4OB1B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via co-crystallization
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
total genus 73
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob1B02
1UGPB 4OB1B 1DJ7B 1V29B 3QYGB 3HHTB 3X24B 3VYHB 3QZ5B 3A8GB 2CZ1B 2CZ6B 1UGRB 1AHJB 3A8OB 5L8RE 1GXIE 4OB3B 2CYZB 4FM4B 4Y28E 2AHJB 3A8HB 1UGSB 2DXCB 1PSEA 2PUKB 1QP2A 3X25B 2DXCA 2PVDB 2ZCFB 3LW5E 2WSEE 2DD4A 4RKUE 2ZZDB 2DD5B 2DPPB 3X28B 4OB0B 4ZGJB 3VYGB 2ZZDA 2ZPEB 2DD5A 4OB2B 1QP3A 4KT0E 2CZ0B 3WVEB 3VYGA 3QZ9B 3X20B 4ZGEB 4L6V5 2ZPBB 3X26B 1IREB 2DD4B 2D0QB 3A8LB 2O01E 1JB0E 3WVDB 3A8MB 4ZGDB 2PUOB 2QDYB 1UGQB 2ZPHB 2DXBB 2WSCE 3QYHB 2ZPGB 2WSFE 4XK8E 2ZPIB 3QXEB 2DXBA 2PU9B 2PVOB 2CZ7B 1PSFA 2ZPFB 2PVGB
chains in the Genus database with same CATH superfamily
5HQ0B 4OB1B 3CMAA 1VQKT 1U5SA 4LN2A 1DJ7B 5L2WB 3O8VA 5LJ3e 3VYHB 1NPRA 3TREA 1OEBA 4AKIA 3VKGA 4ROEA 2IW6B 5KYYA 4E7IA 2Y90A 2DILA 2O4XB 1YIJT 1KHCA 3MEAA 2CP2A 2DXUA 2EKHA 4IKFA 1F5QB 4J7FA 5A0LA 4PFZA 1JQQA 3VUZA 5CCAA 1JJ2P 2X3WD 2CYZB 4PL6A 3HL8A 4LD6A 1OULA 2V22B 2JS0A 4PJOC 2OTLA 3Q1JA 1RI0A 1YFNA 3QHSA 4C0DC 3HTRA 3QWYA 4M7DE 1PSEA 3ZEHA 1MMGA 4XU2A 2CSQA 2UZBB 2GFUA 1QVGP 1X43A 2GGRA 3SD4A 3OMGA 1OU9A 3OS0A 1YI2Q 1ZUUA 4G6LB 2DRMA 3JCMV 2H8HA 1C1AA 2EYQA 4J6WA 3GOXA 1AT1B 4RG2A 2L89A 4M78C 1IHWA 5DQVA 2AK5A 2PHGA 1TOVA 4C5HA 3KFVA 1P92A 1H1SB 5BNJB 2B8AA 3X26B 1ZHIA 3I5RA 2YUPA 2Z0WA 5IHYA 3QDFA 4OP0A 2EQJA 2OX7A 4OGEA 2DBKA 4BY6C 3TNWB 4KULA 1LPLA 1KK7A 4M7AB 2OI3A 3I9QA 3G4SQ 4N0AC 2DYIA 2LJ1A 2YDLA 1VQPT 1YWPA 2RNAA 5GAN4 1H27B 1CKBA 5LJ5h 4XK8E 3FEOA 2DXBA 2HNIA 2RQWA 2EYYA 2X4XA 3I35A 3H0FA 2MPXC 1UGPB 2M0OA 1YITA 2WMAB 1XNIA 3CCLT 1K0XA 9ATCB 1I4K1 3G6EQ 3X24B 2VWFA 1UB4A 1VQ8T 1K0SA 2E41A 3CCQA 1VQ7Q 5AYFA 1Y96B 1PM3A 3CCMT 2LCLA 4QT7A 5GANh 3RUXA 2X4YA 2O4XA 4M77C 4GY5A 4PJMA 2KYMA 1SHGA 2E4HA 4M75C 2KI7A 3JCMX 3UA6A 1BCOA 1WXTA 1WHKA 2R58A 3F70A 2K2VA 4PNOA 1X2QA 3ASKA 4RTUA 5GMKm 5J26A 3MI9B 4Z6YA 2H3JA 1D1AA 1PRMC 4IUPA 4DBHA 2NWMA 2KT1A 5FROA 2VGMA 1Z9QA 4EMKB 4BCQD 1QCFA 4IMYB 2HD0A 1OIUB 2K3XA 3TW7A 4HXJA 3CCST 5KCOA 4HT9A 2JZ2A 4E6RA 5I22A 3OYJA 2QDLA 4CFWB 4A53A 4QKUA 4BCFB 2BE7D 1TUGB 4BCHB 2E6ZA 5D7UA 4F7UE 1WDXA 4NSTB 1X27A 3TNIB 1KXUA 2D0QB 4KGVB 2LJ0A 1WPYA 3S3NA 1YJNQ 2M1HA 4MMLA 3BLHB 2KNBB 4KUDK 4PJJA 4JX5A 4MZPA 2YSQA 1U1SA 3QBYA 2QXFA 2LQKA 1WQ7A 3L2WA 2K5FA 1JOWA 1Q86U 2MMPA 4M7AA 1AWWA 2CDTA 3ME9A 4EOLB 1TSFA 2ZPIB 3DL1A 2CZ7B 1H641 1YJ9Q 2EUFA 1M8MA 1YP5A 4C92B 2QQSA 1E6HA 2JTFA 2O2OA 2CT3A 2KQWA 3BE3A 3A98A 4JRPA 2CP6A 2M0YA 4J9EA 4AKGA 4BE1A 1NYFA 1QKXA 1W1FA 2JS2A 4JS4A 2RB6A 4JJNK 1Y96A 3QWXX 3CMAQ 3DOGB 1YI2T 1VQ6A 1QVPA 2B86A 4ANJA 2RF0A 5L8RE 3QJYA 2XI9A 3M57A 3VS5A 2CP5A 2UUEB 1XQHA 4LDXA 5IXBA 3CC7A 2L3RA 4DQ2A 1ACMB 3FC3A 1SSFA 1XJWB 1G8XA 3OYBA 4D8DA 3TU4K 2IPOB 2HBWA 3M56A 4XAXB 4EOIB 3RMQA 2PTKA 5IXFA 1FKMA 1URCB 1M5Q1 4WTOB 4OMNA 4M7AF 2LNVA 1OL1B 1ZX6A 2K5LA 2QA4A 2SRCA 1OI9B 2BKZB 2DD5B 4F7UG 1UUEA 2F2XA 2OTLQ 2VV5A 4EMKA 3QDRB 1PC0A 5HVYB 2YUNA 1RAFB 2HQXA 2EAYA 3RMSA 2D1XA 2DL3A 2FG0A 2C0TA 3R6OA 5LJ5d 3OW2A 3CD6A 5CKHA 1Y57A 2LDMA 1WJQA 4XTWA 2QQ9A 4E47A 3NTHA 1Y07A 2X51A 1G83A 1PKTA 4HCCA 4FW2A 4CFMB 2EWNA 3CCRA 1XO2A 3OYMA 2Y4XA 1JBMA 1VIFA 2DMEA 4M7AD 1R0CB 1KQSA 2ZPGB 3BHVB 1BBZA 4YOOA 2V26A 1AOJA 2KRMA 3V7SA 1FVVB 1RAHB 2KY9A 1KIKA 3H6ZA 4EOMB 4R56A 2DTHA 4C92A 1VQ5A 3REBB 4F7SB 1W4SA 4BI3A 1QLBA 5ECAA 2RJFA 4PJOE 4PKCC 1U8RA 2GCXA 4ZTJA 3VS3A 3MKDA 4MDWA 1YITQ 2WFYB 1I5LA 2M51A 1Q82U 2LQWA 2A3LA 1KD1U 5FWCA 1UEBA 1H3ZA 4AI6A 3CCQQ 1ZSZB 3M59A 1S1NA 4JLGA 3QKJA 4Y91A 4RTWA 2FVUA 2R5AA 4Y28E 2LC4A 4Y92A 2COWA 1VYVA 1UGSB 1WGSA 3M5AA 3CMEA 3GP8A 1YJNT 2PK9B 1TD6A 2DXCB 3NTKA 3CCUQ 1TH7A 1PKDB 2IN3A 3EFOB 1OI1A 1VIEA 2F69A 2UZEB 3QUIA 3JCMh 3E9GA 5GAN8 4EORB 1SPKA 4QQ6A 4OMQA 2ABLA 5GJWB 1PRLC 2YRCA 1UJYA 1WHJA 2DD5A 3EG3A 5I2MA 4C92F 1YJ9T 3OYHA 2E5QA 2MK5A 1OZ3A 2RI3A 3VU3C 3OYNA 1WYXA 1CSKA 3E19A 1Q7YU 1VQ9A 2DL5A 4FX3B 4F7JB 2IW8B 4LE9A 3L42A 5FWBA 2RI5A 2PJQA 1WLPB 2PMIB 4O5VA 4AFQC 4C0FA 1HD3A 1TU0B 1GFCA 2DEUA 2J6KA 2KRSA 3S3OA 4JRKA 2WEVB 2LNHB 2KK4A 3CMAT 4DEYA 1VYUA 1X2KA 3LGLA 5HK3A 5DY9A 3JCMQ 1MV3A 2LVMA 5LJ5j 2KE9A 2HQEA 2GFAA 3CCEA 3G4SA 4PJOG 2PU9B 3LWHA 1AZGB 2RHZA 4M75E 1HK9A 2NUTB 4NC6A 3BG5A 4Z02A 4C92D 5FU6B 1RAAB 3RKYA 2MCNA 1JU5C 1PG5B 2OTJA 1ZA1B 3OW2S 1NYGA 2W2HA 2QGSA 4HNVA 1MGQA 1N9RA 3GNFB 1TUCA 4WF2A 5GMKe 2BS2A 1ZBJA 3G6EA 2MWOA 4F7LB 2YRDA 3A5ZB 4V2SA 1Q7YR 5GANj 1H28B 1QMCA 2F5TX 2DKGA 3FLGA 4HVUA 4RCCA 2QASA 3T9NA 4A4FA 1N8RC 2OTLT 3SHWA 4N4HA 2E65A 4IUQA 3VS0A 4E7ZA 2DFUA 1KQSS 2CKKA 1QWEA 1EZZB 2QI2A 2K3YA 2HL3A 1XTDA 2QDJA 1G2BA 2EVRA 3BDUA 1ZLMA 2JJ9A 5KYYB 2MAMA 1ZSZA 2A37A 2CCIB 3VV0A 1NEGA 2RHUA 5GAMh 1FMWA 1GCQA 1LVKA 4HCZA 2RHIA 2CP3A 2DXCA 2WIPB 2L3SA 3EFSA 2ECZA 3CC7Q 4MZTA 3EFOA 2VXEA 4P5NA 2AIRB 2EYWA 1MHNA 5DLQE 3RESA 4EPCA 2ZPEB 5HBEB 1UHFA 1TS9A 2L3QA 2CH4W 2DL8A 4IUVA 4FYXB 2ROLA 3C0CA 4OMLA 2E70A 1IREB 1G3WA 3PT9A 3MEUA 3B57A 1X6BA 2SEMA 4EOKB 4ZN1A 2YLCA 4M75G 3OS5A 3VUBA 1NZ9A 1UFFA 1YITT 3UWNA 4JJCA 1H24B 2DIGA 1KQ2A 2HKNA 3HSBA 1KHIA 1FX7A 3CD6Q 4ROCA 2V1QA 4M7DA 2DZ9A 3CCQT 4ELYC 3EH1A 1D0ZA 4RTTA 2BUDA 1JXMA 3CCRQ 1R8OB 4Z88A 4Z89A 4XTXA 4MIMA 3HHTB 2NUTA 3S3MA 2BIVA 1K73R 1VQOA 3CC2A 3A8GB 4MZMA 1G5VA 2BTTA 1FXXA 2GTOA 2D0NA 3HRSA 3LWIA 1WHMA 3VRZA 5ICPB 2CZ6B 5CIUA 5IHNA 3OYEA 4MFEA 1VQ5Q 3A8OB 3H0IA 4L5GA 2FZGB 4HNUA 3CCVA 2DVEA 1GXIE 2P4TA 3UT1A 2W9ZA 1SRMA 1OQKA 3J80E 3LQ5B 2L5QA 3JCMd 2C5NB 5I21A 1RABB 3M03A 5LJ3h 5GMKi 1VQMA 2LZ6B 4CC2A 1M1KR 1C0MA 2KROA 3BG3A 3DKMA 4M7AC 2FZKB 5A0GA 4C8QB 5C6SA 1QVFA 4DA4A 4C5EA 1NM7A 2FPFA 1AWJA 1QP2A 1Y7XA 3PO3S 2RJDA 4HCKA 2VUBA 4C0GA 2DAQA 1IZ6A 3CMEQ 2ED1A 3L2QA 4NS5A 3HO8A 1RAGB 4ZGEB 4E7HA 1D3UB 2RD1A 2DL4A 3QYEA 2F1LA 2QGFB 2LTOA 2L0AA 3QJ6A 1VQLA 2C4GB 2MI6A 2VC8A 1VQ9Q 4J7IA 1YBYA 2DXTA 2RM4A 3PVLA 4A4KA 3CXCA 1U3OA 2ROTA 1NJIU 1W2BP 3JB9H 4Y72B 1Y0MA 4PJNA 3I55A 3QYGB 1PD1A 5KH6A 1VQ6T 1K9AA 4J9IA 2YT6A 2GQVA 1QQJA 1H1PB 2EPDA 1TUDA 2KXCA 2ESWA 3CCEQ 4IIOA 2DEQA 2CZ1B 1OL2B 2CS7A 4QVZA 4X34A 3CC7T 1BIBA 3DDQB 1BK2A 1WHLA 2EKOA 4L59A 2XDBA 3EGUA 2R57A 1UGRB 2RA2A 2AKKA 2NLUA 2E10A 2OTJQ 2LT1A 4MMKA 5CQYA 2MF2A 3CPWP 4OMMA 3L2ZA 3M0PA 4BUGA 1T0JA 1M30A 2XU8A 3GLXA 2QA4T 3META 3NPFA 1WHGA 4JX6A 2YUOA 1YNZA 1B7TA 5GAN2 3EG1A 1AZEA 1LNXA 3QWLA 2DIQA 3MO8A 4BY7X 3LW5E 1UG1A 2A28A 4C8QA 3CCJA 1NJIR 2HL5C 3CCUA 4HT8A 3QSUA 2DTIA 1BI3A 4LDVA 4RODA 2QGGA 1OX9A 3HRTA 3CD6T 3OYAA 1D09B 4C0DB 2P84A 2LQ8A 4HLQA 2QEXQ 1I0CA 3A1PA 2VXFA 4OB2B 2I40B 4X9CA 2VGNA 4CRIA 4QVCA 3ZFJA 3CCRT 1EIFA 5J3BA 1YJWA 7AT1B 5LJ5g 3NTIA 1ZUKA 3H9NA 2E1HA 4XTYA 2R5MA 3V7CA 3M0TA 4EIKA 4GLMA 4ELZC 1VYWB 4FSXA 4OGCA 3HB9A 2YWWA 4M78B 3IQLA 1QVFS 1F1BB 2VKNA 2CCHB 4GBQA 1NPPA 2DL7A 1PWTA 2WPAB 3K7AM 1YCYA 2BZXA 1VA7A 2HSPA 1VQ5T 3MIAB 1MUZA 3L2UA 1RACB 2RI2A 4CFUB 2G6FX 5DLOA 5GANg 1Q86C 1GRIA 