2WIPB

Structure of cdk2-cyclin a complexed with 8-anilino-1-methyl-4,5-dihydro- 1h-pyrazolo[4,3-h] quinazoline-3-carboxylic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Identification of N,1,4,4-Tetramethyl-8-{[4-(4-Methylpiperazin-1-Yl)Phenyl]Amino}-4,5-Dihydro-1H-Pyrazolo[4,3-H]Quinazoline-3-Carboxamide (Pha-848125), a Potent, Orally Available Cyclin Dependent Kinase Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wipB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wipB02
5CYIB 1H1QB 5HBEB 4CFWB 1AISB 1OKWB 1OGUB 4CFNB 2UZBB 4KRDB 1UNGD 4EORB 5FGKB 1JKWA 4II5B 3POMA 5EFQB 3TNHB 2UZDB 1GH6B 4Y72B 4EOMB 3LQ5B 2CJMB 4CFMB 3G33B 1H1SB 1VYWB 2WEVB 1AD6A 5HQ0B 2BKZB 3EIDB 2IW9B 1D3UB 1G3NC 1VOLA 2C6TB 4BCGB 2W99A 2WXVB 3DOGB 4EOPB 5HNBB 2PK9B 4EC9B 4CFVB 1H26B 4YOZA 1XO2A 3K7AM 4TTHA 3TN8B 3O0GD 5IF1B 2EUFA 4BCQD 3EJ1B 4IMYB 1OL2B 2C4GB 2WIHB 1JSTB 4F7LB 5ACBA 4F6WB 4F7SB 2W9ZA 3EOCB 1H1PB 1UNHD 3BHUB 5IDNB 1JSUB 1TFBA 3F5XB 4CFXB 2F2CA 4BCKB 1H4LD 1VINA 2WMBB 2C5VB 2W9FA 1E9HB 3BHTB 4OR5B 2IW6B 2C5OB 3BLQB 2C5XB 2PMIB 4UN0A 4BCMB 5I5ZB 1W98B 3M03A 1H25B 1FINB 1GY3B 2G9XB 3MI9B 2X1NB 4RODA 2BPMB 2R7GA 4FX3B 4CFUB 5LQFB 1GUXB 4BCMD 1JOWA 4KRCB 3MY5B 2UZEB 1GUXA 2W96A 4BCIB 1OIUB 3BHVB 3TNIB 4F7NB 4CFUD 4OGRB 4EOKB 4BCFB 4G6LB 4ELJA 4F6SB 3BLHB 4YOSA 4EONB 4F70B 5ICPB 5L2WB 1C9BA 2QDJA 2I40B 4CRLB 4EC8B 4BCPB 2UUEB 4NSTB 2WIPB 4YOOA 5CEIB 1H24B 2CCHB 2WPAB 2PHGA 2B9RA 2JGZB 4BCJB 4I3ZB 5HBJB 1ZP2A 4CXAB 1H27B 2PK2A 4EOLB 2WHBB 3MIAB 1QMZB 2CCIB 1H28B 5HBHB 4BCHB 1P5EB 4BCNB 3RGFB 1OL1B 4F6UB 2IW8B 4EOQB 1KXUA 2I53A 3DDPB 1UNLD 5HVYB 4BCOB 4EOIB 4ROCA 3TNWB 4BCND 1FVVB 5LMKB 4EOJB 2UZLB 1O9KB 3QHWB 3BLRB 3QHRB 5BNJB 1F5QB 2W2HA 2C5NB 1O9KA 4F7JB 3H4CA 1OIYB 3DDQB 1N4MA 1PKDB 3MY1B 1OKVB 2WMAB 4ELLA 2IVXA 1H1RB 5IDPB 2V22B 4BCQB 4EOOB 4ROEA 1OI9B 1URCB 1BU2A 4YC3B 4EOSB 2WFYB
chains in the Genus database with same CATH superfamily
