4OB1B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via co-crystallization
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Hydrolase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 73
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob1B02
3QZ5B 3A8MB 2DD5B 4ZGJB 1QP3A 2WSEE 1UGRB 3QZ9B 2DD4A 3A8GB 2ZPHB 2WSFE 4OB0B 3X25B 2PUOB 3QYHB 1PSFA 2ZPFB 1DJ7B 3A8OB 1JB0E 3X20B 5L8RE 2PUKB 2PVDB 2D0QB 1UGQB 4L6V5 2CZ6B 2AHJB 2CZ1B 1UGPB 2CZ7B 2O01E 1V29B 4Y28E 2PU9B 3HHTB 1UGSB 3VYGB 2ZPIB 2PVOB 4OB3B 2ZPEB 2DXCB 2WSCE 2DXBA 3A8LB 4FM4B 2CZ0B 3VYHB 3WVEB 4KT0E 2DD4B 2ZZDA 2DXBB 4XK8E 3A8HB 4RKUE 2ZPGB 4OB1B 2CYZB 3WVDB 2QDYB 1QP2A 1PSEA 1IREB 4ZGDB 4ZGEB 2ZPBB 1AHJB 2DD5A 3VYGA 3X28B 2DXCA 3QXEB 2ZZDB 2ZCFB 2DPPB 3X26B 3X24B 3LW5E 4OB2B 1GXIE 2PVGB 3QYGB
chains in the Genus database with same CATH superfamily
3EG2A 1I8FA 1FMWA 4R55A 2JTMA 2V8KA 4B9XA 4M7AB 2QA4Q 3V7CA 3J81E 4EOQB 3DLMA 3CXCP 4F6UB 1WJSA 1XO2A 3B57A 2R58A 3VS7A 2MPXC 1FMVA 3OBWA 3P8HA 1RADB 4XAXB 3G71Q 1OV3A 2MWOA 3CC4T 2F1LA 2UZDB 4BE0A 2D0QB 2JVVA 3EH2A 4BCOB 1KD1R 4BBRM 4WF2A 2EBPA 2GF7A 3EAEA 1YNZA 1K76A 4X1VA 1B34A 2PHGA 1X2QA 2FRWA 1MNEA 1NEBA 5LJ3e 1M2OA 1A0NB 4OGRB 1ZUUA 4KH1B 3I5SA 4PLLA 3OSVA 4OB3B 2V26A 3QWYA 2FO0A 2IW9B 1MMNA 4AKIA 1BIAA 4M78D 4BDYA 1WQWA 4MIMA 4CFUD 2RI2A 2FPFA 2RHYA 1AWJA 4KT0E 1Y57A 2EJ9A 1RLPC 4Y91A 3E2UA 2YRCA 4XTUA 2LNVA 4XU0A 4HCKA 5LJ3g 1K8AU 1QW1A 1WX6A 3R6NA 1KJWA 4M75B 3UATA 2QFZA 1OI1A 2L3SA 4OMPA 2G6FX 2V1QA 5CQXA 2E64A 4ATOA 1EX4A 4E7ZA 4MDWA 3TEEA 3TNIB 1EZZB 4Z6YA 2OTJT 2E65A 1WFWA 1V1CA 1YJWT 4OVAA 4BD3A 2LQ8A 1YHQQ 2RK1A 1UTIA 2PMIB 2CT3A 5CIUA 3OY9A 4OB2B 3QWXX 3SFMA 3NTHA 4EMKC 4ESRA 3G71T 1VQ6Q 4BE2A 4IUTA 3BHVB 5A0LA 1OI9B 2HSEB 2FL7A 3QZ9B 4DEXA 3TSWA 1VQ5A 3CCVA 3M0TA 1K9MR 4E7IA 2HBWA 4L59A 4IUUA 1VQOT 1KFZA 1PRMC 2WPAB 3WXMB 1K8AR 2PVDB 5EFQB 1TS9A 3H6ZA 3CPWP 5HY6A 1QVFP 1E7OA 2LCCA 2BTTA 2CSIA 1YIJT 3I9QA 2J6OA 1ZSZB 2UZEB 1VQPA 3TREA 4EOKB 1MMGA 4HVWA 3SHWA 4M7AF 1UFFA 5KYXA 5I2MA 1K1ZA 4C92D 4C92G 3H0FA 4F70B 3O0GD 3CCLT 2IN3A 2OTLA 1GH6B 4JRPA 1UNGD 4EMKA 4EORB 1HK9A 3MP8A 3SEMA 4AFZC 2A0FB 2JS0A 4EC8B 3REAB 2K4YA 5C0MA 1YWOA 1K0XA 2DETA 3O8VA 2WACA 1HJDA 4IUQA 4EOPB 1GCPA 2CYZB 2KAFA 4OF1A 5LJ3d 5KYUA 1WPYA 4A63B 2M16A 4BBSM 4FL6A 2WMAB 2E5QA 4HVVA 4BI8B 5DLQE 4LOCA 4RTTA 1KQSA 1PWTA 5D6YA 3OYJA 2E70A 3S3MA 1ARKA 1JEGA 1X27A 4Z89A 5GAOn 2A08A 1J3TA 1CSKA 2DVEA 2QTXA 1AHJB 3UF4A 4QQGA 4F7UE 2DD5A 3OS2A 1OKWB 2DMEA 2YDLA 4J9GA 3FB9A 3DTOA 2QG9B 2PK9B 1YHQA 1X43A 2RM4A 2X9HA 4AFSC 5LJ5j 4RTZA 1ACMB 1OU8A 3QHSA 2KVQG 3NDQA 2OJ2A 1M8MA 2L3QA 5GAN4 3VRZA 1H1RB 3SWNA 1YITQ 2NLUA 3VS5A 2IG0A 2P0QA 4RG8A 1G3SA 1WYXA 5HK0A 4CFUB 3CMAQ 4OB0B 1QLYA 3QYHB 3MCAB 4RTUA 3V8LA 2ENMA 4C0DB 2O2OA 3UA6A 2YT6A 1VQ4T 2DKGA 4M7AA 1H1SB 2BIVA 3CPWS 3CD6Q 1ZQ1A 1ZA1B 1Q86U 1YJ9Q 1NLOC 4C8QG 1GY3B 4J9CA 3CCQT 4OGEA 1BIBA 3ME9A 3OYHA 2IVXA 3META 1VQPQ 3LYIA 3FC3A 4C5IA 2QTVA 2CDTA 2YUPA 1B34B 5DY9A 2DTIA 1MMDA 5C6SA 2EGAA 2HDAA 2WSCE 2DJZA 4PJOB 3QPHA 3A8LB 1BCMA 3N5BB 1KD1U 5IN1A 4IURA 5CAIA 1YJNA 1N4MA 3L2WA 2BZ8A 2HQHA 3VJPA 3BW1A 4BY7X 1H8KA 4UC4A 3EGXA 5KYXB 3M54A 4IKFA 3PFSA 3M0QA 4XTWA 1IHVA 3M03A 5LMKB 4R56A 1OEBA 4O5VA 2DF6A 4AFUC 3P8BB 5KH6A 5GAOr 1VYVA 2FYKA 2GCXA 1SHFA 1I4K1 2R5AA 2HQEA 3RR6A 5I21A 2DLPA 3JCMh 1GL5A 4BCNB 4M77D 2F2WA 2MI6A 2K79A 2CUDA 2DXCA 3RKXA 3FEOA 1YJWA 3BG3A 1UNLD 1RLQC 2DPPB 3X26B 3Q1JA 3HFOA 2IPOB 4RODA 2RJEA 4QQDA 3DL1A 4WCIA 1R0CB 5IHNA 2JM8A 2KRMA 4HCBA 4YTLA 1WHHA 1VQ7Q 4DBQA 2WSEE 4Z8AA 1TH7A 1UJ0A 3JRZA 3A8GB 4LUEA 3DDQB 3JCMJ 1Q86R 5HKCA 3EFSA 1C9BA 2EKHA 1U1TA 4M78B 2QI2A 2MCNA 2LJ1A 1DJ7B 3URGA 1VQ6A 4LD9K 3CMAA 1PC0A 1T3SA 5GJVB 3PNWC 2O31A 1K9MC 3QYEA 4PFZA 5IHYA 1JJ2P 3A5ZB 2XICA 2W9ZA 4AKHA 2KYMA 2CZ6B 3M59A 4BI4A 3R6OA 1VQ9A 2JTEA 3RMQA 1W6XA 2COZA 4JJNK 3HHTB 1ZBXA 1FYNA 4CFVB 1H92A 3BY7A 5FROA 2ZPEB 4HA8A 3JB9F 3K7AM 2BZYA 3CPFA 4AG1C 3VYHB 2EUFA 1AWOA 4JJBA 2PNIA 4OMOA 4CFWB 5D6WA 2GNCA 4KRTA 1Y96A 3VKGA 4EMKB 2I0NA 1NPPA 3M4GA 3TVTA 2W96A 3ULRB 2JS2A 3BG9A 5CKDA 1AOJA 5HBJB 3SWNC 1UNHD 3HB9A 2QQSA 4JRKA 4HCZA 1QVFS 2X4WA 4E7JA 2VUBA 2V1RA 5IDNB 2CP5A 5I2SA 3MPUB 2E6NA 4ANJA 2O4XA 3JCMW 2V8JA 2OTLT 4JRQA 3CCLA 3OMCA 3DKMA 1WXTA 4M7AE 1GCQC 1OX8A 3L42A 2ZZDB 3QDRB 1NJIC 3GOXA 2QQRA 3BLHB 2KGTA 3NGPA 5GAOl 1VQ7T 2BS4A 3RERA 1YJWQ 1GXIE 2CH4A 4PJOA 1QVPA 3QBYA 2HNIA 2BZXA 1TUDA 4N4IA 5GAMd 4F14A 3AHUA 4FYYB 4F7JB 2EYYA 1TG0A 4IUVA 1XQHA 4D8DA 1M1FA 3DDPB 5EC7A 2VC8A 1RI0A 4QVDA 5IXFA 4JPBW 4RTYA 1TFBA 4M77F 1WXUA 2F2VA 1NJIR 4J6YA 2C6TB 4XU1A 1ZUYA 3G4ST 4M7DA 2W99A 1U8RA 1FINB 2KR3A 4J7IA 3UPUA 2XDPA 3HO8A 4EOIB 4HNUA 2EQMA 3VKHA 1LOJA 3L2ZA 2CH4W 2WIHB 3JCMX 2MAMA 2NUZA 3GIBA 2H3JA 4KGVB 2K5FA 2UZLB 2J6KA 2QYZA 3HSBA 1PNJA 4JLIA 2DL8A 2ED1A 5DM7R 1KC8U 2KK4A 2RI5A 4NS5A 2QASA 2L5QA 2O4XB 2C0IA 2RO0A 4BDZA 2MK5A 5GAOm 4M78E 1GBQA 5GANh 1VQLQ 4BCGB 4YOOA 2MWPA 3QIIA 4EIKA 3MP6A 1WXBA 4LD6A 1X01A 5D6XA 4CFNB 1O9KB 2DD4B 5CKHA 1H3HA 2ZZDA 4GY5A 4J83A 3CCMQ 2RPNA 2KXDA 2G3RA 3OYBA 2EYWA 5GJWB 1ZX6A 3CD6T 3OYDA 2V8IA 1NEGA 4M4ZA 4VUBA 4ZN1A 2LJ3A 3I55A 4C8QD 1QLBA 1YCSB 4J9BA 4OR5B 2YUOA 4BCPB 2A37A 1NZ9A 1SKUB 1W70A 2XMFA 2P0PA 2J7IA 4JJDA 3L2VA 5LJ5g 1VQNT 2ESWA 4M7AC 1X69A 3PVQA 1RAIB 3VYGA 2K7AA 2JW4A 3PMTA 4FT2A 3CCET 3M56A 3OSSC 1SHGA 1W2BS 2DTHA 2FZKB 3HL8A 2EYZA 1HD3A 2LVMA 1YIJA 1WJQA 1XTDA 1WQ7A 3HRTA 3M4YA 2FRYA 1QVGS 5KYNA 1M90C 1OOTA 2Y90A 1AWXA 1NYFA 4FSSA 5IF1B 4F7UA 4EONB 2D0NA 5FWBA 1YN8A 1VQOA 4D8KA 3G4SQ 3EFRA 3PT9A 4FYWB 1RAHB 2RHUA 3EG0A 4BCHB 2LRQA 5AYFA 1H25B 2DERA 1B07A 3CCRQ 1VQMA 1TSFA 3EJ1B 1VA7A 3G6ET 1ENWA 5CCAA 4KULA 1JSTB 3P8DA 5BNJB 5ECAA 1H24B 2DYIA 3VS4A 2UUEB 1VQLT 2CZ1B 1UGPB 1AISB 4HNTA 1TTHB 3GBQA 2DXTA 3QWLA 2O01E 4C8QC 5GMKh 3A1PA 4P5NA 3ER0A 1QKWA 3QDFA 3F5XB 2RI3A 4FT4A 1Y7XA 1B3QA 1ZUKA 4B6MA 4C8QF 4WTOB 4CC7A 3IQLA 2AZSA 3CCMA 3M9QA 3G1JA 4J8OA 4C8QA 3OYCA 4BCKB 1TOVA 2QEXT 1UJYA 1S72Q 2DXBB 3DOGB 4L5GA 3OS5A 4RKUE 4N4GA 4EOLB 1WGSA 3LWHA 1ZSZC 2QQBA 4PJOD 1ZHIA 1E7PA 2EAYA 4BY6B 4HNVA 4NC6A 3GNGA 2WJ9A 3EH1A 1AD6A 4PL6A 2KROA 3EG9A 2GTJA 5GMKm 5KCOA 2LW4A 1M90R 2BE7D 4J9IA 2DYBA 5GAMg 3PGGA 5IDPB 2L3RA 2LQKA 1R8OB 3CQTA 2CT4A 2XDBA 2HKNA 4J6WA 2DBKA 3JCMc 1VYUA 2EIFA 4GBQA 4RTWA 1UUEA 2P0KA 4DBHA 4I3ZB 4B9WA 2EW3A 1QP3A 1OQKA 5GAN2 3PMIA 1IZ6A 3CCJA 3LQ5B 2DD4A 5IHKA 3I5RA 3JAME 1N8RR 1XNIA 3ZL7C 1PM3A 1M3CA 2PUOB 1UG1A 1QMCA 2QGFB 2K57A 1VQLA 4IUPA 1VQ5Q 2VWFA 1QVFA 9ATCB 4M77A 3RMSA 2RH2A 2Z0WA 1NG2A 5M9OA 2DL5A 1VQMT 2MOXA 1D0ZA 1UEBA 5FW9A 4IMYB 5HBEB 1KQSS 1KG1A 3MP1A 4CC3A 2LCSA 3TU4K 4XU2A 4EOMB 1I07A 2CKKA 4C92E 4F7UB 2KSSA 3VS3A 4M7DG 1Q7YR 1X6OA 1NJIU 1W2BA 2E10A 3J80E 1IGQA 3PTAA 3MKDA 1OIYB 4OMMA 2RJFA 1Q82C 1VQ9T 4ROEA 3MY5B 2F5KA 5GAN5 4J9EA 4F17A 4OMQA 4OMFB 4F6WB 4EOOB 4MDXA 2JTFA 2EGEA 1KQSP 4PJOG 2HBPA 1K9AA 4RCCA 1M2VB 1WJRA 1R0BG 2E6ZA 3CMAT 4ZTJA 2W2HA 4CC2A 2PJQA 4Q5WA 2O9SA 