2C5OB

Differential binding of inhibitors to active and inactive cdk2 provides insights for drug design
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Differential Binding of Inhibitors to Active and Inactive Cdk2 Provides Insights for Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5oB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5oB02
4I3ZB 1GH6B 2WIPB 1JSUB 1C9BA 1UNLD 1H26B 2QDJA 3MY1B 5HVYB 4OR5B 5HBEB 3BHTB 5EFQB 4NSTB 1VOLA 1QMZB 2PK9B 1VINA 4KRDB 4BCPB 4YC3B 2PMIB 3RGFB 3O0GD 2BPMB 2IW8B 1D3UB 3DDQB 4BCFB 4BCMD 3LQ5B 5LMKB 3DDPB 3TNWB 4F6UB 5LQFB 3BLRB 2EUFA 1ZP2A 4BCNB 4BCQD 2G9XB 2WEVB 4F70B 4ELLA 4EOMB 4TTHA 4EOQB 4BCJB 2UUEB 1OIUB 3BLQB 3H4CA 5ACBA 4CFWB 3F5XB 1AISB 1W98B 4CFNB 4CRLB 1OL2B 3QHRB 4ROEA 2V22B 1JSTB 2C5OB 4G6LB 2X1NB 5IF1B 4EC8B 2WMAB 4BCKB 1H24B 4F6SB 5L2WB 2F2CA 3EOCB 4BCHB 1GY3B 1URCB 3POMA 1H4LD 3QHWB 5FGKB 1OL1B 5CYIB 2BKZB 1G3NC 2WXVB 3MIAB 1BU2A 2IW6B 5HBJB 4KRCB 2W9ZA 3EJ1B 3TN8B 4F7JB 4CFVB 4EONB 4OGRB 1OKWB 1GUXB 1H1SB 2PK2A 4BCGB 1PKDB 4BCMB 1UNHD 2WMBB 5HNBB 3DOGB 4EOLB 2W99A 1F5QB 4BCIB 1P5EB 4II5B 4YOZA 4CFUD 1OI9B 5BNJB 2R7GA 3K7AM 5HBHB 2W9FA 3MY5B 4BCQB 1O9KB 3TNHB 5IDPB 3EIDB 4ROCA 2CJMB 3MI9B 1OIYB 2WPAB 2PHGA 2UZEB 2WFYB 1E9HB 3M03A 4ELJA 5ICPB 1OGUB 1TFBA 2C4GB 4CFUB 4EOIB 1H1RB 1AD6A 2CCHB 4F7SB 4UN0A 2C5VB 5CEIB 1UNGD 1GUXA 5IDNB 4F6WB 2CCIB 2JGZB 2C6TB 2C5XB 2UZLB 2UZBB 5HQ0B 4CFMB 4EORB 2B9RA 2W2HA 2WIHB 4CXAB 4EC9B 1FVVB 4RODA 4FX3B 4EOJB 4YOOA 4EOPB 4BCND 1JKWA 1H25B 4EOSB 1OKVB 1VYWB 4F7NB 2I40B 2IVXA 3BHUB 1O9KA 2I53A 1JOWA 4YOSA 2IW9B 1H27B 4Y72B 2C5NB 2WHBB 1FINB 3TNIB 1H1PB 3BHVB 3BLHB 3G33B 4EOOB 1H28B 1H1QB 5I5ZB 4BCOB 2W96A 4F7LB 1N4MA 1KXUA 1XO2A 2UZDB 4IMYB 4CFXB 4EOKB
chains in the Genus database with same CATH superfamily
3X20B 4MIMA 4QSHA 3X28B 1UNLD 1QMZB 3PO3S 5IHYA 3RGFB 2IW8B 3DDQB 3WVEB 1ZP2A 2DPPB 3HHTB 4TTHA 2D0QB 1OIUB 3A8GB 3F5XB 2ZPGB 3X26B 2CZ0B 4CFNB 4OB3B 5IF1B 2C5OB 5EJCA 4BCHB 3POMA 3VYGB 5FGKB 1OL1B 1G3NC 5HBJB 4KRCB 3QXEB 4OGRB 1GUXB 1H1SB 2PK2A 3A8OB 1PKDB 1V29B 4BCIB 1OI9B 4BCQB 4M6VA 5IDPB 4ROCA 5ICPB 1OGUB 1TFBA 1H1RB 1AD6A 4OB2B 2C5VB 3A8LB 