5A2QE 5GAOl 1SRLA 3V8KA 4PFPA 4CI0C 1RI9A 4C8QF 1YN8A 4XTVA 4QVDA 3G7ZA 3TW6A 3NDQA 5LJ3d 2FHDA 3EH2A 1K9MU 4TTHA 2DBMA 4B9WA 4LXCA 3HKSA 3EIDB 8AT1B 4BCPB 2VASA 2LW4A 2EQMA 5LMKB 4I3ZB 3CMET 1WXUA 3OMCA 2YLBA 3V8JA 2COZA 2LT4A 1VQOQ 2JM8A 2QTVA 3CC2Q 3LH0A 2E64A 3CXCS 5FRNA 4XQ3A 4O6JA 4NOYA 1NEBA 5CAIA 4A63B 5KCHA 4M77B 4AG1C 5HK0A 3U23A 3QO3A 5GAMj 3LYIA 4M4ZA 2QQ8A 4BCOB 1LOJA 1ZUYA 4C8QD 3CCVQ 1K1ZA 2HEQA 4XU1A 1UE9A 1VQ9T 2F2WA 2DD4A 1WJRA 2E5KA 1SSHA 3P8DA 4A4HA 5KE2A 2A7YA 4PLLA 1VQMQ 1H1RB 4MDXA 4JJDA 3I56A 1I5OB 1M2VB 1BU1A 5HBJB 3RBBB 4J9BA 2WXVB 1K9MR 3G71A 1RLQC 3CPFA 5CVIA 1VQ4Q 1H4LD 1PNJA 1I07A 5FU7B 4EDUA 4AFZC 5KYUB 2DNUA 3CCET 1HYOA 2IVWA 3G4ST 1MV0B 1VQPA 3OYKA 5GAN5 4CXAB 2DMOA 2XK0A 1OKWB 4J9CA 1XOVA 1QVGA 2O9SA 2XHCA 3URGA 4M78A 4BY1X 2P4RA 2DJZA 2O88A 1ZSZC 2OTJT 3TCJA 1P5EB 4RTVA 2DERA 2A08A 3BG9A 2C5OB 2O31A 1OKVB 3H41A 3NHNA 3G6ET 1OOTA 1BB9A 3C4SA 2PVGB 1AVZC 2ENMA 3MP8A 1VQ7T 1VQLQ 3JAME 2JGZB 1H3HA 1ABOA 4YOZA 2CP7A 2K4YA 4N0AA 2RPNA 1GCPA 3EG0A 5I11A 5CKBA 1V1CA 1O9KB 4M7AE 4II1A 2DZCA 4D6WA 5CQXA 4C5GA 1GBRA 3JCMf 4JLIA 3M58A 3I55Q 2A0FB 3HFOA 3RDVA 5FLXE 1VOLA 5GANd 2HDAA 4JRIA 2RQTA 2HAXA 4DBQA 1AWXA 1BYMA 1Q82C 1JXOA 2BKDN 4QQDA 5LJ3j 4BCGB 1BCMA 1KD1C 4XU0A 3QYBA 1GL5A 4LDUA 4EOQB 4M78F 4JZ3A 4M77A 3JB9F 4RUGA 1JO8A 3V7RA 4M6VA 5D6WA 1JKWA 2LRQA 4RKUE 4LUEA 4DOVA 4CFXB 3PIPA 1C6VX 1OV3A 2QYZA 2W0ZA 1QP3A 3TNHB 3SFMA 2CZ0B 2E3IA 2V8JA 1PHTA 1M2VA 3CCJQ 4LD9K 1M2OA 1I81A 3VS6A 3M4YA 4BDZA 2C5XB 3BHTB 1Q7YC 2KAFA 1Q81U 1JSTB 2YUQA 5KYUA 1QCOA 5GAOr 1IB8A 5DM7R 3JB9D 2W9FA 1B34A 1E7OA 1MNDA 2RK2A 2GTJA 1QVFP 4C5IA 1C9BA 1YJWQ 4LOCA 1VQOT 2GF7A 4E7LA 3CC2T 2MIOA 1KFZA 1LCKA 3OSSC 4FCYA 1NE8A 4KRCB 1TG0A 3JCMe 4M7AG 4M77F 2W10A 4F6WB 1WNLA 1WX6A 1X69A 3EG2A 1HJDA 2KMTA 5HKCA 2HKQB 2KYBA 1I8FA 3CCVT 3INZA 1K8AU 4M7DB 1RL2A 4PJLA 1N6AA 1YHQA 1M3AA 1QVGS 1O9KA 1PCXA 1VQMT 3JSCA 1D1CA 4HNTA 1VINA 1TXQA 2GNCA 1T3SA 2RJCA 3FIFA 1WI7A 1N5ZA 3PFSA 4C92E 1Q81R 2OJ2A 3VS7A 2K2MA 2K5IA 3SWNB 4JS5A 1I1JA 3JCMg 2UZLB 2F2VA 2FRYA 2K9GA 2G77A 2C6TB 3KUFA 1D0YA 3CXCP 3QIIA 4M77D 4ESRA 3AHUA 5GMKh 4DBRA 3DLMA 3GPLA 2J6OA 4PLIA 4BDYA 2EIFA 4EOJB 3RIRA 4J8OA 1BI1A 1KC8C 4YOSA 4F14A 4PK4A 1EFNA 3TSZA 2D8HA 1RADB 1K8AR 3FB9A 4BB7A 4KT0E 2QEXA 3WVEB 3OYDA 1VQLT 4ZTFA 1G3SA 5IHKA 5IF1B 3TEEA 2HMAA 2AZVA 2FYKA 4GLKA 4Z8AA 2C0OA 3I56Q 2DVJA 2K57A 2DX1A 3F5XB 1Z9ZA 1KG1A 1K73U 4AG2C 4F6UB 1U06A 3G71Q 1UNLD 4HA8A 5HY6A 1SF9A 3ULRB 4JUVA 3VRYA 4OR5B 3ER0A 5GMKl 2D8JA 1PSFA 4LDYA 4N4IA 1VQPQ 1H92A 3CBPA 4C8QC 1OGUB 3MEVA 1M90U 4OF1A 1MNEA 2LX7A 1W98B 2HZYA 3E9FA 1BU2A 4BCNB 3HPWA 2EGAA 4D8KA 4C92G 2DE0X 4UN0A 4FL6A 1FMVA 1M1KU 2EQUA 2LQNA 2BZYA 2R7GA 4J5YA 5GAMg 5IAYA 2H3EB 2JN0A 3MPUB 1MMDA 5EG2A 1H1QB 1K76A 2WACA 3PMIA 3EFRA 3OSVA 4BCQB 2WHBB 5GAOq 2K3BA 1IGUA 3OYGA 1D3BB 3EHQA 3CCJT 3OBWA 4OB3B 4BACA 3MCAB 3CCUT 3SWNA 2RHYA 3MJXA 3NMZC 1N8RR 3HRUA 3KHIA 1OPLA 3JCMP 3OYLA 2LP5A 4F7UB 4CC7A 4EOPB 4OMPA 2ZAEA 1D1BA 4EOOB 2EW3A 2ZCFB 2PVDB 3DB3A 1YJWT 3PTAA 1M90R 2CT4A 3L1AA 5CEIB 3NFCA 4QQGA 2ZZDB 2IIMA 2QG9B 2E12A 4DOWA 3O5ZA 1QKWA 3VYGB 1S72A 3OBYA 1VQNA 4R0KA 5FW9A 3D7SB 2JOYA 5GAN7 3PVQA 4BCJB 3CEYA 1RLPC 4BCIB 3CCSQ 1ZQ1A 3OB9A 4RTZA 2IVXA 1JRIA 3EG9A 2X3XD 4FYYB 1GUXB 3FJPA 1M3CA 4J9GA 4M7DF 5I2SA 3A8MB 1VQ4A 5ACBA 4DBFA 2C5VB 4HCBA 2EJFA 2X35A 3S6WA 5LJ5f 1GBQA 1ZA2B 1UGQB 2D9TA 2V8KA 3HZJA 4R55A 5KYNA 2AZSA 2RH2A 3UDCA 3H4CA 3KXTA 5AT1B 2PVOB 4KRDB 3HP9A 3DTOA 2JXBA 2DO3A 2DTOA 2EGCA 1ABQA 3GNGA 3CC4A 4NL2A 1TFBA 1OZ2A 3C95A 4B9XA 3RGFB 1ZSGA 2YXYA 1NJIC 2J7IA 5GJVB 3J81E 5GANf 3UA7A 1JEGA 5LJ3g 4KGZB 4RMOA 4M7DD 2Y4YA 2X1NB 1SHFA 5CK9A 2NUPB 4UC4A 3FJ5A 1WJSA 2RO0A 3EGDB 4HVWA 1R77A 2J05A 2XG8D 3VKHA 2JMCA 3BLQB 3OS1A 3O0GD 5M9OA 4BXXX 2DLPA 2KXDA 1AEYA 1IXDA 4AMCA 2DRKA 2P0PA 1YHQQ 3JCMb 1KJWA 4BBRM 3JCMc 2AHJB 3A8HB 1D3BA 3VS2A 4EMKC 4LUDA 2WIHB 4ELLA 1T3LA 4II5B 1TWBA 3OW2P 2E6NA 3THKA 3I56T 2PZ1A 2PUKB 1K4US 2EQKA 5GAMd 4F7UA 2RQUA 1IO6A 2VB6A 3LH5A 3OQ5A 3G71T 1AWOA 3PGGA 3M0SA 4RG8A 5FRMA 1QWFA 4OB0B 2CUBA 1HSQA 1KQSP 2ZZDA 1W70A 4F6SB 5LJ5e 2LCCA 3C94A 1T0HA 3PE0A 3VYGA 3FDRA 2XICA 2KMGA 1BKBA 2LJ3A 2DYBA 2O9VA 5EFQB 3C12A 4F16A 3OA6A 3QHRB 4HKEA 2W96A 1V76A 1ZBXA 2DD4B 4JRQA 3BLRB 4C0ZA 3EJ1B 1GUXA 4A4GA 1CKAA 1UNGD 1M1FA 2IG0A 4PJOB 3SDZA 3L2VA 4C92C 1BI2A 5D6YA 3LX7A 1R0BG 5GANe 4E2FB 1QMZB 3QYHB 5CKFA 5EC7A 1VOMA 2GQIA 3QXEB 1Y71A 4BD3A 3KBGA 4ME7A 2JUFA 2RK1A 4M7DG 2HSEB 1UGVA 4J83A 3RKWA 2QF7A 4F7UF 1PKSA 3MY1B 2CP0A 2P0QA 4EMGA 3UATA 2K6DA 2COYA 4BCND 3UPUA 2F2CA 4BI8B 2DA9A 1VQKA 3PMTA 4PFOA 1GFDA 4XTZA 3M0UA 1NLPC 3N5BB 3CQTA 1ZP2A 3TSWA 5LQFB 4BY6B 5FGKB 2NUPA 3P8BB 1K9MC 3GTMS 3EGDA 3OYYA 2HQHA 1N4MA 4A54A 2JW4A 5FU7C 4AFSC 5GAOn 3JCMJ 1YIJA 4BBSM 4F70B 4HVVA 1MMAA 2DJQA 4J9DA 1IGQA 2X4WA 4BCMB 1BIAA 5GMKj 2KBTA 3DB4A 1D0XA 4EOSB 2QQAA 4RTXA 2G3RA 3AT1B 2W99A 4J6YA 1FINB 1BI0A 2KSSA 3MY5B 2PNIA 2RQVA 2C06A 2XD0A 2FEIA 3P8HA 2EYXA 5J39A 2WSEE 3OY9A 4FW1A 5IHIA 2I0NA 2QK0A 3RKXA 3POMA 1NLOC 2DPPB 1AISB 4F7NB 4ZGJB 4KRTA 5KYXB 3GF5A 4FT2A 2DETA 5HNBB 3JCMW 3DJBA 5I5ZB 1X6OA 1OU8A 3ZBDA 3G33B 2QFZA 2JNGA 2XDPA 2FO0A 4M75B 8ATCB 1E7PA 3GBQA 4C8QE 4CC4B 3I5SA 3WVDB 1S72Q 3H8ZA 4YC3B 1UJ0A 1VQNQ 1FMKA 2HBPA 3REAB 5CR2A 1M4ZA 4J9FA 2QDYB 2QTXA 4PJOA 4CFVB 4EONB 2NYSA 4JX4A 1A0NB 1H8KA 1JJ2A 2RJEA 3BHUB 2FPDA 1VYTA 1N27A 2KR3A 3OYCA 4J6XA 4ATOA 2EYZA 5D6XA 2EQIA 2MWPA 4MFDA 4XTUA 1YHQT 1B07A 3V8LA 2RQRA 1QLYA 1V29B 1B34B 2KR6A 2CUDA 4FIBA 4OMOA 3ZL7C 2BS3A 2AKLA 1WA7A 3QZ5B 3DDPB 3MEWA 3CBMA 1Q86R 1ENWA 1OPKA 2CSIA 4HL4A 3BFMA 4CC3A 1TTHB 5IDNB 3CCLA 1OIYB 4IURA 3JB9J 3CC4Q 1RAIB 4E7SA 1VQ8A 1YWOA 1GCQC 2A36A 3WXMB 2J06A 1WXBA 1RUWA 1UNHD 3MHXA 4FSSA 1W2BA 2MYSA 3CCMA 4FM4B 4A4EA 4X9DA 2XMFA 1M3BA 4KGXB 1VUBA 2L2PA 5CKEA 4PJOF 3BW1A 1U1TA 2EBPA 4F04B 2LMJA 2QEXT 4LDWA 3EHRA 2LX9A 3EAEA 3M4GA 2BS4A 4C8QG 4LNPA 2D6FA 3CPWA 3M55A 1LJOA 1GH6B 5EJCA 2CJMB 1WQWA 5KYXA 2L8DA 1X75C 2BPMB 1UDLA 4L6V5 2P0KA 4M7DC 2RMOA 5GAN6 2PQWA 2HCKA 4M75A 1M9SA 4JDSA 3CCSA 2I2LA 2FB7A 4ZGDB 5A0DA 4TVRA 2M16A 3H0HA 5DQWA 4PJOD 1SEMA 4IIMA 2NUZA 5IN1A 4OMFB 5FU6C 5LL6S 1Q81C 4KH1B 3SWNC 4ELJA 4ZNXA 2FPEA 1Q95G 4IUTA 5IT9E 3J7AF 2WSFE 2IW9B 4ORZA 1RAEB 3OYIA 2ZPFB 3PNWC 1WHHA 5GAOp 2LCSA 2WMBB 2JMAA 1PD0A 3EGXB 1AD6A 3R6NA 4KH0B 3TN8B 1OYXA 4M78D 4OVAA 3VS1A 4M78E 3MP1A 2VVKA 4N4GA 4AFUC 2KGTA 2JM9A 3UF4A 2EGEA 1X01A 1OX8A 5HCKA 4E7JA 4EC9B 4CRLB 2QQRA 2G9XB 5KYWB 2KDSA 2EJ9A 1K8AC 4B6MA 4EC8B 1AHJB 4CFUD 2XIDA 3OS2A 3JRZA 1JJ2S 2I53A 3QG1A 4ZN3A 2L3PA 4M75F 4QSHA 5GAMf 1G3YA 4E7KA 2ED0A 3LGFA 1VQKQ 1YI2A 4J9HA 1WZOA 4BE2A 4BCMD 2WJ9A 5GAOm 1S72T 1VQNT 2KVQG 2JVVA 3VKIA 1Q82R 1QCNA 2E3HA 3M54A 3M9QA 2X9HA 2YRVA 3X25B 3G1JA 1O75A 1YCSB 3PIOA 1KD1R 1YIJQ 4FU6A 2ATCB 3HBLA 4DEXA 2FL7A 3JV3A 5KE3A 2JT4A 2V8IA 3VJPA 3FRNA 1SG5A 1O9SA 1AD5A 5C0MA 3RNJA 4XU3A 1VQ4T 1IHVA 4VUBA 3QZ9B 3X20B 4M77E 2CREA 1W2BS 