4OB1B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via co-crystallization
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Hydrolase
total genus 73
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob1B02
2DXCA 1AHJB 1JB0E 2DXCB 4OB0B 2PVOB 1UGPB 2ZPHB 4OB1B 2PVGB 3WVEB 1UGSB 3A8OB 2WSCE 1GXIE 3A8GB 2PVDB 3LW5E 1V29B 2DXBA 1DJ7B 2DD4A 2ZPIB 2DXBB 4ZGJB 2DD4B 3VYGA 3VYHB 2ZPEB 3X20B 2DD5A 2CZ7B 2DD5B 4L6V5 2PU9B 4ZGEB 2PUOB 4ZGDB 2CZ6B 4FM4B 4OB2B 2DPPB 3X25B 2ZPBB 3QYHB 1QP3A 1PSFA 2ZZDA 2ZCFB 2ZPFB 1UGRB 3QZ5B 2ZZDB 3VYGB 3A8LB 1QP2A 3HHTB 3X28B 2QDYB 4Y28E 2CZ0B 3X26B 2WSEE 4RKUE 2CZ1B 4OB3B 3A8MB 2CYZB 1UGQB 2D0QB 3A8HB 3WVDB 4KT0E 2ZPGB 2WSFE 5L8RE 2AHJB 3QYGB 4XK8E 2O01E 2PUKB 3X24B 1IREB 3QZ9B 1PSEA 3QXEB
chains in the Genus database with same CATH superfamily
1JSTB 2KK4A 4M77C 2V8JA 4ME7A 4KGXB 2KBTA 4QVCA 2RJCA 1QMZB 2QA4A 4M7AD 3CBMA 2O31A 2W9FA 5LJ5f 4Y91A 2C0OA 1AD5A 4OGCA 4CI0C 3EGXA 3VRYA 2WIPB 1T3SA 3I56Q 1TWBA 1OL1B 2QQ8A 1HD3A 3PNWC 1NPPA 3A5ZB 4FU6A 1H1RB 2ZPEB 4J83A 1KHCA 2VWFA 4M75A 3RESA 5IXFA 4NL3A 2LW4A 1HK9A 1RAGB 2A37A 4GBQA 3CCJT 4Z6YA 5HK3A 2P0KA 1BI1A 2CUBA 4PFPA 3OYNA 4BBSM 4PJOC 4F7NB 5I2MA 1VQ8Q 5IN1A 1LOJA 2D8JA 3SHWA 1OIYB 1RI9A 1M1GA 2JMAA 2EWNA 4XTWA 2ZCFB 2ZPFB 3OW2S 1YJNT 4IIMA 4J6WA 3OY9A 2F1LA 2X3XD 2ZZDB 1PNJA 4LE9A 3I5RA 3LWHA 1UJYA 2A36A 1OI9B 4LN2A 3CCEA 3M4GA 1TG0A 4L5GA 1YI2Q 2JOYA 1GBRA 1E7OA 3DLMA 1PC0A 4KUIA 1N5ZA 5GANd 4BE1A 5GAOn 1BBZA 4MDXA 3DKMA 5GMKl 4C5IA 3M9QA 3QJ6A 3I56T 1VQ8A 2UZDB 3FJ5A 2CYZB 4EC8B 1QVFP 1OI1A 3S3MA 1ZSZB 1YJ9T 2P4RA 2WSFE 1RAAB 2LNHB 4XTZA 3J80E 5I5ZB 4IURA 2VC8A 3MP6A 3TW7A 4PK4A 1LJOA 4LDUA 2E64A 5D6YA 4EOSB 2W2HA 1WQ7A 2H8HA 1OQKA 3G6EQ 1WZOA 1F1BB 2X9HA 4AFUC 3CMAT 3RKYA 5AT1B 1WHJA 1JB0E 3UATA 1QCFA 1M4ZA 1N9SA 2ZPHB 2LQNA 1KG1A 1JBMA 2QAZA 1TSFA 3CCSQ 1YI2T 2LMJA 2Y90A 4D8DA 1WQWA 2DKGA 2GQIA 3LW5E 4RG8A 2PZ1A 3EFOA 1WI7A 2UZBB 1DJ7B 2IW9B 1WFWA 4EOIB 4PJMA 4D6WA 2IN3A 3G6EA 1IHVA 1H641 3JB9I 1N8RC 5KYXA 4M7AE 4JLIA 5CR2A 2EJFA 3L2ZA 4MFEA 2CH4W 5LJ5h 2HCKA 3TQ7P 1ZBJA 3ZBDA 1M1KR 3CCSA 2HL3A 3OYKA 1Q81R 2DX1A 2KROA 2YUNA 3ZEHA 3FDRA 1K9MU 2QTVA 3MPUB 2UZLB 4E2FB 4LOCA 2E41A 1M8MA 3CCLQ 3RGFB 2DEUA 2R5AA 2ZAEA 2WEVB 5EJCA 1XJWB 2RHUA 4HNUA 1OV3A 2DTOA 4C8QG 4HVWA 4LD9K 2GTJA 2MI6A 5A0GA 4CC3A 1WIEA 3DB3A 3G33B 1TU0B 2JTFA 3G4SQ 3SWNB 3BDLA 4C8QF 1QLYA 1FMKA 3I55T 2KY9A 2EYZA 4M78G 1B07A 2LRQA 3HSBA 1QVGS 3EG9B 1WXBA 4M77G 1LCKA 3CCLA 4EOMB 2JTMA 3JRZA 2A08A 2K3BA 2OI3A 1KQSS 4E47A 3KXTA 3L2QA 4M78F 3VV0A 4BXXX 3VS3A 4P5NA 1Y7XA 1SPKA 2H3EB 2HSEB 3CPWP 4HKEA 2EKHA 1G5VA 2YUOA 3G4SA 4F7SB 4C5EA 4DQ2A 2DLPA 5GAN2 3CXCA 3L2VA 4PL6A 5DQWA 4RUGA 5CQXA 2K2MA 1UGPB 1YHQT 1M2VB 2F2XA 4KGVB 3BLQB 5FU6C 3CCQT 2HDAA 1JKWA 2FZCB 1GXIE 2NUZA 2OTLQ 2JJ9A 4QSHA 2DERA 3NGPA 1PKTA 2R58A 4HCZA 3RBBB 1W1FA 4PJOG 5I22A 4M7AC 2DIGA 1ZUUA 4BACA 2XKOC 3REAB 2IW8B 2AZSA 2X4YA 3VKIA 4PJOF 8ATCB 5GANg 1X43A 5GAOq 1U06A 3A98A 2XDBA 4DOVA 2MF2A 2OTLA 5GAN7 2F5KA 1IRXA 2LP5A 2C5NB 2E10A 1BIAA 2NLUA 4CXAB 4PLIA 3LWIA 1ZBXA 2HSPA 3QYBA 1WHMA 4BCPB 2VVKA 4MIMA 4AT1B 1QKWA 5ACBA 2HEQA 1WLPB 4NL2A 3VYGB 2YLCA 2LC4A 3UWNA 1NLOC 1KD1U 1Q82C 4C92A 3H0HA 3VJPA 3X28B 2V8IA 4F7UG 2RQRA 4Y28E 2EQKA 4M7AA 2OX7A 2LJ3A 1H3ZA 3PTAA 2PK2A 4J9CA 3QPHA 3BHTB 1QMCA 3TU4K 2M0OA 4BBRM 1U5SA 4C8QB 4OGRB 2UZEB 4BCKB 1MMGA 4XAXB 1VQNT 1X6BA 4E7IA 1G3YA 4C8QD 1D3BA 2O01E 2O4XA 2DRMA 1PSEA 1VOMA 4ATOA 1ZSGA 2L8DA 3HTRA 3CCVQ 4LDWA 2B8AA 2QDLA 2RMOA 3QDFA 4K11A 4E7LA 5EC7A 1TUDA 1ZSZC 2XU8A 3HRUA 5CCAA 2RJDA 1C0MA 1YN8A 5GAN3 1UGSB 1WA7A 4XU0A 2JGZB 2O9VA 3EFRA 2W0ZA 1OU8A 3VS5A 1QW1A 1FWZA 3GP8A 2IIMA 1ZUYA 2LCCA 4Z89A 2DD4B 2QQSA 4RODA 1Y96B 3CCVA 2WJ9A 4EONB 3M53A 2IW6B 1WXTA 4MZMA 2R57A 1QKXA 2YRCA 1YITQ 3CPFA 3Q1JA 4L6V5 2PUOB 1GUXB 3VS1A 3JB9D 3B57A 2SRCA 2DMOA 2CREA 3QYHB 1IGUA 3VUZA 2L2PA 3MHXA 3VS7A 4IKFA 2CT3A 3I9QA 4M7DB 4M6VA 2MOXA 2QEXQ 3NTIA 2LT1A 4OMFB 4R55A 1X6OA 4AKGA 1G83A 4M7DD 2L5QA 3EIDB 1QWFA 1IHWA 4FW2A 4JJNK 1BK2A 4JJDA 1OX9A 4EMKB 4MDWA 4AMCA 1KC8C 2Y4XA 5KH6A 4N0AA 2PQWA 2OAUA 3QHWB 4F6SB 4EOJB 3CC2Q 2QXFA 3N5BB 3QO3A 2QEXA 1GCQA 2AHJB 3QYGB 2KVQG 2NUTB 2K4YA 1VYUA 3HPWA 4BDZA 1YITT 2CP0A 2CJMB 3UT1A 1G3WA 2QYZA 2YXYA 1QVFA 1Q81C 1W98B 2EBPA 2AIRB 1N8RR 1BI3A 4OMMA 3SWNC 2JNGA 4X9DA 1AHJB 1M90U 2I40B 1BKBA 4AKIA 3H8ZA 3P8DA 3THKA 1SG5A 4M7AG 2DZCA 3CC2A 2FL7A 4C8QE 1KSWA 3CC7T 4ELYC 4PKCC 3DDQB 1JXOA 3RUXA 4NOYA 4JLGA 3EOCB 2FPDA 2DNUA 1Q86U 3U23A 1JJ2P 3CD6T 4BE2A 5LMKB 4FSXA 5GANj 4JRPA 3RMQA 2I53A 1W70A 1FXXA 5GMKm 4QKUA 2HMAA 1FX7A 3CCMA 3UA7A 2LDMA 3GLXA 3X20B 2JW4A 4ROCA 4OR5B 2KRMA 5KYWA 1SF9A 3JV3A 2COYA 3HKSA 3R6OA 1NYFA 5CQYA 5IDNB 3EGDA 4N4HA 4FM4B 3OS1A 4WF2A 2SEMA 3BLHB 2DK3A 4XU2A 4DEYA 1VQPQ 5L2WB 3EG9A 4J9DA 4KRCB 1UNGD 1B7TA 1OULA 2K79A 2BZXA 2LT4A 1PKSA 1JXMA 1SSFA 1W6XA 4JPBW 2F69A 3G71T 1SSHA 1VQKQ 2BPMB 2CSIA 1SEMA 2EYWA 2QDYB 1KQ1A 4ZTFA 3RIRA 1OKWB 2X4WA 3HRTA 2PK9B 5FROA 5DY9A 4PFOA 4RKUE 3QSUA 4EOLB 3BW1A 1VQPA 1VQ5T 4ORZA 4CFUB 2K9GA 3OS0A 2GCXA 2AKLA 1M2VA 4J6YA 3PIOA 1K8AU 4IMYB 3CMEQ 1U3OA 3MY5B 4M7DE 1O9KB 3EJ1B 1ZA1B 1X27A 4CFUD 2J6OA 5HBJB 2PHGA 5GANf 2GGRA 1K73U 2KRNA 5J39A 1U8RA 1ZP2A 2HZYA 2D8HA 3REBB 2DL3A 1NM7A 1BCMA 1ARKA 3NPFA 1Y0MA 2QA4Q 2RA2A 3CMEA 2XDDA 1VQ9A 4JRQA 2GNCA 3UDCA 1VQKT 3CPWA 1HSQA 4MMKA 3ULRB 2V22B 1YJWA 5CEIB 2RK2A 4BE0A 4BY1X 2BUDA 2DXBA 4Z02A 5CKEA 3VRZA 5FLXE 1K0SA 3BG5A 3M58A 3OYMA 3FIFA 4RTVA 2EGCA 3VYGA 1Q7YC 5GMKj 2K5IA 2PJQA 3CXCS 1PHTA 1Q82R 5CKDA 4PJLA 1RAIB 3CBPA 3LGFA 1B3QA 2E3HA 2QFZA 2GBQA 5IF1B 4F16A 2WMBB 4HA8A 4RG2A 2X3WD 2CP2A 5D7UA 4A4GA 3BLRB 2DJQA 4C8QA 1M8VA 4JJCA 4GY5A 2JT4A 2DL8A 1KFZA 2EGAA 1D09B 1M1FA 1YIJA 1BIBA 2O9SA 1ZHIA 1VYTA 4N4IA 3CCEQ 4BI4A 3OSVA 2EYQA 1B34B 1U1TA 2FZKB 3CEYA 4M78A 4EOPB 2M0YA 2CZ0B 4M77A 1CKBA 2W9ZA 1BU2A 3DJBA 5GANe 1H25B 2QG9B 4BB7A 4KRDB 3POMA 5CO7A 3O5ZA 2RJEA 1FKMA 3DB4A 4C0ZA 1TXQA 1OOTA 1TS9A 1X69A 2EJGA 2VGMA 4M7DC 1T0JA 4A4EA 1M5Q1 5L8RE 3NHNA 3QDRB 1VA7A 4WCIA 4EOKB 1RAFB 1UE9A 5A0DA 2J6FA 1UNHD 5GAMj 2I0NA 1G3NC 4II5B 2UUEB 2K5LA 1Y96A 5KCHA 1GBQA 3LH0A 2FVUA 2DL5A 4EMKC 3H0IA 2RO0A 3FLGA 1H1PB 3CCUA 3PIPA 2DBMA 4ZN3A 5GANh 4MFDA 2YT6A 3CCET 4PJOA 2DL4A 2RM4A 1LVKA 1N9RA 2YWWA 5EFQB 1ZX6A 3DLLA 2NUPB 1IXDA 2LZ6B 2FZGB 1VQ8T 1JSUB 1RI0A 4ANJA 4CC4B 3VUBA 1RLPC 3QG1A 2FPEA 5IAYA 4JRIA 1VQLQ 2DTIA 3H4CA 5IDPB 4BCGB 4EDUA 4E7ZA 2EW3A 3H0FA 4F7LB 1S72Q 3LQ5B 2DD5B 3TREA 4FYXB 1NEGA 1XO2A 1YBYA 4EMKA 2G77A 4IUTA 2EKOA 1N4MA 3WXMB 1TFBA 2OAWA 1KC8R 3VS4A 3H6ZA 3OYYA 2NYSA 4IIOA 4F7UA 5HCKA 2HBPA 4G6LB 2R7GA 3SEMA 5GAMf 1QP2A 1VQLA 3M0PA 3V8JA 4OMQA 3L42A 1I5OB 1QWEA 5DLOA 3JCMQ 4ELZC 1S72A 1LPLA 1R0CB 5CKFA 2FPFA 4KH1B 5KYYA 1H3HA 1K1ZA 2MPXC 4LD6A 4XU1A 3G6ET 4ELJA 4DBFA 1OKVB 1RABB 1R8OB 2KT8A 5GMKe 3I5SA 3M03A 1H8KA 3FJPA 2VB6A 1PRLC 2EYYA 4OMOA 3PVLA 1P5EB 4F04B 1ZUKA 5HBHB 3OYHA 1X6GA 2BZYA 2MYSA 4RTTA 4AKHA 2DVEA 