1UNGD 5IDNB 4F6WB 5CEIB 1QLBA 2C6TB 3QYBA 4EORB 1ENWA 2B9RA 2WIHB 1FVVB 4RODA 5DQWA 4HNVA 1JKWA 1VYWB 3X25B 2I40B 3BHUB 1H27B 2WHBB 1FINB 1AHJB 3G33B 3HO8A 4BXXX 4F7LB 1N4MA 3QYHB 2UZDB 4CFXB 4EOKB 4I3ZB 1JSUB 2ZPFB 1H26B 5HBEB 3BHTB 4NSTB 3NDQA 2PK9B 4BCPB 1UGPB 4HL4A 2DMEA 5LMKB 5LQFB 3DJBA 4BCQD 2G9XB 2WEVB 3VKHA 2UUEB 3BLQB 3QYGB 3HBLA 3QWLA 2X1NB 4EC8B 4MFEA 1H24B 2F2CA 3A8MB 1GY3B 1UGSB 5CYIB 2DD5B 3HB9A 2BKZB 3MIAB 2IW6B 4BBRM 4FM4B 4F7JB 4EONB 3BG3A 1OKWB 2DXCB 2G77A 2WMBB 1F5QB 4II5B 4CFUD 4BBSM 5HBHB 2W9FA 2ZCFB 1O9KB 3TNHB 2QDYB 2CYZB 3EIDB 2CJMB 3MI9B 1OIYB 2QFZA 4ELJA 2KMGA 4EOIB 2CCHB 1TD6A 4UN0A 1GUXA 2CCIB 2JGZB 2UZBB 5HQ0B 3B57A 2W2HA 1E7PA 4EOJB 2IVXA 4JX5A 1JOWA 2CZ7B 2IW9B 4Y72B 2C5NB 4ZGEB 2ZPBB 4EOOB 5DQVA 4BCOB 3QYEA 1UGRB 4IMYB 2ZPHB 3WVDB 4ZGDB 3A8HB 4OR5B 1VINA 4KRDB 2PMIB 3BG9A 2QF7A 3LQ5B 3TNWB 4F6UB 2EUFA 2ZPIB 4OB0B 4F70B 4ELLA 4EOQB 3H4CA 4CFWB 4CRLB 1OL2B 4ROEA 2V22B 1JSTB 4Z6YA 4BCKB 4F6SB 5L2WB 4OB1B 3X24B 3DTOA 2ZZDB 4AKGA 2W9ZA 2BS3A 4HNTA 4BCGB 4BCMB 1UNHD 5HNBB 1P5EB 2QGSA 4YOZA 5BNJB 2R7GA 3K7AM 3MY5B 2PHGA 2UZEB 3M03A 1E9HB 1UGQB 2C4GB 3HZJA 3VYHB 2DXBB 2C5XB 2UZLB 4CFMB 2BS2A 4CXAB 4FX3B 4YOOA 1H25B 1O9KA 2I53A 2IN3A 2DD4B 3TNIB 3DL1A 1H1PB 3BHVB 1GH6B 2WIPB 1C9BA 2QDJA 3TW7A 3MY1B 5HVYB 5EFQB 2AHJB 1VOLA 4YC3B 4JX4A 2LW4A 3O0GD 2BPMB 1D3UB 4BCFB 4BCMD 4BY1X 3DDPB 3BLRB 4BCNB 2CZ1B 4EOMB 2KR6A 4ZGJB 4BCJB 5ACBA 3GTMS 1AISB 1W98B 4HNUA 3QHRB 4G6LB 2WMAB 3EOCB 1URCB 1H4LD 3QHWB 2WXVB 1BU2A 4AKHA 3EJ1B 3TN8B 4LOCA 4CFVB 4AI6A 4NC6A 1FKMA 3DOGB 4EOLB 2W99A 2BS4A 4MFDA 4BY7X 2WPAB 2WFYB 3VKGA 4CFUB 3TW6A 2QQ8A 2ZPEB 4AKIA 4F7SB 3KHIA 4EC9B 3QZ9B 4EOPB 4BCND 4EOSB 3BG5A 1OKVB 4F7NB 4YOSA 3BLHB 4HLQA 1H28B 1H1QB 5I5ZB 2W96A 1IREB 1KXUA 1XO2A 4JX6A 2CZ6B 2WJ9A 3QZ5B 2PJQA
chains in the Genus database with same CATH topology