2K7AA 2J6FA 2UZDB 2JTEA 4M75D 2KEAA 1KSWA 3JB9I 1MMNA 5IDPB 3A8LB 1UHCA 2O01E 1JB0E 2AT1B 2EJGA 2PUOB 2M9UA 4F17A 3DLLA 2ZPHB 3RERA 4JZ4A 2MOXA 2YHTA 3CC4T 1HXDA 3CBOA 1H25B 4QW2A 4M78G 3EOCB 3EG9B 1M1GA 1K73C 1VQ7A 4IUUA 2JTMA 3CPWS 3JB9G 1M27C 2XKOC 1J3TA 1G3NC 2CH4A 2X4JA 1NG2A 2C0IA 3GIBA 4JPBW 4CFNB 1FYNA 3BY7A 1H26B 4X1VA 3EGXA 3TQ7P 5GAMe 1KQ1A 1SKUB 5CKDA 1M90C 4AKHA 1UECA 4FT4A 3I55T 1N8RU 1VQ6Q 4RCBA 4OGRB 1E9HB 2BZ8A 3E2UA 3M53A 2GBQA 1KC8U 1WFWA 3E1SA 2KT8A 3NGPA 3QPHA 2QQBA 4FYVB 4NL3A 2DF6A 1EX4A 1M1KC 5KYWA 2FZCB 5LJ3f 1UTIA 1E6GA 3TVTA 4BI4A 2VYTA 3RR6A 4RTYA 2B9RA 1B3QA 3MP6A 5GAN3 3CCLQ 4K11A 5L23A 4KBMB 2OAWA 3HFNA 4JJBA 1VQ8Q 2QA4Q 3SB2A 5CYIB 4M77G 1GY3B 3CCMQ 5HBHB 1FWZA 1WIEA 3X28B 2RN8A 1QW1A 1JSUB 2XDDA 3QHWB 1YJNA 2KRNA 2DM1A 2F5KA 3BDLA 6AT1B 4AT1B 2RHXA 2QAZA 2OAUA 2M02A 4Q5WA 1KC8R 3LLRA 3VS4A 2BE9B 4FYWB 2ZPBB 1NBEB 3L2RA 2K79A 4WCIA 4EMHA 1M8VA 1X6GA 1YJ9A 5CO7A 1G3TA 2FRWA 5IH2A 1ARKA 2CGHA 2DK3A 2PK2A 4BE0A 3OYFA 3M0QA 4YTLA 2DXBB 2WSCE 2V1RA 2ZGWA 4KUIA 1IRXA 1N9SA 3M0RA 3SEMA 4BCKB 2EFIA 1W6XA
chains in the Genus database with same CATH topology
1HK9A 4OB1B 4NC6A 4M7DG 3BG5A 4Z02A 3MP8A 3CMAA 1DJ7B 4C92D 5FU6B 4J83A 3RKYA 3RKWA 1VQ7T 3JAME 2QF7A 4F7UF 3O8VA 5LJ3e 2OTJA 3VYHB 3OW2S 2K4YA 1N9RA 4HNVA 1NPRA 1MGQA 2P0QA 3GNFB 4AKIA 4N0AA 4WF2A 3TREA 3VKGA 4EMGA 5GMKe 2BS2A 3G6EA 4E7IA 5CKBA 2MWOA 2Y90A 3UPUA 4M7AE 3A5ZB 4BI8B 4V2SA 2O4XB 4II1A 1YIJT 2DZCA 1VQKA 3PMTA 4D6WA 5GANj 5CQXA 4C5GA 1KHCA 2F5TX 3MEAA 3JCMf 4JLIA 4XTZA 3M58A 2DKGA 2DXUA 3FLGA 4RCCA 3N5BB 3T9NA 4A4FA 1N8RC 2OTLT 3HFOA 4N4HA 2E65A 4IUQA 4BY6B 5FLXE 5GANd 4IKFA 1KQSS 2CKKA 3P8BB 2QI2A 4J7FA 4JRIA 5A0LA 2K3YA 1K9MC 3OYYA 2HAXA 1G5VA 1XTDA 2QDJA 1BYMA 1Q82C 3VUZA 4A54A 5FU7C 3BDUA 5GAOn 3JCMJ 5CCAA 1YIJA 2BKDN 4QQDA 2CYZB 2MAMA 4BBSM 5LJ3j 4PL6A 3HL8A 4LD6A 1KD1C 3VV0A 2X4WA 4XU0A 3QYBA 1BIAA 2RHUA 4LDUA 4PJOC 2OTLA 5GMKj 3Q1JA 1RI0A 3QHSA 3DB4A 4M78F 4C0DC 5GAMh 4M7DE 4M77A 2QQAA 3JB9F 2G3RA 1PSEA 4J6YA 3ZEHA 1BI0A 2KSSA 3V7RA 4M6VA 4XU2A 4HCZA 2RHIA 2DXCA 2C06A 2XD0A 3P8HA 5J39A 2WSEE 3EFSA 2GFUA 5D6WA 3OY9A 2LRQA 4MZTA 4RKUE 3RKXA 2VXEA 3SD4A 3OMGA 4P5NA 2DPPB 3OS0A 3JCMV 1MHNA 4DOVA 5DLQE 4ZGJB 3RESA 2EYQA 3GF5A 4EPCA 4FT2A 3PIPA 2ZPEB 4J6WA 3GOXA 4RG2A 3JCMW 2L89A 1QP3A 1X6OA 4M78C 3SFMA 2CZ0B 2V8JA 3ZBDA 2QFZA 2JNGA 2XDPA 4M75B 4LD9K 4IUVA 1I81A 1E7PA 4C5HA 1P92A 2B8AA 2E70A 3M4YA 3X26B 1ZHIA 1IREB 4C8QE 4BDZA 1G3WA 3PT9A 3MEUA 1Q7YC 2KAFA 4OP0A 4ZN1A 3WVDB 2EQJA 2YLCA 3H8ZA 4OGEA 1Q81U 4M75G 2HBPA 5CR2A 3OS5A 3VUBA 1NZ9A 4BY6C 5DM7R 1M4ZA 4KULA 2QDYB 5GAOr 3JB9D 1YITT 2RK2A 1B34A 2QTXA 4M7AB 4PJOA 4N0AC 3UWNA 4C5IA 4JX4A 2DIGA 1KQ2A 1VQPT 2RJEA 1JJ2A 3HSBA 5GAN4 1KHIA 1FX7A 1N27A 4LOCA 5LJ5h 4M7DA 3OYCA 1VQOT 2DZ9A 2GF7A 3FEOA 4J6XA 4XK8E 2DXBA 2HNIA 4ELYC 3CCQT 4E7LA 5D6XA 3CC2T 3OSSC 2X4XA 2MWPA 1NE8A 4MFDA 4XTUA 3JCMe 1YHQT 4M7AG 2BUDA 1UGPB 4M77F 3V8LA 2M0OA 1YITA 1R8OB 1WNLA 1XNIA 4XTXA 1V29B 4M75E 3CCLT 4MIMA 3HHTB 1I4K1 1B34B 3X24B 3S3MA 2BIVA 1UB4A 2KR6A 2KMTA 1VQ8T 4FIBA 1VQOA 5HKCA 2E41A 2BS3A 3CCQA 3QZ5B 1I8FA 3A8GB 3MEWA 4MZMA 3CCVT 3CBMA 3INZA 5AYFA 1K8AU 3CC2A 4M7DB 1RL2A 1FXXA 1Y96B 1N6AA 1YHQA 4HL4A 3BFMA 3CCMT 3LWIA 2LCLA 3HRSA 3C4SA 1QVGS 5GANh 3CCLA 3RUXA 2X4YA 1VQMT 2CZ6B 4IURA 3JB9J 2O4XA 3JSCA 4GY5A 4M77C 5CIUA 3OYEA 4MFEA 4HNTA 1VQ8A 2RJCA 3A8OB 3FIFA 4L5GA 4M75C 3WXMB 3PFSA 4HNUA 3CCVA 2DVEA 1GXIE 4C92E 2P4TA 3MHXA 3UT1A 2K5IA 3SWNB 4JS5A 1W2BA 3JCMg 3JCMX 3J80E 3CCMA 2L5QA 3JCMd 4FM4B 2G77A 5I21A 5LJ3h 2R58A 4A4EA 4X9DA 5GMKi 1VQMA 3F70A 2K2VA 4PNOA 3KUFA 3ASKA 3QIIA 4M77D 3AHUA 5GMKh 5GMKm 5J26A 3BG3A 3DLMA 3GPLA 1VUBA 3DKMA 5CKEA 4PJOF 4M7AC 3BW1A 1U1TA 4C8QB 5A0GA 5C6SA 4DA4A 4Z6YA 2H3JA 4PLIA 4C5EA 4BDYA 1QVFA 2EIFA 4IUPA 2QEXT 1QP2A 1Y7XA 4LDWA 2RJDA 3RIRA 4J8OA 5FROA 1BI1A 2VGMA 1KC8C 2LX9A 2VUBA 4C0GA 4EMKB 2DAQA 3EAEA 3M4GA 2BS4A 1IZ6A 4C8QG 2HD0A 2D6FA 3CPWA 3M55A 2K3XA 3TW7A 3CCST 1VQKT 5KCOA 4HT9A 1LJOA 2JZ2A 3OYJA 3FB9A 4BB7A 5EJCA 1WQWA 4NS5A 3L2QA 4KT0E 2QEXA 3WVEB 3HO8A 2L8DA 4A53A 3OYDA 1X75C 4ZGEB 1VQLT 4ZTFA 4L6V5 2P0KA 1G3SA 3OS2A 4E7HA 4M7DC 5GAN6 2E6ZA 2PQWA 4F7UE 3TEEA 2RD1A 4M75A 1M9SA 4JDSA 2D0QB 3QYEA 1WPYA 2FYKA 4GLKA 3CCSA 3S3NA 2I2LA 2LTOA 2FB7A 2M1HA 4MMLA 4KUDK 4ZGDB 5A0DA 2K57A 4JX5A 3QJ6A 4TVRA 2M16A 1KG1A 4MZPA 4PJOD 1K73U 1VQLA 1U1SA 3QBYA 2QXFA 2LQKA 1WQ7A 5IN1A 2MI6A 4OMFB 2VC8A 5FU6C 5LL6S 3L2WA 2K5FA 1Q81C 4HA8A 1Q86U 3SWNC 5HY6A 4ELJA 2MMPA 4M7AA 4JUVA 4IUTA 5IT9E 3J7AF 4J7IA 1YBYA 2WSFE 3ER0A 3ME9A 2DXTA 2RM4A 2ZPIB 3DL1A 4A4KA 2CZ7B 1H641 5GMKl 3CXCA 3OYIA 1PSFA 4LDYA 2ZPFB 4N4IA 3PNWC 4C92B 5GAOp 3CBPA 1NJIU 2QQSA 2JTFA 4C8QC 3JB9H 3MEVA 3I55A 1M90U 2KQWA 3QYGB 5KH6A 1VQ6T 4OF1A 4JRPA 2GQVA 1OYXA 4AKGA 4M78D 4OVAA 4BE1A 4M78E 3MP1A 3E9FA 3HPWA 4N4GA 4C92G 2DEQA 4JS4A 4FL6A 2CZ1B 2CS7A 2RB6A 4QVZA 4X34A 2EQUA 1M1KU 1X01A 4JJNK 3CC7T 1BIBA 4E7JA 2EKOA 4L59A 4J5YA 1Y96A 2QQRA 5GAMg 5IAYA 2XDBA 2JN0A 2KDSA 2EJ9A 2R57A 1K8AC 1UGRB 1YI2T 1VQ6A 2RA2A 5EG2A 1QVPA 1AHJB 2WACA 2NLUA 2E10A 2XIDA 3EFRA 3JRZA 3OSVA 3PMIA 2LT1A 3QJYA 2XI9A 3M57A 4MMKA 5L8RE 5CQYA 1JJ2S 2MF2A 4ZN3A 3QG1A 5GAOq 4M75F 3OYGA 1XQHA 3L2ZA 4QSHA 1D3BB 4LDXA 4BUGA 3CCJT 5GAMf 1G3YA 3OBWA 4OB3B 2L3RA 2XU8A 3CC7A 4BACA 3GLXA 3MCAB 3CCUT 2QA4T 3LGFA 3META 3SWNA 4DQ2A 2RHYA 3FC3A 1YI2A 3HRUA 1SSFA 3KHIA 4BE2A 3JCMP 4JX6A 3OYLA 3OYBA 2WJ9A 5GAN2 4F7UB 3TU4K 5GAOm 1S72T 1VQNT 1LNXA 2KVQG 2JVVA 3QWLA 2DIQA 3M56A 3MO8A 4XAXB 3RMQA 3VKIA 1FKMA 3M54A 1M5Q1 3M9QA 4M7AF 2YRVA 3X25B 2ZCFB 2LNVA 2PVDB 3LW5E 4C8QA 3CCJA 1O75A 3DB3A 3PIOA 3QSUA 3CCUA 2K5LA 4HT8A 2DTIA 4FU6A 1BI3A 4LDVA 2QA4A 1YJWT 3PTAA 3L1AA 3HBLA 3NFCA 2ZZDB 2DD5B 3HRTA 4QQGA 4F7UG 2FL7A 2E12A 4DOWA 2V8IA 3VJPA 4C0DB 5KE3A 2LQ8A 4HLQA 3OYAA 3CD6T 3FRNA 2VV5A 1O9SA 3VYGB 4EMKA 3OBYA 3QDRB 1S72A 1VQNA 2VXFA 4OB2B 5C0MA 4X9CA 2JOYA 4XU3A 5GAN7 1VQ4T 2VGNA 4CRIA 4QVCA 3ZFJA 3CCRT 4VUBA 3QZ9B 3X20B 1EIFA 2EAYA 2HQXA 4M77E 1W2BS 3CEYA 3RMSA 5J3BA 1YJWA 5LJ5g 3NTIA 1ZQ1A 4M75D 2E1HA 3OB9A 1JRIA 3R6OA 4XTYA 5LJ5d 3OW2A 3CD6A 2R5MA 5CKHA 3V7CA 3JB9I 3FJPA 4XTWA 2LDMA 1WJQA 4E47A 2QQ9A 4ELZC 3A8LB 3NTHA 4FSXA 4OGCA 4M7DF 5I2SA 3HB9A 1Y07A 2O01E 1JB0E 4HCCA 3A8MB 1VQ4A 4M78B 2EJGA 1QVFS 2EWNA 2PUOB 2M9UA 1NPPA 3CCRA 4HCBA 2EJFA 2X35A 3S6WA 3OYMA 2Y4XA 5LJ5f 1JBMA 1VIFA 1UGQB 3DLLA 2ZPHB 3RERA 2D9TA 2V8KA 3HZJA 1YCYA 1HXDA 2YHTA 3CC4T 4M7AD 1VQ5T 3CBOA 4R55A 1KQSA 2ZPGB 4QW2A 4M78G 2RH2A 3UDCA 1K73C 1M1GA 3L2UA 1VQ7A 3V7SA 2RI2A 4IUUA 3H4CA 2JTMA 3KXTA 3CPWS 2KY9A 3JB9G 2PVOB 3H6ZA 5DLOA 3HP9A 5GANg 1Q86C 2XKOC 5A2QE 5GAOl 2DO3A 3V8KA 4R56A 2DTOA 4CI0C 2X4JA 2DTHA 3GNGA 3CC4A 4NL2A 1OZ2A 3GIBA 4C92A 3C95A 4B9XA 4C8QF 1VQ5A 4XTVA 1W4SA 3BY7A 4BI3A 4QVDA 1QLBA 3G7ZA 2RJFA 1NJIC 4PJOE 5GAMe 5CKDA 1KQ1A 3TW6A 5GANf 3J81E 1M90C 4AKHA 4FT4A 4PKCC 3I55T 5LJ3g 1U8RA 4E7KA 1N8RU 4RCBA 4RMOA 2GCXA 5LJ3d 2FHDA 4M7DD 3M53A 4ZTJA 