2JZ2A 4A4FA 1ZSZA 2FVUA 3G6EQ 5KYWA 2A7YA 2DEQA 3CC2Q 1FWZA 2EYXA 2NWMA 3JV3A 2K3BA 3SB2A 4HT9A 2E41A 4QT7A 3L2RA 2C5OB 3PO3S 4J6XA 4OMNA 3CCQQ 4PJOE 3SD4A 1SRMA 2D8JA 2HL5C 4BCMD 1NBEB 4XTYA 4CFMB 2DK3A 2P84A 4II1A 3A8MB 3S6WA 1MUZA 4A54A 4PJJA 4RMOA 1SG5A 2BKZB 4X9DA 3PIOA 3X25B 2QA4T 1GUXA 1FKMA 2HQXA 2X4XA 2CUBA 1GBRA 1JU5C 2DJQA 3NPFA 4M7DE 5LJ3f 5GMKi 1H26B 3PIPA 1BI2A 1O75A 4AI6A 2PUKB 2G9XB 3A98A 1K4US 5GAOq 1KD1C 2EJFA 1KQ1A 1KXUA 1M5Q1 4JX5A 2JUFA 3MEVA 3CC4Q 4XU3A 2KDSA 3C0CA 3QJ6A 4LDWA 2D6FA 3LWIA 5KYUB 2VB6A 3MY1B 1Q7YU 5HQ0B 1N9RA 2YHTA 4LDVA 4FYXB 1IXDA 4F7UF 3JCMb 4QVZA 4M7DD 2RMOA 1M27C 2DNUA 2EQIA 2QGSA 3NFCA 3OYMA 5LJ3h 4LDXA 4M75E 1SPKA 1Q82R 3NTKA 5FRMA 1JKWA 1OPKA 1HYOA 1LNXA 3POMA 4M7AD 4PFOA 1H28B 3SDZA 1K8AC 4UN0A 1G3YA 1YJNQ 4M7DC 2K2MA 1VIEA 1Y0MA 3WVDB 2LNHB 2JOYA 3LGLA 1PSEA 2D9TA 3H8ZA 3EHRA 4NOYA 1UHFA 3OYKA 1AEYA 2MF2A 1LPLA 2GFUA 2QAZA 2R5MA 4M7DB 2M9UA 2OX7A 5J3BA 4YOSA 3VU3C 4ROCA 4F04B 4Y72B 3CC2A 2ECZA 2K3YA 2VASA 1F5QB 2DXUA 1S1NA 2QGGA 1YHQT 1VUBA 5LJ5e 1IB8A 2VGNA 5GAMf 1VOMA 2LQNA 4EMHA 3ZEHA 1VYWB 2DD5B 2LT1A 3QHRB 4KGXB 4J9DA 2XKOC 1I1JA 4IIOA 4JDSA 2XHCA 5LJ5h 2VXEA 1WI7A 2ZPFB 3UA7A 2I53A 2KNBB 4DA4A 1O9KA 1NPRA 4RTVA 2MMPA 1HXDA 4DOVA 2K3XA 3HBLA 1P5EB 3S3NA 5GMKe 2LX9A 1N27A 4CI0C 3LX7A 1Y07A 4A53A 2LP5A 4J7FA 2WFYB 3U23A 4HL4A 3H4CA 4E6RA 5A0DA 4QQ6A 4F6SB 2CZ7B 2SEMA 3UT1A 1C1AA 3GTMS 1VYTA 1VQ4Q 4BACA 1Q95G 3LH5A 5LL6S 2ZPIB 5GANf 4CFXB 1OZ2A 2C06A 5FU6C 1MHNA 2V22B 4ZN3A 5CR2A 4FM4B 4M75D 1WHKA 3LGFA 3HTRA 4D6WA 3C94A 1PD1A 4XK8E 2AKLA 1JSUB 2F69A 1S72T 3OYNA 1F1BB 4OB1B 2QQAA 2FEIA 4BI3A 4JS5A 1N8RU 2KEAA 3G7ZA 3QKJA 2RQWA 1RL2A 3KXTA 3INZA 5KE2A 4FW2A 3CCVQ 1D3BB 1FMKA 2BKDN 3VUZA 2GGRA 2BS2A 3E1SA 4BCQD 2VV5A 1D09B 2XDDA 2CP3A 1M30A 3CCVT 1O9SA 2K2VA 4QSHA 1Q81U 1T0HA 2G77A 8ATCB 3GF5A 2ZCFB 4JZ4A 3BG5A 2RF0A 2F2CA 4BE1A 3EFOB 2QF7A 2ROLA 3FJPA 2X4YA 3DB3A 3QHWB 5FU7C 4KBMB 2ABLA 3QYGB 4C5HA 3CCUQ 1OGUB 5FLXE 5GAN8 2VYTA 3JCMg 1YBYA 2LC4A 2RB6A 1TU0B 4ZNXA 2VKNA 3CCQA 1YITA 1H641 5KCHA 2DFUA 2PTKA 4MMLA 4ELJA 3I56A 3H0HA 1Z9QA 3E19A 4BUGA 1YCYA 1WHLA 3JCMd 3JSCA 1QQJA 1RUWA 4C92B 2CP2A 1MNDA 2DILA 1VQ4A 2EFIA 1WHJA 2ZGWA 2DRMA 1SSFA 1D3BA 2E3HA 1H1PB 4N4HA 4Y28E 5FU7B 2ROTA 2RQTA 2PU9B 1UGSB 2BS3A 1YJ9A 5LJ5f 3S3OA 1RAFB 4M77C 3EG1A 4E7HA 1G3TA 4LXCA 4XQ3A 2HSPA 3BFMA 1UECA 3CCEQ 1I0CA 4M7DF 3CCMT 3CBMA 3AT1B 5KYYA 1QMZB 1AVZC 3BLQB 5J39A 1M9SA 4DBFA 4JLGA 5EJCA 4GLMA 3OMGA 1KC8C 1GRIA 1JJ2S 4N0AC 3JCMQ 3DJBA 1LCKA 2XD0A 1M4ZA 3FIFA 5GAMh 3FDRA 4ME7A 1WZOA 2X1NB 3I55Q 3M55A 3QXEB 4HLQA 3FRNA 4PJMA 4Z88A 1EFNA 1G8XA 1D3UB 3CPWA 3M0RA 1W1FA 2CS7A 1OIUB 3X24B 1M1KR 2FPDA 3LW5E 3OQ5A 3MEWA 3M0SA 1IRXA 4ELZC 1UHCA 1XJWB 2AKKA 1AT1B 2FZGB 1P92A 3EHQA 3QZ5B 4ZGJB 1E6HA 3I56Q 3JB9I 2B86A 4M75G 1UDLA 3VS1A 1KSWA 1PKSA 2QDLA 3CCUA 5AT1B 2DRKA 3BLRB 3BDUA 4BCJB 1M3BA 2LMJA 1GFDA 2B8AA 1M3AA 4BY1X 1IO6A 1UGQB 2KMTA 5FRNA 2RD1A 5IT9E 2KE9A 1VQNA 1PG5B 3VV0A 1CKBA 2DIGA 2LZ6B 2C4GB 2AHJB 4PJLA 1URCB 1VQMQ 1MV3A 1JOWA 2OTLQ 1QVGA 1SF9A 2RN8A 4AG2C 3TN8B 3CD6A 3OYIA 4II5B 2PQWA 2PVOB 3EG3A 3L2UA 1UGVA 2KQWA 3JB9G 2IIMA 2EKOA 2X51A 1PKDB 2HL3A 2DXBA 1VQ8T 3OYAA 2CZ0B 1V76A 3C12A 3EGDB 3WVEB 2I2LA 3C95A 3HRSA 2DL7A 4PJNA 4XTXA 5GMKl 4FCYA 3O5ZA 4DOWA 1XOVA 1SRLA 5J26A 5GMKj 1E9HB 4DQ2A 1NM7A 2E4HA 2YUQA 1W4SA 4M78F 4BXXX 4CC4B 1X75C 4X9CA 3V7RA 2UZBB 4YC3B 2OTJA 1SSHA 3RIRA 3LH0A 5I22A 4HKEA 3VKIA 4EPCA 4RTXA 3MEAA 2LDMA 3RESA 1GUXB 1G3WA 1PRLC 2DE0X 4PFPA 1VQ8A 2XI9A 2AIRB 3DB4A 3NTIA 1H4LD 4LE9A 3BDLA 4HVUA 4JJCA 5GANd 3TW7A 2GFAA 3CBPA 1IGUA 2KI7A 3HZJA 2CGHA 4MZPA 4KH0B 2COWA 4MZMA 4C0GA 2JMAA 4F7SB 3GNFB 2DX1A 1QCNA 4QKUA 1M1KC 3MI9B 1OX9A 1QWFA 2PVGB 3RKYA 2RNAA 3TQ7P 2Y4YA 1PHTA 3JCMV 1WDXA 2ZAEA 4CXAB 1G83A 5FWCA 2KXCA 1X2KA 3EFOA 1OULA 3EOCB 1VQKA 2L3PA 2OAUA 5CQYA 2EYQA 3MHXA 1PSFA 2B9RA 3HRUA 1VQ7A 2HKQB 3UWNA 2A36A 2GQIA 1BCOA 2R7GA 3CCEA 1ZSGA 2YRVA 3VS0A 1I5OB 4BCIB 1W98B 5HK3A 4BCND 1JBMA 4PJOF 3BHUB 3CMEQ 4FIBA 3I55T 1JO8A 1YFNA 4M6VA 4NL2A 2C5VB 2LJ0A 2Y4XA 4DEYA 3CBOA 3OYYA 1W2BP 1PKTA 1G3NC 2DAQA 1VQ9Q 4F7LB 5KYWB 1M8VA 2JM9A 2CP6A 4A4GA 2X35A 1JRIA 1M2VA 5GANe 4QVCA 3A8HB 2DL4A 1Y71A 1GCQA 1NYGA 4J9FA 3OA6A 4G6LB 1EIFA 3QO3A 1C6VX 1BU2A 2CCHB 2HZYA 5LQFB 1U5SA 2MIOA 2YWWA 3BHTB 1VINA 5DQWA 2KMGA 4ZGDB 1BI1A 2XIDA 3RUXA 4JS4A 2HD0A 3VS6A 2L0AA 3F70A 3FLGA 1Q82U 3JB9H 2P4TA 2DVJA 2D1XA 1YJ9T 2E5KA 4E2FB 1ZBJA 2DO3A 3TNWB 2RQRA 1ABOA 3RDVA 2YLBA 1BKBA 3GLXA 1FX7A 4PNOA 2EJGA 1MGQA 4ZTFA 4R0KA 2IW6B 2DL3A 2KYBA 4FW1A 5IXBA 2FG0A 3RGFB 4ORZA 2QEXA 2C5NB 2K5LA 1YP5A 4JUVA 4A4EA 2HEQA 4IIMA 2QDJA 5GANj 4JZ3A 3OBYA 4HT8A 3CCUT 3X20B 1YITT 1C0MA 4A4HA 3CMEA 2PK2A 2GQVA 2W10A 2HAXA 2W9FA 1KHCA 4O6JA 1WIEA 5DLOA 3THKA 1I81A 4M78C 2X3WD 3QSUA 4L6V5 2RHIA 2VVKA 4GLKA 4KGZB 2JNGA 3CCRT 4HCCA 3OS1A 4TTHA 4KUIA 2ED0A 2KRNA 2IVWA 2GBQA 2NYSA 2A3LA 2QXFA 2DXCB 3HPWA 5GAOp 3OW2P 5GAN7 2SRCA 3TCJA 1YJNT 2VGMA 3OW2A 4N0AA 2DZCA 1U3OA 4Z02A 1N9SA 4KUDK 2BPMB 3FJ5A 1M1KU 1KK7A 2PZ1A 1S72A 4NSTB 1YIJQ 3M0PA 4V2SA 1TXQA 2KR6A 2K5IA 3H41A 5GAMe 3JB9J 5LJ3j 2M51A 1AWWA 1N5ZA 2JMCA 1U06A 2H8HA 1M90U 1H1QB 3CC7T 2C0OA 1IREB 3RKWA 3CCLQ 4BCFB 1TD6A 4ZGEB 3DLLA 5CEIB 1VOLA 1QKXA 4YOZA 2EGCA 2YXYA 1QVGP 1H3ZA 3L1AA 3HKSA 3X28B 1NLPC 4LN2A 2VXFA 3JCMf 5CVIA 1Q7YC 4TVRA 2AZVA 3CXCS 1OYXA 1VQ8Q 1VQ6T 1VIFA 3JCMe 5D7UA 1KQ2A 2QEXQ 2WEVB 1JXOA 1WNLA 3CCSA 1K9MU 1UGRB 2XK0A 4LUDA 1ZLMA 2KT8A 4M75F 1K73R 4EOJB 1X6BA 3KUFA 3I56T 2JT4A 1OL2B 4CRIA 3TSZA 1D1AA 3ZBDA 2P4RA 4C92C 2M0YA 5L8RE 2WHBB 2RA2A 5CO7A 3D7SB 1VQKQ 2CP7A 5IH2A 2EQUA 4FSXA 3SWNB 5GAN6 4C0ZA 2DBMA 2O9VA 4HXJA 1V29B 2QQ8A 3CC2T 1T0JA 4A4KA 2M1HA 3OW2S 3I35A 3VYGB 1Y96B 2E12A 5LJ5d 5CK9A 1UE9A 3BE3A 3G4SA 3LLRA 2DM1A 4F7NB 5DQVA 4XTZA 3GP8A 3CCRA 3V8KA 1ZP2A 1G5VA 1HSQA 3QJYA 1KC8R 4XTVA 4Y92A 5A0GA 3V8JA 2HMAA 5GAN3 3M53A 1AZEA 3J7AF 4PKCC 4EOSB 2FB7A 1YWPA 2J05A 3OYLA 2LTOA 4FYVB 5HNBB 4EC9B 2DMOA 1LVKA 4LNPA 2M0OA 2DEUA 2RQUA 3CCJQ 2QDYB 2K9GA 4CRLB 3TNHB 5IAYA 1BU1A 2LT4A 4LDYA 1VQPT 1AD5A 2H3EB 2AT1B 1YI2Q 2NUTB 1TUGB 1D1BA 3OYFA 1RAEB 5ACBA 1N6AA 4AMCA 2LX7A 4KRDB 2DIQA 2M02A 3CEYA 5A2QE 4NL3A 2W0ZA 3TW6A 4PLIA 2F2XA 4KRCB 2E3IA 1BBZA 3ZFJA 3PE0A 3KHIA 2JXBA 1PCXA 1SEMA 5L2WB 3C4SA 3HP9A 1LJOA 5CKEA 4E47A 1VQOQ 3EGUA 1RACB 3T9NA 2A28A 3M0UA 4E7KA 2CREA 2C0TA 7AT1B 4M77E 2WSFE 2CSQA 4OGCA 3CCSQ 2QQ9A 3GPLA 5ICPB 3G33B 2YRDA 1JB0E 4E7SA 5I11A 2WIPB 1E6GA 3VS2A 2FPEA 4M78A 1TWBA 2J6FA 2KBTA 1Q81R 5IHIA 4J5YA 4AFQC 2LCLA 2O88A 2KT1A 4M75C 2WXVB 2L8DA 2DTOA 2L89A 1WHGA 1PD0A 4C5EA 4C92F 5CYIB 2X3XD 1MMAA 4EMGA 1H27B 5HCKA 2BE9B 1JJ2A 2DA9A 4M77G 1IHWA 3CCST 1QCOA 2QK0A 3G6EA 1D0XA 3M57A 2AK5A 4C8QB 4C92A 5HVYB 2I40B 1BYMA 2E1HA 5HBHB 3MEUA 1OPLA 3KFVA 1WLPB 3ASKA 1OZ3A 2EPDA 3H0IA 3NHNA 5CKBA 1K73C 3M58A 2RQVA 1U1SA 2JJ9A 4F16A 4RCBA 2LQWA 3H9NA 3CC7A 4J9HA 1QP2A 1BI0A 2YSQA 3UDCA 1WA7A 3E9FA 1TUCA 4OP0A 1VQKT 