3G33B

Crystal structure of cdk4/cyclin d3
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
232
structure length
229
Chain Sequence
GDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGMSGDELTELLAGITGTEVDCLRACQEQIEAALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division protein kinase 4
publication title The structure of CDK4/cyclin D3 has implications for models of CDK activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 229
sequence length 232
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3g33B02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3g33B01
5HNBB 4BCFB 1BU2A 1W98B 1AISB 3EOCB 4EOMB 1AD6A 4OGRB 1OIYB 4EONB 4KRCB 2PK9B 4EORB 1ZP2A 5HBJB 4ROCA 2QDJA 5IDNB 3BHUB 4CFVB 4BCNB 1GUXB 2UZDB 1H1PB 1VYWB 2C4GB 3TNIB 5LMKB 4YC3B 1JSTB 4F7SB 1OGUB 2IVXA 4BCQD 2C5XB 1TFBA 4NSTB 4EOQB 5CYIB 4CFUD 5I5ZB 1GUXA 2UZLB 3LQ5B 1JSUB 4CFNB 1GY3B 4F6UB 3MY1B 5FGKB 3M03A 4TTHA 1H1SB 2CJMB 4F7LB 3TN8B 2BPMB 2WMAB 4Y72B 1FINB 2C5VB 1OL2B 1OL1B 5EFQB 4BCGB 5LQFB 1URCB 3QHWB 3DOGB 4EOPB 1KXUA 3MIAB 4F7JB 2WPAB 5HBEB 2B9RA 4F7NB 1P5EB 4EOJB 1G3NC 4EC9B 2R7GA 2X1NB 3TNWB 3F5XB 5ACBA 3G33B 4BCIB 4BCHB 1OI9B 2I40B 4RODA 2W9ZA 3O0GD 4ELJA 2G9XB 1JKWA 1UNLD 2F2CA 3BLQB 4BCMD 1E9HB 5L2WB 2EUFA 4F70B 1C9BA 2W9FA 4EOSB 4EOOB 4CFXB 2UZBB 3TNHB 2IW6B 1H1RB 4EC8B 1H25B 3BLHB 4EOLB 1UNHD 3K7AM 4BCQB 4CXAB 2UUEB 3H4CA 1JOWA 3DDPB 2CCHB 1OKVB 2WIHB 2WEVB 4CFUB 1H24B 4YOOA 2W99A 4CRLB 2IW8B 4ELLA 3BHTB 4BCJB 1UNGD 1GH6B 5HVYB 2JGZB 4BCND 4F6WB 4YOSA 2PK2A 2PMIB 4CFWB 3EIDB 1QMZB 4ROEA 1XO2A 1F5QB 4CFMB 3BHVB 5IF1B 1D3UB 2I53A 2WIPB 3EJ1B 2C5NB 2V22B 4YOZA 4BCOB 1VINA 2IW9B 5CEIB 5ICPB 3MI9B 1OIUB 2C5OB 1H27B 1PKDB 4IMYB 2CCIB 3POMA 1VOLA 2C6TB 4BCKB 2UZEB 5IDPB 1O9KB 4UN0A 2BKZB 4KRDB 1H28B 5BNJB 2WHBB 3QHRB 4I3ZB 3RGFB 4FX3B 4G6LB 4OR5B 3MY5B 1FVVB 1O9KA 5HQ0B 2WFYB 1H26B 4BCMB 1OKWB 2PHGA 1N4MA 1H1QB 2W96A 1H4LD 2WMBB 3DDQB 4II5B 5HBHB 2WXVB 4BCPB 4EOIB 4F6SB 3BLRB 2W2HA 4EOKB
chains in the Genus database with same CATH superfamily