2Y4YA 1KC8U 4MDWA 1K9MU 3E1SA 4B9WA 1I5LA 3QPHA 3HKSA 5CK9A 2QQBA 4UC4A 4NL3A 1Q82U 1WJSA 2RO0A 2EQMA 2A3LA 1M1KC 2XG8D 3VKHA 3CMET 3OS1A 1KD1U 3OMCA 5LJ3f 2YLBA 1UEBA 3V8JA 5M9OA 1H3ZA 2LT4A 4AI6A 3LH0A 3M59A 4JLGA 4BI4A 2E64A 3CXCS 2P0PA 4XQ3A 3QKJA 2VYTA 4Y91A 4O6JA 5FRNA 4NOYA 3JCMb 2FVUA 2R5AA 4BBRM 5CAIA 4Y28E 2LC4A 3JCMc 2AHJB 3A8HB 1D3BA 3MP6A 4M77B 4EMKC 5KCHA 5GAN3 5HK0A 1UGSB 1WGSA 3M5AA 3QO3A 5GAMj 3LYIA 2QQ8A 2E6NA 4KBMB 1LOJA 3HFNA 3GP8A 3CMEA 1YJNT 3I56T 2DXCB 3NTKA 1TH7A 3SB2A 2PUKB 4C8QD 2EQKA 5GAMd 4F7UA 1OI1A 1VIEA 4XU1A 2F69A 4M77G 1VQ9T 2DD4A 1WJRA 3OQ5A 3P8DA 3G71T 4A4HA 5KE2A 1FWZA 2A7YA 3PGGA 3QUIA 4PLLA 3JCMh 3E9GA 4RG8A 5GAN8 5FRMA 3X28B 4OB0B 4QQ6A 1QW1A 2XDDA 4MDXA 1YJNA 3I56A 2ZZDA 2DD5A 5I2MA 5LJ5e 4C92F 1YJ9T 2F5KA 2LCCA 3C94A 3OYHA 2E5QA 3BDLA 2RHXA 3VU3C 1OZ3A 2RI3A 3VYGA 3OYNA 4ATOA 3FDRA 2KMGA 2OAUA 1BKBA 2XICA 3E19A 4Q5WA 1Q7YU 1VQ9A 3G71A 3C12A 3OA6A 3LLRA 4HKEA 3CPFA 5CVIA 3L42A 2RI5A 2ZPBB 1ZBXA 2DD4B 4JRQA 5FU7B 3L2RA 4O5VA 4EDUA 4C0FA 4EMHA 3CCET 4C0ZA 1M8VA 3G4ST 2IVWA 5CO7A 1YJ9A 4A4GA 1VQPA 1G3TA 1M1FA 3OYKA 5GAN5 2IG0A 4PJOB 3SDZA 2XK0A 3L2VA 3S3OA 4JRKA 1QVGA 1XOVA 3URGA 1BI2A 2XHCA 2CGHA 2DK3A 2KK4A 4M78A 4C92C 4BE0A 2DJZA 3CMAT 5D6YA 3LGLA 3LX7A 3OYFA 5HK3A 5GANe 2OTJT 5DY9A 4YTLA 2DXBB 3TCJA 2WSCE 3JCMQ 2LVMA 5LJ5j 3QYHB 2ZGWA 5CKFA 3BG9A 4KUIA 2HQEA 2GFAA 1N9SA 3CCEA 3G4SA 4PJOG 3QXEB 1Y71A 2PU9B 3LWHA 4BD3A 3G6ET 3KBGA 2RHZA 4ME7A 2EFIA 2JUFA 2RK1A 2PVGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGP B;  4OB1 B;  1DJ7 B;  1V29 B;  3QYG B;  3HHT B;  3X24 B;  3VYH B;  3QZ5 B;  3A8G B;  2CZ1 B;  2CZ6 B;  1UGR B;  1AHJ B;  3A8O B;  5L8R E;  1GXI E;  4OB3 B;  2CYZ B;  4FM4 B;  4Y28 E;  2AHJ B;  3A8H B;  1UGS B;  2DXC B;  1PSE A;  2PUK B;  1QP2 A;  3X25 B;  2DXC A;  2PVD B;  2ZCF B;  3LW5 E;  2WSE E;  2DD4 A;  4RKU E;  2ZZD B;  2DD5 B;  2DPP B;  3X28 B;  4OB0 B;  4ZGJ B;  3VYG B;  2ZZD A;  2ZPE B;  2DD5 A;  4OB2 B;  1QP3 A;  4KT0 E;  2CZ0 B;  3WVE B;  3VYG A;  3QZ9 B;  3X20 B;  4ZGE B;  4L6V 5;  2ZPB B;  3X26 B;  1IRE B;  2DD4 B;  2D0Q B;  3A8L B;  2O01 E;  1JB0 E;  3WVD B;  3A8M B;  4ZGD B;  2PUO B;  2QDY B;  1UGQ B;  2ZPH B;  2DXB B;  2WSC E;  3QYH B;  2ZPG B;  2WSF E;  4XK8 E;  2ZPI B;  3QXE B;  2DXB A;  2PU9 B;  2PVO B;  2CZ7 B;  1PSF A;  2ZPF B;  2PVG B; 
#chains in the Genus database with same CATH topology
 5HQ0 B;  4OB1 B;  3CMA A;  1VQK T;  1U5S A;  4LN2 A;  1DJ7 B;  5L2W B;  3O8V A;  5LJ3 e;  3VYH B;  1NPR A;  3TRE A;  1OEB A;  4AKI A;  3VKG A;  4ROE A;  2IW6 B;  5KYY A;  4E7I A;  2Y90 A;  2DIL A;  2O4X B;  1YIJ T;  1KHC A;  3MEA A;  2CP2 A;  2DXU A;  2EKH A;  4IKF A;  1F5Q B;  4J7F A;  5A0L A;  4PFZ A;  1JQQ A;  3VUZ A;  5CCA A;  1JJ2 P;  2X3W D;  2CYZ B;  4PL6 A;  3HL8 A;  4LD6 A;  1OUL A;  2V22 B;  2JS0 A;  4PJO C;  2OTL A;  3Q1J A;  1RI0 A;  1YFN A;  3QHS A;  4C0D C;  3HTR A;  3QWY A;  4M7D E;  1PSE A;  3ZEH A;  1MMG A;  4XU2 A;  2CSQ A;  2UZB B;  2GFU A;  1QVG P;  1X43 A;  2GGR A;  3SD4 A;  3OMG A;  1OU9 A;  3OS0 A;  1YI2 Q;  1ZUU A;  4G6L B;  2DRM A;  3JCM V;  2H8H A;  1C1A A;  2EYQ A;  4J6W A;  3GOX A;  1AT1 B;  4RG2 A;  2L89 A;  4M78 C;  1IHW A;  5DQV A;  2AK5 A;  2PHG A;  1TOV A;  4C5H A;  3KFV A;  1P92 A;  1H1S B;  5BNJ B;  2B8A A;  3X26 B;  1ZHI A;  3I5R A;  2YUP A;  2Z0W A;  5IHY A;  3QDF A;  4OP0 A;  2EQJ A;  2OX7 A;  4OGE A;  2DBK A;  4BY6 C;  3TNW B;  4KUL A;  1LPL A;  1KK7 A;  4M7A B;  2OI3 A;  3I9Q A;  3G4S Q;  4N0A C;  2DYI A;  2LJ1 A;  2YDL A;  1VQP T;  1YWP A;  2RNA A;  5GAN 4;  1H27 B;  1CKB A;  5LJ5 h;  4XK8 E;  3FEO A;  2DXB A;  2HNI A;  2RQW A;  2EYY A;  2X4X A;  3I35 A;  3H0F A;  2MPX C;  1UGP B;  2M0O A;  1YIT A;  2WMA B;  1XNI A;  3CCL T;  1K0X A;  9ATC B;  1I4K 1;  3G6E Q;  3X24 B;  2VWF A;  1UB4 A;  1VQ8 T;  1K0S A;  2E41 A;  3CCQ A;  1VQ7 Q;  5AYF A;  1Y96 B;  1PM3 A;  3CCM T;  2LCL A;  4QT7 A;  5GAN h;  3RUX A;  2X4Y A;  2O4X A;  4M77 C;  4GY5 A;  4PJM A;  2KYM A;  1SHG A;  2E4H A;  4M75 C;  2KI7 A;  3JCM X;  3UA6 A;  1BCO A;  1WXT A;  1WHK A;  2R58 A;  3F70 A;  2K2V A;  4PNO A;  1X2Q A;  3ASK A;  4RTU A;  5GMK m;  5J26 A;  3MI9 B;  4Z6Y A;  2H3J A;  1D1A A;  1PRM C;  4IUP A;  4DBH A;  2NWM A;  2KT1 A;  5FRO A;  2VGM A;  1Z9Q A;  4EMK B;  4BCQ D;  1QCF A;  4IMY B;  2HD0 A;  1OIU B;  2K3X A;  3TW7 A;  4HXJ A;  3CCS T;  5KCO A;  4HT9 A;  2JZ2 A;  4E6R A;  5I22 A;  3OYJ A;  2QDL A;  4CFW B;  4A53 A;  4QKU A;  4BCF B;  2BE7 D;  1TUG B;  4BCH B;  2E6Z A;  5D7U A;  4F7U E;  1WDX A;  4NST B;  1X27 A;  3TNI B;  1KXU A;  2D0Q B;  4KGV B;  2LJ0 A;  1WPY A;  3S3N A;  1YJN Q;  2M1H A;  4MML A;  3BLH B;  2KNB B;  4KUD K;  4PJJ A;  4JX5 A;  4MZP A;  2YSQ A;  1U1S A;  3QBY A;  2QXF A;  2LQK A;  1WQ7 A;  3L2W A;  2K5F A;  1JOW A;  1Q86 U;  2MMP A;  4M7A A;  1AWW A;  2CDT A;  3ME9 A;  4EOL B;  1TSF A;  2ZPI B;  3DL1 A;  2CZ7 B;  1H64 1;  1YJ9 Q;  2EUF A;  1M8M A;  1YP5 A;  4C92 B;  2QQS A;  1E6H A;  2JTF A;  2O2O A;  2CT3 A;  2KQW A;  3BE3 A;  3A98 A;  4JRP A;  2CP6 A;  2M0Y A;  4J9E A;  4AKG A;  4BE1 A;  1NYF A;  1QKX A;  1W1F A;  2JS2 A;  4JS4 A;  2RB6 A;  4JJN K;  1Y96 A;  3QWX X;  3CMA Q;  3DOG B;  1YI2 T;  1VQ6 A;  1QVP A;  2B86 A;  4ANJ A;  2RF0 A;  5L8R E;  3QJY A;  2XI9 A;  3M57 A;  3VS5 A;  2CP5 A;  2UUE B;  1XQH A;  4LDX A;  5IXB A;  3CC7 A;  2L3R A;  4DQ2 A;  1ACM B;  3FC3 A;  1SSF A;  1XJW B;  1G8X A;  3OYB A;  4D8D A;  3TU4 K;  2IPO B;  2HBW A;  3M56 A;  4XAX B;  4EOI B;  3RMQ A;  2PTK A;  5IXF A;  1FKM A;  1URC B;  1M5Q 1;  4WTO B;  4OMN A;  4M7A F;  2LNV A;  1OL1 B;  1ZX6 A;  2K5L A;  2QA4 A;  2SRC A;  1OI9 B;  2BKZ B;  2DD5 B;  4F7U G;  1UUE A;  2F2X A;  2OTL Q;  2VV5 A;  4EMK A;  3QDR B;  1PC0 A;  5HVY B;  2YUN A;  1RAF B;  2HQX A;  2EAY A;  3RMS A;  2D1X A;  2DL3 A;  2FG0 A;  2C0T A;  3R6O A;  5LJ5 d;  3OW2 A;  3CD6 A;  5CKH A;  1Y57 A;  2LDM A;  1WJQ A;  4XTW A;  2QQ9 A;  4E47 A;  3NTH A;  1Y07 A;  2X51 A;  1G83 A;  1PKT A;  4HCC A;  4FW2 A;  4CFM B;  2EWN A;  3CCR A;  1XO2 A;  3OYM A;  2Y4X A;  1JBM A;  1VIF A;  2DME A;  4M7A D;  1R0C B;  1KQS A;  2ZPG B;  3BHV B;  1BBZ A;  4YOO A;  2V26 A;  1AOJ A;  2KRM A;  3V7S A;  1FVV B;  1RAH B;  2KY9 A;  1KIK A;  3H6Z A;  4EOM B;  4R56 A;  2DTH A;  4C92 A;  1VQ5 A;  3REB B;  4F7S B;  1W4S A;  4BI3 A;  1QLB A;  5ECA A;  2RJF A;  4PJO E;  4PKC C;  1U8R A;  2GCX A;  4ZTJ A;  3VS3 A;  3MKD A;  4MDW A;  1YIT Q;  2WFY B;  1I5L A;  2M51 A;  1Q82 U;  2LQW A;  2A3L A;  1KD1 U;  5FWC A;  1UEB A;  1H3Z A;  4AI6 A;  3CCQ Q;  1ZSZ B;  3M59 A;  1S1N A;  4JLG A;  3QKJ A;  4Y91 A;  4RTW A;  2FVU A;  2R5A A;  4Y28 E;  2LC4 A;  4Y92 A;  2COW A;  1VYV A;  1UGS B;  1WGS A;  3M5A A;  3CME A;  3GP8 A;  1YJN T;  2PK9 B;  1TD6 A;  2DXC B;  3NTK A;  3CCU Q;  1TH7 A;  1PKD B;  2IN3 A;  3EFO B;  1OI1 A;  1VIE A;  2F69 A;  2UZE B;  3QUI A;  3JCM h;  3E9G A;  5GAN 8;  4EOR B;  1SPK