2IW9B

Structure of human thr160-phospho cdk2-cyclin a complexed with a bisanilinopyrimidine inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
255
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Dissecting the Determinants of Cyclin-Dependent Kinase 2 and Cyclin-Dependent Kinase 4 Inhibitor Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 255
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2iw9B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2iw9B02
1UNGD 5FGKB 2QDJA 4ELLA 2W99A 4CFXB 2CCIB 2R7GA 4I3ZB 3TNHB 4ELJA 4F6UB 4EC9B 4TTHA 2UUEB 1OL2B 5IF1B 2G9XB 1JOWA 1VINA 2UZDB 3BHVB 3BLRB 5HQ0B 4RODA 3DDQB 1O9KB 3O0GD 2PMIB 1GUXB 1W98B 2W9ZA 3BHUB 5IDNB 3TNIB 5HBHB 4F7SB 4EOOB 3MI9B 2BPMB 4OGRB 4YOSA 5CYIB 3MIAB 1H1QB 3BHTB 4KRCB 1C9BA 5ACBA 4UN0A 4CFWB 4EC8B 1QMZB 5EFQB 3EJ1B 2WFYB 1OI9B 1O9KA 4F70B 1OGUB 2PK9B 1UNHD 4BCNB 3MY5B 3K7AM 4EOPB 4EOSB 2CCHB 3H4CA 4YC3B 1H24B 2C5XB 2B9RA 4BCFB 1H25B 3EOCB 2UZLB 2IVXA 1D3UB 1KXUA 1FINB 3MY1B 4BCQD 4YOZA 4CFNB 4CFUB 1ZP2A 4BCKB 3LQ5B 4CRLB 4BCIB 3M03A 1E9HB 1N4MA 5LQFB 2CJMB 2X1NB 2C5NB 4BCPB 3DOGB 2W9FA 2W96A 2WEVB 3TN8B 4ROEA 4BCMD 1VYWB 1OKVB 4NSTB 4F7LB 2UZBB 1GUXA 4EOMB 2WHBB 2WMAB 5L2WB 1UNLD 4BCOB 4F6SB 2IW8B 2C6TB 3DDPB 4EOLB 1JSTB 2C5OB 1P5EB 3POMA 4EOQB 4G6LB 2WMBB 2UZEB 3TNWB 4YOOA 4KRDB 3RGFB 5LMKB 2C4GB 1OIUB 1BU2A 1F5QB 1G3NC 1H27B 2EUFA 1H1RB 1H4LD 1OKWB 2WXVB 4OR5B 4BCJB 4FX3B 1H1PB 1JKWA 1TFBA 2I53A 3BLQB 2F2CA 3QHWB 3G33B 1GH6B 2IW9B 4BCQB 4CFMB 3F5XB 5HBJB 1XO2A 5IDPB 1PKDB 2IW6B 4EORB 5ICPB 1GY3B 5HVYB 2BKZB 1H28B 4ROCA 1OIYB 1OL1B 2V22B 4CXAB 4BCGB 2C5VB 4EOJB 1AISB 1JSUB 1H1SB 4CFVB 4EOIB 1VOLA 4II5B 4BCMB 4F6WB 4BCND 2PK2A 1H26B 5BNJB 5HBEB 3EIDB 2I40B 4Y72B 5CEIB 3BLHB 2JGZB 1FVVB 2WPAB 4EONB 3QHRB 4F7JB 4F7NB 1AD6A 2WIPB 4IMYB 2WIHB 4CFUD 4EOKB 1URCB 2W2HA 5HNBB 4BCHB 2PHGA 5I5ZB
chains in the Genus database with same CATH superfamily
