4OB1B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via co-crystallization
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
228
structure length
228
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Hydrolase
total genus 73
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob1B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob1B02
3LW5E 3A8OB 2ZPEB 1PSEA 2ZPIB 4XK8E 2DD4B 4OB3B 1UGRB 1AHJB 2DD4A 2ZPBB 3A8GB 1JB0E 2CZ0B 3A8HB 3X24B 2AHJB 2CZ7B 2ZZDB 2ZZDA 2PVGB 4ZGEB 4Y28E 1IREB 2DD5B 1UGSB 1PSFA 5L8RE 3X26B 2DXBB 2DPPB 3X20B 1UGQB 1QP3A 3A8LB 2CYZB 3HHTB 4OB2B 3VYGB 4FM4B 2ZPHB 2DD5A 2WSEE 3VYGA 2PUOB 2CZ1B 2ZPGB 4ZGDB 2WSCE 2QDYB 3QYGB 2DXBA 2O01E 3QZ9B 4KT0E 4L6V5 4ZGJB 2PU9B 3VYHB 4RKUE 3QZ5B 3WVDB 1QP2A 2PUKB 2CZ6B 3WVEB 3QXEB 2D0QB 2PVOB 1GXIE 3A8MB 1UGPB 4OB0B 2WSFE 2ZCFB 4OB1B 1V29B 3QYHB 3X25B 2DXCB 2ZPFB 2DXCA 1DJ7B 3X28B 2PVDB
chains in the Genus database with same CATH superfamily
1K8AR 4JJCA 4JS4A 1AWOA 4CFNB 2I2LA 3QDRB 3I5SA 2EFIA 1PKSA 2RA2A 1T0HA 4PK4A 3O8VA 5GANf 2KXDA 2G9XB 1YHQA 2X9HA 5CIUA 3OA6A 2JVVA 4ESRA 5LJ5j 4PJOC 2HKNA 2YSQA 1W2BP 4C8QB 4C8QE 1OV3A 1VQOT 1Z9ZA 3DL1A 1VYTA 5I2SA 1N5ZA 3FRNA 3RBBB 3MO8A 2XD0A 4ZN3A 5GAMd 1AWJA 1G3WA 1NE8A 1ZUKA 4CI0C 1TWBA 4PJLA 3M58A 3G6EQ 1VIFA 2DXBB 3X20B 2HBWA 3CCMQ 1UGQB 3RMQA 2BS4A 2HSPA 2QEXT 3QKJA 3MP8A 1I5LA 4BUGA 2XI9A 4Z8AA 2L0AA 5KYXA 1PRMC 4C8QD 1WXBA 3VYGA 4J7IA 2YUOA 2CCHB 4CRIA 1AVZC 1RAFB 5IXBA 3JB9G 4NL3A 2R7GA 2IVXA 1GRIA 1H27B 4FW1A 2DJZA 1FMVA 3ZL7C 2VGNA 4BCQB 1WHJA 3M0UA 4GLMA 2CT3A 2RQWA 5GAOq 3JCMQ 1NPRA 5CK9A 3OB9A 5FGKB 2QGGA 4L5GA 2XMFA 4LD6A 5D6XA 2D0QB 1K76A 2E3IA 4II5B 2W99A 1B34B 1UEBA 3EH1A 5CO7A 4ZNXA 2C0TA 3MP6A 3ZBDA 5KCOA 3CCEQ 2VXFA 2C06A 3CC4T 4F7UA 5IT9E 3TW7A 3ZFJA 2F1LA 1WHHA 1C9BA 2H8HA 4LNPA 1SHGA 5FRMA 2VUBA 2GBQA 2UZLB 4RTTA 1QMCA 4TVRA 1W2BA 2MWOA 3PIPA 5HKCA 3QHRB 1VQ9T 1YITQ 4DEYA 1Y71A 1S72T 2WACA 4Z88A 2O31A 3CCQA 5CEIB 2DE0X 2V8KA 1WI7A 2BIVA 2OI3A 1KC8R 4PKCC 3EH2A 2AZVA 5HQ0B 2DL8A 2GFUA 5L8RE 1KQSS 1RACB 1NEBA 2M51A 1GCPA 4XU2A 2YRDA 3CMEQ 2RHXA 2LQKA 4IUUA 2FPEA 2DXUA 3TNHB 4RTXA 4BCGB 4HVVA 2ED0A 4MMLA 1OIUB 2DEQA 2DFUA 2L8DA 4F6WB 2GFAA 2J6OA 3HP9A 4E7HA 3VS1A 1VQNT 1KHIA 1VQLA 5A2QE 3CEYA 4C92B 4ME7A 3CCJA 5LJ3d 1WX6A 3RKYA 1VQ7A 4F7UG 1WGSA 4J83A 1K0SA 3JSCA 2DM1A 1H1RB 1OQKA 3MHXA 4NL2A 2CSIA 3CMAT 1GFDA 1D3BB 3HRTA 3CCUQ 1SSHA 4JLGA 2FZKB 4OF1A 1ENWA 4EOLB 1YIJT 2CZ6B 4JUVA 3URGA 9ATCB 2JW4A 2BS3A 4GY5A 4JJDA 3EFOA 2X51A 2RH2A 1V29B 3BG3A 2MF2A 1KD1U 2L3SA 3VS5A 3X25B 3EIDB 4HVUA 3QYEA 3JB9F 1KD1C 2RHYA 2QF7A 2FEIA 2H3JA 5D6WA 3I35A 2LC4A 4L59A 3JCMh 3CCVA 4HNVA 3BHVB 2ZPEB 3JCMP 3H0IA 1M30A 2D6FA 1E7PA 5LJ5g 1URCB 1TS9A 4KGVB 4DBHA 3PIOA 2ZPBB 1NJIU 2E12A 2YXYA 1YFNA 1BBZA 3JCMb 1JEGA 2W9ZA 4BACA 1VQ6Q 4KRDB 3OYBA 4BCFB 3CC7T 2X3WD 4YOOA 2LDMA 1AD6A 4M75G 5LJ5f 2ZZDB 2X1NB 3MP1A 1M1GA 3JB9H 4J9BA 4RCCA 4WF2A 2EJ9A 1S1NA 2DYIA 1VQMQ 4BE0A 2KY9A 4RG2A 2KK4A 2PNIA 1X43A 1OU8A 5GANd 1UHFA 4UC4A 2KT1A 2LJ3A 4EONB 2RHZA 3OYIA 1O9KB 2QASA 4MFEA 3FJ5A 2DL7A 2RQRA 1WYXA 3CXCS 1Y7XA 5M9OA 4J9DA 2KXCA 4KRTA 3VV0A 2EKHA 1P92A 3I56Q 3HHTB 5FW9A 5IDPB 5HNBB 1TSFA 2RB6A 2XICA 2A3LA 4HVWA 4ORZA 3G6EA 1NPPA 2OAWA 4HL4A 2HQXA 2K2VA 4F70B 2NUPA 3JCMe 3CCMA 3UWNA 1D1CA 4E7LA 3TNWB 3QYGB 3BLHB 3HTRA 3MIAB 7AT1B 3PFSA 4EOOB 2QA4T 5I5ZB 3TU4K 2WIHB 4C92C 1VUBA 1WJSA 2RJFA 1X6BA 1Q7YR 3DB4A 5BNJB 2V22B 2LMJA 1V76A 4EMKB 5KH6A 2QQ9A 3META 4KH0B 2QYZA 2I53A 1JRIA 2AK5A 1WA7A 2JJ9A 2E70A 5GANe 1D0XA 2CP7A 2MCNA 5GAN5 1M1KC 5C0MA 4LN2A 2WMBB 5GMKh 2BUDA 2CGHA 3LW5E 4M6VA 1UUEA 3FJPA 1YJ9Q 4M7DG 1VQKT 1D09B 1UG1A 1D3UB 3QO3A 1AHJB 5KYUB 4B9XA 3G71Q 4BY6C 3CCEA 5KYWB 4M7AG 3X24B 2CKKA 4JJNK 1O9SA 1G83A 3EG1A 2HMAA 1NEGA 1Q82R 4N0AC 1VQPT 1OI1A 4ZGEB 2QGSA 4HT8A 1UGSB 3M54A 2P0KA 1ZHIA 4PJJA 3ME9A 4OMFB 2GF7A 2OTLT 5L2WB 3QHSA 4J9EA 1YITA 3P8HA 3PO3S 3I55Q 2JMCA 1ZSZB 3OSVA 4QVDA 2FL7A 1JO8A 3A8LB 4EMHA 1N8RU 2A28A 4Z02A 2QTVA 1OU9A 1CKAA 1VIEA 4M75F 1QWEA 4E7SA 1IZ6A 3HSBA 4OR5B 3V7CA 3QUIA 3CCLT 2QK0A 4FX3B 1BU1A 3CMEA 2OTJQ 4PFOA 2GTJA 5GMKe 2RI3A 2EPDA 4J6YA 4MDXA 2GQVA 4B6MA 2PU9B 2XK0A 2ROLA 2DJQA 3HL8A 3M55A 1WIEA 2KYMA 3H6ZA 1WHKA 3WVDB 1M8MA 2CH4A 2FB7A 3WVEB 3CBMA 2CP2A 1KQSP 4BCKB 3QG1A 2C6TB 2WIPB 2LQ8A 1RUWA 2XDDA 2EJFA 3PMIA 4RTUA 1O75A 3SEMA 4EOKB 3J80E 3CD6T 1OL1B 1WDXA 1WHGA 1YWPA 5IN1A 4EMKC 2BZXA 1IXDA 5GAOn 1WLPB 3CCUA 1DJ7B 2FZGB 3UDCA 2DTIA 1GBQA 2AKKA 3E2UA 3PT9A 4PNOA 1N9RA 4LDXA 5GMKj 1Q95G 2WPAB 2GGRA 3RMSA 3CPWS 1VYWB 4YOZA 4XTXA 3DJBA 3GNGA 4F17A 2EYWA 1VQ8Q 3MKDA 2DX1A 1QLYA 4XU3A 5GAOr 4F6UB 2KI7A 2C5XB 3BG5A 1XJWB 4F7NB 3I5RA 3CBOA 5IH2A 4DQ2A 4M77G 4II1A 4PJOB 2VYTA 4PJOE 1W6XA 1PWTA 4M7DF 1VQ6A 2RNAA 1WQ7A 3UF4A 1M3BA 1YJWT 3MJXA 5LJ5d 4OMNA 2IW9B 3OYNA 2CYZB 1H28B 3DLMA 3TVTA 1PNJA 1YI2Q 4M7AF 2W9FA 4C5GA 1VQMA 4DOVA 4OGRB 3BFMA 4X9DA 3J81E 1X27A 1FMWA 3CC2Q 4I3ZB 1ZSZC 2KGTA 4OB2B 5KCHA 1X01A 4BI8B 4CC4B 3JCMJ 1JQQA 1OX8A 6AT1B 1ZP2A 4DA4A 4J8OA 1TXQA 3S6WA 2DBKA 4MZPA 4BE2A 4GLKA 3SB2A 1U1TA 2DVJA 4PJOD 3M56A 3I56A 3M0SA 4YC3B 1K8AU 1PKTA 1T3SA 5CKEA 2F69A 1I07A 2J7IA 3PMTA 1KQSA 3QIIA 2DRKA 4YTLA 4J9IA 1OL2B 3EGXB 1QQJA 3QXEB 1C0MA 3NGPA 1HD3A 2V1QA 4Y72B 5GAN2 1VYUA 1UNLD 1UTIA 1E6HA 1XTDA 4KBMB 3JCMg 2BZYA 3CXCP 4RTWA 2KRNA 5J39A 5J26A 3M4YA 4RTZA 2KR3A 3DDQB 1JKWA 2O4XB 3LGLA 2M9UA 3FEOA 4M78A 1FVVB 1YJNT 2F5KA 2DYBA 3JCMf 1M4ZA 2DD4A 2DIQA 3A8GB 1OGUB 1QCFA 1JB0E 4J9GA 4IURA 2RQTA 2W10A 3A5ZB 4BB7A 1VQOQ 5EC7A 4JPBW 3C95A 4F14A 3QDFA 3H4CA 1K73R 1D1AA 1M5Q1 5KYXB 3VJPA 3OMCA 1YJ9A 4Y28E 1IHWA 1M3AA 2KBTA 1YN8A 1XOVA 4C0DB 2ZGWA 4JX4A 2F2WA 1GUXA 2JTFA 2C5NB 2C0IA 2LX7A 4NS5A 3GIBA 4CFVB 3JAME 2RK2A 3HKSA 3OYKA 3G71A 3OS5A 3N5BB 2OX7A 2CREA 3E1SA 2QEXQ 1VYVA 1WNLA 1I81A 3H41A 2OJ2A 3GPLA 1PD0A 2ENMA 2JS2A 2E1HA 4XTZA 3FC3A 2JN0A 4RUGA 4IIMA 4C0FA 8AT1B 2Y90A 2F2VA 4FM4B 1H641 1BK2A 2M02A 3OBYA 1IHVA 4XQ3A 3I55A 3NTIA 3MY1B 4M77F 3OQ5A 2IW6B 1YWOA 4PFPA 3LWHA 4KT0E 2LVMA 4V2SA 4ZGJB 3POMA 2YRCA 3M5AA 2EYQA 8ATCB 4M78G 4LE9A 4QQGA 2RO0A 4BCMB 4NC6A 3M4GA 1FINB 2YT6A 2OTJA 2AT1B 4CC3A 4AFZC 1ZUUA 1QVFS 3D7SB 4AKHA 4F04B 4WTOB 3CXCA 3HBLA 3CC4Q 2EYXA 4A53A 2DL4A 3F5XB 1N4MA 3EG9A 3GBQA 4XU0A 1AD5A 1NLOC 5A0LA 2KEAA 1H1PB 1H92A 3S3OA 2HSEB 5GAOp 2RK1A 1KC8U 2K5FA 3L2QA 1VQ4T 1KC8C 4F7LB 3SFMA 1OZ3A 4BCMD 3RKWA 1VQ9Q 4XTVA 4C5IA 1G3YA 4JJBA 1S72Q 2GTOA 3AHUA 2AZSA 1B07A 4GBQA 5FU7B 4VUBA 3BE3A 4XTWA 2RD1A 4M75B 4C8QA 4TTHA 3VRZA 3L42A 1MHNA 2KT8A 3EJ1B 2QTXA 4NOYA 3EAEA 1H25B 2K3YA 1JSTB 4BCQD 3MPUB 4OP0A 4DBRA 1H1QB 3VU3C 3BLQB 5CQXA 1IGQA 1TUGB 3SWNB 1VQ8A 2FVUA 4C0DC 4QW2A 4CFUB 5DM7R 1JJ2S 4FL6A 4FU6A 1PC0A 1GBRA 3QSUA 1M3CA 2X35A 2A36A 3CCST 4ELZC 1VQNQ 2B8AA 3DDPB 2L3QA 4R0KA 4N4HA 4A4KA 2KRMA 4F6SB 2BS2A 2KVQG 5CKFA 3UA6A 3EFOB 3HPWA 2G77A 3CPWP 4BCIB 3OYJA 1FYNA 1W1FA 2RJDA 1C6VX 2DLPA 3PVQA 5I11A 2BPMB 1OULA 1YI2A 1BIBA 3CQTA 3R6NA 1YIJQ 4LD9K 3CC2A 4CFUD 