3PO3S 4CFWB 1OKWB 2KMGA 2UZBB 4EORB 5FGKB 1JKWA 2G77A 4II5B 4JX6A 3QYEA 5DQVA 4EOMB 2DD5B 1H1SB 1VYWB 2BS2A 2WEVB 5HQ0B 3EIDB 4HNVA 2C6TB 3B57A 4BCGB 4EOPB 2PK9B 4CFVB 1XO2A 4OB2B 4OB3B 2QGSA 4TTHA 3TN8B 3O0GD 5IF1B 2EUFA 4BCQD 1OL2B 4NC6A 3TW7A 1TFBA 4CFXB 2F2CA 2C5VB 2ZZDB 2C5OB 5I5ZB 3VKHA 1W98B 1H25B 2CZ1B 4M6VA 3MI9B 2G9XB 1QLBA 4FX3B 4CFUB 4HNUA 1GUXB 4BCMD 1JOWA 3MY5B 2UZEB 4HL4A 4BCIB 3QZ9B 4BCFB 4G6LB 4ELJA 1C9BA 3X26B 4EC8B 2UUEB 4NSTB 4YOOA 4MFEA 2CCHB 2WHBB 3MIAB 3A8HB 5HBHB 3DDPB 2I53A 4MIMA 5HVYB 4BCOB 4EOIB 4ROCA 4BCND 1FVVB 5LMKB 1O9KB 3BLRB 2C5NB 4F7JB 3H4CA 3DDQB 3VYGB 1PKDB 5IDPB 4MFDA 4BCQB 1OI9B 3X28B 2QFZA 4EOSB 2WFYB 2ZPGB 1H1QB 5CYIB 5HBEB 1AISB 4CFNB 1UNGD 3NDQA 1FKMA 1GH6B 3LQ5B 3G33B 1D3UB 3QYBA 2DPPB 1H26B 4YOZA 2DD4B 3EJ1B 4IMYB 2WIHB 5ACBA 4F6WB 4FM4B 3EOCB 4ZGJB 2C5XB 1UGRB 2BS3A 5LQFB 2WJ9A 2W96A 3TW6A 3QXEB 1AHJB 4EOKB 3KHIA 2QDJA 4BY7X 5CEIB 1H24B 2WPAB 2JGZB 4BCJB 4CXAB 2PK2A 3A8LB 2CCIB 1QMZB 1TD6A 3RGFB 1OL1B 3QWLA 4F6UB 3A8MB 1UGSB 4JX5A 3TNWB 5BNJB 3X24B 4AKHA 2PJQA 4ZGEB 2ZPIB 1OKVB 2WMAB 4ELLA 3BG5A 4ZGDB 4ROEA 4Z6YA 1URCB 1BU2A 4YC3B 1IREB 1OGUB 2DXBB 5DQWA 1E7PA 3POMA 4HNTA 2QF7A 3DTOA 3TNHB 2UZDB 4Y72B 2CJMB 1AD6A 2BKZB 2IW9B 2IN3A 1G3NC 1VOLA 2W99A 3A8OB 5HNBB 4EC9B 2QQ8A 2BS4A 2CZ0B 3WVEB 2C4GB 1JSTB 4QSHA 2W9ZA 1H1PB 2ZCFB 3BHUB 5IDNB 1JSUB 4BCKB 1VINA 2WMBB 2W9FA 3BHTB 4BY1X 3BLQB 4UN0A 2PMIB 4BCMB 3M03A 3HBLA 2X1NB 2ZPHB 2ZPBB 1OIUB 3BHVB 4OB0B 4CFUD 4F6SB 3BLHB 3DJBA 4YOSA 4AI6A 5L2WB 4LOCA 4BCPB 2B9RA 5HBJB 1ZP2A 3QZ5B 2D0QB 1H28B 4BCHB 1P5EB 4BCNB 4EOQB 1UNLD 4BXXX 4EOJB 1ENWA 3QHRB 2W2HA 1OIYB 2QDYB 4HLQA 1N4MA 1H1RB 2V22B 2CZ7B 1V29B 3X20B 1UGQB 3HZJA 3VKGA 3HO8A 4KRDB 5EFQB 4BBRM 3QYGB 4AKGA 3BG9A 4CFMB 4OB1B 3X25B 2CYZB 2WXVB 3DOGB 2LW4A 3DL1A 3A8GB 3WVDB 3K7AM 4F7LB 3BG3A 4F7SB 1UNHD 3F5XB 1H4LD 1E9HB 4OR5B 2IW6B 4AKIA 1FINB 1GY3B 4RODA 4BBSM 2BPMB 2R7GA 4KRCB 3QYHB 1GUXA 4F7NB 3TNIB 4OGRB 2AHJB 5EJCA 4EONB 4F70B 5ICPB 2I40B 4CRLB 2WIPB 2KR6A 2PHGA 4I3ZB 2DXCB 5IHYA 1H27B 4EOLB 4JX4A 1UGPB 2IW8B 1KXUA 3HB9A 2UZLB 3QHWB 1F5QB 3VYHB 1O9KA 3HHTB 2DMEA 3MY1B 2ZPFB 2IVXA 4EOOB 2CZ6B 2ZPEB 3GTMS
chains in the Genus database with same CATH topology