3X26B 2WJ9A 1W98B 3DTOA 2KMGA 2PK9B 2BS4A 2CYZB 3TNIB 2IVXA 4HNUA 2C5XB 4EOQB 5CYIB 2BS3A 3PO3S 1JSUB 4CFNB 1GY3B 1IREB 3VYGB 1H1SB 2CJMB 4F7LB 2C5VB 1E7PA 5EFQB 4OB1B 3DOGB 3VYHB 3WVEB 4F7NB 1UGSB 2DD4B 3TNWB 4M6VA 2G9XB 1UNLD 2CZ1B 4HNVA 3TNHB 4EC8B 1H25B 3BLHB 4BCQB 3DDPB 4CFUB 1UNGD 1GH6B 2PK2A 4HNTA 2PJQA 1QMZB 4OB3B 3DJBA 1D3UB 2C5NB 2V22B 4YOZA 1VINA 4OB2B 1H27B 1PKDB 4IMYB 4Z6YA 2UZEB 5IDPB 1V29B 5BNJB 3QHRB 3RGFB 4MFDA 1O9KA 4ZGEB 5HQ0B 1UGQB 1H26B 4BCMB 1OKWB 3DDQB 4II5B 4EOIB 4F6SB 5EJCA 1AISB 2ZPHB 4OGRB 4EONB 4NC6A 4BCNB 2AHJB 3A8MB 1H1PB 4HLQA 2C4GB 1VYWB 5LMKB 1JSTB 2QQ8A 4F7SB 4ZGJB 3QWLA 4F6UB 3MY1B 2IN3A 4TTHA 5DQWA 2BPMB 4Y72B 3QXEB 3WVDB 2ZPIB 1AHJB 4BCGB 4AKIA 4HL4A 4EOPB 1KXUA 2B9RA 2DMEA 1P5EB 1G3NC 3BG9A 1FKMA 3A8OB 2X1NB 4BCIB 2DXCB 1JKWA 1C9BA 2EUFA 1H1RB 4EOLB 3H4CA 1JOWA 2CCHB 1OKVB 3A8HB 2WIHB 2WEVB 3QZ9B 3HHTB 1H24B 2W99A 3BG3A 3QZ5B 2JGZB 4ROEA 3X24B 4JX4A 1OIUB 1VOLA 3X25B 4UN0A 2BKZB 2QFZA 4KRDB 2D0QB 4FX3B 3HZJA 4OR5B 3HB9A 3B57A 2WFYB 2PHGA 1N4MA 1H1QB 2W96A 1H4LD 4BCFB 2W2HA 4FM4B 3VKHA 4EOMB 1AD6A 4AKGA 4KRCB 4BY7X 1ZP2A 4MIMA 2QDJA 5IDNB 4CFVB 1GUXB 2UZDB 1UGRB 4YC3B 2ZPEB 1TFBA 4NSTB 3GTMS 3BG5A 2UZLB 2CZ0B 2CZ6B 5FGKB 2KR6A 4BBSM 3TN8B 2WMAB 1FINB 1OL2B 4BBRM 3NDQA 3A8LB 3MIAB 4F7JB 2WPAB 1ENWA 4EOJB 1QLBA 2CZ7B 3F5XB 3G33B 1OI9B 2I40B 3O0GD 4ELJA 2DXBB 1E9HB 4F70B 2W9FA 4EOSB 2IW6B 3KHIA 4QSHA 3QYEA 3K7AM 4CRLB 2IW8B 3BHTB 5HVYB 3TW7A 3QYBA 4CFWB 3EIDB 4JX5A 1XO2A 1F5QB 2ZCFB 5IF1B 2WIPB 4ZGDB 4BCOB 5ICPB 2C6TB 4BCKB 2QDYB 5IHYA 1H28B 2WHBB 4I3ZB 3MY5B 1UGPB 4AI6A 2ZPBB 2WXVB 4BCPB 4ELLA 3BLRB 4LOCA 5HNBB 3TW6A 1BU2A 4BY1X 3EOCB 2DPPB 1OIYB 2BS2A 4EORB 5HBJB 4ROCA 3BHUB 5DQVA 3QYGB 1OGUB 4BCQD 5I5ZB 4CFUD 1GUXA 2ZPFB 3LQ5B 3M03A 2QGSA 2ZZDB 1OL1B 5LQFB 3DL1A 1URCB 3QHWB 5HBEB 4EC9B 2R7GA 5ACBA 2QF7A 4BXXX 3HO8A 2DD5B 4BCHB 4RODA 2W9ZA 3HBLA 2F2CA 3BLQB 4BCMD 5L2WB 4EOOB 4CFXB 2UZBB 1UNHD 4CXAB 2UUEB 3VKGA 4YOOA 4BCJB 4BCND 4F6WB 2G77A 4YOSA 2PMIB 4OB0B 3X28B 4CFMB 3BHVB 2I53A 3EJ1B 2LW4A 2IW9B 3MI9B 2C5OB 3A8GB 2CCIB 3POMA 3X20B 1O9KB 4MFEA 3QYHB 4G6LB 1FVVB 1TD6A 2WMBB 5HBHB 4AKHA 2ZPGB 5CEIB 4JX6A 4EOKB
chains in the Genus database with same CATH topology