2E64A 1QCNA 2EGEA 2V1RA 4MFDA 4A4FA 5EG2A 2K3XA 3VS2A 1LPLA 2D0NA 1QP2A 2C5VB 2PVOB 5J3BA 5HK3A 2XG8D 4Y91A 2YRVA 2LCCA 2YLCA 1SKUB 2GQIA 1B34A 1G8XA 4C92E 2CT4A 3U23A 2RN8A 1BU2A 2KMGA 2I40B 4KUDK 1TD6A 3EFSA 4RG8A 5GMKl 4EPCA 1PM3A 1G5VA 3Q1JA 3HRUA 3RUXA 1B7TA 3JCMW 4D8KA 2E10A 1I4K1 4M78F 4XK8E 4F7SB 4OB3B 1ABOA 1BYMA 3VS4A 4M7DB 2LX9A 3AT1B 4M7DE 1JSUB 1GCQC 3BLRB 2KROA 5GJWB 3LGFA 4BCHB 3L2VA 5GMKm 2K79A 5CCAA 4M7AB 1CSKA 1KSWA 4C92D 4C5EA 1HSQA 2AKLA 2A08A 3IQLA 1X6GA 4EOPB 4ZTJA 4JX6A 1FX7A 5FU7C 3JCMd 3O5ZA 2QQSA 4BY6B 4EIKA 5KE3A 3C0CA 1H3ZA 4M75C 2IN3A 1X2QA 1VQOA 4NSTB 4PJMA 1NJIC 3MEUA 4X1VA 2BKZB 4EC8B 2KDSA 2K5LA 5CKBA 4D6WA 3OY9A 4LOCA 5GAOl 1XNIA 3V8JA 2D1XA 4CFWB 5GAN4 2WHBB 1NBEB 3H0FA 3PVLA 3SWNC 4EDUA 3P8BB 3VUZA 1Q7YU 2X4XA 3OYFA 2DILA 4K11A 2LQNA 2QQRA 3CPWA 1Q81R 2DD5A 1Y07A 2DKGA 2LP5A 5IHKA 2QEXA 4MIMA 1NLPC 1IB8A 4QSHA 2QA4Q 5CR2A 1MV0B 2R57A 1T3LA 5GAOm 3QZ9B 1IRXA 4N4GA 4PL6A 2D9TA 2UZEB 5LL6S 2RPNA 1D3BA 1IGUA 1RL2A 4IUTA 2DIGA 1HK9A 1RAAB 4JRQA 2PUKB 2MYSA 1U5SA 2M0YA 3ER0A 1K0XA 3E9GA 2CH4W 3CBPA 1SEMA 2PK9B 2PK2A 2XKOC 3MEVA 2YDLA 2E3HA 1YCSB 4RMOA 1OYXA 4X9CA 1KD1R 2E6NA 1Q82U 4OMOA 2QQBA 2CUDA 4FT2A 2R5MA 1VQKQ 1BKBA 3OSSC 2ED1A 3HFOA 1H8KA 1QW1A 3M53A 4AFSC 1VQ5T 3CC4A 2X4JA 3EGDB 2RJCA 2OAUA 1VQMT 2DVEA 4N0AA 3BHUB 3VS3A 4XTUA 1VQPQ 3A8HB 1NG2A 1ZLMA 2MWPA 3UPUA 4LDWA 1Q86U 3EHRA 5A0DA 4M7DC 1OPKA 1Q86C 2V26A 3JV3A 4F7UF 2ZZDA 4EORB 3TN8B 2DAQA 4KUIA 4R56A 4IMYB 2LQWA 1U06A 1XQHA 3NPFA 2OTLQ 3QJ6A 1MNEA 1VQ9A 3RNJA 3GLXA 4M7AC 4A54A 1S72A 2HL5C 1QVFP 4BCPB 1E7OA 2EKOA 4M77B 5FLXE 2MIOA 2VASA 1O9KA 3TQ7P 2DPPB 2A0FB 3MEWA 5I2MA 1LCKA 4FYWB 2DERA 4B9WA 3CCLQ 2CP5A 5LQFB 1OIYB 1H4LD 3V7SA 3KBGA 3QWYA 4BDYA 3H0HA 4C0GA 4KULA 4OMPA 1H26B 4YOSA 2K3BA 2CZ1B 2QDLA 2ZPGB 2HD0A 2EJGA 1EZZB 5IHIA 5ICPB 1VQNA 4G6LB 3VKHA 2UUEB 5IXFA 2JT4A 1N27A 1EIFA 1NYGA 2VGMA 2X4YA 3VYHB 4HCBA 1YBYA 1OX9A 1N8RC 2VXEA 4QQ6A 2DF6A 2RI5A 1WXTA 2JTMA 1HYOA 1MNDA 5I21A 3G4ST 4QVCA 1GXIE 2K2MA 5GAMf 3OYAA 3CD6Q 5EJCA 2WSFE 2C4GB 4EOJB 3NTHA 3OYGA 1YJ9T 1R0CB 3HFNA 1YIJA 1JJ2P 3L2WA 1M1KR 2KRSA 4LDVA 2DXCB 4ATOA 4IUVA 4JRPA 1KQ2A 3S3NA 3LX7A 3ULRB 2DTOA 1H1SB 1U1SA 1YHQT 4M4ZA 1I0CA 2LRQA 5KYYB 1KK7A 4PFZA 2SEMA 4OMLA 1B3QA 2ROTA 4FSXA 1ZBXA 4FCYA 1OPLA 5CYIB 5KYWA 4A4GA 3DOGB 1XO2A 3GF5A 5DQVA 5FWCA 5GAN8 3B57A 4RODA 1TG0A 2EW3A 2XDBA 1VINA 1QVFA 1RADB 5A0GA 1YJWQ 4KGZB 3TCJA 2EVRA 1ZA1B 2EQMA 1NZ9A 1QVGS 3NDQA 4BD3A 3CCRQ 1LNXA 2C5OB 4KH1B 2RI2A 1RAHB 2NUTA 4E7JA 2CUBA 2E41A 3SHWA 1BIAA 3PNWC 2M0OA 4M77C 2JNGA 1E6GA 1W70A 1YNZA 3V7RA 1M90U 4CRLB 5EFQB 2CP0A 4ELYC 2K4YA 3EFRA 1M90C 3M57A 2DTHA 2KQWA 2LZ6B 3A1PA 2H3EB 1UE9A 1RAEB 2P0PA 2MOXA 4L6V5 4E7ZA 1AT1B 1WJQA 3JRZA 3QHWB 1KJWA 2DL3A 2C0OA 2KSSA 2PTKA 2X4WA 1QVPA 3HZJA 1Y96A 2G3RA 1BI0A 2QA4A 2KE9A 1JJ2A 4EOMB 1V1CA 1Y57A 2ZCFB 1UNGD 2W96A 3QYBA 3L1AA 1TOVA 2L5QA 3EOCB 2FPFA 1YJNQ 2P0QA 4XTYA 3QBYA 2GNCA 5D7UA 2PMIB 1D0YA 1K8AC 3BW1A 1AOJA 5C6SA 3QWLA 1PG5B 2DBMA 5DQWA 2CJMB 2RQVA 3BY7A 4AMCA 1ZBJA 3CCQT 1TUDA 4ANJA 4BY7X 1PD1A 1VQKA 2RMOA 3QPHA 2AHJB 5ACBA 3M0TA 4FW2A 4OMMA 1SRMA 2Z0WA 1TU0B 3JB9D 4EMGA 3C12A 2J6FA 1YI2T 2HQHA 4J6XA 3BDLA 1K4US 1W98B 2JTEA 2CCIB 1K9MR 5HBHB 1VQPA 4ROCA 4PJOA 2K6DA 3X26B 1OOTA 4FT4A 2E5KA 4MDWA 3VS7A 1VQLT 4CC7A 4BE1A 2OTLA 4HXJA 2ECZA 2MMPA 1AZGB 2FHDA 3O0GD 2HEQA 2NWMA 3CCJT 1SF9A 3VYGB 3NTKA 1VQ7T 3NMZC 4QT7A 4E47A 3RESA 1SSFA 3HB9A 1RAIB 3FLGA 4OMQA 1TUCA 2PUOB 3M0QA 4RTVA 1QKWA 3C94A 4AKGA 2WSCE 4FYYB 3K7AM 2QDYB 4LDYA 4OGEA 3M59A 3CCLA 5KYNA 1UHCA 2G6FX 2V8JA 5I22A 2BTTA 4EOIB 2L2PA 3E9FA 2JM8A 1P5EB 1UJ0A 5IDNB 3QZ5B 3FDRA 1QWFA 3JCMV 1HXDA 1ZQ1A 2IPOB 1M2VA 2J06A 1MMGA 3EHQA 3EGXA 4ROEA 1J3TA 2XDPA 4MZMA 1OZ2A 4M78C 4OB1B 1FWZA 1G3SA 2WJ9A 2YUNA 3CCVT 2P4RA 2YHTA 2EYYA 1X6OA 2CP3A 5AT1B 1VQ4Q 1RABB 4IKFA 4F7UB 1H24B 1KG1A 4F7UE 2QXFA 1SG5A 1RI0A 2DA9A 3A8OB 3M0RA 1HJDA 5GAMh 2O4XA 4PJOG 3CD6A 3SDZA 2XIDA 4BBRM 1UGRB 3VRYA 3DKMA 2FO0A 3E19A 2BE7D 1G2BA 2DRMA 4O5VA 4EOQB 5CAIA 2BE9B 4BY1X 2JMAA 1N6AA 2RF0A 2EBPA 4X34A 4D8DA 1FXXA 1E9HB 2UZDB 3G1JA 4DEXA 2QGFB 1AISB 2UZBB 4RCBA 3JB9I 3CCSQ 2DZ9A 3ASKA 1WZOA 3LWIA 2EQUA 2EIFA 3L2UA 1QP3A 3BHTB 4JDSA 3M03A 3G6ET 4Q5WA 5IHYA 3H8ZA 4HLQA 4M75E 4KGXB 3CCMT 1YJWA 1UDLA 4A4HA 1R8OB 4HT9A 3G33B 2ZPHB 1WHLA 2BKDN 1MUZA 4IUPA 4HNTA 4C5HA 3CCRA 3NFCA 2DXBA 2B9RA 2K7AA 4PLIA 5GAMe 3OYDA 1KQ1A 1RLQC 1UGVA 3I9QA 3RDVA 2WXVB 4Z6YA 2EWNA 1UJYA 1VOMA 2P4TA 2ESWA 1GL5A 1LVKA 2IIMA 4AG1C 3V8LA 4M75D 3L2RA 4AT1B 2EAYA 1QVGP 5FWBA 1UGPB 5D6YA 3MY5B 5CKHA 1IO6A 2CSQA 1X75C 2VV5A 3CMAQ 1M2OA 1MGQA 1NYFA 3FB9A 1TFBA 1UNHD 1QLBA 3TSZA 1EFNA 3OYHA 5GAN7 1F1BB 1GCQA 2COWA 3WXMB 4UN0A 5FRNA 4AG2C 1JOWA 3CCET 2ABLA 2EUFA 2D8HA 2I0NA 2ZPIB 2JM9A 4C8QC 2A37A 1OKVB 2FRYA 5GAMj 3MEAA 1GY3B 2L89A 2KNBB 1VOLA 1YJNA 2DO3A 1LOJA 4C8QG 2JZ2A 3OYMA 4FIBA 1X2KA 1SPKA 3REAB 1WHMA 2WFYB 3A98A 4J6WA 4M75A 2DMEA 1YITT 3DB3A 3JB9J 1IREB 1Q81U 2PJQA 2DD5B 2FG0A 4CXAB 1QCOA 3S3MA 4CFMB 1Q81C 2RHUA 3OW2P 3BDUA 2KAFA 4PJOF 5LJ3h 3CC7Q 3KFVA 3QJYA 4HCZA 3SWNA 2D8JA 2LJ1A 2COYA 1K1ZA 2JXBA 4HA8A 2R58A 3LLRA 4DBQA 4M7AE 2WEVB 5GAN3 3CMET 3LH0A 1MMAA 1MMNA 2LTOA 4ELJA 4E7IA 2LNVA 1PRLC 2DEUA 3H9NA 3MCAB 2L3PA 4BCOB 2JOYA 3M0PA 4BI3A 3VKGA 3UATA 2NUZA 2WMAB 1SHFA 4AFUC 2EGCA 2LCLA 2MAMA 2NUPB 4LUEA 3OYYA 4FSSA 4JRKA 4M7DD 2O01E 3EG2A 2DXTA 4R55A 1ZX6A 3F70A 4HNUA 3L2ZA 1AEYA 1FMKA 1ACMB 4RKUE 1QVGA 4M7AD 1Q7YC 4BBSM 4J5YA 4IUQA 3UT1A 3CCUT 2HDAA 1JXOA 2E5QA 5DLQE 3OS2A 4BDZA 5IAYA 5DLOA 1VA7A 1AWWA 4C92A 4O6JA 1WXUA 2O9VA 2XU8A 2YWWA 2KR6A 3OBWA 4BXXX 2XHCA 5GMKi 2VWFA 4F7JB 2MK5A 1VQ5Q 2JS0A 5LJ3e 1BI2A 2RHIA 1U8RA 5GANh 3M9QA 4EC9B 5HK0A 4QVZA 3RGFB 4JZ4A 3LYIA 4FYXB 4M7DA 4LXCA 1M9SA 2QQAA 5CVIA 1VQ4A 3THKA 2PHGA 2F2CA 3VUBA 4M7AA 3ZEHA 1G3TA 2EYZA 2PVGB 1Q82C 1VQ6T 2LT4A 3OW2A 1LJOA 3PE0A 4IIOA 1RI9A 2YLBA 4WCIA 3C4SA 4OVAA 2R5AA 4N4IA 5CKDA 3GNFB 5CQYA 3VS0A 1NJIR 4XAXB 1AZEA 3PGGA 4AFQC 1U3OA 1BI1A 3RIRA 5LJ3j 1UECA 1QKXA 1WFWA 3SD4A 4C8QF 4DBFA 5IF1B 4DOWA 2WSEE 3OS0A 3TSWA 3I56T 3PTAA 5HBEB 1KIKA 4C92G 3CCSA 1OI9B 2PZ1A 1MMDA 2QG9B 1F5QB 4M77E 1TH7A 1Z9QA 2MPXC 1M1KU 2M1HA 2B86A 3G7ZA 5KE2A 2FZCB 4MZTA 2FYKA 1W2BS 3OYLA 2MI6A 2L3RA 2J6KA 4QQDA 3G4SQ 4AKIA 2YUPA 1OKWB 1JXMA 1ABQA 2RM4A 1BI3A 4CC2A 2LT1A 2O88A 2K9GA 2HZYA 4J9HA 5HBJB 1H3HA 2K57A 2K5IA 1QMZB 3V8KA 4E2FB 5FROA 4BCNB 4M77D 1YHQQ 5GAMg 4MMKA 2LJ0A 4LDUA 2VVKA 2E65A 1CKBA 2QI2A 3X28B 1KHCA 5FU6B 4Z89A 2HAXA 1TTHB 4C0ZA 3GOXA 2QQ8A 1YCYA 1OEBA 3DTOA 5GANj 3GP8A 1KXUA 3LQ5B 1KFZA 3EGDA 1ZA2B 3CMAA 2A7YA 2VB6A 4EMKA 1M8VA 2NUTB 1PHTA 2QDJA 2DL5A 3RKXA 2HBPA 1Q86R 3G71T 1ZSGA 1AWXA 1I1JA 4BCND 3TREA 3T9NA 2KMTA 1ARKA 5KYUA 4M77A 1BB9A 1NM7A 1JBMA 4A63B 2PQWA 2VKNA 4HCCA 5LMKB 3UA7A 4LUDA 2F5TX 1I5OB 1C1AA 2EQKA 1M27C 3I55T 2X3XD 4JRIA 2J05A 1Y96B 4J9CA 4AI6A 2JGZB 4XU1A 3OMGA 2E4HA 2QFZA 2F2XA 3CC7A 1I8FA 3JCMc 4ZGDB 1RAGB 2QAZA 3INZA 5IHNA 2IVWA 3TEEA 