4OB1B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via co-crystallization
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Hydrolase
total genus 73
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob1B02
3VYGB 4ZGDB 1IREB 3QZ9B 2ZPGB 3HHTB 1V29B 1PSFA 4FM4B 3WVDB 2CZ6B 4OB1B 2CZ1B 3QZ5B 2DXBA 4Y28E 2ZPIB 2ZPEB 2ZPFB 3VYGA 3A8HB 2ZZDB 4XK8E 3A8MB 2PVOB 3A8OB 3VYHB 3LW5E 2CZ7B 3X28B 4ZGJB 2DXCB 2WSFE 4KT0E 2WSEE 1GXIE 3X24B 1UGQB 2DD5B 4OB0B 1QP3A 4RKUE 4L6V5 2PUKB 2PU9B 2ZZDA 2CZ0B 3X25B 2PVGB 2WSCE 2D0QB 1PSEA 2ZPBB 2DXCA 1DJ7B 4OB2B 2DD5A 3QYHB 1UGPB 3A8GB 2AHJB 2PVDB 2ZPHB 2CYZB 2DD4B 3QXEB 2O01E 2PUOB 2QDYB 4ZGEB 1UGRB 2DPPB 1QP2A 4OB3B 3X20B 1JB0E 3X26B 3WVEB 1AHJB 3QYGB 2DD4A 2DXBB 5L8RE 1UGSB 3A8LB 2ZCFB
chains in the Genus database with same CATH superfamily
2KGTA 4M75C 4OF1A 3LWIA 2P0KA 4PKCC 4M7DC 5EG2A 2RJEA 1D3BA 4CFUD 3CCUQ 3VS5A 2QQ9A 2GTOA 3GPLA 1PD0A 5GANd 3KBGA 2PJQA 3ZEHA 4Y28E 4LUEA 1D0YA 2WJ9A 1LCKA 2HZYA 3QHSA 4F7NB 2RQTA 2AKLA 1D1AA 1VQLA 2V22B 2A08A 1YI2Q 3TSWA 2K3BA 2DL4A 3VYHB 3B57A 1UDLA 4C5IA 1B3QA 3NDQA 4YTLA 2HBPA 4II5B 3JCMV 2DBKA 1N9RA 5FGKB 4EIKA 4F14A 3PO3S 3BG9A 2BKZB 5LJ3d 1GFCA 4OVAA 2PU9B 4DA4A 1BBZA 2KAFA 1UGVA 2VGMA 2YDLA 2HQXA 2EJGA 5GMKh 1G8XA 1YJ9Q 2CCIB 3CCVQ 3OYCA 3CMAA 5EJCA 2LQNA 2QQBA 2LRQA 2Z0WA 3OYDA 1RAFB 3VS3A 1M1KU 2F2XA 3REBB 5GJWB 3HBLA 3DB4A 1ZX6A 2AHJB 3EG3A 4BE1A 1WHJA 3ULRB 3QXEB 4LD9K 1ZLMA 3CCMQ 4YOOA 2R5AA 4OGEA 2F2CA 2X1NB 3JB9J 2MOXA 1UJYA 5FWCA 5GMKe 5A0GA 2M0YA 1C6VX 3G71Q 1VA7A 1KXUA 3BLRB 1JB0E 3REAB 2RHYA 5I5ZB 3RESA 3TVTA 4C8QF 4EMKB 1Q86R 2RI3A 2QEXT 1UGSB 2EYQA 3PMIA 4PFZA 1N8RC 2EJ9A 3PMTA 2FRWA 3QHWB 3ZBDA 5CQYA 3RMQA 4IUUA 5CYIB 3QDFA 1ZHIA 4EMKC 2J05A 2OTJA 4EORB 4JRIA 4AI6A 4L5GA 1VQPA 4BCJB 4HVVA 3FRNA 3S3MA 3A1PA 4M77F 1RUWA 3UDCA 2MWPA 1Q82U 4BD3A 1UHFA 3V7RA 1I81A 4EOKB 4E7HA 3M55A 3TU4K 3I5SA 4RTXA 2ATCB 4RTZA 5M9OA 4MMKA 2EJFA 3OW2S 1IGUA 2HQHA 4OP0A 2DVJA 3KHIA 2X9HA 1E6GA 5FLXE 1VQKQ 2VASA 1QP3A 1BCMA 2HD0A 4BBRM 2BTTA 1FINB 2UZDB 3X25B 1I5OB 1SPKA 1WPYA 4M7AA 4J8OA 4QQ6A 5HVYB 1YI2T 2EBPA 2BUDA 1ZSZA 2P0QA 2X3XD 2HL3A 3CMAQ 3MJXA 2KXCA 3VS1A 1SKUB 4A4FA 4LOCA 4BXXX 2QA4T 3OYAA 1B07A 2V1QA 2X3WD 1WQWA 4XTWA 4PJOA 1S72T 4BY7X 1T3LA 3OBWA 1WNLA 4XTVA 3TNHB 3SEMA 4BCMB 2PVDB 3DDQB 1JJ2P 2JT4A 2DAQA 2BS4A 5GANg 1QVFP 3JCMW 1WIEA 1YJ9T 2COWA 3C94A 4D6WA 3OBYA 2IVXA 3I35A 4HNVA 5GAMe 1BU1A 1NBEB 1ZBJA 2RQUA 1YWPA 1K9MC 3EFSA 4ELJA 1Y96B 2D0NA 2XU8A 2JW4A 2LX7A 2DLPA 2QDJA 4KRDB 3NTHA 1BI3A 3SD4A 1TWBA 1M2OA 4RTTA 3QWYA 4OMPA 2SRCA 4MZMA 3THKA 2DJQA 1LVKA 5FU6B 1AZGB 2DYBA 2OTJQ 2AT1B 3MHXA 1UEBA 3NFCA 2XICA 5HBEB 1D0XA 3G71T 2B86A 5HBJB 1QVGP 1ENWA 2NUPB 1IGQA 1VQPQ 1QLBA 2PK9B 1KHCA 2YLCA 1OKWB 4IUTA 1QVGS 3OSVA 5GAOr 5IHNA 1LNXA 2DIQA 4LXCA 2CH4A 2NWMA 4M78B 1TU0B 2KBTA 3HRUA 3L2VA 2A0FB 2UUEB 2J6KA 3VKHA 4FSSA 2OAUA 4RMOA 1QCFA 4LE9A 1NEBA 4VUBA 2DMOA 3CCLQ 1IZ6A 2EPDA 3DB3A 2NUTB 1X6GA 2K7AA 3CC4A 5IH2A 2EKOA 3OYBA 2EUFA 2YUPA 1W4SA 2YRCA 4ZNXA 5GANj 2RK1A 3MY1B 2QQSA 1VYVA 3CPWS 3MEWA 1YJWA 2GGRA 3M58A 4LDUA 1VQLT 2RM4A 2CZ0B 2O2OA 4DBQA 1AWJA 3VJPA 5I21A 1K73U 4FT4A 1M1FA 2YHTA 1JSUB 4M75F 1PCXA 2V1RA 4QKUA 3LWHA 3N5BB 1BYMA 1VIEA 2COZA 2CP6A 4C92G 4R56A 4M7DF 5GAN3 1DJ7B 4B6MA 4HCZA 1OQKA 2QF7A 1Q7YR 4OB2B 3GIBA 2DD5A 4PJJA 3GOXA 2V26A 1UGPB 2MMPA 4PFPA 1M8VA 1MHNA 2C0TA 2CP3A 4HT8A 2GFAA 2LX9A 3BLHB 2A28A 4G6LB 1KD1R 2XIDA 1QP2A 2DFUA 3TW6A 2DERA 3LGLA 2VB6A 1RAIB 3EG0A 2JTEA 4PJOG 1N27A 1W98B 3FDRA 3FJPA 3L2UA 2B9RA 5HK3A 2DD4A 2EQUA 1ZSGA 1OKVB 1TXQA 1MMNA 2VXEA 3EGDB 4RCBA 3RIRA 4AFUC 5I2SA 1K8AR 1GY3B 3CC7A 2VYTA 4A54A 2EYYA 1G83A 3M5AA 3LLRA 5HCKA 1PHTA 3EJ1B 1OL2B 1XO2A 2K2VA 2CZ6B 4OB1B 2EFIA 2CZ1B 1RACB 3CMEA 1RAHB 2DXBA 2J7IA 1I07A 4K11A 1FWZA 5KYWA 4QW2A 3CCET 1URCB 1I8FA 1WJRA 4OMNA 3OB9A 2OTJT 3A8MB 4M7AE 4FSXA 4HCKA 3CC4Q 1D09B 3CC2A 1VQPT 2YRDA 3QPHA 3E1SA 1X6OA 2E64A 4F17A 1OZ3A 2CT3A 4ZGJB 2CSQA 3H8ZA 4F7SB 4Z6YA 2BS3A 1MMGA 4PJOE 3PIPA 1VYWB 4EOPB 2CREA 2PUKB 2M51A 3S3NA 2PVGB 1WHLA 4FW2A 4J6YA 1WGSA 2DRMA 2ABLA 3RBBB 1EX4A 1TUCA 3EOCB 5KYNA 2O9VA 2VVKA 3OMGA 2CP0A 2HL5C 4HKEA 4FU6A 3QYEA 1H26B 1C9BA 3RNJA 1GRIA 3OA6A 3VRZA 1SG5A 2R7GA 5LJ5d 2R57A 1NJIU 5KCHA 5CO7A 1CKAA 2KROA 2JMAA 1XTDA 2LP5A 1VQ6Q 1UE9A 3CXCP 2X35A 3CD6Q 2LT1A 2FYKA 3RGFB 2I40B 1VYUA 3CCJA 1OPLA 3JAME 3CXCS 4GY5A 4XTUA 2RHUA 1B34A 4MZPA 1ABOA 1G3NC 2QXFA 2WIHB 1SEMA 2L89A 4BI3A 3CCQA 1ABQA 3R6NA 1BIAA 2GF7A 3QSUA 2VKNA 3VYGB 4QVZA 3CC7Q 2QQRA 1G3YA 3V8KA 4E7KA 5IHYA 2KYMA 2YSQA 3QG1A 4EOMB 5CIUA 2E12A 5C6SA 1W70A 3AT1B 4JJBA 3CMEQ 3F5XB 3M0QA 2RQVA 2FO0A 1GBQA 4F7UA 4EOLB 2DBMA 2LNVA 5CK9A 3QWLA 2ZPFB 2M0OA 1MGQA 2DRKA 3GF5A 4CC2A 3O0GD 3CC2Q 2P0PA 1K0XA 2CSIA 1M2VB 1E6HA 2D6FA 2V8KA 2CZ7B 1NPRA 2Y90A 1I5LA 4BDYA 1GFDA 3EHQA 5CKFA 2DNUA 4ME7A 5IF1B 4RTVA 3H0HA 2X4WA 3FC3A 4J9BA 1OULA 3VS2A 4RTYA 4XU3A 2X51A 2K4YA 1PRMC 2M9UA 4X34A 1F5QB 4C8QA 5D6YA 3DDPB 1QLYA 4GLKA 4OMQA 3OYGA 2GQIA 4ELLA 1UNGD 4MDXA 2A7YA 2KQWA 4BI4A 3DTOA 2C5OB 2W2HA 1YJWT 1K4US 5GANh 5KCOA 1KSWA 2DXTA 1VQ5Q 2RK2A 1VQ8A 4RCCA 3QKJA 4C0FA 2OI3A 1GCPA 2JS0A 2DXUA 4M77A 5CVIA 2WEVB 1Q81C 1Y07A 3FLGA 4KGZB 2CP2A 4C5GA 1EZZB 1XJWB 3BG5A 4PFOA 3CCJQ 3J80E 4CFWB 1IHVA 3JB9I 2BE9B 3CCVA 3CCQQ 1WX6A 2RA2A 5GANe 1Q81R 3QUIA 4KUDK 5LJ3h 3BHVB 2MF2A 4XU0A 2O88A 4DBHA 1WXBA 5CKDA 1WXTA 2ECZA 3L42A 4ELZC 1TH7A 3I55T 2IVWA 3I9QA 1X75C 3VS6A 1VQNQ 3M9QA 5KE3A 1OEBA 3VS4A 3H0IA 3NPFA 1XQHA 2KRSA 2JS2A 3BLQB 3QZ5B 1M4ZA 2EAYA 4KULA 2JOYA 3G7ZA 2ZGWA 4M75B 4YOZA 5LJ3e 1IXDA 1BKBA 1MUZA 4M7DB 4AKHA 4BI8B 2L3SA 2E41A 2W9ZA 4JLIA 1TOVA 3OYMA 1OL1B 2I53A 4E2FB 2CUDA 4JRPA 4PLLA 4AG2C 1KC8C 3X28B 2CP7A 3CMET 4HCCA 2KY9A 2W96A 5L2WB 1WXUA 4F7UG 2WSFE 5LJ5g 1VINA 4Y72B 2W99A 5KYXB 3JB9G 3URGA 3MKDA 4Q5WA 2ZZDA 3KXTA 3HZJA 3M0RA 1SSHA 1KC8R 2MIOA 5IN1A 4M6VA 1GH6B 4CFUB 2LQWA 4BE0A 2FZCB 4EONB 2KK4A 1N5ZA 3EFOA 2DTIA 3CBMA 4QT7A 1IO6A 1Q86U 2A3LA 3G4SQ 1VQ8Q 2MCNA 1VQKA 2ZPHB 4C92D 2A37A 4OMLA 2V8JA 3OYFA 3BDUA 1YIJA 2BZ8A 2G6FX 2KI7A 2C5VB 2KRMA 2M1HA 4DOWA 2QK0A 1RLPC 4EPCA 2JGZB 1X6BA 2KSSA 2LZ6B 3JCMh 3VRYA 2WXVB 3LH5A 4OMOA 3JRZA 2P4TA 1KG1A 5LJ5j 4F7UE 3QO3A 4I3ZB 4PJOD 4C92C 4CXAB 4F04B 4ZGDB 3EGXA 1BK2A 3HHTB 1MMAA 4FYWB 3DOGB 1SSFA 1WHHA 1M3AA 2RN8A 3PTAA 4LDXA 2DL7A 3CCQT 3JB9F 1X2QA 1D0ZA 5GAN4 3OYLA 4WCIA 3OS2A 1OPKA 1G3SA 1YN8A 1M8MA 2EYXA 3HL8A 1VYTA 3JCMe 4TTHA 1M3BA 2ZPIB 1ZSZC 3GNGA 5EC7A 4F6SB 4HVUA 2JJ9A 3PIOA 1NE8A 4PJOC 3ER0A 1VQ4A 2AKKA 2KMGA 2E5QA 3QWXX 3F70A 4C8QE 4F6UB 1OIUB 4E7SA 3BG3A 4JJCA 1PWTA 2MAMA 1H1QB 2F69A 2BZXA 4KT0E 4CRIA 2UZBB 2JM9A 3R6OA 1N8RR 4OB0B 2FVUA 4C5EA 3D7SB 4L6V5 3MP6A 5CKHA 4CFMB 1UECA 3EFRA 2LW4A 4J6WA 5D6XA 1M1KC 1VQOQ 4M77E 3CCLA 1IB8A 4JUVA 4A4KA 3VKGA 2C0OA 1JXMA 3CCUT 2F5TX 1M27C 5GAN5 2CKKA 2O4XB 3M59A 2QAZA 4J9IA 1R0BG 3DLMA 1D1CA 1OX9A 2IW8B 1YIJQ 3EG1A 2AZSA 2K79A 4F16A 3OYNA 3PNWC 3JCMP 3EH2A 2OTLQ 2LJ3A 