4LOCA 4ELLA 2W99A 4MIMA 4CFXB 1V29B 3HBLA 2ZZDB 2ZPEB 1VINA 3BHVB 4RODA 2CZ1B 4AKGA 5IDNB 4F7SB 3MI9B 2PJQA 4BY1X 1H1QB 5ACBA 4CFWB 2DXBB 3X26B 4FM4B 4BCNB 4EOSB 4YC3B 1D3UB 1KXUA 3LQ5B 4CRLB 4MFDA 2KR6A 2CJMB 3DL1A 3X24B 2W9FA 4OB2B 2W96A 2WEVB 4BCMD 3HHTB 2C6TB 4EOLB 3BG9A 4KRDB 2DPPB 2G77A 4JX6A 2QGSA 1AHJB 1OIUB 1FKMA 1F5QB 1UGSB 2EUFA 1H1RB 1H4LD 4HL4A 4BCJB 1JKWA 2I53A 2ZPIB 3QHWB 4OB0B 2DD5B 3F5XB 3DJBA 1E7PA 4HLQA 1UGPB 2IW6B 3VYHB 4EORB 5ICPB 2QDYB 4JX4A 4BCGB 2C5VB 2DXCB 1JSUB 4BCND 5HBEB 3EIDB 3PO3S 5CEIB 3BLHB 2JGZB 1FVVB 2DMEA 4EONB 2WIHB 4EOKB 4JX5A 2W2HA 4BCHB 2PHGA 2R7GA 4F6UB 4EC9B 3VKHA 3BG3A 3DDQB 3O0GD 5HBHB 3HO8A 4YOSA 4KRCB 1QMZB 1UGQB 4BXXX 4EOPB 3H4CA 2C5XB 1H25B 4BBSM 5IHYA 1FINB 4CFUB 3M03A 5LQFB 1IREB 2X1NB 3DTOA 2ZPFB 2UZBB 2WHBB 5L2WB 2IW8B 1JSTB 3VKGA 2WMBB 2UZEB 5DQVA 4YOOA 2C4GB 5IF1B 1G3NC 1H27B 3QZ5B 2BS4A 1H1PB 1GH6B 2ZPHB 1XO2A 3A8LB 3A8MB 1GY3B 5HVYB 4ROCA 1OL1B 2V22B 4CXAB 4EOJB 2BS2A 3QYBA 1VOLA 4II5B 4F6WB 2WPAB 4F7JB 2CZ7B 4CFUD 1URCB 3HZJA 1UNGD 2QDJA 3TW7A 2CCIB 2LW4A 3TNHB 4ELJA 2UUEB 1OL2B 2G9XB 2UZDB 4HNTA 3BG5A 2PMIB 1W98B 3BHUB 2BPMB 4OGRB 5CYIB 3MIAB 3BHTB 4UN0A 3X28B 4EC8B 5EFQB 4ZGDB 4AI6A 2WFYB 1OI9B 1O9KA 1OGUB 2PK9B 3MY5B 2CCHB 1H24B 1TD6A 4QSHA 4BCFB 3EOCB 2UZLB 3QYGB 2QFZA 4BCKB 3WVEB 1E9HB 3DOGB 4OB3B 4BY7X 4ROEA 4F7LB 1VYWB 1OKVB 4OB1B 4EOMB 4BCOB 3A8HB 3POMA 4G6LB 3TNWB 5LMKB 3WVDB 2QQ8A 1OKWB 4FX3B 3BLQB 3QYHB 4BCQB 2ZPBB 1UGRB 5HBJB 1PKDB 3QYEA 2BKZB 1H28B 1OIYB 1AISB 1H1SB 3NDQA 5BNJB 1AD6A 4IMYB 4HNVA 2KMGA 5FGKB 4ZGEB 1ENWA 4Z6YA 4I3ZB 2DD4B 4TTHA 4AKIA 1JOWA 3BLRB 5HQ0B 1O9KB 1GUXB 2W9ZA 3TNIB 2QF7A 4HNUA 4EOOB 1C9BA 2CZ0B 3EJ1B 4F70B 1UNHD 4NC6A 3K7AM 3X25B 3A8OB 2B9RA 3TW6A 2IVXA 3MY1B 4BCQD 4YOZA 4CFNB 2D0QB 1ZP2A 4M6VA 5EJCA 4BCIB 1N4MA 4BCPB 2C5NB 3TN8B 4NSTB 2BS3A 2AHJB 1GUXA 2WMAB 2WJ9A 1UNLD 4F6SB 3GTMS 3DDPB 4ZGJB 2C5OB 1P5EB 3QWLA 4EOQB 2CYZB 3B57A 3RGFB 2CZ6B 1BU2A 4OR5B 2WXVB 5DQWA 1TFBA 3KHIA 2F2CA 3G33B 2IW9B 4CFMB 3QXEB 5IDPB 3X20B 2ZPGB 2ZCFB 4AKHA 2IN3A 1QLBA 4CFVB 3VYGB 4EOIB 4BCMB 2PK2A 1H26B 3A8GB 3HB9A 2I40B 4Y72B 3QHRB 4F7NB 2WIPB 3QZ9B 4BBRM 5HNBB 4MFEA 5I5ZB
chains in the Genus database with same CATH topology
