ8 A;  2PHG A;  4EOS B;  4ZGD B;  3BG3 A;  4IMY B;  1URC B;  1IRE B;  2KMG A;  3BHV B;  5HBH B;  4ZGE B;  3LQ5 B;  3HB9 A;  2WMA B;  3QYH B;  4NC6 A;  2W99 A;  3A8M B;  4BCH B;  1JOW A;  4MFD A;  1TFB A;  3QHW B;  3QWL A;  5IF1 B;  2IN3 A;  1OKW B;  2CJM B;  1FIN B;  4HLQ A;  4OB0 B;  1H1R B;  2G77 A;  5IDP B;  4AI6 A;  3X24 B;  2C6T B;  4I3Z B;  4MFE A;  1OL2 B;  4BBS M;  5CEI B;  4HNU A;  4MIM A;  2WFY B;  2BPM B;  1UNL D;  4BCN D;  4ELL A;  2ZPB B;  5HQ0 B;  2DPP B;  3NDQ A;  2CZ1 B;  4Z6Y A;  2I53 A;  1GY3 B;  1AD6 A;  4F6S B;  2WMB B;  3TW6 A;  2KR6 A;  4EOP B;  1H25 B;  3X20 B;  2WPA B;  5IHY A;  4BCM B;  5BNJ B;  4AKI A;  3EID B;  4TTH A;  4BCQ D;  4OB1 B;  3QZ5 B;  4EOL B;  2QFZ A;  1QLB A;  2ZPG B;  2EUF A;  4EOJ B;  2PMI B;  1ZP2 A;  4FX3 B;  5HBE B;  4ROD A;  2ZPI B;  2W96 A;  4CRL B;  2PK9 B;  3DDP B;  4BCJ B;  3WVE B;  3DTO A;  2IW8 B;  1H26 B;  4HNV A;  2C5O B;  1FKM A;  4UN0 A;  5L2W B;  2WIP B;  3H4C A;  3QHR B;  4KRD B;  3VYG B;  3HZJ A;  3POM A;  4YOZ A;  4BY7 X;  4BY1 X;  1O9K A;  4JX5 A;  3MIA B;  1GUX A;  2LW4 A;  2IW6 B;  1UGS B;  3HHT B;  4F7L B;  3X26 B;  3QYG B;  1UNG D;  3GTM S;  2DME A;  3EJ1 B;  4HL4 A;  1H1S B;  3MI9 B;  1G3N C;  1OIY B;  3PO3 S;  4BCP B;  2ZCF B;  1H1P B;  2DXB B;  2UZB B;  5HVY B;  1V29 B;  4CFV B;  4EON B;  1W98 B;  2V22 B;  3BHU B;  4BCF B;  3BLH B;  4ELJ A;  1JSU B;  2WJ9 A;  1PKD B;  2PJQ A;  4BCM D;  3BLR B;  3A8L B;  3TNH B;  1N4M A;  2UZL B;  2UUE B;  1JKW A;  3VYH B;  3DOG B;  3QXE B;  1QMZ B;  3QYB A;  4LOC A;  2CZ0 B;  1VYW B;  2ZPH B;  1UGP B;  1GH6 B;  3MY5 B;  4ZGJ B;  1H1Q B;  3G33 B;  1AHJ B;  1D3U B;  4BBR M;  4OGR B;  1VOL A;  2PK2 A;  4YC3 B;  5EJC A;  3HO8 A;  1E9H B;  4HNT A;  3BHT B;  4OB3 B;  2UZD B;  4BXX X;  1UGQ B;  1H28 B;  4YOO A;  2BS4 A;  2CYZ B;  3QYE A;  4CFN B;  4EOO B;  1P5E B;  3BG5 A;  2C5N B;  3BG9 A;  3A8H B;  2QDJ A;  5LQF B;  4F7N B;  3A8G B;  1AIS B;  4F70 B;  4BCO B;  4EC9 B;  2CCI B;  2QF7 A;  3DDQ B;  4AKH A;  5HBJ B;  1H4L D;  4CXA B;  3WVD B;  5HNB B;  1OKV B;  4FM4 B;  4ROE A;  1OL1 B;  2W9Z A;  1C9B A;  3DJB A;  2DD4 B;  4JX6 A;  2BKZ B;  1XO2 A;  2ZPE B;  5ICP B;  4F7J B;  4CFU B;  1BU2 A;  4II5 B;  4EOQ B;  5DQW A;  4BCG B;  3K7A M;  5CYI B;  1F5Q B;  5LMK B;  2W9F A;  4M6V A;  5I5Z B;  2WHB B;  3VKH A;  2CCH B;  4OR5 B;  2R7G A;  2BS3 A;  2I40 B;  3QZ9 B;  4F7S B;  4EOK B;  4JX4 A;  4EC8 B;  4AKG A;  5FGK B;  2BS2 A;  2QDY B;  4EOM B;  4CFX B;  2WEV B;  1H27 B;  3TNI B;  1OIU B;  5IDN B;  4F6U B;  1E7P A;  1ENW A; 