4XTUA 4E6RA 3CCST 2RHZA 3VS6A 1UFFA 2CS7A 4Z88A 5FGKB 1JO8A 2O88A 2JTEA 2DXCA 2QDJA 1HJDA 5KYUA 4B6MA 1YCSB 2B9RA 4RTUA 1SHGA 2EQMA 3JCMb 2KYMA 5GMKh 2GTOA 1FVVB 1UGVA 1MMNA 4Q5WA 1OPLA 2KR3A 2F5TX 2WXVB 4II1A 1VIFA 5DLQE 3RMSA 1QVFS 1J3TA 2X4XA 3EG0A 4ESRA 1FMVA 5GMKi 4CFMB 3CCLT 4BUGA 3EH1A 4XTYA 3LGLA 1ZQ1A 1AEYA 1NG2A 2C0TA 1JJ2A 5IHYA 2HBWA 5GAMe 2DIQA 5GAOl 1WGSA 3JB9G 4OVAA 4Y92A 3JCMX 5IHKA 3M0SA 4AG2C 5ECAA 3G4ST 1K9MC 1QQJA 3TVTA 2ZPBB 2HQHA 1M90R 4JX5A 4BCHB 3I35A 1VUBA 3UF4A 3JB9F 2EFIA 3HZJA 2HQEA 4PJNA 1UGRB 4F7JB 3BG3A 4E7KA 1D0ZA 3QKJA 5ICPB 4M7DG 3MEAA 5HBEB 2L3QA 3OYBA 1Q86R 4HNVA 2RK1A 5HNBB 2ED1A 5GAMd 1Y07A 2YRDA 3EHQA 2RI3A 4LDYA 1OEBA 2BKDN 2DVJA 4M7DF 4VUBA 2LX7A 3HP9A 3VS0A 4RTWA 4LNPA 2E12A 1M3BA 2MCNA 1YCYA 3VS2A 2DMEA 1NYGA 5GAMh 2J06A 2GFUA 1PD1A 2X1NB 1I5LA 4MMLA 4EOQB 3QIIA 1D0XA 3HB9A 2OTLT 4YOOA 1PWTA 3OS5A 1WX6A 2CGHA 2KXCA 4OP0A 1Q7YR 1AWJA 5HY6A 1VQ6A 2ATCB 2E6ZA 2YSQA 3MY1B 3E19A 3BFMA 2LQKA 3EFSA 4BDYA 3OBWA 1VQOQ 1VQ7Q 2QF7A 2KYBA 5C0MA 2FYKA 2QGGA 3EGXB 1TUGB 4YOZA 2WFYB 3GF5A 1RAEB 3QHRB 2KEAA 4KULA 2E5QA 2D6FA 3V7RA 3JCMg 4J9EA 1NJIU 5GAOr 2C5VB 1M3CA 2PU9B 2VKNA 1RAHB 3AT1B 1GL5A 3CPWS 1H26B 3LLRA 4M75B 2VXFA 2A7YA 5FWCA 3MI9B 1VQOA 1Y57A 3CBOA 4FL6A 4XTVA 3PGGA 1VQ7A 2IPOB 4QW2A 4QVDA 3SFMA 4M75D 2XI9A 1EZZB 3DDPB 3P8HA 2ZZDA 3OYDA 4FT4A 1W2BP 1VQ4Q 2KXDA 3J7AF 3GOXA 4OMNA 3A8LB 2E70A 1KD1C 3MIAB 2CUDA 3OMCA 5I11A 2EJ9A 4BCNB 4HVVA 4JDSA 1G3TA 1M1KU 4O5VA 2DA9A 9ATCB 2KSSA 1BYMA 2K3XA 4IUVA 1M27C 4QQDA 4BCND 1ENWA 2OTJQ 1ZSZA 3E1SA 3HRSA 3CCVT 1XQHA 1E7PA 1WHHA 1FMWA 1URCB 1QCOA 2KR6A 2A3LA 2WMAB 3OB9A 1VQ4A 3BY7A 4Z8AA 4LUEA 4C0GA 2CT4A 4KH0B 3IQLA 3GBQA 4RTZA 3V7CA 3CCRQ 2ED0A 1KHIA 2HL5C 1N27A 1K76A 2XK0A 2DFUA 2XD0A 5LQFB 4BCIB 2EGEA 1W4SA 3L2RA 2M1HA 2LX9A 2KRSA 5LJ3g 2RJFA 2OTJA 2KQWA 3LYIA 6AT1B 3UPUA 5FRNA 4PFZA 1CSKA 2C06A 2KMGA 2GF7A 5M9OA 2LTOA 5D6WA 1GY3B 2LQ8A 2Z0WA 3A8OB 2PNIA 1XOVA 1NEBA 1VQMQ 1FYNA 4J9HA 1MNEA 1V29B 3CCRA 1HXDA 4AFSC 1TH7A 3O8VA 4J8OA 1OL2B 1ACMB 4FSSA 4AFQC 2K57A 5KYXB 3OYFA 3PVQA 4FYVB 3CCMQ 4BCOB 2JM8A 2ROLA 3E2UA 3KFVA 2QEXT 3A1PA 4CC7A 2VUBA 1N6AA 5GAMg 1M30A 2L3PA 2BS2A 1JEGA 4YC3B 4BY7X 2QQRA 2CZ6B 2HKNA 4DBRA 2KDSA 1VQMA 2DILA 5KCOA 1I4K1 3GTMS 2QK0A 1H27B 4HCBA 3RNJA 1IO6A 3OYJA 2FRYA 4V2SA 2JS0A 3D7SB 4ZN1A 3CC2T 1D1AA 1K9AA 4XTXA 2RI5A 4ELLA 1EX4A 5J26A 2K2VA 3HFNA 1MV3A 4CRLB 1I07A 3OS2A 3SWNA 1GRIA 3QHSA 3CC4A 3X26B 4M75E 4A4HA 2DETA 3M0QA 3M59A 3A8MB 3ZL7C 3TCJA 4BCMB 1EFNA 3TNIB 2D0NA 4JX6A 2F2VA 4ZTJA 2LJ0A 3ASKA 1D1BA 2YRVA 3G71A 2EQUA 3BDUA 4BCMD 2BE7D 4JS4A 1GH6B 2DE0X 3TSZA 3MJXA 2AKKA 2W99A 2A0FB 4QT7A 2COWA 1HYOA 2K6DA 1E6HA 1M90C 4KUDK 2JVVA 1BB9A 1NPRA 3F70A 3PMTA 4TTHA 1V76A 2BTTA 3OW2P 3EH2A 1VQ9Q 4CFWB 3URGA 1RLQC 4BD3A 2RHXA 2C4GB 2WPAB 2MMPA 1YJWQ 3EG2A 3O0GD 2WSCE 1Q86C 1T0HA 3EGUA 4HLQA 1K9MR 3G1JA 4OGEA 1VQPT 1KK7A 2ENMA 1F5QB 2RNAA 2DXTA 2G3RA 3TSWA 5L23A 3DTOA 2EAYA 2CP7A 2L3SA 2ABLA 4AI6A 3JCMJ 3M4YA 3JCMW 4ZGDB 3FEOA 4C5HA 4ROEA 7AT1B 3AHUA 1SRMA 1UUEA 1PSFA 2BZ8A 1G8XA 1YIJQ 1I0CA 2LQWA 1M3AA 3OSSC 3V7SA 3CMET 2K3YA 1VQ9T 2KI7A 4LDXA 1JOWA 4KGZB 1M2OA 1E6GA 1YJWT 3BG9A 4BCQB 4C92B 3CCJQ 1JJ2S 1AWOA 4FT2A 4M75C 2C5OB 1ABQA 2F2CA 2V8KA 4FIBA 4RCCA 4BCQD 3QUIA 1X2KA 1Y71A 4C92D 1K8AC 4AFZC 4KBMB 1YJNQ 4JS5A 3KHIA 1WHKA 4J9BA 2QA4T 5LJ3j 1I8FA 1UTIA 2EYXA 3JCMf 3TN8B 1AD6A 3V8LA 4Y72B 2EPDA 2QQAA 4XK8E 1K73C 1P92A 2VGNA 3QWLA 2DM1A 2BKZB 3CCJA 2JUFA 1D3BB 5GAOm 4FX3B 2O4XB 4J7IA 1MV0B 2FG0A 2DTHA 2M16A 1FINB 3QWYA 3NDQA 2XICA 1VYWB 2JN0A 1YJ9Q 2RQUA 1YIJT 5FRMA 3CCUQ 1YJNA 4OB0B 5GJVB 2QQBA 2KMTA 1KXUA 1RADB 4PJJA 2MK5A 4OB1B 2PVGB 2FRWA 3JB9H 3QBYA 4X34A 3META 4BI8B 2DD4A 4YTLA 4J6XA 3CMAQ 4F17A 2LJ1A 2QASA 4ZGJB 3RDVA 2QI2A 3M57A 5KE3A 3I56A 1N8RU 2IG0A 1X01A 2JZ2A 5C6SA 1YJ9A 2P84A 1QVGP 1NZ9A 2COZA 1KD1R 4JX4A 3OQ5A 2XIDA 4FW1A 2PTKA 4A63B 1YWPA 3MKDA 3M54A 4RCBA 3OYCA 1GUXA 1KQSP 4ZGEB 2DAQA 4OB2B 4IUUA 3C4SA 3HO8A 1WHLA 1A0NB 4B9WA 5LJ3f 4M7DA 2E5KA 3CMAA 1TTHB 1YP5A 4E7HA 2QGSA 1S1NA 4F6UB 3DOGB 4M4ZA 4OMPA 3CCUT 3QZ5B 1PM3A 5D6XA 1M9SA 4E7JA 4HVUA 2A28A 3OYAA 1YI2A 3JCMe 5IH2A 1YFNA 3G7ZA 2DF6A 5LJ5e 2CP6A 1W2BA 4JJBA 3S3NA 4J9FA 3F5XB 2C5XB 4KT0E 4BY6B 2NUTA 1VOLA 5CKHA 1NJIR 1MGQA 4C0DB 1C9BA 4A4FA 2X51A 3H9NA 2E4HA 3JCMd 4C92E 2W96A 2AZVA 1GFDA 3QZ9B 1WJQA 5LJ5d 3I55Q 4GLMA 4QVZA 1VIEA 2EUFA 2LVMA 2KGTA 2RB6A 5CVIA 1O9SA 1T3LA 2LCLA 3E9FA 3JCMh 1VQLT 2MAMA 4EMHA 2HQXA 1S72T 4E7SA 2WIHB 2DL7A 2X4JA 3M56A 4CFVB 3BHVB 2X35A 5KE2A 1WNLA 2ZPIB 1PG5B 3I55A 1BI0A 4FYWB 2HAXA 3K7AM 3OMGA 3ME9A 4JZ3A 2E65A 3VYHB 1K4US 5LJ3e 4J5YA 1YHQQ 1EIFA 4EIKA 3CCQQ 2KT1A 3OYGA 2DYBA 4I3ZB 4LDVA 1NE8A 1VINA 5KYWB 5IT9E 2GQVA 5DQVA 2LNVA 4M7AB 2JM9A 2RPNA 5IHIA 1E9HB 1YWOA 3EGDB 4ZNXA 1AOJA 4M75G 4X1VA 5HKCA 1TUCA 2IVXA 1TD6A 2RQVA 2G6FX 1GFCA 2AT1B 2P0QA 4DBHA 3QYEA 2GFAA 2RF0A 5LJ3d 1Z9QA 5CYIB 3SDZA 2QTXA 2M02A 4M75F 1H28B 4X9CA 1QVPA 2ROTA 1D1CA 2YUQA 3NTKA 4A4KA 1YHQA 4LUDA 1Q82U 5I2SA 3CCQA 3MEWA 1AWXA 1OYXA 4M77F 1G2BA 4EPCA 1UG1A 1PKDB 3FC3A 4NSTB 3BHUB 1MUZA 5LJ3h 5FU7C 2WSEE 2E3IA 2D9TA 4OB3B 1JQQA 1C1AA 1WJRA 3S6WA 1UECA 1O9KA 1NBEB 2V1QA 2VYTA 2ZPGB 2RQWA 2DXUA 4HT9A 4HL4A 1UJ0A 5A0LA 2EQJA 4A53A 4C92C 1VYVA 1IREB 4A54A 3TNHB 2J6KA 3QXEB 4UN0A 1V1CA 2WHBB 3MEVA 1IB8A 3EHRA 4R56A 2PVOB 1VQ6Q 2ECZA 1GCPA 4D8KA 4RMOA 5FWBA 1VQNQ 1WXUA 3WVEB 2BS3A 1LNXA 4IUPA 5GJWB 4JRKA 1BU1A 1K0XA 1JRIA 2DEQA 4MZTA 3QWXX 2ZGWA 3NMZC 1OU9A 2KAFA 4DEXA 2DXBB 3QJYA 3OW2A 3RERA 2L3RA 4KRTA 4EMGA 4C5GA 2P4TA 2QQ9A 1QLBA 4CRIA 4YOSA 1KIKA 1IZ6A 2MWOA 1VQNA 1U1SA 2J7IA 2KE9A 1MNDA 2V26A 1R77A 1ABOA 4F7UF 1K8AR 2BIVA 1WJSA 1MMDA 2YHTA 4MZPA 1VQ6T 2BS4A 2DZ9A 3H41A 3JCMc 3HHTB 1B34A 1PCXA 4BCFB 2VV5A 3FB9A 1K73R 2CP3A 4TVRA 3OA6A 1IGQA 1D3UB 4CFNB 2XG8D 3C95A 5LJ5g 2HD0A 2JMCA 1NLPC 2P0PA 4M78B 3VU3C 5LL6S 4HT8A 3FRNA 4M77B 2CZ1B 3JCMV 5KYNA 1KC8U 2D0QB 1UGQB 3MCAB 4LXCA 4R0KA 4M78D 2NWMA 4DBQA 4M77D 2YUPA 4C0FA 1C6VX 2XMFA 4WTOB 2RHIA 3TEEA 2CH4A 3SB2A 1RUWA 3MP8A 1D0YA 3V8KA 3X24B 1VQOT 1VQ7T 4QQ6A 3CQTA 3NFCA 1Q81U 4BCJB 5GAN6 2M51A 2DJZA 1QCNA 3ZFJA 5GAOp 3RKXA 4N0AC 4BY6C 3M0UA 2JS2A 3C0CA 3M0TA 1I1JA 2C0IA 2RQTA 4BI3A 5GAN8 3J81E 4C0DC 3A8GB 2EIFA 2NUPA 2ESWA 4PJOB 1GCQC 3SD4A 4XU3A 2F2WA 3L1AA 3BE3A 2RN8A 3KBGA 1OGUB 1OIUB 2FB7A 1JU5C 3EAEA 3UA6A 5IXBA 4PJOD 5FW9A 3HFOA 3GNGA 5A2QE 1UNLD 1VQ4T 2V1RA 1OZ2A 2DD5A 3CC7Q 4CFXB 3ER0A 2OJ2A 1NJIC 4AG1C 1SHFA 1YITA 1MMAA 4NC6A 4DOWA 1OPKA 3HBLA 3CD6Q 1OX8A 2CSQA 1H1QB 1WDXA 2DPPB 3X25B 3JCMP 4RTYA 3MP1A 1KQ2A 4IUQA 3E9GA 2BE9B 1OZ3A 1QVGA 2VXEA 1X2QA 3EFOB 2OTJT 3DL1A 3R6NA 1XTDA 1AISB 4J9IA 2DBKA 4RTXA 1KQSA 4EOOB 2PMIB 5HQ0B 2K7AA 1WPYA 1XNIA 3KUFA 4F7UB 5GAN4 3GIBA 2D1XA 4DA4A 2JXBA 3C94A 3CC7A 1O75A 5HVYB 2MWPA 2G9XB 1G3SA 2YDLA 1YNZA 1UHFA 3CC4Q 3CCRT 1M1KC 5J3BA 3CD6A 5KYYB 3S3OA 4N4GA 4QQGA 4F70B 4C92G 1AZEA 1PD0A 1BI2A 2RD1A 2R5MA 5DM7R 4OF1A 3RR6A 3L2UA 