4OB1B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via co-crystallization
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Hydrolase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 73
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob1B02
3VYGB 2ZPIB 1UGPB 3A8HB 1JB0E 3VYHB 3X26B 4XK8E 1UGRB 2PVOB 3A8LB 2DXCA 2CZ0B 2ZPEB 1QP3A 3QYGB 3A8MB 1UGSB 2DPPB 1V29B 4OB3B 2DXBA 2O01E 3WVEB 2DXCB 2AHJB 4OB2B 2WSFE 2DD5B 4ZGJB 2QDYB 2WSEE 1AHJB 1PSEA 4ZGDB 2DD4B 1IREB 2WSCE 4FM4B 3QZ5B 2PUOB 2ZZDA 5L8RE 2CZ7B 3A8OB 2CZ1B 1DJ7B 3WVDB 1QP2A 1GXIE 4RKUE 3A8GB 2DD5A 3HHTB 3X25B 2ZPGB 3X24B 4L6V5 3X20B 3VYGA 2ZZDB 2ZCFB 2PUKB 1PSFA 2PVDB 3QZ9B 4OB1B 2DD4A 4ZGEB 2ZPFB 2CYZB 4Y28E 3LW5E 2PU9B 4KT0E 2ZPHB 2D0QB 4OB0B 3QYHB 2DXBB 2ZPBB 3QXEB 2CZ6B 3X28B 2PVGB 1UGQB
chains in the Genus database with same CATH superfamily
2ZPIB 1MV3A 2E1HA 2C4GB 1UGRB 1VINA 3MKDA 2DKGA 3D7SB 4C5EA 1CKBA 5LMKB 1KK7A 2HL5C 2QEXQ 5LJ3h 4M78D 1HD3A 4MZTA 2NUTA 3OW2A 3WVEB 3I35A 3OSSC 1P5EB 4PJJA 4OMOA 2QQ9A 4EOIB 4F7UE 3BLRB 3QDRB 1ZLMA 2PZ1A 5HKCA 4ZGDB 2COYA 5LL6S 2DTOA 5KE2A 5LJ5d 2P0KA 1WHHA 1LVKA 2WMBB 4M75B 4A4GA 4B6MA 2KAFA 2ZZDA 1M90U 4ZTFA 1KHCA 2E10A 1YI2Q 3H4CA 2QI2A 1X2KA 2C5NB 3TU4K 3QBYA 2CUBA 4M7AG 1VQ5T 1T3LA 3V8LA 3VS4A 4BDYA 3OYHA 4GY5A 3RMQA 2KE9A 2OTLA 4LDXA 3CMET 2EVRA 4C0FA 1WHMA 2DVJA 3SB2A 1WJQA 3HO8A 3VS6A 2E6NA 2X4WA 2P4RA 4CC2A 5ACBA 2YUNA 5GAMj 3CMEQ 1YWOA 3M9QA 4HXJA 4E7SA 3CCMT 2EKOA 1YI2A 1VOLA 1HJDA 1I1JA 5GAOp 2JTMA 1C9BA 1RLQC 2CDTA 4EORB 2YXYA 2EQJA 3EFOA 1XTDA 1GCQA 4PLIA 4IUTA 2ABLA 4JLIA 4AMCA 2JZ2A 2L3QA 2V1QA 4IUQA 4QW2A 3I56Q 4IMYB 2NUPA 4MIMA 2RHIA 2YRDA 1S72A 2KBTA 3CCUT 1SSHA 1TWBA 3EIDB 1X43A 5GAOq 5GANh 2QF7A 4FYXB 5ICPB 3X28B 1MHNA 4M78G 2COZA 3E9GA 4QVDA 1N8RR 5C6SA 1M8MA 1K0XA 3E9FA 3I55A 1RI9A 4JDSA 5FU6C 4BCJB 4IUPA 2ZPEB 3RKXA 1ENWA 2ECZA 1Q86R 2X4YA 7AT1B 1OULA 4ME7A 1QQJA 2MK5A 4CXAB 2XICA 3UA6A 1S72Q 4WF2A 1WDXA 4F14A 3TNWB 4LDUA 3OYKA 4QQDA 4E47A 4IUVA 1M90C 3OYLA 4OMNA 2DM1A 5GAN4 1OZ2A 2KMGA 3HBLA 1V76A 3T9NA 3ME9A 2VASA 4JRQA 3OW2S 3KFVA 1K9MR 1R8OB 2D8HA 1EZZB 3ULRB 2WIHB 4FT4A 4EMKC 1UHFA 4AFSC 2RO0A 3GF5A 3CCVQ 3EFOB 1VQOT 5EJCA 5IHKA 4RKUE 4HVVA 1NPRA 2DZCA 1TU0B 1ZA1B 2DF6A 3S3OA 1URCB 3CXCA 2JW4A 2QQBA 2K5IA 1PKTA 3SWNB 1ZSZC 1FX7A 4D8KA 1UNGD 1YNZA 3L2RA 1M1GA 4P5NA 4F6SB 3QDFA 5HQ0B 2FRWA 2RQRA 1PG5B 1MNDA 1G3TA 2KR3A 4OB1B 1SHFA 4EOKB 1PRLC 3HRUA 5GAN3 3DLLA 3EGUA 5KYNA 3REAB 2O4XB 4OR5B 5CAIA 2IN3A 4PL6A 4F7NB 2DE0X 5C0MA 2MIOA 1SRMA 1XJWB 3CCLT 2XDPA 1ZUKA 2D0QB 5GMKj 4MZPA 1KQSS 4KRDB 1D0YA 1MUZA 4RG8A 4ZN1A 2COWA 3EJ1B 2YLCA 3CCLQ 1AEYA 4J5YA 2K7AA 1GFDA 3DJBA 1YHQT 2DIGA 3DKMA 2DA9A 2A3LA 5FRMA 1X2QA 4L59A 4XK8E 1N9RA 1OKVB 3BLHB 5DQWA 2L3PA 1H4LD 1RADB 4ANJA 3CCUA 5LJ5g 3VV0A 4RODA 2ZGWA 2BZ8A 2LT4A 3EG1A 4YC3B 3VKIA 3G4SQ 1W4SA 3MP6A 5I2SA 1SHGA 2IPOB 1T0HA 4J9HA 5CKHA 2B86A 2KT1A 4M7AD 5FLXE 1LPLA 3JCMW 1M3CA 1WXTA 3CCEA 2RHUA 3CPFA 2HZYA 4FM4B 2BKDN 2PUOB 3M0PA 4Z6YA 2EIFA 3CMAT 4NC6A 5HBHB 2J6KA 3RGFB 1AZGB 3MJXA 4A4FA 3TN8B 1S72T 4J6XA 1N27A 2R7GA 4CFXB 2W96A 3DOGB 4BCOB 1B3QA 1K8AC 1VQMT 4EOLB 2V22B 2CCIB 4OMFB 1YFNA 4KUIA 5IHIA 3CCRQ 3GOXA 2QA4T 2OTJT 3PTAA 3HTRA 1BK2A 3JV3A 4KULA 2QK0A 2FZGB 2LNVA 9ATCB 2P4TA 3QZ9B 4AI6A 1RAGB 2QA4Q 1IRXA 1UFFA 2GFAA 2WMAB 4B9WA 3DTOA 1PNJA 1YBYA 3CCMA 1YI2T 1PD0A 2GTOA 3G71Q 4RTZA 1UEBA 3RIRA 5L23A 3C4SA 2KDSA 1AWOA 4HCKA 1H24B 5GAN6 1VIFA 1QCNA 3V7CA 1UB4A 3HSBA 3CC7T 2DFUA 2O2OA 2X35A 2YLBA 4F16A 2FB7A 3QJYA 2C06A 4QQGA 2EQMA 1OI1A 2LC4A 3VKGA 2GBQA 3MP1A 3VJPA 2DO3A 4CC4B 1M8VA 3JSCA 3JB9I 1E7PA 4ROEA 2WHBB 4KGXB 1YWPA 4OGCA 4ROCA 4EMGA 1YJ9Q 3TEEA 2DNUA 3CMEA 4F7UB 3NDQA 5KYWA 4BACA 1IZ6A 1E6HA 3VKHA 4J9EA 4R0KA 4M7AF 4PJOE 4HVWA 2VGNA 3CD6T 1OQKA 1NBEB 5FU6B 4YOOA 4GBQA 5EFQB 2ED1A 2ENMA 5D6YA 1LOJA 2IW6B 3BG5A 1H1SB 1WJSA 3I5RA 4LDVA 4QSHA 2YUPA 3OYDA 1PKDB 4JX6A 4HNVA 1BB9A 1M90R 5IXFA 1G3WA 1TTHB 3FIFA 1GXIE 2RH2A 3A8GB 4XQ3A 4MFEA 5A0DA 4JLGA 2J05A 4CFVB 5GAMg 1BCMA 4C92D 1BI1A 4HCCA 3BDLA 3HHTB 2WACA 2C5XB 3X24B 1YITT 2Y4XA 3S3NA 2PUKB 1YIJA 1WI7A 3NMZC 2LJ3A 1QVPA 3EG3A 3M5AA 3PGGA 2EFIA 1QVGP 3LW5E 4DEYA 3F70A 1FYNA 3CBPA 3EG9B 1VQ7Q 4KT0E 4E7HA 2SRCA 1UE9A 5FW9A 2A28A 4XU2A 2BS3A 4IURA 4JS5A 2EJFA 4XTUA 3CCVA 3QIIA 5LJ3d 2HSEB 2HCKA 1QMZB 2LJ0A 3JB9H 1Z9QA 2LQKA 3OS0A 1AOJA 1D3BA 4PFZA 4M7DD 1Q7YR 1WHGA 1UGQB 3RR6A 4C8QD 2F5TX 1GUXB 2RA2A 4BCMB 2NLUA 3EH1A 4JJDA 4HKEA 4RG2A 3A8MB 1VQ7A 8AT1B 5EC7A 1X27A 2C5OB 3M53A 4BY6C 4WTOB 2AZSA 4O6JA 5KYYB 3CC7Q 4EMHA 3FLGA 3NGPA 2HMAA 1D1CA 1VUBA 4M77D 1VQLT 4CFWB 1VQ9Q 5CEIB 2PNIA 4M77F 1VQNQ 4CFMB 1ZSZA 3ASKA 1O9KB 1I8FA 1QVFS 2XIDA 4HA8A 4PJLA 1VOMA 2KVQG 3PO3S 4FCYA 2CGHA 3KHIA 2R5AA 1VQNT 2L8DA 2EYYA 2A0FB 3WVDB 1MMNA 4HT9A 4PJOA 4RTXA 1AT1B 1UG1A 2DD5A 5CO7A 5IDPB 5LJ5e 2MMPA 4CRLB 2BKZB 2ROTA 1K73C 2M16A 2MAMA 4BI4A 1H3HA 1W2BS 4M75D 3H0FA 3I56A 1EX4A 3S6WA 3P8BB 3EAEA 3UA7A 4C0DB 4M75F 4PJOG 3DB3A 3I5SA 1X6OA 2CH4A 2OTJA 2AZVA 2KYBA 2DD4A 5KCHA 4MDWA 3HRTA 1K76A 1WHLA 3QKJA 4FW1A 1U1SA 3OSVA 2DRKA 2F2CA 1X6BA 2CREA 4M7DG 2ROLA 1SG5A 2I0NA 1QVGA 1OIYB 2MYSA 4F7UG 2R58A 4EMKB 3WXMB 4N0AC 3CCQA 1U06A 3CCRT 3SEMA 2CZ6B 4PJOF 3FDRA 5GANf 2FZKB 3RKWA 3H0IA 4BCND 4FYVB 1QVGS 4C8QA 1IHWA 3CCRA 3M56A 1Y0MA 4LDYA 3G33B 3EGDB 3G1JA 4IIOA 2EJGA 5FWCA 2DXBA 2KQWA 2L0AA 2RM4A 1VQ8A 3CCST 1O9KA 1GBRA 2DXCB 4WCIA 4C0GA 2AHJB 4BCNB 4LOCA 2FRYA 2QDJA 1BI2A 4Y92A 2HKQB 2EBPA 3CCSQ 3L42A 4C92G 4HNTA 1WHKA 2LRQA 2XHCA 3KUFA 3JCMd 4MFDA 1IREB 2QQ8A 5I22A 1XQHA 1D0XA 3JB9J 4A4KA 2X3WD 4ESRA 5GMKe 3JCMe 1VYUA 2VYTA 1JOWA 2RB6A 3LH5A 1ZSGA 2D6FA 1DJ7B 5A0GA 1QP2A 2P84A 3CCLA 1J3TA 2X1NB 1K8AU 4BY7X 3OYMA 1YJNQ 1OPLA 2BZXA 3TW6A 3H9NA 4JJNK 4EOPB 3M0RA 1SF9A 5HCKA 2BE9B 1FMWA 4BXXX 2L3RA 2VVKA 3HRSA 5A0LA 1YJNT 2LZ6B 2V1RA 3CD6Q 4FYYB 3X20B 4LE9A 2ZZDB 4OGRB 3VS2A 1WLPB 3RMSA 2KY9A 2RK1A 1Q86C 2UZEB 1M1KR 2DERA 1VQ6A 1W1FA 5HY6A 2RJCA 4JX4A 1OU8A 4M7DB 1G3SA 1I81A 3EFRA 3UDCA 5AYFA 2JXBA 4V2SA 4XTZA 2ZPHB 2GQVA 2JUFA 4FIBA 4FX3B 3TVTA 1NLOC 1RAFB 1Y07A 3Q1JA 4BUGA 4DA4A 4YOSA 3CXCS 3KXTA 5AT1B 2DVEA 4FW2A 1YHQA 3VYGB 3V8JA 3BLQB 2CP3A 4TVRA 1V1CA 4LUDA 2A36A 1N9SA 4JJCA 1B34B 1ZQ1A 2GTJA 2K3YA 2EKHA 2DEQA 4E7LA 1I0CA 1VQ7T 1JO8A 3SWNC 3MY1B 2PHGA 3H8ZA 2AK5A 1NEGA 1OKWB 1ZUUA 1NLPC 3MHXA 1QKXA 5IF1B 4Q5WA 1H25B 1TH7A 2R5MA 1PSEA 4HCZA 1M4ZA 4J9IA 1UDLA 1JJ2A 4M7AA 4M78E 4RCCA 2E5KA 5GAN7 1OL1B 1VQPT 2PMIB 1ZBJA 2EYXA 2DYIA 5GAOm 2JM8A 4BCGB 4M7AE 1SKUB 2W0ZA 4JX5A 2L5QA 3SD4A 3L2VA 2W9FA 4C8QC 2AKKA 1VQPQ 1TXQA 1M9SA 3QWYA 3EG0A 1FWZA 4DBRA 1VA7A 2EW3A 1H92A 1WJRA 4C0ZA 3X25B 1FXXA 1K0SA 3EG9A 1VQNA 3A98A 4C5GA 3DB4A 2QQSA 4N0AA 2WIPB 2G3RA 4VUBA 2RHYA 5GAOl 1VQ9T 2D8JA 2I53A 1W70A 3NPFA 2ZCFB 1UNHD 4XTYA 2ESWA 4ZGEB 1H8KA 4KUDK 2M02A 1B34A 4F17A 4BCKB 2CYZB 1VQPA 2RI3A 1VQ9A 2XU8A 4XTXA 5I21A 3I56T 2LCCA 4ELZC 4F7JB 4J8OA 2BTTA 1RAAB 2F2WA 4FSSA 2EQKA 4ATOA 4BCFB 4F7UF 