4EDUA 2GCXA 3OS5A 5GAMh 2PZ1A 3V8JA 2CH4W 1GCQC 1QCOA 1VQ8T 2JZ2A 2DX1A 1VOMA 2I2LA 2JM8A 4WF2A 1RABB 2C6TB 1WFWA 3BFMA 5GAMf 2K3YA 1Q82C 2VGNA 5KE2A 2VUBA 1VQMA 2BIVA 4JX6A 2XHCA 4AFZC 2XDBA 1JJ2S 1K0SA 3CCVT 2IW6B 1BB9A 2DETA 1QVFS 3OYKA 4HA8A 3C12A 5J3BA 4V2SA 4HNTA 1E7PA 4EMKA 1M90U 1AEYA 4CC7A 3MI9B 4CRLB 1Q82R 3FIFA 5FROA 4DBRA 4QQDA 1OGUB 4J9EA 3VUBA 1UTIA 2C5NB 4CC4B 2DTOA 3CCMT 2A36A 3OS1A 1NG2A 1VQ4Q 1N9SA 1KQSP 1WLPB 2BKDN 2E6NA 1E7OA 2DTHA 1K9MR 2YRVA 3HRTA 2XDDA 1KQSS 3CEYA 1Q7YU 5BNJB 3U23A 1PKDB 1CKBA 1GXIE 1FXXA 1ZUYA 4MMLA 2VXFA 4ELYC 5FWBA 5J39A 2IN3A 1QCNA 1UB4A 1AT1B 2H3EB 4MDWA 1KD1U 4XTZA 3OW2A 3M0TA 2CT4A 4AG1C 3T9NA 1Y7XA 1JSTB 3CCRA 5FW9A 1RADB 3SDZA 3SWNC 5EFQB 2Y4YA 4J9FA 2FPFA 5I11A 1JO8A 2JXBA 2RD1A 3QYHB 3A8GB 1Y71A 3JSCA 1K8AU 4KH1B 4ZGEB 3MCAB 4HT9A 2FRYA 3OYHA 2MI6A 3WXMB 4IUPA 2DF6A 4J6XA 5CAIA 3M4YA 5AT1B 2C06A 2Y4XA 3DKMA 3BW1A 5GAN2 4HXJA 5DM7R 1JKWA 3JCMb 1UFFA 4BCND 4JX4A 5IDNB 1VQKT 3FJ5A 3CCSA 1R0CB 1T0HA 1LPLA 1PC0A 4M7AG 1YIJT 1H1RB 1M3CA 4HVWA 1KJWA 1H28B 2L2PA 1Z9ZA 4E47A 1VQMQ 1VQ6A 1QQJA 4BCNB 2RJCA 3NMZC 4Z89A 3CMAT 2IG0A 5LQFB 3CD6A 1WDXA 4KH0B 1Y96A 2EYWA 3V7CA 3UT1A 1QKXA 2JN0A 4FT2A 1VQ7A 4PLIA 3M4GA 2K5FA 2RHXA 3FEOA 4LNPA 4BY1X 5GAOl 2PNIA 5IXBA 1Y57A 2PVOB 1OI1A 4E6RA 2ED0A 4ZN1A 2NUPA 4XQ3A 3MEAA 3HO8A 4DEYA 1QVGA 3ME9A 1K73C 3GTMS 3RKWA 1KQ1A 4QSHA 4RG2A 5HY6A 3TW7A 3DJBA 4DOVA 4M78A 3M0SA 2DZ9A 5GAN7 4BCFB 4JRQA 7AT1B 1IRXA 2QGSA 2JTFA 4EOIB 1ARKA 1VQ4T 1CSKA 2NUTA 2WSCE 4C92F 5LJ5e 1FMKA 3KFVA 4HL4A 2AK5A 3KUFA 1K73R 2VV5A 4AMCA 1WYXA 2KNBB 4ESRA 2K2MA 4BY6C 1P5EB 3V8LA 1N6AA 3CCRQ 2KR6A 2D1XA 2ROLA 3NGPA 2R5MA 3JB9D 2LDMA 2K6DA 4M7AF 3CPWA 3TNIB 1WQ7A 1H3ZA 3HB9A 3HSBA 1UNHD 1U06A 3P8DA 2RPNA 2QTVA 5I22A 4JZ3A 4UN0A 1BIBA 3E9GA 4AFSC 1MNEA 2DL3A 1SRLA 3CCLT 4PJOF 1BI0A 2K5IA 2H3JA 2GBQA 3MEVA 2RO0A 1G2BA 2BS2A 3EAEA 3UATA 4M4ZA 1H25B 3L2QA 4LDWA 1GUXB 4BACA 3M54A 1D3UB 3MEUA 3CCSQ 2LC4A 1O9KB 1VQ5A 3UPUA 4FX3B 4N0AC 4AFQC 2FL7A 2LVMA 5FU7B 5GMKj 2YLBA 1M30A 2RQWA 2DK3A 1V29B 1YNZA 3VV0A 2FHDA 3QBYA 5ECAA 5HQ0B 5FU7C 4E7ZA 4DBFA 1AWWA 1VQ7Q 1PD1A 1VQ9Q 2DJZA 1XOVA 5J26A 5DQVA 2KYBA 3EGDA 1X43A 5KYUB 2G9XB 1UNLD 3K7AM 1ZQ1A 3A8HB 2WMBB 3TEEA 1VQMT 1H4LD 1X01A 2RQRA 1YP5A 4PJNA 2KT8A 1W2BP 3NTIA 4BB7A 3DL1A 3QIIA 3I5RA 4MFDA 1W2BS 2DXCB 1YHQA 1VQNA 2HNIA 4II1A 2L8DA 4BE2A 2F2WA 3H6ZA 3X24B 1WA7A 3CPFA 3S3OA 1G5VA 4EMHA 2CDTA 2WACA 2DIGA 1FMWA 3G6EQ 4Z02A 5GAOm 3L1AA 1PSEA 2HBWA 4FW1A 9ATCB 1KK7A 2LJ0A 4Y91A 5KYYB 2DEUA 5KH6A 4M78G 4O5VA 2PK2A 1VIFA 1WI7A 1KFZA 4A4GA 2JVVA 1RI9A 2E3IA 1SHGA 1KQ2A 5CKBA 3UA6A 4PL6A 1G3TA 1C0MA 2NUZA 4AKGA 1NYFA 2PUOB 3L2WA 2O9SA 3BHUB 2JUFA 3CC4T 1UGRB 4IMYB 2B8AA 4Z8AA 3M0PA 4J9DA 2FG0A 4R55A 5GAOq 5GAN8 4J9CA 2LT4A 2RF0A 2O31A 2QI2A 1H1SB 1D3BB 2COYA 3HFNA 3GBQA 2RB6A 5FRMA 5IDPB 1AD6A 5ACBA 1M5Q1 3BE3A 5L8RE 3RKYA 3G4SA 1YITA 3PE0A 4EOSB 2YT6A 4MZTA 2KRNA 1IREB 1H92A 2FZGB 2ZPGB 4EC9B 2NYSA 4A4HA 3CXCA 5GANf 1QMZB 2L3RA 4D8KA 2XKOC 3OS0A 5IAYA 1YCYA 3CCST 2MK5A 4HLQA 3PGGA 4JLGA 4OGCA 3OQ5A 3UA7A 4M78E 1S72A 3QDRB 2CJMB 2E3HA 3VYGA 1VQ6T 4C0DB 1TG0A 2YXYA 3CD6T 3G1JA 4IIMA 3H4CA 4QQGA 1HK9A 2CS7A 2OAWA 1YHQQ 2K57A 3M03A 5LJ3f 4BCOB 2GQVA 3HPWA 4C0DC 1VQ7T 2QYZA 1XNIA 2HMAA 2FPDA 2LMJA 1H3HA 4RKUE 1QWEA 2ROTA 2QEXQ 2XMFA 4LDYA 4J5YA 3CC7T 1M2VA 2D0QB 4EC8B 1OX8A 1WHGA 2J6OA 2ZPBB 2QQAA 3EG2A 2ESWA 3TQ7P 1KHIA 3OYEA 2W0ZA 3J7AF 1X69A 2LCLA 3OYJA 1RAAB 3GP8A 1UHCA 2QGFB 4PJLA 1OZ2A 1O75A 2EGCA 2BZYA 2KR3A 1TD6A 4IKFA 3H9NA 4NOYA 2FZKB 1V1CA 2RMOA 1MMDA 4BCKB 5GJVB 2LJ1A 3CC2T 2C0IA 3HFOA 4JRKA 4OB3B 1VQOA 1LJOA 2C4GB 2SEMA 2DZCA 3META 1IHWA 3OMCA 2QGGA 5GMKi 2L3QA 1YCSB 1ACMB 1I0CA 5A0DA 4NL2A 5DLQE 2E70A 2E5KA 1YJNA 1YITQ 1C1AA 2G3RA 3O5ZA 4A53A 4KGXB 4C8QG 4FYXB 1LOJA 2HKNA 3S6WA 4RTUA 1WJSA 2ED1A 1PSFA 4FCYA 3PVQA 4ROCA 4CFNB 1I4K1 5IHKA 3J81E 4KRCB 4M7AD 1SHFA 1AOJA 4FYVB 2D8HA 2QA4Q 2L5QA 2OTLA 1N8RU 1Q95G 4C92B 1VQ5T 3TREA 1S72Q 4J9HA 5HK0A 4IUQA 1FYNA 1R8OB 1S1NA 4M77G 4QVCA 3JCMX 3QJ6A 3RUXA 4O6JA 4CFXB 3EG9B 2E4HA 1MV0B 4M7AB 3SB2A 2LCCA 2RHZA 3MIAB 5CEIB 3CCJT 4F7UF 3JCMf 1E9HB 2W9FA 2V8IA 1ZSZB 4NSTB 1ZA2B 4RTWA 3HP9A 4A4EA 4M7AC 2LQKA 4JDSA 1V76A 2JMCA 4M75A 2EQIA 1BI2A 4PJOB 1FVVB 1UGQB 4M7DA 4OGRB 1SF9A 2KMTA 3HTRA 1HJDA 1B7TA 2KDSA 2E65A 1M1GA 2EGEA 1OU8A 1Q86C 1BCOA 4F7JB 2X4JA 2FPEA 4DQ2A 1YHQT 1VQNT 1WHMA 1ZUUA 4F6WB 2HQEA 1EIFA 5KYXA 2J06A 1QVPA 2YUQA 3HRSA 3NHNA 4E7IA 3E2UA 5DY9A 2NLUA 2XD0A 1JXOA 2LNHB 2H8HA 4TVRA 4PJMA 3A5ZB 3BY7A 4LN2A 3CCEA 4L59A 5D6WA 1YWOA 3CBOA 2EVRA 4X1VA 4WTOB 5ICPB 2OJ2A 3TN8B 2P4RA 4X9DA 4OMFB 4CI0C 1W1FA 3CBPA 1U1SA 3C4SA 4JS5A 1YJNQ 1AVZC 1A0NB 1UG1A 2EKHA 4C0GA 3AHUA 4XAXB 1M1KR 2JNGA 1VQLQ 2W10A 1PRLC 3OW2P 1K9MU 2LTOA 2RHIA 2XK0A 1U1TA 2QG9B 2WPAB 4C5HA 2RI2A 4FM4B 5D7UA 1H27B 1T0JA 4C92A 1OIYB 2GNCA 4EMGA 1YFNA 1NEGA 2CCHB 3P8HA 5CR2A 3HKSA 1BU2A 3JCMd 1PKTA 4JPBW 3G4ST 1YITT 3EG9A 4XU2A 2WMAB 2DM1A 4GBQA 5LL6S 2DO3A 4R0KA 1TFBA 4BCMD 4D8DA 5I2MA 3M57A 3VU3C 1TS9A 4BCIB 1OOTA 2EYZA 2JTMA 4J9GA 2PTKA 1QMCA 4P5NA 2XDPA 4ATOA 4KUIA 2DILA 1AZEA 2E1HA 3OY9A 4BCPB 1JQQA 2HCKA 2DD5B 4N4GA 2DMEA 1JU5C 3O8VA 1U8RA 1NLOC 2RJDA 1JOWA 2L0AA 2DE0X 5GAN6 5L23A 2DYIA 4KBMB 4RG8A 2K3XA 4M75G 2I0NA 4UC4A 3L2ZA 4A63B 4M7DG 1TUGB 3QJYA 4IURA 2DD4B 3SFMA 3CCEQ 1HYOA 3RDVA 2O01E 2QDYB 1WZOA 2M16A 3A98A 4M78D 4BBSM 3SWNB 3LGFA 5LJ3g 5GMKl 1MNDA 4F7LB 1PM3A 2HSPA 4ROEA 2O4XA 4B9XA 2ZAEA 3X20B 5FU6C 3VUZA 2LQ8A 1KIKA 1MV3A 4KGVB 3DLLA 1FKMA 3ZFJA 2DXBB 1HD3A 1RAGB 3PFSA 5KYWB 2DL8A 1GCQA 4B9WA 3UWNA 3RERA 2F5KA 3C0CA 4LD6A 1VQOT 4OR5B 1T3SA 4M78C 1M90C 5IT9E 3EHRA 4EOQB 1YBYA 2UZLB 3CPWP 3RMSA 1QW1A 5IXFA 3TNWB 5GAMd 5IHIA 1YJNT 5GAOn 2KXDA 4M75E 3TCJA 1NZ9A 2KT1A 1M90R 3BDLA 1Q7YC 1NPPA 1EFNA 4M7DE 1H8KA 5C0MA 1ZBXA 2KE9A 4MFEA 3I56A 2YUOA 1JJ2A 1ZA1B 3LYIA 2OTLT 1QVFA 4FYYB 4YOSA 1KD1C 2EW3A 1BI1A 4FIBA 3H41A 2OX7A 5LJ3j 3CQTA 5LMKB 2YUNA 1VQ9A 3PT9A 2D8JA 5LJ5h 3E9FA 1Y0MA 1OU9A 3H0FA 3LQ5B 3MP1A 5DQWA 1I1JA 1KQSA 1D1BA 1PKSA 3I55A 1K8AC 2HAXA 2DL5A 3MO8A 4HCBA 2K5LA 3MPUB 1K76A 1B34B 5LJ5f 3TSZA 2EQKA 3GNFB 4E7LA 2RJFA 4BCHB 1QKWA 1X2KA 1X27A 2FEIA 2RH2A 2F1LA 2BE7D 1JRIA 3SWNA 4BY6B 1HSQA 6AT1B 4ZTJA 2IW9B 2ENMA 1AD5A 2GTJA 1ZP2A 4GLMA 3JCMg 3G6EA 4OMMA 5CKEA 2R58A 4LDVA 1OYXA 5A2QE 3SHWA 4C0ZA 3L2RA 4C92E 2HKQB 4LUDA 4Z88A 2HEQA 1NYGA 1PG5B 1K1ZA 3MP8A 4JZ4A 3OYIA 4IUVA 1RI0A 3JCMc 2KVQG 4J7IA 4AT1B 4N4IA 2KEAA 5CQXA 1ZUKA 4F7UB 1TTHB 1AWXA 3A8LB 2ZCFB 4ZN3A 2WFYB 2EWNA 4Y92A 3LX7A 4AKIA 3JCMQ 2CGHA 4RODA 4XTXA 5GMKm 2J6FA 4JS4A 2MYSA 2VC8A 1YJWQ 4C8QD 4ZTFA 4JJNK 2X4YA 2ZPEB 1WHKA 4ANJA 1HXDA 3QYBA 4NS5A 3I56Q 3EH1A 1U5SA 2DVEA 4XK8E 2EGAA 4N4HA 3A8OB 2QQ8A 2HSEB 4JJDA 3VKIA 2DA9A 4C8QB 4BCQD 1SRMA 3ASKA 1H24B 3ZL7C 4M77D 3BHTB 3M0UA 1AWOA 2P84A 3IQLA 4C8QC 4CFVB 1RL2A 2XG8D 1VOLA 3LH0A 4BCQB 5CCAA 3OYYA 2UZEB 3EIDB 1FMVA 2DKGA 1O9SA 8ATCB 1F1BB 4M77B 3I55Q 2WIPB 3VS0A 