1D1CA 4C0DC 4JX4A 2ZPBB 5KE3A 1BK2A 1AZGB 1RAAB 4AKGA 1N8RC 2EWNA 1MV0B 2JGZB 3JB9D 3CC4A 2D8HA 3OB9A 5I5ZB 4MMKA 2RK2A 2R57A 4MFEA 3L2QA 1FVVB 2RJCA 2OAWA 4AT1B 1VQ5T 1QWEA 2WMBB 3HFNA 5GANg 1KIKA 1Q81C 3QYBA 5FU6B 1NE8A 3MO8A 2RJDA 2ZPHB 3G71A 2KY9A 1T3LA 2EVRA 1GFCA 1RAGB 1QCFA 1BI3A 4BCMB 4JX6A 2QA4A 3A8OB 2BUDA 4QW2A 3M5AA 2F5TX 1M1GA 4BB7A 1FXXA 3CCJT 3EGXB 2XG8D 2KRSA 4JRIA 1RABB 5EG2A 4C8QE 3CMET 1D0YA 4M78G 2NUTA 4DBRA 4C0FA 6AT1B 2EQJA 2GTOA 3OYGA 2HCKA 1OL1B 3VUBA 1VQNQ 4BCQB 3KBGA 4MZTA 2FZCB 1OKVB 4M75A 2DZ9A 4RUGA 3QG1A 5KYYB 3VRYA 1KHIA 3NMZC 4X34A 2FHDA 1YI2A 2YLCA 4E7LA 4FX3B 4MFDA 3EIDB 2J06A 4LDUA 4EDUA 2CCIB 3MJXA 2EQKA 1G2BA 2L2PA 4RG2A 4FU6A 4OMLA 1JXMA 1Z9ZA 1UB4A 1ZA2B 2CJMB 4BY6C 2RHZA 1YI2T 2ZPGB 1R77A 2RHXA 3EG9B 3E9GA 3REBB 1WHMA 1RI9A 4ELYC 2X4JA 3JCMP 1X6GA 1I5LA 1K73U 1BB9A 4K11A 3PVLA 1Q86C 4F7UG 3CC7Q 2K6DA 2IW8B 3MIAB 1OU9A 2OTJQ 3EGDA 4M77B 4C5GA 2JN0A 2C5XB 5FGKB 3V7SA 1ABQA 2ATCB 2NUPB 2NUPA 1JQQA 4PJOC 4M7AG 4PK4A 2CP0A 1B7TA 1CKAA 4ELLA 2COYA 3OYEA 2XU8A 1K0SA 3OS0A 3RBBB 5CKFA 3QUIA 2OI3A 2MYSA 8AT1B 3RNJA 5L23A 5GAMj 2YUNA 3CXCA
chains in the Genus database with same CATH topology
2EJGA 2VGNA 1I8FA 1MGQA 5GAMf 4N4IA 4R55A 2JTMA 5GAMd 4EMHA 4ZTFA 3ZEHA 3AHUA 2V8KA 4B9XA 2DD5B 4M7AB 4IUVA 1XQHA 2LT1A 3V7CA 3J81E 3DLMA 2XKOC 1M1FA 1WJSA 2QEXA 2K5LA 2VC8A 4JDSA 2R58A 4JUVA 4A4EA 2XHCA 5LJ5h 2VXEA 2QDJA 1RI0A 4QVDA 3OBWA 2ZPFB 3P8HA 5GANj 4M77F 4XAXB 3OBYA 2MWOA 3CCUT 3CC4T 3X20B 4DA4A 1YITT 1NPRA 4J6YA 4XU1A 4A4HA 3CMEA 3G4ST 4M7DA 2GQVA 2HAXA 4BE0A 2MMPA 2D0QB 1HXDA 4DOVA 1KHCA 4O6JA 2K3XA 1U8RA 5DLOA 3HBLA 2JVVA 4J7IA 3UPUA 1I81A 4BBRM 3S3NA 2XDPA 5GMKe 2LX9A 4M78C 3HO8A 4WF2A 1N27A 4CI0C 4HNUA 2EQMA 3VKHA 1Y07A 2GF7A 1LOJA 3EAEA 3L2ZA 3LX7A 4J7FA 4L6V5 2RHIA 1B34A 4A53A 3JCMX 3QSUA 4HL4A 2MAMA 4GLKA 3H4CA 5A0DA 3GIBA 2H3JA 4QQ6A 2K5FA 5LJ3e 2CZ7B 3UT1A 2JNGA 3CCRT 3HSBA 4JLIA 4HCCA 4BACA 3OS1A 5DM7R 1KC8U 2KK4A 2RI5A 5LL6S 4KUIA 2ZPIB 4PLLA 4NS5A 2IVWA 2L5QA 4OB3B 2O4XB 3OSVA 1OZ2A 5GANf 2C06A 2RO0A 5FU6C 1MHNA 2A3LA 4AKIA 2DXCB 2QXFA 3HPWA 4M78E 4ZN3A 1BIAA 5GANh 5GAOp 5GAOm 4M78D 5CR2A 5GAN7 4BDYA 2MWPA 1WQWA 3QIIA 4FM4B 4MIMA 4M75D 2RI2A 2RHYA 3MP6A 3TCJA 4KT0E 4LD6A 1X01A 2EJ9A 5D6XA 4Y91A 1YJNT 2VGMA 3OW2A 4N0AA 2DZCA 3LGFA 4XTUA 2DD4B 2LNVA 4XU0A 5CKHA 4Z02A 3C94A 1N9SA 2ZZDA 4GY5A 4D6WA 5LJ3g 1QW1A 1K8AU 4KUDK 4J83A 4XK8E 2F69A 1S72T 1M1KU 1S72A 2G3RA 3OYBA 3OYNA 4V2SA 2KR6A 2K5IA 4OB1B 2QQAA 4M75B 5GAMe 5LJ3j 3JB9J 2QFZA 4BI3A 3OYDA 4JS5A 1N8RU 3G7ZA 3CD6T 1OI1A 3QKJA 1RL2A 5CQXA 3KXTA 3INZA 2V8IA 4VUBA 5KE2A 1M90U 2E64A 4ATOA 4ZN1A 1D3BB 3I55A 3VUZA 2BKDN 4MDWA 4C8QD 1QLBA 3TEEA 3CC7T 4Z6YA 2BS2A 2OTJT 3E1SA 2VV5A 1IREB 3RKWA 2E65A 1NZ9A 2P0PA 2XDDA 4ZGEB 1YJWT 4OVAA 3DLLA 4BD3A 2LQ8A 3L2VA 3CCVT 1O9SA 2K2VA 5LJ5g 1VQNT 4QSHA 4M7AC 1Q81U 1H3ZA 3L1AA 3HKSA 2RK1A 3X28B 3PMTA 3VYGA 4FT2A 3CCET 2G77A 3M56A 3OSSC 2VXFA 3GF5A 2ZCFB 5CVIA 4TVRA 3BG5A 5CIUA 3JCMf 1Q7YC 3OY9A 3CXCS 1OYXA 4BE1A 1VQ6T 1W2BS 2DTHA 1VIFA 2QF7A 3JCMe 3HL8A 4OB2B 3FJPA 1KQ2A 2X4YA 3DB3A 3SFMA 3NTHA 4EMKC 2LVMA 4KBMB 5FU7C 1YIJA 3G71T 1WJQA 1XTDA 3QYGB 1WQ7A 3HRTA 4C5HA 1WNLA 4BE2A 4IUTA 3CCSA 5GAN8 5FLXE 3M4YA 1QVGS 2VYTA 5A0LA 1K9MU 3JCMg 1M90C 1UGRB 1YBYA 2FL7A 3QZ9B 2LC4A 1QVPA 2RB6A 2XK0A 1VQ5A 2Y90A 3CCVA 4M75F 3CCQA 4F7UA 1YITA 1H641 3KUFA 3I56T 1VQOA 5KCHA 3EFRA 3PT9A 4CRIA 4E7IA 4L59A 4IUUA 4ELJA 4MMLA 3I56A 1VQOT 3ZBDA 3E19A 4BUGA 4C92C 1YCYA 2RHUA 2LRQA 5AYFA 5L8RE 3WXMB 3JCMd 3JSCA 2PVDB 2RA2A 1VQMA 4C92B 3H6ZA 3G6ET 5CO7A 5HY6A 1KD1U 2LCCA 5CCAA 1VQ4A 2EFIA 4KULA 3P8DA 1YIJT 2ZGWA 2EQUA 4FSXA 1VQPA 1VQLT 2CZ1B 3SWNB 1UGPB 1SSFA 3TREA 5GAN6 4HNTA 1D3BA 4C0ZA 2DXTA 3QWLA 2O01E 4M7AF 1V29B 2QQ8A 4Y28E 4N4HA 5FU7B 4C8QC 3CC2T 5GMKh 5I2MA 4C92G 4A4KA 2M1HA 2PU9B 3ER0A 1UGSB 2BS3A 4P5NA 4C92D 3OW2S 3VYGB 1YJ9A 3CCLT 2RI3A 1Y96B 2OTLA 2E12A 5LJ5d 5LJ5f 4FT4A 1Y7XA 5CK9A 3S3OA 4M77C 3G4SA 4JRPA 3LLRA 4C8QF 4EMKA 4E7HA 1G3TA 1HK9A 3MP8A 4XQ3A 3CCMA 4XTZA 3M9QA 3BFMA 4J8OA 4C8QA 3GP8A 3V8KA 3CCRA 3OYCA 1G5VA 2K4YA 5C0MA 2QEXT 4M7DF 3QJYA 3O8VA 3CCMT 2DXBB 4XTVA 3CBMA 3V8JA 5A0GA 4L5GA 5GAN3 3OS5A 2WACA 1M9SA 3M53A 4N4GA 4JLGA 4RKUE 1WGSA 5J39A 3LWHA 4IUQA 5EJCA 4PKCC 3J7AF 2FB7A 3OYLA 2LTOA 5LJ3d 2CYZB 2KAFA 3OMGA 4OF1A 1KC8C 2M0OA 2QQBA 4PJOD 1ZHIA 2QDYB 4N0AC 1JJ2S 1E7PA 1WPYA 3JCMQ 2EAYA 4HT8A 2M16A 4BBSM 5IAYA 4BY6B 4FL6A 4HNVA 4NC6A 2E5QA 2LT4A 4BI8B 2XD0A 4LDYA 1M4ZA 4LOCA 3GNGA 5DLQE 1VQPT 2WJ9A 3S3MA 5D6YA 3FIFA 2E70A 3OYJA 5GAMh 1KQSA 3FDRA 4PL6A 4ME7A 5GAOn 2DVEA 2QTXA 3OYFA 5GMKm 1AHJB 4F7UE 1N6AA 4QQGA 2DD5A 5KCOA 3OS2A 5GAMg 3M55A 2DIQA 3CEYA 5A2QE 3PGGA 4NL3A 3FB9A 3QXEB 2L3RA 4HLQA 1R8OB 2LQKA 3FRNA 1YHQA 2XDBA 3TW6A 2RM4A 3CPWA 4PLIA 2CS7A 3X24B 5LJ5j 3LW5E 3OQ5A 3ZFJA 3QHSA 3MEWA 4J6WA 4ELZC 3KHIA 2KVQG 3JCMc 2EIFA 5GAN4 3C4SA 2P0KA 3HP9A 3SWNA 1LJOA 1P92A 3QZ5B 5CKEA 4B9WA 4E47A 4ZGJB 1QP3A 2NLUA 5GAN2 3CCJA 3PMIA 1IZ6A 2IG0A 3JB9I 3T9NA 2DD4A 2P0QA 4M75G 4RG8A 4E7KA 1G3SA 5HK0A 4M77E 1XNIA 2WSFE 3JAME 3CCUA 4OGCA 4OB0B 2QQ9A 3GPLA 2PUOB 3QYHB 3MCAB 3BDUA 3V8LA 2K57A 1VQLA 4IUPA 4C0DB 1JB0E 1QVFA 2B8AA 1VQ4T 4M77A 4M78A 1UGQB 2DKGA 3RMSA 2KMTA 2RH2A 5FRNA 4M7AA 2RD1A 2BIVA 3CPWS 5M9OA 5IT9E 1VQMT 1VQNA 4J5YA 2LCLA 1ZQ1A 1UEBA 3VV0A 2DIGA 4M75C 2L8DA 2DTOA 1Q86U 2AHJB 2L89A 4C8QG 1KQSS 3MP1A 1KG1A 1QVGA 3TU4K 4XU2A 4C5EA 4C92F 2CKKA 4C92E 4F7UB 4EMGA 4OGEA 3CCQT 1BIBA 3ME9A 2KSSA 3OYHA 3META 3LYIA 3CD6A 3OYIA 3FC3A 2PQWA 4C5IA 1JJ2A 2PVOB 4M77G 1B34B 3L2UA 4M7DG 5DY9A 3CCST 2DTIA 2KQWA 3JB9G 1X6OA 2EKOA 5C6SA 1NJIU 3G6EA 2WSCE 1W2BA 3M57A 2E10A 2DJZA 4PJOB 3QPHA 3A8LB 2DXBA 4C8QB 4C92A 3J80E 3OYAA 3PTAA 1VQ8T 2CZ0B 1BYMA 2E1HA 2RJFA 3C12A 3WVEB 3N5BB 5IN1A 2I2LA 1Q82C 3C95A 3HRSA 4IURA 3MEUA 5CAIA 1VQ9T 1YJNA 2F5KA 4XTXA 5GMKl 3L2WA 4DOWA 5GAN5 1XOVA 5J26A 3ASKA 5GMKj 1OZ3A 4OMFB 3VJPA 3BW1A 4DQ2A 4MDXA 2JTFA 4UC4A 5CKBA 1K73C 1W4SA 3M58A 4M78F 4PJOG 2HBPA 1U1SA 3M54A 1X75C 4X9CA 3V7RA 3PFSA 4RCCA 4IKFA 4XTWA 5LJ5e 4RCBA 2OTJA 1WJRA 3CC7A 3RIRA 2E6ZA 3CMAT 3LH0A 4ZTJA 4HKEA 1QP2A 3VKIA 4EPCA 1BI0A 4O5VA 3MEAA 3UDCA 2LDMA 3P8BB 4Q5WA 3RESA 5KH6A 1G3WA 5GAOr 3E9FA 2FYKA 4OP0A 2JZ2A 4A4FA 1VQKT 1VQ8A 2XI9A 2FVUA 2GCXA 1I4K1 2R5AA 3DB4A 2HQEA 3NTIA 4C0DC 4JX4A 5I21A 2A7YA 3BDLA 2DEQA 3JCMh 2ZPBB 1FWZA 4M77D 3TW7A 5KE3A 2GFAA 5GANd 2MI6A 3CBPA 3HZJA 2DXCA 2CGHA 3RKXA 4AKGA 4MZPA 2EWNA 3FEOA 3SB2A 1N8RC 4HT9A 1YJWA 3BG3A 2E41A 3JB9D 2DPPB 3CC4A 3X26B 4MZMA 3Q1JA 4C0GA 3L2RA 3OB9A 3HFOA 3GNFB 4J6XA 2RJEA 2RK2A 4MMKA 3DL1A 2R57A 4QQDA 4PJOE 1M1KC 3SD4A 4HCBA 4MFEA 4XTYA 4YTLA 3L2QA 2PVGB 2DK3A 2RJCA 1VQ5T 3RKYA 2Y4YA 3JCMV 3HFNA 3A8MB 4II1A 5GANg 1Q81C 2WSEE 3QYBA 1TH7A 3S6WA 5FU6B 1NE8A 3MO8A 4A54A 3JRZA 3A8GB 4RMOA 2RJDA 2ZPHB 3G71A 2KY9A 3JCMJ 4X9DA 3PIOA 5HKCA 3EFSA 1VQKA 3X25B 2OAUA 5CQYA 2QA4T 1BI3A 2EYQA 1U1TA 4M78B 1FKMA 2HQXA 2QI2A 3MHXA 1PSFA 4JX6A 1DJ7B 2X4XA 