1LCKA 4J9BA 2F1LA 2JN0A 1IGUA 1KSWA 4HNUA 3DDQB 1M2VB 3MY5B 2B9RA 2MPXC 1BYMA 2EYWA 3BFMA 3POMA 2M51A 3M0SA 2E65A 4UC4A 1KD1C 3V7SA 4DBHA 2JNGA 2IIMA 4LD9K 1JBMA 5IAYA 5KCOA 1RAEB 4M78C 1RUWA 2CP0A 2M0YA 1K8AR 4G6LB 4OMLA 4EC8B 2RQTA 1HXDA 4II1A 4MMLA 2E6ZA 3CMAA 3E1SA 5KE3A 3RNJA 4R56A 3CXCP 4OB2B 2RQVA 3INZA 3UT1A 2F2XA 4RMOA 1WA7A 1E7OA 4QVZA 2QG9B 3LYIA 5IHNA 3QSUA 4J9CA 5DQVA 1AWWA 2DL5A 2JS0A 3NTKA 4LNPA 3BG9A 4BD3A 1PHTA 3QZ5B 3MIAB 4C92C 4M77A 2DAQA 2K57A 4F7UA 2EGAA 2MF2A 4PJMA 2H8HA 1N8RU 2CT4A 5GAN2 1BI3A 1VYWB 2W99A 1G8XA 5EG2A 1SRLA 1BCOA 4A4EA 4IIMA 3UPUA 2RD1A 3MP8A 1ZUYA 4B9XA 4NS5A 4OMQA 4DBQA 1QKWA 2E3IA 5GAMe 3OYFA 4J7FA 1KQSA 3GTMS 2D0NA 2QAZA 3OY9A 3SFMA 3OYCA 5I11A 2LNHB 4LD6A 4M75A 4M77C 1SEMA 2WPAB 4C92B 1QLYA 3JB9G 2O88A 2KK4A 2J7IA 1C0MA 4C8QB 1GUXA 2RJFA 5CCAA 1ZP2A 2GNCA 1IGQA 1KQSP 4M7DC 4QVCA 3NTHA 1G2BA 3MI9B 4RTTA 3HFNA 2CCHB 1BU1A 3H41A 5KYYA 2DX1A 4J83A 5I2MA 4EDUA 1ARKA 2HEQA 1AWXA 2BPMB 3E2UA 3EFSA 4BDZA 1QLBA 3C0CA 3OS5A 1VQLQ 2V8JA 1VQ6Q 2UUEB 4M77B 1QW1A 1KD1R 2KEAA 4FSXA 1JXOA 3JCMV 5D6WA 2PK2A 2H3EB 5GJVB 2EPDA 4C8QF 2FEIA 2DETA 3L2WA 2O01E 5KYXB 4AG2C 3LGLA 2X51A 2FYKA 2KT8A 2DBMA 4YOZA 2QDLA 1OI9B 2EYZA 1E6GA 4QT7A 4ZGJB 1Q81R 1TUDA 1NJIR 1ZBXA 2FO0A 3N5BB 1ZA2B 2GGRA 4I3ZB 3QG1A 5CQXA 2IVWA 3GPLA 3S3MA 2A7YA 2RJEA 3URGA 1R0CB 4PFPA 1KQ1A 2P0QA 2CZ1B 2IVXA 2E4HA 4IUUA 1Q82C 4XAXB 4BE1A 4A54A 4F6WB 4BCPB 1NPPA 2DMOA 2YHTA 3MEVA 2RNAA 3VUBA 1C6VX 3CCUQ 3UATA 2C5VB 1KG1A 3M4YA 3FB9A 1XNIA 2HQEA 2KGTA 2K5FA 3G4SA 2MWPA 2PVDB 3VS3A 3G71T 3QO3A 1M3BA 1E9HB 4ZTJA 2KR6A 3M0TA 2VC8A 1I4K1 2NUTB 1HYOA 1KC8U 1U8RA 1VQOA 1QVFP 1ABQA 5CKEA 3ZL7C 4X9CA 3SHWA 4BY6B 1VQ5Q 1WFWA 3TW7A 4OMPA 3JB9F 2ZPBB 2WJ9A 3QWLA 1EFNA 1F1BB 5KYUA 4Z89A 2RMOA 3SWNA 2WXVB 4PKCC 3HL8A 2KI7A 5GMKi 1SPKA 1F5QB 5CKDA 1M5Q1 3P8DA 2G77A 2PJQA 1PWTA 2QTVA 4ORZA 3PFSA 3CCMQ 1WQ7A 3G71A 4PJOD 3R6OA 3CCVT 3QYGB 1G83A 3META 1KQ2A 1QCFA 1O9SA 4OMMA 5IHYA 2X3XD 1D3UB 4KGVB 1QVFA 3M0QA 1OL2B 2KRNA 2QA4A 3CCJA 3CCJT 1D3BB 1YJWA 3TCJA 1AVZC 2RHXA 3CC4T 2DRMA 3G7ZA 2EQIA 2H3JA 2RJDA 1AISB 2V8IA 4MMKA 3CD6A 1D09B 4NL2A 2DXUA 4KRCB 2K3BA 2MI6A 2CP2A 2I2LA 4F7SB 2MWOA 2UZDB 2DMEA 1OYXA 1BIBA 1WNLA 1XO2A 1YITQ 3C94A 2Y4YA 4BCIB 4PLLA 3JB9D 2CSIA 2CKKA 1OPKA 4LUEA 1UHCA 1X01A 4X1VA 1MV0B 1W98B 2BE7D 5GANg 1JSUB 5DM7R 4KRTA 3CCQT 1VQKA 4KH1B 2ZPFB 3RUXA 2YSQA 3LQ5B 2LQNA 1OZ3A 1WXBA 1TFBA 2XG8D 2YUOA 5GJWB 1D0ZA 3DLMA 4BCMD 3EGXA 1WIEA 1FMKA 2YT6A 3THKA 1Y71A 4C8QE 6AT1B 5M9OA 2EAYA 4M78B 2C0OA 4NSTB 1H26B 3EG2A 4AKGA 4QQ6A 2JMCA 1KXUA 3JRZA 5DLQE 1VQKQ 2ATCB 3G6EA 1NJIC 3CPWA 3GIBA 2VKNA 3VYHB 2LCSA 2ED0A 3QHRB 4M7AB 1BKBA 2CZ0B 1W2BP 2PQWA 4OGEA 4Y72B 1P92A 2BS2A 3E19A 1YIJQ 1NYFA 1GBQA 1YCSB 4JUVA 5GAMd 1QWEA 2K2VA 2C0IA 2VXEA 3CPWP 3J7AF 4JPBW 5FU7B 2QEXT 3CC4A 4KBMB 1FKMA 2WSEE 1N5ZA 2EGCA 2LCLA 4JZ3A 1NEBA 4BI8B 2QXFA 2C0TA 1PKSA 3NHNA 2V26A 3NFCA 5GANd 4EOOB 1OX8A 2V8KA 3GNFB 4ZNXA 2F5KA 3MEUA 2E70A 2CZ7B 2HKNA 3A8OB 1NZ9A 3I55T 5FGKB 1AD5A 3HPWA 2J6FA 2D1XA 1OEBA 4FYWB 1KJWA 2DZ9A 2DIQA 1KIKA 1RAHB 3QUIA 4M75G 2A08A 5HBEB 1S1NA 5IT9E 1X75C 3I55Q 3PIPA 1OIUB 2F2VA 2W2HA 3V7RA 5J39A 4MZMA 2FZCB 3TSZA 1YJWT 1GCQC 5GAMf 2CH4W 2DXTA 3NTIA 4ZN3A 4BE0A 5DY9A 4MDXA 2CS7A 2YUQA 4OF1A 5LJ3e 1RL2A 5FWBA 3OS2A 1TD6A 3BE3A 3MCAB 1YP5A 4E6RA 3GBQA 2LP5A 2PU9B 1CKAA 4CI0C 1FINB 2K2MA 2BS4A 4AKHA 3JCMc 4R55A 2SEMA 4J7IA 5DLOA 2OTJQ 5LJ5h 3LGFA 5CR2A 4EOSB 1GCPA 1WYXA 3G6ET 2EWNA 3X26B 4C5HA 4PJOC 1Q82R 2G6FX 4DOVA 1WHJA 2LW4A 2L3SA 4PNOA 3MEWA 2LX9A 1WPYA 3LWIA 1GH6B 3PMIA 3REBB 5IH2A 3I9QA 5I5ZB 2YDLA 2E5QA 1N6AA 3JAME 2QASA 3O0GD 2K6DA 3JCMP 3L2UA 5IN1A 2X4XA 3C95A 2CT3A 2LVMA 1IO6A 4C5IA 4BB7A 4XTWA 1VQ5A 1ZX6A 1HSQA 3ER0A 3M0UA 2IW9B 5IXBA 2VV5A 2FPEA 2XI9A 1K9AA 4E7KA 2HNIA 4II5B 3OYNA 5CKBA 2DTIA 4QKUA 3FEOA 4CC3A 3CCJQ 2LT1A 3UWNA 3CPWS 1ABOA 2JGZB 3JCMf 2HQXA 2EUFA 4DEXA 2CSQA 2FPDA 1AD6A 2K3XA 1K73R 5D7UA 3BW1A 4BBRM 2FG0A 2HBWA 1UUEA 3JCMQ 2QQAA 2HD0A 3AT1B 1OX9A 4DQ2A 3QHSA 4C8QG 4E7IA 3BHUB 2OJ2A 1VQ8Q 1H1RB 2RQWA 3P8HA 2G9XB 2JT4A 3M4GA 3CC7A 3HB9A 3EHRA 2NWMA 3VUZA 1FVVB 3PE0A 2KSSA 2JTEA 4JS4A 1GL5A 4FT2A 4EPCA 1YN8A 3LX7A 1WZOA 1Q7YU 2XKOC 1UGVA 2FVUA 4OB0B 2JJ9A 3CEYA 1VYTA 4AKIA 3LH0A 3L1AA 3JCMJ 4N4IA 3JCMX 1Y96B 3GLXA 1IHVA 1AWJA 1CSKA 1NYGA 5FRNA 2BZYA 4LN2A 2C6TB 1C1AA 2J6OA 1PD1A 3A8HB 3VRZA 1X6GA 2O9SA 1SSFA 4RCBA 4O5VA 1H27B 2KXDA 3PNWC 2LQ8A 4L5GA 3CC2A 2XDDA 4AFZC 4NL3A 2VB6A 1QP3A 4M6VA 1PCXA 2KNBB 1OGUB 5CKFA 1V29B 2LX7A 3OYEA 4OVAA 4J9GA 4JJBA 2O9VA 1PRMC 1VIEA 3CC2T 3OYYA 4ELYC 2W10A 3KBGA 3RBBB 4Z02A 5ECAA 2WSFE 2X9HA 3G6EQ 2DILA 1RABB 1N4MA 1IXDA 1T3SA 4BCQB 3G4ST 3UF4A 3B57A 4EIKA 1M30A 4JRIA 4F70B 1I07A 3VS5A 1G3NC 1QCOA 1YCYA 1M27C 1WGSA 1R0BG 5L8RE 1LNXA 3CBOA 2A37A 2PTKA 2OI3A 4F04B 4AFUC 3OMGA 4AT1B 2DL8A 3O5ZA 3JCMb 4EOJB 3O8VA 3CCET 2W9ZA 1GRIA 2JVVA 4CC7A 3QHWB 1Q86U 1Y96A 4TTHA 4CRIA 1WX6A 3C12A 2FPFA 3HKSA 5FU7C 3M03A 2OX7A 3TREA 1JU5C 1VQMQ 3MO8A 5L2WB 1PSFA 2MOXA 3CQTA 5HNBB 3OYAA 2CJMB 3VS0A 4KGZB 4PK4A 2AKLA 3LWHA 4N4GA 4M7AC 2HAXA 2NYSA 2VXFA 3CCSA 2LJ1A 3M58A 2KRMA 1MMAA 4LXCA 3HFOA 5LJ5j 2RF0A 1K4US 3J81E 1ACMB 2HL3A 1YJWQ 5GANe 1ZSZB 3QYBA 3QXEB 3VU3C 3OMCA 3QJ6A 2QGFB 2L2PA 4C0DC 5GAN5 3U23A 5CK9A 1UGPB 3BG3A 4PJNA 4A53A 2DL7A 3TNHB 2QGGA 3OB9A 3OA6A 1VYVA 2GF7A 3OBYA 1UGSB 2DPPB 2NUZA 4GLMA 2P0PA 4A4HA 1G3YA 4X34A 2I40B 4ELLA 3OS1A 4HLQA 2BUDA 1JXMA 1OOTA 1WQWA 1K1ZA 4LDWA 1W6XA 4BI3A 2FHDA 1Q95G 3VRYA 1AHJB 4ELJA 1W2BA 2E64A 4PJOB 3EH2A 2QGSA 2DD4B 4AFQC 3MEAA 1KC8R 2IW8B 3J80E 4XU1A 3BY7A 2HDAA 3RESA 5KYXA 3SDZA 5LJ3j 3OYJA 4FL6A 4BCHB 4GLKA 1G5VA 1TOVA 1H28B 1BI0A 2QQRA 5HBJB 4PFOA 1M1KC 3EOCB 3QWXX 3QYEA 2RI5A 3GP8A 5A2QE 3EHQA 1TG0A 5GMKl 3EGXB 2R57A 2UZBB 1Q81C 2YRVA 5J26A 1PM3A 3DDPB 2F69A 4NOYA 1MMGA 4X9DA 5GANj 2HSPA 3CMAQ 3PIOA 2WEVB 1TUCA 2E12A 4F6UB 2LTOA 1UNLD 1VQ4T 4EMKA 4RTVA 1Q81U 4YTLA 3VS7A 3GNGA 3VS1A 1JSTB 3PVLA 2UZLB 1R77A 4HL4A 2DJZA 2XDBA 4RTYA 4Y91A 2QEXA 1M1KU 3CBMA 4BBSM 3BHTB 1LJOA 2OAWA 3QPHA 4RTWA 3DL1A 3QYHB 1M3AA 1NG2A 3M54A 1YIJT 2XK0A 3FRNA 1JJ2P 3F5XB 3H0HA 1VQ8T 1NM7A 2JOYA 1KFZA 1FMVA 3EGDA 4EC9B 1HK9A 5GAN8 4M77G 5KYWB 3CC4Q 3LLRA 3FC3A 2ZAEA 4XU3A 3ZEHA 2OTLT 4DBFA 1K9MU 3H6ZA 2O4XA 1JB0E 2L89A 4A63B 3RDVA 2PVOB 3A8LB 2DXCA 4BCQD 1M2VA 2XMFA 1KD1U 3OBWA 2LDMA 2OTLQ 1MGQA 2EGEA 2NUPB 2CUDA 5KYUB 1JKWA 2GCXA 4M75C 1Q7YC 2QFZA 5J3BA 4J6YA 3R6NA 4JRPA 5CIUA 2LQWA 4D8DA 3BHVB 2K79A 2EQUA 2VWFA 2KYMA 4M75E 2Y90A 3TNIB 1M2OA 1RACB 1U1TA 5HVYB 1ZHIA 2DL4A 3IQLA 4D6WA 3L2QA 4EONB 3FJ5A 2WFYB 1XOVA 3HP9A 2VUBA 4M7DA 1EIFA 2K9GA 3CCQQ 2M9UA 2HBPA 4K11A 4RTUA 3RERA 2RPNA 2KROA 5IDNB 5CYIB 1Y57A 1WXUA 4E7JA 1TSFA 3A1PA 5HK0A 2PK9B 3OYIA 4HT8A 3CC2Q 1GY3B 3OW2P 2J06A 1NE8A 1K73U 4N4HA 2RK2A 4L6V5 3M55A 1NJIU 1BIAA 1MNEA 1JQQA 5LQFB 3M57A 5CVIA 3VYGA 1OU9A 4J9DA 2OAUA 4E7ZA 1BU2A 4Z88A 4FU6A 2M0OA 4XU0A 4CFUD 3JCMh 5GMKh 1PC0A 2DJQA 4JZ4A 