2PHGA 4BCGB 2DEQA 3NTKA 1J3TA 4IIOA 5A0LA 4M77C 4ORZA 2BPMB 1NLPC 4F70B 1JEGA 1QWFA 3RR6A 5GAMg 1WJQA 1OI9B 1RAEB 2AIRB 2QEXA 3GLXA 3PVLA 5FRNA 8AT1B 2E6ZA 5DLOA 2RNAA 2GFUA 1NM7A 2IIMA 1R77A 1NJIC 1GBRA 2QFZA 1UJ0A 1Q81U 2MPXC 3WVEB 1AHJB 4EOOB 3INZA 3JCMJ 1TUDA 2K9GA 3QYGB 1FX7A 3OSSC 5GAOp 2QDLA 1AISB 2C5XB 4NC6A 1K9AA 1H1PB 2IPOB 3QZ9B 2WHBB 3RKXA 1NJIR 3V7SA 5HKCA 2F2VA 3CCRT 4DEXA 4YC3B 2AZVA 2PMIB 1GUXA 2XI9A 4N0AA 4PK4A 2QASA 2L3PA 3WVDB 4QVDA 4CC3A 1PNJA 1O9KA 1M9SA 3VS7A 3CCUA 2CUBA 1RLQC 3Q1JA 4FL6A 3UF4A 4BDZA 2D9TA 1GL5A 2EQJA 2YWWA 2CP5A 3JV3A 4J83A 2ZZDB 1H641 4J7FA 1YI2A 3LW5E 5GAMj 1U3OA 3POMA 1UUEA 4E7JA 3EFOB 2WSEE 4X9CA 2QA4A 5KYUA 5AYFA 4BUGA 1OV3A 4PNOA 3M56A 3MY5B 3I56T 1KC8U 3C95A 4KRTA 3G33B 2EIFA 4M78F 3P8BB 3E19A 4JX5A 1P92A 3QHRB 2DXCA 1W2BA 4HNUA 1YJ9A 2MWOA 1Z9QA 1JBMA 2X4XA 1N4MA 3M53A 2QTXA 2E10A 1VQ9T 1VUBA 5HBHB 2CYZB 3EGUA 3JB9H 4M75D 1TSFA 2VWFA 2HDAA 4XU1A 2DPPB 4MIMA 5KYYA 3CCMA 3FB9A 4M7DD 3EGXB 5HNBB 3G71A 2EQMA 2M02A 2PQWA 4XTYA 3X26B 4RUGA 2FB7A 4NL3A 2LCSA 4EOJB 2RI5A 1W6XA 2G77A 1G3WA 3G6ET
chains in the Genus database with same CATH topology
3VYGB 4QVZA 4M75C 2QQRA 1G3YA 4OF1A 3V8KA 4E47A 4E7KA 3LWIA 2LTOA 2P0KA 2RHIA 1U1TA 2XK0A 4PKCC 1VQ6A 4C5HA 2RI2A 2RJCA 4FM4B 3CMAT 4M7DC 2IG0A 3QG1A 5EG2A 3CD6A 5CIUA 4C92A 2RJEA 4EMGA 1D3BA 2E12A 1Y96A 3P8HA 5C6SA 3V7CA 5CR2A 3UT1A 3HKSA 2QQ9A 3JCMd 3GPLA 2JN0A 4FT2A 5GANd 3KBGA 3ZEHA 4F7UA 4Y28E 3G4ST 1YITT 1VQ7A 4PLIA 2LNVA 5CK9A 2WJ9A 3M4GA 3QWLA 2K5FA 3QHSA 2ZPFB 2RHXA 3FEOA 4XU2A 2M0OA 5GAOl 1MGQA 5LL6S 2DO3A 1VQLA 2PVOB 3GF5A 1OI1A 5I2MA 3M57A 2P0PA 3VU3C 4ZN1A 4XQ3A 3VYHB 2D6FA 4C5IA 2V8KA 2CZ7B 3MEAA 3HO8A 1QVGA 1NPRA 2JTMA 2Y90A 3ME9A 4YTLA 2HBPA 4BDYA 1K73C 1I5LA 4P5NA 3RKWA 2XDPA 1KQ1A 4QSHA 4KUIA 4ME7A 3TW7A 4RG2A 5CKFA 5HY6A 3JCMV 4ATOA 4DOVA 4M78A 2DZ9A 2X4WA 2E1HA 3OY9A 3FC3A 5GAN7 1N9RA 4JRQA 2DD5B 3BG9A 4N4GA 4XU3A 5LJ3d 2JTFA 4OVAA 2K4YA 2PU9B 4DA4A 3O8VA 1VQ4T 2KAFA 2VGMA 2M9UA 2WSCE 4C92F 5LJ5e 2HQXA 4X34A 3KUFA 4HL4A 1U8RA 2VV5A 2EJGA 2RJDA 4C8QA 5D6YA 4GLKA 3OYGA 5GMKh 5GAN6 4BY6C 4KBMB 1N6AA 4RG8A 3V8LA 2A7YA 2KR6A 2K3XA 2KQWA 4M75G 2R5MA 4BI4A 3JB9D 2LDMA 4UC4A 3OYCA 3CMAA 5EJCA 4M7AF 3CPWA 2QQBA 1WQ7A 3L2ZA 1YJWT 3HB9A 2LRQA 4M7DG 5GANh 1H3ZA 5KCOA 3QJYA 4IURA 2DXTA 3HSBA 3OYDA 3P8DA 1M1KU 3HBLA 2RK2A 3DB4A 2AHJB 1BIBA 4BE1A 1VQ8A 4RCCA 3E9GA 2DD4B 3QKJA 3SFMA 4C0FA 3QXEB 2O01E 4LD9K 2QDYB 2DXUA 2M16A 4M77A 4M78D 5CVIA 3CCLT 4BBSM 1Y07A 3SWNB 1Q81C 4PJOF 1BI0A 2K5IA 3FLGA 2H3JA 2R5AA 4OGEA 3LGFA 2RO0A 3MEVA 4C5GA 2BS2A 5LJ3g 3JB9J 3BG5A 5GMKe 5GMKl 3J80E 5A0GA 3EAEA 2O4XA 4B9XA 4LDWA 3L2QA 4BACA 3X20B 3JB9I 5FU6C 3VUZA 1Q82C 3M54A 3CCVA 2LQ8A 1JB0E 3MEUA 2RHYA 2RA2A 5GANe 3RESA 2LC4A 3DLLA 3QUIA 4KUDK 5LJ3h 4C8QF 1FKMA 2MF2A 4XU0A 2DXBB 3ZFJA 4EMKB 1VQ5A 3UPUA 2RI3A 2QEXT 4N0AC 1UGSB 3PFSA 2EYQA 5CKDA 3PMIA 4B9WA 2EJ9A 1N8RC 3PMTA 3UWNA 3RERA 3ZBDA 2F5KA 2FL7A 4LD6A 2LVMA 5CQYA 5FU7B 3L42A 5GMKj 1VQOT 3RMQA 2YLBA 4ELZC 4M78C 1TH7A 4IUUA 3I55T 5IT9E 1M90C 1ZHIA 2DK3A 4EMKC 1V29B 2OTJA 1YBYA 2IVWA 1X75C 4JRIA 3VV0A 2FHDA 3M9QA 3RMSA 5KE3A 1QW1A 3QBYA 4AI6A 4L5GA 5GAMd 1VQPA 3CCET 5FU7C 1XQHA 3FRNA 3S3MA 3QZ5B 1M4ZA 2EAYA 4KULA 1YJNT 2JOYA 4M77F 3UDCA 3G7ZA 5GAOn 2MWPA 2ZGWA 4M75B 4M75E 1Q82U 2DJZA 1XOVA 5J26A 3TCJA 4BD3A 1NZ9A 5LJ3e 3BDLA 3V7RA 1Q7YC 1NPPA 1BKBA 4M7DB 1ZQ1A 4M7DE 3A8HB 5C0MA 1ZBXA 4AKHA 3TEEA 4BI8B 4MFEA 1VQMT 2E41A 1I81A 1X01A 4JLIA 3I56A 4E7HA 3M55A 3TU4K 3OYMA 1JJ2A 3NTIA 3LYIA 3DL1A 3QIIA 4BB7A 5M9OA 4MMKA 2OTLT 1QVFA 4JRPA 4PLLA 1KC8C 2EJFA 3X28B 3OW2S 4HCCA 3CMET 1KD1C 4MFDA 2KY9A 1W2BS 2DXCB 1YHQA 5LJ5g 4F7UG 2HNIA 2WSFE 1BI1A 4FIBA 4II1A 2L8DA 1VQNA 4OP0A 4BE2A 5LJ3j 3KHIA 3H6ZA 3X24B 5FLXE 3CPFA 1QP3A 3S3OA 3JB9G 1G5VA 3URGA 4Q5WA 2HD0A 4EMHA 4BBRM 1VQ9A 2WACA 3X25B 2ZZDA 1WPYA 3KXTA 4M7AA 3HZJA 2DIGA 3PT9A 5LJ5h 4J8OA 4QQ6A 1K9MU 3E9FA 4Z02A 5IN1A 5GAOm 1YI2T 4M6VA 3L1AA 1PSEA 2BUDA 3MP1A 4BE0A 1KQSA 2P0QA 4Y91A 3I55A 5KH6A 1K8AC 2KK4A 2HAXA 4M78G 4A4FA 2QA4T 4LOCA 4O5VA 3MO8A 3OYAA 2K5LA 4HCBA 4PJOA 1VIFA 2DTIA 1WQWA 4XTWA 3CBMA 1S72T 4A4GA 1B34B 2JVVA 5LJ5f 1Q86U 3OBWA 2A3LA 1WNLA 2EQKA 3GNFB 4XTVA 4E7LA 2RJFA 2RH2A 1KQ2A 2PVDB 5CKBA 3SWNA 1JRIA 2ZPHB 4PL6A 4BY6B 4C92D 1G3TA 1VQKA 2V8JA 4ZTJA 3OYFA 4AKGA 2PUOB 3BDUA 3L2WA 1YIJA 2DAQA 2JUFA 3CC4T 1UGRB 2BS4A 3JCMg 2B8AA 5GANg 3G6EA 3JCMW 4R55A 1YJ9T 5GAOq 3C94A 5CKEA 2M1HA 4D6WA 3OBYA 5GAN8 2LT4A 2R58A 4DOWA 4LDVA 4HNVA 1OYXA 4EPCA 2KSSA 5GAMe 5A2QE 4C0ZA 2QI2A 3L2RA 4C92E 1K9MC 1D3BB 3JCMh 3MP8A 3EFSA 4ELJA 1Y96B 2XU8A 3HFNA 2RB6A 3OYIA 4IUVA 1RI0A 3JCMc 2KVQG 5FRMA 4J7IA 4N4IA 3JRZA 2QDJA 5CQXA 2P4TA 1BI3A 1M5Q1 3NTHA 3SD4A 4F7UB 4F7UE 5LJ5j 5L8RE 1KG1A 3RKYA 3QO3A 3G4SA 1YITA 3A8LB 2ZCFB 4MZTA 4C92C 4ZN3A 4PJOD 4MZMA 4ZGDB 1IREB 5FU6B 2ZPGB 3HHTB 2EWNA 1SSFA 3MHXA 1UEBA 3NFCA 2XICA 4A4HA 3G71T 3LX7A 4AKIA 3JCMQ 2CGHA 3CXCA 5GANf 2L3RA 4XTXA 3PTAA 1QLBA 4LDXA 2XKOC 5GMKm 3OS0A 3CCQT 4JS4A 1KHCA 2YLCA 5IAYA 4IUTA 3JB9F 1YCYA 3CCST 1QVGS 3OSVA 5GAN4 3OYLA 3OS2A 5GAOr 4HLQA 2VC8A 1G3SA 1LNXA 4C8QD 3PGGA 4JLGA 2DIQA 3HL8A 4OGCA 3JCMe 2ZPIB 3OQ5A 4M78B 4ZTFA 4M78E 1S72A 3QDRB 4JJNK 2X4YA 2ZPEB 3HRUA 3L2VA 3GNGA 3VYGA 3VKHA 1HXDA 2OAUA 4RMOA 3QYBA 4NS5A 1VQ6T 3PIOA 4VUBA 2DVEA 4XK8E 1NE8A 4PJOC 1IZ6A 4C0DB 3DB3A 4N4HA 3ER0A 1VQ4A 3CD6T 3A8OB 2QQ8A 2E5QA 2KMGA 3H4CA 4QQGA 3VKIA 3CC4A 1HK9A 3F70A 4C8QB 4C8QE 2EKOA 3OYBA 2CS7A 3ASKA 1W4SA 3BG3A 2K57A 2MAMA 5LJ3f 2F69A 4M77D 2GQVA 5GANj 2RK1A 3HPWA 4C0DC 1VQ7T 4KT0E 4CRIA 2QQSA 3CPWS 1XNIA 3R6OA 4C8QC 3MEWA 1YJWA 4OB0B 2FVUA 1RL2A 4C5EA 2XG8D 3M58A 4RKUE 4L6V5 4LDUA 3LH0A 1VQLT 2RM4A 2CZ0B 3MP6A 5CKHA 3VJPA 4LDYA 5CCAA 4J5YA 3OYYA 4FT4A 3EFRA 5I21A 1M1FA 1K73U 3CC7T 2D0QB 4J6WA 5D6XA 2YHTA 4M75F 2ZPBB 2DKGA 1M1KC 1O9SA 2QQAA 4M77B 3LWHA 3N5BB 4M77E 1BYMA 3CCLA 1VIEA 4R56A 4JUVA 4C92G 4A4KA 4M7DF 1KHIA 3VKGA 5GAN3 1DJ7B 3OYEA 3CCUT 2F5TX 4HCZA 5GAN5 2CKKA 2DEQA 3NTKA 2O4XB 3J7AF 2QF7A 2LCLA 3M59A 4OB2B 3OYJA 5A0LA 2DD5A 3GIBA 4M77C 3GP8A 3DLMA 3GOXA 1OZ2A 1O75A 4IKFA 1UGPB 2MMPA 1M8VA 4NOYA 1MHNA 4HT8A 2GFAA 5GAMg 1WJQA 2LX9A 2QEXA 3GLXA 3CC2T 3HFOA 2XIDA 3OYNA 1QP2A 3PNWC 3TW6A 5FRNA 2E6ZA 3LGLA 5DLOA 4JRKA 3JCMP 4OB3B 1VQOA 1LJOA 4PJOG 2GFUA 4EDUA 1N27A 2DZCA 2GCXA 3META 3OS5A 5GAMh 3OMCA 3V8JA 5GMKi 1NJIC 2QFZA 3FDRA 3FJPA 1Q81U 5A0DA 4NL2A 5DLQE 3L2UA 1VQ8T 3WVEB 1AHJB 3INZA 3JCMJ 2E70A 2JZ2A 3QYGB 5HK3A 2DD4A 1FX7A 3OSSC 2EQUA 5GAOp 1YJNA 2I2LA 2G3RA 2VXEA 4A53A 4RCBA 4NC6A 4WF2A 4C8QG 3RIRA 5I2SA 1LOJA 3QZ9B 3BFMA 3S6WA 5GAMf 2K3YA 3CC7A 2VGNA 2VYTA 3RKXA 4A54A 5KE2A 2VUBA 3V7SA 5HKCA 1WJSA 3M5AA 2BIVA 3LLRA 4JX6A 1PSFA 2XHCA 3CCRT 1VQMA 1JJ2S 2XI9A 4N0AA 2XDBA 3CCVT 1I4K1 3WVDB 3J81E 4QVDA 2K2VA 4M7AD 2CZ6B 4OB1B 1QVFS 3OYKA 4HA8A 2L5QA 2EFIA 3C12A 1M9SA 2CZ1B 1N8RU 3CCUA 2OTLA 5J3BA 4C92B 3CMEA 4HNTA 1VQ5T 1E7PA 2DXBA 4EMKA 4V2SA 3TREA 3Q1JA 1M90U 4FL6A 