4FYYB 3L2WA 1ZA2B 2C6TB 2L89A 3HL8A 5CKBA 3JB9J 4C92F 3G71Q 2FO0A 2CP5A 3CXCP 2DO3A 3EG1A 4GLKA 2FHDA 3INZA 1Z9ZA 4M7AF 1SKUB 4EORB 3EG3A 1VQMT 2CKKA 1AVZC 5IHNA 4M78E 2DYIA 1VQ5Q 4M77E 4JZ4A 1PRMC 2HKQB 3M0RA 4PLLA 5HK0A 1W2BS 2DXCB 2W10A 3RKWA 3CCMT 1UHCA 2J05A 5KYUB 1UDLA 4HCCA 1ZLMA 1Q95G 1RACB 3M5AA 4XQ3A 5CK9A 2PVDB 3CC4T 3GNFB 5GAN5 2CCIB 4HNTA 2EVRA 2RH2A 2Y4YA 3PMIA 1H24B 3OYLA 4FCYA 2XDPA 3C12A 2DRKA 1VQ5A 2I2LA 3LH5A 1Q7YU 2EQIA 4O6JA 2LCSA 5CIUA 1UEBA 2CZ7B 1WHGA 1MHNA 4HCKA 3OYEA 2WACA 2MIOA 4PJOE 3OBYA 1AT1B 1UB4A 2E1HA 5LJ5j 1QP3A 1AWWA 5CAIA 3PT9A 3M55A 2RHYA 2XHCA 1H1SB 3PE0A 4F14A 2B86A 5BNJB 1TOVA 1KJWA 2KNBB 2K5FA 2M9UA 2CCHB 4J7FA 3T9NA 1VQKA 4CC2A 1R0BG 2O2OA 2E6NA 1I81A 2YLBA 1BCOA 1H92A 4F6WB 3OYIA 5FU7B 2L0AA 4B9XA 3VKHA 4J9GA 3TNWB 3VKGA 2CDTA 3PO3S 3NTHA 4L59A 2FEIA 3A8HB 3WVDB 1AZGB 1CKAA 3LX7A 2IVWA 3MEUA 5FU6B 3GPLA 4EC9B 1WYXA 2HNIA 4PNOA 3JAME 5I21A 5AYFA 4C8QC 3TW6A 2VASA 3JSCA 4F7UE 5EG2A 4JUVA 2RI2A 3PFSA 4OMLA 2PUKB 4UC4A 8AT1B 2QGFB 1X75C 3P8BB 2AK5A 1H4LD 3MO8A 4HXJA 1SRLA 4NS5A 4M78C 2H3JA 1RL2A
chains in the Genus database with same CATH topology
3SWNC 2KK4A 2JNGA 2RB6A 2V8JA 4M77C 1AHJB 4ME7A 4X9DA 5CVIA 1M90U 1O9SA 1BKBA 4AKIA 3H8ZA 3P8DA 2RJCA 5HY6A 4QVCA 2LCLA 3E9FA 3JCMh 2DZCA 2QA4A 1VQ6A 1VQLT 4M7AG 3CC2A 2FL7A 4M7AD 4C8QE 2MAMA 3CBMA 2E6ZA 4EMHA 3CC7T 4ELYC 2HQXA 4PKCC 3E19A 3BFMA 3RUXA 1S72T 2LQKA 4JLGA 4NOYA 5LJ5f 4Y91A 3EFSA 4BDYA 3OBWA 1Q86U 2X4JA 3CD6T 3M56A 4CI0C 4OGCA 4BE2A 4FSXA 2QF7A 2X35A 5KE2A 5GANj 1WNLA 5C0MA 4JRPA 2ZPIB 2FYKA 3I55A 1BI0A 2HAXA 3OMGA 3RMQA 3ME9A 1FXXA 2QQ8A 5GMKm 3PNWC 3GF5A 1NPPA 3A5ZB 2E65A 4FU6A 3VYHB 1FX7A 2ZPEB 4J83A 4J5YA 5LJ3e 3CCMA 2LDMA 3GLXA 3X20B 4KULA 2E5QA 1EIFA 2D6FA 1KHCA 3V7RA 3OYGA 3JCMg 4LDVA 4M75A 3RESA 4NL3A 5GAOr 1HK9A 1NE8A 1NJIU 3HKSA 2PU9B 3R6OA 3CPWS 3LLRA 5CQYA 4M75B 5IT9E 2GQVA 2VXFA 4N4HA 4Z6YA 4FM4B 2A7YA 2LNVA 4M7AB 5HK3A 3OS1A 3CCJT 2P0KA 1VQOA 1BI1A 4WF2A 3CBOA 4FL6A 3OYNA 4BBSM 3PGGA 4XTVA 1VQ7A 4PJOC 2DK3A 4QW2A 4XU2A 5I2MA 4QVDA 5IN1A 1LOJA 4M75G 1M1GA 5HKCA 3SFMA 4M75D 2XI9A 3P8HA 2EWNA 2ZZDA 4XTWA 3OYDA 2ZCFB 2ZPFB 4FT4A 3OW2S 2P0QA 4J6WA 3OY9A 3QYEA 1YJNT 2GFAA 3J7AF 5LJ3d 2LT4A 3GOXA 2ZZDB 3SDZA 1SSFA 2QTXA 3A8LB 2E70A 4M75F 2F69A 4X9CA 1QVPA 4A4KA 3LWHA 3G71T 3NTKA 1YHQA 1KD1C 3OMCA 1Q82U 5I2SA 3CCQA 3MEWA 3CCEA 2EJ9A 2QDYB 1OYXA 3M4GA 4M77F 1KQ1A 4L5GA 4ZTFA 3RIRA 4JDSA 4EPCA 1G3TA 2X4WA 2JOYA 3FC3A 3HRTA 3DLMA 5GANd 1M1KU 4KUIA 4O5VA 4BE1A 1BYMA 2KSSA 5LJ3h 5DY9A 5FROA 5GAOn 5FU7C 2K3XA 2WSEE 4IUVA 4RKUE 4MDXA 3DKMA 5GMKl 3QSUA 2D9TA 4OB3B 4OP0A 3BW1A 3M9QA 3QJ6A 4QQDA 4C5IA 3E1SA 3I56T 1VQPA 1VQ5T 1VQ8A 1WJRA 3OS0A 2CYZB 3S6WA 2GCXA 1K8AU 4J6YA 1OI1A 3HRSA 3PIOA 3CCVT 1XQHA 3S3MA 1E7PA 1YJ9T 4M7DE 2KR6A 2VYTA 2A3LA 3OB9A 1VQ4A 2ZPGB 2WSFE 3BY7A 4C0GA 4XTZA 2DXUA 5GANf 3J80E 4IURA 2VC8A 4HT9A 3V7CA 3MP6A 3TW7A 4HL4A 1LJOA 1K73U 4LDUA 2E64A 5D6YA 5A0LA 2EQJA 4A53A 1KHIA 1WQ7A 5J39A 1N27A 4C92C 2XK0A 1U8RA 2XD0A 1IREB 4A54A 1W4SA 3QXEB 2M1HA 3L2RA 2LX9A 5LJ3g 3MEVA 3CMAT 2RJFA 3RKYA 2OTJA 1JB0E 2KQWA 3LYIA 3UPUA 4R56A 5FRNA 2PVOB 2RA2A 2C06A 3CMEA 2XDDA 2KMGA 1VQ9A 1M4ZA 4JRQA 2GF7A 3UDCA 5M9OA 1N9SA 2ZPHB 2LTOA 4RMOA 1VQKT 3CPWA 5D6WA 2LQ8A 1KG1A 4MMKA 1JBMA 3WVEB 2BS3A 1LNXA 1YJWA 3A8OB 4IUPA 4JRKA 1XOVA 2RK2A 4BE0A 1YI2T 2Y90A 1JRIA 2DEQA 1WQWA 2DKGA 3LW5E 4MZTA 2BUDA 4RG8A 1V29B 3CCRA 2DXBA 1HXDA 2ZGWA 4Z02A 5CKEA 5FLXE 1TH7A 1DJ7B 2KAFA 3O8VA 3BG5A 4D6WA 3M58A 3OYMA 3FIFA 2DXBB 4J8OA 3G6EA 3QJYA 3JB9I 1H641 3OW2A 1N8RC 4M7AE 3VYGA 3RERA 4JLIA 1Q7YC 5GMKj 2K57A 2L3RA 4EMGA 5CR2A 2K5IA 2P4TA 2EJFA 3L2ZA 4C5GA 2QQ9A 3OYFA 1QLBA 4MFEA 4CRIA 3CXCS 2QEXT 2VUBA 1N6AA 1IZ6A 5CKDA 2MWOA 5GAMg 5LJ5h 2BS2A 3CBPA 1U1SA 1VQNA 3LGFA 2QFZA 2QQRA 3ZBDA 2CZ6B 3CCSA 3OYKA 2KDSA 1VQMA 4HA8A 5KCOA 1I4K1 4RG2A 3ZEHA 3FDRA 4A4GA 1K9MU 4F7UF 4C8QA 1M8VA 4LOCA 2BIVA 4HCBA 1WJSA 2E41A 4GY5A 3OYJA 4V2SA 1M1FA 2YHTA 4MZPA 1YIJA 1VQ6T 2R5AA 4ZN1A 3CC2T 2BS4A 5EJCA 2RHUA 4XTXA 2DZ9A 4HNUA 1BIBA 3JCMc 3HHTB 1B34A 2RI5A 1ZHIA 4N4IA 2VV5A 2DTOA 3FB9A 3OSVA 4TVRA 5J26A 4BI4A 4C8QG 3OA6A 2K2VA 3HFNA 2EYQA 1B34B 1U1TA 3CEYA 4LD9K 4M78A 2MI6A 5A0GA 3OS2A 2XG8D 3C95A 3SWNA 2CZ0B 3DB3A 3QHSA 4M77A 3X26B 4M75E 5LJ5g 3CC4A 2HD0A 4A4HA 4M78B 2P0PA 5GANe 2JTFA 5LL6S 3VU3C 3SWNB 3BDLA 4HT8A 3FRNA 4M77B 2CZ1B 4BB7A 4C8QF 3I55T 3JCMV 5CO7A 3M59A 3A8MB 1KC8U 2D0QB 1UGQB 2KY9A 2RJEA 3TCJA 4M78G 3HSBA 3MCAB 2LRQA 4M78D 1QVGS 1FKMA 4JX6A 4M77G 3DB4A 4C0ZA 4ZTJA 3CCLA 4M77D 2EJGA 2VGMA 2JTMA 3ASKA 4A4EA 4C0FA 2YRVA 4M7DC 1M5Q1 3JRZA 5L8RE 3G71A 2EQUA 2RHIA 3BDUA 3TEEA 4E47A 3QDRB 3KXTA 1KQSS 3SB2A 4M78F 3L2QA 4JS4A 3MP8A 3VV0A 4P5NA 1Y7XA 5A0DA 3V8KA 5GAMj 3X24B 1VQOT 1G5VA 4HKEA 1VQ7T 4QQ6A 2K5LA 1Y96A 3NFCA 5KCHA 1Q81U 3G4SA 3LH0A 2FVUA 4C5EA 4DQ2A 4EMKC 5GAN6 1M90C 2RO0A 2DJZA 2JVVA 5GAN2 3CXCA 4KUDK 1NPRA 4PL6A 3FLGA 3F70A 3L2VA 3ZFJA 5GAOp 3PMTA 5CQXA 3CCUA 3PIPA 3URGA 1UGPB 1YHQT 4BD3A 3RKXA 2RHXA 4ZN3A 4N0AC 4MFDA 5FU6C 4BY6C 5GANh 3CCQT 3CCET 4BI3A 5GAN8 3J81E 2MMPA 4PJOA 2RM4A 4C0DC 1GXIE 2WSCE 1N9RA 3A8GB 2EIFA 1Q86C 4PJOB 3SD4A 4XU3A 4HLQA 4QSHA 3L1AA 3DLLA 3KBGA 4OGEA 2R58A 1VQPT 4HCZA 2FB7A 1VQ8T 4PJOG 1RI0A 3EAEA 4PJOD 2DXTA 2DIGA 2G3RA 3VUBA 4M7AC 3HFOA 4BACA 2XKOC 3GNGA 3QG1A 5A2QE 5IAYA 4JRIA 1VQ4T 1OZ2A 2X4YA 2DD5A 3H4CA 2DTIA 3VKIA 4PJOF 4EDUA 3ER0A 2EAYA 1NJIC 2DD5B 3TREA 1YITA 4AI6A 3JCMJ 3M4YA 5GANg 3JCMW 1YBYA 4EMKA 5GAOq 4NC6A 4ZGDB 2G77A 3FEOA 3HBLA 4IUTA 4DOWA 2XDBA 4C5HA 2EKOA 4DOVA 2MF2A 2OTLA 5GAN7 2DPPB 3X25B 3JCMP 3WXMB 3MP1A 2F5KA 4IUQA 1KQ2A 3AHUA 3E9GA 2E10A 1BIAA 1OZ3A 2NLUA 1QVGA 2VXEA 4PLIA 3LWIA 3H6ZA 3DL1A 2OTJT 1ZBXA 3OYYA 1QVFS 1PSFA 1XTDA 3QYBA 4F7UA 4MIMA 2HBPA 1KQSA 3OSSC 3CMET 3V7SA 2K3YA 1VQ9T 3GIBA 3KUFA 1WPYA 1XNIA 3VYGB 1QP2A 2YLCA 4NL2A 4F7UB 5GAMf 5GAN4 2LC4A 3UWNA 1VQLA 4LDXA 3V8JA 1KD1U 4DA4A 4C92A 1Q82C 3L42A 3C94A 3VJPA 3X28B 5DLOA 1O75A 3JCMQ 3CC7A 1YJWT 2V8IA 4ELZC 2MWPA 3BG9A 1S72A 1G3SA 4C92B 5CKFA 4F7UG 4Y28E 1JJ2S 3CCRT 2EQKA 4M7AA 1M1KC 5J3BA 4LD6A 1H3ZA 4FT2A 3CD6A 4M75C 3S3OA 4N4GA 3PTAA 4QQGA 4XU1A 2V8KA 4C92G 3G6ET 4FIBA 4RCCA 3QPHA 1VQ5A 4ELJA 1BI2A 2RD1A 3QUIA 1Y71A 4C92D 2R5MA 5DM7R 1R8OB 4OF1A 1K8AC 5GMKe 3TU4K 4KBMB 3L2UA 2M0OA 4JS5A 3L2WA 3KHIA 3HL8A 2L89A 4BBRM 3FJPA 5CKBA 4C8QB 2QA4T 3JB9J 5LJ3j 1I8FA 4C92F 3JCMf 2DO3A 4GLKA 4XAXB 1VQNT 2FHDA 3V8LA 2QQAA 4XK8E 1G3YA 3OYHA 1P92A 3INZA 2VGNA 4E7IA 1K73C 4M7AF 4C8QD 4XTUA 4AKHA 3QWLA 1D3BA 2DVEA 3CCST 2O01E 2O4XA 2RHZA 4M78C 1VQMT 3CCJA 2CKKA 2JUFA 1D3BB 5GAOm 2O4XB 1PSEA 4J7IA 4M78E 2CS7A 2DTHA 2M16A 2L8DA 4ATOA 4M77E 2DXCA 2XICA 2QDJA 2JN0A 4LDWA 4PLLA 5HK0A 2B8AA 1W2BS 1YIJT 5FRMA 2DXCB 4OB0B 1YJNA 3RKWA 2QQBA 2KMTA 4E7LA 3CCMT 3HRUA 2XU8A 5CCAA 2RJDA 4OB1B 4HCCA 2PVGB 4XQ3A 2EQMA 3M5AA 1UGSB 5CK9A 5GAN3 4XU0A 3JB9H 3JCMb 3QBYA 2PVDB 5GMKh 3EFRA 3CC4T 3GNFB 5GAN5 4X34A 4HNTA 2RH2A 3META 2Y4YA 3PMIA 