1N8RC 1BBZA 2MCNA 3ZFJA 3CCEQ 2YWWA 3HZJA 2JS2A 1H641 2YRCA 4M4ZA 3PVQA 1RI0A 1AZEA 2GQIA 3AHUA 1U5SA 1B7TA 8ATCB 4C92A 3OYGA 2HQHA 4M7DF 1Z9ZA 1VQMA 2E41A 4CFUB 2QYZA 2DK3A 2PVGB 1VQ4Q 1TS9A 1YJNA 1H3ZA 2K4YA 2LMJA 2EYQA 3PMTA 3M59A 1I5OB 3TQ7P 4M7DE 1VQOQ 1X69A 3K7AM 4OB3B 2CP7A 2IG0A 1TUGB 2X4JA 1RLPC 4RUGA 4EOQB 4M78A 2RI2A 2DLPA 1JJ2S 1M1FA 3RKYA 4E2FB 1KHIA 1MMDA 4CFNB 4KH0B 1QWFA 2D9TA 4BE2A 2CP5A 2QTXA 2DD5B 2JMAA 2QDYB 4EOMB 1VQ4A 2JM9A 3V8KA 4J6WA 2KRSA 2CP6A 2WSCE 2DYBA 1U3OA 1D1AA 4UN0A 1QMCA 1A0NB 4C92F 1H1QB 2AT1B 2RN8A 1YJ9T 2KXCA 4XTVA 1YJ9A 2GFUA 5HK3A 5GAOn 5LJ3g 2EJ9A 1VQLA 2B8AA 5FROA 1O75A 2DTHA 2JTFA 2VGMA 3A5ZB 5KH6A 5LJ5f 2DBKA 2Z0WA 4C92E 1B07A 1Q82U 2RHZA 5BNJB 1JRIA 2ZPGB 5LJ3f 3FJPA 5D6XA 4BY1X 1K9MC 3PT9A 4AG1C 1VQ6T 4IKFA 4Z8AA 3BDUA 4HCBA 3ZBDA 4M78F 5GMKm 3MPUB 2K5LA 3OYBA 1YHQQ 3JCMg 2DEUA 4Y28E 2KMTA 1JEGA 5GAOr 1D1BA 1IB8A 2O31A 1T0JA 2M1HA 2XD0A 2BIVA 4HVUA 1OV3A 3L2ZA 4M77E 1UTIA 1H1PB 2AIRB 5GAMh 2RQUA 4J9FA 1VQKT 4DOWA 1GFCA 4F7LB 1UECA 2DXBB 2DL3A 1UJ0A 3TSWA 1KC8C 4OP0A 1RAIB 2FL7A 1Y7XA 1UJYA 4JRKA 5CQYA 1I5LA 1YITA 2E3HA 3OQ5A
chains in the Genus database with same CATH topology
2ZPIB 4M77B 3A8HB 2E1HA 4C8QD 1QW1A 1SSFA 4RCBA 2F5TX 4O5VA 2RA2A 3PNWC 1UGRB 2LQ8A 4L5GA 3CC2A 2DKGA 4FSXA 3JCMV 4NL3A 2XDDA 2NLUA 1QP3A 4M6VA 5D6WA 4HKEA 4RG2A 3A8MB 1VQ7A 4C5EA 5CKFA 1V29B 4C8QF 3M53A 5LJ3h 3OYEA 2O01E 4M78D 4MZTA 4OVAA 4BY6C 3L2WA 4O6JA 3LGLA 2FYKA 3OW2A 3WVEB 3OSSC 4EMHA 1VIEA 3FLGA 3CC2T 3OYYA 4ELYC 3KBGA 4Z02A 1VUBA 2WSFE 4M77D 2QQ9A 4F7UE 1VQLT 4ZGJB 3QDRB 4M77F 1ZBXA 5HKCA 3N5BB 3G4ST 3ASKA 3GIBA 4ZGDB 5LL6S 1I8FA 2DTOA 3QG1A 5KE2A 5LJ5d 2P0KA 5CQXA 1QVFS 4JRIA 2IVWA 2XIDA 4HA8A 4M75B 2KVQG 3GPLA 3S3MA 4A4GA 1YCYA 2A7YA 2RJEA 2KAFA 3URGA 2CGHA 3KHIA 2ZZDA 1M90U 2R5AA 1WGSA 1VQNT 5L8RE 1KQ1A 2P0QA 1LNXA 2L8DA 4ZTFA 2CZ1B 1KHCA 2E10A 3H4CA 3WVDB 4IUUA 4XAXB 4BE1A 2QI2A 3CBOA 1Q82C 4HT9A 4PJOA 4A54A 3TU4K 1NPPA 2YHTA 3MEVA 3QBYA 3VUBA 2DD5A 3OMGA 5CO7A 5LJ5e 3JCMb 4M7AG 2MMPA 1K73C 3O8VA 1VQ5T 3CCET 2M16A 2MAMA 4BI4A 3V8LA 4BDYA 2JVVA 3OYHA 4GY5A 3RMQA 1W2BS 1Q86U 1Y96A 4M75D 2OTLA 4CRIA 4LDXA 1KG1A 3M4YA 3I56A 3C12A 3S6WA 3CMET 3P8BB 3EAEA 3HKSA 5FU7C 4C0FA 4C0DB 3FB9A 4M75F 1XNIA 4PJOG 3SB2A 1WJQA 3DB3A 3TREA 2HQEA 3HO8A 2E6NA 1X6OA 2X4WA 3MO8A 2OTJA 2K5FA 1PSFA 3G4SA 2MWPA 2PVDB 3G71T 3QO3A 2DD4A 5GAMj 3OYAA 3M9QA 5KCHA 3CCMT 1YI2A 2EKOA 4MDWA 4ZTJA 3HRTA 3QKJA 5GAOp 2KR6A 2JTMA 1U1SA 3LWHA 2VC8A 4N4GA 4M7AC 3OSVA 2HAXA 1I4K1 2EQJA 1KC8U 1U8RA 2VXFA 1XTDA 3CCSA 1VQOA 4M7DG 3M58A 4PLIA 1QVGA 4IUTA 5CKEA 3HFOA 3JB9H 4F7UG 2R58A 5LJ5j 4JLIA 3WXMB 4EMKB 2JZ2A 4N0AC 4X9CA 4BY6B 4IUQA 4QW2A 3J81E 3TW7A 3CCQA 4MIMA 2RHIA 2ZPBB 1S72A 3CCUT 2WJ9A 3QWLA 3JB9F 3SWNA 5GAOq 5GANe 3CCRT 5GANh 2QF7A 3QYBA 4PKCC 3QXEB 2CZ6B 3HL8A 3X28B 1MHNA 4M78G 3VU3C 4PJOF 5GMKi 3FDRA 3E9GA 3OMCA 5GANf 3QJ6A 4QVDA 3RKWA 5C6SA 5CKDA 1M5Q1 4C0DC 5GAN5 5CK9A 1UGPB 3P8DA 2G77A 3BG3A 3E9FA 3I55A 4C8QA 1QVGS 4A53A 3PFSA 3CCRA 3M56A 4LDYA 1WQ7A 4JDSA 5FU6C 4IUPA 3G71A 4PJOD 3OB9A 2ZPEB 3R6OA 3RKXA 3CCVT 3QYGB 3META 1KQ2A 3OA6A 2X4YA 2GF7A 3OBYA 2EJGA 1UGSB 2DPPB 1O9SA 4ME7A 2DXBA 2P0PA 4A4HA 1QVFA 1G3YA 2KQWA 2RM4A 4X34A 2XICA 3CCJA 2QA4A 3CCST 1VQ8A 3CCJT 4WF2A 4HLQA 3OS1A 1D3BB 2DXCB 4LDUA 3TCJA 3OYKA 1YJWA 2BUDA 4QQDA 4C0GA 4E47A 4IUVA 1WQWA 2AHJB 1M90C 2RHXA 4LDWA 4LOCA 2QDJA 3CC4T 1BI2A 3G7ZA 3OYLA 4BI3A 5GAN4 2FHDA 1OZ2A 2KMGA 2H3JA 3HBLA 3L42A 1AHJB 2RJDA 4ELJA 4C92G 4HNTA 3T9NA 3ME9A 2V8IA 2E64A 2LRQA 1W2BA 4PJOB 2XHCA 3OW2S 3KUFA 4MMKA 3JCMd 4JRQA 4MFDA 1IREB 2DD4B 2QQ8A 3MEAA 4NL2A 1XQHA 2DXUA 3J80E 1R8OB 3JB9J 4XU1A 3BY7A 4A4KA 4FT4A 5GMKe 3JCMe 4EMKC 2VYTA 3RESA 2MI6A 3SDZA 5LJ3j 3OYJA 2RB6A 2RO0A 4FL6A 4GLKA 2D6FA 1G5VA 3GF5A 2I2LA 1DJ7B 5A0GA 1QP2A 2MWOA 1VQOT 3CCLA 5EJCA 1BI0A 1K8AU 2QQRA 4RKUE 3OYMA 1OYXA 1BIBA 1NPRA 2DZCA 1WNLA 1M1KC 3TW6A 3QYEA 2RI5A 4JJNK 3S3OA 3C94A 3GP8A 2Y4YA 4PLLA 5A2QE 3CXCA 3JB9D 2QQBA 2K5IA 3SWNB 2L3RA 1FX7A 5GMKl 3HRSA 5A0LA 1YJNT 2CKKA 3L2RA 2R57A 1M1GA 4P5NA 1Q81C 2YRVA 1VQNA 3X20B 5J26A 2ZZDB 4NOYA 1X01A 2F69A 4X9DA 5GANj 3RMSA 2KY9A 2RK1A 3PIOA 1G3TA 5GANg 1Q86C 5DM7R 4OB1B 2E12A 3CCQT 1VQKA 2LTOA 1VQ6A 3HRUA 1VQ4T 2ZPFB 3RUXA 4EMKA 5GAN3 5HY6A 3DLLA 1Q81U 2RJCA 4YTLA 4JX4A 2O4XB 4M7DB 1G3SA 1I81A 3EFRA 3GNGA 5CAIA 1OZ3A 4PL6A 2XG8D 3UDCA 5C0MA 5AYFA 3CCLT 2XDPA 4HL4A 2DJZA 3DLMA 4V2SA 4XTZA 2ZPHB 2D0QB 2XDBA 4Y91A 5GMKj 2GQVA 4MZPA 2QEXA 1M1KU 3CBMA 4BBSM 1LJOA 2JUFA 1Y71A 3QPHA 4FIBA 4C8QE 1KQSS 3DL1A 4RG8A 3QYHB 1Y07A 3Q1JA 3M54A 5M9OA 2EAYA 4ZN1A 1YIJT 2XK0A 3FRNA 4BUGA 1VQ8T 4M78B 2YLCA 2JOYA 4DA4A 4J5YA 3CXCS 4AKGA 1HK9A 5GAN8 4M77G 4QQ6A 3JRZA 3KXTA 5DLQE 3LLRA 2DVEA 3FC3A 1YHQT 3G6EA 3ZEHA 2DIGA 4XU3A 3CPWA 3VYGB 1YHQA 3DKMA 3H6ZA 1NJIC 2A3LA 2O4XA 1JB0E 1K9MU 3VYHB 3V8JA 2L89A 5FRMA 4L59A 4XK8E 1N9RA 4TVRA 1NJIU 4M7AB 2PVOB 3A8LB 1BKBA 2DXCA 2CZ0B 1N9SA 2PQWA 4OGEA 1B34B 3CCUA 1KD1U 3OBWA 2LDMA 5LJ5g 1ZQ1A 2K3YA 2DEQA 1MGQA 1P92A 2BS2A 3E19A 3VV0A 4E7LA 2GCXA 4M75C 1VQ7T 2ZGWA 1Q7YC 2QFZA 4JUVA 5J3BA 2LT4A 3SWNC 5GAMd 2K2VA 4J6YA 2VXEA 3VKIA 3H8ZA 1W4SA 4JRPA 3MP6A 3J7AF 5CIUA 5FU7B 5I2SA 2QEXT 3CC4A 4KBMB 1FKMA 2EQUA 5CKHA 2WSEE 3MHXA 4M75E 4Q5WA 2Y90A 1TH7A 2R5MA 4M7AD 5FLXE 1PSEA 4HCZA 1M4ZA 3JCMW 1JJ2A 2LCLA 4M7AA 3CCEA 1U1TA 4M78E 2RHUA 4BI8B 3CPFA 1ZHIA 4RCCA 5GAN7 1VQPT 2QXFA 4D6WA 4FM4B 5GANd 2BKDN 3NFCA 3L2QA 2PUOB 4Z6YA 2EIFA 5GAOm 3CMAT 4NC6A 1XOVA 2V8KA 2VUBA 3GNFB 3HP9A 2F5KA 3MEUA 4M7DA 4M7AE 1EIFA 2E70A 2CZ7B 3A8OB 4JX5A 2M9UA 2L5QA 2HBPA 3SD4A 3L2VA 4C8QC 1NZ9A 3RERA 4A4FA 3I55T 1S72T 3HPWA 4J6XA 1N27A 1M9SA 1FWZA 2DZ9A 4E7JA 2DIQA 3QUIA 4M75G 5HK0A 3OYIA 1WJRA 4HT8A 4C0ZA 3X25B 1K8AC 1VQMT 5IT9E 1FXXA 1X75C 4OMFB 1NE8A 3PIPA 1K73U 4C5GA 4KUIA 4N4HA 2RK2A 3DB4A 3GOXA 2QA4T 2QQSA 4ATOA 2OTJT 4N0AA 2G3RA 4L6V5 3M55A 2RHYA 4VUBA 1BIAA 5GAOl 3PTAA 1VQ9T 5CVIA 3V7RA 3M57A 3VYGA 4KULA 5J39A 2ZCFB 4MZMA 1YJWT 2LNVA 5GAMf 2OAUA 2DXTA 3NTIA 4ZN3A 2P4TA 4XTYA 3QZ9B 4AI6A 4BE0A 5DY9A 4FU6A 4MDXA 4ZGEB 4KUDK 1B34A 2M0OA 2CS7A 4OF1A 4XU0A 3JCMh 5GMKh 2CYZB 5LJ3e 1VQPA 2GFAA 1RL2A 2RI3A 3OS2A 1VQ9A 2XU8A 4B9WA 3MCAB 4XTXA 5I21A 3I56T 2LCCA 1YBYA 4ELZC 3CCMA 1YI2T 1N8RC 3ZFJA 1UEBA 3HZJA 3RIRA 1H641 4J8OA 2PU9B 1RI0A 3C4SA 3AHUA 4CI0C 2KDSA 5GAN6 2BS4A 1VIFA 2EQKA 4AKHA 3V7CA 1UB4A 4C92A 3CC7T 3HSBA 2X35A 2YLBA 3OYGA 4F7UF 2FB7A 3QJYA 3JCMc 2JN0A 4R55A 4M7DF 2C06A 4J7IA 4QQGA 2EQMA 5DLOA 4HNUA 2E41A 1VQMA 1OI1A 2LC4A 1BYMA 5LJ5h 3VKGA 3LGFA 5CR2A 2DK3A 2PVGB 3G6ET 2EWNA 3BFMA 3MP1A 1YJNA 2E65A 3X26B 4UC4A 4C5HA 1KD1C 2K4YA 3V7SA 2EYQA 4PJOC 3VJPA 1H3ZA 2DO3A 2JNGA 4DOVA 1M8VA 4LD9K 1JBMA 3JSCA 5IAYA 5KCOA 4PNOA 3PMTA 3MEWA 2LX9A 3JB9I 1E7PA 1WPYA 3M59A 3LWIA 4M78C 4M7DE 3PMIA 4OB3B 2IG0A 4OGCA 2X4JA 4EMGA 4M78A 2RI2A 3TEEA 1JJ2S 3CMEA 2E5QA 4F7UB 1HXDA 1N6AA 4II1A 4MMLA 1M1FA 3RKYA 3JAME 2E6ZA 3CMAA 3E1SA 5KE3A 1KHIA 4R56A 1IZ6A 4BACA 