A;  4QQ6 A;  4OMQ A;  2ABL A;  5GJW B;  1PRL C;  2YRC A;  1UJY A;  1WHJ A;  2DD5 A;  3EG3 A;  5I2M A;  4C92 F;  1YJ9 T;  3OYH A;  2E5Q A;  2MK5 A;  1OZ3 A;  2RI3 A;  3VU3 C;  3OYN A;  1WYX A;  1CSK A;  3E19 A;  1Q7Y U;  1VQ9 A;  2DL5 A;  4FX3 B;  4F7J B;  2IW8 B;  4LE9 A;  3L42 A;  5FWB A;  2RI5 A;  2PJQ A;  1WLP B;  2PMI B;  4O5V A;  4AFQ C;  4C0F A;  1HD3 A;  1TU0 B;  1GFC A;  2DEU A;  2J6K A;  2KRS A;  3S3O A;  4JRK A;  2WEV B;  2LNH B;  2KK4 A;  3CMA T;  4DEY A;  1VYU A;  1X2K A;  3LGL A;  5HK3 A;  5DY9 A;  3JCM Q;  1MV3 A;  2LVM A;  5LJ5 j;  2KE9 A;  2HQE A;  2GFA A;  3CCE A;  3G4S A;  4PJO G;  2PU9 B;  3LWH A;  1AZG B;  2RHZ A;  4M75 E;  1HK9 A;  2NUT B;  4NC6 A;  3BG5 A;  4Z02 A;  4C92 D;  5FU6 B;  1RAA B;  3RKY A;  2MCN A;  1JU5 C;  1PG5 B;  2OTJ A;  1ZA1 B;  3OW2 S;  1NYG A;  2W2H A;  2QGS A;  4HNV A;  1MGQ A;  1N9R A;  3GNF B;  1TUC A;  4WF2 A;  5GMK e;  2BS2 A;  1ZBJ A;  3G6E A;  2MWO A;  4F7L B;  2YRD A;  3A5Z B;  4V2S A;  1Q7Y R;  5GAN j;  1H28 B;  1QMC A;  2F5T X;  2DKG A;  3FLG A;  4HVU A;  4RCC A;  2QAS A;  3T9N A;  4A4F A;  1N8R C;  2OTL T;  3SHW A;  4N4H A;  2E65 A;  4IUQ A;  3VS0 A;  4E7Z A;  2DFU A;  1KQS S;  2CKK A;  1QWE A;  1EZZ B;  2QI2 A;  2K3Y A;  2HL3 A;  1XTD A;  2QDJ A;  1G2B A;  2EVR A;  3BDU A;  1ZLM A;  2JJ9 A;  5KYY B;  2MAM A;  1ZSZ A;  2A37 A;  2CCI B;  3VV0 A;  1NEG A;  2RHU A;  5GAM h;  1FMW A;  1GCQ A;  1LVK A;  4HCZ A;  2RHI A;  2CP3 A;  2DXC A;  2WIP B;  2L3S A;  3EFS A;  2ECZ A;  3CC7 Q;  4MZT A;  3EFO A;  2VXE A;  4P5N A;  2AIR B;  2EYW A;  1MHN A;  5DLQ E;  3RES A;  4EPC A;  2ZPE B;  5HBE B;  1UHF A;  1TS9 A;  2L3Q A;  2CH4 W;  2DL8 A;  4IUV A;  4FYX B;  2ROL A;  3C0C A;  4OML A;  2E70 A;  1IRE B;  1G3W A;  3PT9 A;  3MEU A;  3B57 A;  1X6B A;  2SEM A;  4EOK B;  4ZN1 A;  2YLC A;  4M75 G;  3OS5 A;  3VUB A;  1NZ9 A;  1UFF A;  1YIT T;  3UWN A;  4JJC A;  1H24 B;  2DIG A;  1KQ2 A;  2HKN A;  3HSB A;  1KHI A;  1FX7 A;  3CD6 Q;  4ROC A;  2V1Q A;  4M7D A;  2DZ9 A;  3CCQ T;  4ELY C;  3EH1 A;  1D0Z A;  4RTT A;  2BUD A;  1JXM A;  3CCR Q;  1R8O B;  4Z88 A;  4Z89 A;  4XTX A;  4MIM A;  3HHT B;  2NUT A;  3S3M A;  2BIV A;  1K73 R;  1VQO A;  3CC2 A;  3A8G B;  4MZM A;  1G5V A;  2BTT A;  1FXX A;  2GTO A;  2D0N A;  3HRS A;  3LWI A;  1WHM A;  3VRZ A;  5ICP B;  2CZ6 B;  5CIU A;  5IHN A;  3OYE A;  4MFE A;  1VQ5 Q;  3A8O B;  3H0I A;  4L5G A;  2FZG B;  4HNU A;  3CCV A;  2DVE A;  1GXI E;  2P4T A;  3UT1 A;  2W9Z A;  1SRM A;  1OQK A;  3J80 E;  3LQ5 B;  2L5Q A;  3JCM d;  2C5N B;  5I21 A;  1RAB B;  3M03 A;  5LJ3 h;  5GMK i;  1VQM A;  2LZ6 B;  4CC2 A;  1M1K R;  1C0M A;  2KRO A;  3BG3 A;  3DKM A;  4M7A C;  2FZK B;  5A0G A;  4C8Q B;  5C6S A;  1QVF A;  4DA4 A;  4C5E A;  1NM7 A;  2FPF A;  1AWJ A;  1QP2 A;  1Y7X A;  3PO3 S;  2RJD A;  4HCK A;  2VUB A;  4C0G A;  2DAQ A;  1IZ6 A;  3CME Q;  2ED1 A;  3L2Q A;  4NS5 A;  3HO8 A;  1RAG B;  4ZGE B;  4E7H A;  1D3U B;  2RD1 A;  2DL4 A;  3QYE A;  2F1L A;  2QGF B;  2LTO A;  2L0A A;  3QJ6 A;  1VQL A;  2C4G B;  2MI6 A;  2VC8 A;  1VQ9 Q;  4J7I A;  1YBY A;  2DXT A;  2RM4 A;  3PVL A;  4A4K A;  3CXC A;  1U3O A;  2ROT A;  1NJI U;  1W2B P;  3JB9 H;  4Y72 B;  1Y0M A;  4PJN A;  3I55 A;  3QYG B;  1PD1 A;  5KH6 A;  1VQ6 T;  1K9A A;  4J9I A;  2YT6 A;  2GQV A;  1QQJ A;  1H1P B;  2EPD A;  1TUD A;  2KXC A;  2ESW A;  3CCE Q;  4IIO A;  2DEQ A;  2CZ1 B;  1OL2 B;  2CS7 A;  4QVZ A;  4X34 A;  3CC7 T;  1BIB A;  3DDQ B;  1BK2 A;  1WHL A;  2EKO A;  4L59 A;  2XDB A;  3EGU A;  2R57 A;  1UGR B;  2RA2 A;  2AKK A;  2NLU A;  2E10 A;  2OTJ Q;  2LT1 A;  4MMK A;  5CQY A;  2MF2 A;  3CPW P;  4OMM A;  3L2Z A;  3M0P A;  4BUG A;  1T0J A;  1M30 A;  2XU8 A;  3GLX A;  2QA4 T;  3MET A;  3NPF A;  1WHG A;  4JX6 A;  2YUO A;  1YNZ A;  1B7T A;  5GAN 2;  3EG1 A;  1AZE A;  1LNX A;  3QWL A;  2DIQ A;  3MO8 A;  4BY7 X;  3LW5 E;  1UG1 A;  2A28 A;  4C8Q A;  3CCJ A;  1NJI R;  2HL5 C;  3CCU A;  4HT8 A;  3QSU A;  2DTI A;  1BI3 A;  4LDV A;  4ROD A;  2QGG A;  1OX9 A;  3HRT A;  3CD6 T;  3OYA A;  1D09 B;  4C0D B;  2P84 A;  2LQ8 A;  4HLQ A;  2QEX Q;  1I0C A;  3A1P A;  2VXF A;  4OB2 B;  2I40 B;  4X9C A;  2VGN A;  4CRI A;  4QVC A;  3ZFJ A;  3CCR T;  1EIF A;  5J3B A;  1YJW A;  7AT1 B;  5LJ5 g;  3NTI A;  1ZUK A;  3H9N A;  2E1H A;  4XTY A;  2R5M A;  3V7C A;  3M0T A;  4EIK A;  4GLM A;  4ELZ C;  1VYW B;  4FSX A;  4OGC A;  3HB9 A;  2YWW A;  4M78 B;  3IQL A;  1QVF S;  1F1B B;  2VKN A;  2CCH B;  4GBQ A;  1NPP A;  2DL7 A;  1PWT A;  2WPA B;  3K7A M;  1YCY A;  2BZX A;  1VA7 A;  2HSP A;  1VQ5 T;  3MIA B;  1MUZ A;  3L2U A;  1RAC B;  2RI2 A;  4CFU B;  2G6F X;  5DLO A;  5GAN g;  1Q86 C;  1GRI A;  5A2Q E;  5GAO l;  1SRL A;  3V8K A;  4PFP A;  4CI0 C;  1RI9 A;  4C8Q F;  1YN8 A;  4XTV A;  4QVD A;  3G7Z A;  3TW6 A;  3NDQ A;  5LJ3 d;  2FHD A;  3EH2 A;  1K9M U;  4TTH A;  2DBM A;  4B9W A;  4LXC A;  3HKS A;  3EID B;  8AT1 B;  4BCP B;  2VAS A;  2LW4 A;  2EQM A;  5LMK B;  4I3Z B;  3CME T;  1WXU A;  3OMC A;  2YLB A;  3V8J A;  2COZ A;  2LT4 A;  1VQO Q;  2JM8 A;  2QTV A;  3CC2 Q;  3LH0 A;  2E64 A;  3CXC S;  5FRN A;  4XQ3 A;  4O6J A;  4NOY A;  1NEB A;  5CAI A;  4A63 B;  5KCH A;  4M77 B;  4AG1 C;  5HK0 A;  3U23 A;  3QO3 A;  5GAM j;  3LYI A;  4M4Z A;  2QQ8 A;  4BCO B;  1LOJ A;  1ZUY A;  4C8Q D;  3CCV Q;  1K1Z A;  2HEQ A;  4XU1 A;  1UE9 A;  1VQ9 T;  2F2W A;  2DD4 A;  1WJR A;  2E5K A;  1SSH A;  3P8D A;  4A4H A;  5KE2 A;  2A7Y A;  4PLL A;  1VQM Q;  1H1R B;  4MDX A;  4JJD A;  3I56 A;  1I5O B;  1M2V B;  1BU1 A;  5HBJ B;  3RBB B;  4J9B A;  2WXV B;  1K9M R;  3G71 A;  1RLQ C;  3CPF A;  5CVI A;  1VQ4 Q;  1H4L D;  1PNJ A;  1I07 A;  5FU7 B;  4EDU A;  4AFZ C;  5KYU B;  2DNU A;  3CCE T;  1HYO A;  2IVW A;  3G4S T;  1MV0 B;  1VQP A;  3OYK A;  5GAN 5;  4CXA B;  2DMO A;  2XK0 A;  1OKW B;  4J9C A;  1XOV A;  1QVG A;  2O9S A;  2XHC A;  3URG A;  4M78 A;  4BY1 X;  2P4R A;  2DJZ A;  2O88 A;  1ZSZ C;  2OTJ T;  3TCJ A;  1P5E B;  4RTV A;  2DER A;  2A08 A;  3BG9 A;  2C5O B;  2O31 A;  1OKV B;  3H41 A;  3NHN A;  3G6E T;  1OOT A;  1BB9 A;  3C4S A;  2PVG B;  1AVZ C;  2ENM A;  3MP8 A;  1VQ7 T;  1VQL Q;  3JAM E;  2JGZ B;  1H3H A;  1ABO A;  4YOZ A;  2CP7 A;  2K4Y A;  4N0A A;  2RPN A;  1GCP A;  3EG0 A;  5I11 A;  5CKB A;  1V1C A;  1O9K B;  4M7A E;  4II1 A;  2DZC A;  4D6W A;  5CQX A;  4C5G A;  1GBR A;  3JCM f;  4JLI A;  3M58 A;  3I55 Q;  2A0F B;  3HFO A;  3RDV A;  5FLX E;  1VOL A;  5GAN d;  2HDA A;  4JRI A;  2RQT A;  2HAX A;  4DBQ A;  1AWX A;  1BYM A;  1Q82 C;  1JXO A;  2BKD N;  4QQD A;  5LJ3 j;  4BCG B;  1BCM A;  1KD1 C;  4XU0 A;  3QYB A;  1GL5 A;  4LDU A;  4EOQ B;  4M78 F;  4JZ3 A;  4M77 A;  3JB9 F;  4RUG A;  1JO8 A;  3V7R A;  4M6V A;  5D6W A;  1JKW A;  2LRQ A;  4RKU E;  4LUE A;  4DOV A;  4CFX B;  3PIP A;  1C6V X;  1OV3 A;  2QYZ A;  2W0Z A;  1QP3 A;  3TNH B;  3SFM A;  2CZ0 B;  2E3I A;  2V8J A;  1PHT A;  1M2V A;  3CCJ Q;  4LD9 K;  1M2O A;  1I81 A;  3VS6 A;  3M4Y A;  4BDZ A;  2C5X