4Q5WA 1QW1A 4BI8B 1FWZA 2DD4A 4YTLA 2F5TX 3GP8A 3OYLA 2LCCA 4II1A 5DLQE 1VIFA 4J6XA 2XDPA 3C12A 3RMSA 3I56A 4ZGJB 2DD4B 2QI2A 2QQSA 2X4XA 3M57A 5KE3A 2I2LA 1N8RU 1Y96B 2IG0A 1Q7YU 1X01A 2JZ2A 2WJ9A 4O6JA 5C6SA 5GMKi 3CCLT 4BUGA 3CCVA 1YJ9A 5CIUA 1NZ9A 1UEBA 3M53A 4XTYA 3LGLA 4JX4A 4MZMA 1ZQ1A 3OQ5A 2R57A 2XIDA 2CZ7B 1JJ2A 1MHNA 4RCBA 3M54A 3OYCA 3CPFA 3Q1JA 3OYEA 4L6V5 2WACA 4ZGEB 2PUOB 5GAMe 2DIQA 5GAOl 1WGSA 3JB9G 2DAQA 4OVAA 4OB2B 3JCMX 4PJOE 4IUUA 3JB9D 3C4SA 3OBYA 1UB4A 2E1HA 3HO8A 3G4ST 1K9MC 4B9WA 2ZPBB 5LJ3f 4M7DA 3QYHB 5LJ5j 1QP3A 3VUZA 4JX5A 3MHXA 5CAIA 3CMAA 4IKFA 1VUBA 3PT9A 3M55A 2RHYA 4E7HA 2EFIA 3JB9F 3HZJA 4M6VA 2HQEA 2XHCA 4M7DB 1UGRB 3CCUT 3BG3A 3QZ5B 4E7KA 3NTIA 3QKJA 2K5FA 2LT1A 2M9UA 5D6XA 4OMFB 1M9SA 4E7JA 4J7FA 4M7DG 3T9NA 3MEAA 1X6OA 4AKGA 4R55A 1VQKA 3OYBA 4M7DD 3OYAA 2L5QA 2E6NA 4HNVA 2RK1A 1I81A 2YLBA 5GAMd 1YI2A 1Y07A 3JCMe 3OYIA 4JJNK 5FU7B 2RI3A 4LDYA 3G7ZA 2BKDN 4B9XA 3VKHA 4M7DF 4VUBA 4EMKB 5LJ5e 4MDWA 3HP9A 1W2BA 3VKGA 1KC8C 3NTHA 2E12A 2Y4XA 4N0AA 5KH6A 3S3NA 2PQWA 2OAUA 4L59A 3A8HB 3WVDB 1YCYA 5GAMh 4KT0E 3LX7A 2IVWA 3MEUA 2QXFA 5FU6B 4BY6B 2GFUA 2HNIA 4PNOA 3GPLA 3JAME 3N5BB 5CKHA 1MGQA 3QO3A 3TW6A 5AYFA 4C8QC 5I21A 2QEXA 4C0DB 3JSCA 2AHJB 3QYGB 2KVQG 4F7UE 5EG2A 4JUVA 4A4FA 2K4YA 4BDZA 2RI2A 3HPWA 1YITT 3UT1A 4MMLA 3PFSA 1I5LA 1G3WA 3QIIA 2PUKB 3JCMd 4C92E 3HB9A 2OTLT 4UC4A 3P8BB 1X75C 3QZ9B 1WJQA 3MO8A 3OS5A 1Q81C 5LJ5d 1QVFA 2CGHA 4NS5A 4QVZA 1VIEA 1BI3A 2LVMA 2H3JA 1RL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXC A;  1AHJ B;  1JB0 E;  2DXC B;  4OB0 B;  2PVO B;  1UGP B;  2ZPH B;  4OB1 B;  2PVG B;  3WVE B;  1UGS B;  3A8O B;  2WSC E;  1GXI E;  3A8G B;  2PVD B;  3LW5 E;  1V29 B;  2DXB A;  1DJ7 B;  2DD4 A;  2ZPI B;  2DXB B;  4ZGJ B;  2DD4 B;  3VYG A;  3VYH B;  2ZPE B;  3X20 B;  2DD5 A;  2CZ7 B;  2DD5 B;  4L6V 5;  2PU9 B;  4ZGE B;  2PUO B;  4ZGD B;  2CZ6 B;  4FM4 B;  4OB2 B;  2DPP B;  3X25 B;  2ZPB B;  3QYH B;  1QP3 A;  1PSF A;  2ZZD A;  2ZCF B;  2ZPF B;  1UGR B;  3QZ5 B;  2ZZD B;  3VYG B;  3A8L B;  1QP2 A;  3HHT B;  3X28 B;  2QDY B;  4Y28 E;  2CZ0 B;  3X26 B;  2WSE E;  4RKU E;  2CZ1 B;  4OB3 B;  3A8M B;  2CYZ B;  1UGQ B;  2D0Q B;  3A8H B;  3WVD B;  4KT0 E;  2ZPG B;  2WSF E;  5L8R E;  2AHJ B;  3QYG B;  4XK8 E;  2O01 E;  2PUK B;  3X24 B;  1IRE B;  3QZ9 B;  1PSE A;  3QXE B; 
#chains in the Genus database with same CATH topology
 1JST B;  2KK4 A;  4M77 C;  2V8J A;  4ME7 A;  4KGX B;  2KBT A;  4QVC A;  2RJC A;  1QMZ B;  2QA4 A;  4M7A D;  3CBM A;  2O31 A;  2W9F A;  5LJ5 f;  4Y91 A;  2C0O A;  1AD5 A;  4OGC A;  4CI0 C;  3EGX A;  3VRY A;  2WIP B;  1T3S A;  3I56 Q;  1TWB A;  1OL1 B;  2QQ8 A;  1HD3 A;  3PNW C;  1NPP A;  3A5Z B;  4FU6 A;  1H1R B;  2ZPE B;  4J83 A;  1KHC A;  2VWF A;  4M75 A;  3RES A;  5IXF A;  4NL3 A;  2LW4 A;  1HK9 A;  1RAG B;  2A37 A;  4GBQ A;  3CCJ T;  4Z6Y A;  5HK3 A;  2P0K A;  1BI1 A;  2CUB A;  4PFP A;  3OYN A;  4BBS M;  4PJO C;  4F7N B;  5I2M A;  1VQ8 Q;  5IN1 A;  1LOJ A;  2D8J A;  3SHW A;  1OIY B;  1RI9 A;  1M1G A;  2JMA A;  2EWN A;  4XTW A;  2ZCF B;  2ZPF B;  3OW2 S;  1YJN T;  4IIM A;  4J6W A;  3OY9 A;  2F1L A;  2X3X D;  2ZZD B;  1PNJ A;  4LE9 A;  3I5R A;  3LWH A;  1UJY A;  2A36 A;  1OI9 B;  4LN2 A;  3CCE A;  3M4G A;  1TG0 A;  4L5G A;  1YI2 Q;  2JOY A;  1GBR A;  1E7O A;  3DLM A;  1PC0 A;  4KUI A;  1N5Z A;  5GAN d;  4BE1 A;  5GAO n;  1BBZ A;  4MDX A;  3DKM A;  5GMK l;  4C5I A;  3M9Q A;  3QJ6 A;  3I56 T;  1VQ8 A;  2UZD B;  3FJ5 A;  2CYZ B;  4EC8 B;  1QVF P;  1OI1 A;  3S3M A;  1ZSZ B;  1YJ9 T;  2P4R A;  2WSF E;  1RAA B;  2LNH B;  4XTZ A;  3J80 E;  5I5Z B;  4IUR A;  2VC8 A;  3MP6 A;  3TW7 A;  4PK4 A;  1LJO A;  4LDU A;  2E64 A;  5D6Y A;  4EOS B;  2W2H A;  1WQ7 A;  2H8H A;  1OQK A;  3G6E Q;  1WZO A;  1F1B B;  2X9H A;  4AFU C;  3CMA T;  3RKY A;  5AT1 B;  1WHJ A;  1JB0 E;  3UAT A;  1QCF A;  1M4Z A;  1N9S A;  2ZPH B;  2LQN A;  1KG1 A;  1JBM A;  2QAZ A;  1TSF A;  3CCS Q;  1YI2 T;  2LMJ A;  2Y90 A;  4D8D A;  1WQW A;  2DKG A;  2GQI A;  3LW5 E;  4RG8 A;  2PZ1 A;  3EFO A;  1WI7 A;  2UZB B;  1DJ7 B;  2IW9 B;  1WFW A;  4EOI B;  4PJM A;  4D6W A;  2IN3 A;  3G6E A;  1IHV A;  1H64 1;  3JB9 I;  1N8R C;  5KYX A;  4M7A E;  4JLI A;  5CR2 A;  2EJF A;  3L2Z A;  4MFE A;  2CH4 W;  5LJ5 h;  2HCK A;  3TQ7 P;  1ZBJ A;  3ZBD A;  1M1K R;  3CCS A;  2HL3 A;  3OYK A;  1Q81 R;  2DX1 A;  2KRO A;  2YUN A;  3ZEH A;  3FDR A;  1K9M U;  2QTV A;  3MPU B;  2UZL B;  4E2F B;  4LOC A;  2E41 A;  1M8M A;  3CCL Q;  3RGF B;  2DEU A;  2R5A A;  2ZAE A;  2WEV B;  5EJC A;  1XJW B;  2RHU A;  4HNU A;  1OV3 A;  2DTO A;  4C8Q G;  4HVW A;  4LD9 K;  2GTJ A;  2MI6 A;  5A0G A;  4CC3 A;  1WIE A;  3DB3 A;  3G33 B;  1TU0 B;  2JTF A;  3G4S Q;  3SWN B;  3BDL A;  4C8Q F;  1QLY A;  1FMK A;  3I55 T;  2KY9 A;  2EYZ A;  4M78 G;  1B07 A;  2LRQ A;  3HSB A;  1QVG S;  3EG9 B;  1WXB A;  4M77 G;  1LCK A;  3CCL A;  4EOM B;  2JTM A;  3JRZ A;  2A08 A;  2K3B A;  2OI3 A;  1KQS S;  4E47 A;  3KXT A;  3L2Q A;  4M78 F;  3VV0 A;  4BXX X;  3VS3 A;  4P5N A;  1Y7X A;  1SPK A;  2H3E B;  2HSE B;  3CPW P;  4HKE A;  2EKH A;  1G5V A;  2YUO A;  3G4S A;  4F7S B;  4C5E A;  4DQ2 A;  2DLP A;  5GAN 2;  3CXC A;  3L2V A;  4PL6 A;  5DQW A;  4RUG A;  5CQX A;  2K2M A;  1UGP B;  1YHQ T;  1M2V B;  2F2X A;  4KGV B;  3BLQ B;  5FU6 C;  3CCQ T;  2HDA A;  1JKW A;  2FZC B;  1GXI E;  2NUZ A;  2OTL Q;  2JJ9 A;  4QSH A;  2DER A;  3NGP A;  1PKT A;  2R58 A;  4HCZ A;  3RBB B;  1W1F A;  4PJO G;  5I22 A;  4M7A C;  2DIG A;  1ZUU A;  4BAC A;  2XKO C;  3REA B;  2IW8 B;  2AZS A;  2X4Y A;  3VKI A;  4PJO F;  8ATC B;  5GAN g;  1X43 A;  5GAO q;  1U06 A;  3A98 A;  2XDB A;  4DOV A;  2MF2 A;  2OTL A;  5GAN 7;  2F5K A;  1IRX A;  2LP5 A;  2C5N B;  2E10 A;  1BIA A;  2NLU A;  4CXA B;  4PLI A;  3LWI A;  1ZBX A;  2HSP A;  3QYB A;  1WHM A;  4BCP B;  2VVK A;  4MIM A;  4AT1 B;  1QKW A;  5ACB A;  2HEQ A;  1WLP B;  4NL2 A;  3VYG B;  2YLC A;  2LC4 A;  3UWN A;  1NLO C;  1KD1 U;  1Q82 C;  4C92 A;  3H0H A;  3VJP A;  3X28 B;  2V8I A;  4F7U G;  2RQR A;  4Y28 E;  2EQK A;  4M7A A;  2OX7 A;  2LJ3 A;  1H3Z A;  3PTA A;  2PK2 A;  4J9C A;  3QPH A;  3BHT B;  1QMC A;  3TU4 K;  2M0O A;  4BBR M;  1U5S A;  4C8Q B;  4OGR B;  2UZE B;  4BCK B;  1MMG A;  4XAX B;  1VQN T;  1X6B A;  4E7I A;  1G3Y A;  4C8Q D;  1D3B A;  2O01 E;  2O4X A;  2DRM A;  1PSE A;  1VOM A;  4ATO A;  1ZSG A;  2L8D A;  3HTR A;  3CCV Q;  4LDW A;  2B8A A;  2QDL A;  2RMO A;  3QDF A;  4K11 A;  4E7L A;  5EC7 A;  1TUD A;  1ZSZ C;  2XU8 A;  3HRU A;  5CCA A;  2RJD A;  1C0M A;  1YN8 A;  5GAN 3;  1UGS B;  1WA7 A;  4XU0 A;  2JGZ B;  2O9V A;  3EFR A;  2W0Z A;  1OU8 A;  3VS5 A;  1QW1 A;  1FWZ A;  3GP8 A;  2IIM A;  1ZUY A;  2LCC A;  4Z89 A;  2DD4 B;  2QQS A;  4ROD A;  1Y96 B;  3CCV A;  2WJ9 A;  4EON B;  3M53 A;  2IW6 B;  1WXT A;  4MZM A;  2R57 A;  1QKX A;  2YRC A;  1YIT Q;  3CPF A;  3Q1J A;  4L6V 5;  2PUO B;  1GUX B;  3VS1 A;  3JB9 D;  3B57 A;  