1UNGD 5FGKB 2QDJA 4ELLA 2W99A 4CFXB 2CCIB 2R7GA 4I3ZB 3TNHB 4ELJA 4F6UB 4EC9B 4TTHA 2UUEB 1OL2B 5IF1B 2G9XB 1JOWA 1VINA 2UZDB 3BHVB 3BLRB 5HQ0B 4RODA 3DDQB 1O9KB 3O0GD 2PMIB 1GUXB 1W98B 2W9ZA 3BHUB 5IDNB 3TNIB 5HBHB 4F7SB 4EOOB 3MI9B 2BPMB 4OGRB 4YOSA 5CYIB 3MIAB 1H1QB 3BHTB 4KRCB 1C9BA 5ACBA 4UN0A 4CFWB 4EC8B 1QMZB 5EFQB 3EJ1B 2WFYB 1OI9B 1O9KA 4F70B 1OGUB 2PK9B 1UNHD 4BCNB 3MY5B 3K7AM 4EOPB 4EOSB 2CCHB 3H4CA 4YC3B 1H24B 2C5XB 2B9RA 4BCFB 1H25B 3EOCB 2UZLB 2IVXA 1D3UB 1KXUA 1FINB 3MY1B 4BCQD 4YOZA 4CFNB 4CFUB 1ZP2A 4BCKB 3LQ5B 4CRLB 4BCIB 3M03A 1E9HB 1N4MA 5LQFB 2CJMB 2X1NB 2C5NB 4BCPB 3DOGB 2W9FA 2W96A 2WEVB 3TN8B 4ROEA 4BCMD 1VYWB 1OKVB 4NSTB 4F7LB 2UZBB 1GUXA 4EOMB 2WHBB 2WMAB 5L2WB 1UNLD 4BCOB 4F6SB 2IW8B 2C6TB 3DDPB 4EOLB 1JSTB 2C5OB 1P5EB 3POMA 4EOQB 4G6LB 2WMBB 2UZEB 3TNWB 4YOOA 4KRDB 3RGFB 5LMKB 2C4GB 1OIUB 1BU2A 1F5QB 1G3NC 1H27B 2EUFA 1H1RB 1H4LD 1OKWB 2WXVB 4OR5B 4BCJB 4FX3B 1H1PB 1JKWA 1TFBA 2I53A 3BLQB 2F2CA 3QHWB 3G33B 1GH6B 2IW9B 4BCQB 4CFMB 3F5XB 5HBJB 1XO2A 5IDPB 1PKDB 2IW6B 4EORB 5ICPB 1GY3B 5HVYB 2BKZB 1H28B 4ROCA 1OIYB 1OL1B 2V22B 4CXAB 4BCGB 2C5VB 4EOJB 1AISB 1JSUB 1H1SB 4CFVB 4EOIB 1VOLA 4II5B 4BCMB 4F6WB 4BCND 2PK2A 1H26B 5BNJB 5HBEB 3EIDB 2I40B 4Y72B 5CEIB 3BLHB 2JGZB 1FVVB 2WPAB 4EONB 3QHRB 4F7JB 4F7NB 1AD6A 2WIPB 4IMYB 2WIHB 4CFUD 4EOKB 1URCB 2W2HA 5HNBB 4BCHB 2PHGA 5I5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNG D;  5FGK B;  2QDJ A;  4ELL A;  2W99 A;  4CFX B;  2CCI B;  2R7G A;  4I3Z B;  3TNH B;  4ELJ A;  4F6U B;  4EC9 B;  4TTH A;  2UUE B;  1OL2 B;  5IF1 B;  2G9X B;  1JOW A;  1VIN A;  2UZD B;  3BHV B;  3BLR B;  5HQ0 B;  4ROD A;  3DDQ B;  1O9K B;  3O0G D;  2PMI B;  1GUX B;  1W98 B;  2W9Z A;  3BHU B;  5IDN B;  3TNI B;  5HBH B;  4F7S B;  4EOO B;  3MI9 B;  2BPM B;  4OGR B;  4YOS A;  5CYI B;  3MIA B;  1H1Q B;  3BHT B;  4KRC B;  1C9B A;  5ACB A;  4UN0 A;  4CFW B;  4EC8 B;  1QMZ B;  5EFQ B;  3EJ1 B;  2WFY B;  1OI9 B;  1O9K A;  4F70 B;  1OGU B;  2PK9 B;  1UNH D;  4BCN B;  3MY5 B;  3K7A M;  4EOP B;  4EOS B;  2CCH B;  3H4C A;  4YC3 B;  1H24 B;  2C5X B;  2B9R A;  4BCF B;  1H25 B;  3EOC B;  2UZL B;  2IVX A;  1D3U B;  1KXU A;  1FIN B;  3MY1 B;  4BCQ D;  4YOZ A;  4CFN B;  4CFU B;  1ZP2 A;  4BCK B;  3LQ5 B;  4CRL B;  4BCI B;  3M03 A;  1E9H B;  1N4M A;  5LQF B;  2CJM B;  2X1N B;  2C5N B;  4BCP B;  3DOG B;  2W9F A;  2W96 A;  2WEV B;  3TN8 B;  4ROE