B;  3BHT B;  1Q7Y C;  2KAF A;  1Q81 U;  1JST B;  2YUQ A;  5KYU A;  1QCO A;  5GAO r;  1IB8 A;  5DM7 R;  3JB9 D;  2W9F A;  1B34 A;  1E7O A;  1MND A;  2RK2 A;  2GTJ A;  1QVF P;  4C5I A;  1C9B A;  1YJW Q;  4LOC A;  1VQO T;  2GF7 A;  4E7L A;  3CC2 T;  2MIO A;  1KFZ A;  1LCK A;  3OSS C;  4FCY A;  1NE8 A;  4KRC B;  1TG0 A;  3JCM e;  4M7A G;  4M77 F;  2W10 A;  4F6W B;  1WNL A;  1WX6 A;  1X69 A;  3EG2 A;  1HJD A;  2KMT A;  5HKC A;  2HKQ B;  2KYB A;  1I8F A;  3CCV T;  3INZ A;  1K8A U;  4M7D B;  1RL2 A;  4PJL A;  1N6A A;  1YHQ A;  1M3A A;  1QVG S;  1O9K A;  1PCX A;  1VQM T;  3JSC A;  1D1C A;  4HNT A;  1VIN A;  1TXQ A;  2GNC A;  1T3S A;  2RJC A;  3FIF A;  1WI7 A;  1N5Z A;  3PFS A;  4C92 E;  1Q81 R;  2OJ2 A;  3VS7 A;  2K2M A;  2K5I A;  3SWN B;  4JS5 A;  1I1J A;  3JCM g;  2UZL B;  2F2V A;  2FRY A;  2K9G A;  2G77 A;  2C6T B;  3KUF A;  1D0Y A;  3CXC P;  3QII A;  4M77 D;  4ESR A;  3AHU A;  5GMK h;  4DBR A;  3DLM A;  3GPL A;  2J6O A;  4PLI A;  4BDY A;  2EIF A;  4EOJ B;  3RIR A;  4J8O A;  1BI1 A;  1KC8 C;  4YOS A;  4F14 A;  4PK4 A;  1EFN A;  3TSZ A;  2D8H A;  1RAD B;  1K8A R;  3FB9 A;  4BB7 A;  4KT0 E;  2QEX A;  3WVE B;  3OYD A;  1VQL T;  4ZTF A;  1G3S A;  5IHK A;  5IF1 B;  3TEE A;  2HMA A;  2AZV A;  2FYK A;  4GLK A;  4Z8A A;  2C0O A;  3I56 Q;  2DVJ A;  2K57 A;  2DX1 A;  3F5X B;  1Z9Z A;  1KG1 A;  1K73 U;  4AG2 C;  4F6U B;  1U06 A;  3G71 Q;  1UNL D;  4HA8 A;  5HY6 A;  1SF9 A;  3ULR B;  4JUV A;  3VRY A;  4OR5 B;  3ER0 A;  5GMK l;  2D8J A;  1PSF A;  4LDY A;  4N4I A;  1VQP Q;  1H92 A;  3CBP A;  4C8Q C;  1OGU B;  3MEV A;  1M90 U;  4OF1 A;  1MNE A;  2LX7 A;  1W98 B;  2HZY A;  3E9F A;  1BU2 A;  4BCN B;  3HPW A;  2EGA A;  4D8K A;  4C92 G;  2DE0 X;  4UN0 A;  4FL6 A;  1FMV A;  1M1K U;  2EQU A;  2LQN A;  2BZY A;  2R7G A;  4J5Y A;  5GAM g;  5IAY A;  2H3E B;  2JN0 A;  3MPU B;  1MMD A;  5EG2 A;  1H1Q B;  1K76 A;  2WAC A;  3PMI A;  3EFR A;  3OSV A;  4BCQ B;  2WHB B;  5GAO q;  2K3B A;  1IGU A;  3OYG A;  1D3B B;  3EHQ A;  3CCJ T;  3OBW A;  4OB3 B;  4BAC A;  3MCA B;  3CCU T;  3SWN A;  2RHY A;  3MJX A;  3NMZ C;  1N8R R;  3HRU A;  3KHI A;  1OPL A;  3JCM P;  3OYL A;  2LP5 A;  4F7U B;  4CC7 A;  4EOP B;  4OMP A;  2ZAE A;  1D1B A;  4EOO B;  2EW3 A;  2ZCF B;  2PVD B;  3DB3 A;  1YJW T;  3PTA A;  1M90 R;  2CT4 A;  3L1A A;  5CEI B;  3NFC A;  4QQG A;  2ZZD B;  2IIM A;  2QG9 B;  2E12 A;  4DOW A;  3O5Z A;  1QKW A;  3VYG B;  1S72 A;  3OBY A;  1VQN A;  4R0K A;  5FW9 A;  3D7S B;  2JOY A;  5GAN 7;  3PVQ A;  4BCJ B;  3CEY A;  1RLP C;  4BCI B;  3CCS Q;  1ZQ1 A;  3OB9 A;  4RTZ A;  2IVX A;  1JRI A;  3EG9 A;  2X3X D;  4FYY B;  1GUX B;  3FJP A;  1M3C A;  4J9G A;  4M7D F;  5I2S A;  3A8M B;  1VQ4 A;  5ACB A;  4DBF A;  2C5V B;  4HCB A;  2EJF A;  2X35 A;  3S6W A;  5LJ5 f;  1GBQ A;  1ZA2 B;  1UGQ B;  2D9T A;  2V8K A;  3HZJ A;  4R55 A;  5KYN A;  2AZS A;  2RH2 A;  3UDC A;  3H4C A;  3KXT A;  5AT1 B;  2PVO B;  4KRD B;  3HP9 A;  3DTO A;  2JXB A;  2DO3 A;  2DTO A;  2EGC A;  1ABQ A;  3GNG A;  3CC4 A;  4NL2 A;  1TFB A;  1OZ2 A;  3C95 A;  4B9X A;  3RGF B;  1ZSG A;  2YXY A;  1NJI C;  2J7I A;  5GJV B;  3J81 E;  5GAN f;  3UA7 A;  1JEG A;  5LJ3 g;  4KGZ B;  4RMO A;  4M7D D;  2Y4Y A;  2X1N B;  1SHF A;  5CK9 A;  2NUP B;  4UC4 A;  3FJ5 A;  1WJS A;  2RO0 A;  3EGD B;  4HVW A;  1R77 A;  2J05 A;  2XG8 D;  3VKH A;  2JMC A;  3BLQ B;  3OS1 A;  3O0G D;  5M9O A;  4BXX X;  2DLP A;  2KXD A;  1AEY A;  1IXD A;  4AMC A;  2DRK A;  2P0P A;  1YHQ Q;  3JCM b;  1KJW A;  4BBR M;  3JCM c;  2AHJ B;  3A8H B;  1D3B A;  3VS2 A;  4EMK C;  4LUD A;  2WIH B;  4ELL A;  1T3L A;  4II5 B;  1TWB A;  3OW2 P;  2E6N A;  3THK A;  3I56 T;  2PZ1 A;  2PUK B;  1K4U S;  2EQK A;  5GAM d;  4F7U A;  2RQU A;  1IO6 A;  2VB6 A;  3LH5 A;  3OQ5 A;  3G71 T;  1AWO A;  3PGG A;  3M0S A;  4RG8 A;  5FRM A;  1QWF A;  4OB0 B;  2CUB A;  1HSQ A;  1KQS P;  2ZZD A;  1W70 A;  4F6S B;  5LJ5 e;  2LCC A;  3C94 A;  1T0H A;  3PE0 A;  3VYG A;  3FDR A;  2XIC A;  2KMG A;  1BKB A;  2LJ3 A;  2DYB A;  2O9V A;  5EFQ B;  3C12 A;  4F16 A;  3OA6 A;  3QHR B;  4HKE A;  2W96 A;  1V76 A;  1ZBX A;  2DD4 B;  4JRQ A;  3BLR B;  4C0Z A;  3EJ1 B;  1GUX A;  4A4G A;  1CKA A;  1UNG D;  1M1F A;  2IG0 A;  4PJO B;  3SDZ A;  3L2V A;  4C92 C;  1BI2 A;  5D6Y A;  3LX7 A;  1R0B G;  5GAN e;  4E2F B;  1QMZ B;  3QYH B;  5CKF A;  5EC7 A;  1VOM A;  2GQI A;  3QXE B;  1Y71 A;  4BD3 A;  3KBG A;  4ME7 A;  2JUF A;  2RK1 A;  4M7D G;  2HSE B;  1UGV A;  4J83 A;  3RKW A;  2QF7 A;  4F7U F;  1PKS A;  3MY1 B;  2CP0 A;  2P0Q A;  4EMG A;  3UAT A;  2K6D A;  2COY A;  4BCN D;  3UPU A;  2F2C A;  4BI8 B;  2DA9 A;  1VQK A;  3PMT A;  4PFO A;  1GFD A;  4XTZ A;  3M0U A;  1NLP C;  3N5B B;  3CQT A;  1ZP2 A;  3TSW A;  5LQF B;  4BY6 B;  5FGK B;  2NUP A;  3P8B B;  1K9M C;  3GTM S;  3EGD A;  3OYY A;  2HQH A;  1N4M A;  4A54 A;  2JW4 A;  5FU7 C;  4AFS C;  5GAO n;  3JCM J;  1YIJ A;  4BBS M;  4F70 B;  4HVV A;  1MMA A;  2DJQ A;  4J9D A;  1IGQ A;  2X4W A;  4BCM B;  1BIA A;  5GMK j;  2KBT A;  3DB4 A;  1D0X A;  4EOS B;  2QQA A;  4RTX A;  2G3R A;  3AT1 B;  2W99 A;  4J6Y A;  1FIN B;  1BI0 A;  2KSS A;  3MY5 B;  2PNI A;  2RQV A;  2C06 A;  2XD0 A;  2FEI A;  3P8H A;  2EYX A;  5J39 A;  2WSE E;  3OY9 A;  4FW1 A;  5IHI A;  2I0N A;  2QK0 A;  3RKX A;  3POM A;  1NLO C;  2DPP B;  1AIS B;  4F7N B;  4ZGJ B;  4KRT A;  5KYX B;  3GF5 A;  4FT2 A;  2DET A;  5HNB B;  3JCM W;  3DJB A;  5I5Z B;  1X6O A;  1OU8 A;  3ZBD A;  3G33 B;  2QFZ A;  2JNG A;  2XDP A;  2FO0 A;  4M75 B;  8ATC B;  1E7P A;  3GBQ A;  4C8Q E;  4CC4 B;  3I5S A;  3WVD B;  1S72 Q;  3H8Z A;  4YC3 B;  1UJ0 A;  1VQN Q;  1FMK A;  2HBP A;  3REA B;  5CR2 A;  1M4Z A;  4J9F A;  2QDY B;  2QTX A;  4PJO A;  4CFV B;  4EON B;  2NYS A;  4JX4 A;  1A0N B;  1H8K A;  1JJ2 A;  2RJE A;  3BHU B;  2FPD A;  1VYT A;  1N27 A;  2KR3 A;  3OYC A;  4J6X A;  4ATO A;  2EYZ A;  5D6X A;  2EQI A;  2MWP A;  4MFD A;  4XTU A;  1YHQ T;  1B07 A;  3V8L A;  2RQR A;  1QLY A;  1V29 B;  1B34 B;  2KR6 A;  2CUD A;  4FIB A;  4OMO A;  3ZL7 C;  2BS3 A;  2AKL A;  1WA7 A;  3QZ5 B;  3DDP B;  3MEW A;  3CBM A;  1Q86 R;  1ENW A;  1OPK A;  2CSI A;  4HL4 A;  3BFM A;  4CC3 A;  1TTH B;  5IDN B;  3CCL A;  1OIY B;  4IUR A;  3JB9 J;  3CC4 Q;  1RAI B;  4E7S A;  1VQ8 A;  1YWO A;  1GCQ C;  2A36 A;  3WXM B;  2J06 A;  1WXB A;  1RUW A;  1UNH D;  3MHX A;  4FSS A;  1W2B A;  2MYS A;  3CCM A;  4FM4 B;  4A4E A;  4X9D A;  2XMF A;  1M3B A;  4KGX B;  1VUB A;  2L2P A;  5CKE A;  4PJO F;  3BW1 A;  1U1T A;  2EBP A;  4F04 B;  2LMJ A;  2QEX T;  4LDW A;  3EHR A;  2LX9 A;  3EAE A;  3M4G A;  2BS4 A;  4C8Q G;  4LNP A;  2D6F A;  3CPW A;  3M55 A;  1LJO A;  1GH6 B;  5EJC A;  2CJM B;  1WQW A;  5KYX A;  2L8D A;  1X75 C;  2BPM B;  1UDL A;  4L6V 5;  2P0K A;  4M7D C;  2RMO A;  5GAN 6;  2PQW A;  2HCK A;  4M75 A;  1M9S A;  4JDS A;  3CCS A;  2I2L A;  2FB7 A;  4ZGD B;  5A0D A;  4TVR A;  2M16 A;  3H0H A;  5DQW A;  4PJO D;  1SEM A;  4IIM A;  2NUZ A;  5IN1 A;  4OMF