2SRC A;  2DMO A;  2CRE A;  3QYH B;  1IGU A;  3VUZ A;  2L2P A;  3MHX A;  3VS7 A;  4IKF A;  2CT3 A;  3I9Q A;  4M7D B;  4M6V A;  2MOX A;  2QEX Q;  3NTI A;  2LT1 A;  4OMF B;  4R55 A;  1X6O A;  4AKG A;  1G83 A;  4M7D D;  2L5Q A;  3EID B;  1QWF A;  1IHW A;  4FW2 A;  4JJN K;  1BK2 A;  4JJD A;  1OX9 A;  4EMK B;  4MDW A;  4AMC A;  1KC8 C;  2Y4X A;  5KH6 A;  4N0A A;  2PQW A;  2OAU A;  3QHW B;  4F6S B;  4EOJ B;  3CC2 Q;  2QXF A;  3N5B B;  3QO3 A;  2QEX A;  1GCQ A;  2AHJ B;  3QYG B;  2KVQ G;  2NUT B;  2K4Y A;  1VYU A;  3HPW A;  4BDZ A;  1YIT T;  2CP0 A;  2CJM B;  3UT1 A;  1G3W A;  2QYZ A;  2YXY A;  1QVF A;  1Q81 C;  1W98 B;  2EBP A;  2AIR B;  1N8R R;  1BI3 A;  4OMM A;  3SWN C;  2JNG A;  4X9D A;  1AHJ B;  1M90 U;  2I40 B;  1BKB A;  4AKI A;  3H8Z A;  3P8D A;  3THK A;  1SG5 A;  4M7A G;  2DZC A;  3CC2 A;  2FL7 A;  4C8Q E;  1KSW A;  3CC7 T;  4ELY C;  4PKC C;  3DDQ B;  1JXO A;  3RUX A;  4NOY A;  4JLG A;  3EOC B;  2FPD A;  2DNU A;  1Q86 U;  3U23 A;  1JJ2 P;  3CD6 T;  4BE2 A;  5LMK B;  4FSX A;  5GAN j;  4JRP A;  3RMQ A;  2I53 A;  1W70 A;  1FXX A;  5GMK m;  4QKU A;  2HMA A;  1FX7 A;  3CCM A;  3UA7 A;  2LDM A;  3GLX A;  3X20 B;  2JW4 A;  4ROC A;  4OR5 B;  2KRM A;  5KYW A;  1SF9 A;  3JV3 A;  2COY A;  3HKS A;  3R6O A;  1NYF A;  5CQY A;  5IDN B;  3EGD A;  4N4H A;  4FM4 B;  3OS1 A;  4WF2 A;  2SEM A;  3BLH B;  2DK3 A;  4XU2 A;  4DEY A;  1VQP Q;  5L2W B;  3EG9 A;  4J9D A;  4KRC B;  1UNG D;  1B7T A;  1OUL A;  2K79 A;  2BZX A;  2LT4 A;  1PKS A;  1JXM A;  1SSF A;  1W6X A;  4JPB W;  2F69 A;  3G71 T;  1SSH A;  1VQK Q;  2BPM B;  2CSI A;  1SEM A;  2EYW A;  2QDY B;  1KQ1 A;  4ZTF A;  3RIR A;  1OKW B;  2X4W A;  3HRT A;  2PK9 B;  5FRO A;  5DY9 A;  4PFO A;  4RKU E;  3QSU A;  4EOL B;  3BW1 A;  1VQP A;  1VQ5 T;  4ORZ A;  4CFU B;  2K9G A;  3OS0 A;  2GCX A;  2AKL A;  1M2V A;  4J6Y A;  3PIO A;  1K8A U;  4IMY B;  3CME Q;  1U3O A;  3MY5 B;  4M7D E;  1O9K B;  3EJ1 B;  1ZA1 B;  1X27 A;  4CFU D;  2J6O A;  5HBJ B;  2PHG A;  5GAN f;  2GGR A;  1K73 U;  2KRN A;  5J39 A;  1U8R A;  1ZP2 A;  2HZY A;  2D8H A;  3REB B;  2DL3 A;  1NM7 A;  1BCM A;  1ARK A;  3NPF A;  1Y0M A;  2QA4 Q;  2RA2 A;  3CME A;  2XDD A;  1VQ9 A;  4JRQ A;  2GNC A;  3UDC A;  1VQK T;  3CPW A;  1HSQ A;  4MMK A;  3ULR B;  2V22 B;  1YJW A;  5CEI B;  2RK2 A;  4BE0 A;  4BY1 X;  2BUD A;  2DXB A;  4Z02 A;  5CKE A;  3VRZ A;  5FLX E;  1K0S A;  3BG5 A;  3M58 A;  3OYM A;  3FIF A;  4RTV A;  2EGC A;  3VYG A;  1Q7Y C;  5GMK j;  2K5I A;  2PJQ A;  3CXC S;  1PHT A;  1Q82 R;  5CKD A;  4PJL A;  1RAI B;  3CBP A;  3LGF A;  1B3Q A;  2E3H A;  2QFZ A;  2GBQ A;  5IF1 B;  4F16 A;  2WMB B;  4HA8 A;  4RG2 A;  2X3W D;  2CP2 A;  5D7U A;  4A4G A;  3BLR B;  2DJQ A;  4C8Q A;  1M8V A;  4JJC A;  4GY5 A;  2JT4 A;  2DL8 A;  1KFZ A;  2EGA A;  1D09 B;  1M1F A;  1YIJ A;  1BIB A;  2O9S A;  1ZHI A;  1VYT A;  4N4I A;  3CCE Q;  4BI4 A;  3OSV A;  2EYQ A;  1B34 B;  1U1T A;  2FZK B;  3CEY A;  4M78 A;  4EOP B;  2M0Y A;  2CZ0 B;  4M77 A;  1CKB A;  2W9Z A;  1BU2 A;  3DJB A;  5GAN e;  1H25 B;  2QG9 B;  4BB7 A;  4KRD B;  3POM A;  5CO7 A;  3O5Z A;  2RJE A;  1FKM A;  3DB4 A;  4C0Z A;  1TXQ A;  1OOT A;  1TS9 A;  1X69 A;  2EJG A;  2VGM A;  4M7D C;  1T0J A;  4A4E A;  1M5Q 1;  5L8R E;  3NHN A;  3QDR B;  1VA7 A;  4WCI A;  4EOK B;  1RAF B;  1UE9 A;  5A0D A;  2J6F A;  1UNH D;  5GAM j;  2I0N A;  1G3N C;  4II5 B;  2UUE B;  2K5L A;  1Y96 A;  5KCH A;  1GBQ A;  3LH0 A;  2FVU A;  2DL5 A;  4EMK C;  3H0I A;  2RO0 A;  3FLG A;  1H1P B;  3CCU A;  3PIP A;  2DBM A;  4ZN3 A;  5GAN h;  4MFD A;  2YT6 A;  3CCE T;  4PJO A;  2DL4 A;  2RM4 A;  1LVK A;  1N9R A;  2YWW A;  5EFQ B;  1ZX6 A;  3DLL A;  2NUP B;  1IXD A;  2LZ6 B;  2FZG B;  1VQ8 T;  1JSU B;  1RI0 A;  4ANJ A;  4CC4 B;  3VUB A;  1RLP C;  3QG1 A;  2FPE A;  5IAY A;  4JRI A;  1VQL Q;  2DTI A;  3H4C A;  5IDP B;  4BCG B;  4EDU A;  4E7Z A;  2EW3 A;  3H0F A;  4F7L B;  1S72 Q;  3LQ5 B;  2DD5 B;  3TRE A;  4FYX B;  1NEG A;  1XO2 A;  1YBY A;  4EMK A;  2G77 A;  4IUT A;  2EKO A;  1N4M A;  3WXM B;  1TFB A;  2OAW A;  1KC8 R;  3VS4 A;  3H6Z A;  3OYY A;  2NYS A;  4IIO A;  4F7U A;  5HCK A;  2HBP A;  4G6L B;  2R7G A;  3SEM A;  5GAM f;  1QP2 A;  1VQL A;  3M0P A;  3V8J A;  4OMQ A;  3L42 A;  1I5O B;  1QWE A;  5DLO A;  3JCM Q;  4ELZ C;  1S72 A;  1LPL A;  1R0C B;  5CKF A;  2FPF A;  4KH1 B;  5KYY A;  1H3H A;  1K1Z A;  2MPX C;  4LD6 A;  4XU1 A;  3G6E T;  4ELJ A;  4DBF A;  1OKV B;  1RAB B;  1R8O B;  2KT8 A;  5GMK e;  3I5S A;  3M03 A;  1H8K A;  3FJP A;  2VB6 A;  1PRL C;  2EYY A;  4OMO A;  3PVL A;  1P5E B;  4F04 B;  1ZUK A;  5HBH B;  3OYH A;  1X6G A;  2BZY A;  2MYS A;  4RTT A;  4AKH A;  2DVE A;  4XTU A;  4E6R A;  3CCS T;  2RHZ A;  3VS6 A;  1UFF A;  2CS7 A;  4Z88 A;  5FGK B;  1JO8 A;  2O88 A;  2JTE A;  2DXC A;  2QDJ A;  1HJD A;  5KYU A;  4B6M A;  1YCS B;  2B9R A;  4RTU A;  1SHG A;  2EQM A;  3JCM b;  2KYM A;  5GMK h;  2GTO A;  1FVV B;  1UGV A;  1MMN A;  4Q5W A;  1OPL A;  2KR3 A;  2F5T X;  2WXV B;  4II1 A;  1VIF A;  5DLQ E;  3RMS A;  1QVF S;  1J3T A;  2X4X A;  3EG0 A;  4ESR A;  1FMV A;  5GMK i;  4CFM B;  3CCL T;  4BUG A;  3EH1 A;  4XTY A;  3LGL A;  1ZQ1 A;  1AEY A;  1NG2 A;  2C0T A;  1JJ2 A;  5IHY A;  2HBW A;  5GAM e;  2DIQ A;  5GAO l;  1WGS A;  3JB9 G;  4OVA A;  4Y92 A;  3JCM X;  5IHK A;  3M0S A;  4AG2 C;  5ECA A;  3G4S T;  1K9M C;  1QQJ A;  3TVT A;  2ZPB B;  2HQH A;  1M90 R;  4JX5 A;  4BCH B;  3I35 A;  1VUB A;  3UF4 A;  3JB9 F;  2EFI A;  3HZJ A;  2HQE A;  4PJN A;  1UGR B;  4F7J B;  3BG3 A;  4E7K A;  1D0Z A;  3QKJ A;  5ICP B;  4M7D G;  3MEA A;  5HBE B;  2L3Q A;  3OYB A;  1Q86 R;  4HNV A;  2RK1 A;  5HNB B;  2ED1 A;  5GAM d;  1Y07 A;  2YRD A;  3EHQ A;  2RI3 A;  4LDY A;  1OEB A;  2BKD N;  2DVJ A;  4M7D F;  4VUB A;  2LX7 A;  3HP9 A;  3VS0 A;  4RTW A;  4LNP A;  2E12 A;  1M3B A;  2MCN A;  1YCY A;  3VS2 A;  2DME A;  1NYG A;  5GAM h;  2J06 A;  2GFU A;  1PD1 A;  2X1N B;  1I5L A;  4MML A;  4EOQ B;  3QII A;  1D0X A;  3HB9 A;  2OTL T;  4YOO A;  1PWT A;  3OS5 A;  1WX6 A;  2CGH A;  2KXC A;  4OP0 A;  1Q7Y R;  1AWJ A;  5HY6 A;  1VQ6 A;  2ATC B;  2E6Z A;  2YSQ A;  3MY1 B;  3E19 A;  3BFM A;  2LQK A;  3EFS A;  4BDY A;  3OBW A;  1VQO Q;  1VQ7 Q;  2QF7 A;  2KYB A;  5C0M A;  2FYK A;  2QGG A;  3EGX B;  1TUG B;  4YOZ A;  2WFY B;  3GF5 A;  1RAE B;  3QHR B;  2KEA A;  4KUL A;  2E5Q A;  2D6F A;  3V7R A;  3JCM g;  4J9E A;  1NJI U;  5GAO r;  2C5V B;  1M3C A;  2PU9 B;  2VKN A;  1RAH B;  3AT1 B;  1GL5 A;  3CPW S;  1H26 B;  3LLR A;  4M75 B;  2VXF A;  2A7Y A;  5FWC A;  3MI9 B;  1VQO A;  1Y57 A;  3CBO A;  4FL6 A;  4XTV A;  3PGG A;  1VQ7 A;  2IPO B;  4QW2 A;  4QVD A;  3SFM A;  4M75 D;  2XI9 A;  1EZZ B;  3DDP B;  3P8H A;  2ZZD A;  3OYD A;  4FT4 A;  1W2B P;  1VQ4 Q;  2KXD A;  3J7A F;  3GOX A;  4OMN A;  3A8L B;  2E70 A;  1KD1 C;  3MIA B;  2CUD A;  3OMC A;  5I11 A;  2EJ9 A;  4BCN B;  4HVV A;  4JDS A;  1G3T A;  1M1K U;  4O5V A;  2DA9 A;  9ATC B;  2KSS A;  1BYM A;  2K3X A;  