3VKHA 4M7AF 2D9TA 4PJOE 4OB2B 2VGNA 4BE2A 3L2UA 3INZA 2QTXA 5IN1A 2X4XA 2DD5B 3JCMP 3UT1A 3CD6T 2QDYB 3C95A 5FU6B 4RMOA 1VQ4A 4QVZA 3LYIA 2LVMA 3QSUA 4C5IA 3V8KA 4J6WA 4BB7A 5D6YA 4XTWA 1LOJA 3NTKA 1VQ5A 3BG9A 4BD3A 3BG5A 2WSCE 3ER0A 3QZ5B 1WJSA 4C92C 2VV5A 4M77A 2DAQA 4LDVA 4QSHA 2XI9A 3OYDA 4C92F 4E7KA 2HNIA 3OYNA 3CD6A 4JX6A 4HNVA 2K57A 2DTIA 4XTVA 5CKBA 4F7UA 2MF2A 1YJ9T 1YJ9A 1G3WA 3FEOA 3FIFA 1N8RU 2OTLT 5GAN2 1BI3A 2RH2A 1GXIE 3A8GB 2GFUA 4MFEA 2LT1A 4JLGA 4XQ3A 3UWNA 5A0DA 3CPWS 5HK3A 5GAOn 5GAMg 5EG2A 5LJ3g 2EJ9A 3JCMf 1VQLA 2HQXA 2B8AA 1BI1A 5FROA 4C92D 4HCCA 1O75A 2DTHA 2JTFA 4A4EA 2VGMA 3A5ZB 3BDLA 2K3XA 5KH6A 3HHTB 2RD1A 3MP8A 3UPUA 2WACA 5LJ5f 3BW1A 4BBRM 1Q82U 4C92E 4B9XA 3JCMQ 2RHZA 2QQAA 1JRIA 2HD0A 2ZPGB 5LJ3f 3X24B 3FJPA 4NS5A 4DQ2A 5D6XA 3OYFA 5GAMe 1YITT 3QHSA 4C8QG 4E7IA 2Y4XA 4J7FA 3PT9A 3S3NA 1KQSA 1K9MC 1VQ6T 3P8HA 3OY9A 4IKFA 2PUKB 3SFMA 3OYCA 3BDUA 4HCBA 3ZBDA 3M4GA 4M78F 1YIJA 5GMKm 3CC7A 4LD6A 3HB9A 2K5LA 3VUZA 3OYBA 1QVPA 4M75A 4M77C 3M5AA 3PGGA 2EFIA 3JCMg 2KSSA 4C92B 4Y28E 2KMTA 3JB9G 5GAOr 4JS4A 3LW5E 2M1HA 2KK4A 3F70A 4FT2A 4C8QB 4EPCA 2RJFA 3CBPA 3LX7A 5CCAA 2XD0A 2BIVA 3L2ZA 4KT0E 4E7HA 4M77E 1Q7YU 2XKOC 4M7DC 4XU2A 4QVCA 2BS3A 3NTHA 4IURA 2FVUA 3HFNA 5GAMh 4JS5A 4OB0B 3CEYA 4DOWA 1VQKT 2EJFA 2DXBB 4XTUA 4AKIA 3CCVA 3QIIA 3LH0A 4J83A 3L1AA 5I2MA 5LJ3d 4EDUA 1KC8C 4OP0A 3JCMJ 2FL7A 1Y7XA 4N4IA 3JCMX 1Y96B 2LQKA 3OS0A 3EFSA 4BDZA 4JRKA 3GLXA 1D3BA 5CQYA 1QLBA 1I5LA 1YITA 5FRNA 3OS5A 2V8JA 4M7DD 3OQ5A 1UGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYG B;  2ZPI B;  1UGP B;  3A8H B;  1JB0 E;  3VYH B;  3X26 B;  4XK8 E;  1UGR B;  2PVO B;  3A8L B;  2DXC A;  2CZ0 B;  2ZPE B;  1QP3 A;  3QYG B;  3A8M B;  1UGS B;  2DPP B;  1V29 B;  4OB3 B;  2DXB A;  2O01 E;  3WVE B;  2DXC B;  2AHJ B;  4OB2 B;  2WSF E;  2DD5 B;  4ZGJ B;  2QDY B;  2WSE E;  1AHJ B;  1PSE A;  4ZGD B;  2DD4 B;  1IRE B;  2WSC E;  4FM4 B;  3QZ5 B;  2PUO B;  2ZZD A;  5L8R E;  2CZ7 B;  3A8O B;  2CZ1 B;  1DJ7 B;  3WVD B;  1QP2 A;  1GXI E;  4RKU E;  3A8G B;  2DD5 A;  3HHT B;  3X25 B;  2ZPG B;  3X24 B;  4L6V 5;  3X20 B;  3VYG A;  2ZZD B;  2ZCF B;  2PUK B;  1PSF A;  2PVD B;  3QZ9 B;  4OB1 B;  2DD4 A;  4ZGE B;  2ZPF B;  2CYZ B;  4Y28 E;  3LW5 E;  2PU9 B;  4KT0 E;  2ZPH B;  2D0Q B;  4OB0 B;  3QYH B;  2DXB B;  2ZPB B;  3QXE B;  2CZ6 B;  3X28 B;  2PVG B;  1UGQ B; 
#chains in the Genus database with same CATH topology
 2ZPI B;  1MV3 A;  2E1H A;  2C4G B;  1UGR B;  1VIN A;  3MKD A;  2DKG A;  3D7S B;  4C5E A;  1CKB A;  5LMK B;  1KK7 A;  2HL5 C;  2QEX Q;  5LJ3 h;  4M78 D;  1HD3 A;  4MZT A;  2NUT A;  3OW2 A;  3WVE B;  3I35 A;  3OSS C;  1P5E B;  4PJJ A;  4OMO A;  2QQ9 A;  4EOI B;  4F7U E;  3BLR B;  3QDR B;  1ZLM A;  2PZ1 A;  5HKC A;  4ZGD B;  2COY A;  5LL6 S;  2DTO A;  5KE2 A;  5LJ5 d;  2P0K A;  1WHH A;  1LVK A;  2WMB B;  4M75 B;  4A4G A;  4B6M A;  2KAF A;  2ZZD A;  1M90 U;  4ZTF A;  1KHC A;  2E10 A;  1YI2 Q;  3H4C A;  2QI2 A;  1X2K A;  2C5N B;  3TU4 K;  3QBY A;  2CUB A;  4M7A G;  1VQ5 T;  1T3L A;  3V8L A;  3VS4 A;  4BDY A;  3OYH A;  4GY5 A;  3RMQ A;  2KE9 A;  2OTL A;  4LDX A;  3CME T;  2EVR A;  4C0F A;  1WHM A;  2DVJ A;  3SB2 A;  1WJQ A;  3HO8 A;  3VS6 A;  2E6N A;  2X4W A;  2P4R A;  4CC2 A;  5ACB A;  2YUN A;  5GAM j;  3CME Q;  1YWO A;  3M9Q A;  4HXJ A;  4E7S A;  3CCM T;  2EKO A;  1YI2 A;  1VOL A;  1HJD A;  1I1J A;  5GAO p;  2JTM A;  1C9B A;  1RLQ C;  2CDT A;  4EOR B;  2YXY A;  2EQJ A;  3EFO A;  1XTD A;  1GCQ A;  4PLI A;  4IUT A;  2ABL A;  4JLI A;  4AMC A;  2JZ2 A;  2L3Q A;  2V1Q A;  4IUQ A;  4QW2 A;  3I56 Q;  4IMY B;  2NUP A;  4MIM A;  2RHI A;  2YRD A;  1S72 A;  2KBT A;  3CCU T;  1SSH A;  1TWB A;  3EID B;  1X43 A;  5GAO q;  5GAN h;  2QF7 A;  4FYX B;  5ICP B;  3X28 B;  1MHN A;  4M78 G;  2COZ A;  3E9G A;  4QVD A;  1N8R R;  5C6S A;  1M8M A;  1K0X A;  3E9F A;  3I55 A;  1RI9 A;  4JDS A;  5FU6 C;  4BCJ B;  4IUP A;  2ZPE B;  3RKX A;  1ENW A;  2ECZ A;  1Q86 R;  2X4Y A;  7AT1 B;  1OUL A;  4ME7 A;  1QQJ A;  2MK5 A;  4CXA B;  2XIC A;  3UA6 A;  1S72 Q;  4WF2 A;  1WDX A;  4F14 A;  3TNW B;  4LDU A;  3OYK A;  4QQD A;  4E47 A;  4IUV A;  1M90 C;  3OYL A;  4OMN A;  2DM1 A;  5GAN 4;  1OZ2 A;  2KMG A;  3HBL A;  1V76 A;  3T9N A;  3ME9 A;  2VAS A;  4JRQ A;  3OW2 S;  3KFV A;  1K9M R;  1R8O B;  2D8H A;  1EZZ B;  3ULR B;  2WIH B;  4FT4 A;  4EMK C;  1UHF A;  4AFS C;  2RO0 A;  3GF5 A;  3CCV Q;  3EFO B;  1VQO T;  5EJC A;  5IHK A;  4RKU E;  4HVV A;  1NPR A;  2DZC A;  1TU0 B;  1ZA1 B;  2DF6 A;  3S3O A;  1URC B;  3CXC A;  2JW4 A;  2QQB A;  2K5I A;  1PKT A;  3SWN B;  1ZSZ C;  1FX7 A;  4D8K A;  1UNG D;  1YNZ A;  3L2R A;  1M1G A;  4P5N A;  4F6S B;  3QDF A;  5HQ0 B;  2FRW A;  2RQR A;  1PG5 B;  1MND A;  1G3T A;  2KR3 A;  4OB1 B;  1SHF A;  4EOK B;  1PRL C;  3HRU A;  5GAN 3;  3DLL A;  3EGU A;  5KYN A;  3REA B;  2O4X B;  4OR5 B;  5CAI A;  2IN3 A;  4PL6 A;  4F7N B;  2DE0 X;  5C0M A;  2MIO A;  1SRM A;  1XJW B;  3CCL T;  2XDP A;  1ZUK A;  2D0Q B;  5GMK j;  4MZP A;  1KQS S;  4KRD B;  1D0Y A;  1MUZ A;  4RG8 A;  4ZN1 A;  2COW A;  3EJ1 B;  2YLC A;  3CCL Q;  1AEY A;  4J5Y A;  2K7A A;  1GFD A;  3DJB A;  1YHQ T;  2DIG A;  3DKM A;  2DA9 A;  2A3L A;  5FRM A;  1X2Q A;  4L59 A;  4XK8 E;  1N9R A;  1OKV B;  3BLH B;  5DQW A;  2L3P A;  1H4L D;  1RAD B;  4ANJ A;  3CCU A;  5LJ5 g;  3VV0 A;  4ROD A;  2ZGW A;  2BZ8 A;  2LT4 A;  3EG1 A;  4YC3 B;  3VKI A;  3G4S Q;  1W4S A;  3MP6 A;  5I2S A;  1SHG A;  2IPO B;  1T0H A;  4J9H A;  5CKH A;  2B86 A;  2KT1 A;  4M7A D;  5FLX E;  1LPL A;  3JCM W;  1M3C A;  1WXT A;  3CCE A;  2RHU A;  3CPF A;  2HZY A;  4FM4 B;  2BKD N;  2PUO B;  3M0P A;  4Z6Y A;  2EIF A;  3CMA T;  4NC6 A;  5HBH B;  2J6K A;  3RGF B;  1AZG B;  3MJX A;  4A4F A;  3TN8 B;  1S72 T;  4J6X A;  1N27 A;  2R7G A;  4CFX B;  2W96 A;  3DOG B;  4BCO B;  1B3Q A;  1K8A C;  1VQM T;  4EOL B;  2V22 B;  2CCI B;  4OMF B;  1YFN A;  4KUI A;  5IHI A;  3CCR Q;  3GOX A;  2QA4 T;  2OTJ T;  3PTA A;  3HTR A;  1BK2 A;  3JV3 A;  4KUL A;  2QK0 A;  2FZG B;  2LNV A;  9ATC B;  2P4T A;  3QZ9 B;  4AI6 A;  1RAG B;  2QA4 Q;  1IRX A;  1UFF A;  2GFA A;  2WMA B;  4B9W A;  3DTO A;  1PNJ A;  1YBY A;  3CCM A;  1YI2 T;  1PD0 A;  2GTO A;  3G71 Q;  4RTZ A;  1UEB A;  3RIR A;  5L23 A;  3C4S A;  2KDS A;  1AWO A;  4HCK A;  1H24 B;  5GAN 6;  1VIF A;  1QCN A;  3V7C A;  1UB4 A;  3HSB A;  3CC7 T;  2DFU A;  2O2O A;  2X35 A;  2YLB A;  4F16 A;  2FB7 A;  3QJY A;  2C06 A;  4QQG A;  2EQM A;  1OI1 A;  2LC4 A;  3VKG A;  2GBQ A;  3MP1 A;  3VJP A;  2DO3 A;  4CC4 B;  1M8V A;  3JSC A;  3JB9 I;  1E7P A;  4ROE A;  2WHB B;  4KGX B;  1YWP A;  4OGC A;  4ROC A;  4EMG A;  1YJ9 Q;  3TEE A;  2DNU A;  3CME A;  4F7U B;  3NDQ A;  5KYW A;  4BAC A;  1IZ6 A;  1E6H A;  3VKH A;  4J9E A;  4R0K A;  4M7A F;  4PJO E;  4HVW A;  2VGN A;  3CD6 T;  1OQK A;  1NBE B;  5FU6 B;  4YOO A;  4GBQ A;  5EFQ B;  2ED1 A;  2ENM A;  5D6Y A;  1LOJ A;  2IW6 B;  3BG5 A;  1H1S B;  1WJS