A;  4BCM D;  1VYW B;  1OKV B;  4NST B;  4F7L B;  2UZB B;  1GUX A;  4EOM B;  2WHB B;  2WMA B;  5L2W B;  1UNL D;  4BCO B;  4F6S B;  2IW8 B;  2C6T B;  3DDP B;  4EOL B;  1JST B;  2C5O B;  1P5E B;  3POM A;  4EOQ B;  4G6L B;  2WMB B;  2UZE B;  3TNW B;  4YOO A;  4KRD B;  3RGF B;  5LMK B;  2C4G B;  1OIU B;  1BU2 A;  1F5Q B;  1G3N C;  1H27 B;  2EUF A;  1H1R B;  1H4L D;  1OKW B;  2WXV B;  4OR5 B;  4BCJ B;  4FX3 B;  1H1P B;  1JKW A;  1TFB A;  2I53 A;  3BLQ B;  2F2C A;  3QHW B;  3G33 B;  1GH6 B;  2IW9 B;  4BCQ B;  4CFM B;  3F5X B;  5HBJ B;  1XO2 A;  5IDP B;  1PKD B;  2IW6 B;  4EOR B;  5ICP B;  1GY3 B;  5HVY B;  2BKZ B;  1H28 B;  4ROC A;  1OIY B;  1OL1 B;  2V22 B;  4CXA B;  4BCG B;  2C5V B;  4EOJ B;  1AIS B;  1JSU B;  1H1S B;  4CFV B;  4EOI B;  1VOL A;  4II5 B;  4BCM B;  4F6W B;  4BCN D;  2PK2 A;  1H26 B;  5BNJ B;  5HBE B;  3EID B;  2I40 B;  4Y72 B;  5CEI B;  3BLH B;  2JGZ B;  1FVV B;  2WPA B;  4EON B;  3QHR B;  4F7J B;  4F7N B;  1AD6 A;  2WIP B;  4IMY B;  2WIH B;  4CFU D;  4EOK B;  1URC B;  2W2H A;  5HNB B;  4BCH B;  2PHG A;  5I5Z B; 
#chains in the Genus database with same CATH topology
 4LOC A;  4ELL A;  2W99 A;  4MIM A;  4CFX B;  1V29 B;  3HBL A;  2ZZD B;  2ZPE B;  1VIN A;  3BHV B;  4ROD A;  2CZ1 B;  4AKG A;  5IDN B;  4F7S B;  3MI9 B;  2PJQ A;  4BY1 X;  1H1Q B;  5ACB A;  4CFW B;  2DXB B;  3X26 B;  4FM4 B;  4BCN B;  4EOS B;  4YC3 B;  1D3U B;  1KXU A;  3LQ5 B;  4CRL B;  4MFD A;  2KR6 A;  2CJM B;  3DL1 A;  3X24 B;  2W9F A;  4OB2 B;  2W96 A;  2WEV B;  4BCM D;  3HHT B;  2C6T B;  4EOL B;  3BG9 A;  4KRD B;  2DPP B;  2G77 A;  4JX6 A;  2QGS A;  1AHJ B;  1OIU B;  1FKM A;  1F5Q B;  1UGS B;  2EUF A;  1H1R B;  1H4L D;  4HL4 A;  4BCJ B;  1JKW A;  2I53 A;  2ZPI B;  3QHW B;  4OB0 B;  2DD5 B;  3F5X B;  3DJB A;  1E7P A;  4HLQ A;  1UGP B;  2IW6 B;  3VYH B;  4EOR B;  5ICP B;  2QDY B;  4JX4 A;  4BCG B;  2C5V B;  2DXC B;  1JSU B;  4BCN D;  5HBE B;  3EID B;  3PO3 S;  5CEI B;  3BLH B;  2JGZ B;  1FVV B;  2DME A;  4EON B;  2WIH B;  4EOK B;  4JX5 A;  2W2H A;  4BCH B;  2PHG A;  2R7G A;  4F6U B;  4EC9 B;  3VKH A;  3BG3 A;  3DDQ B;  3O0G D;  5HBH B;  3HO8 A;  4YOS A;  4KRC B;  1QMZ B;  1UGQ B;  4BXX X;  