4I3ZB 1GH6B 2WIPB 1JSUB 1C9BA 1UNLD 1H26B 2QDJA 3MY1B 5HVYB 4OR5B 5HBEB 3BHTB 5EFQB 4NSTB 1VOLA 1QMZB 2PK9B 1VINA 4KRDB 4BCPB 4YC3B 2PMIB 3RGFB 3O0GD 2BPMB 2IW8B 1D3UB 3DDQB 4BCFB 4BCMD 3LQ5B 5LMKB 3DDPB 3TNWB 4F6UB 5LQFB 3BLRB 2EUFA 1ZP2A 4BCNB 4BCQD 2G9XB 2WEVB 4F70B 4ELLA 4EOMB 4TTHA 4EOQB 4BCJB 2UUEB 1OIUB 3BLQB 3H4CA 5ACBA 4CFWB 3F5XB 1AISB 1W98B 4CFNB 4CRLB 1OL2B 3QHRB 4ROEA 2V22B 1JSTB 2C5OB 4G6LB 2X1NB 5IF1B 4EC8B 2WMAB 4BCKB 1H24B 4F6SB 5L2WB 2F2CA 3EOCB 4BCHB 1GY3B 1URCB 3POMA 1H4LD 3QHWB 5FGKB 1OL1B 5CYIB 2BKZB 1G3NC 2WXVB 3MIAB 1BU2A 2IW6B 5HBJB 4KRCB 2W9ZA 3EJ1B 3TN8B 4F7JB 4CFVB 4EONB 4OGRB 1OKWB 1GUXB 1H1SB 2PK2A 4BCGB 1PKDB 4BCMB 1UNHD 2WMBB 5HNBB 3DOGB 4EOLB 2W99A 1F5QB 4BCIB 1P5EB 4II5B 4YOZA 4CFUD 1OI9B 5BNJB 2R7GA 3K7AM 5HBHB 2W9FA 3MY5B 4BCQB 1O9KB 3TNHB 5IDPB 3EIDB 4ROCA 2CJMB 3MI9B 1OIYB 2WPAB 2PHGA 2UZEB 2WFYB 1E9HB 3M03A 4ELJA 5ICPB 1OGUB 1TFBA 2C4GB 4CFUB 4EOIB 1H1RB 1AD6A 2CCHB 4F7SB 4UN0A 2C5VB 5CEIB 1UNGD 1GUXA 5IDNB 4F6WB 2CCIB 2JGZB 2C6TB 2C5XB 2UZLB 2UZBB 5HQ0B 4CFMB 4EORB 2B9RA 2W2HA 2WIHB 4CXAB 4EC9B 1FVVB 4RODA 4FX3B 4EOJB 4YOOA 4EOPB 4BCND 1JKWA 1H25B 4EOSB 1OKVB 1VYWB 4F7NB 2I40B 2IVXA 3BHUB 1O9KA 2I53A 1JOWA 4YOSA 2IW9B 1H27B 4Y72B 2C5NB 2WHBB 1FINB 3TNIB 1H1PB 3BHVB 3BLHB 3G33B 4EOOB 1H28B 1H1QB 5I5ZB 4BCOB 2W96A 4F7LB 1N4MA 1KXUA 1XO2A 2UZDB 4IMYB 4CFXB 4EOKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3Z B;  1GH6 B;  2WIP B;  1JSU B;  1C9B A;  1UNL D;  1H26 B;  2QDJ A;  3MY1 B;  5HVY B;  4OR5 B;  5HBE B;  3BHT B;  5EFQ B;  4NST B;  1VOL A;  1QMZ B;  2PK9 B;  1VIN A;  4KRD B;  4BCP B;  4YC3 B;  2PMI B;  3RGF B;  3O0G D;  2BPM B;  2IW8 B;  1D3U B;  3DDQ B;  4BCF B;  4BCM D;  3LQ5 B;  5LMK B;  3DDP B;  3TNW B;  4F6U B;  5LQF B;  3BLR B;  2EUF A;  1ZP2 A;  4BCN B;  4BCQ D;  2G9X B;  2WEV B;  4F70 B;  4ELL A;  4EOM B;  4TTH A;  4EOQ B;  4BCJ B;  2UUE B;  1OIU B;  3BLQ B;  3H4C A;  5ACB A;  4CFW B;  3F5X B;  1AIS B;  1W98 B;  4CFN B;  4CRL B;  1OL2 B;  3QHR B;  4ROE A;  2V22 B;  1JST B;  2C5O B;  4G6L B;  2X1N B;  5IF1 B;  4EC8 B;  2WMA B;  4BCK B;  1H24 B;  4F6S B;  5L2W B;  2F2C A;  3EOC B;  4BCH B;  1GY3 B;  1URC B;  3POM A;  1H4L D;  3QHW B;  5FGK B;  1OL1 B;  5CYI B;  2BKZ B;  1G3N C;  2WXV B;  3MIA B;  1BU2 A;  2IW6 B;  5HBJ B;  4KRC B;  2W9Z A;  3EJ1 B;  3TN8 B;  4F7J B;  4CFV B;  4EON B;  4OGR B;  1OKW B;  1GUX B;  1H1S B;  2PK2 A;  4BCG B;  1PKD B;  4BCM B;  1UNH D;  2WMB B;  5HNB