5CYIB 1H1QB 5HBEB 4CFWB 1AISB 1OKWB 1OGUB 4CFNB 2UZBB 4KRDB 1UNGD 4EORB 5FGKB 1JKWA 4II5B 3POMA 5EFQB 3TNHB 2UZDB 1GH6B 4Y72B 4EOMB 3LQ5B 2CJMB 4CFMB 3G33B 1H1SB 1VYWB 2WEVB 1AD6A 5HQ0B 2BKZB 3EIDB 2IW9B 1D3UB 1G3NC 1VOLA 2C6TB 4BCGB 2W99A 2WXVB 3DOGB 4EOPB 5HNBB 2PK9B 4EC9B 4CFVB 1H26B 4YOZA 1XO2A 3K7AM 4TTHA 3TN8B 3O0GD 5IF1B 2EUFA 4BCQD 3EJ1B 4IMYB 1OL2B 2C4GB 2WIHB 1JSTB 4F7LB 5ACBA 4F6WB 4F7SB 2W9ZA 3EOCB 1H1PB 1UNHD 3BHUB 5IDNB 1JSUB 1TFBA 3F5XB 4CFXB 2F2CA 4BCKB 1H4LD 1VINA 2WMBB 2C5VB 2W9FA 1E9HB 3BHTB 4OR5B 2IW6B 2C5OB 3BLQB 2C5XB 2PMIB 4UN0A 4BCMB 5I5ZB 1W98B 3M03A 1H25B 1FINB 1GY3B 2G9XB 3MI9B 2X1NB 4RODA 2BPMB 2R7GA 4FX3B 4CFUB 5LQFB 1GUXB 4BCMD 1JOWA 4KRCB 3MY5B 2UZEB 1GUXA 2W96A 4BCIB 1OIUB 3BHVB 3TNIB 4F7NB 4CFUD 4OGRB 4EOKB 4BCFB 4G6LB 4ELJA 4F6SB 3BLHB 4YOSA 4EONB 4F70B 5ICPB 5L2WB 1C9BA 2QDJA 2I40B 4CRLB 4EC8B 4BCPB 2UUEB 4NSTB 2WIPB 4YOOA 5CEIB 1H24B 2CCHB 2WPAB 2PHGA 2B9RA 2JGZB 4BCJB 4I3ZB 5HBJB 1ZP2A 4CXAB 1H27B 2PK2A 4EOLB 2WHBB 3MIAB 1QMZB 2CCIB 1H28B 5HBHB 4BCHB 1P5EB 4BCNB 3RGFB 1OL1B 4F6UB 2IW8B 4EOQB 1KXUA 2I53A 3DDPB 1UNLD 5HVYB 4BCOB 4EOIB 4ROCA 3TNWB 4BCND 1FVVB 5LMKB 4EOJB 2UZLB 1O9KB 3QHWB 3BLRB 3QHRB 5BNJB 1F5QB 2W2HA 2C5NB 1O9KA 4F7JB 3H4CA 1OIYB 3DDQB 1N4MA 1PKDB 3MY1B 1OKVB 2WMAB 4ELLA 2IVXA 1H1RB 5IDPB 2V22B 4BCQB 4EOOB 4ROEA 1OI9B 1URCB 1BU2A 4YC3B 4EOSB 2WFYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CYI B;  1H1Q B;  5HBE B;  4CFW B;  1AIS B;  1OKW B;  1OGU B;  4CFN B;  2UZB B;  4KRD B;  1UNG D;  4EOR B;  5FGK B;  1JKW A;  4II5 B;  3POM A;  5EFQ B;  3TNH B;  2UZD B;  1GH6 B;  4Y72 B;  4EOM B;  3LQ5 B;  2CJM B;  4CFM B;  3G33 B;  1H1S B;  1VYW B;  2WEV B;  1AD6 A;  5HQ0 B;  2BKZ B;  3EID B;  2IW9 B;  1D3U B;  1G3N C;  1VOL A;  2C6T B;  4BCG B;  2W99 A;  2WXV B;  3DOG B;  4EOP B;  5HNB B;  2PK9 B;  4EC9 B;  4CFV B;  1H26 B;  4YOZ A;  1XO2 A;  3K7A M;  4TTH A;  3TN8 B;  3O0G D;  5IF1 B;  2EUF A;  4BCQ D;  3EJ1 B;  4IMY B;  1OL2 B;  2C4G B;  2WIH B;  1JST B;  4F7L B;  5ACB A;  4F6W B;  4F7S B;  2W9Z A;  3EOC B;  1H1P B;  1UNH D;  3BHU B;  5IDN B;  1JSU B;  1TFB A;  3F5X B;  4CFX B;  2F2C A;  4BCK B;  1H4L D;  1VIN A;  2WMB B;  2C5V B;  2W9F A;  1E9H B;  3BHT B;  4OR5 B;  2IW6 B;  2C5O B;  3BLQ B;  2C5X B;  2PMI B;  4UN0 A;  4BCM B;  5I5Z B;  1W98 B;  3M03 A;  1H25 