2OTJT 1ZSZA 2M16A 1A0NB 2DK3A 1N8RR 1WPYA 2HCKA 3RR6A 2O2OA 2ZAEA 4JS5A 3TW6A 4PJNA 3A8MB 3KUFA 1T0JA 2COZA 3QYHB 4Y92A 4C92F 5GAN6 2FPDA 5GJVB 2NYSA 2DMOA 4ZTFA 2E6ZA 4F16A 4A4EA 1R0BG 2DXCA 3RERA 2DETA 1D0ZA 4E7KA 2CS7A 4E6RA 4M78B 4J9FA 1R77A 4M78E 2AIRB 1PSEA 2GCXA 3CCQQ 1K9MU 2DD4B 5KYYA 3EGUA 2LCSA 2IG0A 1BCMA 3OW2S 1K9MC 2CZ0B 5FU6C 2DNUA 5LJ5h 4JLIA 1ZUYA 3P8DA 1VQ5A 1GFCA 2CP6A 3NHNA 1K73U 5HVYB 4BI4A 2CZ7B 3CCRT 2DZCA 3J7AF 1K73C 3KXTA 1RLPC 1K9AA 3CPFA 5HCKA 3HRSA 5LJ3g 1VQ8T 1GUXB 2O9SA 4JZ3A 1BCOA 3VS6A 1PSFA 3JCMX 4ELLA 2EQJA 3VKIA 2P84A 4KRCB 4CFXB 4M78D 3QWXX 2HNIA 1VQLQ 5AYFA 1N9SA 2HL3A 5ECAA 1WQWA 1MV3A 1GH6B 4OGCA 1SRLA 3CCJQ 5LJ3f 2W2HA 3GTMS 1VQ7Q 1FKMA 4ZN1A 3BG9A 2SRCA 3HO8A 3FIFA 2HQEA 2RJEA 3OYCA 2EQIA 1M2VB 4PLLA 1M90R 4JX5A 2FRWA 4HCKA 1UB4A 3MI9B 1D1BA 1UFFA 2BZ8A 2Y4YA 1YP5A 3TNIB 3CC2T 5DY9A 5HY6A 1Y0MA 1EX4A 2HKQB 3R6OA 4HKEA 4P5NA 1W4SA 2W0ZA 3OS1A 1PKDB 3OYEA 2LW4A 3REBB 1JU5C 4RTYA 2YUQA 2CDTA 2KYBA 3EG0A 3DLLA 3KHIA 5LJ5e 2RQUA 2JUFA 4QKUA 4BCJB 3CCVQ 2VC8A 1X69A 4OB0B 2EGAA 4FYVB 2Y4XA 3EG9B 2LNHB 5L23A 1M1FA 1G3NC 4EOSB 2V8IA 2IW8B 1WJRA 3G4SA 2ZPFB 5GANg 1PCXA 3EG3A 3LH5A 2ATCB 4J7FA 2NLUA 2PVDB
chains in the Genus database with same CATH topology
2DTIA 3HFOA 4JS4A 3WXMB 5FRNA 1QW1A 3PT9A 4PNOA 1N9RA 3CCET 4LDXA 3M53A 2I2LA 2ZPIB 5GMKj 3QDRB 2EFIA 4C8QC 1VQ5T 2RA2A 3CC4A 2X4JA 5GAMj 2RJCA 3MEAA 3RMSA 2OAUA 1VQMT 2DVEA 3O8VA 5GANf 3CPWS 4N0AA 4XTXA 4XTUA 3A8HB 1YHQA 2L89A 2MWPA 3UPUA 1YJNA 5CIUA 3GNGA 4LDWA 2DO3A 2JVVA 3OA6A 1Q86U 1LOJA 4C8QG 2JZ2A 5LJ5j 3OYMA 4FIBA 4PJOC 5A0DA 4M7DC 4C8QB 1Q86C 4C8QE 4XU3A 5GAOr 4F7UF 1VQOT 2ZZDA 3DL1A 4J6WA 4M75A 3BG5A 2DAQA 4KUIA 1YITT 4R56A 3DB3A 5I2SA 3JB9J 1IREB 1XQHA 3FRNA 1Q81U 2DD5B 3QJ6A 3S3MA 1VQ9A 3CBOA 3GLXA 3MO8A 4M7AC 1Q81C 2RHUA 2XD0A 4A54A 4DQ2A 4M77G 4ZN3A 5GAMd 4II1A 3BDUA 1S72A 1G3WA 2KAFA 1NE8A 2VYTA 4PJOB 4PJOF 4PJOE 2EKOA 4M77B 5LJ3h 4CI0C 4M7DF 1VQ6A 3M58A 5FLXE 1VIFA 2DXBB 1WQ7A 3QJYA 4HCZA 3SWNA 2DPPB 1YJWT 3X20B 5LJ5d 3MEWA 5I2MA 1UGQB 4HA8A 2R58A 3RMQA 3OYNA 2CYZB 2NLUA 2BS4A 3DLMA 3LLRA 4M7AE 4B9WA 4M7AF 2QEXT 3QKJA 4C5GA 3CMET 5GAN3 4DOVA 1VQMA 3LH0A 3MP8A 3V7SA 1I5LA 3BFMA 3KBGA 2LTOA 2XI9A 4ELJA 4X9DA 4BUGA 3J81E 4E7IA 2LNVA 4C8QD 4OB2B 5KCHA 1X01A 3MCAB 4BI8B 4BI3A 3VYGA 2JOYA 3JCMJ 3VKGA 4BDYA 4DA4A 4J7IA 4J8OA 4C0GA 4KULA 3S6WA 4CRIA 4MZPA 2MAMA 2LCLA 4BE2A 2CZ1B 2ZPGB 4GLKA 3SB2A 1U1TA 2HD0A 3OYYA 3JB9G 4NL3A 2EJGA 4PJOD 4JRKA 4M7DD 2O01E 1VQNA 3VKHA 2DJZA 3M56A 2DXTA 3I56A 4R55A 3F70A 2VGNA 4HNUA 1N27A 1EIFA 3L2ZA 2VGMA 2X4YA 5CKEA 1K8AU 3VYHB 4HCBA 1YBYA 4RKUE 2F69A 5GAOq 1N8RC 2VXEA 3PMTA 3JCMQ 4QQ6A 1NPRA 1QVGA 1KQSA 5CK9A 2RI5A 3OB9A 3QIIA 4M7AD 4YTLA 1Q7YC 4L5GA 5D6XA 4LD6A 4BBSM 2JTMA 5I21A 3G4ST 3QXEB 2D0QB 4J5YA 4QVCA 1GXIE 4IUQA 5GAMf 3OYAA 3UT1A 5EJCA 3CCUT 2WSFE 5GAN2 3NTHA 3OYGA 1YJ9T 2E5QA 1B34B 1XTDA 5DLQE 3OS2A 4BDZA 5IAYA 3HFNA 5DLOA 1UEBA 4KBMB 4O6JA 4C92A 1YIJA 3JCMg 2XU8A 5CO7A 3L2WA 3MP6A 2KR6A 4LDVA 3ZBDA 3OBWA 5KCOA 5J39A 2DXCB 2VXFA 3CC4T 2C06A 2XHCA 5GMKi 4IUVA 4JRPA 4ATOA 5J26A 1KQ2A 3M4YA 4F7UA 3S3NA 3LX7A 5IT9E 3TW7A 3ZFJA 5LJ3e 1BI2A 2RHIA 2O4XB 2DTOA 1U8RA 1YHQT 1U1SA 3LGLA 2M9UA 5GANh 3M9QA 3FEOA 4M78A 1YJNT 2LRQA 5HK0A 2F5KA 5FRMA 2VUBA 4QVZA 3JCMf 1M4ZA 2DD4A 3LYIA 2DIQA 3A8GB 1JB0E 4M7DA 4IURA 4TVRA 3A5ZB 1M9SA 4FSXA 2QQAA 1ZBXA 5CVIA 4BB7A 1W2BA 2MWOA 1VQ4A 3PIPA 5HKCA 1VQ9T 4A4GA 3C95A 3GF5A 3H4CA 1Y71A 3VUBA 1S72T 2WACA 4M7AA 3ZEHA 5GAN8 1M5Q1 1G3TA 2PVGB 1Q82C 3VJPA 1VQ6T 3OMCA 3CCQA 2LT4A 4Y28E 3OW2A 1YJ9A 2XDBA 1LJOA 2V8KA 1QVFA 1XOVA 2BIVA 2YLBA 4C0DB 2ZGWA 4PKCC 4JX4A 2JTFA 5A0GA 4NS5A 3GIBA 3OYKA 2GFUA 2RK2A 3HKSA 3TCJA 3JAME 3C4SA 4OVAA 3OS5A 2EQMA 1NZ9A 3N5BB 5L8RE 3G71A 1QVGS 1KQSS 2R5AA 4N4IA 5CKDA 3GNFB 4XU2A 5CQYA 4XAXB 3E1SA 4BD3A 3PGGA 1LNXA 2RHXA 1WNLA 1BI1A 2LQKA 4IUUA 3RIRA 5LJ3j 1I81A 2DXUA 2RI2A 3GPLA 4E7JA 2E41A 3SD4A 1BIAA 2E1HA 4XTZA 3PNWC 2M0OA 4M77C 2JNGA 3FC3A 2JN0A 4C8QF 4MMLA 4C0FA 2DEQA 3V7RA 1M90U 2Y90A 2L8DA 4DOWA 2GFAA 4ELYC 4FM4B 2K4YA 2WSEE 3EFRA 3HP9A 3OS0A 4E7HA 1M90C 1H641 1VQNT 1KHIA 1VQLA 3M57A 2DTHA 2KQWA 5A2QE 3I56T 3OBYA 4XQ3A 3PTAA 4C92G 3CCSA 3I55A 3CEYA 3NTIA 4M77F 3OQ5A 4M77E 1TH7A 4ME7A 4C92B 3CCJA 5LJ3d 3RKYA 1M1KU 1VQ7A 4F7UG 2M1HA 3LWHA 3G7ZA 5KE2A 1WGSA 2P0PA 4J83A 4KT0E 2LVMA 4L6V5 3JSCA 4MZTA 4V2SA 4ZGJB 2FYKA 1WJQA 3JRZA 3MHXA 3M5AA 4NL2A 2EYQA 3OYLA 1W2BS 2MI6A 2L3RA 2KSSA 4M78G 3CMAT 4QQDA 4QQGA 1D3BB 2RO0A 2X4WA 4AKIA 3HRTA 4NC6A 1QVPA 3HZJA 4JLGA 3M4GA 4OF1A 1Y96A 1YIJT 2G3RA 2OTJA 2RM4A 2CZ6B 1BI0A 4JUVA 1BI3A 3URGA 2QA4A 1QVFS 2BS3A 4GY5A 1JJ2A 4AKHA 2LT1A 3CXCA 3HBLA 2ZCFB 4A53A 2RH2A 1V29B 3BG3A 3QYBA 3L1AA 2K57A 2MF2A 1KD1U 2K5IA 4XU0A 3V8KA 2L5QA 3X25B 5FROA 3QYEA 4M77D 5A0LA 3JB9F 1KD1C 5GAMg 4MMKA 2RHYA 2QF7A 2P0QA 4XTYA 2H3JA 3QBYA 4LDUA 5D6WA 3S3OA 2E65A 2LC4A 4L59A 2QI2A 3JCMh 1KHCA 3X28B 2RK1A 5FU6B 5GAOp 1KC8U 3CCVA 2HAXA 4HNVA 2K5FA 3L2QA 1K8AC 2ZPEB 4C0ZA 3JCMP 1VQ4T 2D6FA 3BW1A 2QQ8A 1E7PA 3GOXA 1KC8C 5LJ5g 1YCYA 5C6SA 3SFMA 1OZ3A 3RKWA 3QWLA 5GANj 3GP8A 3PIOA 2ZPBB 1NJIU 4XTVA 4C5IA 2E12A 1G3YA 3BY7A 3CMAA 2A7YA 4EMKA 3JCMb 3CCQT 3AHUA 1M8VA 2QDJA 4BACA 3RKXA 2HBPA 5FU7B 3OYBA 1VQKA 3CC7T 2LDMA 4VUBA 3QPHA 4M75G 2AHJB 4XTWA 5LJ5f 2ZZDB 3G71T 2RD1A 4M75B 4C8QA 3MP1A 1M1GA 3L42A 3JB9H 4RCCA 1MHNA 4WF2A 2EJ9A 2QTXA 4NOYA 4EMGA 3EAEA 3JB9D 3C12A 3TREA 4BE0A 2KY9A 4RG2A 2KK4A 4J6XA 1YI2T 2K3YA 3BDLA 3T9NA 5GANd 2KMTA 4OP0A 4UC4A 3VU3C 1VQPA 5CQXA 4PJOA 3X26B 4M77A 3SWNB 2RHZA 3OYIA 1JBMA 2PQWA 1VQ8A 2FVUA 4C0DC 4HCCA 4QW2A 4MFEA 4FT4A 5DM7R 1JJ2S 3CXCS 2F5TX 4MDWA 4FL6A 4FU6A 1Y7XA 1VQLT 5M9OA 4BE1A 3QSUA 2OTLA 2X35A 2EQKA 3VV0A 4ELZC 3I55T 3CCST 2MMPA 1P92A 3HHTB 2FHDA 2B8AA 4JRIA 1Y96B 3CCJT 2RB6A 3NTKA 3VYGB 4AI6A 2XICA 4N4HA 4XU1A 3OMGA 4A4KA 1VQ7T 3CC7A 2QFZA 2BS2A 2A3LA 2KVQG 5CKFA 4E47A 3RESA 3G6EA 1SSFA 3HB9A 1NPPA 3HPWA 3FLGA 2G77A 2PUOB 3OYJA 4HL4A 2RJDA 2HQXA 2K2VA 3C94A 1I8FA 4AKGA 3JCMc 4ZGDB 2WSCE 3UWNA 3JCMe 3CCMA 4E7LA 2QDYB 3QYGB 4LDYA 4OGEA 3INZA 3M59A 1YI2A 3CCLA 2IVWA 3TEEA 1BIBA 3PFSA 2V8JA 2OTJT 2M16A 4LD9K 2QA4T 2DK3A 3E9FA 3TU4K 3CC2A 2E64A 4C92C 1VUBA 1WJSA 1WPYA 3QZ5B 2RJFA 3FDRA 4MFDA 4A4FA 5EG2A 2K3XA 3JCMV 1HXDA 1QP2A 1ZQ1A 3DB4A 2XDPA 4JS5A 3TW6A 2PVOB 5J3BA 3A8MB 4MZMA 4EMKB 2XG8D 3KUFA 4Y91A 1OZ2A 5KH6A 5HK3A 2QQ9A 2YRVA 2LCCA 3META 2YLCA 4M78C 4OB1B 1FWZA 1JRIA 3QYHB 1G3SA 2WJ9A 1B34A 4C92F 4C92E 5GAN6 3CCVT 2YHTA 2KMGA 2E70A 5GANe 1X6OA 4ZTFA 2E6ZA 4KUDK 4A4EA 4IKFA 3EFSA 4RG8A 4F7UB 5GMKl 4EPCA 5GAN5 2DXCA 4F7UE 2QXFA 1M1KC 5C0MA 1KG1A 3RERA 1G5VA 3Q1JA 3HRUA 3RUXA 5GMKh 4E7KA 1RI0A 2BUDA 2CS7A 3JCMW 2CGHA 3LW5E 4MDXA 4M78B 3A8OB 1I4K1 2E10A 4M78E 2O4XA 4M6VA 4M78F 5GAMh 4PJOG 1PSEA 2GCXA 3FJPA 1K9MU 3CD6A 4M7DG 1VQKT 4XK8E 3SDZA 2DD4B 2XIDA 4OB3B 4BBRM 1UGRB 3QO3A 1BYMA 1AHJB 2IG0A 4M7DB 2LX9A 3DKMA 4B9XA 3OW2S 1K9MC 3E19A 4M7DE 2CZ0B 5FU6C 3LGFA 5LJ5h 4JLIA 