B;  3DOG B;  4EOL B;  2W99 A;  1F5Q B;  4BCI B;  1P5E B;  4II5 B;  4YOZ A;  4CFU D;  1OI9 B;  5BNJ B;  2R7G A;  3K7A M;  5HBH B;  2W9F A;  3MY5 B;  4BCQ B;  1O9K B;  3TNH B;  5IDP B;  3EID B;  4ROC A;  2CJM B;  3MI9 B;  1OIY B;  2WPA B;  2PHG A;  2UZE B;  2WFY B;  1E9H B;  3M03 A;  4ELJ A;  5ICP B;  1OGU B;  1TFB A;  2C4G B;  4CFU B;  4EOI B;  1H1R B;  1AD6 A;  2CCH B;  4F7S B;  4UN0 A;  2C5V B;  5CEI B;  1UNG D;  1GUX A;  5IDN B;  4F6W B;  2CCI B;  2JGZ B;  2C6T B;  2C5X B;  2UZL B;  2UZB B;  5HQ0 B;  4CFM B;  4EOR B;  2B9R A;  2W2H A;  2WIH B;  4CXA B;  4EC9 B;  1FVV B;  4ROD A;  4FX3 B;  4EOJ B;  4YOO A;  4EOP B;  4BCN D;  1JKW A;  1H25 B;  4EOS B;  1OKV B;  1VYW B;  4F7N B;  2I40 B;  2IVX A;  3BHU B;  1O9K A;  2I53 A;  1JOW A;  4YOS A;  2IW9 B;  1H27 B;  4Y72 B;  2C5N B;  2WHB B;  1FIN B;  3TNI B;  1H1P B;  3BHV B;  3BLH B;  3G33 B;  4EOO B;  1H28 B;  1H1Q B;  5I5Z B;  4BCO B;  2W96 A;  4F7L B;  1N4M A;  1KXU A;  1XO2 A;  2UZD B;  4IMY B;  4CFX B;  4EOK B; 
#chains in the Genus database with same CATH topology
 3X20 B;  4MIM A;  4QSH A;  3X28 B;  1UNL D;  1QMZ B;  3PO3 S;  5IHY A;  3RGF B;  2IW8 B;  3DDQ B;  3WVE B;  1ZP2 A;  2DPP B;  3HHT B;  4TTH A;  2D0Q B;  1OIU B;  3A8G B;  3F5X B;  2ZPG B;  3X26 B;  2CZ0 B;  4CFN B;  4OB3 B;  5IF1 B;  2C5O B;  5EJC A;  4BCH B;  3POM A;  3VYG B;  5FGK B;  1OL1 B;  1G3N C;  5HBJ B;  4KRC B;  3QXE B;  4OGR B;  1GUX B;  1H1S B;  2PK2 A;  3A8O B;  1PKD B;  1V29 B;  4BCI B;  1OI9 B;  4BCQ B;  4M6V A;  5IDP B;  4ROC A;  5ICP B;  1OGU B;  1TFB A;  1H1R B;  1AD6 A;  4OB2 B;  2C5V B;  3A8L B;  1UNG D;  5IDN B;  4F6W B;  5CEI B;  1QLB A;  2C6T B;  3QYB A;  4EOR B;  1ENW A;  2B9R A;  2WIH B;  1FVV B;  4ROD A;  5DQW A;  4HNV A;  1JKW A;  1VYW B;  3X25 B;  2I40 B;  3BHU B;  1H27 B;  2WHB B;  1FIN B;  1AHJ B;  3G33 B;  3HO8 A;  4BXX X;  4F7L B;  1N4M A;  3QYH B;  2UZD B;  4CFX B;  4EOK B;  4I3Z B;  1JSU B;  2ZPF B;  1H26 B;  5HBE B;  3BHT B;  4NST B;  3NDQ A;  2PK9 B;  4BCP B;  1UGP B;  4HL4 A;  2DME A;  5LMK B;  5LQF B;  3DJB A;  4BCQ D;  2G9X B;  2WEV B;  3VKH A;  2UUE B;  3BLQ B;  3QYG B;  3HBL A;  3QWL A;  2X1N