5HNBB 4BCFB 1BU2A 1W98B 1AISB 3EOCB 4EOMB 1AD6A 4OGRB 1OIYB 4EONB 4KRCB 2PK9B 4EORB 1ZP2A 5HBJB 4ROCA 2QDJA 5IDNB 3BHUB 4CFVB 4BCNB 1GUXB 2UZDB 1H1PB 1VYWB 2C4GB 3TNIB 5LMKB 4YC3B 1JSTB 4F7SB 1OGUB 2IVXA 4BCQD 2C5XB 1TFBA 4NSTB 4EOQB 5CYIB 4CFUD 5I5ZB 1GUXA 2UZLB 3LQ5B 1JSUB 4CFNB 1GY3B 4F6UB 3MY1B 5FGKB 3M03A 4TTHA 1H1SB 2CJMB 4F7LB 3TN8B 2BPMB 2WMAB 4Y72B 1FINB 2C5VB 1OL2B 1OL1B 5EFQB 4BCGB 5LQFB 1URCB 3QHWB 3DOGB 4EOPB 1KXUA 3MIAB 4F7JB 2WPAB 5HBEB 2B9RA 4F7NB 1P5EB 4EOJB 1G3NC 4EC9B 2R7GA 2X1NB 3TNWB 3F5XB 5ACBA 3G33B 4BCIB 4BCHB 1OI9B 2I40B 4RODA 2W9ZA 3O0GD 4ELJA 2G9XB 1JKWA 1UNLD 2F2CA 3BLQB 4BCMD 1E9HB 5L2WB 2EUFA 4F70B 1C9BA 2W9FA 4EOSB 4EOOB 4CFXB 2UZBB 3TNHB 2IW6B 1H1RB 4EC8B 1H25B 3BLHB 4EOLB 1UNHD 3K7AM 4BCQB 4CXAB 2UUEB 3H4CA 1JOWA 3DDPB 2CCHB 1OKVB 2WIHB 2WEVB 4CFUB 1H24B 4YOOA 2W99A 4CRLB 2IW8B 4ELLA 3BHTB 4BCJB 1UNGD 1GH6B 5HVYB 2JGZB 4BCND 4F6WB 4YOSA 2PK2A 2PMIB 4CFWB 3EIDB 1QMZB 4ROEA 1XO2A 1F5QB 4CFMB 3BHVB 5IF1B 1D3UB 2I53A 2WIPB 3EJ1B 2C5NB 2V22B 4YOZA 4BCOB 1VINA 2IW9B 5CEIB 5ICPB 3MI9B 1OIUB 2C5OB 1H27B 1PKDB 4IMYB 2CCIB 3POMA 1VOLA 2C6TB 4BCKB 2UZEB 5IDPB 1O9KB 4UN0A 2BKZB 4KRDB 1H28B 5BNJB 2WHBB 3QHRB 4I3ZB 3RGFB 4FX3B 4G6LB 4OR5B 3MY5B 1FVVB 1O9KA 5HQ0B 2WFYB 1H26B 4BCMB 1OKWB 2PHGA 1N4MA 1H1QB 2W96A 1H4LD 2WMBB 3DDQB 4II5B 5HBHB 2WXVB 4BCPB 4EOIB 4F6SB 3BLRB 2W2HA 4EOKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNB B;  4BCF B;  1BU2 A;  1W98 B;  1AIS B;  3EOC B;  4EOM B;  1AD6 A;  4OGR B;  1OIY B;  4EON B;  4KRC B;  2PK9 B;  4EOR B;  1ZP2 A;  5HBJ B;  4ROC A;  2QDJ A;  5IDN B;  3BHU B;  4CFV B;  4BCN B;  1GUX B;  2UZD B;  1H1P B;  1VYW B;  2C4G B;  3TNI B;  5LMK B;  4YC3 B;  1JST B;  4F7S B;  1OGU B;  2IVX A;  4BCQ D;  2C5X B;  1TFB A;  4NST B;  4EOQ B;  5CYI B;  4CFU D;  5I5Z B;  1GUX A;  2UZL B;  3LQ5 B;  1JSU B;  4CFN B;  1GY3 B;  4F6U B;  3MY1 B;  5FGK B;  3M03 A;  4TTH A;  1H1S B;  2CJM B;  4F7L B;  3TN8 B;  2BPM B;  2WMA B;  4Y72 B;  1FIN B;  2C5V B;  1OL2 B;  1OL1 B;  5EFQ B;  4BCG B;  5LQF B;  1URC B;  3QHW B;  3DOG B;  4EOP B;  1KXU A;  3MIA B;  4F7J B;  2WPA B;  5HBE B;  2B9R A;  4F7N B;  1P5E B;  4EOJ B;  1G3N C;  4EC9 B;  2R7G A;  2X1N B;  3TNW B;  3F5X B;  5ACB A;  3G33 B;  4BCI B;  4BCH B;  1OI9 B;  2I40 B;  4ROD A;  2W9Z A;  3O0G D;  4ELJ A;  2G9X B;  1JKW A;  1UNL