#chains in the Genus database with same CATH homology
 2C5O B;  4IMY B;  4YOO A;  4UN0 A;  1URC B;  5L2W B;  3BHV B;  3TNW B;  2WIP B;  5HBH B;  3H4C A;  3QHR B;  4ROC A;  4KRD B;  1UNH D;  4CFN B;  4EOO B;  1P5E B;  3LQ5 B;  3POM A;  4G6L B;  1OGU B;  2B9R A;  2C5N B;  4YOZ A;  2QDJ A;  1O9K A;  5LQF B;  2WMA B;  4F7N B;  3MIA B;  1VIN A;  1GUX A;  2W99 A;  2IW6 B;  1AIS B;  4F7L B;  4F70 B;  4BCH B;  4BCO B;  4CFM B;  4EC9 B;  1O9K B;  2UZE B;  1UNG D;  2CCI B;  1GUX B;  1JOW A;  1TFB A;  3DDQ B;  3QHW B;  3BLQ B;  2X1N B;  5IF1 B;  1OKW B;  3EOC B;  5HBJ B;  2CJM B;  2WXV B;  3EJ1 B;  1FIN B;  3TN8 B;  1H1S B;  3M03 A;  1H4L D;  1H1R B;  3MI9 B;  3MY1 B;  1G3N C;  1OIY B;  4CXA B;  5ACB A;  5IDP B;  4BCP B;  5HNB B;  1H1P B;  1OKV B;  4ROE A;  2C6T B;  2IVX A;  4I3Z B;  1JST B;  4BCI B;  2UZB B;  5HVY B;  1OL2 B;  1OL1 B;  2G9X B;  2W9Z A;  1C9B A;  5CEI B;  4CFU D;  5EFQ B;  4CFV B;  1W98 B;  2WFY B;  4EON B;  2BKZ B;  2BPM B;  1UNL D;  2V22 B;  1XO2 A;  4BCN D;  4ELL A;  4F6W B;  3BHU B;  5HQ0 B;  3O0G D;  4BCF B;  1KXU A;  3BLH B;  5ICP B;  4BCK B;  4ELJ A;  4F7J B;  4CFU B;  1JSU B;  1PKD B;  3F5X B;  1BU2 A;  2C4G B;  4BCN B;  2I53 A;  4II5 B;  2WIH B;  1GY3 B;  4EOI B;  4BCM D;  3BLR B;  1AD6 A;  4EOQ B;  4F6S B;  2JGZ B;  2WMB B;  4BCG B;  3K7A M;  4EOP B;  3TNH B;  5CYI B;  1N4M A;  1F5Q B;  2UZL B;  4NST B;  5LMK B;  1H25 B;  2UUE B;  1JKW A;  2C5V B;  2W9F A;  3RGF B;  2WPA B;  1FVV B;  4BCM B;  3DOG B;  2C5X B;  5I5Z B;  1QMZ B;  5BNJ B;  2WHB B;  2CCH B;  3EID B;  4TTH A;  1H24 B;  4BCQ D;  4YOS A;  2IW9 B;  1VYW B;  4EOL B;  4OR5 B;  2EUF A;  2F2C A;  2I40 B;  2R7G A;  1GH6 B;  3MY5 B;  1H1Q B;  3G33 B;  4EOJ B;  1D3U B;  4BCQ B;  4F7S B;  1OI9 B;  4KRC B;  4OGR B;  2PMI B;  4Y72 B;  1VOL A;  4EOK B;  2PK2 A;  4YC3 B;  2W2H A;  1ZP2 A;  4FX3 B;  4EC8 B;  5HBE B;  4ROD A;  5FGK B;  4CFW B;  4EOR B;  4EOM B;  1E9H B;  2W96 A;  2WEV B;  4CRL B;  2PK9 B;  1H27 B;  4CFX B;  3TNI B;  1OIU B;  3BHT B;  3DDP B;  5IDN B;  2PHG A;  4BCJ B;  2UZD B;  4EOS B;  2IW8 B;  4F6U B;  1H26 B;  1H28 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...