4IUV A;  1M27 C;  4QQD A;  4BCN D;  1ENW A;  2OTJ Q;  1ZSZ A;  3E1S A;  3HRS A;  3CCV T;  1XQH A;  1E7P A;  1WHH A;  1FMW A;  1URC B;  1QCO A;  2KR6 A;  2A3L A;  2WMA B;  3OB9 A;  1VQ4 A;  3BY7 A;  4Z8A A;  4LUE A;  4C0G A;  2CT4 A;  4KH0 B;  3IQL A;  3GBQ A;  4RTZ A;  3V7C A;  3CCR Q;  2ED0 A;  1KHI A;  2HL5 C;  1N27 A;  1K76 A;  2XK0 A;  2DFU A;  2XD0 A;  5LQF B;  4BCI B;  2EGE A;  1W4S A;  3L2R A;  2M1H A;  2LX9 A;  2KRS A;  5LJ3 g;  2RJF A;  2OTJ A;  2KQW A;  3LYI A;  6AT1 B;  3UPU A;  5FRN A;  4PFZ A;  1CSK A;  2C06 A;  2KMG A;  2GF7 A;  5M9O A;  2LTO A;  5D6W A;  1GY3 B;  2LQ8 A;  2Z0W A;  3A8O B;  2PNI A;  1XOV A;  1NEB A;  1VQM Q;  1FYN A;  4J9H A;  1MNE A;  1V29 B;  3CCR A;  1HXD A;  4AFS C;  1TH7 A;  3O8V A;  4J8O A;  1OL2 B;  1ACM B;  4FSS A;  4AFQ C;  2K57 A;  5KYX B;  3OYF A;  3PVQ A;  4FYV B;  3CCM Q;  4BCO B;  2JM8 A;  2ROL A;  3E2U A;  3KFV A;  2QEX T;  3A1P A;  4CC7 A;  2VUB A;  1N6A A;  5GAM g;  1M30 A;  2L3P A;  2BS2 A;  1JEG A;  4YC3 B;  4BY7 X;  2QQR A;  2CZ6 B;  2HKN A;  4DBR A;  2KDS A;  1VQM A;  2DIL A;  5KCO A;  1I4K 1;  3GTM S;  2QK0 A;  1H27 B;  4HCB A;  3RNJ A;  1IO6 A;  3OYJ A;  2FRY A;  4V2S A;  2JS0 A;  3D7S B;  4ZN1 A;  3CC2 T;  1D1A A;  1K9A A;  4XTX A;  2RI5 A;  4ELL A;  1EX4 A;  5J26 A;  2K2V A;  3HFN A;  1MV3 A;  4CRL B;  1I07 A;  3OS2 A;  3SWN A;  1GRI A;  3QHS A;  3CC4 A;  3X26 B;  4M75 E;  4A4H A;  2DET A;  3M0Q A;  3M59 A;  3A8M B;  3ZL7 C;  3TCJ A;  4BCM B;  1EFN A;  3TNI B;  2D0N A;  4JX6 A;  2F2V A;  4ZTJ A;  2LJ0 A;  3ASK A;  1D1B A;  2YRV A;  3G71 A;  2EQU A;  3BDU A;  4BCM D;  2BE7 D;  4JS4 A;  1GH6 B;  2DE0 X;  3TSZ A;  3MJX A;  2AKK A;  2W99 A;  2A0F B;  4QT7 A;  2COW A;  1HYO A;  2K6D A;  1E6H A;  1M90 C;  4KUD K;  2JVV A;  1BB9 A;  1NPR A;  3F70 A;  3PMT A;  4TTH A;  1V76 A;  2BTT A;  3OW2 P;  3EH2 A;  1VQ9 Q;  4CFW B;  3URG A;  1RLQ C;  4BD3 A;  2RHX A;  2C4G B;  2WPA B;  2MMP A;  1YJW Q;  3EG2 A;  3O0G D;  2WSC E;  1Q86 C;  1T0H A;  3EGU A;  4HLQ A;  1K9M R;  3G1J A;  4OGE A;  1VQP T;  1KK7 A;  2ENM A;  1F5Q B;  2RNA A;  2DXT A;  2G3R A;  3TSW A;  5L23 A;  3DTO A;  2EAY A;  2CP7 A;  2L3S A;  2ABL A;  4AI6 A;  3JCM J;  3M4Y A;  3JCM W;  4ZGD B;  3FEO A;  4C5H A;  4ROE A;  7AT1 B;  3AHU A;  1SRM A;  1UUE A;  1PSF A;  2BZ8 A;  1G8X A;  1YIJ Q;  1I0C A;  2LQW A;  1M3A A;  3OSS C;  3V7S A;  3CME T;  2K3Y A;  1VQ9 T;  2KI7 A;  4LDX A;  1JOW A;  4KGZ B;  1M2O A;  1E6G A;  1YJW T;  3BG9 A;  4BCQ B;  4C92 B;  3CCJ Q;  1JJ2 S;  1AWO A;  4FT2 A;  4M75 C;  2C5O B;  1ABQ A;  2F2C A;  2V8K A;  4FIB A;  4RCC A;  4BCQ D;  3QUI A;  1X2K A;  1Y71 A;  4C92 D;  1K8A C;  4AFZ C;  4KBM B;  1YJN Q;  4JS5 A;  3KHI A;  1WHK A;  4J9B A;  2QA4 T;  5LJ3 j;  1I8F A;  1UTI A;  2EYX A;  3JCM f;  3TN8 B;  1AD6 A;  3V8L A;  4Y72 B;  2EPD A;  2QQA A;  4XK8 E;  1K73 C;  1P92 A;  2VGN A;  3QWL A;  2DM1 A;  2BKZ B;  3CCJ A;  2JUF A;  1D3B B;  5GAO m;  4FX3 B;  2O4X B;  4J7I A;  1MV0 B;  2FG0 A;  2DTH A;  2M16 A;  1FIN B;  3QWY A;  3NDQ A;  2XIC A;  1VYW B;  2JN0 A;  1YJ9 Q;  2RQU A;  1YIJ T;  5FRM A;  3CCU Q;  1YJN A;  4OB0 B;  5GJV B;  2QQB A;  2KMT A;  1KXU A;  1RAD B;  4PJJ A;  2MK5 A;  4OB1 B;  2PVG B;  2FRW A;  3JB9 H;  3QBY A;  4X34 A;  3MET A;  4BI8 B;  2DD4 A;  4YTL A;  4J6X A;  3CMA Q;  4F17 A;  2LJ1 A;  2QAS A;  4ZGJ B;  3RDV A;  2QI2 A;  3M57 A;  5KE3 A;  3I56 A;  1N8R U;  2IG0 A;  1X01 A;  2JZ2 A;  5C6S A;  1YJ9 A;  2P84 A;  1QVG P;  1NZ9 A;  2COZ A;  1KD1 R;  4JX4 A;  3OQ5 A;  2XID A;  4FW1 A;  2PTK A;  4A63 B;  1YWP A;  3MKD A;  3M54 A;  4RCB A;  3OYC A;  1GUX A;  1KQS P;  4ZGE B;  2DAQ A;  4OB2 B;  4IUU A;  3C4S A;  3HO8 A;  1WHL A;  1A0N B;  4B9W A;  5LJ3 f;  4M7D A;  2E5K A;  3CMA A;  1TTH B;  1YP5 A;  4E7H A;  2QGS A;  1S1N A;  4F6U B;  3DOG B;  4M4Z A;  4OMP A;  3CCU T;  3QZ5 B;  1PM3 A;  5D6X A;  1M9S A;  4E7J A;  4HVU A;  2A28 A;  3OYA A;  1YI2 A;  3JCM e;  5IH2 A;  1YFN A;  3G7Z A;  2DF6 A;  5LJ5 e;  2CP6 A;  1W2B A;  4JJB A;  3S3N A;  4J9F A;  3F5X B;  2C5X B;  4KT0 E;  4BY6 B;  2NUT A;  1VOL A;  5CKH A;  1NJI R;  1MGQ A;  4C0D B;  1C9B A;  4A4F A;  2X51 A;  3H9N A;  2E4H A;  3JCM d;  4C92 E;  2W96 A;  2AZV A;  1GFD A;  3QZ9 B;  1WJQ A;  5LJ5 d;  3I55 Q;  4GLM A;  4QVZ A;  1VIE A;  2EUF A;  2LVM A;  2KGT A;  2RB6 A;  5CVI A;  1O9S A;  1T3L A;  2LCL A;  3E9F A;  3JCM h;  1VQL T;  2MAM A;  4EMH A;  2HQX A;  1S72 T;  4E7S A;  2WIH B;  2DL7 A;  2X4J A;  3M56 A;  4CFV B;  3BHV B;  2X35 A;  5KE2 A;  1WNL A;  2ZPI B;  1PG5 B;  3I55 A;  1BI0 A;  4FYW B;  2HAX A;  3K7A M;  3OMG A;  3ME9 A;  4JZ3 A;  2E65 A;  3VYH B;  1K4U S;  5LJ3 e;  4J5Y A;  1YHQ Q;  1EIF A;  4EIK A;  3CCQ Q;  2KT1 A;  3OYG A;  2DYB A;  4I3Z B;  4LDV A;  1NE8 A;  1VIN A;  5KYW B;  5IT9 E;  2GQV A;  5DQV A;  2LNV A;  4M7A B;  2JM9 A;  2RPN A;  5IHI A;  1E9H B;  1YWO A;  3EGD B;  4ZNX A;  1AOJ A;  4M75 G;  4X1V A;  5HKC A;  1TUC A;  2IVX A;  1TD6 A;  2RQV A;  2G6F X;  1GFC A;  2AT1 B;  2P0Q A;  4DBH A;  3QYE A;  2GFA A;  2RF0 A;  5LJ3 d;  1Z9Q A;  5CYI B;  3SDZ A;  2QTX A;  2M02 A;  4M75 F;  1H28 B;  4X9C A;  1QVP A;  2ROT A;  1D1C A;  2YUQ A;  3NTK A;  4A4K A;  1YHQ A;  4LUD A;  1Q82 U;  5I2S A;  3CCQ A;  3MEW A;  1AWX A;  1OYX A;  4M77 F;  1G2B A;  4EPC A;  1UG1 A;  1PKD B;  3FC3 A;  4NST B;  3BHU B;  1MUZ A;  5LJ3 h;  5FU7 C;  2WSE E;  2E3I A;  2D9T A;  4OB3 B;  1JQQ A;  1C1A A;  1WJR A;  3S6W A;  1UEC A;  1O9K A;  1NBE B;  2V1Q A;  2VYT A;  2ZPG B;  2RQW A;  2DXU A;  4HT9 A;  4HL4 A;  1UJ0 A;  5A0L A;  2EQJ A;  4A53 A;  4C92 C;  1VYV A;  1IRE B;  4A54 A;  3TNH B;  2J6K A;  3QXE B;  4UN0 A;  1V1C A;  2WHB B;  3MEV A;  1IB8 A;  3EHR A;  4R56 A;  2PVO B;  1VQ6 Q;  2ECZ A;  1GCP A;  4D8K A;  4RMO A;  5FWB A;  1VQN Q;  1WXU A;  3WVE B;  2BS3 A;  1LNX A;  4IUP A;  5GJW B;  4JRK A;  1BU1 A;  1K0X A;  1JRI A;  2DEQ A;  4MZT A;  3QWX X;  2ZGW A;  3NMZ C;  1OU9 A;  2KAF A;  4DEX A;  2DXB B;  3QJY A;  3OW2 A;  3RER A;  2L3R A;  4KRT A;  4EMG A;  4C5G A;  2P4T A;  2QQ9 A;  1QLB A;  4CRI A;  4YOS A;  1KIK A;  1IZ6 A;  2MWO A;  1VQN A;  1U1S A;  2J7I A;  2KE9 A;  1MND A;  2V26 A;  1R77 A;  1ABO A;  4F7U F;  1K8A R;  2BIV A;  1WJS A;  1MMD A;  2YHT A;  4MZP A;  1VQ6 T;  2BS4 A;  2DZ9 A;  3H41 A;  3JCM c;  3HHT B;  1B34 A;  1PCX A;  4BCF B;  2VV5 A;  3FB9 A;  1K73 R;  2CP3 A;  4TVR A;  3OA6 A;  1IGQ A;  1D3U B;  4CFN B;  2XG8 D;  3C95 A;  5LJ5 g;  2HD0 A;  2JMC A;  1NLP C;  2P0P A;  4M78 B;  3VU3 C;  5LL6 S;  4HT8 A;  3FRN A;  4M77 B;  2CZ1 B;  3JCM V;  5KYN A;  1KC8 U;  2D0Q B;  1UGQ B;  3MCA B;  4LXC A;  4R0K A;  4M78 D;  2NWM A;  4DBQ A;  4M77 D;  2YUP A;  4C0F A;  1C6V X;  2XMF A;  4WTO B;  2RHI A;  3TEE A;  2CH4 A;  3SB2 A;  1RUW A;  3MP8 A;  1D0Y A;  3V8K A;  3X24 B;  1VQO T;  1VQ7 T;  4QQ6 A;  3CQT A;  3NFC A;  1Q81 U;  4BCJ B;  5GAN 6;  2M51 A;  2DJZ A;  1QCN A;  3ZFJ A;  5GAO p;  3RKX A;  4N0A C;  4BY6 