3URGA 2QA4A 3HRUA 1VQ7A 3A8OB 1VQ6A 4M7DE 2BUDA 4QW2A 5LJ3f 5GMKi 4LD9K 3CMAA 3UWNA 3PIPA 1BI2A 1O75A 4AI6A 2PUKB 2YRVA 2F5TX 3M5AA 1M1GA 3PNWC 3CCEA 1K9MC 3QYEA 4BB7A 2EJFA 5GAOq 1FXXA 1KQ1A 1KD1C 3CCJT 2XG8D 1M5Q1 4JX5A 2JUFA 3MEVA 4JRIA 5EG2A 4XU3A 2KDSA 1JBMA 4C8QE 3A5ZB 5HK3A 3CMET 4M78G 2XICA 3QJ6A 4AKHA 4LDWA 4PJOF 2D6FA 2CZ6B 3M59A 3LWIA 4FIBA 4BI4A 3R6OA 4C0FA 3I55T 2EQJA 1Q7YU 1VQ9A 3RMQA 3OYGA 3VUBA 1N9RA 2YHTA 4LDVA 3KBGA 4M6VA 4MZTA 4NL2A 4JJNK 3HHTB 4F7UF 1ZBXA 4M75A 2DZ9A 2Y4XA 3CBOA 3JCMb 3QG1A 4QVZA 4M7DD 1KHIA 3OYYA 4X34A 3BY7A 5FROA 4BDZA 2ZPEB 2FHDA 3NFCA 4HA8A 5LJ3h 3OYMA 1YI2A 2YLCA 3JB9F 2DAQA 4E7LA 4MFDA 4LDXA 3CPFA 4LDUA 4EDUA 3VYHB 1M8VA 4M75E 2EQKA 4A4GA 3NTKA 5FRMA 2X35A 4RG2A 5D6WA 4FU6A 1JRIA 1LNXA 5GANe 1UB4A 3VKGA 3A8HB 1Y96A 4EMKB 4QVCA 4M7AD 1Y71A 4BY6C 2RHZA 1YI2T 1NPPA 2ZPGB 3M4GA 2RHXA 3E9GA 3SDZA 1K8AC 1G3YA 4M7DC 4ELYC 3BG9A 5CKDA 2X4JA 3JCMP 3OA6A 3SWNC 1VIEA 1I5LA 1EIFA 3WVDB 1K73U 3HB9A 2JOYA 2QQSA 4JRKA 3LGLA 3QO3A 4HCZA 4R56A 1Q86C 1PSEA 2D9TA 2X4WA 3H8ZA 4E7JA 1QVFS 2VUBA 4NOYA 4F7UG 3OYKA 3RUXA 1BI1A 2KMGA 4ZGDB 2MF2A 2XIDA 4M77B 5I2SA 4JS4A 2GFUA 2HD0A 2E6NA 2R5MA 4M7DB 4C5GA 2JN0A 2M9UA 3F70A 2O4XA 3FLGA 3JCMW 1Q82U 3JB9H 2P4TA 3V7SA 2V8JA 2OTLT 4JRQA 4PJOC 3CCLA 3OMCA 3DKMA 5J3BA 4M7AG 3L42A 1YJ9T 3VU3C 4M7AE 2ZZDB 3QDRB 1NJIC 2DO3A 3GOXA 2QQRA 3CC2A 5GAOl 2XU8A 3OYEA 2K3YA 1VQ7T 3OS0A 5CKFA 3QUIA 2BS4A 3RERA 2YLBA 2DXUA 5GAMj 1BKBA 3GLXA 1GXIE 1FX7A 4PNOA 4PJOA 1YHQT 1VUBA 3QBYA 3CXCA 2HNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ5 B;  3A8M B;  2DD5 B;  4ZGJ B;  1QP3 A;  2WSE E;  1UGR B;  3QZ9 B;  2DD4 A;  3A8G B;  2ZPH B;  2WSF E;  4OB0 B;  3X25 B;  2PUO B;  3QYH B;  1PSF A;  2ZPF B;  1DJ7 B;  3A8O B;  1JB0 E;  3X20 B;  5L8R E;  2PUK B;  2PVD B;  2D0Q B;  1UGQ B;  4L6V 5;  2CZ6 B;  2AHJ B;  2CZ1 B;  1UGP B;  2CZ7 B;  2O01 E;  1V29 B;  4Y28 E;  2PU9 B;  3HHT B;  1UGS B;  3VYG B;  2ZPI B;  2PVO B;  4OB3 B;  2ZPE B;  2DXC B;  2WSC E;  2DXB A;  3A8L B;  4FM4 B;  2CZ0 B;  3VYH B;  3WVE B;  4KT0 E;  2DD4 B;  2ZZD A;  2DXB B;  4XK8 E;  3A8H B;  4RKU E;  2ZPG B;  4OB1 B;  2CYZ B;  3WVD B;  2QDY B;  1QP2 A;  1PSE A;  1IRE B;  4ZGD B;  4ZGE B;  2ZPB B;  1AHJ B;  2DD5 A;  3VYG A;  3X28 B;  2DXC A;  3QXE B;  2ZZD B;  2ZCF B;  2DPP B;  3X26 B;  3X24 B;  3LW5 E;  4OB2 B;  1GXI E;  2PVG B;  3QYG B; 
#chains in the Genus database with same CATH topology
 3EG2 A;  1I8F A;  1FMW A;  4R55 A;  2JTM A;  2V8K A;  4B9X A;  4M7A B;  2QA4 Q;  3V7C A;  3J81 E;  4EOQ B;  3DLM A;  3CXC P;  4F6U B;  1WJS A;  1XO2 A;  3B57 A;  2R58 A;  3VS7 A;  2MPX C;  1FMV A;  3OBW A;  3P8H A;  1RAD B;  4XAX B;  3G71 Q;  1OV3 A;  2MWO A;  3CC4 T;  2F1L A;  2UZD B;  4BE0 A;  2D0Q B;  2JVV A;  3EH2 A;  4BCO B;  1KD1 R;  4BBR M;  4WF2 A;  2EBP A;  2GF7 A;  3EAE A;  1YNZ A;  1K76 A;  4X1V A;  1B34 A;  2PHG A;  1X2Q A;  2FRW A;  1MNE A;  1NEB A;  5LJ3 e;  1M2O A;  1A0N B;  4OGR B;  1ZUU A;  4KH1 B;  3I5S A;  4PLL A;  3OSV A;  4OB3 B;  2V26 A;  3QWY A;  2FO0 A;  2IW9 B;  1MMN A;  4AKI A;  1BIA A;  4M78 D;  4BDY A;  1WQW A;  4MIM A;  4CFU D;  2RI2 A;  2FPF A;  2RHY A;  1AWJ A;  4KT0 E;  1Y57 A;  2EJ9 A;  1RLP C;  4Y91 A;  3E2U A;  2YRC A;  4XTU A;  2LNV A;  4XU0 A;  4HCK A;  5LJ3 g;  1K8A U;  1QW1 A;  1WX6 A;  3R6N A;  1KJW A;  4M75 B;  3UAT A;  2QFZ A;  1OI1 A;  2L3S A;  4OMP A;  2G6F X;  2V1Q A;  5CQX A;  2E64 A;  4ATO A;  1EX4 A;  4E7Z A;  4MDW A;  3TEE A;  3TNI B;  1EZZ B;  4Z6Y A;  2OTJ T;  2E65 A;  1WFW A;  1V1C A;  1YJW T;  4OVA A;  4BD3 A;  2LQ8 A;  1YHQ Q;  2RK1 A;  1UTI A;  2PMI B;  2CT3 A;  5CIU A;  3OY9 A;  4OB2 B;  3QWX X;  3SFM A;  3NTH A;  4EMK C;  4ESR A;  3G71 T;  1VQ6 Q;  4BE2 A;  4IUT A;  3BHV B;  5A0L A;  1OI9 B;  2HSE B;  2FL7 A;  3QZ9 B;  4DEX A;  3TSW A;  1VQ5 A;  3CCV A;  3M0T A;  1K9M R;  4E7I A;  2HBW A;  4L59 A;  4IUU A;  1VQO T;  1KFZ A;  1PRM C;  2WPA B;  3WXM B;  1K8A R;  2PVD B;  5EFQ B;  1TS9 A;  3H6Z A;  3CPW P;  5HY6 A;  1QVF P;  1E7O A;  2LCC A;  2BTT A;  2CSI A;  1YIJ T;  3I9Q A;  2J6O A;  1ZSZ B;  2UZE B;  1VQP A;  3TRE A;  4EOK B;  1MMG A;  4HVW A;  3SHW A;  4M7A F;  1UFF A;  5KYX A;  5I2M A;  1K1Z A;  4C92 D;  4C92 G;  3H0F A;  4F70 B;  3O0G D;  3CCL T;  2IN3 A;  2OTL A;  1GH6 B;  4JRP A;  1UNG D;  4EMK A;  4EOR B;  1HK9 A;  3MP8 A;  3SEM A;  4AFZ C;  2A0F B;  2JS0 A;  4EC8 B;  3REA B;  2K4Y A;  5C0M A;  1YWO A;  1K0X A;  2DET A;  3O8V A;  2WAC A;  1HJD A;  4IUQ A;  4EOP B;  1GCP A;  2CYZ B;  2KAF A;  4OF1 A;  5LJ3 d;  5KYU A;  1WPY A;  4A63 B;  2M16 A;  4BBS M;  4FL6 A;  2WMA B;  2E5Q A;  4HVV A;  4BI8 B;  5DLQ E;  4LOC A;  4RTT A;  1KQS A;  1PWT A;  5D6Y A;  3OYJ A;  2E70 A;  3S3M A;  1ARK A;  1JEG A;  1X27 A;  4Z89 A;  5GAO n;  2A08 A;  1J3T A;  1CSK A;  2DVE A;  2QTX A;  1AHJ B;  3UF4 A;  4QQG A;  4F7U E;  2DD5 A;  3OS2 A;  1OKW B;  2DME A;  2YDL A;  4J9G A;  3FB9 A;  3DTO A;  2QG9 B;  2PK9 B;  1YHQ A;  1X43 A;  2RM4 A;  2X9H A;  4AFS C;  5LJ5 j;  4RTZ A;  1ACM B;  1OU8 A;  3QHS A;  2KVQ G;  3NDQ A;  2OJ2 A;  1M8M A;  2L3Q A;  5GAN 4;  3VRZ A;  1H1R B;  3SWN A;  1YIT Q;  2NLU A;  3VS5 A;  2IG0 A;  2P0Q A;  4RG8 A;  1G3S A;  1WYX A;  5HK0 A;  4CFU B;  3CMA Q;  4OB0 B;  1QLY A;  3QYH B;  3MCA B;  4RTU A;  3V8L A;  2ENM A;  4C0D B;  2O2O A;  3UA6 A;  2YT6 A;  1VQ4 T;  2DKG A;  4M7A A;  1H1S B;  2BIV A;  3CPW S;  3CD6 Q;  1ZQ1 A;  1ZA1 B;  1Q86 U;  1YJ9 Q;  1NLO C;  4C8Q G;  1GY3 B;  4J9C A;  3CCQ T;  4OGE A;  1BIB A;  3ME9 A;  3OYH A;  2IVX A;  3MET A;  1VQP Q;  3LYI A;  3FC3 A;  4C5I A;  2QTV A;  2CDT A;  2YUP A;  1B34 B;  5DY9 A;  2DTI A;  1MMD A;  5C6S A;  2EGA A;  2HDA A;  2WSC E;  2DJZ A;  4PJO B;  3QPH A;  3A8L B;  1BCM A;  3N5B B;  1KD1 U;  5IN1 A;  4IUR A;  5CAI A;  1YJN A;  1N4M A;  3L2W A;  2BZ8 A;  2HQH A;  3VJP A;  3BW1 A;  4BY7 X;  1H8K A;  4UC4 A;  3EGX A;  5KYX B;  3M54 A;  4IKF A;  3PFS A;  3M0Q A;  4XTW A;  1IHV A;  3M03 A;  5LMK B;  4R56 A;  1OEB A;  4O5V A;  2DF6 A;  4AFU C;  3P8B B;  5KH6 A;  5GAO r;  1VYV A;  2FYK A;  2GCX A;  1SHF A;  1I4K 1;  2R5A A;  2HQE A;  3RR6 A;  5I21 A;  2DLP A;  3JCM h;  1GL5 A;  4BCN B;  4M77 D;  2F2W A;  2MI6 A;  2K79 A;  2CUD A;  2DXC A;  3RKX A;  3FEO A;  1YJW A;  3BG3 A;  1UNL D;  1RLQ C;  2DPP B;  3X26 B;  3Q1J A;  3HFO A;  2IPO B;  4ROD A;  2RJE A;  4QQD A;  3DL1 A;  4WCI A;  1R0C B;  5IHN A;  2JM8 A;  2KRM A;  4HCB A;  4YTL A;  1WHH A;  1VQ7 Q;  4DBQ A;  2WSE E;  4Z8A A;  1TH7 A;  1UJ0 A;  3JRZ A;  3A8G B;  4LUE A;  3DDQ B;  3JCM J;  1Q86 R;  5HKC A;  3EFS A;  1C9B A;  2EKH A;  1U1T A;  4M78 B;  2QI2 A;  2MCN A;  2LJ1 A;  1DJ7 B;  3URG A;  1VQ6 A;  4LD9 K;  3CMA A;  1PC0 A;  1T3S A;  5GJV B;  3PNW C;  2O31 A;  1K9M C;  3QYE A;  4PFZ A;  5IHY A;  1JJ2 P;  3A5Z B;  2XIC A;  2W9Z A;  4AKH A;  2KYM A;  2CZ6 B;  3M59 A;  4BI4 A;  3R6O A;  1VQ9 A;  2JTE A;  3RMQ A;  1W6X A;  2COZ A;  4JJN K;  3HHT B;  