A;  3I5R A;  4LDV A;  4QSH A;  2YUP A;  3OYD A;  1PKD B;  4JX6 A;  4HNV A;  1BB9 A;  1M90 R;  5IXF A;  1G3W A;  1TTH B;  3FIF A;  1GXI E;  2RH2 A;  3A8G B;  4XQ3 A;  4MFE A;  5A0D A;  4JLG A;  2J05 A;  4CFV B;  5GAM g;  1BCM A;  4C92 D;  1BI1 A;  4HCC A;  3BDL A;  3HHT B;  2WAC A;  2C5X B;  3X24 B;  1YIT T;  2Y4X A;  3S3N A;  2PUK B;  1YIJ A;  1WI7 A;  3NMZ C;  2LJ3 A;  1QVP A;  3EG3 A;  3M5A A;  3PGG A;  2EFI A;  1QVG P;  3LW5 E;  4DEY A;  3F70 A;  1FYN A;  3CBP A;  3EG9 B;  1VQ7 Q;  4KT0 E;  4E7H A;  2SRC A;  1UE9 A;  5FW9 A;  2A28 A;  4XU2 A;  2BS3 A;  4IUR A;  4JS5 A;  2EJF A;  4XTU A;  3CCV A;  3QII A;  5LJ3 d;  2HSE B;  2HCK A;  1QMZ B;  2LJ0 A;  3JB9 H;  1Z9Q A;  2LQK A;  3OS0 A;  1AOJ A;  1D3B A;  4PFZ A;  4M7D D;  1Q7Y R;  1WHG A;  1UGQ B;  3RR6 A;  4C8Q D;  2F5T X;  1GUX B;  2RA2 A;  4BCM B;  2NLU A;  3EH1 A;  4JJD A;  4HKE A;  4RG2 A;  3A8M B;  1VQ7 A;  8AT1 B;  5EC7 A;  1X27 A;  2C5O B;  3M53 A;  4BY6 C;  4WTO B;  2AZS A;  4O6J A;  5KYY B;  3CC7 Q;  4EMH A;  3FLG A;  3NGP A;  2HMA A;  1D1C A;  1VUB A;  4M77 D;  1VQL T;  4CFW B;  1VQ9 Q;  5CEI B;  2PNI A;  4M77 F;  1VQN Q;  4CFM B;  1ZSZ A;  3ASK A;  1O9K B;  1I8F A;  1QVF S;  2XID A;  4HA8 A;  4PJL A;  1VOM A;  2KVQ G;  3PO3 S;  4FCY A;  2CGH A;  3KHI A;  2R5A A;  1VQN T;  2L8D A;  2EYY A;  2A0F B;  3WVD B;  1MMN A;  4HT9 A;  4PJO A;  4RTX A;  1AT1 B;  1UG1 A;  2DD5 A;  5CO7 A;  5IDP B;  5LJ5 e;  2MMP A;  4CRL B;  2BKZ B;  2ROT A;  1K73 C;  2M16 A;  2MAM A;  4BI4 A;  1H3H A;  1W2B S;  4M75 D;  3H0F A;  3I56 A;  1EX4 A;  3S6W A;  3P8B B;  3EAE A;  3UA7 A;  4C0D B;  4M75 F;  4PJO G;  3DB3 A;  3I5S A;  1X6O A;  2CH4 A;  2OTJ A;  2AZV A;  2KYB A;  2DD4 A;  5KCH A;  4MDW A;  3HRT A;  1K76 A;  1WHL A;  3QKJ A;  4FW1 A;  1U1S A;  3OSV A;  2DRK A;  2F2C A;  1X6B A;  2CRE A;  4M7D G;  2ROL A;  1SG5 A;  2I0N A;  1QVG A;  1OIY B;  2MYS A;  4F7U G;  2R58 A;  4EMK B;  3WXM B;  4N0A C;  3CCQ A;  1U06 A;  3CCR T;  3SEM A;  2CZ6 B;  4PJO F;  3FDR A;  5GAN f;  2FZK B;  3RKW A;  3H0I A;  4BCN D;  4FYV B;  1QVG S;  4C8Q A;  1IHW A;  3CCR A;  3M56 A;  1Y0M A;  4LDY A;  3G33 B;  3EGD B;  3G1J A;  4IIO A;  2EJG A;  5FWC A;  2DXB A;  2KQW A;  2L0A A;  2RM4 A;  1VQ8 A;  3CCS T;  1O9K A;  1GBR A;  2DXC B;  4WCI A;  4C0G A;  2AHJ B;  4BCN B;  4LOC A;  2FRY A;  2QDJ A;  1BI2 A;  4Y92 A;  2HKQ B;  2EBP A;  3CCS Q;  3L42 A;  4C92 G;  4HNT A;  1WHK A;  2LRQ A;  2XHC A;  3KUF A;  3JCM d;  4MFD A;  1IRE B;  2QQ8 A;  5I22 A;  1XQH A;  1D0X A;  3JB9 J;  4A4K A;  2X3W D;  4ESR A;  5GMK e;  3JCM e;  1VYU A;  2VYT A;  1JOW A;  2RB6 A;  3LH5 A;  1ZSG A;  2D6F A;  1DJ7 B;  5A0G A;  1QP2 A;  2P84 A;  3CCL A;  1J3T A;  2X1N B;  1K8A U;  4BY7 X;  3OYM A;  1YJN Q;  1OPL A;  2BZX A;  3TW6 A;  3H9N A;  4JJN K;  4EOP B;  3M0R A;  1SF9 A;  5HCK A;  2BE9 B;  1FMW A;  4BXX X;  2L3R A;  2VVK A;  3HRS A;  5A0L A;  1YJN T;  2LZ6 B;  2V1R A;  3CD6 Q;  4FYY B;  3X20 B;  4LE9 A;  2ZZD B;  4OGR B;  3VS2 A;  1WLP B;  3RMS A;  2KY9 A;  2RK1 A;  1Q86 C;  2UZE B;  1M1K R;  2DER A;  1VQ6 A;  1W1F A;  5HY6 A;  2RJC A;  4JX4 A;  1OU8 A;  4M7D B;  1G3S A;  1I81 A;  3EFR A;  3UDC A;  5AYF A;  2JXB A;  4V2S A;  4XTZ A;  2ZPH B;  2GQV A;  2JUF A;  4FIB A;  4FX3 B;  3TVT A;  1NLO C;  1RAF B;  1Y07 A;  3Q1J A;  4BUG A;  4DA4 A;  4YOS A;  3CXC S;  3KXT A;  5AT1 B;  2DVE A;  4FW2 A;  1YHQ A;  3VYG B;  3V8J A;  3BLQ B;  2CP3 A;  4TVR A;  1V1C A;  4LUD A;  2A36 A;  1N9S A;  4JJC A;  1B34 B;  1ZQ1 A;  2GTJ A;  2K3Y A;  2EKH A;  2DEQ A;  4E7L A;  1I0C A;  1VQ7 T;  1JO8 A;  3SWN C;  3MY1 B;  2PHG A;  3H8Z A;  2AK5 A;  1NEG A;  1OKW B;  1ZUU A;  1NLP C;  3MHX A;  1QKX A;  5IF1 B;  4Q5W A;  1H25 B;  1TH7 A;  2R5M A;  1PSE A;  4HCZ A;  1M4Z A;  4J9I A;  1UDL A;  1JJ2 A;  4M7A A;  4M78 E;  4RCC A;  2E5K A;  5GAN 7;  1OL1 B;  1VQP T;  2PMI B;  1ZBJ A;  2EYX A;  2DYI A;  5GAO m;  2JM8 A;  4BCG B;  4M7A E;  1SKU B;  2W0Z A;  4JX5 A;  2L5Q A;  3SD4 A;  3L2V A;  2W9F A;  4C8Q C;  2AKK A;  1VQP Q;  1TXQ A;  1M9S A;  3QWY A;  3EG0 A;  1FWZ A;  4DBR A;  1VA7 A;  2EW3 A;  1H92 A;  1WJR A;  4C0Z A;  3X25 B;  1FXX A;  1K0S A;  3EG9 A;  1VQN A;  3A98 A;  4C5G A;  3DB4 A;  2QQS A;  4N0A A;  2WIP B;  2G3R A;  4VUB A;  2RHY A;  5GAO l;  1VQ9 T;  2D8J A;  2I53 A;  1W70 A;  3NPF A;  2ZCF B;  1UNH D;  4XTY A;  2ESW A;  4ZGE B;  1H8K A;  4KUD K;  2M02 A;  1B34 A;  4F17 A;  4BCK B;  2CYZ B;  1VQP A;  2RI3 A;  1VQ9 A;  2XU8 A;  4XTX A;  5I21 A;  3I56 T;  2LCC A;  4ELZ C;  4F7J B;  4J8O A;  2BTT A;  1RAA B;  2F2W A;  4FSS A;  2EQK A;  4ATO A;  4BCF B;  4F7U F;  1LCK A;  4J9B A;  2F1L A;  2JN0 A;  1IGU A;  1KSW A;  4HNU A;  3DDQ B;  1M2V B;  3MY5 B;  2B9R A;  2MPX C;  1BYM A;  2EYW A;  3BFM A;  3POM A;  2M51 A;  3M0S A;  2E65 A;  4UC4 A;  1KD1 C;  3V7S A;  4DBH A;  2JNG A;  2IIM A;  4LD9 K;  1JBM A;  5IAY A;  5KCO A;  1RAE B;  4M78 C;  1RUW A;  2CP0 A;  2M0Y A;  1K8A R;  4G6L B;  4OML A;  4EC8 B;  2RQT A;  1HXD A;  4II1 A;  4MML A;  2E6Z A;  3CMA A;  3E1S A;  5KE3 A;  3RNJ A;  4R56 A;  3CXC P;  4OB2 B;  2RQV A;  3INZ A;  3UT1 A;  2F2X A;  4RMO A;  1WA7 A;  1E7O A;  4QVZ A;  2QG9 B;  3LYI A;  5IHN A;  3QSU A;  4J9C A;  5DQV A;  1AWW A;  2DL5 A;  2JS0 A;  3NTK A;  4LNP A;  3BG9 A;  4BD3 A;  1PHT A;  3QZ5 B;  3MIA B;  4C92 C;  4M77 A;  2DAQ A;  2K57 A;  4F7U A;  2EGA A;  2MF2 A;  4PJM A;  2H8H A;  1N8R U;  2CT4 A;  5GAN 2;  1BI3 A;  1VYW B;  2W99 A;  1G8X A;  5EG2 A;  1SRL A;  1BCO A;  4A4E A;  4IIM A;  3UPU A;  2RD1 A;  3MP8 A;  1ZUY A;  4B9X A;  4NS5 A;  4OMQ A;  4DBQ A;  1QKW A;  2E3I A;  5GAM e;  3OYF A;  4J7F A;  1KQS A;  3GTM S;  2D0N A;  2QAZ A;  3OY9 A;  3SFM A;  3OYC A;  5I11 A;  2LNH B;  4LD6 A;  4M75 A;  4M77 C;  1SEM A;  2WPA B;  4C92 B;  1QLY A;  3JB9 G;  2O88 A;  2KK4 A;  2J7I A;  1C0M A;  4C8Q B;  1GUX A;  2RJF A;  5CCA A;  1ZP2 A;  2GNC A;  1IGQ A;  1KQS P;  4M7D C;  4QVC A;  3NTH A;  1G2B A;  3MI9 B;  4RTT A;  3HFN A;  2CCH B;  1BU1 A;  3H41 A;  5KYY A;  2DX1 A;  4J83 A;  5I2M A;  4EDU A;  1ARK A;  2HEQ A;  1AWX A;  2BPM B;  3E2U A;  3EFS A;  4BDZ A;  1QLB A;  3C0C A;  3OS5 A;  1VQL Q;  2V8J A;  1VQ6 Q;  2UUE B;  4M77 B;  1QW1 A;  1KD1 R;  2KEA A;  4FSX A;  1JXO A;  3JCM V;  5D6W A;  2PK2 A;  2H3E B;  5GJV B;  2EPD A;  4C8Q F;  2FEI A;  2DET A;  3L2W A;  2O01 E;  5KYX B;  4AG2 C;  3LGL A;  2X51 A;  2FYK A;  2KT8 A;  2DBM A;  4YOZ A;  2QDL A;  1OI9 B;  2EYZ A;  1E6G A;  4QT7 A;  4ZGJ B;  1Q81 R;  1TUD A;  1NJI R;  1ZBX A;  2FO0 A;  3N5B B;  1ZA2 B;  2GGR A;  4I3Z B;  3QG1 A;  5CQX A;  2IVW A;  3GPL A;  3S3M A;  2A7Y A;  2RJE A;  3URG A;  1R0C B;  4PFP A;  1KQ1 A;  2P0Q A;  2CZ1 B;  2IVX A;  2E4H A;  4IUU A;  1Q82 C;  4XAX B;  4BE1 A;  4A54 A;  4F6W B;  4BCP B;  1NPP A;  2DMO A;  2YHT A;  3MEV A;  2RNA A;  3VUB A;  1C6V X;  3CCU Q;  3UAT A;  2C5V B;  1KG1 A;  3M4Y A;  3FB9 A;  1XNI A;  2HQE A;  2KGT A;  2K5F A;  3G4S A;  2MWP