B;  4EC8 B;  4MFE A;  1H24 B;  2F2C A;  3A8M B;  1GY3 B;  1UGS B;  5CYI B;  2DD5 B;  3HB9 A;  2BKZ B;  3MIA B;  2IW6 B;  4BBR M;  4FM4 B;  4F7J B;  4EON B;  3BG3 A;  1OKW B;  2DXC B;  2G77 A;  2WMB B;  1F5Q B;  4II5 B;  4CFU D;  4BBS M;  5HBH B;  2W9F A;  2ZCF B;  1O9K B;  3TNH B;  2QDY B;  2CYZ B;  3EID B;  2CJM B;  3MI9 B;  1OIY B;  2QFZ A;  4ELJ A;  2KMG A;  4EOI B;  2CCH B;  1TD6 A;  4UN0 A;  1GUX A;  2CCI B;  2JGZ B;  2UZB B;  5HQ0 B;  3B57 A;  2W2H A;  1E7P A;  4EOJ B;  2IVX A;  4JX5 A;  1JOW A;  2CZ7 B;  2IW9 B;  4Y72 B;  2C5N B;  4ZGE B;  2ZPB B;  4EOO B;  5DQV A;  4BCO B;  3QYE A;  1UGR B;  4IMY B;  2ZPH B;  3WVD B;  4ZGD B;  3A8H B;  4OR5 B;  1VIN A;  4KRD B;  2PMI B;  3BG9 A;  2QF7 A;  3LQ5 B;  3TNW B;  4F6U B;  2EUF A;  2ZPI B;  4OB0 B;  4F70 B;  4ELL A;  4EOQ B;  3H4C A;  4CFW B;  4CRL B;  1OL2 B;  4ROE A;  2V22 B;  1JST B;  4Z6Y A;  4BCK B;  4F6S B;  5L2W B;  4OB1 B;  3X24 B;  3DTO A;  2ZZD B;  4AKG A;  2W9Z A;  2BS3 A;  4HNT A;  4BCG B;  4BCM B;  1UNH D;  5HNB B;  1P5E B;  2QGS A;  4YOZ A;  5BNJ B;  2R7G A;  3K7A M;  3MY5 B;  2PHG A;  2UZE B;  3M03 A;  1E9H B;  1UGQ B;  2C4G B;  3HZJ A;  3VYH B;  2DXB B;  2C5X B;  2UZL B;  4CFM B;  2BS2 A;  4CXA B;  4FX3 B;  4YOO A;  1H25 B;  1O9K A;  2I53 A;  2IN3 A;  2DD4 B;  3TNI B;  3DL1 A;  1H1P B;  3BHV B;  1GH6 B;  2WIP B;  1C9B A;  2QDJ A;  3TW7 A;  3MY1 B;  5HVY B;  5EFQ B;  2AHJ B;  1VOL A;  4YC3 B;  4JX4 A;  2LW4 A;  3O0G D;  2BPM B;  1D3U B;  4BCF B;  4BCM D;  4BY1 X;  3DDP B;  3BLR B;  4BCN B;  2CZ1 B;  4EOM B;  2KR6 A;  4ZGJ B;  4BCJ B;  5ACB A;  3GTM S;  1AIS B;  1W98 B;  4HNU A;  3QHR B;  4G6L B;  2WMA B;  3EOC B;  1URC B;  1H4L D;  3QHW B;  2WXV B;  1BU2 A;  4AKH A;  3EJ1 B;  3TN8 B;  4LOC A;  4CFV B;  4AI6 A;  4NC6 A;  1FKM A;  3DOG B;  4EOL B;  2W99 A;  2BS4 A;  4MFD A;  4BY7 X;  2WPA B;  2WFY B;  3VKG A;  4CFU B;  3TW6 A;  2QQ8 A;  2ZPE B;  4AKI A;  4F7S B;  3KHI A;  4EC9 B;  3QZ9 B;  4EOP B;  4BCN D;  4EOS B;  3BG5 A;  1OKV B;  4F7N B;  4YOS A;  3BLH B;  4HLQ A;  1H28 B;  1H1Q B;  5I5Z B;  2W96 A;  1IRE B;  1KXU A;  1XO2 A;  4JX6 A;  2CZ6 B;  2WJ9 A;  3QZ5 B;  2PJQ A; 