1ZBX A;  1FYN A;  4CFV B;  1H92 A;  3BY7 A;  5FRO A;  2ZPE B;  4HA8 A;  3JB9 F;  3K7A M;  2BZY A;  3CPF A;  4AG1 C;  3VYH B;  2EUF A;  1AWO A;  4JJB A;  2PNI A;  4OMO A;  4CFW B;  5D6W A;  2GNC A;  4KRT A;  1Y96 A;  3VKG A;  4EMK B;  2I0N A;  1NPP A;  3M4G A;  3TVT A;  2W96 A;  3ULR B;  2JS2 A;  3BG9 A;  5CKD A;  1AOJ A;  5HBJ B;  3SWN C;  1UNH D;  3HB9 A;  2QQS A;  4JRK A;  4HCZ A;  1QVF S;  2X4W A;  4E7J A;  2VUB A;  2V1R A;  5IDN B;  2CP5 A;  5I2S A;  3MPU B;  2E6N A;  4ANJ A;  2O4X A;  3JCM W;  2V8J A;  2OTL T;  4JRQ A;  3CCL A;  3OMC A;  3DKM A;  1WXT A;  4M7A E;  1GCQ C;  1OX8 A;  3L42 A;  2ZZD B;  3QDR B;  1NJI C;  3GOX A;  2QQR A;  3BLH B;  2KGT A;  3NGP A;  5GAO l;  1VQ7 T;  2BS4 A;  3RER A;  1YJW Q;  1GXI E;  2CH4 A;  4PJO A;  1QVP A;  3QBY A;  2HNI A;  2BZX A;  1TUD A;  4N4I A;  5GAM d;  4F14 A;  3AHU A;  4FYY B;  4F7J B;  2EYY A;  1TG0 A;  4IUV A;  1XQH A;  4D8D A;  1M1F A;  3DDP B;  5EC7 A;  2VC8 A;  1RI0 A;  4QVD A;  5IXF A;  4JPB W;  4RTY A;  1TFB A;  4M77 F;  1WXU A;  2F2V A;  1NJI R;  4J6Y A;  2C6T B;  4XU1 A;  1ZUY A;  3G4S T;  4M7D A;  2W99 A;  1U8R A;  1FIN B;  2KR3 A;  4J7I A;  3UPU A;  2XDP A;  3HO8 A;  4EOI B;  4HNU A;  2EQM A;  3VKH A;  1LOJ A;  3L2Z A;  2CH4 W;  2WIH B;  3JCM X;  2MAM A;  2NUZ A;  3GIB A;  2H3J A;  4KGV B;  2K5F A;  2UZL B;  2J6K A;  2QYZ A;  3HSB A;  1PNJ A;  4JLI A;  2DL8 A;  2ED1 A;  5DM7 R;  1KC8 U;  2KK4 A;  2RI5 A;  4NS5 A;  2QAS A;  2L5Q A;  2O4X B;  2C0I A;  2RO0 A;  4BDZ A;  2MK5 A;  5GAO m;  4M78 E;  1GBQ A;  5GAN h;  1VQL Q;  4BCG B;  4YOO A;  2MWP A;  3QII A;  4EIK A;  3MP6 A;  1WXB A;  4LD6 A;  1X01 A;  5D6X A;  4CFN B;  1O9K B;  2DD4 B;  5CKH A;  1H3H A;  2ZZD A;  4GY5 A;  4J83 A;  3CCM Q;  2RPN A;  2KXD A;  2G3R A;  3OYB A;  2EYW A;  5GJW B;  1ZX6 A;  3CD6 T;  3OYD A;  2V8I A;  1NEG A;  4M4Z A;  4VUB A;  4ZN1 A;  2LJ3 A;  3I55 A;  4C8Q D;  1QLB A;  1YCS B;  4J9B A;  4OR5 B;  2YUO A;  4BCP B;  2A37 A;  1NZ9 A;  1SKU B;  1W70 A;  2XMF A;  2P0P A;  2J7I A;  4JJD A;  3L2V A;  5LJ5 g;  1VQN T;  2ESW A;  4M7A C;  1X69 A;  3PVQ A;  1RAI B;  3VYG A;  2K7A A;  2JW4 A;  3PMT A;  4FT2 A;  3CCE T;  3M56 A;  3OSS C;  1SHG A;  1W2B S;  2DTH A;  2FZK B;  3HL8 A;  2EYZ A;  1HD3 A;  2LVM A;  1YIJ A;  1WJQ A;  1XTD A;  1WQ7 A;  3HRT A;  3M4Y A;  2FRY A;  1QVG S;  5KYN A;  1M90 C;  1OOT A;  2Y90 A;  1AWX A;  1NYF A;  4FSS A;  5IF1 B;  4F7U A;  4EON B;  2D0N A;  5FWB A;  1YN8 A;  1VQO A;  4D8K A;  3G4S Q;  3EFR A;  3PT9 A;  4FYW B;  1RAH B;  2RHU A;  3EG0 A;  4BCH B;  2LRQ A;  5AYF A;  1H25 B;  2DER A;  1B07 A;  3CCR Q;  1VQM A;  1TSF A;  3EJ1 B;  1VA7 A;  3G6E T;  1ENW A;  5CCA A;  4KUL A;  1JST B;  3P8D A;  5BNJ B;  5ECA A;  1H24 B;  2DYI A;  3VS4 A;  2UUE B;  1VQL T;  2CZ1 B;  1UGP B;  1AIS B;  4HNT A;  1TTH B;  3GBQ A;  2DXT A;  3QWL A;  2O01 E;  4C8Q C;  5GMK h;  3A1P A;  4P5N A;  3ER0 A;  1QKW A;  3QDF A;  3F5X B;  2RI3 A;  4FT4 A;  1Y7X A;  1B3Q A;  1ZUK A;  4B6M A;  4C8Q F;  4WTO B;  4CC7 A;  3IQL A;  2AZS A;  3CCM A;  3M9Q A;  3G1J A;  4J8O A;  4C8Q A;  3OYC A;  4BCK B;  1TOV A;  2QEX T;  1UJY A;  1S72 Q;  2DXB B;  3DOG B;  4L5G A;  3OS5 A;  4RKU E;  4N4G A;  4EOL B;  1WGS A;  3LWH A;  1ZSZ C;  2QQB A;  4PJO D;  1ZHI A;  1E7P A;  2EAY A;  4BY6 B;  4HNV A;  4NC6 A;  3GNG A;  2WJ9 A;  3EH1 A;  1AD6 A;  4PL6 A;  2KRO A;  3EG9 A;  2GTJ A;  5GMK m;  5KCO A;  2LW4 A;  1M90 R;  2BE7 D;  4J9I A;  2DYB A;  5GAM g;  3PGG A;  5IDP B;  2L3R A;  2LQK A;  1R8O B;  3CQT A;  2CT4 A;  2XDB A;  2HKN A;  4J6W A;  2DBK A;  3JCM c;  1VYU A;  2EIF A;  4GBQ A;  4RTW A;  1UUE A;  2P0K A;  4DBH A;  4I3Z B;  4B9W A;  2EW3 A;  1QP3 A;  1OQK A;  5GAN 2;  3PMI A;  1IZ6 A;  3CCJ A;  3LQ5 B;  2DD4 A;  5IHK A;  3I5R A;  3JAM E;  1N8R R;  1XNI A;  3ZL7 C;  1PM3 A;  1M3C A;  2PUO B;  1UG1 A;  1QMC A;  2QGF B;  2K57 A;  1VQL A;  4IUP A;  1VQ5 Q;  2VWF A;  1QVF A;  9ATC B;  4M77 A;  3RMS A;  2RH2 A;  2Z0W A;  1NG2 A;  5M9O A;  2DL5 A;  1VQM T;  2MOX A;  1D0Z A;  1UEB A;  5FW9 A;  4IMY B;  5HBE B;  1KQS S;  1KG1 A;  3MP1 A;  4CC3 A;  2LCS A;  3TU4 K;  4XU2 A;  4EOM B;  1I07 A;  2CKK A;  4C92 E;  4F7U B;  2KSS A;  3VS3 A;  4M7D G;  1Q7Y R;  1X6O A;  1NJI U;  1W2B A;  2E10 A;  3J80 E;  1IGQ A;  3PTA A;  3MKD A;  1OIY B;  4OMM A;  2RJF A;  1Q82 C;  1VQ9 T;  4ROE A;  3MY5 B;  2F5K A;  5GAN 5;  4J9E A;  4F17 A;  4OMQ A;  4OMF B;  4F6W B;  4EOO B;  4MDX A;  2JTF A;  2EGE A;  1KQS P;  4PJO G;  2HBP A;  1K9A A;  4RCC A;  1M2V B;  1WJR A;  1R0B G;  2E6Z A;  3CMA T;  4ZTJ A;  2W2H A;  4CC2 A;  2PJQ A;  4Q5W A;  2O9S A;  2JZ2 A;  4A4F A;  1ZSZ A;  2FVU A;  3G6E Q;  5KYW A;  2A7Y A;  2DEQ A;  3CC2 Q;  1FWZ A;  2EYX A;  2NWM A;  3JV3 A;  2K3B A;  3SB2 A;  4HT9 A;  2E41 A;  4QT7 A;  3L2R A;  2C5O B;  3PO3 S;  4J6X A;  4OMN A;  3CCQ Q;  4PJO E;  3SD4 A;  1SRM A;  2D8J A;  2HL5 C;  4BCM D;  1NBE B;  4XTY A;  4CFM B;  2DK3 A;  2P84 A;  4II1 A;  3A8M B;  3S6W A;  1MUZ A;  4A54 A;  4PJJ A;  4RMO A;  1SG5 A;  2BKZ B;  4X9D A;  3PIO A;  3X25 B;  2QA4 T;  1GUX A;  1FKM A;  2HQX A;  2X4X A;  2CUB A;  1GBR A;  1JU5 C;  2DJQ A;  3NPF A;  4M7D E;  5LJ3 f;  5GMK i;  1H26 B;  3PIP A;  1BI2 A;  1O75 A;  4AI6 A;  2PUK B;  2G9X B;  3A98 A;  1K4U S;  5GAO q;  1KD1 C;  2EJF A;  1KQ1 A;  1KXU A;  1M5Q 1;  4JX5 A;  2JUF A;  3MEV A;  3CC4 Q;  4XU3 A;  2KDS A;  3C0C A;  3QJ6 A;  4LDW A;  2D6F A;  3LWI A;  5KYU B;  2VB6 A;  3MY1 B;  1Q7Y U;  5HQ0 B;  1N9R A;  2YHT A;  4LDV A;  4FYX B;  1IXD A;  4F7U F;  3JCM b;  4QVZ A;  4M7D D;  2RMO A;  1M27 C;  2DNU A;  2EQI A;  2QGS A;  3NFC A;  3OYM A;  5LJ3 h;  4LDX A;  4M75 E;  1SPK A;  1Q82 R;  3NTK A;  5FRM A;  1JKW A;  1OPK A;  1HYO A;  1LNX A;  3POM A;  4M7A D;  4PFO A;  1H28 B;  3SDZ A;  1K8A C;  4UN0 A;  1G3Y A;  1YJN Q;  4M7D C;  2K2M A;  1VIE A;  1Y0M A;  3WVD B;  2LNH B;  2JOY A;  3LGL A;  1PSE A;  2D9T A;  3H8Z A;  3EHR A;  4NOY A;  1UHF A;  3OYK A;  1AEY A;  2MF2 A;  1LPL A;  2GFU A;  2QAZ A;  2R5M A;  4M7D B;  2M9U A;  2OX7 A;  5J3B A;  4YOS A;  3VU3 C;  4ROC A;  4F04 B;  4Y72 B;  3CC2 A;  2ECZ A;  2K3Y A;  2VAS A;  1F5Q B;  2DXU A;  1S1N A;  2QGG A;  1YHQ T;  1VUB A;  5LJ5 e;  1IB8 A;  2VGN A;  5GAM f;  1VOM A;  2LQN A;  4EMH A;  3ZEH A;  1VYW B;  2DD5 B;  2LT1 A;  3QHR B;  4KGX B;  4J9D A;  2XKO C;  1I1J A;  4IIO A;  4JDS A;  2XHC A;  5LJ5 h;  2VXE A;  1WI7 A;  2ZPF B;  3UA7 A;  2I53 A;  2KNB B;  4DA4 A;  1O9K A;  1NPR A;  4RTV A;  2MMP A;  1HXD A;  4DOV A;  2K3X A;  3HBL A;  1P5E B;  3S3N A;  5GMK e;  2LX9 A;  1N27 A;  4CI0 C;  3LX7 A;  1Y07 A;  4A53 A;  2LP5 A;  4J7F A;  2WFY B;  3U23 A;  4HL4 A;  3H4C A;  4E6R A;  5A0D A;  4QQ6 A;  4F6S B;  2CZ7 B;  2SEM A;  3UT1 A;  1C1A A;  3GTM S;  1VYT A;  1VQ4 Q;  4BAC A;  1Q95 G;  3LH5 A;  5LL6 S;  2ZPI B;  5GAN f;  4CFX B;  1OZ2 A;  2C06 A;  5FU6 C;  1MHN A;  2V22 B;  4ZN3 A;  5CR2 A;  4FM4 B;  4M75 D;  1WHK A;  3LGF A;  3HTR