4EOP B;  3H4C A;  2C5X B;  1H25 B;  4BBS M;  5IHY A;  1FIN B;  4CFU B;  3M03 A;  5LQF B;  1IRE B;  2X1N B;  3DTO A;  2ZPF B;  2UZB B;  2WHB B;  5L2W B;  2IW8 B;  1JST B;  3VKG A;  2WMB B;  2UZE B;  5DQV A;  4YOO A;  2C4G B;  5IF1 B;  1G3N C;  1H27 B;  3QZ5 B;  2BS4 A;  1H1P B;  1GH6 B;  2ZPH B;  1XO2 A;  3A8L B;  3A8M B;  1GY3 B;  5HVY B;  4ROC A;  1OL1 B;  2V22 B;  4CXA B;  4EOJ B;  2BS2 A;  3QYB A;  1VOL A;  4II5 B;  4F6W B;  2WPA B;  4F7J B;  2CZ7 B;  4CFU D;  1URC B;  3HZJ A;  1UNG D;  2QDJ A;  3TW7 A;  2CCI B;  2LW4 A;  3TNH B;  4ELJ A;  2UUE B;  1OL2 B;  2G9X B;  2UZD B;  4HNT A;  3BG5 A;  2PMI B;  1W98 B;  3BHU B;  2BPM B;  4OGR B;  5CYI B;  3MIA B;  3BHT B;  4UN0 A;  3X28 B;  4EC8 B;  5EFQ B;  4ZGD B;  4AI6 A;  2WFY B;  1OI9 B;  1O9K A;  1OGU B;  2PK9 B;  3MY5 B;  2CCH B;  1H24 B;  1TD6 A;  4QSH A;  4BCF B;  3EOC B;  2UZL B;  3QYG B;  2QFZ A;  4BCK B;  3WVE B;  1E9H B;  3DOG B;  4OB3 B;  4BY7 X;  4ROE A;  4F7L B;  1VYW B;  1OKV B;  4OB1 B;  4EOM B;  4BCO B;  3A8H B;  3POM A;  4G6L B;  3TNW B;  5LMK B;  3WVD B;  2QQ8 A;  1OKW B;  4FX3 B;  3BLQ B;  3QYH B;  4BCQ B;  2ZPB B;  1UGR B;  5HBJ B;  1PKD B;  3QYE A;  2BKZ B;  1H28 B;  1OIY B;  1AIS B;  1H1S B;  3NDQ A;  5BNJ B;  1AD6 A;  4IMY B;  4HNV A;  2KMG A;  5FGK B;  4ZGE B;  1ENW A;  4Z6Y A;  4I3Z B;  2DD4 B;  4TTH A;  4AKI A;  1JOW A;  3BLR B;  5HQ0 B;  1O9K B;  1GUX B;  2W9Z A;  3TNI B;  2QF7 A;  4HNU A;  4EOO B;  1C9B A;  2CZ0 B;  3EJ1 B;  4F70 B;  1UNH D;  4NC6 A;  3K7A M;  3X25 B;  3A8O B;  2B9R A;  3TW6 A;  2IVX A;  3MY1 B;  4BCQ D;  4YOZ A;  4CFN B;  2D0Q B;  1ZP2 A;  4M6V A;  5EJC A;  4BCI B;  1N4M A;  4BCP B;  2C5N B;  3TN8 B;  4NST B;  2BS3 A;  2AHJ B;  1GUX A;  2WMA B;  2WJ9 A;  1UNL D;  4F6S B;  3GTM S;  3DDP B;  4ZGJ B;  2C5O B;  1P5E B;  3QWL A;  4EOQ B;  2CYZ B;  3B57 A;  3RGF B;  2CZ6 B;  1BU2 A;  4OR5 B;  2WXV B;  5DQW A;  1TFB A;  3KHI A;  2F2C A;  3G33 B;  2IW9 B;  4CFM B;  3QXE B;  5IDP B;  3X20 B;  2ZPG B;  2ZCF B;  4AKH A;  2IN3 A;  1QLB A;  4CFV B;  3VYG B;  4EOI B;  4BCM B;  2PK2 A;  1H26 B;  3A8G B;  3HB9 A;  2I40 B;  4Y72 B;  3QHR B;  4F7N B;  2WIP B;  3QZ9 B;  4BBR M;  5HNB B;  4MFE A;  5I5Z B; 