1FWZA 5HK0A 3FIFA 4QW2A 5FROA 4QQDA 2D9TA 4IUQA 4BDZA 1R8OB 3VUBA 4M77G 4QVCA 2EQJA 3JCMX 3QJ6A 3RUXA 2DTOA 4O6JA 3CCMT 1I8FA 1WJRA 4J83A 3OB9A 3OS1A 2OTJT 2ZZDB 1H641 3A8MB 1N9SA 4M7AB 4FSXA 3SB2A 2LCCA 4M7AE 2BKDN 2RHZA 4J7FA 2E6NA 3CCJT 4F7UF 3CC2A 1YI2A 2DTHA 3LW5E 1VQPT 3QPHA 5GAMj 2YRVA 3HRTA 3JCMf 2E64A 1X6OA 2V8IA 3E1SA 1OZ3A 3CEYA 2XDDA 1Q7YU 1KQSS 3HP9A 4E7JA 4ZGJB 4A4EA 3H8ZA 2LQKA 4JDSA 4M7AC 4M75A 2WSEE 1BI2A 4X9CA 2QA4A 1GXIE 1FXXA 4Z6YA 2BS3A 1UGQB 5AYFA 4BUGA 4M7DA 4PJOB 4PJOE 4PNOA 4MMLA 2KMTA 2VXFA 3M56A 4ELYC 3PIPA 2PUKB 3S3NA 2KDSA 3I56T 2E65A 1M1GA 2PVGB 3C95A 1UB4A 4MDWA 5J39A 1KC8U 1KD1U 4XTZA 4J6YA 1WGSA 2EIFA 1Q86C 4MDXA 4M78F 3P8BB 2X4JA 3E19A 3OW2A 4DQ2A 1YHQT 4JX5A 1VQNT 1P92A 2DXCA 3OMGA 3T9NA 1Y7XA 1W2BA 3CCRA 4HNUA 2HQEA 1EIFA 1YJ9A 2MWOA 3SDZA 3SWNC 4HKEA 1JBMA 2X4XA 1QVPA 2Y4YA 3HRSA 3QYEA 4FU6A 4E7IA 3M53A 2QTXA 2E10A 1VQ9T 5DY9A 1VUBA 2RD1A 2NLUA 2XD0A 3QYHB 3A8GB 1Y71A 4TVRA 3JSCA 3OA6A 2CYZB 1K8AU 3A5ZB 3BY7A 5LJ5d 3CCEA 2R57A 4M75D 1NJIU 3JB9H 4ZGEB 3MCAB 4L59A 4XU1A 5CO7A 5D6WA 5KCHA 3OYHA 2MI6A 1XTDA 4HT9A 3WXMB 2DPPB 4MIMA 3CBOA 3CCMA 3FB9A 2X35A 4IUPA 4J6XA 5CAIA 4M7DD 3M4YA 2LT1A 2C06A 2FYKA 2Y4XA 3DKMA 3CCJA 3BW1A 3JAME 4X9DA 4OMFB 3CXCS 4GY5A 4XTUA 4CI0C 3G71A 2RHUA 5GAN2 1B34A 4MZPA 3JCMb 5DM7R 2EQMA 2QXFA 4JX4A 3CBPA 2L89A 1U1SA 2PQWA 3X26B 4XTYA 4BI3A 3C4SA 3CCQA 3CCSA 4JS5A 1VQKT 2FB7A 4NL3A 4M7AG 4C0GA 1YIJT 3AHUA 2RI5A 4XAXB 2G77A 1G3WA 2JNGA 3G6ET 1BIAA 2GF7A 3QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYG B;  4ZGD B;  1IRE B;  3QZ9 B;  2ZPG B;  3HHT B;  1V29 B;  1PSF A;  4FM4 B;  3WVD B;  2CZ6 B;  4OB1 B;  2CZ1 B;  3QZ5 B;  2DXB A;  4Y28 E;  2ZPI B;  2ZPE B;  2ZPF B;  3VYG A;  3A8H B;  2ZZD B;  4XK8 E;  3A8M B;  2PVO B;  3A8O B;  3VYH B;  3LW5 E;  2CZ7 B;  3X28 B;  4ZGJ B;  2DXC B;  2WSF E;  4KT0 E;  2WSE E;  1GXI E;  3X24 B;  1UGQ B;  2DD5 B;  4OB0 B;  1QP3 A;  4RKU E;  4L6V 5;  2PUK B;  2PU9 B;  2ZZD A;  2CZ0 B;  3X25 B;  2PVG B;  2WSC E;  2D0Q B;  1PSE A;  2ZPB B;  2DXC A;  1DJ7 B;  4OB2 B;  2DD5 A;  3QYH B;  1UGP B;  3A8G B;  2AHJ B;  2PVD B;  2ZPH B;  2CYZ B;  2DD4 B;  3QXE B;  2O01 E;  2PUO B;  2QDY B;  4ZGE B;  1UGR B;  2DPP B;  1QP2 A;  4OB3 B;  3X20 B;  1JB0 E;  3X26 B;  3WVE B;  1AHJ B;  3QYG B;  2DD4 A;  2DXB B;  5L8R E;  1UGS B;  3A8L B;  2ZCF B; 
#chains in the Genus database with same CATH topology
 2KGT A;  4M75 C;  4OF1 A;  3LWI A;  2P0K A;  4PKC C;  4M7D C;  5EG2 A;  2RJE A;  1D3B A;  4CFU D;  3CCU Q;  3VS5 A;  2QQ9 A;  2GTO A;  3GPL A;  1PD0 A;  5GAN d;  3KBG A;  2PJQ A;  3ZEH A;  4Y28 E;  4LUE A;  1D0Y A;  2WJ9 A;  1LCK A;  2HZY A;  3QHS A;  4F7N B;  2RQT A;  2AKL A;  1D1A A;  1VQL A;  2V22 B;  2A08 A;  1YI2 Q;  3TSW A;  2K3B A;  2DL4 A;  3VYH B;  3B57 A;  1UDL A;  4C5I A;  1B3Q A;  3NDQ A;  4YTL A;  2HBP A;  4II5 B;  3JCM V;  2DBK A;  1N9R A;  5FGK B;  4EIK A;  4F14 A;  3PO3 S;  3BG9 A;  2BKZ B;  5LJ3 d;  1GFC A;  4OVA A;  2PU9 B;  4DA4 A;  1BBZ A;  2KAF A;  1UGV A;  2VGM A;  2YDL A;  2HQX A;  2EJG A;  5GMK h;  1G8X A;  1YJ9 Q;  2CCI B;  3CCV Q;  3OYC A;  3CMA A;  5EJC A;  2LQN A;  2QQB A;  2LRQ A;  2Z0W A;  3OYD A;  1RAF B;  3VS3 A;  1M1K U;  2F2X A;  3REB B;  5GJW B;  3HBL A;  3DB4 A;  1ZX6 A;  2AHJ B;  3EG3 A;  4BE1 A;  1WHJ A;  3ULR B;  3QXE B;  4LD9 K;  1ZLM A;  3CCM Q;  4YOO A;  2R5A A;  4OGE A;  2F2C A;  2X1N B;  3JB9 J;  2MOX A;  1UJY A;  5FWC A;  5GMK e;  5A0G A;  2M0Y A;  1C6V X;  3G71 Q;  1VA7 A;  1KXU A;  3BLR B;  1JB0 E;  3REA B;  2RHY A;  5I5Z B;  3RES A;  3TVT A;  4C8Q F;  4EMK B;  1Q86 R;  2RI3 A;  2QEX T;  1UGS B;  2EYQ A;  3PMI A;  4PFZ A;  1N8R C;  2EJ9 A;  3PMT A;  2FRW A;  3QHW B;  3ZBD A;  5CQY A;  3RMQ A;  4IUU A;  5CYI B;  3QDF A;  1ZHI A;  4EMK C;  2J05 A;  2OTJ A;  4EOR B;  4JRI A;  4AI6 A;  4L5G A;  1VQP A;  4BCJ B;  4HVV A;  3FRN A;  3S3M A;  3A1P A;  4M77 F;  1RUW A;  3UDC A;  2MWP A;  1Q82 U;  4BD3 A;  1UHF A;  3V7R A;  1I81 A;  4EOK B;  4E7H A;  3M55 A;  3TU4 K;  3I5S A;  4RTX A;  2ATC B;  4RTZ A;  5M9O A;  4MMK A;  2EJF A;  3OW2 S;  1IGU A;  2HQH A;  4OP0 A;  2DVJ A;  3KHI A;  2X9H A;  1E6G A;  5FLX E;  1VQK Q;  2VAS A;  1QP3 A;  1BCM A;  2HD0 A;  4BBR M;  2BTT A;  1FIN B;  2UZD B;  3X25 B;  1I5O B;  1SPK A;  1WPY A;  4M7A A;  4J8O A;  4QQ6 A;  5HVY B;  1YI2 T;  2EBP A;  2BUD A;  1ZSZ A;  2P0Q A;  2X3X D;  2HL3 A;  3CMA Q;  3MJX A;  2KXC A;  3VS1 A;  1SKU B;  4A4F A;  4LOC A;  4BXX X;  2QA4 T;  3OYA A;  1B07 A;  2V1Q A;  2X3W D;  1WQW A;  4XTW A;  4PJO A;  1S72 T;  4BY7 X;  1T3L A;  3OBW A;  1WNL A;  4XTV A;  3TNH B;  3SEM A;  4BCM B;  2PVD B;  3DDQ B;  1JJ2 P;  2JT4 A;  2DAQ A;  2BS4 A;  5GAN g;  1QVF P;  3JCM W;  1WIE A;  1YJ9 T;  2COW A;  3C94 A;  4D6W A;  3OBY A;  2IVX A;  3I35 A;  4HNV A;  5GAM e;  1BU1 A;  1NBE B;  1ZBJ A;  2RQU A;  1YWP A;  1K9M C;  3EFS A;  4ELJ A;  1Y96 B;  2D0N A;  2XU8 A;  2JW4 A;  2LX7 A;  2DLP A;  2QDJ A;  4KRD B;  3NTH A;  1BI3 A;  3SD4 A;  1TWB A;  1M2O A;  4RTT A;  3QWY A;  4OMP A;  2SRC A;  4MZM A;  3THK A;  2DJQ A;  1LVK A;  5FU6 B;  1AZG B;  2DYB A;  2OTJ Q;  2AT1 B;  3MHX A;  1UEB A;  3NFC A;  2XIC A;  5HBE B;  1D0X A;  3G71 T;  2B86 A;  5HBJ B;  1QVG P;  1ENW A;  2NUP B;  1IGQ A;  1VQP Q;  1QLB A;  2PK9 B;  1KHC A;  2YLC A;  1OKW B;  4IUT A;  1QVG S;  3OSV A;  5GAO r;  5IHN A;  1LNX A;  2DIQ A;  4LXC A;  2CH4 A;  2NWM A;  4M78 B;  1TU0 B;  2KBT A;  3HRU A;  3L2V A;  2A0F B;  2UUE B;  2J6K A;  3VKH A;  4FSS A;  2OAU A;  4RMO A;  1QCF A;  4LE9 A;  1NEB A;  4VUB A;  2DMO A;  3CCL Q;  1IZ6 A;  2EPD A;  3DB3 A;  2NUT B;  1X6G A;  2K7A A;  3CC4 A;  5IH2 A;  2EKO A;  3OYB A;  2EUF A;  2YUP A;  1W4S A;  2YRC A;  4ZNX A;  5GAN j;  2RK1 A;  3MY1 B;  2QQS A;  1VYV A;  3CPW S;  3MEW A;  1YJW A;  2GGR A;  3M58 A;  4LDU A;  1VQL T;  2RM4 A;  2CZ0 B;  2O2O A;  4DBQ A;  1AWJ A;  3VJP A;  5I21 A;  1K73 U;  4FT4 A;  1M1F A;  2YHT A;  1JSU B;  4M75 F;  1PCX A;  2V1R A;  4QKU A;  3LWH A;  3N5B B;  1BYM A;  1VIE A;  2COZ A;  2CP6 A;  4C92 G;  4R56 A;  4M7D F;  5GAN 3;  1DJ7 B;  4B6M A;  4HCZ A;  1OQK A;  2QF7 A;  1Q7Y R;  4OB2 B;  3GIB A;  2DD5 A;  4PJJ A;  3GOX A;  2V26 A;  1UGP B;  2MMP A;  4PFP A;  1M8V A;  1MHN A;  2C0T A;  2CP3 A;  4HT8 A;  2GFA A;  2LX9 A;  3BLH B;  2A28 A;  4G6L B;  1KD1 R;  2XID A;  1QP2 A;  2DFU A;  3TW6 A;  2DER A;  3LGL A;  2VB6 A;  1RAI B;  3EG0 A;  2JTE A;  4PJO G;  1N27 A;  1W98 B;  3FDR A;  3FJP A;  3L2U A;  2B9R A;  5HK3 A;  2DD4 A;  2EQU A;  1ZSG A;  1OKV B;  1TXQ A;  1MMN A;  2VXE A;  3EGD B;  4RCB A;  3RIR A;  4AFU C;  5I2S A;  1K8A R;  1GY3 B;  3CC7 A;  2VYT A;  4A54 A;  2EYY A;  1G83 A;  3M5A A;  3LLR A;  5HCK A;  1PHT A;  3EJ1 B;  1OL2 B;  1XO2 A;  2K2V A;  2CZ6 B;  4OB1 B;  2EFI A;  2CZ1 B;  1RAC B;  3CME A;  1RAH B;  2DXB A;  2J7I A;  1I07 A;  4K11 A;  1FWZ A;  5KYW A;  4QW2 A;  3CCE T;  1URC B;  1I8F A;  1WJR A;  4OMN A;  