B;  5FU6 C;  5LL6 S;  1Q81 C;  4KH1 B;  3SWN C;  4ELJ A;  4ZNX A;  2FPE A;  1Q95 G;  4IUT A;  5IT9 E;  3J7A F;  2WSF E;  2IW9 B;  4ORZ A;  1RAE B;  3OYI A;  2ZPF B;  3PNW C;  1WHH A;  5GAO p;  2LCS A;  2WMB B;  2JMA A;  1PD0 A;  3EGX B;  1AD6 A;  3R6N A;  4KH0 B;  3TN8 B;  1OYX A;  4M78 D;  4OVA A;  3VS1 A;  4M78 E;  3MP1 A;  2VVK A;  4N4G A;  4AFU C;  2KGT A;  2JM9 A;  3UF4 A;  2EGE A;  1X01 A;  1OX8 A;  5HCK A;  4E7J A;  4EC9 B;  4CRL B;  2QQR A;  2G9X B;  5KYW B;  2KDS A;  2EJ9 A;  1K8A C;  4B6M A;  4EC8 B;  1AHJ B;  4CFU D;  2XID A;  3OS2 A;  3JRZ A;  1JJ2 S;  2I53 A;  3QG1 A;  4ZN3 A;  2L3P A;  4M75 F;  4QSH A;  5GAM f;  1G3Y A;  4E7K A;  2ED0 A;  3LGF A;  1VQK Q;  1YI2 A;  4J9H A;  1WZO A;  4BE2 A;  4BCM D;  2WJ9 A;  5GAO m;  1S72 T;  1VQN T;  2KVQ G;  2JVV A;  3VKI A;  1Q82 R;  1QCN A;  2E3H A;  3M54 A;  3M9Q A;  2X9H A;  2YRV A;  3X25 B;  3G1J A;  1O75 A;  1YCS B;  3PIO A;  1KD1 R;  1YIJ Q;  4FU6 A;  2ATC B;  3HBL A;  4DEX A;  2FL7 A;  3JV3 A;  5KE3 A;  2JT4 A;  2V8I A;  3VJP A;  3FRN A;  1SG5 A;  1O9S A;  1AD5 A;  5C0M A;  3RNJ A;  4XU3 A;  1VQ4 T;  1IHV A;  4VUB A;  3QZ9 B;  3X20 B;  4M77 E;  2CRE A;  1W2B S;  2K7A A;  2J6F A;  2UZD B;  2JTE A;  4M75 D;  2KEA A;  1KSW A;  3JB9 I;  1MMN A;  5IDP B;  3A8L B;  1UHC A;  2O01 E;  1JB0 E;  2AT1 B;  2EJG A;  2PUO B;  2M9U A;  4F17 A;  3DLL A;  2ZPH B;  3RER A;  4JZ4 A;  2MOX A;  2YHT A;  3CC4 T;  1HXD A;  3CBO A;  1H25 B;  4QW2 A;  4M78 G;  3EOC B;  3EG9 B;  1M1G A;  1K73 C;  1VQ7 A;  4IUU A;  2JTM A;  3CPW S;  3JB9 G;  1M27 C;  2XKO C;  1J3T A;  1G3N C;  2CH4 A;  2X4J A;  1NG2 A;  2C0I A;  3GIB A;  4JPB W;  4CFN B;  1FYN A;  3BY7 A;  1H26 B;  4X1V A;  3EGX A;  3TQ7 P;  5GAM e;  1KQ1 A;  1SKU B;  5CKD A;  1M90 C;  4AKH A;  1UEC A;  4FT4 A;  3I55 T;  1N8R U;  1VQ6 Q;  4RCB A;  4OGR B;  1E9H B;  2BZ8 A;  3E2U A;  3M53 A;  2GBQ A;  1KC8 U;  1WFW A;  3E1S A;  2KT8 A;  3NGP A;  3QPH A;  2QQB A;  4FYV B;  4NL3 A;  2DF6 A;  1EX4 A;  1M1K C;  5KYW A;  2FZC B;  5LJ3 f;  1UTI A;  1E6G A;  3TVT A;  4BI4 A;  2VYT A;  3RR6 A;  4RTY A;  2B9R A;  1B3Q A;  3MP6 A;  5GAN 3;  3CCL Q;  4K11 A;  5L23 A;  4KBM B;  2OAW A;  3HFN A;  4JJB A;  1VQ8 Q;  2QA4 Q;  3SB2 A;  5CYI B;  4M77 G;  1GY3 B;  3CCM Q;  5HBH B;  1FWZ A;  1WIE A;  3X28 B;  2RN8 A;  1QW1 A;  1JSU B;  2XDD A;  3QHW B;  1YJN A;  2KRN A;  2DM1 A;  2F5K A;  3BDL A;  6AT1 B;  4AT1 B;  2RHX A;  2QAZ A;  2OAU A;  2M02 A;  4Q5W A;  1KC8 R;  3LLR A;  3VS4 A;  2BE9 B;  4FYW B;  2ZPB B;  1NBE B;  3L2R A;  2K79 A;  4WCI A;  4EMH A;  1M8V A;  1X6G A;  1YJ9 A;  5CO7 A;  1G3T A;  2FRW A;  5IH2 A;  1ARK A;  2CGH A;  2DK3 A;  2PK2 A;  4BE0 A;  3OYF A;  3M0Q A;  4YTL A;  2DXB B;  2WSC E;  2V1R A;  2ZGW A;  4KUI A;  1IRX A;  1N9S A;  3M0R A;  3SEM A;  4BCK B;  2EFI A;  1W6X A; 
#chains in the Genus database with same CATH homology
 1HK9 A;  4OB1 B;  4NC6 A;  4M7D G;  3BG5 A;  4Z02 A;  3MP8 A;  3CMA A;  1DJ7 B;  4C92 D;  5FU6 B;  4J83 A;  3RKY A;  3RKW A;  1VQ7 T;  3JAM E;  2QF7 A;  4F7U F;  3O8V A;  5LJ3 e;  2OTJ A;  3VYH B;  3OW2 S;  2K4Y A;  1N9R A;  4HNV A;  1NPR A;  1MGQ A;  2P0Q A;  3GNF B;  4AKI A;  4N0A A;  4WF2 A;  3TRE A;  3VKG A;  4EMG A;  5GMK e;  2BS2 A;  3G6E A;  4E7I A;  5CKB A;  2MWO A;  2Y90 A;  3UPU A;  4M7A E;  3A5Z B;  4BI8 B;  4V2S A;  2O4X B;  4II1 A;  1YIJ T;  2DZC A;  1VQK A;  3PMT A;  4D6W A;  5GAN j;  5CQX A;  4C5G A;  1KHC A;  2F5T X;  3MEA A;  3JCM f;  4JLI A;  4XTZ A;  3M58 A;  2DKG A;  2DXU A;  3FLG A;  4RCC A;  3N5B B;  3T9N A;  4A4F A;  1N8R C;  2OTL T;  3HFO A;  4N4H A;  2E65 A;  4IUQ A;  4BY6 B;  5FLX E;  5GAN d;  4IKF A;  1KQS S;  2CKK A;  3P8B B;  2QI2 A;  4J7F A;  4JRI A;  5A0L A;  2K3Y A;  1K9M C;  3OYY A;  2HAX A;  1G5V A;  1XTD A;  2QDJ A;  1BYM A;  1Q82 C;  3VUZ A;  4A54 A;  5FU7 C;  3BDU A;  5GAO n;  3JCM J;  5CCA A;  1YIJ A;  2BKD N;  4QQD A;  2CYZ B;  2MAM A;  4BBS M;  5LJ3 j;  4PL6 A;  3HL8 A;  4LD6 A;  1KD1 C;  3VV0 A;  2X4W A;  4XU0 A;  3QYB A;  1BIA A;  2RHU A;  4LDU A;  4PJO C;  2OTL A;  5GMK j;  3Q1J A;  1RI0 A;  3QHS A;  3DB4 A;  4M78 F;  4C0D C;  5GAM h;  4M7D E;  4M77 A;  2QQA A;  3JB9 F;  2G3R A;  1PSE A;  4J6Y A;  3ZEH A;  1BI0 A;  2KSS A;  3V7R A;  4M6V A;  4XU2 A;  4HCZ A;  2RHI A;  2DXC A;  2C06 A;  2XD0 A;  3P8H A;  5J39 A;  2WSE E;  3EFS A;  2GFU A;  5D6W A;  3OY9 A;  2LRQ A;  4MZT A;  4RKU E;  3RKX A;  2VXE A;  3SD4 A;  3OMG A;  4P5N A;  2DPP B;  3OS0 A;  3JCM V;  1MHN A;  4DOV A;  5DLQ E;  4ZGJ B;  3RES A;  2EYQ A;  3GF5 A;  4EPC A;  4FT2 A;  3PIP A;  2ZPE B;  4J6W A;  3GOX A;  4RG2 A;  3JCM W;  2L89 A;  1QP3 A;  1X6O A;  4M78 C;  3SFM A;  2CZ0 B;  2V8J A;  3ZBD A;  2QFZ A;  2JNG A;  2XDP A;  4M75 B;  4LD9 K;  4IUV A;  1I81 A;  1E7P A;  4C5H A;  1P92 A;  2B8A A;  2E70 A;  3M4Y A;  3X26 B;  1ZHI A;  1IRE B;  4C8Q E;  4BDZ A;  1G3W A;  3PT9 A;  3MEU A;  1Q7Y C;  2KAF A;  4OP0 A;  4ZN1 A;  3WVD B;  2EQJ A;  2YLC A;  3H8Z A;  4OGE A;  1Q81 U;  4M75 G;  2HBP A;  5CR2 A;  3OS5 A;  3VUB A;  1NZ9 A;  4BY6 C;  5DM7 R;  1M4Z A;  4KUL A;  2QDY B;  5GAO r;  3JB9 D;  1YIT T;  2RK2 A;  1B34 A;  2QTX A;  4M7A B;  4PJO A;  4N0A C;  3UWN A;  4C5I A;  4JX4 A;  2DIG A;  1KQ2 A;  1VQP T;  2RJE A;  1JJ2 A;  3HSB A;  5GAN 4;  1KHI A;  1FX7 A;  1N27 A;  4LOC A;  5LJ5 h;  4M7D A;  3OYC A;  1VQO T;  2DZ9 A;  2GF7 A;  3FEO A;  4J6X A;  4XK8 E;  2DXB A;  2HNI A;  4ELY C;  3CCQ T;  4E7L A;  5D6X A;  3CC2 T;  3OSS C;  2X4X A;  2MWP A;  1NE8 A;  4MFD A;  4XTU A;  3JCM e;  1YHQ T;  4M7A G;  2BUD A;  1UGP B;  4M77 F;  3V8L A;  2M0O A;  1YIT A;  1R8O B;  1WNL A;  1XNI A;  4XTX A;  1V29 B;  4M75 E;  3CCL T;  4MIM A;  3HHT B;  1I4K 1;  1B34 B;  3X24 B;  3S3M A;  2BIV A;  1UB4 A;  2KR6 A;  2KMT A;  1VQ8 T;  4FIB A;  1VQO A;  5HKC A;  2E41 A;  2BS3 A;  3CCQ A;  3QZ5 B;  1I8F A;  3A8G B;  3MEW A;  4MZM A;  3CCV T;  3CBM A;  3INZ A;  5AYF A;  1K8A U;  3CC2 A;  4M7D B;  1RL2 A;  1FXX A;  1Y96 B;  1N6A A;  1YHQ A;  4HL4 A;  3BFM A;  3CCM T;  3LWI A;  2LCL A;  3HRS A;  3C4S A;  1QVG S;  5GAN h;  3CCL A;  3RUX A;  2X4Y A;  1VQM T;  2CZ6 B;  4IUR A;  3JB9 J;  2O4X A;  3JSC A;  4GY5 A;  4M77 C;  5CIU A;  3OYE A;  4MFE A;  4HNT A;  1VQ8 A;  2RJC A;  3A8O B;  3FIF A;  4L5G A;  4M75 C;  3WXM B;  3PFS A;  4HNU A;  3CCV A;  2DVE A;  1GXI E;  4C92 E;  2P4T A;  3MHX A;  3UT1 A;  2K5I A;  3SWN B;  4JS5 A;  1W2B A;  3JCM g;  3JCM X;  3J80 E;  3CCM A;  2L5Q A;  3JCM d;  4FM4 B;  2G77 A;  5I21 A;  5LJ3 h;  2R58 A;  4A4E A;  4X9D A;  5GMK i;  1VQM A;  3F70 A;  2K2V A;  4PNO A;  3KUF A;  3ASK A;  3QII A;  4M77 D;  3AHU A;  5GMK h;  5GMK m;  5J26 A;  3BG3 A;  3DLM A;  3GPL A;  1VUB A;  3DKM A;  5CKE A;  4PJO F;  4M7A C;  3BW1 A;  1U1T A;  4C8Q B;  5A0G A;  5C6S A;  4DA4 A;  4Z6Y A;  2H3J A;  4PLI A;  4C5E A;  4BDY A;  1QVF A;  2EIF A;  4IUP A;  2QEX T;  1QP2 A;  1Y7X A;  4LDW A;  2RJD A;  3RIR A;  4J8O A;  5FRO