#chains in the Genus database with same CATH homology
 1UNG D;  5FGK B;  2QDJ A;  4ELL A;  2W99 A;  4CFX B;  2CCI B;  2R7G A;  4I3Z B;  3TNH B;  4ELJ A;  4F6U B;  4EC9 B;  4TTH A;  2UUE B;  1OL2 B;  5IF1 B;  2G9X B;  1JOW A;  1VIN A;  2UZD B;  3BHV B;  3BLR B;  5HQ0 B;  4ROD A;  3DDQ B;  1O9K B;  3O0G D;  2PMI B;  1GUX B;  1W98 B;  2W9Z A;  3BHU B;  5IDN B;  3TNI B;  5HBH B;  4F7S B;  4EOO B;  3MI9 B;  2BPM B;  4OGR B;  4YOS A;  5CYI B;  3MIA B;  1H1Q B;  3BHT B;  4KRC B;  1C9B A;  5ACB A;  4UN0 A;  4CFW B;  4EC8 B;  1QMZ B;  5EFQ B;  3EJ1 B;  2WFY B;  1OI9 B;  1O9K A;  4F70 B;  1OGU B;  2PK9 B;  1UNH D;  4BCN B;  3MY5 B;  3K7A M;  4EOP B;  4EOS B;  2CCH B;  3H4C A;  4YC3 B;  1H24 B;  2C5X B;  2B9R A;  4BCF B;  1H25 B;  3EOC B;  2UZL B;  2IVX A;  1D3U B;  1KXU A;  1FIN B;  3MY1 B;  4BCQ D;  4YOZ A;  4CFN B;  4CFU B;  1ZP2 A;  4BCK B;  3LQ5 B;  4CRL B;  4BCI B;  3M03 A;  1E9H B;  1N4M A;  5LQF B;  2CJM B;  2X1N B;  2C5N B;  4BCP B;  3DOG B;  2W9F A;  2W96 A;  2WEV B;  3TN8 B;  4ROE A;  4BCM D;  1VYW B;  1OKV B;  4NST B;  4F7L B;  2UZB B;  1GUX A;  4EOM B;  2WHB B;  2WMA B;  5L2W B;  1UNL D;  4BCO B;  4F6S B;  2IW8 B;  2C6T B;  3DDP B;  4EOL B;  1JST B;  2C5O B;  1P5E B;  3POM A;  4EOQ B;  4G6L B;  2WMB B;  2UZE B;  3TNW B;  4YOO A;  4KRD B;  3RGF B;  5LMK B;  2C4G B;  1OIU B;  1BU2 A;  1F5Q B;  1G3N C;  1H27 B;  2EUF A;  1H1R B;  1H4L D;  1OKW B;  2WXV B;  4OR5 B;  4BCJ B;  4FX3 B;  1H1P B;  1JKW A;  1TFB A;  2I53 A;  3BLQ B;  2F2C A;  3QHW B;  3G33 B;  1GH6 B;  2IW9 B;  4BCQ B;  4CFM B;  3F5X B;  5HBJ B;  1XO2 A;  5IDP B;  1PKD B;  2IW6 B;  4EOR B;  5ICP B;  1GY3 B;  5HVY B;  2BKZ B;  1H28 B;  4ROC A;  1OIY B;  1OL1 B;  2V22 B;  4CXA B;  4BCG B;  2C5V B;  4EOJ B;  1AIS B;  1JSU B;  1H1S B;  4CFV B;  4EOI B;  1VOL A;  4II5 B;  4BCM B;  4F6W B;  4BCN D;  2PK2 A;  1H26 B;  5BNJ B;  5HBE B;  3EID B;  2I40 B;  4Y72 B;  5CEI B;  3BLH B;  2JGZ B;  1FVV B;  2WPA B;  4EON B;  3QHR B;  4F7J B;  4F7N B;  1AD6 A;  2WIP B;  4IMY B;  2WIH B;  4CFU D;  4EOK B;  1URC B;  2W2H A;  5HNB B;  4BCH B;  2PHG A;  5I5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...