C;  3M0U A;  2JS2 A;  3C0C A;  3M0T A;  1I1J A;  2C0I A;  2RQT A;  4BI3 A;  5GAN 8;  3J81 E;  4C0D C;  3A8G B;  2EIF A;  2NUP A;  2ESW A;  4PJO B;  1GCQ C;  3SD4 A;  4XU3 A;  2F2W A;  3L1A A;  3BE3 A;  2RN8 A;  3KBG A;  1OGU B;  1OIU B;  2FB7 A;  1JU5 C;  3EAE A;  3UA6 A;  5IXB A;  4PJO D;  5FW9 A;  3HFO A;  3GNG A;  5A2Q E;  1UNL D;  1VQ4 T;  2V1R A;  1OZ2 A;  2DD5 A;  3CC7 Q;  4CFX B;  3ER0 A;  2OJ2 A;  1NJI C;  4AG1 C;  1SHF A;  1YIT A;  1MMA A;  4NC6 A;  4DOW A;  1OPK A;  3HBL A;  3CD6 Q;  1OX8 A;  2CSQ A;  1H1Q B;  1WDX A;  2DPP B;  3X25 B;  3JCM P;  4RTY A;  3MP1 A;  1KQ2 A;  4IUQ A;  3E9G A;  2BE9 B;  1OZ3 A;  1QVG A;  2VXE A;  1X2Q A;  3EFO B;  2OTJ T;  3DL1 A;  3R6N A;  1XTD A;  1AIS B;  4J9I A;  2DBK A;  4RTX A;  1KQS A;  4EOO B;  2PMI B;  5HQ0 B;  2K7A A;  1WPY A;  1XNI A;  3KUF A;  4F7U B;  5GAN 4;  3GIB A;  2D1X A;  4DA4 A;  2JXB A;  3C94 A;  3CC7 A;  1O75 A;  5HVY B;  2MWP A;  2G9X B;  1G3S A;  2YDL A;  1YNZ A;  1UHF A;  3CC4 Q;  3CCR T;  1M1K C;  5J3B A;  3CD6 A;  5KYY B;  3S3O A;  4N4G A;  4QQG A;  4F70 B;  4C92 G;  1AZE A;  1PD0 A;  1BI2 A;  2RD1 A;  2R5M A;  5DM7 R;  4OF1 A;  3RR6 A;  3L2U A;  4FYY B;  3L2W A;  1ZA2 B;  2C6T B;  2L89 A;  3HL8 A;  5CKB A;  3JB9 J;  4C92 F;  3G71 Q;  2FO0 A;  2CP5 A;  3CXC P;  2DO3 A;  3EG1 A;  4GLK A;  2FHD A;  3INZ A;  1Z9Z A;  4M7A F;  1SKU B;  4EOR B;  3EG3 A;  1VQM T;  2CKK A;  1AVZ C;  5IHN A;  4M78 E;  2DYI A;  1VQ5 Q;  4M77 E;  4JZ4 A;  1PRM C;  2HKQ B;  3M0R A;  4PLL A;  5HK0 A;  1W2B S;  2DXC B;  2W10 A;  3RKW A;  3CCM T;  1UHC A;  2J05 A;  5KYU B;  1UDL A;  4HCC A;  1ZLM A;  1Q95 G;  1RAC B;  3M5A A;  4XQ3 A;  5CK9 A;  2PVD B;  3CC4 T;  3GNF B;  5GAN 5;  2CCI B;  4HNT A;  2EVR A;  2RH2 A;  2Y4Y A;  3PMI A;  1H24 B;  3OYL A;  4FCY A;  2XDP A;  3C12 A;  2DRK A;  1VQ5 A;  2I2L A;  3LH5 A;  1Q7Y U;  2EQI A;  4O6J A;  2LCS A;  5CIU A;  1UEB A;  2CZ7 B;  1WHG A;  1MHN A;  4HCK A;  3OYE A;  2WAC A;  2MIO A;  4PJO E;  3OBY A;  1AT1 B;  1UB4 A;  2E1H A;  5LJ5 j;  1QP3 A;  1AWW A;  5CAI A;  3PT9 A;  3M55 A;  2RHY A;  2XHC A;  1H1S B;  3PE0 A;  4F14 A;  2B86 A;  5BNJ B;  1TOV A;  1KJW A;  2KNB B;  2K5F A;  2M9U A;  2CCH B;  4J7F A;  3T9N A;  1VQK A;  4CC2 A;  1R0B G;  2O2O A;  2E6N A;  1I81 A;  2YLB A;  1BCO A;  1H92 A;  4F6W B;  3OYI A;  5FU7 B;  2L0A A;  4B9X A;  3VKH A;  4J9G A;  3TNW B;  3VKG A;  2CDT A;  3PO3 S;  3NTH A;  4L59 A;  2FEI A;  3A8H B;  3WVD B;  1AZG B;  1CKA A;  3LX7 A;  2IVW A;  3MEU A;  5FU6 B;  3GPL A;  4EC9 B;  1WYX A;  2HNI A;  4PNO A;  3JAM E;  5I21 A;  5AYF A;  4C8Q C;  3TW6 A;  2VAS A;  3JSC A;  4F7U E;  5EG2 A;  4JUV A;  2RI2 A;  3PFS A;  4OML A;  2PUK B;  4UC4 A;  8AT1 B;  2QGF B;  1X75 C;  3P8B B;  2AK5 A;  1H4L D;  3MO8 A;  4HXJ A;  1SRL A;  4NS5 A;  4M78 C;  2H3J A;  1RL2 A; 
#chains in the Genus database with same CATH homology
 3SWN C;  2KK4 A;  2JNG A;  2RB6 A;  2V8J A;  4M77 C;  1AHJ B;  4ME7 A;  4X9D A;  5CVI A;  1M90 U;  1O9S A;  1BKB A;  4AKI A;  3H8Z A;  3P8D A;  2RJC A;  5HY6 A;  4QVC A;  2LCL A;  3E9F A;  3JCM h;  2DZC A;  2QA4 A;  1VQ6 A;  1VQL T;  4M7A G;  3CC2 A;  2FL7 A;  4M7A D;  4C8Q E;  2MAM A;  3CBM A;  2E6Z A;  4EMH A;  3CC7 T;  4ELY C;  2HQX A;  4PKC C;  3E19 A;  3BFM A;  3RUX A;  1S72 T;  2LQK A;  4JLG A;  4NOY A;  5LJ5 f;  4Y91 A;  3EFS A;  4BDY A;  3OBW A;  1Q86 U;  2X4J A;  3CD6 T;  3M56 A;  4CI0 C;  4OGC A;  4BE2 A;  4FSX A;  2QF7 A;  2X35 A;  5KE2 A;  5GAN j;  1WNL A;  5C0M A;  4JRP A;  2ZPI B;  2FYK A;  3I55 A;  1BI0 A;  2HAX A;  3OMG A;  3RMQ A;  3ME9 A;  1FXX A;  2QQ8 A;  5GMK m;  3PNW C;  3GF5 A;  1NPP A;  3A5Z B;  2E65 A;  4FU6 A;  3VYH B;  1FX7 A;  2ZPE B;  4J83 A;  4J5Y A;  5LJ3 e;  3CCM A;  2LDM A;  3GLX A;  3X20 B;  4KUL A;  2E5Q A;  1EIF A;  2D6F A;  1KHC A;  3V7R A;  3OYG A;  3JCM g;  4LDV A;  4M75 A;  3RES A;  4NL3 A;  5GAO r;  1HK9 A;  1NE8 A;  1NJI U;  3HKS A;  2PU9 B;  3R6O A;  3CPW S;  3LLR A;  5CQY A;  4M75 B;  5IT9 E;  2GQV A;  2VXF A;  4N4H A;  4Z6Y A;  4FM4 B;  2A7Y A;  2LNV A;  4M7A B;  5HK3 A;  3OS1 A;  3CCJ T;  2P0K A;  1VQO A;  1BI1 A;  4WF2 A;  3CBO A;  4FL6 A;  3OYN A;  4BBS M;  3PGG A;  4XTV A;  1VQ7 A;  4PJO C;  2DK3 A;  4QW2 A;  4XU2 A;  5I2M A;  4QVD A;  5IN1 A;  1LOJ A;  4M75 G;  1M1G A;  5HKC A;  3SFM A;  4M75 D;  2XI9 A;  3P8H A;  2EWN A;  2ZZD A;  4XTW A;  3OYD A;  2ZCF B;  2ZPF B;  4FT4 A;  3OW2 S;  2P0Q A;  4J6W A;  3OY9 A;  3QYE A;  1YJN T;  2GFA A;  3J7A F;  5LJ3 d;  2LT4 A;  3GOX A;  2ZZD B;  3SDZ A;  1SSF A;  2QTX A;  3A8L B;  2E70 A;  4M75 F;  2F69 A;  4X9C A;  1QVP A;  4A4K A;  3LWH A;  3G71 T;  3NTK A;  1YHQ A;  1KD1 C;  3OMC A;  1Q82 U;  5I2S A;  3CCQ A;  3MEW A;  3CCE A;  2EJ9 A;  2QDY B;  1OYX A;  3M4G A;  4M77 F;  1KQ1 A;  4L5G A;  4ZTF A;  3RIR A;  4JDS A;  4EPC A;  1G3T A;  2X4W A;  2JOY A;  3FC3 A;  3HRT A;  3DLM A;  5GAN d;  1M1K U;  4KUI A;  4O5V A;  4BE1 A;  1BYM A;  2KSS A;  5LJ3 h;  5DY9 A;  5FRO A;  5GAO n;  5FU7 C;  2K3X A;  2WSE E;  4IUV A;  4RKU E;  4MDX A;  3DKM A;  5GMK l;  3QSU A;  2D9T A;  4OB3 B;  4OP0 A;  3BW1 A;  3M9Q A;  3QJ6 A;  4QQD A;  4C5I A;  3E1S A;  3I56 T;  1VQP A;  1VQ5 T;  1VQ8 A;  1WJR A;  3OS0 A;  2CYZ B;  3S6W A;  2GCX A;  1K8A U;  4J6Y A;  1OI1 A;  3HRS A;  3PIO A;  3CCV T;  1XQH A;  3S3M A;  1E7P A;  1YJ9 T;  4M7D E;  2KR6 A;  2VYT A;  2A3L A;  3OB9 A;  1VQ4 A;  2ZPG B;  2WSF E;  3BY7 A;  4C0G A;  4XTZ A;  2DXU A;  5GAN f;  3J80 E;  4IUR A;  2VC8 A;  4HT9 A;  3V7C A;  3MP6 A;  3TW7 A;  4HL4 A;  1LJO A;  1K73 U;  4LDU A;  2E64 A;  5D6Y A;  5A0L A;  2EQJ A;  4A53 A;  1KHI A;  1WQ7 A;  5J39 A;  1N27 A;  4C92 C;  2XK0 A;  1U8R A;  2XD0 A;  1IRE B;  4A54 A;  1W4S A;  3QXE B;  2M1H A;  3L2R A;  2LX9 A;  5LJ3 g;  3MEV A;  3CMA T;  2RJF A;  3RKY A;  2OTJ A;  1JB0 E;  2KQW A;  3LYI A;  3UPU A;  4R56 A;  5FRN A;  2PVO B;  2RA2 A;  2C06 A;  3CME A;  2XDD A;  2KMG A;  1VQ9 A;  1M4Z A;  4JRQ A;  2GF7 A;  3UDC A;  5M9O A;  1N9S A;  2ZPH B;  2LTO A;  4RMO A;  1VQK T;  3CPW A;  5D6W A;  2LQ8 A;  1KG1 A;  4MMK A;  1JBM A;  3WVE B;  2BS3 A;  1LNX A;  1YJW A;  3A8O B;  4IUP A;  4JRK A;  1XOV A;  2RK2 A;  4BE0 A;  1YI2 T;  2Y90 A;  1JRI A;  2DEQ A;  1WQW A;  2DKG A;  3LW5 E;  4MZT A;  2BUD A;  4RG8 A;  1V29 B;  3CCR A;  2DXB A;  1HXD A;  2ZGW A;  4Z02 A;  5CKE A;  5FLX E;  1TH7 A;  1DJ7 B;  2KAF A;  3O8V A;  3BG5 A;  4D6W A;  3M58 A;  3OYM A;  3FIF A;  2DXB B;  4J8O A;  3G6E A;  3QJY A;  3JB9 I;  1H64 1;  3OW2 A;  1N8R C;  4M7A E;  3VYG A;  3RER A;  4JLI A;  1Q7Y C;  5GMK j;  2K57 A;  2L3R A;  4EMG A;  5CR2 A;  2K5I A;  2P4T A;  2EJF A;  3L2Z A;  4C5G A;  2QQ9 A;  3OYF A;  1QLB A;  4MFE A;  4CRI A;  3CXC S;  2QEX T;  2VUB A;  1N6A A;  1IZ6 A;  5CKD A;  2MWO A;  5GAM g;  5LJ5 h;  2BS2 A;  3CBP A;  1U1S A;  1VQN A;  3LGF A;  2QFZ A;  2QQR A;  3ZBD A;  2CZ6 B;  3CCS A;  3OYK A;  2KDS A;  1VQM A;  4HA8 A;  5KCO A;  1I4K 1;  4RG2 