3OB9 A;  2OTJ T;  3A8M B;  4M7A E;  4FSX A;  4HCK A;  3CC4 Q;  1D09 B;  3CC2 A;  1VQP T;  2YRD A;  3QPH A;  3E1S A;  1X6O A;  2E64 A;  4F17 A;  1OZ3 A;  2CT3 A;  4ZGJ B;  2CSQ A;  3H8Z A;  4F7S B;  4Z6Y A;  2BS3 A;  1MMG A;  4PJO E;  3PIP A;  1VYW B;  4EOP B;  2CRE A;  2PUK B;  2M51 A;  3S3N A;  2PVG B;  1WHL A;  4FW2 A;  4J6Y A;  1WGS A;  2DRM A;  2ABL A;  3RBB B;  1EX4 A;  1TUC A;  3EOC B;  5KYN A;  2O9V A;  2VVK A;  3OMG A;  2CP0 A;  2HL5 C;  4HKE A;  4FU6 A;  3QYE A;  1H26 B;  1C9B A;  3RNJ A;  1GRI A;  3OA6 A;  3VRZ A;  1SG5 A;  2R7G A;  5LJ5 d;  2R57 A;  1NJI U;  5KCH A;  5CO7 A;  1CKA A;  2KRO A;  2JMA A;  1XTD A;  2LP5 A;  1VQ6 Q;  1UE9 A;  3CXC P;  2X35 A;  3CD6 Q;  2LT1 A;  2FYK A;  3RGF B;  2I40 B;  1VYU A;  3CCJ A;  1OPL A;  3JAM E;  3CXC S;  4GY5 A;  4XTU A;  2RHU A;  1B34 A;  4MZP A;  1ABO A;  1G3N C;  2QXF A;  2WIH B;  1SEM A;  2L89 A;  4BI3 A;  3CCQ A;  1ABQ A;  3R6N A;  1BIA A;  2GF7 A;  3QSU A;  2VKN A;  3VYG B;  4QVZ A;  3CC7 Q;  2QQR A;  1G3Y A;  3V8K A;  4E7K A;  5IHY A;  2KYM A;  2YSQ A;  3QG1 A;  4EOM B;  5CIU A;  2E12 A;  5C6S A;  1W70 A;  3AT1 B;  4JJB A;  3CME Q;  3F5X B;  3M0Q A;  2RQV A;  2FO0 A;  1GBQ A;  4F7U A;  4EOL B;  2DBM A;  2LNV A;  5CK9 A;  3QWL A;  2ZPF B;  2M0O A;  1MGQ A;  2DRK A;  3GF5 A;  4CC2 A;  3O0G D;  3CC2 Q;  2P0P A;  1K0X A;  2CSI A;  1M2V B;  1E6H A;  2D6F A;  2V8K A;  2CZ7 B;  1NPR A;  2Y90 A;  1I5L A;  4BDY A;  1GFD A;  3EHQ A;  5CKF A;  2DNU A;  4ME7 A;  5IF1 B;  4RTV A;  3H0H A;  2X4W A;  3FC3 A;  4J9B A;  1OUL A;  3VS2 A;  4RTY A;  4XU3 A;  2X51 A;  2K4Y A;  1PRM C;  2M9U A;  4X34 A;  1F5Q B;  4C8Q A;  5D6Y A;  3DDP B;  1QLY A;  4GLK A;  4OMQ A;  3OYG A;  2GQI A;  4ELL A;  1UNG D;  4MDX A;  2A7Y A;  2KQW A;  4BI4 A;  3DTO A;  2C5O B;  2W2H A;  1YJW T;  1K4U S;  5GAN h;  5KCO A;  1KSW A;  2DXT A;  1VQ5 Q;  2RK2 A;  1VQ8 A;  4RCC A;  3QKJ A;  4C0F A;  2OI3 A;  1GCP A;  2JS0 A;  2DXU A;  4M77 A;  5CVI A;  2WEV B;  1Q81 C;  1Y07 A;  3FLG A;  4KGZ B;  2CP2 A;  4C5G A;  1EZZ B;  1XJW B;  3BG5 A;  4PFO A;  3CCJ Q;  3J80 E;  4CFW B;  1IHV A;  3JB9 I;  2BE9 B;  3CCV A;  3CCQ Q;  1WX6 A;  2RA2 A;  5GAN e;  1Q81 R;  3QUI A;  4KUD K;  5LJ3 h;  3BHV B;  2MF2 A;  4XU0 A;  2O88 A;  4DBH A;  1WXB A;  5CKD A;  1WXT A;  2ECZ A;  3L42 A;  4ELZ C;  1TH7 A;  3I55 T;  2IVW A;  3I9Q A;  1X75 C;  3VS6 A;  1VQN Q;  3M9Q A;  5KE3 A;  1OEB A;  3VS4 A;  3H0I A;  3NPF A;  1XQH A;  2KRS A;  2JS2 A;  3BLQ B;  3QZ5 B;  1M4Z A;  2EAY A;  4KUL A;  2JOY A;  3G7Z A;  2ZGW A;  4M75 B;  4YOZ A;  5LJ3 e;  1IXD A;  1BKB A;  1MUZ A;  4M7D B;  4AKH A;  4BI8 B;  2L3S A;  2E41 A;  2W9Z A;  4JLI A;  1TOV A;  3OYM A;  1OL1 B;  2I53 A;  4E2F B;  2CUD A;  4JRP A;  4PLL A;  4AG2 C;  1KC8 C;  3X28 B;  2CP7 A;  3CME T;  4HCC A;  2KY9 A;  2W96 A;  5L2W B;  1WXU A;  4F7U G;  2WSF E;  5LJ5 g;  1VIN A;  4Y72 B;  2W99 A;  5KYX B;  3JB9 G;  3URG A;  3MKD A;  4Q5W A;  2ZZD A;  3KXT A;  3HZJ A;  3M0R A;  1SSH A;  1KC8 R;  2MIO A;  5IN1 A;  4M6V A;  1GH6 B;  4CFU B;  2LQW A;  4BE0 A;  2FZC B;  4EON B;  2KK4 A;  1N5Z A;  3EFO A;  2DTI A;  3CBM A;  4QT7 A;  1IO6 A;  1Q86 U;  2A3L A;  3G4S Q;  1VQ8 Q;  2MCN A;  1VQK A;  2ZPH B;  4C92 D;  2A37 A;  4OML A;  2V8J A;  3OYF A;  3BDU A;  1YIJ A;  2BZ8 A;  2G6F X;  2KI7 A;  2C5V B;  2KRM A;  2M1H A;  4DOW A;  2QK0 A;  1RLP C;  4EPC A;  2JGZ B;  1X6B A;  2KSS A;  2LZ6 B;  3JCM h;  3VRY A;  2WXV B;  3LH5 A;  4OMO A;  3JRZ A;  2P4T A;  1KG1 A;  5LJ5 j;  4F7U E;  3QO3 A;  4I3Z B;  4PJO D;  4C92 C;  4CXA B;  4F04 B;  4ZGD B;  3EGX A;  1BK2 A;  3HHT B;  1MMA A;  4FYW B;  3DOG B;  1SSF A;  1WHH A;  1M3A A;  2RN8 A;  3PTA A;  4LDX A;  2DL7 A;  3CCQ T;  3JB9 F;  1X2Q A;  1D0Z A;  5GAN 4;  3OYL A;  4WCI A;  3OS2 A;  1OPK A;  1G3S A;  1YN8 A;  1M8M A;  2EYX A;  3HL8 A;  1VYT A;  3JCM e;  4TTH A;  1M3B A;  2ZPI B;  1ZSZ C;  3GNG A;  5EC7 A;  4F6S B;  4HVU A;  2JJ9 A;  3PIO A;  1NE8 A;  4PJO C;  3ER0 A;  1VQ4 A;  2AKK A;  2KMG A;  2E5Q A;  3QWX X;  3F70 A;  4C8Q E;  4F6U B;  1OIU B;  4E7S A;  3BG3 A;  4JJC A;  1PWT A;  2MAM A;  1H1Q B;  2F69 A;  2BZX A;  4KT0 E;  4CRI A;  2UZB B;  2JM9 A;  3R6O A;  1N8R R;  4OB0 B;  2FVU A;  4C5E A;  3D7S B;  4L6V 5;  3MP6 A;  5CKH A;  4CFM B;  1UEC A;  3EFR A;  2LW4 A;  4J6W A;  5D6X A;  1M1K C;  1VQO Q;  4M77 E;  3CCL A;  1IB8 A;  4JUV A;  4A4K A;  3VKG A;  2C0O A;  1JXM A;  3CCU T;  2F5T X;  1M27 C;  5GAN 5;  2CKK A;  2O4X B;  3M59 A;  2QAZ A;  4J9I A;  1R0B G;  3DLM A;  1D1C A;  1OX9 A;  2IW8 B;  1YIJ Q;  3EG1 A;  2AZS A;  2K79 A;  4F16 A;  3OYN A;  3PNW C;  3JCM P;  3EH2 A;  2OTL Q;  2LJ3 A;  4EDU A;  2GCX A;  3OS5 A;  5GAM h;  2PZ1 A;  3V8J A;  2CH4 W;  1GCQ C;  1QCO A;  1VQ8 T;  2JZ2 A;  2DX1 A;  1VOM A;  2I2L A;  2JM8 A;  4WF2 A;  1RAB B;  2C6T B;  1WFW A;  3BFM A;  5GAM f;  2K3Y A;  1Q82 C;  2VGN A;  5KE2 A;  2VUB A;  1VQM A;  2BIV A;  4JX6 A;  2XHC A;  4AFZ C;  2XDB A;  1JJ2 S;  1K0S A;  3CCV T;  2IW6 B;  1BB9 A;  2DET A;  1QVF S;  3OYK A;  4HA8 A;  3C12 A;  5J3B A;  4V2S A;  4HNT A;  1E7P A;  4EMK A;  1M90 U;  1AEY A;  4CC7 A;  3MI9 B;  4CRL B;  1Q82 R;  3FIF A;  5FRO A;  4DBR A;  4QQD A;  1OGU B;  4J9E A;  3VUB A;  1UTI A;  2C5N B;  4CC4 B;  2DTO A;  3CCM T;  2A36 A;  3OS1 A;  1NG2 A;  1VQ4 Q;  1N9S A;  1KQS P;  1WLP B;  2BKD N;  2E6N A;  1E7O A;  2DTH A;  1K9M R;  2YRV A;  3HRT A;  2XDD A;  1KQS S;  3CEY A;  1Q7Y U;  5BNJ B;  3U23 A;  1PKD B;  1CKB A;  1GXI E;  1FXX A;  1ZUY A;  4MML A;  2VXF A;  4ELY C;  5FWB A;  5J39 A;  2IN3 A;  1QCN A;  1UB4 A;  1AT1 B;  2H3E B;  4MDW A;  1KD1 U;  4XTZ A;  3OW2 A;  3M0T A;  2CT4 A;  4AG1 C;  3T9N A;  1Y7X A;  1JST B;  3CCR A;  5FW9 A;  1RAD B;  3SDZ A;  3SWN C;  5EFQ B;  2Y4Y A;  4J9F A;  2FPF A;  5I11 A;  1JO8 A;  2JXB A;  2RD1 A;  3QYH B;  3A8G B;  1Y71 A;  3JSC A;  1K8A U;  4KH1 B;  4ZGE B;  3MCA B;  4HT9 A;  2FRY A;  3OYH A;  2MI6 A;  3WXM B;  4IUP A;  2DF6 A;  4J6X A;  5CAI A;  3M4Y A;  5AT1 B;  2C06 A;  2Y4X A;  3DKM A;  3BW1 A;  5GAN 2;  4HXJ A;  5DM7 R;  1JKW A;  3JCM b;  1UFF A;  4BCN D;  4JX4 A;  5IDN B;  1VQK T;  3FJ5 A;  3CCS A;  1R0C B;  1T0H A;  1LPL A;  1PC0 A;  4M7A G;  1YIJ T;  1H1R B;  1M3C A;  4HVW A;  1KJW A;  1H28 B;  2L2P A;  1Z9Z A;  4E47 A;  1VQM Q;  1VQ6 A;  1QQJ A;  4BCN B;  2RJC A;  3NMZ C;  4Z89 A;  3CMA T;  2IG0 A;  5LQF B;  3CD6 A;  1WDX A;  4KH0 B;  1Y96 A;  2EYW A;  3V7C A;  3UT1 A;  1QKX A;  2JN0 A;  4FT2 A;  1VQ7 A;  4PLI A;  3M4G A;  2K5F A;  2RHX A;  3FEO A;  4LNP A;  4BY1 X;  5GAO l;  2PNI A;  5IXB A;  1Y57 A;  2PVO B;  1OI1 A;  4E6R A;  2ED0 A;  4ZN1 A;  2NUP A;  4XQ3 A;  3MEA A;  3HO8 A;  4DEY A;  1QVG A;  3ME9 A;  1K73 C;  3GTM S;  3RKW A;  1KQ1 A;  4QSH A;  4RG2 A;  5HY6 A;  3TW7 A;  3DJB A;  4DOV A;  4M78 A;  3M0S A;  2DZ9 A;  5GAN 7;  4BCF B;  4JRQ A;  7AT1 B;  1IRX A;  2QGS A;  2JTF A;  4EOI B;  1ARK A;  1VQ4 T;  1CSK A;  2NUT A;  2WSC E;  