#chains in the Genus database with same CATH homology
 4I3Z B;  1GH6 B;  2WIP B;  1JSU B;  1C9B A;  1UNL D;  1H26 B;  2QDJ A;  3MY1 B;  5HVY B;  4OR5 B;  5HBE B;  3BHT B;  5EFQ B;  4NST B;  1VOL A;  1QMZ B;  2PK9 B;  1VIN A;  4KRD B;  4BCP B;  4YC3 B;  2PMI B;  3RGF B;  3O0G D;  2BPM B;  2IW8 B;  1D3U B;  3DDQ B;  4BCF B;  4BCM D;  3LQ5 B;  5LMK B;  3DDP B;  3TNW B;  4F6U B;  5LQF B;  3BLR B;  2EUF A;  1ZP2 A;  4BCN B;  4BCQ D;  2G9X B;  2WEV B;  4F70 B;  4ELL A;  4EOM B;  4TTH A;  4EOQ B;  4BCJ B;  2UUE B;  1OIU B;  3BLQ B;  3H4C A;  5ACB A;  4CFW B;  3F5X B;  1AIS B;  1W98 B;  4CFN B;  4CRL B;  1OL2 B;  3QHR B;  4ROE A;  2V22 B;  1JST B;  2C5O B;  4G6L B;  2X1N B;  5IF1 B;  4EC8 B;  2WMA B;  4BCK B;  1H24 B;  4F6S B;  5L2W B;  2F2C A;  3EOC B;  4BCH B;  1GY3 B;  1URC B;  3POM A;  1H4L D;  3QHW B;  5FGK B;  1OL1 B;  5CYI B;  2BKZ B;  1G3N C;  2WXV B;  3MIA B;  1BU2 A;  2IW6 B;  5HBJ B;  4KRC B;  2W9Z A;  3EJ1 B;  3TN8 B;  4F7J B;  4CFV B;  4EON B;  4OGR B;  1OKW B;  1GUX B;  1H1S B;  2PK2 A;  4BCG B;  1PKD B;  4BCM B;  1UNH D;  2WMB B;  5HNB B;  3DOG B;  4EOL B;  2W99 A;  1F5Q B;  4BCI B;  1P5E B;  4II5 B;  4YOZ A;  4CFU D;  1OI9 B;  5BNJ B;  2R7G A;  3K7A M;  5HBH B;  2W9F A;  3MY5 B;  4BCQ B;  1O9K B;  3TNH B;  5IDP B;  3EID B;  4ROC A;  2CJM B;  3MI9 B;  1OIY B;  2WPA B;  2PHG A;  2UZE B;  2WFY B;  1E9H B;  3M03 A;  4ELJ A;  5ICP B;  1OGU B;  1TFB A;  2C4G B;  4CFU B;  4EOI B;  1H1R B;  1AD6 A;  2CCH B;  4F7S B;  4UN0 A;  2C5V B;  5CEI B;  1UNG D;  1GUX A;  5IDN B;  4F6W B;  2CCI B;  2JGZ B;  2C6T B;  2C5X B;  2UZL B;  2UZB B;  5HQ0 B;  4CFM B;  4EOR B;  2B9R A;  2W2H A;  2WIH B;  4CXA B;  4EC9 B;  1FVV B;  4ROD A;  4FX3 B;  4EOJ B;  4YOO A;  4EOP B;  4BCN D;  1JKW A;  1H25 B;  4EOS B;  1OKV B;  1VYW B;  4F7N B;  2I40 B;  2IVX A;  3BHU B;  1O9K A;  2I53 A;  1JOW A;  4YOS A;  2IW9 B;  1H27 B;  4Y72 B;  2C5N B;  2WHB B;  1FIN B;  3TNI B;  1H1P B;  3BHV B;  3BLH B;  3G33 B;  4EOO B;  1H28 B;  1H1Q B;  5I5Z B;  4BCO B;  2W96 A;  4F7L B;  1N4M A;  1KXU A;  1XO2 A;  2UZD B;  4IMY B;  4CFX B;  4EOK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...