A;  3ZEH A;  3FDR A;  4A4G A;  1K9M U;  4F7U F;  4C8Q A;  1M8V A;  4LOC A;  2BIV A;  4HCB A;  1WJS A;  2E41 A;  4GY5 A;  3OYJ A;  4V2S A;  1M1F A;  2YHT A;  4MZP A;  1YIJ A;  1VQ6 T;  2R5A A;  4ZN1 A;  3CC2 T;  2BS4 A;  5EJC A;  2RHU A;  4XTX A;  2DZ9 A;  4HNU A;  1BIB A;  3JCM c;  3HHT B;  1B34 A;  2RI5 A;  1ZHI A;  4N4I A;  2VV5 A;  2DTO A;  3FB9 A;  3OSV A;  4TVR A;  5J26 A;  4BI4 A;  4C8Q G;  3OA6 A;  2K2V A;  3HFN A;  2EYQ A;  1B34 B;  1U1T A;  3CEY A;  4LD9 K;  4M78 A;  2MI6 A;  5A0G A;  3OS2 A;  2XG8 D;  3C95 A;  3SWN A;  2CZ0 B;  3DB3 A;  3QHS A;  4M77 A;  3X26 B;  4M75 E;  5LJ5 g;  3CC4 A;  2HD0 A;  4A4H A;  4M78 B;  2P0P A;  5GAN e;  2JTF A;  5LL6 S;  3VU3 C;  3SWN B;  3BDL A;  4HT8 A;  3FRN A;  4M77 B;  2CZ1 B;  4BB7 A;  4C8Q F;  3I55 T;  3JCM V;  5CO7 A;  3M59 A;  3A8M B;  1KC8 U;  2D0Q B;  1UGQ B;  2KY9 A;  2RJE A;  3TCJ A;  4M78 G;  3HSB A;  3MCA B;  2LRQ A;  4M78 D;  1QVG S;  1FKM A;  4JX6 A;  4M77 G;  3DB4 A;  4C0Z A;  4ZTJ A;  3CCL A;  4M77 D;  2EJG A;  2VGM A;  2JTM A;  3ASK A;  4A4E A;  4C0F A;  2YRV A;  4M7D C;  1M5Q 1;  3JRZ A;  5L8R E;  3G71 A;  2EQU A;  2RHI A;  3BDU A;  3TEE A;  4E47 A;  3QDR B;  3KXT A;  1KQS S;  3SB2 A;  4M78 F;  3L2Q A;  4JS4 A;  3MP8 A;  3VV0 A;  4P5N A;  1Y7X A;  5A0D A;  3V8K A;  5GAM j;  3X24 B;  1VQO T;  1G5V A;  4HKE A;  1VQ7 T;  4QQ6 A;  2K5L A;  1Y96 A;  3NFC A;  5KCH A;  1Q81 U;  3G4S A;  3LH0 A;  2FVU A;  4C5E A;  4DQ2 A;  4EMK C;  5GAN 6;  1M90 C;  2RO0 A;  2DJZ A;  2JVV A;  5GAN 2;  3CXC A;  4KUD K;  1NPR A;  4PL6 A;  3FLG A;  3F70 A;  3L2V A;  3ZFJ A;  5GAO p;  3PMT A;  5CQX A;  3CCU A;  3PIP A;  3URG A;  1UGP B;  1YHQ T;  4BD3 A;  3RKX A;  2RHX A;  4ZN3 A;  4N0A C;  4MFD A;  5FU6 C;  4BY6 C;  5GAN h;  3CCQ T;  3CCE T;  4BI3 A;  5GAN 8;  3J81 E;  2MMP A;  4PJO A;  2RM4 A;  4C0D C;  1GXI E;  2WSC E;  1N9R A;  3A8G B;  2EIF A;  1Q86 C;  4PJO B;  3SD4 A;  4XU3 A;  4HLQ A;  4QSH A;  3L1A A;  3DLL A;  3KBG A;  4OGE A;  2R58 A;  1VQP T;  4HCZ A;  2FB7 A;  1VQ8 T;  4PJO G;  1RI0 A;  3EAE A;  4PJO D;  2DXT A;  2DIG A;  2G3R A;  3VUB A;  4M7A C;  3HFO A;  4BAC A;  2XKO C;  3GNG A;  3QG1 A;  5A2Q E;  5IAY A;  4JRI A;  1VQ4 T;  1OZ2 A;  2X4Y A;  2DD5 A;  3H4C A;  2DTI A;  3VKI A;  4PJO F;  4EDU A;  3ER0 A;  2EAY A;  1NJI C;  2DD5 B;  3TRE A;  1YIT A;  4AI6 A;  3JCM J;  3M4Y A;  5GAN g;  3JCM W;  1YBY A;  4EMK A;  5GAO q;  4NC6 A;  4ZGD B;  2G77 A;  3FEO A;  3HBL A;  4IUT A;  4DOW A;  2XDB A;  4C5H A;  2EKO A;  4DOV A;  2MF2 A;  2OTL A;  5GAN 7;  2DPP B;  3X25 B;  3JCM P;  3WXM B;  3MP1 A;  2F5K A;  4IUQ A;  1KQ2 A;  3AHU A;  3E9G A;  2E10 A;  1BIA A;  1OZ3 A;  2NLU A;  1QVG A;  2VXE A;  4PLI A;  3LWI A;  3H6Z A;  3DL1 A;  2OTJ T;  1ZBX A;  3OYY A;  1QVF S;  1PSF A;  1XTD A;  3QYB A;  4F7U A;  4MIM A;  2HBP A;  1KQS A;  3OSS C;  3CME T;  3V7S A;  2K3Y A;  1VQ9 T;  3GIB A;  3KUF A;  1WPY A;  1XNI A;  3VYG B;  1QP2 A;  2YLC A;  4NL2 A;  4F7U B;  5GAM f;  5GAN 4;  2LC4 A;  3UWN A;  1VQL A;  4LDX A;  3V8J A;  1KD1 U;  4DA4 A;  4C92 A;  1Q82 C;  3L42 A;  3C94 A;  3VJP A;  3X28 B;  5DLO A;  1O75 A;  3JCM Q;  3CC7 A;  1YJW T;  2V8I A;  4ELZ C;  2MWP A;  3BG9 A;  1S72 A;  1G3S A;  4C92 B;  5CKF A;  4F7U G;  4Y28 E;  1JJ2 S;  3CCR T;  2EQK A;  4M7A A;  1M1K C;  5J3B A;  4LD6 A;  1H3Z A;  4FT2 A;  3CD6 A;  4M75 C;  3S3O A;  4N4G A;  3PTA A;  4QQG A;  4XU1 A;  2V8K A;  4C92 G;  3G6E T;  4FIB A;  4RCC A;  3QPH A;  1VQ5 A;  4ELJ A;  1BI2 A;  2RD1 A;  3QUI A;  1Y71 A;  4C92 D;  2R5M A;  5DM7 R;  1R8O B;  4OF1 A;  1K8A C;  5GMK e;  3TU4 K;  4KBM B;  3L2U A;  2M0O A;  4JS5 A;  3L2W A;  3KHI A;  3HL8 A;  2L89 A;  4BBR M;  3FJP A;  5CKB A;  4C8Q B;  2QA4 T;  3JB9 J;  5LJ3 j;  1I8F A;  4C92 F;  3JCM f;  2DO3 A;  4GLK A;  4XAX B;  1VQN T;  2FHD A;  3V8L A;  2QQA A;  4XK8 E;  1G3Y A;  3OYH A;  1P92 A;  3INZ A;  2VGN A;  4E7I A;  1K73 C;  4M7A F;  4C8Q D;  4XTU A;  4AKH A;  3QWL A;  1D3B A;  2DVE A;  3CCS T;  2O01 E;  2O4X A;  2RHZ A;  4M78 C;  1VQM T;  3CCJ A;  2CKK A;  2JUF A;  1D3B B;  5GAO m;  2O4X B;  1PSE A;  4J7I A;  4M78 E;  2CS7 A;  2DTH A;  2M16 A;  2L8D A;  4ATO A;  4M77 E;  2DXC A;  2XIC A;  2QDJ A;  2JN0 A;  4LDW A;  4PLL A;  5HK0 A;  2B8A A;  1W2B S;  1YIJ T;  5FRM A;  2DXC B;  4OB0 B;  1YJN A;  3RKW A;  2QQB A;  2KMT A;  4E7L A;  3CCM T;  3HRU A;  2XU8 A;  5CCA A;  2RJD A;  4OB1 B;  4HCC A;  2PVG B;  4XQ3 A;  2EQM A;  3M5A A;  1UGS B;  5CK9 A;  5GAN 3;  4XU0 A;  3JB9 H;  3JCM b;  3QBY A;  2PVD B;  5GMK h;  3EFR A;  3CC4 T;  3GNF B;  5GAN 5;  4X34 A;  4HNT A;  2RH2 A;  3MET A;  2Y4Y A;  3PMI A;  4Q5W A;  1QW1 A;  4BI8 B;  1FWZ A;  2DD4 A;  4YTL A;  2F5T X;  3GP8 A;  3OYL A;  2LCC A;  4II1 A;  5DLQ E;  1VIF A;  4J6X A;  2XDP A;  3C12 A;  3RMS A;  3I56 A;  4ZGJ B;  2DD4 B;  2QI2 A;  2QQS A;  2X4X A;  3M57 A;  5KE3 A;  2I2L A;  1N8R U;  1Y96 B;  2IG0 A;  1Q7Y U;  1X01 A;  2JZ2 A;  2WJ9 A;  4O6J A;  5C6S A;  5GMK i;  3CCL T;  4BUG A;  3CCV A;  1YJ9 A;  5CIU A;  1NZ9 A;  1UEB A;  3M53 A;  4XTY A;  3LGL A;  4JX4 A;  4MZM A;  1ZQ1 A;  3OQ5 A;  2R57 A;  2XID A;  2CZ7 B;  1JJ2 A;  1MHN A;  4RCB A;  3M54 A;  3OYC A;  3CPF A;  3Q1J A;  3OYE A;  4L6V 5;  2WAC A;  4ZGE B;  2PUO B;  5GAM e;  2DIQ A;  5GAO l;  1WGS A;  3JB9 G;  2DAQ A;  4OVA A;  4OB2 B;  3JCM X;  4PJO E;  4IUU A;  3JB9 D;  3C4S A;  3OBY A;  1UB4 A;  2E1H A;  3HO8 A;  3G4S T;  1K9M C;  4B9W A;  2ZPB B;  5LJ3 f;  4M7D A;  3QYH B;  5LJ5 j;  1QP3 A;  3VUZ A;  4JX5 A;  3MHX A;  5CAI A;  3CMA A;  4IKF A;  1VUB A;  3PT9 A;  3M55 A;  2RHY A;  4E7H A;  2EFI A;  3JB9 F;  3HZJ A;  4M6V A;  2HQE A;  2XHC A;  4M7D B;  1UGR B;  3CCU T;  3BG3 A;  3QZ5 B;  4E7K A;  3NTI A;  3QKJ A;  2K5F A;  2LT1 A;  2M9U A;  5D6X A;  4OMF B;  1M9S A;  4E7J A;  4J7F A;  4M7D G;  3T9N A;  3MEA A;  1X6O A;  4AKG A;  4R55 A;  1VQK A;  3OYB A;  4M7D D;  3OYA A;  2L5Q A;  2E6N A;  4HNV A;  2RK1 A;  1I81 A;  2YLB A;  5GAM d;  1YI2 A;  1Y07 A;  3JCM e;  3OYI A;  4JJN K;  5FU7 B;  2RI3 A;  4LDY A;  3G7Z A;  2BKD N;  4B9X A;  3VKH A;  4M7D F;  4VUB A;  4EMK B;  5LJ5 e;  4MDW A;  3HP9 A;  1W2B A;  3VKG A;  1KC8 C;  3NTH A;  2E12 A;  2Y4X A;  4N0A A;  5KH6 A;  3S3N A;  2PQW A;  2OAU A;  4L59 A;  3A8H B;  3WVD B;  1YCY A;  5GAM h;  4KT0 E;  3LX7 A;  2IVW A;  3MEU A;  2QXF A;  5FU6 B;  4BY6 B;  2GFU A;  2HNI A;  4PNO A;  3GPL A;  3JAM E;  3N5B B;  5CKH A;  1MGQ A;  3QO3 A;  3TW6 A;  5AYF A;  4C8Q C;  5I21 A;  2QEX A;  4C0D B;  3JSC A;  2AHJ B;  3QYG B;  2KVQ G;  4F7U E;  5EG2 A;  4JUV A;  4A4F A;  2K4Y A;  4BDZ A;  2RI2 A;  3HPW A;  1YIT T;  3UT1 A;  4MML A;  3PFS A;  1I5L A;  1G3W A;  3QII A;  2PUK B;  3JCM d;  4C92 E;  3HB9 A;  2OTL T;  4UC4 A;  3P8B B;  1X75 C;  3QZ9 B;  1WJQ A;  3MO8 A;  3OS5 A;  1Q81 C;  5LJ5 d;  1QVF A;  2CGH A;  4NS5 A;  4QVZ A;  1VIE A;  1BI3 A;  2LVM A;  2H3J A;  1RL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...