A;  4D6W A;  3C94 A;  1PD1 A;  4XK8 E;  2AKL A;  1JSU B;  2F69 A;  1S72 T;  3OYN A;  1F1B B;  4OB1 B;  2QQA A;  2FEI A;  4BI3 A;  4JS5 A;  1N8R U;  2KEA A;  3G7Z A;  3QKJ A;  2RQW A;  1RL2 A;  3KXT A;  3INZ A;  5KE2 A;  4FW2 A;  3CCV Q;  1D3B B;  1FMK A;  2BKD N;  3VUZ A;  2GGR A;  2BS2 A;  3E1S A;  4BCQ D;  2VV5 A;  1D09 B;  2XDD A;  2CP3 A;  1M30 A;  3CCV T;  1O9S A;  2K2V A;  4QSH A;  1Q81 U;  1T0H A;  2G77 A;  8ATC B;  3GF5 A;  2ZCF B;  4JZ4 A;  3BG5 A;  2RF0 A;  2F2C A;  4BE1 A;  3EFO B;  2QF7 A;  2ROL A;  3FJP A;  2X4Y A;  3DB3 A;  3QHW B;  5FU7 C;  4KBM B;  2ABL A;  3QYG B;  4C5H A;  3CCU Q;  1OGU B;  5FLX E;  5GAN 8;  2VYT A;  3JCM g;  1YBY A;  2LC4 A;  2RB6 A;  1TU0 B;  4ZNX A;  2VKN A;  3CCQ A;  1YIT A;  1H64 1;  5KCH A;  2DFU A;  2PTK A;  4MML A;  4ELJ A;  3I56 A;  3H0H A;  1Z9Q A;  3E19 A;  4BUG A;  1YCY A;  1WHL A;  3JCM d;  3JSC A;  1QQJ A;  1RUW A;  4C92 B;  2CP2 A;  1MND A;  2DIL A;  1VQ4 A;  2EFI A;  1WHJ A;  2ZGW A;  2DRM A;  1SSF A;  1D3B A;  2E3H A;  1H1P B;  4N4H A;  4Y28 E;  5FU7 B;  2ROT A;  2RQT A;  2PU9 B;  1UGS B;  2BS3 A;  1YJ9 A;  5LJ5 f;  3S3O A;  1RAF B;  4M77 C;  3EG1 A;  4E7H A;  1G3T A;  4LXC A;  4XQ3 A;  2HSP A;  3BFM A;  1UEC A;  3CCE Q;  1I0C A;  4M7D F;  3CCM T;  3CBM A;  3AT1 B;  5KYY A;  1QMZ B;  1AVZ C;  3BLQ B;  5J39 A;  1M9S A;  4DBF A;  4JLG A;  5EJC A;  4GLM A;  3OMG A;  1KC8 C;  1GRI A;  1JJ2 S;  4N0A C;  3JCM Q;  3DJB A;  1LCK A;  2XD0 A;  1M4Z A;  3FIF A;  5GAM h;  3FDR A;  4ME7 A;  1WZO A;  2X1N B;  3I55 Q;  3M55 A;  3QXE B;  4HLQ A;  3FRN A;  4PJM A;  4Z88 A;  1EFN A;  1G8X A;  1D3U B;  3CPW A;  3M0R A;  1W1F A;  2CS7 A;  1OIU B;  3X24 B;  1M1K R;  2FPD A;  3LW5 E;  3OQ5 A;  3MEW A;  3M0S A;  1IRX A;  4ELZ C;  1UHC A;  1XJW B;  2AKK A;  1AT1 B;  2FZG B;  1P92 A;  3EHQ A;  3QZ5 B;  4ZGJ B;  1E6H A;  3I56 Q;  3JB9 I;  2B86 A;  4M75 G;  1UDL A;  3VS1 A;  1KSW A;  1PKS A;  2QDL A;  3CCU A;  5AT1 B;  2DRK A;  3BLR B;  3BDU A;  4BCJ B;  1M3B A;  2LMJ A;  1GFD A;  2B8A A;  1M3A A;  4BY1 X;  1IO6 A;  1UGQ B;  2KMT A;  5FRN A;  2RD1 A;  5IT9 E;  2KE9 A;  1VQN A;  1PG5 B;  3VV0 A;  1CKB A;  2DIG A;  2LZ6 B;  2C4G B;  2AHJ B;  4PJL A;  1URC B;  1VQM Q;  1MV3 A;  1JOW A;  2OTL Q;  1QVG A;  1SF9 A;  2RN8 A;  4AG2 C;  3TN8 B;  3CD6 A;  3OYI A;  4II5 B;  2PQW A;  2PVO B;  3EG3 A;  3L2U A;  1UGV A;  2KQW A;  3JB9 G;  2IIM A;  2EKO A;  2X51 A;  1PKD B;  2HL3 A;  2DXB A;  1VQ8 T;  3OYA A;  2CZ0 B;  1V76 A;  3C12 A;  3EGD B;  3WVE B;  2I2L A;  3C95 A;  3HRS A;  2DL7 A;  4PJN A;  4XTX A;  5GMK l;  4FCY A;  3O5Z A;  4DOW A;  1XOV A;  1SRL A;  5J26 A;  5GMK j;  1E9H B;  4DQ2 A;  1NM7 A;  2E4H A;  2YUQ A;  1W4S A;  4M78 F;  4BXX X;  4CC4 B;  1X75 C;  4X9C A;  3V7R A;  2UZB B;  4YC3 B;  2OTJ A;  1SSH A;  3RIR A;  3LH0 A;  5I22 A;  4HKE A;  3VKI A;  4EPC A;  4RTX A;  3MEA A;  2LDM A;  3RES A;  1GUX B;  1G3W A;  1PRL C;  2DE0 X;  4PFP A;  1VQ8 A;  2XI9 A;  2AIR B;  3DB4 A;  3NTI A;  1H4L D;  4LE9 A;  3BDL A;  4HVU A;  4JJC A;  5GAN d;  3TW7 A;  2GFA A;  3CBP A;  1IGU A;  2KI7 A;  3HZJ A;  2CGH A;  4MZP A;  4KH0 B;  2COW A;  4MZM A;  4C0G A;  2JMA A;  4F7S B;  3GNF B;  2DX1 A;  1QCN A;  4QKU A;  1M1K C;  3MI9 B;  1OX9 A;  1QWF A;  2PVG B;  3RKY A;  2RNA A;  3TQ7 P;  2Y4Y A;  1PHT A;  3JCM V;  1WDX A;  2ZAE A;  4CXA B;  1G83 A;  5FWC A;  2KXC A;  1X2K A;  3EFO A;  1OUL A;  3EOC B;  1VQK A;  2L3P A;  2OAU A;  5CQY A;  2EYQ A;  3MHX A;  1PSF A;  2B9R A;  3HRU A;  1VQ7 A;  2HKQ B;  3UWN A;  2A36 A;  2GQI A;  1BCO A;  2R7G A;  3CCE A;  1ZSG A;  2YRV A;  3VS0 A;  1I5O B;  4BCI B;  1W98 B;  5HK3 A;  4BCN D;  1JBM A;  4PJO F;  3BHU B;  3CME Q;  4FIB A;  3I55 T;  1JO8 A;  1YFN A;  4M6V A;  4NL2 A;  2C5V B;  2LJ0 A;  2Y4X A;  4DEY A;  3CBO A;  3OYY A;  1W2B P;  1PKT A;  1G3N C;  2DAQ A;  1VQ9 Q;  4F7L B;  5KYW B;  1M8V A;  2JM9 A;  2CP6 A;  4A4G A;  2X35 A;  1JRI A;  1M2V A;  5GAN e;  4QVC A;  3A8H B;  2DL4 A;  1Y71 A;  1GCQ A;  1NYG A;  4J9F A;  3OA6 A;  4G6L B;  1EIF A;  3QO3 A;  1C6V X;  1BU2 A;  2CCH B;  2HZY A;  5LQF B;  1U5S A;  2MIO A;  2YWW A;  3BHT B;  1VIN A;  5DQW A;  2KMG A;  4ZGD B;  1BI1 A;  2XID A;  3RUX A;  4JS4 A;  2HD0 A;  3VS6 A;  2L0A A;  3F70 A;  3FLG A;  1Q82 U;  3JB9 H;  2P4T A;  2DVJ A;  2D1X A;  1YJ9 T;  2E5K A;  4E2F B;  1ZBJ A;  2DO3 A;  3TNW B;  2RQR A;  1ABO A;  3RDV A;  2YLB A;  1BKB A;  3GLX A;  1FX7 A;  4PNO A;  2EJG A;  1MGQ A;  4ZTF A;  4R0K A;  2IW6 B;  2DL3 A;  2KYB A;  4FW1 A;  5IXB A;  2FG0 A;  3RGF B;  4ORZ A;  2QEX A;  2C5N B;  2K5L A;  1YP5 A;  4JUV A;  4A4E A;  2HEQ A;  4IIM A;  2QDJ A;  5GAN j;  4JZ3 A;  3OBY A;  4HT8 A;  3CCU T;  3X20 B;  1YIT T;  1C0M A;  4A4H A;  3CME A;  2PK2 A;  2GQV A;  2W10 A;  2HAX A;  2W9F A;  1KHC A;  4O6J A;  1WIE A;  5DLO A;  3THK A;  1I81 A;  4M78 C;  2X3W D;  3QSU A;  4L6V 5;  2RHI A;  2VVK A;  4GLK A;  4KGZ B;  2JNG A;  3CCR T;  4HCC A;  3OS1 A;  4TTH A;  4KUI A;  2ED0 A;  2KRN A;  2IVW A;  2GBQ A;  2NYS A;  2A3L A;  2QXF A;  2DXC B;  3HPW A;  5GAO p;  3OW2 P;  5GAN 7;  2SRC A;  3TCJ A;  1YJN T;  2VGM A;  3OW2 A;  4N0A A;  2DZC A;  1U3O A;  4Z02 A;  1N9S A;  4KUD K;  2BPM B;  3FJ5 A;  1M1K U;  1KK7 A;  2PZ1 A;  1S72 A;  4NST B;  1YIJ Q;  3M0P A;  4V2S A;  1TXQ A;  2KR6 A;  2K5I A;  3H41 A;  5GAM e;  3JB9 J;  5LJ3 j;  2M51 A;  1AWW A;  1N5Z A;  2JMC A;  1U06 A;  2H8H A;  1M90 U;  1H1Q B;  3CC7 T;  2C0O A;  1IRE B;  3RKW A;  3CCL Q;  4BCF B;  1TD6 A;  4ZGE B;  3DLL A;  5CEI B;  1VOL A;  1QKX A;  4YOZ A;  2EGC A;  2YXY A;  1QVG P;  1H3Z A;  3L1A A;  3HKS A;  3X28 B;  1NLP C;  4LN2 A;  2VXF A;  3JCM f;  5CVI A;  1Q7Y C;  4TVR A;  2AZV A;  3CXC S;  1OYX A;  1VQ8 Q;  1VQ6 T;  1VIF A;  3JCM e;  5D7U A;  1KQ2 A;  2QEX Q;  2WEV B;  1JXO A;  1WNL A;  3CCS A;  1K9M U;  1UGR B;  2XK0 A;  4LUD A;  1ZLM A;  2KT8 A;  4M75 F;  1K73 R;  4EOJ B;  1X6B A;  3KUF A;  3I56 T;  2JT4 A;  1OL2 B;  4CRI A;  3TSZ A;  1D1A A;  3ZBD A;  2P4R A;  4C92 C;  2M0Y A;  5L8R E;  2WHB B;  2RA2 A;  5CO7 A;  3D7S B;  1VQK Q;  2CP7 A;  5IH2 A;  2EQU A;  4FSX A;  3SWN B;  5GAN 6;  4C0Z A;  2DBM A;  2O9V A;  4HXJ A;  1V29 B;  2QQ8 A;  3CC2 T;  1T0J A;  4A4K A;  2M1H A;  3OW2 S;  3I35 A;  3VYG B;  1Y96 B;  2E12 A;  5LJ5 d;  5CK9 A;  1UE9 A;  3BE3 A;  3G4S A;  3LLR A;  2DM1 A;  4F7N B;  5DQV A;  4XTZ A;  3GP8 A;  3CCR A;  3V8K A;  1ZP2 A;  1G5V A;  1HSQ A;  3QJY A;  1KC8 R;  4XTV A;  4Y92 A;  5A0G A;  3V8J A;  2HMA A;  5GAN 3;  3M53 A;  1AZE A;  3J7A F;  4PKC C;  4EOS B;  2FB7 A;  1YWP A;  2J05 A;  3OYL A;  2LTO A;  4FYV B;  5HNB B;  4EC9 B;  2DMO A;  1LVK A;  4LNP A;  2M0O A;  2DEU A;  2RQU A;  3CCJ Q;  2QDY B;  2K9G A;  4CRL B;  3TNH B;  5IAY A;  1BU1 A;  2LT4 A;  4LDY A;  1VQP T;  1AD5 A;  2H3E B;  2AT1 B;  1YI2 Q;  2NUT B;  1TUG B;  1D1B A;  3OYF A;  1RAE B;  5ACB A;  1N6A A;  4AMC A;  2LX7 A;  4KRD B;  2DIQ A;  2M02 A;  3CEY A;  5A2Q E;  4NL3 A;  