D;  2F2C A;  3BLQ B;  4BCM D;  1E9H B;  5L2W B;  2EUF A;  4F70 B;  1C9B A;  2W9F A;  4EOS B;  4EOO B;  4CFX B;  2UZB B;  3TNH B;  2IW6 B;  1H1R B;  4EC8 B;  1H25 B;  3BLH B;  4EOL B;  1UNH D;  3K7A M;  4BCQ B;  4CXA B;  2UUE B;  3H4C A;  1JOW A;  3DDP B;  2CCH B;  1OKV B;  2WIH B;  2WEV B;  4CFU B;  1H24 B;  4YOO A;  2W99 A;  4CRL B;  2IW8 B;  4ELL A;  3BHT B;  4BCJ B;  1UNG D;  1GH6 B;  5HVY B;  2JGZ B;  4BCN D;  4F6W B;  4YOS A;  2PK2 A;  2PMI B;  4CFW B;  3EID B;  1QMZ B;  4ROE A;  1XO2 A;  1F5Q B;  4CFM B;  3BHV B;  5IF1 B;  1D3U B;  2I53 A;  2WIP B;  3EJ1 B;  2C5N B;  2V22 B;  4YOZ A;  4BCO B;  1VIN A;  2IW9 B;  5CEI B;  5ICP B;  3MI9 B;  1OIU B;  2C5O B;  1H27 B;  1PKD B;  4IMY B;  2CCI B;  3POM A;  1VOL A;  2C6T B;  4BCK B;  2UZE B;  5IDP B;  1O9K B;  4UN0 A;  2BKZ B;  4KRD B;  1H28 B;  5BNJ B;  2WHB B;  3QHR B;  4I3Z B;  3RGF B;  4FX3 B;  4G6L B;  4OR5 B;  3MY5 B;  1FVV B;  1O9K A;  5HQ0 B;  2WFY B;  1H26 B;  4BCM B;  1OKW B;  2PHG A;  1N4M A;  1H1Q B;  2W96 A;  1H4L D;  2WMB B;  3DDQ B;  4II5 B;  5HBH B;  2WXV B;  4BCP B;  4EOI B;  4F6S B;  3BLR B;  2W2H A;  4EOK B; 
#chains in the Genus database with same CATH topology
 3X26 B;  2WJ9 A;  1W98 B;  3DTO A;  2KMG A;  2PK9 B;  2BS4 A;  2CYZ B;  3TNI B;  2IVX A;  4HNU A;  2C5X B;  4EOQ B;  5CYI B;  2BS3 A;  3PO3 S;  1JSU B;  4CFN B;  1GY3 B;  1IRE B;  3VYG B;  1H1S B;  2CJM B;  4F7L B;  2C5V B;  1E7P A;  5EFQ B;  4OB1 B;  3DOG B;  3VYH B;  3WVE B;  4F7N B;  1UGS B;  2DD4 B;  3TNW B;  4M6V A;  2G9X B;  1UNL D;  2CZ1 B;  4HNV A;  3TNH B;  4EC8 B;  1H25 B;  3BLH B;  4BCQ B;  3DDP B;  4CFU B;  1UNG D;  1GH6 B;  2PK2 A;  4HNT A;  2PJQ A;  1QMZ B;  4OB3 B;  3DJB A;  1D3U B;  2C5N B;  2V22 B;  4YOZ A;  1VIN A;  4OB2 B;  1H27 B;  1PKD B;  4IMY B;  4Z6Y A;  2UZE B;  5IDP B;  1V29 B;  5BNJ B;  3QHR B;  3RGF B;  4MFD A;  1O9K A;  4ZGE B;  5HQ0 B;  1UGQ B;  1H26 B;  4BCM B;  1OKW B;  3DDQ B;  4II5 B;  4EOI B;  4F6S B;  5EJC A;  1AIS B;  2ZPH B;  4OGR B;  4EON B;  4NC6 A;  4BCN B;  2AHJ B;  3A8M B;  1H1P B;  4HLQ A;  2C4G B;  1VYW B;  5LMK B;  1JST B;  2QQ8 A;  4F7S B;  4ZGJ B;  3QWL A;  4F6U B;  3MY1 B;  2IN3 A;  4TTH A;  5DQW A;  2BPM