A;  2PVD B;  3VS3 A;  3G71 T;  3QO3 A;  1M3B A;  1E9H B;  4ZTJ A;  2KR6 A;  3M0T A;  2VC8 A;  1I4K 1;  2NUT B;  1HYO A;  1KC8 U;  1U8R A;  1VQO A;  1QVF P;  1ABQ A;  5CKE A;  3ZL7 C;  4X9C A;  3SHW A;  4BY6 B;  1VQ5 Q;  1WFW A;  3TW7 A;  4OMP A;  3JB9 F;  2ZPB B;  2WJ9 A;  3QWL A;  1EFN A;  1F1B B;  5KYU A;  4Z89 A;  2RMO A;  3SWN A;  2WXV B;  4PKC C;  3HL8 A;  2KI7 A;  5GMK i;  1SPK A;  1F5Q B;  5CKD A;  1M5Q 1;  3P8D A;  2G77 A;  2PJQ A;  1PWT A;  2QTV A;  4ORZ A;  3PFS A;  3CCM Q;  1WQ7 A;  3G71 A;  4PJO D;  3R6O A;  3CCV T;  3QYG B;  1G83 A;  3MET A;  1KQ2 A;  1QCF A;  1O9S A;  4OMM A;  5IHY A;  2X3X D;  1D3U B;  4KGV B;  1QVF A;  3M0Q A;  1OL2 B;  2KRN A;  2QA4 A;  3CCJ A;  3CCJ T;  1D3B B;  1YJW A;  3TCJ A;  1AVZ C;  2RHX A;  3CC4 T;  2DRM A;  3G7Z A;  2EQI A;  2H3J A;  2RJD A;  1AIS B;  2V8I A;  4MMK A;  3CD6 A;  1D09 B;  4NL2 A;  2DXU A;  4KRC B;  2K3B A;  2MI6 A;  2CP2 A;  2I2L A;  4F7S B;  2MWO A;  2UZD B;  2DME A;  1OYX A;  1BIB A;  1WNL A;  1XO2 A;  1YIT Q;  3C94 A;  2Y4Y A;  4BCI B;  4PLL A;  3JB9 D;  2CSI A;  2CKK A;  1OPK A;  4LUE A;  1UHC A;  1X01 A;  4X1V A;  1MV0 B;  1W98 B;  2BE7 D;  5GAN g;  1JSU B;  5DM7 R;  4KRT A;  3CCQ T;  1VQK A;  4KH1 B;  2ZPF B;  3RUX A;  2YSQ A;  3LQ5 B;  2LQN A;  1OZ3 A;  1WXB A;  1TFB A;  2XG8 D;  2YUO A;  5GJW B;  1D0Z A;  3DLM A;  4BCM D;  3EGX A;  1WIE A;  1FMK A;  2YT6 A;  3THK A;  1Y71 A;  4C8Q E;  6AT1 B;  5M9O A;  2EAY A;  4M78 B;  2C0O A;  4NST B;  1H26 B;  3EG2 A;  4AKG A;  4QQ6 A;  2JMC A;  1KXU A;  3JRZ A;  5DLQ E;  1VQK Q;  2ATC B;  3G6E A;  1NJI C;  3CPW A;  3GIB A;  2VKN A;  3VYH B;  2LCS A;  2ED0 A;  3QHR B;  4M7A B;  1BKB A;  2CZ0 B;  1W2B P;  2PQW A;  4OGE A;  4Y72 B;  1P92 A;  2BS2 A;  3E19 A;  1YIJ Q;  1NYF A;  1GBQ A;  1YCS B;  4JUV A;  5GAM d;  1QWE A;  2K2V A;  2C0I A;  2VXE A;  3CPW P;  3J7A F;  4JPB W;  5FU7 B;  2QEX T;  3CC4 A;  4KBM B;  1FKM A;  2WSE E;  1N5Z A;  2EGC A;  2LCL A;  4JZ3 A;  1NEB A;  4BI8 B;  2QXF A;  2C0T A;  1PKS A;  3NHN A;  2V26 A;  3NFC A;  5GAN d;  4EOO B;  1OX8 A;  2V8K A;  3GNF B;  4ZNX A;  2F5K A;  3MEU A;  2E70 A;  2CZ7 B;  2HKN A;  3A8O B;  1NZ9 A;  3I55 T;  5FGK B;  1AD5 A;  3HPW A;  2J6F A;  2D1X A;  1OEB A;  4FYW B;  1KJW A;  2DZ9 A;  2DIQ A;  1KIK A;  1RAH B;  3QUI A;  4M75 G;  2A08 A;  5HBE B;  1S1N A;  5IT9 E;  1X75 C;  3I55 Q;  3PIP A;  1OIU B;  2F2V A;  2W2H A;  3V7R A;  5J39 A;  4MZM A;  2FZC B;  3TSZ A;  1YJW T;  1GCQ C;  5GAM f;  2CH4 W;  2DXT A;  3NTI A;  4ZN3 A;  4BE0 A;  5DY9 A;  4MDX A;  2CS7 A;  2YUQ A;  4OF1 A;  5LJ3 e;  1RL2 A;  5FWB A;  3OS2 A;  1TD6 A;  3BE3 A;  3MCA B;  1YP5 A;  4E6R A;  3GBQ A;  2LP5 A;  2PU9 B;  1CKA A;  4CI0 C;  1FIN B;  2K2M A;  2BS4 A;  4AKH A;  3JCM c;  4R55 A;  2SEM A;  4J7I A;  5DLO A;  2OTJ Q;  5LJ5 h;  3LGF A;  5CR2 A;  4EOS B;  1GCP A;  1WYX A;  3G6E T;  2EWN A;  3X26 B;  4C5H A;  4PJO C;  1Q82 R;  2G6F X;  4DOV A;  1WHJ A;  2LW4 A;  2L3S A;  4PNO A;  3MEW A;  2LX9 A;  1WPY A;  3LWI A;  1GH6 B;  3PMI A;  3REB B;  5IH2 A;  3I9Q A;  5I5Z B;  2YDL A;  2E5Q A;  1N6A A;  3JAM E;  2QAS A;  3O0G D;  2K6D A;  3JCM P;  3L2U A;  5IN1 A;  2X4X A;  3C95 A;  2CT3 A;  2LVM A;  1IO6 A;  4C5I A;  4BB7 A;  4XTW A;  1VQ5 A;  1ZX6 A;  1HSQ A;  3ER0 A;  3M0U A;  2IW9 B;  5IXB A;  2VV5 A;  2FPE A;  2XI9 A;  1K9A A;  4E7K A;  2HNI A;  4II5 B;  3OYN A;  5CKB A;  2DTI A;  4QKU A;  3FEO A;  4CC3 A;  3CCJ Q;  2LT1 A;  3UWN A;  3CPW S;  1ABO A;  2JGZ B;  3JCM f;  2HQX A;  2EUF A;  4DEX A;  2CSQ A;  2FPD A;  1AD6 A;  2K3X A;  1K73 R;  5D7U A;  3BW1 A;  4BBR M;  2FG0 A;  2HBW A;  1UUE A;  3JCM Q;  2QQA A;  2HD0 A;  3AT1 B;  1OX9 A;  4DQ2 A;  3QHS A;  4C8Q G;  4E7I A;  3BHU B;  2OJ2 A;  1VQ8 Q;  1H1R B;  2RQW A;  3P8H A;  2G9X B;  2JT4 A;  3M4G A;  3CC7 A;  3HB9 A;  3EHR A;  2NWM A;  3VUZ A;  1FVV B;  3PE0 A;  2KSS A;  2JTE A;  4JS4 A;  1GL5 A;  4FT2 A;  4EPC A;  1YN8 A;  3LX7 A;  1WZO A;  1Q7Y U;  2XKO C;  1UGV A;  2FVU A;  4OB0 B;  2JJ9 A;  3CEY A;  1VYT A;  4AKI A;  3LH0 A;  3L1A A;  3JCM J;  4N4I A;  3JCM X;  1Y96 B;  3GLX A;  1IHV A;  1AWJ A;  1CSK A;  1NYG A;  5FRN A;  2BZY A;  4LN2 A;  2C6T B;  1C1A A;  2J6O A;  1PD1 A;  3A8H B;  3VRZ A;  1X6G A;  2O9S A;  1SSF A;  4RCB A;  4O5V A;  1H27 B;  2KXD A;  3PNW C;  2LQ8 A;  4L5G A;  3CC2 A;  2XDD A;  4AFZ C;  4NL3 A;  2VB6 A;  1QP3 A;  4M6V A;  1PCX A;  2KNB B;  1OGU B;  5CKF A;  1V29 B;  2LX7 A;  3OYE A;  4OVA A;  4J9G A;  4JJB A;  2O9V A;  1PRM C;  1VIE A;  3CC2 T;  3OYY A;  4ELY C;  2W10 A;  3KBG A;  3RBB B;  4Z02 A;  5ECA A;  2WSF E;  2X9H A;  3G6E Q;  2DIL A;  1RAB B;  1N4M A;  1IXD A;  1T3S A;  4BCQ B;  3G4S T;  3UF4 A;  3B57 A;  4EIK A;  1M30 A;  4JRI A;  4F70 B;  1I07 A;  3VS5 A;  1G3N C;  1QCO A;  1YCY A;  1M27 C;  1WGS A;  1R0B G;  5L8R E;  1LNX A;  3CBO A;  2A37 A;  2PTK A;  2OI3 A;  4F04 B;  4AFU C;  3OMG A;  4AT1 B;  2DL8 A;  3O5Z A;  3JCM b;  4EOJ B;  3O8V A;  3CCE T;  2W9Z A;  1GRI A;  2JVV A;  4CC7 A;  3QHW B;  1Q86 U;  1Y96 A;  4TTH A;  4CRI A;  1WX6 A;  3C12 A;  2FPF A;  3HKS A;  5FU7 C;  3M03 A;  2OX7 A;  3TRE A;  1JU5 C;  1VQM Q;  3MO8 A;  5L2W B;  1PSF A;  2MOX A;  3CQT A;  5HNB B;  3OYA A;  2CJM B;  3VS0 A;  4KGZ B;  4PK4 A;  2AKL A;  3LWH A;  4N4G A;  4M7A C;  2HAX A;  2NYS A;  2VXF A;  3CCS A;  2LJ1 A;  3M58 A;  2KRM A;  1MMA A;  4LXC A;  3HFO A;  5LJ5 j;  2RF0 A;  1K4U S;  3J81 E;  1ACM B;  2HL3 A;  1YJW Q;  5GAN e;  1ZSZ B;  3QYB A;  3QXE B;  3VU3 C;  3OMC A;  3QJ6 A;  2QGF B;  2L2P A;  4C0D C;  5GAN 5;  3U23 A;  5CK9 A;  1UGP B;  3BG3 A;  4PJN A;  4A53 A;  2DL7 A;  3TNH B;  2QGG A;  3OB9 A;  3OA6 A;  1VYV A;  2GF7 A;  3OBY A;  1UGS B;  2DPP B;  2NUZ A;  4GLM A;  2P0P A;  4A4H A;  1G3Y A;  4X34 A;  2I40 B;  4ELL A;  3OS1 A;  4HLQ A;  2BUD A;  1JXM A;  1OOT A;  1WQW A;  1K1Z A;  4LDW A;  1W6X A;  4BI3 A;  2FHD A;  1Q95 G;  3VRY A;  1AHJ B;  4ELJ A;  1W2B A;  2E64 A;  4PJO B;  3EH2 A;  2QGS A;  2DD4 B;  4AFQ C;  3MEA A;  1KC8 R;  2IW8 B;  3J80 E;  4XU1 A;  3BY7 A;  2HDA A;  3RES A;  5KYX A;  3SDZ A;  5LJ3 j;  3OYJ A;  4FL6 A;  4BCH B;  4GLK A;  1G5V A;  1TOV A;  1H28 B;  1BI0 A;  2QQR A;  5HBJ B;  4PFO A;  1M1K C;  3EOC B;  3QWX X;  3QYE A;  2RI5 A;  3GP8 A;  5A2Q E;  3EHQ A;  1TG0 A;  5GMK l;  3EGX B;  2R57 A;  2UZB B;  1Q81 C;  2YRV A;  5J26 A;  1PM3 A;  3DDP B;  2F69 A;  4NOY A;  1MMG A;  4X9D A;  5GAN j;  2HSP A;  3CMA Q;  3PIO A;  2WEV B;  1TUC A;  2E12 A;  4F6U B;  2LTO A;  1UNL D;  1VQ4 T;  4EMK A;  4RTV A;  1Q81 U;  4YTL A;  3VS7 A;  3GNG A;  3VS1 A;  1JST B;  3PVL A;  2UZL B;  1R77 A;  4HL4 A;  2DJZ A;  2XDB A;  4RTY A;  4Y91 A;  2QEX A;  1M1K U;  3CBM A;  4BBS M;  3BHT B;  1LJO A;  2OAW A;  3QPH A;  4RTW A;  3DL1 A;  3QYH B;  1M3A A;  1NG2 A;  3M54 A;  1YIJ T;  2XK0 A;  3FRN A;  1JJ2 P;  3F5X B;  3H0H A;  1VQ8 T;  1NM7 A;  2JOY A;  1KFZ A;  1FMV A;  3EGD A;  4EC9 B;  1HK9 A;  5GAN 8;  4M77 G;  