2W0Z A;  3TW6 A;  4PLI A;  2F2X A;  4KRC B;  2E3I A;  1BBZ A;  3ZFJ A;  3PE0 A;  3KHI A;  2JXB A;  1PCX A;  1SEM A;  5L2W B;  3C4S A;  3HP9 A;  1LJO A;  5CKE A;  4E47 A;  1VQO Q;  3EGU A;  1RAC B;  3T9N A;  2A28 A;  3M0U A;  4E7K A;  2CRE A;  2C0T A;  7AT1 B;  4M77 E;  2WSF E;  2CSQ A;  4OGC A;  3CCS Q;  2QQ9 A;  3GPL A;  5ICP B;  3G33 B;  2YRD A;  1JB0 E;  4E7S A;  5I11 A;  2WIP B;  1E6G A;  3VS2 A;  2FPE A;  4M78 A;  1TWB A;  2J6F A;  2KBT A;  1Q81 R;  5IHI A;  4J5Y A;  4AFQ C;  2LCL A;  2O88 A;  2KT1 A;  4M75 C;  2WXV B;  2L8D A;  2DTO A;  2L89 A;  1WHG A;  1PD0 A;  4C5E A;  4C92 F;  5CYI B;  2X3X D;  1MMA A;  4EMG A;  1H27 B;  5HCK A;  2BE9 B;  1JJ2 A;  2DA9 A;  4M77 G;  1IHW A;  3CCS T;  1QCO A;  2QK0 A;  3G6E A;  1D0X A;  3M57 A;  2AK5 A;  4C8Q B;  4C92 A;  5HVY B;  2I40 B;  1BYM A;  2E1H A;  5HBH B;  3MEU A;  1OPL A;  3KFV A;  1WLP B;  3ASK A;  1OZ3 A;  2EPD A;  3H0I A;  3NHN A;  5CKB A;  1K73 C;  3M58 A;  2RQV A;  1U1S A;  2JJ9 A;  4F16 A;  4RCB A;  2LQW A;  3H9N A;  3CC7 A;  4J9H A;  1QP2 A;  1BI0 A;  2YSQ A;  3UDC A;  1WA7 A;  3E9F A;  1TUC A;  4OP0 A;  1VQK T;  1D1C A;  4C0D C;  4JX4 A;  2ZPB B;  5KE3 A;  1BK2 A;  1AZG B;  1RAA B;  4AKG A;  1N8R C;  2EWN A;  1MV0 B;  2JGZ B;  3JB9 D;  3CC4 A;  2D8H A;  3OB9 A;  5I5Z B;  4MMK A;  2RK2 A;  2R57 A;  4MFE A;  3L2Q A;  1FVV B;  2RJC A;  2OAW A;  4AT1 B;  1VQ5 T;  1QWE A;  2WMB B;  3HFN A;  5GAN g;  1KIK A;  1Q81 C;  3QYB A;  5FU6 B;  1NE8 A;  3MO8 A;  2RJD A;  2ZPH B;  3G71 A;  2KY9 A;  1T3L A;  2EVR A;  1GFC A;  1RAG B;  1QCF A;  1BI3 A;  4BCM B;  4JX6 A;  2QA4 A;  3A8O B;  2BUD A;  4QW2 A;  3M5A A;  2F5T X;  1M1G A;  4BB7 A;  1FXX A;  3CCJ T;  3EGX B;  2XG8 D;  2KRS A;  4JRI A;  1RAB B;  5EG2 A;  4C8Q E;  3CME T;  1D0Y A;  4M78 G;  2NUT A;  4DBR A;  4C0F A;  6AT1 B;  2EQJ A;  2GTO A;  3OYG A;  2HCK A;  1OL1 B;  3VUB A;  1VQN Q;  4BCQ B;  3KBG A;  4MZT A;  2FZC B;  1OKV B;  4M75 A;  2DZ9 A;  4RUG A;  3QG1 A;  5KYY B;  3VRY A;  1KHI A;  3NMZ C;  4X34 A;  2FHD A;  1YI2 A;  2YLC A;  4E7L A;  4FX3 B;  4MFD A;  3EID B;  2J06 A;  4LDU A;  4EDU A;  2CCI B;  3MJX A;  2EQK A;  1G2B A;  2L2P A;  4RG2 A;  4FU6 A;  4OML A;  1JXM A;  1Z9Z A;  1UB4 A;  1ZA2 B;  2CJM B;  4BY6 C;  2RHZ A;  1YI2 T;  2ZPG B;  1R77 A;  2RHX A;  3EG9 B;  3E9G A;  3REB B;  1WHM A;  1RI9 A;  4ELY C;  2X4J A;  3JCM P;  1X6G A;  1I5L A;  1K73 U;  1BB9 A;  4K11 A;  3PVL A;  1Q86 C;  4F7U G;  3CC7 Q;  2K6D A;  2IW8 B;  3MIA B;  1OU9 A;  2OTJ Q;  3EGD A;  4M77 B;  4C5G A;  2JN0 A;  2C5X B;  5FGK B;  3V7S A;  1ABQ A;  2ATC B;  2NUP B;  2NUP A;  1JQQ A;  4PJO C;  4M7A G;  4PK4 A;  2CP0 A;  1B7T A;  1CKA A;  4ELL A;  2COY A;  3OYE A;  2XU8 A;  1K0S A;  3OS0 A;  3RBB B;  5CKF A;  3QUI A;  2OI3 A;  2MYS A;  8AT1 B;  3RNJ A;  5L23 A;  5GAM j;  2YUN A;  3CXC A; 
#chains in the Genus database with same CATH homology
 2EJG A;  2VGN A;  1I8F A;  1MGQ A;  5GAM f;  4N4I A;  4R55 A;  2JTM A;  5GAM d;  4EMH A;  4ZTF A;  3ZEH A;  3AHU A;  2V8K A;  4B9X A;  2DD5 B;  4M7A B;  4IUV A;  1XQH A;  2LT1 A;  3V7C A;  3J81 E;  3DLM A;  2XKO C;  1M1F A;  1WJS A;  2QEX A;  2K5L A;  2VC8 A;  4JDS A;  2R58 A;  4JUV A;  4A4E A;  2XHC A;  5LJ5 h;  2VXE A;  2QDJ A;  1RI0 A;  4QVD A;  3OBW A;  2ZPF B;  3P8H A;  5GAN j;  4M77 F;  4XAX B;  3OBY A;  2MWO A;  3CCU T;  3CC4 T;  3X20 B;  4DA4 A;  1YIT T;  1NPR A;  4J6Y A;  4XU1 A;  4A4H A;  3CME A;  3G4S T;  4M7D A;  2GQV A;  2HAX A;  4BE0 A;  2MMP A;  2D0Q B;  1HXD A;  4DOV A;  1KHC A;  4O6J A;  2K3X A;  1U8R A;  5DLO A;  3HBL A;  2JVV A;  4J7I A;  3UPU A;  1I81 A;  4BBR M;  3S3N A;  2XDP A;  5GMK e;  2LX9 A;  4M78 C;  3HO8 A;  4WF2 A;  1N27 A;  4CI0 C;  4HNU A;  2EQM A;  3VKH A;  1Y07 A;  2GF7 A;  1LOJ A;  3EAE A;  3L2Z A;  3LX7 A;  4J7F A;  4L6V 5;  2RHI A;  1B34 A;  4A53 A;  3JCM X;  3QSU A;  4HL4 A;  2MAM A;  4GLK A;  3H4C A;  5A0D A;  3GIB A;  2H3J A;  4QQ6 A;  2K5F A;  5LJ3 e;  2CZ7 B;  3UT1 A;  2JNG A;  3CCR T;  3HSB A;  4JLI A;  4HCC A;  4BAC A;  3OS1 A;  5DM7 R;  1KC8 U;  2KK4 A;  2RI5 A;  5LL6 S;  4KUI A;  2ZPI B;  4PLL A;  4NS5 A;  2IVW A;  2L5Q A;  4OB3 B;  2O4X B;  3OSV A;  1OZ2 A;  5GAN f;  2C06 A;  2RO0 A;  5FU6 C;  1MHN A;  2A3L A;  4AKI A;  2DXC B;  2QXF A;  3HPW A;  4M78 E;  4ZN3 A;  1BIA A;  5GAN h;  5GAO p;  5GAO m;  4M78 D;  5CR2 A;  5GAN 7;  4BDY A;  2MWP A;  1WQW A;  3QII A;  4FM4 B;  4MIM A;  4M75 D;  2RI2 A;  2RHY A;  3MP6 A;  3TCJ A;  4KT0 E;  4LD6 A;  1X01 A;  2EJ9 A;  5D6X A;  4Y91 A;  1YJN T;  2VGM A;  3OW2 A;  4N0A A;  2DZC A;  3LGF A;  4XTU A;  2DD4 B;  2LNV A;  4XU0 A;  5CKH A;  4Z02 A;  3C94 A;  1N9S A;  2ZZD A;  4GY5 A;  4D6W A;  5LJ3 g;  1QW1 A;  1K8A U;  4KUD K;  4J83 A;  4XK8 E;  2F69 A;  1S72 T;  1M1K U;  1S72 A;  2G3R A;  3OYB A;  3OYN A;  4V2S A;  2KR6 A;  2K5I A;  4OB1 B;  2QQA A;  4M75 B;  5GAM e;  5LJ3 j;  3JB9 J;  2QFZ A;  4BI3 A;  3OYD A;  4JS5 A;  1N8R U;  3G7Z A;  3CD6 T;  1OI1 A;  3QKJ A;  1RL2 A;  5CQX A;  3KXT A;  3INZ A;  2V8I A;  4VUB A;  5KE2 A;  1M90 U;  2E64 A;  4ATO A;  4ZN1 A;  1D3B B;  3I55 A;  3VUZ A;  2BKD N;  4MDW A;  4C8Q D;  1QLB A;  3TEE A;  3CC7 T;  4Z6Y A;  2BS2 A;  2OTJ T;  3E1S A;  2VV5 A;  1IRE B;  3RKW A;  2E65 A;  1NZ9 A;  2P0P A;  2XDD A;  4ZGE B;  1YJW T;  4OVA A;  3DLL A;  4BD3 A;  2LQ8 A;  3L2V A;  3CCV T;  1O9S A;  2K2V A;  5LJ5 g;  1VQN T;  4QSH A;  4M7A C;  1Q81 U;  1H3Z A;  3L1A A;  3HKS A;  2RK1 A;  3X28 B;  3PMT A;  3VYG A;  4FT2 A;  3CCE T;  2G77 A;  3M56 A;  3OSS C;  2VXF A;  3GF5 A;  2ZCF B;  5CVI A;  4TVR A;  3BG5 A;  5CIU A;  3JCM f;  1Q7Y C;  3OY9 A;  3CXC S;  1OYX A;  4BE1 A;  1VQ6 T;  1W2B S;  2DTH A;  1VIF A;  2QF7 A;  3JCM e;  3HL8 A;  4OB2 B;  3FJP A;  1KQ2 A;  2X4Y A;  3DB3 A;  3SFM A;  3NTH A;  4EMK C;  2LVM A;  4KBM B;  5FU7 C;  1YIJ A;  3G71 T;  1WJQ A;  1XTD A;  3QYG B;  1WQ7 A;  3HRT A;  4C5H A;  1WNL A;  4BE2 A;  4IUT A;  3CCS A;  5GAN 8;  5FLX E;  3M4Y A;  1QVG S;  2VYT A;  5A0L A;  1K9M U;  3JCM g;  1M90 C;  1UGR B;  1YBY A;  2FL7 A;  3QZ9 B;  2LC4 A;  1QVP A;  2RB6 A;  2XK0 A;  1VQ5 A;  2Y90 A;  3CCV A;  4M75 F;  3CCQ A;  4F7U A;  1YIT A;  1H64 1;  3KUF A;  3I56 T;  1VQO A;  5KCH A;  3EFR A;  3PT9 A;  4CRI A;  4E7I A;  4L59 A;  4IUU A;  4ELJ A;  4MML A;  3I56 A;  1VQO T;  3ZBD A;  3E19 A;  4BUG A;  4C92 C;  1YCY A;  2RHU A;  2LRQ A;  5AYF A;  5L8R E;  3WXM B;  3JCM d;  3JSC A;  2PVD B;  2RA2 A;  1VQM A;  4C92 B;  3H6Z A;  3G6E T;  5CO7 A;  5HY6 A;  1KD1 U;  2LCC A;  5CCA A;  1VQ4 A;  2EFI A;  4KUL A;  3P8D A;  1YIJ T;  2ZGW A;  2EQU A;  4FSX A;  1VQP A;  1VQL T;  2CZ1 B;  3SWN B;  1UGP B;  1SSF A;  3TRE A;  5GAN 6;  4HNT A;  1D3B A;  4C0Z A;  2DXT A;  3QWL A;  2O01 E;  4M7A F;  1V29 B;  2QQ8 A;  4Y28 E;  4N4H A;  5FU7 B;  4C8Q C;  3CC2 T;  5GMK h;  5I2M A;  4C92 G;  4A4K A;  2M1H A;  2PU9 B;  3ER0 A;  1UGS B;  2BS3 A;  4P5N A;  4C92 D;  3OW2 S;  3VYG B;  1YJ9 A;  3CCL T;  