A;  1BI1 A;  2VGM A;  1KC8 C;  2LX9 A;  2VUB A;  4C0G A;  4EMK B;  2DAQ A;  3EAE A;  3M4G A;  2BS4 A;  1IZ6 A;  4C8Q G;  2HD0 A;  2D6F A;  3CPW A;  3M55 A;  2K3X A;  3TW7 A;  3CCS T;  1VQK T;  5KCO A;  4HT9 A;  1LJO A;  2JZ2 A;  3OYJ A;  3FB9 A;  4BB7 A;  5EJC A;  1WQW A;  4NS5 A;  3L2Q A;  4KT0 E;  2QEX A;  3WVE B;  3HO8 A;  2L8D A;  4A53 A;  3OYD A;  1X75 C;  4ZGE B;  1VQL T;  4ZTF A;  4L6V 5;  2P0K A;  1G3S A;  3OS2 A;  4E7H A;  4M7D C;  5GAN 6;  2E6Z A;  2PQW A;  4F7U E;  3TEE A;  2RD1 A;  4M75 A;  1M9S A;  4JDS A;  2D0Q B;  3QYE A;  1WPY A;  2FYK A;  4GLK A;  3CCS A;  3S3N A;  2I2L A;  2LTO A;  2FB7 A;  2M1H A;  4MML A;  4KUD K;  4ZGD B;  5A0D A;  2K57 A;  4JX5 A;  3QJ6 A;  4TVR A;  2M16 A;  1KG1 A;  4MZP A;  4PJO D;  1K73 U;  1VQL A;  1U1S A;  3QBY A;  2QXF A;  2LQK A;  1WQ7 A;  5IN1 A;  2MI6 A;  4OMF B;  2VC8 A;  5FU6 C;  5LL6 S;  3L2W A;  2K5F A;  1Q81 C;  4HA8 A;  1Q86 U;  3SWN C;  5HY6 A;  4ELJ A;  2MMP A;  4M7A A;  4JUV A;  4IUT A;  5IT9 E;  3J7A F;  4J7I A;  1YBY A;  2WSF E;  3ER0 A;  3ME9 A;  2DXT A;  2RM4 A;  2ZPI B;  3DL1 A;  4A4K A;  2CZ7 B;  1H64 1;  5GMK l;  3CXC A;  3OYI A;  1PSF A;  4LDY A;  2ZPF B;  4N4I A;  3PNW C;  4C92 B;  5GAO p;  3CBP A;  1NJI U;  2QQS A;  2JTF A;  4C8Q C;  3JB9 H;  3MEV A;  3I55 A;  1M90 U;  2KQW A;  3QYG B;  5KH6 A;  1VQ6 T;  4OF1 A;  4JRP A;  2GQV A;  1OYX A;  4AKG A;  4M78 D;  4OVA A;  4BE1 A;  4M78 E;  3MP1 A;  3E9F A;  3HPW A;  4N4G A;  4C92 G;  2DEQ A;  4JS4 A;  4FL6 A;  2CZ1 B;  2CS7 A;  2RB6 A;  4QVZ A;  4X34 A;  2EQU A;  1M1K U;  1X01 A;  4JJN K;  3CC7 T;  1BIB A;  4E7J A;  2EKO A;  4L59 A;  4J5Y A;  1Y96 A;  2QQR A;  5GAM g;  5IAY A;  2XDB A;  2JN0 A;  2KDS A;  2EJ9 A;  2R57 A;  1K8A C;  1UGR B;  1YI2 T;  1VQ6 A;  2RA2 A;  5EG2 A;  1QVP A;  1AHJ B;  2WAC A;  2NLU A;  2E10 A;  2XID A;  3EFR A;  3JRZ A;  3OSV A;  3PMI A;  2LT1 A;  3QJY A;  2XI9 A;  3M57 A;  4MMK A;  5L8R E;  5CQY A;  1JJ2 S;  2MF2 A;  4ZN3 A;  3QG1 A;  5GAO q;  4M75 F;  3OYG A;  1XQH A;  3L2Z A;  4QSH A;  1D3B B;  4LDX A;  4BUG A;  3CCJ T;  5GAM f;  1G3Y A;  3OBW A;  4OB3 B;  2L3R A;  2XU8 A;  3CC7 A;  4BAC A;  3GLX A;  3MCA B;  3CCU T;  2QA4 T;  3LGF A;  3MET A;  3SWN A;  4DQ2 A;  2RHY A;  3FC3 A;  1YI2 A;  3HRU A;  1SSF A;  3KHI A;  4BE2 A;  3JCM P;  4JX6 A;  3OYL A;  3OYB A;  2WJ9 A;  5GAN 2;  4F7U B;  3TU4 K;  5GAO m;  1S72 T;  1VQN T;  1LNX A;  2KVQ G;  2JVV A;  3QWL A;  2DIQ A;  3M56 A;  3MO8 A;  4XAX B;  3RMQ A;  3VKI A;  1FKM A;  3M54 A;  1M5Q 1;  3M9Q A;  4M7A F;  2YRV A;  3X25 B;  2ZCF B;  2LNV A;  2PVD B;  3LW5 E;  4C8Q A;  3CCJ A;  1O75 A;  3DB3 A;  3PIO A;  3QSU A;  3CCU A;  2K5L A;  4HT8 A;  2DTI A;  4FU6 A;  1BI3 A;  4LDV A;  2QA4 A;  1YJW T;  3PTA A;  3L1A A;  3HBL A;  3NFC A;  2ZZD B;  2DD5 B;  3HRT A;  4QQG A;  4F7U G;  2FL7 A;  2E12 A;  4DOW A;  2V8I A;  3VJP A;  4C0D B;  5KE3 A;  2LQ8 A;  4HLQ A;  3OYA A;  3CD6 T;  3FRN A;  2VV5 A;  1O9S A;  3VYG B;  4EMK A;  3OBY A;  3QDR B;  1S72 A;  1VQN A;  2VXF A;  4OB2 B;  5C0M A;  4X9C A;  2JOY A;  4XU3 A;  5GAN 7;  1VQ4 T;  2VGN A;  4CRI A;  4QVC A;  3ZFJ A;  3CCR T;  4VUB A;  3QZ9 B;  3X20 B;  1EIF A;  2EAY A;  2HQX A;  4M77 E;  1W2B S;  3CEY A;  3RMS A;  5J3B A;  1YJW A;  5LJ5 g;  3NTI A;  1ZQ1 A;  4M75 D;  2E1H A;  3OB9 A;  1JRI A;  3R6O A;  4XTY A;  5LJ5 d;  3OW2 A;  3CD6 A;  2R5M A;  5CKH A;  3V7C A;  3JB9 I;  3FJP A;  4XTW A;  2LDM A;  1WJQ A;  4E47 A;  2QQ9 A;  4ELZ C;  3A8L B;  3NTH A;  4FSX A;  4OGC A;  4M7D F;  5I2S A;  3HB9 A;  1Y07 A;  2O01 E;  1JB0 E;  4HCC A;  3A8M B;  1VQ4 A;  4M78 B;  2EJG A;  1QVF S;  2EWN A;  2PUO B;  2M9U A;  1NPP A;  3CCR A;  4HCB A;  2EJF A;  2X35 A;  3S6W A;  3OYM A;  2Y4X A;  5LJ5 f;  1JBM A;  1VIF A;  1UGQ B;  3DLL A;  2ZPH B;  3RER A;  2D9T A;  2V8K A;  3HZJ A;  1YCY A;  1HXD A;  2YHT A;  3CC4 T;  4M7A D;  1VQ5 T;  3CBO A;  4R55 A;  1KQS A;  2ZPG B;  4QW2 A;  4M78 G;  2RH2 A;  3UDC A;  1K73 C;  1M1G A;  3L2U A;  1VQ7 A;  3V7S A;  2RI2 A;  4IUU A;  3H4C A;  2JTM A;  3KXT A;  3CPW S;  2KY9 A;  3JB9 G;  2PVO B;  3H6Z A;  5DLO A;  3HP9 A;  5GAN g;  1Q86 C;  2XKO C;  5A2Q E;  5GAO l;  2DO3 A;  3V8K A;  4R56 A;  2DTO A;  4CI0 C;  2X4J A;  2DTH A;  3GNG A;  3CC4 A;  4NL2 A;  1OZ2 A;  3GIB A;  4C92 A;  3C95 A;  4B9X A;  4C8Q F;  1VQ5 A;  4XTV A;  1W4S A;  3BY7 A;  4BI3 A;  4QVD A;  1QLB A;  3G7Z A;  2RJF A;  1NJI C;  4PJO E;  5GAM e;  5CKD A;  1KQ1 A;  3TW6 A;  5GAN f;  3J81 E;  1M90 C;  4AKH A;  4FT4 A;  4PKC C;  3I55 T;  5LJ3 g;  1U8R A;  4E7K A;  1N8R U;  4RCB A;  4RMO A;  2GCX A;  5LJ3 d;  2FHD A;  4M7D D;  3M53 A;  4ZTJ A;  2Y4Y A;  1KC8 U;  4MDW A;  1K9M U;  3E1S A;  4B9W A;  1I5L A;  3QPH A;  3HKS A;  5CK9 A;  2QQB A;  4UC4 A;  4NL3 A;  1Q82 U;  1WJS A;  2RO0 A;  2EQM A;  2A3L A;  1M1K C;  2XG8 D;  3VKH A;  3CME T;  3OS1 A;  1KD1 U;  3OMC A;  5LJ3 f;  2YLB A;  1UEB A;  3V8J A;  5M9O A;  1H3Z A;  2LT4 A;  4AI6 A;  3LH0 A;  3M59 A;  4JLG A;  4BI4 A;  2E64 A;  3CXC S;  2P0P A;  4XQ3 A;  3QKJ A;  2VYT A;  4Y91 A;  4O6J A;  5FRN A;  4NOY A;  3JCM b;  2FVU A;  2R5A A;  4BBR M;  5CAI A;  4Y28 E;  2LC4 A;  3JCM c;  2AHJ B;  3A8H B;  1D3B A;  3MP6 A;  4M77 B;  4EMK C;  5KCH A;  5GAN 3;  5HK0 A;  1UGS B;  1WGS A;  3M5A A;  3QO3 A;  5GAM j;  3LYI A;  2QQ8 A;  2E6N A;  4KBM B;  1LOJ A;  3HFN A;  3GP8 A;  3CME A;  1YJN T;  3I56 T;  2DXC B;  3NTK A;  1TH7 A;  3SB2 A;  2PUK B;  4C8Q D;  2EQK A;  5GAM d;  4F7U A;  1OI1 A;  1VIE A;  4XU1 A;  2F69 A;  4M77 G;  1VQ9 T;  2DD4 A;  1WJR A;  3OQ5 A;  3P8D A;  3G71 T;  4A4H A;  5KE2 A;  1FWZ A;  2A7Y A;  3PGG A;  3QUI A;  4PLL A;  3JCM h;  3E9G A;  4RG8 A;  5GAN 8;  5FRM A;  3X28 B;  4OB0 B;  4QQ6 A;  1QW1 A;  2XDD A;  4MDX A;  1YJN A;  3I56 A;  2ZZD A;  2DD5 A;  5I2M A;  5LJ5 e;  4C92 F;  1YJ9 T;  2F5K A;  2LCC A;  3C94 A;  3OYH A;  2E5Q A;  3BDL A;  2RHX A;  3VU3 C;  1OZ3 A;  2RI3 A;  3VYG A;  3OYN A;  4ATO A;  3FDR A;  2KMG A;  2OAU A;  1BKB A;  2XIC A;  3E19 A;  4Q5W A;  1Q7Y U;  1VQ9 A;  3G71 A;  3C12 A;  3OA6 A;  3LLR A;  4HKE A;  3CPF A;  5CVI A;  3L42 A;  2RI5 A;  2ZPB B;  1ZBX A;  2DD4 B;  4JRQ A;  5FU7 B;  3L2R A;  4O5V A;  4EDU A;  4C0F A;  4EMH A;  3CCE T;  4C0Z A;  1M8V A;  3G4S T;  2IVW A;  5CO7 A;  1YJ9 A;  4A4G A;  1VQP A;  1G3T A;  1M1F A;  3OYK A;  5GAN 5;  2IG0 A;  4PJO B;  3SDZ A;  2XK0 A;  3L2V A;  3S3O A;  4JRK A;  1QVG A;  1XOV A;  3URG A;  1BI2 A;  2XHC A;  2CGH A;  2DK3 A;  2KK4 A;  4M78 A;  4C92 C;  4BE0 A;  2DJZ A;  3CMA T;  5D6Y A;  3LGL A;  3LX7 A;  3OYF A;  5HK3 A;  5GAN e;  2OTJ T;  5DY9 A;  4YTL A;  2DXB B;  3TCJ A;  2WSC E;  3JCM Q;  2LVM A;  5LJ5 j;  3QYH B;  2ZGW A;  5CKF A;  3BG9 A;  4KUI A;  2HQE A;  2GFA A;  1N9S A;  3CCE A;  3G4S A;  4PJO G;  3QXE B;  1Y71 A;  2PU9 B;  3LWH A;  4BD3 A;  3G6E T;  3KBG A;  2RHZ A;  4ME7 A;  2EFI A;  2JUF A;  2RK1 A;  2PVG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...