B;  4Y72 B;  3QXE B;  3WVD B;  2ZPI B;  1AHJ B;  4BCG B;  4AKI A;  4HL4 A;  4EOP B;  1KXU A;  2B9R A;  2DME A;  1P5E B;  1G3N C;  3BG9 A;  1FKM A;  3A8O B;  2X1N B;  4BCI B;  2DXC B;  1JKW A;  1C9B A;  2EUF A;  1H1R B;  4EOL B;  3H4C A;  1JOW A;  2CCH B;  1OKV B;  3A8H B;  2WIH B;  2WEV B;  3QZ9 B;  3HHT B;  1H24 B;  2W99 A;  3BG3 A;  3QZ5 B;  2JGZ B;  4ROE A;  3X24 B;  4JX4 A;  1OIU B;  1VOL A;  3X25 B;  4UN0 A;  2BKZ B;  2QFZ A;  4KRD B;  2D0Q B;  4FX3 B;  3HZJ A;  4OR5 B;  3HB9 A;  3B57 A;  2WFY B;  2PHG A;  1N4M A;  1H1Q B;  2W96 A;  1H4L D;  4BCF B;  2W2H A;  4FM4 B;  3VKH A;  4EOM B;  1AD6 A;  4AKG A;  4KRC B;  4BY7 X;  1ZP2 A;  4MIM A;  2QDJ A;  5IDN B;  4CFV B;  1GUX B;  2UZD B;  1UGR B;  4YC3 B;  2ZPE B;  1TFB A;  4NST B;  3GTM S;  3BG5 A;  2UZL B;  2CZ0 B;  2CZ6 B;  5FGK B;  2KR6 A;  4BBS M;  3TN8 B;  2WMA B;  1FIN B;  1OL2 B;  4BBR M;  3NDQ A;  3A8L B;  3MIA B;  4F7J B;  2WPA B;  1ENW A;  4EOJ B;  1QLB A;  2CZ7 B;  3F5X B;  3G33 B;  1OI9 B;  2I40 B;  3O0G D;  4ELJ A;  2DXB B;  1E9H B;  4F70 B;  2W9F A;  4EOS B;  2IW6 B;  3KHI A;  4QSH A;  3QYE A;  3K7A M;  4CRL B;  2IW8 B;  3BHT B;  5HVY B;  3TW7 A;  3QYB A;  4CFW B;  3EID B;  4JX5 A;  1XO2 A;  1F5Q B;  2ZCF B;  5IF1 B;  2WIP B;  4ZGD B;  4BCO B;  5ICP B;  2C6T B;  4BCK B;  2QDY B;  5IHY A;  1H28 B;  2WHB B;  4I3Z B;  3MY5 B;  1UGP B;  4AI6 A;  2ZPB B;  2WXV B;  4BCP B;  4ELL A;  3BLR B;  4LOC A;  5HNB B;  3TW6 A;  1BU2 A;  4BY1 X;  3EOC B;  2DPP B;  1OIY B;  2BS2 A;  4EOR B;  5HBJ B;  4ROC A;  3BHU B;  5DQV A;  3QYG B;  1OGU B;  4BCQ D;  5I5Z B;  4CFU D;  1GUX A;  2ZPF B;  3LQ5 B;  3M03 A;  2QGS A;  2ZZD B;  1OL1 B;  5LQF B;  3DL1 A;  1URC B;  3QHW B;  5HBE B;  4EC9 B;  2R7G A;  5ACB A;  2QF7 A;  4BXX X;  3HO8 A;  2DD5 B;  4BCH B;  4ROD A;  2W9Z A;  3HBL A;  2F2C A;  3BLQ B;  4BCM D;  5L2W B;  4EOO B;  4CFX B;  2UZB B;  1UNH D;  4CXA B;  2UUE B;  3VKG A;  4YOO A;  4BCJ B;  4BCN D;  4F6W B;  2G77 A;  4YOS A;  2PMI B;  4OB0 B;  3X28 B;  4CFM B;  3BHV B;  2I53 A;  3EJ1 B;  2LW4 A;  2IW9 B;  3MI9 B;  2C5O B;  3A8G B;  2CCI B;  3POM A;  3X20 B;  1O9K B;  4MFE A;  3QYH B;  4G6L B;  1FVV B;  1TD6 A;  2WMB B;  5HBH B;  4AKH A;  2ZPG B;  5CEI B;  4JX6 A;  4EOK B; 