5KYW B;  3CC4 Q;  3LLR A;  3FC3 A;  2ZAE A;  4XU3 A;  3ZEH A;  2OTL T;  4DBF A;  1K9M U;  3H6Z A;  2O4X A;  1JB0 E;  2L89 A;  4A63 B;  3RDV A;  2PVO B;  3A8L B;  2DXC A;  4BCQ D;  1M2V A;  2XMF A;  1KD1 U;  3OBW A;  2LDM A;  2OTL Q;  1MGQ A;  2EGE A;  2NUP B;  2CUD A;  5KYU B;  1JKW A;  2GCX A;  4M75 C;  1Q7Y C;  2QFZ A;  5J3B A;  4J6Y A;  3R6N A;  4JRP A;  5CIU A;  2LQW A;  4D8D A;  3BHV B;  2K79 A;  2EQU A;  2VWF A;  2KYM A;  4M75 E;  2Y90 A;  3TNI B;  1M2O A;  1RAC B;  1U1T A;  5HVY B;  1ZHI A;  2DL4 A;  3IQL A;  4D6W A;  3L2Q A;  4EON B;  3FJ5 A;  2WFY B;  1XOV A;  3HP9 A;  2VUB A;  4M7D A;  1EIF A;  2K9G A;  3CCQ Q;  2M9U A;  2HBP A;  4K11 A;  4RTU A;  3RER A;  2RPN A;  2KRO A;  5IDN B;  5CYI B;  1Y57 A;  1WXU A;  4E7J A;  1TSF A;  3A1P A;  5HK0 A;  2PK9 B;  3OYI A;  4HT8 A;  3CC2 Q;  1GY3 B;  3OW2 P;  2J06 A;  1NE8 A;  1K73 U;  4N4H A;  2RK2 A;  4L6V 5;  3M55 A;  1NJI U;  1BIA A;  1MNE A;  1JQQ A;  5LQF B;  3M57 A;  5CVI A;  3VYG A;  1OU9 A;  4J9D A;  2OAU A;  4E7Z A;  1BU2 A;  4Z88 A;  4FU6 A;  2M0O A;  4XU0 A;  4CFU D;  3JCM h;  5GMK h;  1PC0 A;  2DJQ A;  4JZ4 A;  1N8R C;  1BBZ A;  2MCN A;  3ZFJ A;  3CCE Q;  2YWW A;  3HZJ A;  2JS2 A;  1H64 1;  2YRC A;  4M4Z A;  3PVQ A;  1RI0 A;  1AZE A;  2GQI A;  3AHU A;  1U5S A;  1B7T A;  8ATC B;  4C92 A;  3OYG A;  2HQH A;  4M7D F;  1Z9Z A;  1VQM A;  2E41 A;  4CFU B;  2QYZ A;  2DK3 A;  2PVG B;  1VQ4 Q;  1TS9 A;  1YJN A;  1H3Z A;  2K4Y A;  2LMJ A;  2EYQ A;  3PMT A;  3M59 A;  1I5O B;  3TQ7 P;  4M7D E;  1VQO Q;  1X69 A;  3K7A M;  4OB3 B;  2CP7 A;  2IG0 A;  1TUG B;  2X4J A;  1RLP C;  4RUG A;  4EOQ B;  4M78 A;  2RI2 A;  2DLP A;  1JJ2 S;  1M1F A;  3RKY A;  4E2F B;  1KHI A;  1MMD A;  4CFN B;  4KH0 B;  1QWF A;  2D9T A;  4BE2 A;  2CP5 A;  2QTX A;  2DD5 B;  2JMA A;  2QDY B;  4EOM B;  1VQ4 A;  2JM9 A;  3V8K A;  4J6W A;  2KRS A;  2CP6 A;  2WSC E;  2DYB A;  1U3O A;  1D1A A;  4UN0 A;  1QMC A;  1A0N B;  4C92 F;  1H1Q B;  2AT1 B;  2RN8 A;  1YJ9 T;  2KXC A;  4XTV A;  1YJ9 A;  2GFU A;  5HK3 A;  5GAO n;  5LJ3 g;  2EJ9 A;  1VQL A;  2B8A A;  5FRO A;  1O75 A;  2DTH A;  2JTF A;  2VGM A;  3A5Z B;  5KH6 A;  5LJ5 f;  2DBK A;  2Z0W A;  4C92 E;  1B07 A;  1Q82 U;  2RHZ A;  5BNJ B;  1JRI A;  2ZPG B;  5LJ3 f;  3FJP A;  5D6X A;  4BY1 X;  1K9M C;  3PT9 A;  4AG1 C;  1VQ6 T;  4IKF A;  4Z8A A;  3BDU A;  4HCB A;  3ZBD A;  4M78 F;  5GMK m;  3MPU B;  2K5L A;  3OYB A;  1YHQ Q;  3JCM g;  2DEU A;  4Y28 E;  2KMT A;  1JEG A;  5GAO r;  1D1B A;  1IB8 A;  2O31 A;  1T0J A;  2M1H A;  2XD0 A;  2BIV A;  4HVU A;  1OV3 A;  3L2Z A;  4M77 E;  1UTI A;  1H1P B;  2AIR B;  5GAM h;  2RQU A;  4J9F A;  1VQK T;  4DOW A;  1GFC A;  4F7L B;  1UEC A;  2DXB B;  2DL3 A;  1UJ0 A;  3TSW A;  1KC8 C;  4OP0 A;  1RAI B;  2FL7 A;  1Y7X A;  1UJY A;  4JRK A;  5CQY A;  1I5L A;  1YIT A;  2E3H A;  3OQ5 A; 
#chains in the Genus database with same CATH homology
 2ZPI B;  4M77 B;  3A8H B;  2E1H A;  4C8Q D;  1QW1 A;  1SSF A;  4RCB A;  2F5T X;  4O5V A;  2RA2 A;  3PNW C;  1UGR B;  2LQ8 A;  4L5G A;  3CC2 A;  2DKG A;  4FSX A;  3JCM V;  4NL3 A;  2XDD A;  2NLU A;  1QP3 A;  4M6V A;  5D6W A;  4HKE A;  4RG2 A;  3A8M B;  1VQ7 A;  4C5E A;  5CKF A;  1V29 B;  4C8Q F;  3M53 A;  5LJ3 h;  3OYE A;  2O01 E;  4M78 D;  4MZT A;  4OVA A;  4BY6 C;  3L2W A;  4O6J A;  3LGL A;  2FYK A;  3OW2 A;  3WVE B;  3OSS C;  4EMH A;  1VIE A;  3FLG A;  3CC2 T;  3OYY A;  4ELY C;  3KBG A;  4Z02 A;  1VUB A;  2WSF E;  4M77 D;  2QQ9 A;  4F7U E;  1VQL T;  4ZGJ B;  3QDR B;  4M77 F;  1ZBX A;  5HKC A;  3N5B B;  3G4S T;  3ASK A;  3GIB A;  4ZGD B;  5LL6 S;  1I8F A;  2DTO A;  3QG1 A;  5KE2 A;  5LJ5 d;  2P0K A;  5CQX A;  1QVF S;  4JRI A;  2IVW A;  2XID A;  4HA8 A;  4M75 B;  2KVQ G;  3GPL A;  3S3M A;  4A4G A;  1YCY A;  2A7Y A;  2RJE A;  2KAF A;  3URG A;  2CGH A;  3KHI A;  2ZZD A;  1M90 U;  2R5A A;  1WGS A;  1VQN T;  5L8R E;  1KQ1 A;  2P0Q A;  1LNX A;  2L8D A;  4ZTF A;  2CZ1 B;  1KHC A;  2E10 A;  3H4C A;  3WVD B;  4IUU A;  4XAX B;  4BE1 A;  2QI2 A;  3CBO A;  1Q82 C;  4HT9 A;  4PJO A;  4A54 A;  3TU4 K;  1NPP A;  2YHT A;  3MEV A;  3QBY A;  3VUB A;  2DD5 A;  3OMG A;  5CO7 A;  5LJ5 e;  3JCM b;  4M7A G;  2MMP A;  1K73 C;  3O8V A;  1VQ5 T;  3CCE T;  2M16 A;  2MAM A;  4BI4 A;  3V8L A;  4BDY A;  2JVV A;  3OYH A;  4GY5 A;  3RMQ A;  1W2B S;  1Q86 U;  1Y96 A;  4M75 D;  2OTL A;  4CRI A;  4LDX A;  1KG1 A;  3M4Y A;  3I56 A;  3C12 A;  3S6W A;  3CME T;  3P8B B;  3EAE A;  3HKS A;  5FU7 C;  4C0F A;  4C0D B;  3FB9 A;  4M75 F;  1XNI A;  4PJO G;  3SB2 A;  1WJQ A;  3DB3 A;  3TRE A;  2HQE A;  3HO8 A;  2E6N A;  1X6O A;  2X4W A;  3MO8 A;  2OTJ A;  2K5F A;  1PSF A;  3G4S A;  2MWP A;  2PVD B;  3G71 T;  3QO3 A;  2DD4 A;  5GAM j;  3OYA A;  3M9Q A;  5KCH A;  3CCM T;  1YI2 A;  2EKO A;  4MDW A;  4ZTJ A;  3HRT A;  3QKJ A;  5GAO p;  2KR6 A;  2JTM A;  1U1S A;  3LWH A;  2VC8 A;  4N4G A;  4M7A C;  3OSV A;  2HAX A;  1I4K 1;  2EQJ A;  1KC8 U;  1U8R A;  2VXF A;  1XTD A;  3CCS A;  1VQO A;  4M7D G;  3M58 A;  4PLI A;  1QVG A;  4IUT A;  5CKE A;  3HFO A;  3JB9 H;  4F7U G;  2R58 A;  5LJ5 j;  4JLI A;  3WXM B;  4EMK B;  2JZ2 A;  4N0A C;  4X9C A;  4BY6 B;  4IUQ A;  4QW2 A;  3J81 E;  3TW7 A;  3CCQ A;  4MIM A;  2RHI A;  2ZPB B;  1S72 A;  3CCU T;  2WJ9 A;  3QWL A;  3JB9 F;  3SWN A;  5GAO q;  5GAN e;  3CCR T;  5GAN h;  2QF7 A;  3QYB A;  4PKC C;  3QXE B;  2CZ6 B;  3HL8 A;  3X28 B;  1MHN A;  4M78 G;  3VU3 C;  4PJO F;  5GMK i;  3FDR A;  3E9G A;  3OMC A;  5GAN f;  3QJ6 A;  4QVD A;  3RKW A;  5C6S A;  5CKD A;  1M5Q 1;  4C0D C;  5GAN 5;  5CK9 A;  1UGP B;  3P8D A;  2G77 A;  3BG3 A;  3E9F A;  3I55 A;  4C8Q A;  1QVG S;  4A53 A;  3PFS A;  3CCR A;  3M56 A;  4LDY A;  1WQ7 A;  4JDS A;  5FU6 C;  4IUP A;  3G71 A;  4PJO D;  3OB9 A;  2ZPE B;  3R6O A;  3RKX A;  3CCV T;  3QYG B;  3MET A;  1KQ2 A;  3OA6 A;  2X4Y A;  2GF7 A;  3OBY A;  2EJG A;  1UGS B;  2DPP B;  1O9S A;  4ME7 A;  2DXB A;  2P0P A;  4A4H A;  1QVF A;  1G3Y A;  2KQW A;  2RM4 A;  4X34 A;  2XIC A;  3CCJ A;  2QA4 A;  3CCS T;  1VQ8 A;  3CCJ T;  4WF2 A;  4HLQ A;  3OS1 A;  1D3B B;  2DXC B;  4LDU A;  3TCJ A;  3OYK A;  1YJW A;  2BUD A;  4QQD A;  4C0G A;  4E47 A;  4IUV A;  1WQW A;  2AHJ B;  1M90 C;  2RHX A;  4LDW A;  4LOC A;  2QDJ A;  3CC4 T;  1BI2 A;  3G7Z A;  3OYL A;  4BI3 A;  5GAN 4;  2FHD A;  1OZ2 A;  2KMG A;  2H3J A;  3HBL A;  3L42 A;  1AHJ B;  2RJD A;  4ELJ A;  4C92 G;  4HNT A;  3T9N A;  3ME9 A;  2V8I A;  2E64 A;  2LRQ A;  1W2B A;  4PJO B;  2XHC A;  3OW2 S;  3KUF A;  4MMK A;  3JCM d;  4JRQ A;  4MFD A;  1IRE B;  2DD4 B;  2QQ8 A;  3MEA A;  4NL2 A;  1XQH A;  2DXU A;  3J80 E;  1R8O B;  3JB9 J;  4XU1 A;  3BY7 A;  4A4K A;  4FT4 A;  5GMK e;  3JCM e;  4EMK C;  2VYT A;  3RES A;  2MI6 A;  3SDZ A;  5LJ3 j;  3OYJ A;  2RB6 A;  2RO0 A;  4FL6 A;  4GLK A;  2D6F A;  1G5V A;  3GF5 A;  2I2L A;  1DJ7 B;  5A0G A;  1QP2 A;  2MWO A;  1VQO T;  3CCL A;  5EJC A;  1BI0 A;  1K8A U;  2QQR A;  4RKU E;  3OYM A;  1OYX A;  1BIB A;  1NPR A;  