4BY6C 3CCEA 3L2VA 3P8DA 4M7AG 3X24B 4O5VA 2CKKA 5GMKm 4JJNK 1VQ5A 1O9SA 5CCAA 4M7AB 1K73U 4BI4A 2CZ7B 3CCRT 2DZCA 4C5EA 4C92D 5CAIA 3J7AF 4N0AC 1VQPT 1OI1A 1K73C 3KXTA 3CPFA 4ZGEB 4HT8A 3HRSA 5LJ3g 4ZTJA 1UGSB 4JX6A 1FX7A 1N6AA 3M54A 5FU7C 4BY6B 2QQSA 2P0KA 5KE3A 3JCMd 4X34A 1PSFA 1ZHIA 3JCMX 1FXXA 3ME9A 2EQJA 4OMFB 3VKIA 1H3ZA 2GF7A 4M75C 1VQOA 4M78D 2OTLT 3QHSA 2HNIA 1YITA 3P8HA 5AYFA 4RCBA 1N9SA 3JB9I 2DZ9A 3ASKA 3MEUA 1NJIC 1WQWA 3OSVA 3LWIA 2KDSA 2EQUA 2EIFA 2FL7A 2K5LA 4OGCA 4QVDA 5LJ3f 3L2UA 5CKBA 1QP3A 4JDSA 3A8LB 4D6WA 4EMHA 4LOCA 5GAOl 3OY9A 3V8JA 1FKMA 4Q5WA 3BG9A 4Z02A 4ZN1A 3H8ZA 3G6ET 1N8RU 4HLQA 5GAN4 3SWNC 1VIEA 1Q7YU 4M75F 3P8BB 4M75E 3VUZA 2X4XA 3HO8A 3FIFA 2HQEA 2RJEA 4EDUA 3OYCA 3CCMT 3OYFA 1IZ6A 4PLLA 1YJWA 2QQRA 3CPWA 3HSBA 4JX5A 4A4HA 1R8OB 3V7CA 4HT9A 2ZPHB 2DD5A 3QUIA 3CCLT 1Y07A 2DKGA 1UB4A 2BKDN 4IUPA 4HNTA 2Y4YA 4C5HA 2QEXA 3CCRA 4MIMA 3CMEA 3NFCA 3CC2T 5DY9A 4QSHA 5HY6A 5GMKe 2RI3A 5CR2A 2DXBA 3R6OA 2R57A 5GAMe 4HKEA 4P5NA 4PLIA 1W4SA 4J6YA 3QZ9B 1KQ1A 5GAOm 4N4GA 3OS1A 3OYDA 3OYEA 2GQVA 2D9TA 4PL6A 5LL6S 2PU9B 2XK0A 4Z6YA 2EWNA 3HL8A 3M55A 3DLLA 1D3BA 1RL2A 2P4TA 3KHIA 3H6ZA 4IUTA 5LJ5e 2DIGA 1HK9A 3WVDB 4JRQA 2PUKB 2JUFA 2FB7A 3V8LA 4M75D 3L2RA 3WVEB 3ER0A 3CBMA 2VC8A 3E9GA 2EAYA 3QG1A 3CBPA 1UGPB 4OB0B 2XKOC 3MEVA 1VQ8T 2LQ8A 5D6YA 5CKHA 2XDDA 2EJFA 3PMIA 1X75C 2Y4XA 2VV5A 1OYXA 4X9CA 1O75A 4RMOA 1MGQA 1M1FA 2E6NA 2V8IA 3J80E 1Q82U 3FB9A 1WJRA 3G4SA 3CD6T 2QQBA 2ZPFB 5IN1A 1QLBA 2R5MA 4FT2A 5GANg 4EMKC 5GAOn 3CCUA 1BKBA 3OSSC 3OYHA 4J7FA 1DJ7B 5GAN7 1XNIA 3UDCA 2PVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 E;  3A8O B;  2ZPE B;  1PSE A;  2ZPI B;  4XK8 E;  2DD4 B;  4OB3 B;  1UGR B;  1AHJ B;  2DD4 A;  2ZPB B;  3A8G B;  1JB0 E;  2CZ0 B;  3A8H B;  3X24 B;  2AHJ B;  2CZ7 B;  2ZZD B;  2ZZD A;  2PVG B;  4ZGE B;  4Y28 E;  1IRE B;  2DD5 B;  1UGS B;  1PSF A;  5L8R E;  3X26 B;  2DXB B;  2DPP B;  3X20 B;  1UGQ B;  1QP3 A;  3A8L B;  2CYZ B;  3HHT B;  4OB2 B;  3VYG B;  4FM4 B;  2ZPH B;  2DD5 A;  2WSE E;  3VYG A;  2PUO B;  2CZ1 B;  2ZPG B;  4ZGD B;  2WSC E;  2QDY B;  3QYG B;  2DXB A;  2O01 E;  3QZ9 B;  4KT0 E;  4L6V 5;  4ZGJ B;  2PU9 B;  3VYH B;  4RKU E;  3QZ5 B;  3WVD B;  1QP2 A;  2PUK B;  2CZ6 B;  3WVE B;  3QXE B;  2D0Q B;  2PVO B;  1GXI E;  3A8M B;  1UGP B;  4OB0 B;  2WSF E;  2ZCF B;  4OB1 B;  1V29 B;  3QYH B;  3X25 B;  2DXC B;  2ZPF B;  2DXC A;  1DJ7 B;  3X28 B;  2PVD B; 
#chains in the Genus database with same CATH topology
 1K8A R;  4JJC A;  4JS4 A;  1AWO A;  4CFN B;  2I2L A;  3QDR B;  3I5S A;  2EFI A;  1PKS A;  2RA2 A;  1T0H A;  4PK4 A;  3O8V A;  5GAN f;  2KXD A;  2G9X B;  1YHQ A;  2X9H A;  5CIU A;  3OA6 A;  2JVV A;  4ESR A;  5LJ5 j;  4PJO C;  2HKN A;  2YSQ A;  1W2B P;  4C8Q B;  4C8Q E;  1OV3 A;  1VQO T;  1Z9Z A;  3DL1 A;  1VYT A;  5I2S A;  1N5Z A;  3FRN A;  3RBB B;  3MO8 A;  2XD0 A;  4ZN3 A;  5GAM d;  1AWJ A;  1G3W A;  1NE8 A;  1ZUK A;  4CI0 C;  1TWB A;  4PJL A;  3M58 A;  3G6E Q;  1VIF A;  2DXB B;  3X20 B;  2HBW A;  3CCM Q;  1UGQ B;  3RMQ A;  2BS4 A;  2HSP A;  2QEX T;  3QKJ A;  3MP8 A;  1I5L A;  4BUG A;  2XI9 A;  4Z8A A;  2L0A A;  5KYX A;  1PRM C;  4C8Q D;  1WXB A;  3VYG A;  4J7I A;  2YUO A;  2CCH B;  4CRI A;  1AVZ C;  1RAF B;  5IXB A;  3JB9 G;  4NL3 A;  2R7G A;  2IVX A;  1GRI A;  1H27 B;  4FW1 A;  2DJZ A;  1FMV A;  3ZL7 C;  2VGN A;  4BCQ B;  1WHJ A;  3M0U A;  4GLM A;  2CT3 A;  2RQW A;  5GAO q;  3JCM Q;  1NPR A;  5CK9 A;  3OB9 A;  5FGK B;  2QGG A;  4L5G A;  2XMF A;  4LD6 A;  5D6X A;  2D0Q B;  1K76 A;  2E3I A;  4II5 B;  2W99 A;  1B34 B;  1UEB A;  3EH1 A;  5CO7 A;  4ZNX A;  2C0T A;  3MP6 A;  3ZBD A;  5KCO A;  3CCE Q;  2VXF A;  2C06 A;  3CC4 T;  4F7U A;  5IT9 E;  3TW7 A;  3ZFJ A;  2F1L A;  1WHH A;  1C9B A;  2H8H A;  4LNP A;  1SHG A;  5FRM A;  2VUB A;  2GBQ A;  2UZL B;  4RTT A;  1QMC A;  4TVR A;  1W2B A;  2MWO A;  3PIP A;  5HKC A;  3QHR B;  1VQ9 T;  1YIT Q;  4DEY A;  1Y71 A;  1S72 T;  2WAC A;  4Z88 A;  2O31 A;  3CCQ A;  5CEI B;  2DE0 X;  2V8K A;  1WI7 A;  2BIV A;  2OI3 A;  1KC8 R;  4PKC C;  3EH2 A;  2AZV A;  5HQ0 B;  2DL8 A;  2GFU A;  5L8R E;  1KQS S;  1RAC B;  1NEB A;  2M51 A;  1GCP A;  4XU2 A;  2YRD A;  3CME Q;  2RHX A;  2LQK A;  4IUU A;  2FPE A;  2DXU A;  3TNH B;  4RTX A;  4BCG B;  4HVV A;  2ED0 A;  4MML A;  1OIU B;  2DEQ A;  2DFU A;  2L8D A;  4F6W B;  2GFA A;  2J6O A;  3HP9 A;  4E7H A;  3VS1 A;  1VQN T;  1KHI A;  1VQL A;  5A2Q E;  3CEY A;  4C92 B;  4ME7 A;  3CCJ A;  5LJ3 d;  1WX6 A;  3RKY A;  1VQ7 A;  4F7U G;  1WGS A;  4J83 A;  1K0S A;  3JSC A;  2DM1 A;  1H1R B;  1OQK A;  3MHX A;  4NL2 A;  2CSI A;  3CMA T;  1GFD A;  1D3B B;  3HRT A;  3CCU Q;  1SSH A;  4JLG A;  2FZK B;  4OF1 A;  1ENW A;  4EOL B;  1YIJ T;  2CZ6 B;  4JUV A;  3URG A;  9ATC B;  2JW4 A;  2BS3 A;  4GY5 A;  4JJD A;  3EFO A;  2X51 A;  2RH2 A;  1V29 B;  3BG3 A;  2MF2 A;  1KD1 U;  2L3S A;  3VS5 A;  3X25 B;  3EID B;  4HVU A;  3QYE A;  3JB9 F;  1KD1 C;  2RHY A;  2QF7 A;  2FEI A;  2H3J A;  5D6W A;  3I35 A;  2LC4 A;  4L59 A;  3JCM h;  3CCV A;  4HNV A;  3BHV B;  2ZPE B;  3JCM P;  3H0I A;  1M30 A;  2D6F A;  1E7P A;  5LJ5 g;  1URC B;  1TS9 A;  4KGV B;  4DBH A;  3PIO A;  2ZPB B;  1NJI U;  2E12 A;  2YXY A;  1YFN A;  1BBZ A;  3JCM b;  1JEG A;  2W9Z A;  4BAC A;  1VQ6 Q;  4KRD B;  3OYB A;  4BCF B;  3CC7 T;  2X3W D;  4YOO A;  2LDM A;  1AD6 A;  4M75 G;  5LJ5 f;  2ZZD B;  2X1N B;  3MP1 A;  1M1G A;  3JB9 H;  4J9B A;  4RCC A;  4WF2 A;  2EJ9 A;  1S1N A;  2DYI A;  1VQM Q;  4BE0 A;  2KY9 A;  4RG2 A;  2KK4 A;  2PNI A;  1X43 A;  1OU8 A;  5GAN d;  1UHF A;  4UC4 A;  2KT1 A;  2LJ3 A;  4EON B;  2RHZ A;  3OYI A;  1O9K B;  2QAS A;  4MFE A;  3FJ5 A;  2DL7 A;  2RQR A;  1WYX A;  3CXC S;  1Y7X A;  5M9O A;  4J9D A;  2KXC A;  4KRT A;  3VV0 A;  2EKH A;  1P92 A;  3I56 Q;  3HHT B;  5FW9 A;  5IDP B;  5HNB B;  1TSF A;  2RB6 A;  2XIC A;  2A3L A;  4HVW A;  4ORZ A;  3G6E A;  1NPP A;  2OAW A;  4HL4 A;  2HQX A;  2K2V A;  4F70 B;  2NUP A;  3JCM e;  3CCM A;  3UWN A;  1D1C A;  4E7L A;  3TNW B;  3QYG B;  3BLH B;  3HTR A;  3MIA B;  7AT1 B;  3PFS A;  4EOO B;  2QA4 T;  5I5Z B;  3TU4 K;  2WIH B;  4C92 C;  1VUB A;  1WJS A;  2RJF A;  1X6B A;  1Q7Y R;  3DB4 A;  5BNJ B;  2V22 B;  2LMJ A;  1V76 A;  4EMK B;  5KH6 A;  2QQ9 A;  3MET A;  4KH0 B;  2QYZ A;  2I53 A;  1JRI A;  2AK5 A;  1WA7 A;  2JJ9 A;  2E70 A;  5GAN e;  1D0X A;  2CP7 A;  2MCN A;  5GAN 5;  1M1K C;  5C0M A;  4LN2 A;  2WMB B;  5GMK h;  2BUD A;  2CGH A;  3LW5 E;  4M6V A;  1UUE A;  3FJP A;  1YJ9 Q;  4M7D G;  1VQK T;  1D09 B;  1UG1 A;  1D3U B;  3QO3 A;  1AHJ B;  5KYU B;  4B9X A;  3G71 Q;  4BY6 C;  3CCE A;  5KYW B;  4M7A G;  3X24 B;  2CKK A;  4JJN K;  1O9S A;  1G83 A;  3EG1 A;  2HMA A;  1NEG A;  1Q82 R;  4N0A C;  1VQP T;  1OI1 A;  4ZGE B;  2QGS A;  4HT8 A;  1UGS B;  3M54 A;  2P0K A;  1ZHI A;  4PJJ A;  3ME9 A;  4OMF B;  2GF7 A;  2OTL T;  5L2W B;  3QHS A;  4J9E A;  1YIT A;  3P8H A;  3PO3 S;  3I55 Q;  2JMC A;  1ZSZ B;  3OSV