#chains in the Genus database with same CATH homology
 5HNB B;  4BCF B;  1BU2 A;  1W98 B;  1AIS B;  3EOC B;  4EOM B;  1AD6 A;  4OGR B;  1OIY B;  4EON B;  4KRC B;  2PK9 B;  4EOR B;  1ZP2 A;  5HBJ B;  4ROC A;  2QDJ A;  5IDN B;  3BHU B;  4CFV B;  4BCN B;  1GUX B;  2UZD B;  1H1P B;  1VYW B;  2C4G B;  3TNI B;  5LMK B;  4YC3 B;  1JST B;  4F7S B;  1OGU B;  2IVX A;  4BCQ D;  2C5X B;  1TFB A;  4NST B;  4EOQ B;  5CYI B;  4CFU D;  5I5Z B;  1GUX A;  2UZL B;  3LQ5 B;  1JSU B;  4CFN B;  1GY3 B;  4F6U B;  3MY1 B;  5FGK B;  3M03 A;  4TTH A;  1H1S B;  2CJM B;  4F7L B;  3TN8 B;  2BPM B;  2WMA B;  4Y72 B;  1FIN B;  2C5V B;  1OL2 B;  1OL1 B;  5EFQ B;  4BCG B;  5LQF B;  1URC B;  3QHW B;  3DOG B;  4EOP B;  1KXU A;  3MIA B;  4F7J B;  2WPA B;  5HBE B;  2B9R A;  4F7N B;  1P5E B;  4EOJ B;  1G3N C;  4EC9 B;  2R7G A;  2X1N B;  3TNW B;  3F5X B;  5ACB A;  3G33 B;  4BCI B;  4BCH B;  1OI9 B;  2I40 B;  4ROD A;  2W9Z A;  3O0G D;  4ELJ A;  2G9X B;  1JKW A;  1UNL D;  2F2C A;  3BLQ B;  4BCM D;  1E9H B;  5L2W B;  2EUF A;  4F70 B;  1C9B A;  2W9F A;  4EOS B;  4EOO B;  4CFX B;  2UZB B;  3TNH B;  2IW6 B;  1H1R B;  4EC8 B;  1H25 B;  3BLH B;  4EOL B;  1UNH D;  3K7A M;  4BCQ B;  4CXA B;  2UUE B;  3H4C A;  1JOW A;  3DDP B;  2CCH B;  1OKV B;  2WIH B;  2WEV B;  4CFU B;  1H24 B;  4YOO A;  2W99 A;  4CRL B;  2IW8 B;  4ELL A;  3BHT B;  4BCJ B;  1UNG D;  1GH6 B;  5HVY B;  2JGZ B;  4BCN D;  4F6W B;  4YOS A;  2PK2 A;  2PMI B;  4CFW B;  3EID B;  1QMZ B;  4ROE A;  1XO2 A;  1F5Q B;  4CFM B;  3BHV B;  5IF1 B;  1D3U B;  2I53 A;  2WIP B;  3EJ1 B;  2C5N B;  2V22 B;  4YOZ A;  4BCO B;  1VIN A;  2IW9 B;  5CEI B;  5ICP B;  3MI9 B;  1OIU B;  2C5O B;  1H27 B;  1PKD B;  4IMY B;  2CCI B;  3POM A;  1VOL A;  2C6T B;  4BCK B;  2UZE B;  5IDP B;  1O9K B;  4UN0 A;  2BKZ B;  4KRD B;  1H28 B;  5BNJ B;  2WHB B;  3QHR B;  4I3Z B;  3RGF B;  4FX3 B;  4G6L B;  4OR5 B;  3MY5 B;  1FVV B;  1O9K A;  5HQ0 B;  2WFY B;  1H26 B;  4BCM B;  1OKW B;  2PHG A;  1N4M A;  1H1Q B;  2W96 A;  1H4L D;  2WMB B;  3DDQ B;  4II5 B;  5HBH B;  2WXV B;  4BCP B;  4EOI B;  4F6S B;  3BLR B;  2W2H A;  4EOK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...