4C92 F;  5LJ5 e;  1FMK A;  3KFV A;  4HL4 A;  2AK5 A;  3KUF A;  1K73 R;  2VV5 A;  4AMC A;  1WYX A;  2KNB B;  4ESR A;  2K2M A;  4BY6 C;  1P5E B;  3V8L A;  1N6A A;  3CCR Q;  2KR6 A;  2D1X A;  2ROL A;  3NGP A;  2R5M A;  3JB9 D;  2LDM A;  2K6D A;  4M7A F;  3CPW A;  3TNI B;  1WQ7 A;  1H3Z A;  3HB9 A;  3HSB A;  1UNH D;  1U06 A;  3P8D A;  2RPN A;  2QTV A;  5I22 A;  4JZ3 A;  4UN0 A;  1BIB A;  3E9G A;  4AFS C;  1MNE A;  2DL3 A;  1SRL A;  3CCL T;  4PJO F;  1BI0 A;  2K5I A;  2H3J A;  2GBQ A;  3MEV A;  2RO0 A;  1G2B A;  2BS2 A;  3EAE A;  3UAT A;  4M4Z A;  1H25 B;  3L2Q A;  4LDW A;  1GUX B;  4BAC A;  3M54 A;  1D3U B;  3MEU A;  3CCS Q;  2LC4 A;  1O9K B;  1VQ5 A;  3UPU A;  4FX3 B;  4N0A C;  4AFQ C;  2FL7 A;  2LVM A;  5FU7 B;  5GMK j;  2YLB A;  1M30 A;  2RQW A;  2DK3 A;  1V29 B;  1YNZ A;  3VV0 A;  2FHD A;  3QBY A;  5ECA A;  5HQ0 B;  5FU7 C;  4E7Z A;  4DBF A;  1AWW A;  1VQ7 Q;  1PD1 A;  1VQ9 Q;  2DJZ A;  1XOV A;  5J26 A;  5DQV A;  2KYB A;  3EGD A;  1X43 A;  5KYU B;  2G9X B;  1UNL D;  3K7A M;  1ZQ1 A;  3A8H B;  2WMB B;  3TEE A;  1VQM T;  1H4L D;  1X01 A;  2RQR A;  1YP5 A;  4PJN A;  2KT8 A;  1W2B P;  3NTI A;  4BB7 A;  3DL1 A;  3QII A;  3I5R A;  4MFD A;  1W2B S;  2DXC B;  1YHQ A;  1VQN A;  2HNI A;  4II1 A;  2L8D A;  4BE2 A;  2F2W A;  3H6Z A;  3X24 B;  1WA7 A;  3CPF A;  3S3O A;  1G5V A;  4EMH A;  2CDT A;  2WAC A;  2DIG A;  1FMW A;  3G6E Q;  4Z02 A;  5GAO m;  3L1A A;  1PSE A;  2HBW A;  4FW1 A;  9ATC B;  1KK7 A;  2LJ0 A;  4Y91 A;  5KYY B;  2DEU A;  5KH6 A;  4M78 G;  4O5V A;  2PK2 A;  1VIF A;  1WI7 A;  1KFZ A;  4A4G A;  2JVV A;  1RI9 A;  2E3I A;  1SHG A;  1KQ2 A;  5CKB A;  3UA6 A;  4PL6 A;  1G3T A;  1C0M A;  2NUZ A;  4AKG A;  1NYF A;  2PUO B;  3L2W A;  2O9S A;  3BHU B;  2JUF A;  3CC4 T;  1UGR B;  4IMY B;  2B8A A;  4Z8A A;  3M0P A;  4J9D A;  2FG0 A;  4R55 A;  5GAO q;  5GAN 8;  4J9C A;  2LT4 A;  2RF0 A;  2O31 A;  2QI2 A;  1H1S B;  1D3B B;  2COY A;  3HFN A;  3GBQ A;  2RB6 A;  5FRM A;  5IDP B;  1AD6 A;  5ACB A;  1M5Q 1;  3BE3 A;  5L8R E;  3RKY A;  3G4S A;  1YIT A;  3PE0 A;  4EOS B;  2YT6 A;  4MZT A;  2KRN A;  1IRE B;  1H92 A;  2FZG B;  2ZPG B;  4EC9 B;  2NYS A;  4A4H A;  3CXC A;  5GAN f;  1QMZ B;  2L3R A;  4D8K A;  2XKO C;  3OS0 A;  5IAY A;  1YCY A;  3CCS T;  2MK5 A;  4HLQ A;  3PGG A;  4JLG A;  4OGC A;  3OQ5 A;  3UA7 A;  4M78 E;  1S72 A;  3QDR B;  2CJM B;  2E3H A;  3VYG A;  1VQ6 T;  4C0D B;  1TG0 A;  2YXY A;  3CD6 T;  3G1J A;  4IIM A;  3H4C A;  4QQG A;  1HK9 A;  2CS7 A;  2OAW A;  1YHQ Q;  2K57 A;  3M03 A;  5LJ3 f;  4BCO B;  2GQV A;  3HPW A;  4C0D C;  1VQ7 T;  2QYZ A;  1XNI A;  2HMA A;  2FPD A;  2LMJ A;  1H3H A;  4RKU E;  1QWE A;  2ROT A;  2QEX Q;  2XMF A;  4LDY A;  4J5Y A;  3CC7 T;  1M2V A;  2D0Q B;  4EC8 B;  1OX8 A;  1WHG A;  2J6O A;  2ZPB B;  2QQA A;  3EG2 A;  2ESW A;  3TQ7 P;  1KHI A;  3OYE A;  2W0Z A;  3J7A F;  1X69 A;  2LCL A;  3OYJ A;  1RAA B;  3GP8 A;  1UHC A;  2QGF B;  4PJL A;  1OZ2 A;  1O75 A;  2EGC A;  2BZY A;  2KR3 A;  1TD6 A;  4IKF A;  3H9N A;  4NOY A;  2FZK B;  1V1C A;  2RMO A;  1MMD A;  4BCK B;  5GJV B;  2LJ1 A;  3CC2 T;  2C0I A;  3HFO A;  4JRK A;  4OB3 B;  1VQO A;  1LJO A;  2C4G B;  2SEM A;  2DZC A;  3MET A;  1IHW A;  3OMC A;  2QGG A;  5GMK i;  2L3Q A;  1YCS B;  1ACM B;  1I0C A;  5A0D A;  4NL2 A;  5DLQ E;  2E70 A;  2E5K A;  1YJN A;  1YIT Q;  1C1A A;  2G3R A;  3O5Z A;  4A53 A;  4KGX B;  4C8Q G;  4FYX B;  1LOJ A;  2HKN A;  3S6W A;  4RTU A;  1WJS A;  2ED1 A;  1PSF A;  4FCY A;  3PVQ A;  4ROC A;  4CFN B;  1I4K 1;  5IHK A;  3J81 E;  4KRC B;  4M7A D;  1SHF A;  1AOJ A;  4FYV B;  2D8H A;  2QA4 Q;  2L5Q A;  2OTL A;  1N8R U;  1Q95 G;  4C92 B;  1VQ5 T;  3TRE A;  1S72 Q;  4J9H A;  5HK0 A;  4IUQ A;  1FYN A;  1R8O B;  1S1N A;  4M77 G;  4QVC A;  3JCM X;  3QJ6 A;  3RUX A;  4O6J A;  4CFX B;  3EG9 B;  2E4H A;  1MV0 B;  4M7A B;  3SB2 A;  2LCC A;  2RHZ A;  3MIA B;  5CEI B;  3CCJ T;  4F7U F;  3JCM f;  1E9H B;  2W9F A;  2V8I A;  1ZSZ B;  4NST B;  1ZA2 B;  4RTW A;  3HP9 A;  4A4E A;  4M7A C;  2LQK A;  4JDS A;  1V76 A;  2JMC A;  4M75 A;  2EQI A;  1BI2 A;  4PJO B;  1FVV B;  1UGQ B;  4M7D A;  4OGR B;  1SF9 A;  2KMT A;  3HTR A;  1HJD A;  1B7T A;  2KDS A;  2E65 A;  1M1G A;  2EGE A;  1OU8 A;  1Q86 C;  1BCO A;  4F7J B;  2X4J A;  2FPE A;  4DQ2 A;  1YHQ T;  1VQN T;  1WHM A;  1ZUU A;  4F6W B;  2HQE A;  1EIF A;  5KYX A;  2J06 A;  1QVP A;  2YUQ A;  3HRS A;  3NHN A;  4E7I A;  3E2U A;  5DY9 A;  2NLU A;  2XD0 A;  1JXO A;  2LNH B;  2H8H A;  4TVR A;  4PJM A;  3A5Z B;  3BY7 A;  4LN2 A;  3CCE A;  4L59 A;  5D6W A;  1YWO A;  3CBO A;  2EVR A;  4X1V A;  4WTO B;  5ICP B;  2OJ2 A;  3TN8 B;  2P4R A;  4X9D A;  4OMF B;  4CI0 C;  1W1F A;  3CBP A;  1U1S A;  3C4S A;  4JS5 A;  1YJN Q;  1AVZ C;  1A0N B;  1UG1 A;  2EKH A;  4C0G A;  3AHU A;  4XAX B;  1M1K R;  2JNG A;  1VQL Q;  2W10 A;  1PRL C;  3OW2 P;  1K9M U;  2LTO A;  2RHI A;  2XK0 A;  1U1T A;  2QG9 B;  2WPA B;  4C5H A;  2RI2 A;  4FM4 B;  5D7U A;  1H27 B;  1T0J A;  4C92 A;  1OIY B;  2GNC A;  4EMG A;  1YFN A;  1NEG A;  2CCH B;  3P8H A;  5CR2 A;  3HKS A;  1BU2 A;  3JCM d;  1PKT A;  4JPB W;  3G4S T;  1YIT T;  3EG9 A;  4XU2 A;  2WMA B;  2DM1 A;  4GBQ A;  5LL6 S;  2DO3 A;  4R0K A;  1TFB A;  4BCM D;  4D8D A;  5I2M A;  3M57 A;  3VU3 C;  1TS9 A;  4BCI B;  1OOT A;  2EYZ A;  2JTM A;  4J9G A;  2PTK A;  1QMC A;  4P5N A;  2XDP A;  4ATO A;  4KUI A;  2DIL A;  1AZE A;  2E1H A;  3OY9 A;  4BCP B;  1JQQ A;  2HCK A;  2DD5 B;  4N4G A;  2DME A;  1JU5 C;  3O8V A;  1U8R A;  1NLO C;  2RJD A;  1JOW A;  2L0A A;  2DE0 X;  5GAN 6;  5L23 A;  2DYI A;  4KBM B;  4RG8 A;  2K3X A;  4M75 G;  2I0N A;  4UC4 A;  3L2Z A;  4A63 B;  4M7D G;  1TUG B;  3QJY A;  4IUR A;  2DD4 B;  3SFM A;  3CCE Q;  1HYO A;  3RDV A;  2O01 E;  2QDY B;  1WZO A;  2M16 A;  3A98 A;  4M78 D;  4BBS M;  3SWN B;  3LGF A;  5LJ3 g;  5GMK l;  1MND A;  4F7L B;  1PM3 A;  2HSP A;  4ROE A;  2O4X A;  4B9X A;  2ZAE A;  3X20 B;  5FU6 C;  3VUZ A;  2LQ8 A;  1KIK A;  1MV3 A;  4KGV B;  3DLL A;  1FKM A;  3ZFJ A;  2DXB B;  1HD3 A;  1RAG B;  3PFS A;  5KYW B;  2DL8 A;  1GCQ A;  4B9W A;  3UWN A;  3RER A;  2F5K A;  3C0C A;  4LD6 A;  1VQO T;  4OR5 B;  1T3S A;  4M78 C;  1M90 C;  5IT9 E;  3EHR A;  4EOQ B;  1YBY A;  2UZL B;  3CPW P;  3RMS A;  1QW1 A;  5IXF A;  3TNW B;  5GAM d;  5IHI A;  1YJN T;  5GAO n;  2KXD A;  4M75 E;  3TCJ A;  1NZ9 A;  2KT1 A;  1M90 R;  3BDL A;  1Q7Y C;  1NPP A;  1EFN A;  4M7D E;  1H8K A;  5C0M A;  1ZBX A;  2KE9 A;  4MFE A;  3I56 A;  2YUO A;  1JJ2 A;  1ZA1 B;  3LYI A;  2OTL T;  1QVF A;  4FYY B;  4YOS A;  1KD1 C;  2EW3 A;  1BI1 A;  4FIB A;  3H41 A;  2OX7 A;  5LJ3 j;  3CQT A;  5LMK B;  2YUN A;  1VQ9 A;  3PT9 A;  2D8J A;  5LJ5 h;  3E9F A;  1Y0M A;  1OU9 A;  3H0F A;  3LQ5 B;  3MP1 A;  5DQW A;  1I1J A;  1KQS A;  1D1B A;  1PKS A;  3I55 A;  1K8A C;  2HAX A;  2DL5 A;  3MO8 A;  4HCB A;  2K5L A;  3MPU B;  1K76 A;  1B34 B;  5LJ5 f;  3TSZ A;  2EQK A;  3GNF B;  4E7L A;  2RJF A;  4BCH B;  1QKW A;  1X2K