A;  4QVD A;  2FL7 A;  1JO8 A;  3A8L B;  4EMH A;  1N8R U;  2A28 A;  4Z02 A;  2QTV A;  1OU9 A;  1CKA A;  1VIE A;  4M75 F;  1QWE A;  4E7S A;  1IZ6 A;  3HSB A;  4OR5 B;  3V7C A;  3QUI A;  3CCL T;  2QK0 A;  4FX3 B;  1BU1 A;  3CME A;  2OTJ Q;  4PFO A;  2GTJ A;  5GMK e;  2RI3 A;  2EPD A;  4J6Y A;  4MDX A;  2GQV A;  4B6M A;  2PU9 B;  2XK0 A;  2ROL A;  2DJQ A;  3HL8 A;  3M55 A;  1WIE A;  2KYM A;  3H6Z A;  1WHK A;  3WVD B;  1M8M A;  2CH4 A;  2FB7 A;  3WVE B;  3CBM A;  2CP2 A;  1KQS P;  4BCK B;  3QG1 A;  2C6T B;  2WIP B;  2LQ8 A;  1RUW A;  2XDD A;  2EJF A;  3PMI A;  4RTU A;  1O75 A;  3SEM A;  4EOK B;  3J80 E;  3CD6 T;  1OL1 B;  1WDX A;  1WHG A;  1YWP A;  5IN1 A;  4EMK C;  2BZX A;  1IXD A;  5GAO n;  1WLP B;  3CCU A;  1DJ7 B;  2FZG B;  3UDC A;  2DTI A;  1GBQ A;  2AKK A;  3E2U A;  3PT9 A;  4PNO A;  1N9R A;  4LDX A;  5GMK j;  1Q95 G;  2WPA B;  2GGR A;  3RMS A;  3CPW S;  1VYW B;  4YOZ A;  4XTX A;  3DJB A;  3GNG A;  4F17 A;  2EYW A;  1VQ8 Q;  3MKD A;  2DX1 A;  1QLY A;  4XU3 A;  5GAO r;  4F6U B;  2KI7 A;  2C5X B;  3BG5 A;  1XJW B;  4F7N B;  3I5R A;  3CBO A;  5IH2 A;  4DQ2 A;  4M77 G;  4II1 A;  4PJO B;  2VYT A;  4PJO E;  1W6X A;  1PWT A;  4M7D F;  1VQ6 A;  2RNA A;  1WQ7 A;  3UF4 A;  1M3B A;  1YJW T;  3MJX A;  5LJ5 d;  4OMN A;  2IW9 B;  3OYN A;  2CYZ B;  1H28 B;  3DLM A;  3TVT A;  1PNJ A;  1YI2 Q;  4M7A F;  2W9F A;  4C5G A;  1VQM A;  4DOV A;  4OGR B;  3BFM A;  4X9D A;  3J81 E;  1X27 A;  1FMW A;  3CC2 Q;  4I3Z B;  1ZSZ C;  2KGT A;  4OB2 B;  5KCH A;  1X01 A;  4BI8 B;  4CC4 B;  3JCM J;  1JQQ A;  1OX8 A;  6AT1 B;  1ZP2 A;  4DA4 A;  4J8O A;  1TXQ A;  3S6W A;  2DBK A;  4MZP A;  4BE2 A;  4GLK A;  3SB2 A;  1U1T A;  2DVJ A;  4PJO D;  3M56 A;  3I56 A;  3M0S A;  4YC3 B;  1K8A U;  1PKT A;  1T3S A;  5CKE A;  2F69 A;  1I07 A;  2J7I A;  3PMT A;  1KQS A;  3QII A;  2DRK A;  4YTL A;  4J9I A;  1OL2 B;  3EGX B;  1QQJ A;  3QXE B;  1C0M A;  3NGP A;  1HD3 A;  2V1Q A;  4Y72 B;  5GAN 2;  1VYU A;  1UNL D;  1UTI A;  1E6H A;  1XTD A;  4KBM B;  3JCM g;  2BZY A;  3CXC P;  4RTW A;  2KRN A;  5J39 A;  5J26 A;  3M4Y A;  4RTZ A;  2KR3 A;  3DDQ B;  1JKW A;  2O4X B;  3LGL A;  2M9U A;  3FEO A;  4M78 A;  1FVV B;  1YJN T;  2F5K A;  2DYB A;  3JCM f;  1M4Z A;  2DD4 A;  2DIQ A;  3A8G B;  1OGU B;  1QCF A;  1JB0 E;  4J9G A;  4IUR A;  2RQT A;  2W10 A;  3A5Z B;  4BB7 A;  1VQO Q;  5EC7 A;  4JPB W;  3C95 A;  4F14 A;  3QDF A;  3H4C A;  1K73 R;  1D1A A;  1M5Q 1;  5KYX B;  3VJP A;  3OMC A;  1YJ9 A;  4Y28 E;  1IHW A;  1M3A A;  2KBT A;  1YN8 A;  1XOV A;  4C0D B;  2ZGW A;  4JX4 A;  2F2W A;  1GUX A;  2JTF A;  2C5N B;  2C0I A;  2LX7 A;  4NS5 A;  3GIB A;  4CFV B;  3JAM E;  2RK2 A;  3HKS A;  3OYK A;  3G71 A;  3OS5 A;  3N5B B;  2OX7 A;  2CRE A;  3E1S A;  2QEX Q;  1VYV A;  1WNL A;  1I81 A;  3H41 A;  2OJ2 A;  3GPL A;  1PD0 A;  2ENM A;  2JS2 A;  2E1H A;  4XTZ A;  3FC3 A;  2JN0 A;  4RUG A;  4IIM A;  4C0F A;  8AT1 B;  2Y90 A;  2F2V A;  4FM4 B;  1H64 1;  1BK2 A;  2M02 A;  3OBY A;  1IHV A;  4XQ3 A;  3I55 A;  3NTI A;  3MY1 B;  4M77 F;  3OQ5 A;  2IW6 B;  1YWO A;  4PFP A;  3LWH A;  4KT0 E;  2LVM A;  4V2S A;  4ZGJ B;  3POM A;  2YRC A;  3M5A A;  2EYQ A;  8ATC B;  4M78 G;  4LE9 A;  4QQG A;  2RO0 A;  4BCM B;  4NC6 A;  3M4G A;  1FIN B;  2YT6 A;  2OTJ A;  2AT1 B;  4CC3 A;  4AFZ C;  1ZUU A;  1QVF S;  3D7S B;  4AKH A;  4F04 B;  4WTO B;  3CXC A;  3HBL A;  3CC4 Q;  2EYX A;  4A53 A;  2DL4 A;  3F5X B;  1N4M A;  3EG9 A;  3GBQ A;  4XU0 A;  1AD5 A;  1NLO C;  5A0L A;  2KEA A;  1H1P B;  1H92 A;  3S3O A;  2HSE B;  5GAO p;  2RK1 A;  1KC8 U;  2K5F A;  3L2Q A;  1VQ4 T;  1KC8 C;  4F7L B;  3SFM A;  1OZ3 A;  4BCM D;  3RKW A;  1VQ9 Q;  4XTV A;  4C5I A;  1G3Y A;  4JJB A;  1S72 Q;  2GTO A;  3AHU A;  2AZS A;  1B07 A;  4GBQ A;  5FU7 B;  4VUB A;  3BE3 A;  4XTW A;  2RD1 A;  4M75 B;  4C8Q A;  4TTH A;  3VRZ A;  3L42 A;  1MHN A;  2KT8 A;  3EJ1 B;  2QTX A;  4NOY A;  3EAE A;  1H25 B;  2K3Y A;  1JST B;  4BCQ D;  3MPU B;  4OP0 A;  4DBR A;  1H1Q B;  3VU3 C;  3BLQ B;  5CQX A;  1IGQ A;  1TUG B;  3SWN B;  1VQ8 A;  2FVU A;  4C0D C;  4QW2 A;  4CFU B;  5DM7 R;  1JJ2 S;  4FL6 A;  4FU6 A;  1PC0 A;  1GBR A;  3QSU A;  1M3C A;  2X35 A;  2A36 A;  3CCS T;  4ELZ C;  1VQN Q;  2B8A A;  3DDP B;  2L3Q A;  4R0K A;  4N4H A;  4A4K A;  2KRM A;  4F6S B;  2BS2 A;  2KVQ G;  5CKF A;  3UA6 A;  3EFO B;  3HPW A;  2G77 A;  3CPW P;  4BCI B;  3OYJ A;  1FYN A;  1W1F A;  2RJD A;  1C6V X;  2DLP A;  3PVQ A;  5I11 A;  2BPM B;  1OUL A;  1YI2 A;  1BIB A;  3CQT A;  3R6N A;  1YIJ Q;  4LD9 K;  3CC2 A;  4CFU D;  2E64 A;  1QCN A;  2EGE A;  2V1R A;  4MFD A;  4A4F A;  5EG2 A;  2K3X A;  3VS2 A;  1LPL A;  2D0N A;  1QP2 A;  2C5V B;  2PVO B;  5J3B A;  5HK3 A;  2XG8 D;  4Y91 A;  2YRV A;  2LCC A;  2YLC A;  1SKU B;  2GQI A;  1B34 A;  1G8X A;  4C92 E;  2CT4 A;  3U23 A;  2RN8 A;  1BU2 A;  2KMG A;  2I40 B;  4KUD K;  1TD6 A;  3EFS A;  4RG8 A;  5GMK l;  4EPC A;  1PM3 A;  1G5V A;  3Q1J A;  3HRU A;  3RUX A;  1B7T A;  3JCM W;  4D8K A;  2E10 A;  1I4K 1;  4M78 F;  4XK8 E;  4F7S B;  4OB3 B;  1ABO A;  1BYM A;  3VS4 A;  4M7D B;  2LX9 A;  3AT1 B;  4M7D E;  1JSU B;  1GCQ C;  3BLR B;  2KRO A;  5GJW B;  3LGF A;  4BCH B;  3L2V A;  5GMK m;  2K79 A;  5CCA A;  4M7A B;  1CSK A;  1KSW A;  4C92 D;  4C5E A;  1HSQ A;  2AKL A;  2A08 A;  3IQL A;  1X6G A;  4EOP B;  4ZTJ A;  4JX6 A;  1FX7 A;  5FU7 C;  3JCM d;  3O5Z A;  2QQS A;  4BY6 B;  4EIK A;  5KE3 A;  3C0C A;  1H3Z A;  4M75 C;  2IN3 A;  1X2Q A;  1VQO A;  4NST B;  4PJM A;  1NJI C;  3MEU A;  4X1V A;  2BKZ B;  4EC8 B;  2KDS A;  2K5L A;  5CKB A;  4D6W A;  3OY9 A;  4LOC A;  5GAO l;  1XNI A;  3V8J A;  2D1X A;  4CFW B;  5GAN 4;  2WHB B;  1NBE B;  3H0F A;  3PVL A;  3SWN C;  4EDU A;  3P8B B;  3VUZ A;  1Q7Y U;  2X4X A;  3OYF A;  2DIL A;  4K11 A;  2LQN A;  2QQR A;  3CPW A;  1Q81 R;  2DD5 A;  1Y07 A;  2DKG A;  2LP5 A;  5IHK A;  2QEX A;  4MIM A;  1NLP C;  1IB8 A;  4QSH A;  2QA4 Q;  5CR2 A;  1MV0 B;  2R57 A;  1T3L A;  5GAO m;  3QZ9 B;  1IRX A;  4N4G A;  4PL6 A;  2D9T A;  2UZE B;  5LL6 S;  2RPN A;  1D3B A;  1IGU A;  1RL2 A;  4IUT A;  2DIG A;  1HK9 A;  1RAA B;  4JRQ A;  2PUK B;  2MYS A;  1U5S A;  2M0Y A;  3ER0 A;  1K0X A;  3E9G A;  2CH4 W;  3CBP A;  1SEM A;  2PK9 B;  2PK2 A;  2XKO C;  3MEV A;  2YDL A;  2E3H A;  1YCS B;  4RMO A;  1OYX A;  4X9C A;  1KD1 R;  2E6N A;  1Q82 U;  4OMO A;  2QQB A;  2CUD A;  4FT2 A;  2R5M A;  1VQK Q;  1BKB A;  3OSS C;  2ED1 A;  3HFO A;  1H8K A;  1QW1 A;  3M53 A;  4AFS C;  1VQ5 T;  3CC4 A;  2X4J A;  3EGD B;  2RJC A;  2OAU A;  1VQM T;  2DVE A;  4N0A A;  3BHU B;  3VS3 A;  4XTU A;  1VQP Q;  3A8H B;  1NG2 A;  1ZLM A;  2MWP A;  3UPU A;  4LDW A;  1Q86 U;  3EHR A;  5A0D A;  4M7D C;  1OPK A;  1Q86 C;  2V26 A;  3JV3 A;  4F7U F;  2ZZD A;  4EOR B;  3TN8 B;  2DAQ A;  4KUI A;  4R56 A;  4IMY B;  2LQW A;  1U06 A;  1XQH A;  3NPF A;  2OTL Q;  3QJ6 A;  1MNE A;  1VQ9 A;  3RNJ A;  3GLX A;  4M7A C;  4A54 A;  1S72 A;  2HL5 C;  1QVF P;  4BCP B;  1E7O A;  2EKO A;  4M77 B;  5FLX