2DZC A;  1WNL A;  1M1K C;  3TW6 A;  3QYE A;  2RI5 A;  4JJN K;  3S3O A;  3C94 A;  3GP8 A;  2Y4Y A;  4PLL A;  5A2Q E;  3CXC A;  3JB9 D;  2QQB A;  2K5I A;  3SWN B;  2L3R A;  1FX7 A;  5GMK l;  3HRS A;  5A0L A;  1YJN T;  2CKK A;  3L2R A;  2R57 A;  1M1G A;  4P5N A;  1Q81 C;  2YRV A;  1VQN A;  3X20 B;  5J26 A;  2ZZD B;  4NOY A;  1X01 A;  2F69 A;  4X9D A;  5GAN j;  3RMS A;  2KY9 A;  2RK1 A;  3PIO A;  1G3T A;  5GAN g;  1Q86 C;  5DM7 R;  4OB1 B;  2E12 A;  3CCQ T;  1VQK A;  2LTO A;  1VQ6 A;  3HRU A;  1VQ4 T;  2ZPF B;  3RUX A;  4EMK A;  5GAN 3;  5HY6 A;  3DLL A;  1Q81 U;  2RJC A;  4YTL A;  4JX4 A;  2O4X B;  4M7D B;  1G3S A;  1I81 A;  3EFR A;  3GNG A;  5CAI A;  1OZ3 A;  4PL6 A;  2XG8 D;  3UDC A;  5C0M A;  5AYF A;  3CCL T;  2XDP A;  4HL4 A;  2DJZ A;  3DLM A;  4V2S A;  4XTZ A;  2ZPH B;  2D0Q B;  2XDB A;  4Y91 A;  5GMK j;  2GQV A;  4MZP A;  2QEX A;  1M1K U;  3CBM A;  4BBS M;  1LJO A;  2JUF A;  1Y71 A;  3QPH A;  4FIB A;  4C8Q E;  1KQS S;  3DL1 A;  4RG8 A;  3QYH B;  1Y07 A;  3Q1J A;  3M54 A;  5M9O A;  2EAY A;  4ZN1 A;  1YIJ T;  2XK0 A;  3FRN A;  4BUG A;  1VQ8 T;  4M78 B;  2YLC A;  2JOY A;  4DA4 A;  4J5Y A;  3CXC S;  4AKG A;  1HK9 A;  5GAN 8;  4M77 G;  4QQ6 A;  3JRZ A;  3KXT A;  5DLQ E;  3LLR A;  2DVE A;  3FC3 A;  1YHQ T;  3G6E A;  3ZEH A;  2DIG A;  4XU3 A;  3CPW A;  3VYG B;  1YHQ A;  3DKM A;  3H6Z A;  1NJI C;  2A3L A;  2O4X A;  1JB0 E;  1K9M U;  3VYH B;  3V8J A;  2L89 A;  5FRM A;  4L59 A;  4XK8 E;  1N9R A;  4TVR A;  1NJI U;  4M7A B;  2PVO B;  3A8L B;  1BKB A;  2DXC A;  2CZ0 B;  1N9S A;  2PQW A;  4OGE A;  1B34 B;  3CCU A;  1KD1 U;  3OBW A;  2LDM A;  5LJ5 g;  1ZQ1 A;  2K3Y A;  2DEQ A;  1MGQ A;  1P92 A;  2BS2 A;  3E19 A;  3VV0 A;  4E7L A;  2GCX A;  4M75 C;  1VQ7 T;  2ZGW A;  1Q7Y C;  2QFZ A;  4JUV A;  5J3B A;  2LT4 A;  3SWN C;  5GAM d;  2K2V A;  4J6Y A;  2VXE A;  3VKI A;  3H8Z A;  1W4S A;  4JRP A;  3MP6 A;  3J7A F;  5CIU A;  5FU7 B;  5I2S A;  2QEX T;  3CC4 A;  4KBM B;  1FKM A;  2EQU A;  5CKH A;  2WSE E;  3MHX A;  4M75 E;  4Q5W A;  2Y90 A;  1TH7 A;  2R5M A;  4M7A D;  5FLX E;  1PSE A;  4HCZ A;  1M4Z A;  3JCM W;  1JJ2 A;  2LCL A;  4M7A A;  3CCE A;  1U1T A;  4M78 E;  2RHU A;  4BI8 B;  3CPF A;  1ZHI A;  4RCC A;  5GAN 7;  1VQP T;  2QXF A;  4D6W A;  4FM4 B;  5GAN d;  2BKD N;  3NFC A;  3L2Q A;  2PUO B;  4Z6Y A;  2EIF A;  5GAO m;  3CMA T;  4NC6 A;  1XOV A;  2V8K A;  2VUB A;  3GNF B;  3HP9 A;  2F5K A;  3MEU A;  4M7D A;  4M7A E;  1EIF A;  2E70 A;  2CZ7 B;  3A8O B;  4JX5 A;  2M9U A;  2L5Q A;  2HBP A;  3SD4 A;  3L2V A;  4C8Q C;  1NZ9 A;  3RER A;  4A4F A;  3I55 T;  1S72 T;  3HPW A;  4J6X A;  1N27 A;  1M9S A;  1FWZ A;  2DZ9 A;  4E7J A;  2DIQ A;  3QUI A;  4M75 G;  5HK0 A;  3OYI A;  1WJR A;  4HT8 A;  4C0Z A;  3X25 B;  1K8A C;  1VQM T;  5IT9 E;  1FXX A;  1X75 C;  4OMF B;  1NE8 A;  3PIP A;  1K73 U;  4C5G A;  4KUI A;  4N4H A;  2RK2 A;  3DB4 A;  3GOX A;  2QA4 T;  2QQS A;  4ATO A;  2OTJ T;  4N0A A;  2G3R A;  4L6V 5;  3M55 A;  2RHY A;  4VUB A;  1BIA A;  5GAO l;  3PTA A;  1VQ9 T;  5CVI A;  3V7R A;  3M57 A;  3VYG A;  4KUL A;  5J39 A;  2ZCF B;  4MZM A;  1YJW T;  2LNV A;  5GAM f;  2OAU A;  2DXT A;  3NTI A;  4ZN3 A;  2P4T A;  4XTY A;  3QZ9 B;  4AI6 A;  4BE0 A;  5DY9 A;  4FU6 A;  4MDX A;  4ZGE B;  4KUD K;  1B34 A;  2M0O A;  2CS7 A;  4OF1 A;  4XU0 A;  3JCM h;  5GMK h;  2CYZ B;  5LJ3 e;  1VQP A;  2GFA A;  1RL2 A;  2RI3 A;  3OS2 A;  1VQ9 A;  2XU8 A;  4B9W A;  3MCA B;  4XTX A;  5I21 A;  3I56 T;  2LCC A;  1YBY A;  4ELZ C;  3CCM A;  1YI2 T;  1N8R C;  3ZFJ A;  1UEB A;  3HZJ A;  3RIR A;  1H64 1;  4J8O A;  2PU9 B;  1RI0 A;  3C4S A;  3AHU A;  4CI0 C;  2KDS A;  5GAN 6;  2BS4 A;  1VIF A;  2EQK A;  4AKH A;  3V7C A;  1UB4 A;  4C92 A;  3CC7 T;  3HSB A;  2X35 A;  2YLB A;  3OYG A;  4F7U F;  2FB7 A;  3QJY A;  3JCM c;  2JN0 A;  4R55 A;  4M7D F;  2C06 A;  4J7I A;  4QQG A;  2EQM A;  5DLO A;  4HNU A;  2E41 A;  1VQM A;  1OI1 A;  2LC4 A;  1BYM A;  5LJ5 h;  3VKG A;  3LGF A;  5CR2 A;  2DK3 A;  2PVG B;  3G6E T;  2EWN A;  3BFM A;  3MP1 A;  1YJN A;  2E65 A;  3X26 B;  4UC4 A;  4C5H A;  1KD1 C;  2K4Y A;  3V7S A;  2EYQ A;  4PJO C;  3VJP A;  1H3Z A;  2DO3 A;  2JNG A;  4DOV A;  1M8V A;  4LD9 K;  1JBM A;  3JSC A;  5IAY A;  5KCO A;  4PNO A;  3PMT A;  3MEW A;  2LX9 A;  3JB9 I;  1E7P A;  1WPY A;  3M59 A;  3LWI A;  4M78 C;  4M7D E;  3PMI A;  4OB3 B;  2IG0 A;  4OGC A;  2X4J A;  4EMG A;  4M78 A;  2RI2 A;  3TEE A;  1JJ2 S;  3CME A;  2E5Q A;  4F7U B;  1HXD A;  1N6A A;  4II1 A;  4MML A;  1M1F A;  3RKY A;  3JAM E;  2E6Z A;  3CMA A;  3E1S A;  5KE3 A;  1KHI A;  4R56 A;  1IZ6 A;  4BAC A;  3VKH A;  4M7A F;  2D9T A;  4PJO E;  4OB2 B;  2VGN A;  4BE2 A;  3L2U A;  3INZ A;  2QTX A;  5IN1 A;  2X4X A;  2DD5 B;  3JCM P;  3UT1 A;  3CD6 T;  2QDY B;  3C95 A;  5FU6 B;  4RMO A;  1VQ4 A;  4QVZ A;  3LYI A;  2LVM A;  3QSU A;  4C5I A;  3V8K A;  4J6W A;  4BB7 A;  5D6Y A;  4XTW A;  1LOJ A;  3NTK A;  1VQ5 A;  3BG9 A;  4BD3 A;  3BG5 A;  2WSC E;  3ER0 A;  3QZ5 B;  1WJS A;  4C92 C;  2VV5 A;  4M77 A;  2DAQ A;  4LDV A;  4QSH A;  2XI9 A;  3OYD A;  4C92 F;  4E7K A;  2HNI A;  3OYN A;  3CD6 A;  4JX6 A;  4HNV A;  2K57 A;  2DTI A;  4XTV A;  5CKB A;  4F7U A;  2MF2 A;  1YJ9 T;  1YJ9 A;  1G3W A;  3FEO A;  3FIF A;  1N8R U;  2OTL T;  5GAN 2;  1BI3 A;  2RH2 A;  1GXI E;  3A8G B;  2GFU A;  4MFE A;  2LT1 A;  4JLG A;  4XQ3 A;  3UWN A;  5A0D A;  3CPW S;  5HK3 A;  5GAO n;  5GAM g;  5EG2 A;  5LJ3 g;  2EJ9 A;  3JCM f;  1VQL A;  2HQX A;  2B8A A;  1BI1 A;  5FRO A;  4C92 D;  4HCC A;  1O75 A;  2DTH A;  2JTF A;  4A4E A;  2VGM A;  3A5Z B;  3BDL A;  2K3X A;  5KH6 A;  3HHT B;  2RD1 A;  3MP8 A;  3UPU A;  2WAC A;  5LJ5 f;  3BW1 A;  4BBR M;  1Q82 U;  4C92 E;  4B9X A;  3JCM Q;  2RHZ A;  2QQA A;  1JRI A;  2HD0 A;  2ZPG B;  5LJ3 f;  3X24 B;  3FJP A;  4NS5 A;  4DQ2 A;  5D6X A;  3OYF A;  5GAM e;  1YIT T;  3QHS A;  4C8Q G;  4E7I A;  2Y4X A;  4J7F A;  3PT9 A;  3S3N A;  1KQS A;  1K9M C;  1VQ6 T;  3P8H A;  3OY9 A;  4IKF A;  2PUK B;  3SFM A;  3OYC A;  3BDU A;  4HCB A;  3ZBD A;  3M4G A;  4M78 F;  1YIJ A;  5GMK m;  3CC7 A;  4LD6 A;  3HB9 A;  2K5L A;  3VUZ A;  3OYB A;  1QVP A;  4M75 A;  4M77 C;  3M5A A;  3PGG A;  2EFI A;  3JCM g;  2KSS A;  4C92 B;  4Y28 E;  2KMT A;  3JB9 G;  5GAO r;  4JS4 A;  3LW5 E;  2M1H A;  2KK4 A;  3F70 A;  4FT2 A;  4C8Q B;  4EPC A;  2RJF A;  3CBP A;  3LX7 A;  5CCA A;  2XD0 A;  2BIV A;  3L2Z A;  4KT0 E;  4E7H A;  4M77 E;  1Q7Y U;  2XKO C;  4M7D C;  4XU2 A;  4QVC A;  2BS3 A;  3NTH A;  4IUR A;  2FVU A;  3HFN A;  5GAM h;  4JS5 A;  4OB0 B;  3CEY A;  4DOW A;  1VQK T;  2EJF A;  2DXB B;  4XTU A;  4AKI A;  3CCV A;  3QII A;  3LH0 A;  4J83 A;  3L1A A;  5I2M A;  5LJ3 d;  4EDU A;  1KC8 C;  4OP0 A;  3JCM J;  2FL7 A;  1Y7X A;  4N4I A;  3JCM X;  1Y96 B;  2LQK A;  3OS0 A;  3EFS A;  4BDZ A;  4JRK A;  3GLX A;  1D3B A;  5CQY A;  1QLB A;  1I5L A;  1YIT A;  5FRN A;  3OS5 A;  2V8J A;  4M7D D;  3OQ5 A;  1UGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...