A;  1X27 A;  2FEI A;  2RH2 A;  2F1L A;  2BE7 D;  1JRI A;  3SWN A;  4BY6 B;  1HSQ A;  6AT1 B;  4ZTJ A;  2IW9 B;  2ENM A;  1AD5 A;  2GTJ A;  1ZP2 A;  4GLM A;  3JCM g;  3G6E A;  4OMM A;  5CKE A;  2R58 A;  4LDV A;  1OYX A;  5A2Q E;  3SHW A;  4C0Z A;  3L2R A;  4C92 E;  2HKQ B;  4LUD A;  4Z88 A;  2HEQ A;  1NYG A;  1PG5 B;  1K1Z A;  3MP8 A;  4JZ4 A;  3OYI A;  4IUV A;  1RI0 A;  3JCM c;  2KVQ G;  4J7I A;  4AT1 B;  4N4I A;  2KEA A;  5CQX A;  1ZUK A;  4F7U B;  1TTH B;  1AWX A;  3A8L B;  2ZCF B;  4ZN3 A;  2WFY B;  2EWN A;  4Y92 A;  3LX7 A;  4AKI A;  3JCM Q;  2CGH A;  4ROD A;  4XTX A;  5GMK m;  2J6F A;  4JS4 A;  2MYS A;  2VC8 A;  1YJW Q;  4C8Q D;  4ZTF A;  4JJN K;  2X4Y A;  2ZPE B;  1WHK A;  4ANJ A;  1HXD A;  3QYB A;  4NS5 A;  3I56 Q;  3EH1 A;  1U5S A;  2DVE A;  4XK8 E;  2EGA A;  4N4H A;  3A8O B;  2QQ8 A;  2HSE B;  4JJD A;  3VKI A;  2DA9 A;  4C8Q B;  4BCQ D;  1SRM A;  3ASK A;  1H24 B;  3ZL7 C;  4M77 D;  3BHT B;  3M0U A;  1AWO A;  2P84 A;  3IQL A;  4C8Q C;  4CFV B;  1RL2 A;  2XG8 D;  1VOL A;  3LH0 A;  4BCQ B;  5CCA A;  3OYY A;  2UZE B;  3EID B;  1FMV A;  2DKG A;  1O9S A;  8ATC B;  1F1B B;  4M77 B;  3I55 Q;  2WIP B;  3VS0 A;  2PHG A;  4BCG B;  2DEQ A;  3NTK A;  1J3T A;  4IIO A;  5A0L A;  4M77 C;  4ORZ A;  2BPM B;  1NLP C;  4F70 B;  1JEG A;  1QWF A;  3RR6 A;  5GAM g;  1WJQ A;  1OI9 B;  1RAE B;  2AIR B;  2QEX A;  3GLX A;  3PVL A;  5FRN A;  8AT1 B;  2E6Z A;  5DLO A;  2RNA A;  2GFU A;  1NM7 A;  2IIM A;  1R77 A;  1NJI C;  1GBR A;  2QFZ A;  1UJ0 A;  1Q81 U;  2MPX C;  3WVE B;  1AHJ B;  4EOO B;  3INZ A;  3JCM J;  1TUD A;  2K9G A;  3QYG B;  1FX7 A;  3OSS C;  5GAO p;  2QDL A;  1AIS B;  2C5X B;  4NC6 A;  1K9A A;  1H1P B;  2IPO B;  3QZ9 B;  2WHB B;  3RKX A;  1NJI R;  3V7S A;  5HKC A;  2F2V A;  3CCR T;  4DEX A;  4YC3 B;  2AZV A;  2PMI B;  1GUX A;  2XI9 A;  4N0A A;  4PK4 A;  2QAS A;  2L3P A;  3WVD B;  4QVD A;  4CC3 A;  1PNJ A;  1O9K A;  1M9S A;  3VS7 A;  3CCU A;  2CUB A;  1RLQ C;  3Q1J A;  4FL6 A;  3UF4 A;  4BDZ A;  2D9T A;  1GL5 A;  2EQJ A;  2YWW A;  2CP5 A;  3JV3 A;  4J83 A;  2ZZD B;  1H64 1;  4J7F A;  1YI2 A;  3LW5 E;  5GAM j;  1U3O A;  3POM A;  1UUE A;  4E7J A;  3EFO B;  2WSE E;  4X9C A;  2QA4 A;  5KYU A;  5AYF A;  4BUG A;  1OV3 A;  4PNO A;  3M56 A;  3MY5 B;  3I56 T;  1KC8 U;  3C95 A;  4KRT A;  3G33 B;  2EIF A;  4M78 F;  3P8B B;  3E19 A;  4JX5 A;  1P92 A;  3QHR B;  2DXC A;  1W2B A;  4HNU A;  1YJ9 A;  2MWO A;  1Z9Q A;  1JBM A;  2X4X A;  1N4M A;  3M53 A;  2QTX A;  2E10 A;  1VQ9 T;  1VUB A;  5HBH B;  2CYZ B;  3EGU A;  3JB9 H;  4M75 D;  1TSF A;  2VWF A;  2HDA A;  4XU1 A;  2DPP B;  4MIM A;  5KYY A;  3CCM A;  3FB9 A;  4M7D D;  3EGX B;  5HNB B;  3G71 A;  2EQM A;  2M02 A;  2PQW A;  4XTY A;  3X26 B;  4RUG A;  2FB7 A;  4NL3 A;  2LCS A;  4EOJ B;  2RI5 A;  1W6X A;  2G77 A;  1G3W A;  3G6E T; 
#chains in the Genus database with same CATH homology
 3VYG B;  4QVZ A;  4M75 C;  2QQR A;  1G3Y A;  4OF1 A;  3V8K A;  4E47 A;  4E7K A;  3LWI A;  2LTO A;  2P0K A;  2RHI A;  1U1T A;  2XK0 A;  4PKC C;  1VQ6 A;  4C5H A;  2RI2 A;  2RJC A;  4FM4 B;  3CMA T;  4M7D C;  2IG0 A;  3QG1 A;  5EG2 A;  3CD6 A;  5CIU A;  4C92 A;  2RJE A;  4EMG A;  1D3B A;  2E12 A;  1Y96 A;  3P8H A;  5C6S A;  3V7C A;  5CR2 A;  3UT1 A;  3HKS A;  2QQ9 A;  3JCM d;  3GPL A;  2JN0 A;  4FT2 A;  5GAN d;  3KBG A;  3ZEH A;  4F7U A;  4Y28 E;  3G4S T;  1YIT T;  1VQ7 A;  4PLI A;  2LNV A;  5CK9 A;  2WJ9 A;  3M4G A;  3QWL A;  2K5F A;  3QHS A;  2ZPF B;  2RHX A;  3FEO A;  4XU2 A;  2M0O A;  5GAO l;  1MGQ A;  5LL6 S;  2DO3 A;  1VQL A;  2PVO B;  3GF5 A;  1OI1 A;  5I2M A;  3M57 A;  2P0P A;  3VU3 C;  4ZN1 A;  4XQ3 A;  3VYH B;  2D6F A;  4C5I A;  2V8K A;  2CZ7 B;  3MEA A;  3HO8 A;  1QVG A;  1NPR A;  2JTM A;  2Y90 A;  3ME9 A;  4YTL A;  2HBP A;  4BDY A;  1K73 C;  1I5L A;  4P5N A;  3RKW A;  2XDP A;  1KQ1 A;  4QSH A;  4KUI A;  4ME7 A;  3TW7 A;  4RG2 A;  5CKF A;  5HY6 A;  3JCM V;  4ATO A;  4DOV A;  4M78 A;  2DZ9 A;  2X4W A;  2E1H A;  3OY9 A;  3FC3 A;  5GAN 7;  1N9R A;  4JRQ A;  2DD5 B;  3BG9 A;  4N4G A;  4XU3 A;  5LJ3 d;  2JTF A;  4OVA A;  2K4Y A;  2PU9 B;  4DA4 A;  3O8V A;  1VQ4 T;  2KAF A;  2VGM A;  2M9U A;  2WSC E;  4C92 F;  5LJ5 e;  2HQX A;  4X34 A;  3KUF A;  4HL4 A;  1U8R A;  2VV5 A;  2EJG A;  2RJD A;  4C8Q A;  5D6Y A;  4GLK A;  3OYG A;  5GMK h;  5GAN 6;  4BY6 C;  4KBM B;  1N6A A;  4RG8 A;  3V8L A;  2A7Y A;  2KR6 A;  2K3X A;  2KQW A;  4M75 G;  2R5M A;  4BI4 A;  3JB9 D;  2LDM A;  4UC4 A;  3OYC A;  3CMA A;  5EJC A;  4M7A F;  3CPW A;  2QQB A;  1WQ7 A;  3L2Z A;  1YJW T;  3HB9 A;  2LRQ A;  4M7D G;  5GAN h;  1H3Z A;  5KCO A;  3QJY A;  4IUR A;  2DXT A;  3HSB A;  3OYD A;  3P8D A;  1M1K U;  3HBL A;  2RK2 A;  3DB4 A;  2AHJ B;  1BIB A;  4BE1 A;  1VQ8 A;  4RCC A;  3E9G A;  2DD4 B;  3QKJ A;  3SFM A;  4C0F A;  3QXE B;  2O01 E;  4LD9 K;  2QDY B;  2DXU A;  2M16 A;  4M77 A;  4M78 D;  5CVI A;  3CCL T;  4BBS M;  1Y07 A;  3SWN B;  1Q81 C;  4PJO F;  1BI0 A;  2K5I A;  3FLG A;  2H3J A;  2R5A A;  4OGE A;  3LGF A;  2RO0 A;  3MEV A;  4C5G A;  2BS2 A;  5LJ3 g;  3JB9 J;  3BG5 A;  5GMK e;  5GMK l;  3J80 E;  5A0G A;  3EAE A;  2O4X A;  4B9X A;  4LDW A;  3L2Q A;  4BAC A;  3X20 B;  3JB9 I;  5FU6 C;  3VUZ A;  1Q82 C;  3M54 A;  3CCV A;  2LQ8 A;  1JB0 E;  3MEU A;  2RHY A;  2RA2 A;  5GAN e;  3RES A;  2LC4 A;  3DLL A;  3QUI A;  4KUD K;  5LJ3 h;  4C8Q F;  1FKM A;  2MF2 A;  4XU0 A;  2DXB B;  3ZFJ A;  4EMK B;  1VQ5 A;  3UPU A;  2RI3 A;  2QEX T;  4N0A C;  1UGS B;  3PFS A;  2EYQ A;  5CKD A;  3PMI A;  4B9W A;  2EJ9 A;  1N8R C;  3PMT A;  3UWN A;  3RER A;  3ZBD A;  2F5K A;  2FL7 A;  4LD6 A;  2LVM A;  5CQY A;  5FU7 B;  3L42 A;  5GMK j;  1VQO T;  3RMQ A;  2YLB A;  4ELZ C;  4M78 C;  1TH7 A;  4IUU A;  3I55 T;  5IT9 E;  1M90 C;  1ZHI A;  2DK3 A;  4EMK C;  1V29 B;  2OTJ A;  1YBY A;  2IVW A;  1X75 C;  4JRI A;  3VV0 A;  2FHD A;  3M9Q A;  3RMS A;  5KE3 A;  1QW1 A;  3QBY A;  4AI6 A;  4L5G A;  5GAM d;  1VQP A;  3CCE T;  5FU7 C;  1XQH A;  3FRN A;  3S3M A;  3QZ5 B;  1M4Z A;  2EAY A;  4KUL A;  1YJN T;  2JOY A;  4M77 F;  3UDC A;  3G7Z A;  5GAO n;  2MWP A;  2ZGW A;  4M75 B;  4M75 E;  1Q82 U;  2DJZ A;  1XOV A;  5J26 A;  3TCJ A;  4BD3 A;  1NZ9 A;  5LJ3 e;  3BDL A;  3V7R A;  1Q7Y C;  1NPP A;  1BKB A;  4M7D B;  1ZQ1 A;  4M7D E;  3A8H B;  5C0M A;  1ZBX A;  4AKH A;  3TEE A;  4BI8 B;  4MFE A;  1VQM T;  2E41 A;  1I81 A;  1X01 A;  4JLI A;  3I56 A;  4E7H A;  3M55 A;  3TU4 K;  3OYM A;  1JJ2 A;  3NTI A;  3LYI A;  3DL1 A;  3QII A;  4BB7 A;  5M9O A;  4MMK A;  2OTL T;  1QVF A;  4JRP A;  4PLL A;  1KC8 C;  2EJF A;  3X28 B;  3OW2 S;  4HCC A;  3CME T;  1KD1 C;  4MFD A;  2KY9 A;  1W2B S;  2DXC B;  1YHQ A;  5LJ5 g;  4F7U G;  2HNI A;  2WSF E;  1BI1 A;  4FIB A;  4II1 A;  2L8D A;  1VQN A;  4OP0 A;  4BE2 A;  5LJ3 j;  3KHI A;  3H6Z A;  3X24 B;  5FLX E;  3CPF A;  1QP3 A;  3S3O A;  3JB9 G;  1G5V A;  3URG A;  4Q5W A;  2HD0 A;  4EMH A;  4BBR M;  1VQ9 A;  2WAC A;  3X25 B;  2ZZD A;  1WPY