E;  2MIO A;  2VAS A;  1O9K A;  3TQ7 P;  2DPP B;  2A0F B;  3MEW A;  5I2M A;  1LCK A;  4FYW B;  2DER A;  4B9W A;  3CCL Q;  2CP5 A;  5LQF B;  1OIY B;  1H4L D;  3V7S A;  3KBG A;  3QWY A;  4BDY A;  3H0H A;  4C0G A;  4KUL A;  4OMP A;  1H26 B;  4YOS A;  2K3B A;  2CZ1 B;  2QDL A;  2ZPG B;  2HD0 A;  2EJG A;  1EZZ B;  5IHI A;  5ICP B;  1VQN A;  4G6L B;  3VKH A;  2UUE B;  5IXF A;  2JT4 A;  1N27 A;  1EIF A;  1NYG A;  2VGM A;  2X4Y A;  3VYH B;  4HCB A;  1YBY A;  1OX9 A;  1N8R C;  2VXE A;  4QQ6 A;  2DF6 A;  2RI5 A;  1WXT A;  2JTM A;  1HYO A;  1MND A;  5I21 A;  3G4S T;  4QVC A;  1GXI E;  2K2M A;  5GAM f;  3OYA A;  3CD6 Q;  5EJC A;  2WSF E;  2C4G B;  4EOJ B;  3NTH A;  3OYG A;  1YJ9 T;  1R0C B;  3HFN A;  1YIJ A;  1JJ2 P;  3L2W A;  1M1K R;  2KRS A;  4LDV A;  2DXC B;  4ATO A;  4IUV A;  4JRP A;  1KQ2 A;  3S3N A;  3LX7 A;  3ULR B;  2DTO A;  1H1S B;  1U1S A;  1YHQ T;  4M4Z A;  1I0C A;  2LRQ A;  5KYY B;  1KK7 A;  4PFZ A;  2SEM A;  4OML A;  1B3Q A;  2ROT A;  4FSX A;  1ZBX A;  4FCY A;  1OPL A;  5CYI B;  5KYW A;  4A4G A;  3DOG B;  1XO2 A;  3GF5 A;  5DQV A;  5FWC A;  5GAN 8;  3B57 A;  4ROD A;  1TG0 A;  2EW3 A;  2XDB A;  1VIN A;  1QVF A;  1RAD B;  5A0G A;  1YJW Q;  4KGZ B;  3TCJ A;  2EVR A;  1ZA1 B;  2EQM A;  1NZ9 A;  1QVG S;  3NDQ A;  4BD3 A;  3CCR Q;  1LNX A;  2C5O B;  4KH1 B;  2RI2 A;  1RAH B;  2NUT A;  4E7J A;  2CUB A;  2E41 A;  3SHW A;  1BIA A;  3PNW C;  2M0O A;  4M77 C;  2JNG A;  1E6G A;  1W70 A;  1YNZ A;  3V7R A;  1M90 U;  4CRL B;  5EFQ B;  2CP0 A;  4ELY C;  2K4Y A;  3EFR A;  1M90 C;  3M57 A;  2DTH A;  2KQW A;  2LZ6 B;  3A1P A;  2H3E B;  1UE9 A;  1RAE B;  2P0P A;  2MOX A;  4L6V 5;  4E7Z A;  1AT1 B;  1WJQ A;  3JRZ A;  3QHW B;  1KJW A;  2DL3 A;  2C0O A;  2KSS A;  2PTK A;  2X4W A;  1QVP A;  3HZJ A;  1Y96 A;  2G3R A;  1BI0 A;  2QA4 A;  2KE9 A;  1JJ2 A;  4EOM B;  1V1C A;  1Y57 A;  2ZCF B;  1UNG D;  2W96 A;  3QYB A;  3L1A A;  1TOV A;  2L5Q A;  3EOC B;  2FPF A;  1YJN Q;  2P0Q A;  4XTY A;  3QBY A;  2GNC A;  5D7U A;  2PMI B;  1D0Y A;  1K8A C;  3BW1 A;  1AOJ A;  5C6S A;  3QWL A;  1PG5 B;  2DBM A;  5DQW A;  2CJM B;  2RQV A;  3BY7 A;  4AMC A;  1ZBJ A;  3CCQ T;  1TUD A;  4ANJ A;  4BY7 X;  1PD1 A;  1VQK A;  2RMO A;  3QPH A;  2AHJ B;  5ACB A;  3M0T A;  4FW2 A;  4OMM A;  1SRM A;  2Z0W A;  1TU0 B;  3JB9 D;  4EMG A;  3C12 A;  2J6F A;  1YI2 T;  2HQH A;  4J6X A;  3BDL A;  1K4U S;  1W98 B;  2JTE A;  2CCI B;  1K9M R;  5HBH B;  1VQP A;  4ROC A;  4PJO A;  2K6D A;  3X26 B;  1OOT A;  4FT4 A;  2E5K A;  4MDW A;  3VS7 A;  1VQL T;  4CC7 A;  4BE1 A;  2OTL A;  4HXJ A;  2ECZ A;  2MMP A;  1AZG B;  2FHD A;  3O0G D;  2HEQ A;  2NWM A;  3CCJ T;  1SF9 A;  3VYG B;  3NTK A;  1VQ7 T;  3NMZ C;  4QT7 A;  4E47 A;  3RES A;  1SSF A;  3HB9 A;  1RAI B;  3FLG A;  4OMQ A;  1TUC A;  2PUO B;  3M0Q A;  4RTV A;  1QKW A;  3C94 A;  4AKG A;  2WSC E;  4FYY B;  3K7A M;  2QDY B;  4LDY A;  4OGE A;  3M59 A;  3CCL A;  5KYN A;  1UHC A;  2G6F X;  2V8J A;  5I22 A;  2BTT A;  4EOI B;  2L2P A;  3E9F A;  2JM8 A;  1P5E B;  1UJ0 A;  5IDN B;  3QZ5 B;  3FDR A;  1QWF A;  3JCM V;  1HXD A;  1ZQ1 A;  2IPO B;  1M2V A;  2J06 A;  1MMG A;  3EHQ A;  3EGX A;  4ROE A;  1J3T A;  2XDP A;  4MZM A;  1OZ2 A;  4M78 C;  4OB1 B;  1FWZ A;  1G3S A;  2WJ9 A;  2YUN A;  3CCV T;  2P4R A;  2YHT A;  2EYY A;  1X6O A;  2CP3 A;  5AT1 B;  1VQ4 Q;  1RAB B;  4IKF A;  4F7U B;  1H24 B;  1KG1 A;  4F7U E;  2QXF A;  1SG5 A;  1RI0 A;  2DA9 A;  3A8O B;  3M0R A;  1HJD A;  5GAM h;  2O4X A;  4PJO G;  3CD6 A;  3SDZ A;  2XID A;  4BBR M;  1UGR B;  3VRY A;  3DKM A;  2FO0 A;  3E19 A;  2BE7 D;  1G2B A;  2DRM A;  4O5V A;  4EOQ B;  5CAI A;  2BE9 B;  4BY1 X;  2JMA A;  1N6A A;  2RF0 A;  2EBP A;  4X34 A;  4D8D A;  1FXX A;  1E9H B;  2UZD B;  3G1J A;  4DEX A;  2QGF B;  1AIS B;  2UZB B;  4RCB A;  3JB9 I;  3CCS Q;  2DZ9 A;  3ASK A;  1WZO A;  3LWI A;  2EQU A;  2EIF A;  3L2U A;  1QP3 A;  3BHT B;  4JDS A;  3M03 A;  3G6E T;  4Q5W A;  5IHY A;  3H8Z A;  4HLQ A;  4M75 E;  4KGX B;  3CCM T;  1YJW A;  1UDL A;  4A4H A;  1R8O B;  4HT9 A;  3G33 B;  2ZPH B;  1WHL A;  2BKD N;  1MUZ A;  4IUP A;  4HNT A;  4C5H A;  3CCR A;  3NFC A;  2DXB A;  2B9R A;  2K7A A;  4PLI A;  5GAM e;  3OYD A;  1KQ1 A;  1RLQ C;  1UGV A;  3I9Q A;  3RDV A;  2WXV B;  4Z6Y A;  2EWN A;  1UJY A;  1VOM A;  2P4T A;  2ESW A;  1GL5 A;  1LVK A;  2IIM A;  4AG1 C;  3V8L A;  4M75 D;  3L2R A;  4AT1 B;  2EAY A;  1QVG P;  5FWB A;  1UGP B;  5D6Y A;  3MY5 B;  5CKH A;  1IO6 A;  2CSQ A;  1X75 C;  2VV5 A;  3CMA Q;  1M2O A;  1MGQ A;  1NYF A;  3FB9 A;  1TFB A;  1UNH D;  1QLB A;  3TSZ A;  1EFN A;  3OYH A;  5GAN 7;  1F1B B;  1GCQ A;  2COW A;  3WXM B;  4UN0 A;  5FRN A;  4AG2 C;  1JOW A;  3CCE T;  2ABL A;  2EUF A;  2D8H A;  2I0N A;  2ZPI B;  2JM9 A;  4C8Q C;  2A37 A;  1OKV B;  2FRY A;  5GAM j;  3MEA A;  1GY3 B;  2L89 A;  2KNB B;  1VOL A;  1YJN A;  2DO3 A;  1LOJ A;  4C8Q G;  2JZ2 A;  3OYM A;  4FIB A;  1X2K A;  1SPK A;  3REA B;  1WHM A;  2WFY B;  3A98 A;  4J6W A;  4M75 A;  2DME A;  1YIT T;  3DB3 A;  3JB9 J;  1IRE B;  1Q81 U;  2PJQ A;  2DD5 B;  2FG0 A;  4CXA B;  1QCO A;  3S3M A;  4CFM B;  1Q81 C;  2RHU A;  3OW2 P;  3BDU A;  2KAF A;  4PJO F;  5LJ3 h;  3CC7 Q;  3KFV A;  3QJY A;  4HCZ A;  3SWN A;  2D8J A;  2LJ1 A;  2COY A;  1K1Z A;  2JXB A;  4HA8 A;  2R58 A;  3LLR A;  4DBQ A;  4M7A E;  2WEV B;  5GAN 3;  3CME T;  3LH0 A;  1MMA A;  1MMN A;  2LTO A;  4ELJ A;  4E7I A;  2LNV A;  1PRL C;  2DEU A;  3H9N A;  3MCA B;  2L3P A;  4BCO B;  2JOY A;  3M0P A;  4BI3 A;  3VKG A;  3UAT A;  2NUZ A;  2WMA B;  1SHF A;  4AFU C;  2EGC A;  2LCL A;  2MAM A;  2NUP B;  4LUE A;  3OYY A;  4FSS A;  4JRK A;  4M7D D;  2O01 E;  3EG2 A;  2DXT A;  4R55 A;  1ZX6 A;  3F70 A;  4HNU A;  3L2Z A;  1AEY A;  1FMK A;  1ACM B;  4RKU E;  1QVG A;  4M7A D;  1Q7Y C;  4BBS M;  4J5Y A;  4IUQ A;  3UT1 A;  3CCU T;  2HDA A;  1JXO A;  2E5Q A;  5DLQ E;  3OS2 A;  4BDZ A;  5IAY A;  5DLO A;  1VA7 A;  1AWW A;  4C92 A;  4O6J A;  1WXU A;  2O9V A;  2XU8 A;  2YWW A;  2KR6 A;  3OBW A;  4BXX X;  2XHC A;  5GMK i;  2VWF A;  4F7J B;  2MK5 A;  1VQ5 Q;  2JS0 A;  5LJ3 e;  1BI2 A;  2RHI A;  1U8R A;  5GAN h;  3M9Q A;  4EC9 B;  5HK0 A;  4QVZ A;  3RGF B;  4JZ4 A;  3LYI A;  4FYX B;  4M7D A;  4LXC A;  1M9S A;  2QQA A;  5CVI A;  1VQ4 A;  3THK A;  2PHG A;  2F2C A;  3VUB A;  4M7A A;  3ZEH A;  1G3T A;  2EYZ A;  2PVG B;  1Q82 C;  1VQ6 T;  2LT4 A;  3OW2 A;  1LJO A;  3PE0 A;  4IIO A;  1RI9 A;  2YLB A;  4WCI A;  3C4S A;  4OVA A;  2R5A A;  4N4I A;  5CKD A;  3GNF B;  5CQY A;  3VS0 A;  1NJI R;  4XAX B;  1AZE A;  3PGG A;  4AFQ C;  1U3O A;  1BI1 A;  3RIR A;  5LJ3 j;  1UEC A;  1QKX A;  1WFW A;  3SD4 A;  4C8Q F;  4DBF A;  5IF1 B;  4DOW A;  2WSE E;  3OS0 A;  3TSW A;  3I56 T;  3PTA A;  5HBE B;  1KIK A;  4C92 G;  3CCS A;  1OI9 B;  2PZ1 A;  1MMD A;  2QG9 B;  1F5Q B;  4M77 E;  1TH7 A;  1Z9Q A;  2MPX C;  1M1K U;  2M1H A;  2B86 A;  3G7Z A;  5KE2 A;  2FZC B;  4MZT A;  2FYK A;  1W2B S;  3OYL A;  2MI6 A;  2L3R A;  2J6K A;  4QQD A;  3G4S