2RI3 A;  1Y96 B;  2OTL A;  2E12 A;  5LJ5 d;  5LJ5 f;  4FT4 A;  1Y7X A;  5CK9 A;  3S3O A;  4M77 C;  3G4S A;  4JRP A;  3LLR A;  4C8Q F;  4EMK A;  4E7H A;  1G3T A;  1HK9 A;  3MP8 A;  4XQ3 A;  3CCM A;  4XTZ A;  3M9Q A;  3BFM A;  4J8O A;  4C8Q A;  3GP8 A;  3V8K A;  3CCR A;  3OYC A;  1G5V A;  2K4Y A;  5C0M A;  2QEX T;  4M7D F;  3QJY A;  3O8V A;  3CCM T;  2DXB B;  4XTV A;  3CBM A;  3V8J A;  5A0G A;  4L5G A;  5GAN 3;  3OS5 A;  2WAC A;  1M9S A;  3M53 A;  4N4G A;  4JLG A;  4RKU E;  1WGS A;  5J39 A;  3LWH A;  4IUQ A;  5EJC A;  4PKC C;  3J7A F;  2FB7 A;  3OYL A;  2LTO A;  5LJ3 d;  2CYZ B;  2KAF A;  3OMG A;  4OF1 A;  1KC8 C;  2M0O A;  2QQB A;  4PJO D;  1ZHI A;  2QDY B;  4N0A C;  1JJ2 S;  1E7P A;  1WPY A;  3JCM Q;  2EAY A;  4HT8 A;  2M16 A;  4BBS M;  5IAY A;  4BY6 B;  4FL6 A;  4HNV A;  4NC6 A;  2E5Q A;  2LT4 A;  4BI8 B;  2XD0 A;  4LDY A;  1M4Z A;  4LOC A;  3GNG A;  5DLQ E;  1VQP T;  2WJ9 A;  3S3M A;  5D6Y A;  3FIF A;  2E70 A;  3OYJ A;  5GAM h;  1KQS A;  3FDR A;  4PL6 A;  4ME7 A;  5GAO n;  2DVE A;  2QTX A;  3OYF A;  5GMK m;  1AHJ B;  4F7U E;  1N6A A;  4QQG A;  2DD5 A;  5KCO A;  3OS2 A;  5GAM g;  3M55 A;  2DIQ A;  3CEY A;  5A2Q E;  3PGG A;  4NL3 A;  3FB9 A;  3QXE B;  2L3R A;  4HLQ A;  1R8O B;  2LQK A;  3FRN A;  1YHQ A;  2XDB A;  3TW6 A;  2RM4 A;  3CPW A;  4PLI A;  2CS7 A;  3X24 B;  5LJ5 j;  3LW5 E;  3OQ5 A;  3ZFJ A;  3QHS A;  3MEW A;  4J6W A;  4ELZ C;  3KHI A;  2KVQ G;  3JCM c;  2EIF A;  5GAN 4;  3C4S A;  2P0K A;  3HP9 A;  3SWN A;  1LJO A;  1P92 A;  3QZ5 B;  5CKE A;  4B9W A;  4E47 A;  4ZGJ B;  1QP3 A;  2NLU A;  5GAN 2;  3CCJ A;  3PMI A;  1IZ6 A;  2IG0 A;  3JB9 I;  3T9N A;  2DD4 A;  2P0Q A;  4M75 G;  4RG8 A;  4E7K A;  1G3S A;  5HK0 A;  4M77 E;  1XNI A;  2WSF E;  3JAM E;  3CCU A;  4OGC A;  4OB0 B;  2QQ9 A;  3GPL A;  2PUO B;  3QYH B;  3MCA B;  3BDU A;  3V8L A;  2K57 A;  1VQL A;  4IUP A;  4C0D B;  1JB0 E;  1QVF A;  2B8A A;  1VQ4 T;  4M77 A;  4M78 A;  1UGQ B;  2DKG A;  3RMS A;  2KMT A;  2RH2 A;  5FRN A;  4M7A A;  2RD1 A;  2BIV A;  3CPW S;  5M9O A;  5IT9 E;  1VQM T;  1VQN A;  4J5Y A;  2LCL A;  1ZQ1 A;  1UEB A;  3VV0 A;  2DIG A;  4M75 C;  2L8D A;  2DTO A;  1Q86 U;  2AHJ B;  2L89 A;  4C8Q G;  1KQS S;  3MP1 A;  1KG1 A;  1QVG A;  3TU4 K;  4XU2 A;  4C5E A;  4C92 F;  2CKK A;  4C92 E;  4F7U B;  4EMG A;  4OGE A;  3CCQ T;  1BIB A;  3ME9 A;  2KSS A;  3OYH A;  3MET A;  3LYI A;  3CD6 A;  3OYI A;  3FC3 A;  2PQW A;  4C5I A;  1JJ2 A;  2PVO B;  4M77 G;  1B34 B;  3L2U A;  4M7D G;  5DY9 A;  3CCS T;  2DTI A;  2KQW A;  3JB9 G;  1X6O A;  2EKO A;  5C6S A;  1NJI U;  3G6E A;  2WSC E;  1W2B A;  3M57 A;  2E10 A;  2DJZ A;  4PJO B;  3QPH A;  3A8L B;  2DXB A;  4C8Q B;  4C92 A;  3J80 E;  3OYA A;  3PTA A;  1VQ8 T;  2CZ0 B;  1BYM A;  2E1H A;  2RJF A;  3C12 A;  3WVE B;  3N5B B;  5IN1 A;  2I2L A;  1Q82 C;  3C95 A;  3HRS A;  4IUR A;  3MEU A;  5CAI A;  1VQ9 T;  1YJN A;  2F5K A;  4XTX A;  5GMK l;  3L2W A;  4DOW A;  5GAN 5;  1XOV A;  5J26 A;  3ASK A;  5GMK j;  1OZ3 A;  4OMF B;  3VJP A;  3BW1 A;  4DQ2 A;  4MDX A;  2JTF A;  4UC4 A;  5CKB A;  1K73 C;  1W4S A;  3M58 A;  4M78 F;  4PJO G;  2HBP A;  1U1S A;  3M54 A;  1X75 C;  4X9C A;  3V7R A;  3PFS A;  4RCC A;  4IKF A;  4XTW A;  5LJ5 e;  4RCB A;  2OTJ A;  1WJR A;  3CC7 A;  3RIR A;  2E6Z A;  3CMA T;  3LH0 A;  4ZTJ A;  4HKE A;  1QP2 A;  3VKI A;  4EPC A;  1BI0 A;  4O5V A;  3MEA A;  3UDC A;  2LDM A;  3P8B B;  4Q5W A;  3RES A;  5KH6 A;  1G3W A;  5GAO r;  3E9F A;  2FYK A;  4OP0 A;  2JZ2 A;  4A4F A;  1VQK T;  1VQ8 A;  2XI9 A;  2FVU A;  2GCX A;  1I4K 1;  2R5A A;  3DB4 A;  2HQE A;  3NTI A;  4C0D C;  4JX4 A;  5I21 A;  2A7Y A;  3BDL A;  2DEQ A;  3JCM h;  2ZPB B;  1FWZ A;  4M77 D;  3TW7 A;  5KE3 A;  2GFA A;  5GAN d;  2MI6 A;  3CBP A;  3HZJ A;  2DXC A;  2CGH A;  3RKX A;  4AKG A;  4MZP A;  2EWN A;  3FEO A;  3SB2 A;  1N8R C;  4HT9 A;  1YJW A;  3BG3 A;  2E41 A;  3JB9 D;  2DPP B;  3CC4 A;  3X26 B;  4MZM A;  3Q1J A;  4C0G A;  3L2R A;  3OB9 A;  3HFO A;  3GNF B;  4J6X A;  2RJE A;  2RK2 A;  4MMK A;  3DL1 A;  2R57 A;  4QQD A;  4PJO E;  1M1K C;  3SD4 A;  4HCB A;  4MFE A;  4XTY A;  4YTL A;  3L2Q A;  2PVG B;  2DK3 A;  2RJC A;  1VQ5 T;  3RKY A;  2Y4Y A;  3JCM V;  3HFN A;  3A8M B;  4II1 A;  5GAN g;  1Q81 C;  2WSE E;  3QYB A;  1TH7 A;  3S6W A;  5FU6 B;  1NE8 A;  3MO8 A;  4A54 A;  3JRZ A;  3A8G B;  4RMO A;  2RJD A;  2ZPH B;  3G71 A;  2KY9 A;  3JCM J;  4X9D A;  3PIO A;  5HKC A;  3EFS A;  1VQK A;  3X25 B;  2OAU A;  5CQY A;  2QA4 T;  1BI3 A;  2EYQ A;  1U1T A;  4M78 B;  1FKM A;  2HQX A;  2QI2 A;  3MHX A;  1PSF A;  4JX6 A;  1DJ7 B;  2X4X A;  3URG A;  2QA4 A;  3HRU A;  1VQ7 A;  3A8O B;  1VQ6 A;  4M7D E;  2BUD A;  4QW2 A;  5LJ3 f;  5GMK i;  4LD9 K;  3CMA A;  3UWN A;  3PIP A;  1BI2 A;  1O75 A;  4AI6 A;  2PUK B;  2YRV A;  2F5T X;  3M5A A;  1M1G A;  3PNW C;  3CCE A;  1K9M C;  3QYE A;  4BB7 A;  2EJF A;  5GAO q;  1FXX A;  1KQ1 A;  1KD1 C;  3CCJ T;  2XG8 D;  1M5Q 1;  4JX5 A;  2JUF A;  3MEV A;  4JRI A;  5EG2 A;  4XU3 A;  2KDS A;  1JBM A;  4C8Q E;  3A5Z B;  5HK3 A;  3CME T;  4M78 G;  2XIC A;  3QJ6 A;  4AKH A;  4LDW A;  4PJO F;  2D6F A;  2CZ6 B;  3M59 A;  3LWI A;  4FIB A;  4BI4 A;  3R6O A;  4C0F A;  3I55 T;  2EQJ A;  1Q7Y U;  1VQ9 A;  3RMQ A;  3OYG A;  3VUB A;  1N9R A;  2YHT A;  4LDV A;  3KBG A;  4M6V A;  4MZT A;  4NL2 A;  4JJN K;  3HHT B;  4F7U F;  1ZBX A;  4M75 A;  2DZ9 A;  2Y4X A;  3CBO A;  3JCM b;  3QG1 A;  4QVZ A;  4M7D D;  1KHI A;  3OYY A;  4X34 A;  3BY7 A;  5FRO A;  4BDZ A;  2ZPE B;  2FHD A;  3NFC A;  4HA8 A;  5LJ3 h;  3OYM A;  1YI2 A;  2YLC A;  3JB9 F;  2DAQ A;  4E7L A;  4MFD A;  4LDX A;  3CPF A;  4LDU A;  4EDU A;  3VYH B;  1M8V A;  4M75 E;  2EQK A;  4A4G A;  3NTK A;  5FRM A;  2X35 A;  4RG2 A;  5D6W A;  4FU6 A;  1JRI A;  1LNX A;  5GAN e;  1UB4 A;  3VKG A;  3A8H B;  1Y96 A;  4EMK B;  4QVC A;  4M7A D;  1Y71 A;  4BY6 C;  2RHZ A;  1YI2 T;  1NPP A;  2ZPG B;  3M4G A;  2RHX A;  3E9G A;  3SDZ A;  1K8A C;  1G3Y A;  4M7D C;  4ELY C;  3BG9 A;  5CKD A;  2X4J A;  3JCM P;  3OA6 A;  3SWN C;  1VIE A;  1I5L A;  1EIF A;  3WVD B;  1K73 U;  3HB9 A;  2JOY A;  2QQS A;  4JRK A;  3LGL A;  3QO3 A;  4HCZ A;  4R56 A;  1Q86 C;  1PSE A;  2D9T A;  2X4W A;  3H8Z A;  4E7J A;  1QVF S;  2VUB A;  4NOY A;  4F7U G;  3OYK A;  3RUX A;  1BI1 A;  2KMG A;  4ZGD B;  2MF2 A;  2XID A;  4M77 B;  5I2S A;  4JS4 A;  2GFU A;  2HD0 A;  2E6N A;  2R5M A;  4M7D B;  4C5G A;  2JN0 A;  2M9U A;  3F70 A;  2O4X A;  3FLG A;  3JCM W;  1Q82 U;  3JB9 H;  2P4T A;  3V7S A;  2V8J A;  2OTL T;  4JRQ A;  4PJO C;  3CCL A;  3OMC A;  3DKM A;  5J3B A;  4M7A G;  3L42 A;  1YJ9 T;  3VU3 C;  4M7A E;  2ZZD B;  3QDR B;  1NJI C;  2DO3 A;  3GOX A;  2QQR A;  3CC2 A;  5GAO l;  2XU8 A;  3OYE A;  2K3Y A;  1VQ7 T;  3OS0 A;  5CKF A;  3QUI A;  2BS4 A;  3RER A;  2YLB A;  2DXU A;  5GAM j;  1BKB A;  3GLX A;  1GXI E;  1FX7 A;  4PNO A;  4PJO A;  1YHQ T;  1VUB A;  3QBY A;  3CXC A;  2HNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...