A;  3KXT A;  4M7A A;  3HZJ A;  2DIG A;  3PT9 A;  5LJ5 h;  4J8O A;  4QQ6 A;  1K9M U;  3E9F A;  4Z02 A;  5IN1 A;  5GAO m;  1YI2 T;  4M6V A;  3L1A A;  1PSE A;  2BUD A;  3MP1 A;  4BE0 A;  1KQS A;  2P0Q A;  4Y91 A;  3I55 A;  5KH6 A;  1K8A C;  2KK4 A;  2HAX A;  4M78 G;  4A4F A;  2QA4 T;  4LOC A;  4O5V A;  3MO8 A;  3OYA A;  2K5L A;  4HCB A;  4PJO A;  1VIF A;  2DTI A;  1WQW A;  4XTW A;  3CBM A;  1S72 T;  4A4G A;  1B34 B;  2JVV A;  5LJ5 f;  1Q86 U;  3OBW A;  2A3L A;  1WNL A;  2EQK A;  3GNF B;  4XTV A;  4E7L A;  2RJF A;  2RH2 A;  1KQ2 A;  2PVD B;  5CKB A;  3SWN A;  1JRI A;  2ZPH B;  4PL6 A;  4BY6 B;  4C92 D;  1G3T A;  1VQK A;  2V8J A;  4ZTJ A;  3OYF A;  4AKG A;  2PUO B;  3BDU A;  3L2W A;  1YIJ A;  2DAQ A;  2JUF A;  3CC4 T;  1UGR B;  2BS4 A;  3JCM g;  2B8A A;  5GAN g;  3G6E A;  3JCM W;  4R55 A;  1YJ9 T;  5GAO q;  3C94 A;  5CKE A;  2M1H A;  4D6W A;  3OBY A;  5GAN 8;  2LT4 A;  2R58 A;  4DOW A;  4LDV A;  4HNV A;  1OYX A;  4EPC A;  2KSS A;  5GAM e;  5A2Q E;  4C0Z A;  2QI2 A;  3L2R A;  4C92 E;  1K9M C;  1D3B B;  3JCM h;  3MP8 A;  3EFS A;  4ELJ A;  1Y96 B;  2XU8 A;  3HFN A;  2RB6 A;  3OYI A;  4IUV A;  1RI0 A;  3JCM c;  2KVQ G;  5FRM A;  4J7I A;  4N4I A;  3JRZ A;  2QDJ A;  5CQX A;  2P4T A;  1BI3 A;  1M5Q 1;  3NTH A;  3SD4 A;  4F7U B;  4F7U E;  5LJ5 j;  5L8R E;  1KG1 A;  3RKY A;  3QO3 A;  3G4S A;  1YIT A;  3A8L B;  2ZCF B;  4MZT A;  4C92 C;  4ZN3 A;  4PJO D;  4MZM A;  4ZGD B;  1IRE B;  5FU6 B;  2ZPG B;  3HHT B;  2EWN A;  1SSF A;  3MHX A;  1UEB A;  3NFC A;  2XIC A;  4A4H A;  3G71 T;  3LX7 A;  4AKI A;  3JCM Q;  2CGH A;  3CXC A;  5GAN f;  2L3R A;  4XTX A;  3PTA A;  1QLB A;  4LDX A;  2XKO C;  5GMK m;  3OS0 A;  3CCQ T;  4JS4 A;  1KHC A;  2YLC A;  5IAY A;  4IUT A;  3JB9 F;  1YCY A;  3CCS T;  1QVG S;  3OSV A;  5GAN 4;  3OYL A;  3OS2 A;  5GAO r;  4HLQ A;  2VC8 A;  1G3S A;  1LNX A;  4C8Q D;  3PGG A;  4JLG A;  2DIQ A;  3HL8 A;  4OGC A;  3JCM e;  2ZPI B;  3OQ5 A;  4M78 B;  4ZTF A;  4M78 E;  1S72 A;  3QDR B;  4JJN K;  2X4Y A;  2ZPE B;  3HRU A;  3L2V A;  3GNG A;  3VYG A;  3VKH A;  1HXD A;  2OAU A;  4RMO A;  3QYB A;  4NS5 A;  1VQ6 T;  3PIO A;  4VUB A;  2DVE A;  4XK8 E;  1NE8 A;  4PJO C;  1IZ6 A;  4C0D B;  3DB3 A;  4N4H A;  3ER0 A;  1VQ4 A;  3CD6 T;  3A8O B;  2QQ8 A;  2E5Q A;  2KMG A;  3H4C A;  4QQG A;  3VKI A;  3CC4 A;  1HK9 A;  3F70 A;  4C8Q B;  4C8Q E;  2EKO A;  3OYB A;  2CS7 A;  3ASK A;  1W4S A;  3BG3 A;  2K57 A;  2MAM A;  5LJ3 f;  2F69 A;  4M77 D;  2GQV A;  5GAN j;  2RK1 A;  3HPW A;  4C0D C;  1VQ7 T;  4KT0 E;  4CRI A;  2QQS A;  3CPW S;  1XNI A;  3R6O A;  4C8Q C;  3MEW A;  1YJW A;  4OB0 B;  2FVU A;  1RL2 A;  4C5E A;  2XG8 D;  3M58 A;  4RKU E;  4L6V 5;  4LDU A;  3LH0 A;  1VQL T;  2RM4 A;  2CZ0 B;  3MP6 A;  5CKH A;  3VJP A;  4LDY A;  5CCA A;  4J5Y A;  3OYY A;  4FT4 A;  3EFR A;  5I21 A;  1M1F A;  1K73 U;  3CC7 T;  2D0Q B;  4J6W A;  5D6X A;  2YHT A;  4M75 F;  2ZPB B;  2DKG A;  1M1K C;  1O9S A;  2QQA A;  4M77 B;  3LWH A;  3N5B B;  4M77 E;  1BYM A;  3CCL A;  1VIE A;  4R56 A;  4JUV A;  4C92 G;  4A4K A;  4M7D F;  1KHI A;  3VKG A;  5GAN 3;  1DJ7 B;  3OYE A;  3CCU T;  2F5T X;  4HCZ A;  5GAN 5;  2CKK A;  2DEQ A;  3NTK A;  2O4X B;  3J7A F;  2QF7 A;  2LCL A;  3M59 A;  4OB2 B;  3OYJ A;  5A0L A;  2DD5 A;  3GIB A;  4M77 C;  3GP8 A;  3DLM A;  3GOX A;  1OZ2 A;  1O75 A;  4IKF A;  1UGP B;  2MMP A;  1M8V A;  4NOY A;  1MHN A;  4HT8 A;  2GFA A;  5GAM g;  1WJQ A;  2LX9 A;  2QEX A;  3GLX A;  3CC2 T;  3HFO A;  2XID A;  3OYN A;  1QP2 A;  3PNW C;  3TW6 A;  5FRN A;  2E6Z A;  3LGL A;  5DLO A;  4JRK A;  3JCM P;  4OB3 B;  1VQO A;  1LJO A;  4PJO G;  2GFU A;  4EDU A;  1N27 A;  2DZC A;  2GCX A;  3MET A;  3OS5 A;  5GAM h;  3OMC A;  3V8J A;  5GMK i;  1NJI C;  2QFZ A;  3FDR A;  3FJP A;  1Q81 U;  5A0D A;  4NL2 A;  5DLQ E;  3L2U A;  1VQ8 T;  3WVE B;  1AHJ B;  3INZ A;  3JCM J;  2E70 A;  2JZ2 A;  3QYG B;  5HK3 A;  2DD4 A;  1FX7 A;  3OSS C;  2EQU A;  5GAO p;  1YJN A;  2I2L A;  2G3R A;  2VXE A;  4A53 A;  4RCB A;  4NC6 A;  4WF2 A;  4C8Q G;  3RIR A;  5I2S A;  1LOJ A;  3QZ9 B;  3BFM A;  3S6W A;  5GAM f;  2K3Y A;  3CC7 A;  2VGN A;  2VYT A;  3RKX A;  4A54 A;  5KE2 A;  2VUB A;  3V7S A;  5HKC A;  1WJS A;  3M5A A;  2BIV A;  3LLR A;  4JX6 A;  1PSF A;  2XHC A;  3CCR T;  1VQM A;  1JJ2 S;  2XI9 A;  4N0A A;  2XDB A;  3CCV T;  1I4K 1;  3WVD B;  3J81 E;  4QVD A;  2K2V A;  4M7A D;  2CZ6 B;  4OB1 B;  1QVF S;  3OYK A;  4HA8 A;  2L5Q A;  2EFI A;  3C12 A;  1M9S A;  2CZ1 B;  1N8R U;  3CCU A;  2OTL A;  5J3B A;  4C92 B;  3CME A;  4HNT A;  1VQ5 T;  1E7P A;  2DXB A;  4EMK A;  4V2S A;  3TRE A;  3Q1J A;  1M90 U;  4FL6 A;  1FWZ A;  5HK0 A;  3FIF A;  4QW2 A;  5FRO A;  4QQD A;  2D9T A;  4IUQ A;  4BDZ A;  1R8O B;  3VUB A;  4M77 G;  4QVC A;  2EQJ A;  3JCM X;  3QJ6 A;  3RUX A;  2DTO A;  4O6J A;  3CCM T;  1I8F A;  1WJR A;  4J83 A;  3OB9 A;  3OS1 A;  2OTJ T;  2ZZD B;  1H64 1;  3A8M B;  1N9S A;  4M7A B;  4FSX A;  3SB2 A;  2LCC A;  4M7A E;  2BKD N;  2RHZ A;  4J7F A;  2E6N A;  3CCJ T;  4F7U F;  3CC2 A;  1YI2 A;  2DTH A;  3LW5 E;  1VQP T;  3QPH A;  5GAM j;  2YRV A;  3HRT A;  3JCM f;  2E64 A;  1X6O A;  2V8I A;  3E1S A;  1OZ3 A;  3CEY A;  2XDD A;  1Q7Y U;  1KQS S;  3HP9 A;  4E7J A;  4ZGJ B;  4A4E A;  3H8Z A;  2LQK A;  4JDS A;  4M7A C;  4M75 A;  2WSE E;  1BI2 A;  4X9C A;  2QA4 A;  1GXI E;  1FXX A;  4Z6Y A;  2BS3 A;  1UGQ B;  5AYF A;  4BUG A;  4M7D A;  4PJO B;  4PJO E;  4PNO A;  4MML A;  2KMT A;  2VXF A;  3M56 A;  4ELY C;  3PIP A;  2PUK B;  3S3N A;  2KDS A;  3I56 T;  2E65 A;  1M1G A;  2PVG B;  3C95 A;  1UB4 A;  4MDW A;  5J39 A;  1KC8 U;  1KD1 U;  4XTZ A;  4J6Y A;  1WGS A;  2EIF A;  1Q86 C;  4MDX A;  4M78 F;  3P8B B;  2X4J A;  3E19 A;  3OW2 A;  4DQ2 A;  1YHQ T;  4JX5 A;  1VQN T;  1P92 A;  2DXC A;  3OMG A;  3T9N A;  1Y7X A;  1W2B A;  3CCR A;  4HNU A;  2HQE A;  1EIF A;  1YJ9 A;  2MWO A;  3SDZ A;  3SWN C;  4HKE A;  1JBM A;  2X4X A;  1QVP A;  2Y4Y A;  3HRS A;  3QYE A;  4FU6 A;  4E7I A;  3M53 A;  2QTX A;  2E10 A;  1VQ9 T;  5DY9 A;  1VUB A;  2RD1 A;  2NLU A;  2XD0 A;  3QYH B;  3A8G B;  1Y71 A;  4TVR A;  3JSC A;  3OA6 A;  2CYZ B;  1K8A U;  3A5Z B;  3BY7 A;  5LJ5 d;  3CCE A;  2R57 A;  4M75 D;  1NJI U;  3JB9 H;  4ZGE B;  3MCA B;  4L59 A;  4XU1 A;  5CO7 A;  5D6W A;  5KCH A;  3OYH A;  2MI6 A;  1XTD A;  4HT9 A;  3WXM B;  2DPP B;  4MIM A;  3CBO A;  3CCM A;  3FB9 A;  2X35 A;  4IUP A;  4J6X A;  5CAI A;  4M7D D;  3M4Y A;  2LT1 A;  2C06 A;  2FYK A;  2Y4X A;  3DKM A;  3CCJ A;  3BW1 A;  3JAM E;  4X9D A;  4OMF B;  3CXC S;  4GY5 A;  4XTU A;  4CI0 C;  3G71 A;  2RHU A;  5GAN 2;  1B34 A;  4MZP A;  3JCM b;  5DM7 R;  2EQM A;  2QXF A;  4JX4 A;  3CBP A;  2L89 A;  1U1S A;  2PQW A;  3X26 B;  4XTY A;  4BI3 A;  3C4S A;  3CCQ A;  3CCS A;  4JS5 A;  1VQK T;  2FB7 A;  4NL3 A;  4M7A G;  4C0G A;  1YIJ T;  3AHU A;  2RI5 A;  4XAX B;  2G77 A;  1G3W A;  2JNG A;  3G6E T;  1BIA A;  2GF7 A;  3QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...