Q;  4AKI A;  2YUP A;  1OKW B;  1JXM A;  1ABQ A;  2RM4 A;  1BI3 A;  4CC2 A;  2LT1 A;  2O88 A;  2K9G A;  2HZY A;  4J9H A;  5HBJ B;  1H3H A;  2K57 A;  2K5I A;  1QMZ B;  3V8K A;  4E2F B;  5FRO A;  4BCN B;  4M77 D;  1YHQ Q;  5GAM g;  4MMK A;  2LJ0 A;  4LDU A;  2VVK A;  2E65 A;  1CKB A;  2QI2 A;  3X28 B;  1KHC A;  5FU6 B;  4Z89 A;  2HAX A;  1TTH B;  4C0Z A;  3GOX A;  2QQ8 A;  1YCY A;  1OEB A;  3DTO A;  5GAN j;  3GP8 A;  1KXU A;  3LQ5 B;  1KFZ A;  3EGD A;  1ZA2 B;  3CMA A;  2A7Y A;  2VB6 A;  4EMK A;  1M8V A;  2NUT B;  1PHT A;  2QDJ A;  2DL5 A;  3RKX A;  2HBP A;  1Q86 R;  3G71 T;  1ZSG A;  1AWX A;  1I1J A;  4BCN D;  3TRE A;  3T9N A;  2KMT A;  1ARK A;  5KYU A;  4M77 A;  1BB9 A;  1NM7 A;  1JBM A;  4A63 B;  2PQW A;  2VKN A;  4HCC A;  5LMK B;  3UA7 A;  4LUD A;  2F5T X;  1I5O B;  1C1A A;  2EQK A;  1M27 C;  3I55 T;  2X3X D;  4JRI A;  2J05 A;  1Y96 B;  4J9C A;  4AI6 A;  2JGZ B;  4XU1 A;  3OMG A;  2E4H A;  2QFZ A;  2F2X A;  3CC7 A;  1I8F A;  3JCM c;  4ZGD B;  1RAG B;  2QAZ A;  3INZ A;  5IHN A;  2IVW A;  3TEE A;  2OTJ T;  1ZSZ A;  2M16 A;  1A0N B;  2DK3 A;  1N8R R;  1WPY A;  2HCK A;  3RR6 A;  2O2O A;  2ZAE A;  4JS5 A;  3TW6 A;  4PJN A;  3A8M B;  3KUF A;  1T0J A;  2COZ A;  3QYH B;  4Y92 A;  4C92 F;  5GAN 6;  2FPD A;  5GJV B;  2NYS A;  2DMO A;  4ZTF A;  2E6Z A;  4F16 A;  4A4E A;  1R0B G;  2DXC A;  3RER A;  2DET A;  1D0Z A;  4E7K A;  2CS7 A;  4E6R A;  4M78 B;  4J9F A;  1R77 A;  4M78 E;  2AIR B;  1PSE A;  2GCX A;  3CCQ Q;  1K9M U;  2DD4 B;  5KYY A;  3EGU A;  2LCS A;  2IG0 A;  1BCM A;  3OW2 S;  1K9M C;  2CZ0 B;  5FU6 C;  2DNU A;  5LJ5 h;  4JLI A;  1ZUY A;  3P8D A;  1VQ5 A;  1GFC A;  2CP6 A;  3NHN A;  1K73 U;  5HVY B;  4BI4 A;  2CZ7 B;  3CCR T;  2DZC A;  3J7A F;  1K73 C;  3KXT A;  1RLP C;  1K9A A;  3CPF A;  5HCK A;  3HRS A;  5LJ3 g;  1VQ8 T;  1GUX B;  2O9S A;  4JZ3 A;  1BCO A;  3VS6 A;  1PSF A;  3JCM X;  4ELL A;  2EQJ A;  3VKI A;  2P84 A;  4KRC B;  4CFX B;  4M78 D;  3QWX X;  2HNI A;  1VQL Q;  5AYF A;  1N9S A;  2HL3 A;  5ECA A;  1WQW A;  1MV3 A;  1GH6 B;  4OGC A;  1SRL A;  3CCJ Q;  5LJ3 f;  2W2H A;  3GTM S;  1VQ7 Q;  1FKM A;  4ZN1 A;  3BG9 A;  2SRC A;  3HO8 A;  3FIF A;  2HQE A;  2RJE A;  3OYC A;  2EQI A;  1M2V B;  4PLL A;  1M90 R;  4JX5 A;  2FRW A;  4HCK A;  1UB4 A;  3MI9 B;  1D1B A;  1UFF A;  2BZ8 A;  2Y4Y A;  1YP5 A;  3TNI B;  3CC2 T;  5DY9 A;  5HY6 A;  1Y0M A;  1EX4 A;  2HKQ B;  3R6O A;  4HKE A;  4P5N A;  1W4S A;  2W0Z A;  3OS1 A;  1PKD B;  3OYE A;  2LW4 A;  3REB B;  1JU5 C;  4RTY A;  2YUQ A;  2CDT A;  2KYB A;  3EG0 A;  3DLL A;  3KHI A;  5LJ5 e;  2RQU A;  2JUF A;  4QKU A;  4BCJ B;  3CCV Q;  2VC8 A;  1X69 A;  4OB0 B;  2EGA A;  4FYV B;  2Y4X A;  3EG9 B;  2LNH B;  5L23 A;  1M1F A;  1G3N C;  4EOS B;  2V8I A;  2IW8 B;  1WJR A;  3G4S A;  2ZPF B;  5GAN g;  1PCX A;  3EG3 A;  3LH5 A;  2ATC B;  4J7F A;  2NLU A;  2PVD B; 
#chains in the Genus database with same CATH homology
 2DTI A;  3HFO A;  4JS4 A;  3WXM B;  5FRN A;  1QW1 A;  3PT9 A;  4PNO A;  1N9R A;  3CCE T;  4LDX A;  3M53 A;  2I2L A;  2ZPI B;  5GMK j;  3QDR B;  2EFI A;  4C8Q C;  1VQ5 T;  2RA2 A;  3CC4 A;  2X4J A;  5GAM j;  2RJC A;  3MEA A;  3RMS A;  2OAU A;  1VQM T;  2DVE A;  3O8V A;  5GAN f;  3CPW S;  4N0A A;  4XTX A;  4XTU A;  3A8H B;  1YHQ A;  2L89 A;  2MWP A;  3UPU A;  1YJN A;  5CIU A;  3GNG A;  4LDW A;  2DO3 A;  2JVV A;  3OA6 A;  1Q86 U;  1LOJ A;  4C8Q G;  2JZ2 A;  5LJ5 j;  3OYM A;  4FIB A;  4PJO C;  5A0D A;  4M7D C;  4C8Q B;  1Q86 C;  4C8Q E;  4XU3 A;  5GAO r;  4F7U F;  1VQO T;  2ZZD A;  3DL1 A;  4J6W A;  4M75 A;  3BG5 A;  2DAQ A;  4KUI A;  1YIT T;  4R56 A;  3DB3 A;  5I2S A;  3JB9 J;  1IRE B;  1XQH A;  3FRN A;  1Q81 U;  2DD5 B;  3QJ6 A;  3S3M A;  1VQ9 A;  3CBO A;  3GLX A;  3MO8 A;  4M7A C;  1Q81 C;  2RHU A;  2XD0 A;  4A54 A;  4DQ2 A;  4M77 G;  4ZN3 A;  5GAM d;  4II1 A;  3BDU A;  1S72 A;  1G3W A;  2KAF A;  1NE8 A;  2VYT A;  4PJO B;  4PJO F;  4PJO E;  2EKO A;  4M77 B;  5LJ3 h;  4CI0 C;  4M7D F;  1VQ6 A;  3M58 A;  5FLX E;  1VIF A;  2DXB B;  1WQ7 A;  3QJY A;  4HCZ A;  3SWN A;  2DPP B;  1YJW T;  3X20 B;  5LJ5 d;  3MEW A;  5I2M A;  1UGQ B;  4HA8 A;  2R58 A;  3RMQ A;  3OYN A;  2CYZ B;  2NLU A;  2BS4 A;  3DLM A;  3LLR A;  4M7A E;  4B9W A;  4M7A F;  2QEX T;  3QKJ A;  4C5G A;  3CME T;  5GAN 3;  4DOV A;  1VQM A;  3LH0 A;  3MP8 A;  3V7S A;  1I5L A;  3BFM A;  3KBG A;  2LTO A;  2XI9 A;  4ELJ A;  4X9D A;  4BUG A;  3J81 E;  4E7I A;  2LNV A;  4C8Q D;  4OB2 B;  5KCH A;  1X01 A;  3MCA B;  4BI8 B;  4BI3 A;  3VYG A;  2JOY A;  3JCM J;  3VKG A;  4BDY A;  4DA4 A;  4J7I A;  4J8O A;  4C0G A;  4KUL A;  3S6W A;  4CRI A;  4MZP A;  2MAM A;  2LCL A;  4BE2 A;  2CZ1 B;  2ZPG B;  4GLK A;  3SB2 A;  1U1T A;  2HD0 A;  3OYY A;  3JB9 G;  4NL3 A;  2EJG A;  4PJO D;  4JRK A;  4M7D D;  2O01 E;  1VQN A;  3VKH A;  2DJZ A;  3M56 A;  2DXT A;  3I56 A;  4R55 A;  3F70 A;  2VGN A;  4HNU A;  1N27 A;  1EIF A;  3L2Z A;  2VGM A;  2X4Y A;  5CKE A;  1K8A U;  3VYH B;  4HCB A;  1YBY A;  4RKU E;  2F69 A;  5GAO q;  1N8R C;  2VXE A;  3PMT A;  3JCM Q;  4QQ6 A;  1NPR A;  1QVG A;  1KQS A;  5CK9 A;  2RI5 A;  3OB9 A;  3QII A;  4M7A D;  4YTL A;  1Q7Y C;  4L5G A;  5D6X A;  4LD6 A;  4BBS M;  2JTM A;  5I21 A;  3G4S T;  3QXE B;  2D0Q B;  4J5Y A;  4QVC A;  1GXI E;  4IUQ A;  5GAM f;  3OYA A;  3UT1 A;  5EJC A;  3CCU T;  2WSF E;  5GAN 2;  3NTH A;  3OYG A;  1YJ9 T;  2E5Q A;  1B34 B;  1XTD A;  5DLQ E;  3OS2 A;  4BDZ A;  5IAY A;  3HFN A;  5DLO A;  1UEB A;  4KBM B;  4O6J A;  4C92 A;  1YIJ A;  3JCM g;  2XU8 A;  5CO7 A;  3L2W A;  3MP6 A;  2KR6 A;  4LDV A;  3ZBD A;  3OBW A;  5KCO A;  5J39 A;  2DXC B;  2VXF A;  3CC4 T;  2C06 A;  2XHC A;  5GMK i;  4IUV A;  4JRP A;  4ATO A;  5J26 A;  1KQ2 A;  3M4Y A;  4F7U A;  3S3N A;  3LX7 A;  5IT9 E;  3TW7 A;  3ZFJ A;  5LJ3 e;  1BI2 A;  2RHI A;  2O4X B;  2DTO A;  1U8R A;  1YHQ T;  1U1S A;  3LGL A;  2M9U A;  5GAN h;  3M9Q A;  3FEO A;  4M78 A;  1YJN T;  2LRQ A;  5HK0 A;  2F5K A;  5FRM A;  2VUB A;  4QVZ A;  3JCM f;  1M4Z A;  2DD4 A;  3LYI A;  2DIQ A;  3A8G B;  1JB0 E;  4M7D A;  4IUR A;  4TVR A;  3A5Z B;  1M9S A;  4FSX A;  2QQA A;  1ZBX A;  5CVI A;  4BB7 A;  1W2B A;  2MWO A;  1VQ4 A;  3PIP A;  5HKC A;  1VQ9 T;  4A4G A;  3C95 A;  3GF5 A;  3H4C A;  1Y71 A;  3VUB A;  1S72 T;  2WAC A;  4M7A A;  3ZEH A;  5GAN 8;  1M5Q 1;  1G3T A;  2PVG B;  1Q82 C;  3VJP A;  1VQ6 T;  3OMC A;  3CCQ A;  2LT4 A;  4Y28 E;  3OW2 A;  1YJ9 A;  2XDB A;  1LJO A;  2V8K A;  1QVF A;  1XOV A;  2BIV A;  2YLB A;  4C0D B;  2ZGW A;  4PKC C;  4JX4 A;  2JTF A;  5A0G A;  4NS5 A;  3GIB A;  3OYK A;  2GFU A;  2RK2 A;  3HKS A;  3TCJ A;  3JAM E;  3C4S A;  4OVA A;  3OS5 A;  2EQM A;  1NZ9 A;  3N5B B;  5L8R E;  3G71 A;  1QVG S;  1KQS S;  2R5A A;  4N4I A;  5CKD A;  3GNF B;  4XU2 A;  5CQY A;  4XAX B;  3E1S A;  4BD3 A;  3PGG A;  1LNX A;  2RHX A;  1WNL A;  1BI1 A;  2LQK A;  4IUU A;  3RIR A;  5LJ3 j;  1I81 A;  2DXU A;  2RI2 A;  3GPL A;  4E7J A;  2E41 A;  3SD4 A;  1BIA A;  2E1H A;  4XTZ A;  3PNW C;  2M0O A;  4M77 C;  2JNG A;  3FC3 A;  2JN0 A;  4C8Q F;  4MML A;  4C0F A;  2DEQ A;  3V7R A;  1M90 U;  2Y90 A;  2L8D A;  4DOW A;  2GFA A;  4ELY C;  4FM4 B;  2K4Y A;  2WSE E;  3EFR A;  3HP9 A;  3OS0 A;  4E7H A;  1M90 C;  1H64 1;  1VQN T;  1KHI A;  1VQL A;  3M57 A;  2DTH A;  2KQW A;  5A2Q E;  3I56 T;  3OBY A;  4XQ3 A;  3PTA A;  4C92 G;  3CCS A;  3I55 A;  3CEY A;  3NTI A;  4M77 F;  3OQ5 A;  4M77 E;  1TH7 A;  4ME7 A;  4C92 B;  3CCJ A;  5LJ3 d;  3RKY A;  1M1K U;  1VQ7 A;  4F7U G;  2M1H A;  3LWH A;  3G7Z A;  5KE2 A;  1WGS A;  2P0P A;  4J83 A;  4KT0 E;  2LVM A;  4L6V 5;  3JSC A;  4MZT A;  4V2S A;  4ZGJ B;  2FYK A;  1WJQ A;  3JRZ A;  3MHX A;  3M5A A;  4NL2 A;  2EYQ A;  3OYL A;  1W2B S;  2MI6 A;  2L3R A;  2KSS A;  4M78 G;  3CMA T;  4QQD A;  4QQG A;  1D3B B;  2RO0 A;  2X4W A;  4AKI A;  3HRT A;  4NC6 A;  1QVP A;  3HZJ A;  4JLG A;  3M4G A;  4OF1 A;  1Y96 A;  1YIJ T;  2G3R A;  2OTJ A;  2RM4 A;  2CZ6 B;  1BI0 A;  4JUV A;  1BI3 A;  3URG A;  2QA4 A;  1QVF S;  2BS3 A;  4GY5 A;  1JJ2 A;  4AKH A;  2LT1 A;  3CXC A;  3HBL A;  2ZCF B;  4A53 A;  2RH2 A;  1V29 B;  3BG3 A;  3QYB A;  3L1A A;  2K57 A;  2MF2 A;  1KD1 U;  2K5I A;  4XU0 A;  3V8K A;  2L5Q A;  3X25 B;  5FRO A;  3QYE A;  4M77 D;  5A0L A;  3JB9 F;  1KD1 C;  5GAM g;  4MMK A;  2RHY A;  2QF7 A;  2P0Q A;  4XTY A;  2H3J A;  3QBY A;  4LDU A;  5D6W A;  3S3O A;  2E65 A;  2LC4 A;  4L59 A;  2QI2 A;  3JCM h;  1KHC A;  3X28 B;  2RK1 A;  5FU6 B;  5GAO p;  1KC8 U;  3CCV A;  2HAX A;  4HNV A;  2K5F A;  3L2Q A;  1K8A C;  2ZPE B;  4C0Z A;  3JCM P;  1VQ4 T;  2D6F A;  3BW1 A;  2QQ8 A;  1E7P A;  3GOX A;  1KC8 C;  5LJ5 g;  1YCY A;  5C6S A;  3SFM A;  1OZ3 A;  3RKW A;  3QWL A;  5GAN j;  3GP8 A;  3PIO A;  2ZPB B;  1NJI U;  4XTV A;  4C5I A;  2E12 A;  1G3Y A;  3BY7 A;  3CMA A;  2A7Y A;  4EMK A;  3JCM b;  3CCQ T;  3AHU A;  1M8V A;  2QDJ A;  4BAC A;  3RKX A;  2HBP A;  5FU7 B;  3OYB A;  1VQK A;  3CC7 T;  2LDM A;  4VUB A;  3QPH A;  4M75 G;  2AHJ B;  4XTW A;  5LJ5 f;  2ZZD B;  3G71 T;  2RD1 A;  4M75 B;  4C8Q A;  3MP1 A;  1M1G A;  3L42 A;  3JB9 H;  4RCC A;  1MHN A;  4WF2 A;  2EJ9 A;  2QTX A;  4NOY A;  4EMG A;  3EAE A;  3JB9 D;  3C12 A;  3TRE A;  4BE0 A;  2KY9 A;  4RG2 A;  2KK4 A;  4J6X A;  1YI2 T;  2K3Y A;  3BDL A;  3T9N A;  5GAN d;  2KMT A;  4OP0 A;  4UC4 A;  3VU3 C;  1VQP A;  5CQX A;  4PJO A;  3X26 B;  4M77 A;  3SWN B;  2RHZ A;  3OYI A;  1JBM A;  2PQW A;  1VQ8 A;  2FVU A;  4C0D C;  4HCC A;  4QW2 A;  4MFE A;  4FT4 A;  5DM7 R;  1JJ2 S;  3CXC S;  2F5T X;  4MDW A;  4FL6 A;  4FU6 A;  1Y7X A;  1VQL T;  5M9O A;  4BE1 A;  3QSU A;  2OTL A;  2X35 A;  2EQK A;  3VV0 A;  4ELZ C;  3I55 T;  3CCS T;  2MMP A;  1P92 A;  3HHT B;  2FHD A;  2B8A A;  4JRI A;  1Y96 B;  3CCJ T;  2RB6 A;  3NTK A;  3VYG B;  4AI6 A;  2XIC A;  4N4H A;  4XU1 A;  3OMG A;  4A4K A;  1VQ7 T;  3CC7 A;  2QFZ A;  2BS2 A;  2A3L A;  2KVQ G;  5CKF A;  4E47 A;  3RES A;  3G6E A;  1SSF A;  3HB9 A;  1NPP A;  3HPW A;  3FLG A;  2G77 A;  2PUO B;  3OYJ A;  4HL4 A;  2RJD A;  2HQX A;  2K2V A;  3C94 A;  1I8F A;  4AKG A;  3JCM c;  4ZGD B;  2WSC E;  3UWN A;  3JCM e;  3CCM A;  4E7L A;  2QDY B;  3QYG B;  4LDY A;  4OGE A;  3INZ A;  3M59 A;  1YI2 A;  3CCL A;  2IVW A;  3TEE A;  1BIB A;  3PFS A;  2V8J A;  2OTJ T;  2M16 A;  4LD9 K;  2QA4 T;  2DK3 A;  3E9F A;  3TU4 K;  3CC2 A;  2E64 A;  4C92 C;  1VUB A;  1WJS A;  1WPY A;  3QZ5 B;  2RJF A;  3FDR A;  4MFD A;  4A4F A;  5EG2 A;  2K3X A;  3JCM V;  1HXD A;  1QP2 A;  1ZQ1 A;  3DB4 A;  2XDP A;  4JS5 A;  3TW6 A;  2PVO B;  5J3B A;  3A8M B;  4MZM A;  4EMK B;  2XG8 D;  3KUF A;  4Y91 A;  1OZ2 A;  5KH6 A;  5HK3 A;  2QQ9 A;  2YRV A;  2LCC A;  3MET A;  2YLC A;  4M78 C;  4OB1 B;  1FWZ A;  1JRI A;  3QYH B;  1G3S A;  2WJ9 A;  1B34 A;  4C92 F;  4C92 E;  5GAN 6;  3CCV T;  2YHT A;  2KMG A;  2E70 A;  5GAN e;  1X6O A;  4ZTF A;  2E6Z A;  4KUD K;  4A4E A;  4IKF A;  3EFS A;  4RG8 A;  4F7U B;  5GMK l;  4EPC A;  5GAN 5;  2DXC A;  4F7U E;  2QXF A;  1M1K C;  5C0M A;  1KG1 A;  3RER A;  1G5V A;  3Q1J A;  3HRU A;  3RUX A;  5GMK h;  4E7K A;  1RI0 A;  2BUD A;  2CS7 A;  3JCM W;  2CGH A;  3LW5 E;  4MDX A;  4M78 B;  3A8O B;  1I4K 1;  2E10 A;  4M78 E;  2O4X A;  4M6V A;  4M78 F;  5GAM h;  4PJO G;  1PSE A;  2GCX A;  3FJP A;  1K9M U;  3CD6 A;  4M7D G;  1VQK T;  4XK8 E;  3SDZ A;  2DD4 B;  2XID A;  4OB3 B;  4BBR M;  1UGR B;  3QO3 A;  1BYM A;  1AHJ B;  2IG0 A;  4M7D B;  2LX9 A;  3DKM A;  4B9X A;  3OW2 S;  1K9M C;  3E19 A;  4M7D E;  2CZ0 B;  5FU6 C;  3LGF A;  5LJ5 h;  4JLI A;  4BY6 C;  3CCE A;  3L2V A;  3P8D A;  4M7A G;  3X24 B;  4O5V A;  2CKK A;  5GMK m;  4JJN K;  1VQ5 A;  1O9S A;  5CCA A;  4M7A B;  1K73 U;  4BI4 A;  2CZ7 B;  3CCR T;  2DZC A;  4C5E A;  4C92 D;  5CAI A;  3J7A F;  4N0A C;  1VQP T;  1OI1 A;  1K73 C;  3KXT A;  3CPF A;  4ZGE B;  4HT8 A;  3HRS A;  5LJ3 g;  4ZTJ A;  1UGS B;  4JX6 A;  1FX7 A;  1N6A A;  3M54 A;  5FU7 C;  4BY6 B;  2QQS A;  2P0K A;  5KE3 A;  3JCM d;  4X34 A;  1PSF A;  1ZHI A;  3JCM X;  1FXX A;  3ME9 A;  2EQJ A;  4OMF B;  3VKI A;  1H3Z A;  2GF7 A;  4M75 C;  1VQO A;  4M78 D;  2OTL T;  3QHS A;  2HNI A;  1YIT A;  3P8H A;  5AYF A;  4RCB A;  1N9S A;  3JB9 I;  2DZ9 A;  3ASK A;  3MEU A;  1NJI C;  1WQW A;  3OSV A;  3LWI A;  2KDS A;  2EQU A;  2EIF A;  2FL7 A;  2K5L A;  4OGC A;  4QVD A;  5LJ3 f;  3L2U A;  5CKB A;  1QP3 A;  4JDS A;  3A8L B;  4D6W A;  4EMH A;  4LOC A;  5GAO l;  3OY9 A;  3V8J A;  1FKM A;  4Q5W A;  3BG9 A;  4Z02 A;  4ZN1 A;  3H8Z A;  3G6E T;  1N8R U;  4HLQ A;  5GAN 4;  3SWN C;  1VIE A;  1Q7Y U;  4M75 F;  3P8B B;  4M75 E;  3VUZ A;  2X4X A;  3HO8 A;  3FIF A;  2HQE A;  2RJE A;  4EDU A;  3OYC A;  3CCM T;  3OYF A;  1IZ6 A;  4PLL A;  1YJW A;  2QQR A;  3CPW A;  3HSB A;  4JX5 A;  4A4H A;  1R8O B;  3V7C A;  4HT9 A;  2ZPH B;  2DD5 A;  3QUI A;  3CCL T;  1Y07 A;  2DKG A;  1UB4 A;  2BKD N;  4IUP A;  4HNT A;  2Y4Y A;  4C5H A;  2QEX A;  3CCR A;  4MIM A;  3CME A;  3NFC A;  3CC2 T;  5DY9 A;  4QSH A;  5HY6 A;  5GMK e;  2RI3 A;  5CR2 A;  2DXB A;  3R6O A;  2R57 A;  5GAM e;  4HKE A;  4P5N A;  4PLI A;  1W4S A;  4J6Y A;  3QZ9 B;  1KQ1 A;  5GAO m;  4N4G A;  3OS1 A;  3OYD A;  3OYE A;  2GQV A;  2D9T A;  4PL6 A;  5LL6 S;  2PU9 B;  2XK0 A;  4Z6Y A;  2EWN A;  3HL8 A;  3M55 A;  3DLL A;  1D3B A;  1RL2 A;  2P4T A;  3KHI A;  3H6Z A;  4IUT A;  5LJ5 e;  2DIG A;  1HK9 A;  3WVD B;  4JRQ A;  2PUK B;  2JUF A;  2FB7 A;  3V8L A;  4M75 D;  3L2R A;  3WVE B;  3ER0 A;  3CBM A;  2VC8 A;  3E9G A;  2EAY A;  3QG1 A;  3CBP A;  1UGP B;  4OB0 B;  2XKO C;  3MEV A;  1VQ8 T;  2LQ8 A;  5D6Y A;  5CKH A;  2XDD A;  2EJF A;  3PMI A;  1X75 C;  2Y4X A;  2VV5 A;  1OYX A;  4X9C A;  1O75 A;  4RMO A;  1MGQ A;  1M1F A;  2E6N A;  2V8I A;  3J80 E;  1Q82 U;  3FB9 A;  1WJR A;  3G4S A;  3CD6 T;  2QQB A;  2ZPF B;  5IN1 A;  1QLB A;  2R5M A;  4FT2 A;  5GAN g;  4EMK C;  5GAO n;  3CCU A;  1BKB A;  3OSS C;  3OYH A;  4J7F A;  1DJ7 B;  5GAN 7;  1XNI A;  3UDC A;  2PVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...