B;  1FIN B;  1GY3 B;  2G9X B;  3MI9 B;  2X1N B;  4ROD A;  2BPM B;  2R7G A;  4FX3 B;  4CFU B;  5LQF B;  1GUX B;  4BCM D;  1JOW A;  4KRC B;  3MY5 B;  2UZE B;  1GUX A;  2W96 A;  4BCI B;  1OIU B;  3BHV B;  3TNI B;  4F7N B;  4CFU D;  4OGR B;  4EOK B;  4BCF B;  4G6L B;  4ELJ A;  4F6S B;  3BLH B;  4YOS A;  4EON B;  4F70 B;  5ICP B;  5L2W B;  1C9B A;  2QDJ A;  2I40 B;  4CRL B;  4EC8 B;  4BCP B;  2UUE B;  4NST B;  2WIP B;  4YOO A;  5CEI B;  1H24 B;  2CCH B;  2WPA B;  2PHG A;  2B9R A;  2JGZ B;  4BCJ B;  4I3Z B;  5HBJ B;  1ZP2 A;  4CXA B;  1H27 B;  2PK2 A;  4EOL B;  2WHB B;  3MIA B;  1QMZ B;  2CCI B;  1H28 B;  5HBH B;  4BCH B;  1P5E B;  4BCN B;  3RGF B;  1OL1 B;  4F6U B;  2IW8 B;  4EOQ B;  1KXU A;  2I53 A;  3DDP B;  1UNL D;  5HVY B;  4BCO B;  4EOI B;  4ROC A;  3TNW B;  4BCN D;  1FVV B;  5LMK B;  4EOJ B;  2UZL B;  1O9K B;  3QHW B;  3BLR B;  3QHR B;  5BNJ B;  1F5Q B;  2W2H A;  2C5N B;  1O9K A;  4F7J B;  3H4C A;  1OIY B;  3DDQ B;  1N4M A;  1PKD B;  3MY1 B;  1OKV B;  2WMA B;  4ELL A;  2IVX A;  1H1R B;  5IDP B;  2V22 B;  4BCQ B;  4EOO B;  4ROE A;  1OI9 B;  1URC B;  1BU2 A;  4YC3 B;  4EOS B;  2WFY B; 
#chains in the Genus database with same CATH topology
 3PO3 S;  4CFW B;  1OKW B;  2KMG A;  2UZB B;  4EOR B;  5FGK B;  1JKW A;  2G77 A;  4II5 B;  4JX6 A;  3QYE A;  5DQV A;  4EOM B;  2DD5 B;  1H1S B;  1VYW B;  2BS2 A;  2WEV B;  5HQ0 B;  3EID B;  4HNV A;  2C6T B;  3B57 A;  4BCG B;  4EOP B;  2PK9 B;  4CFV B;  1XO2 A;  4OB2 B;  4OB3 B;  2QGS A;  4TTH A;  3TN8 B;  3O0G D;  5IF1 B;  2EUF A;  4BCQ D;  1OL2 B;  4NC6 A;  3TW7 A;  1TFB A;  4CFX B;  2F2C A;  2C5V B;  2ZZD B;  2C5O B;  5I5Z B;  3VKH A;  1W98 B;  1H25 B;  2CZ1 B;  4M6V A;  3MI9 B;  2G9X B;  1QLB A;  4FX3 B;  4CFU B;  4HNU A;  1GUX B;  4BCM D;  1JOW A;  3MY5 B;  2UZE B;  4HL4 A;  4BCI B;  3QZ9 B;  4BCF B;  4G6L B;  4ELJ A;  1C9B A;  3X26 B;  4EC8 B;  2UUE B;  4NST B;  4YOO A;  4MFE A;  2CCH B;  2WHB B;  3MIA B;  3A8H B;  5HBH B;  3DDP B;  2I53 A;  4MIM A;  5HVY B;  4BCO B;  4EOI B;  4ROC A;  4BCN D;  1FVV B;  5LMK B;  1O9K B;  3BLR B;  2C5N B;  4F7J B;  3H4C A;  3DDQ B;  3VYG B;  1PKD B;  5IDP B;  4MFD A;  4BCQ B;  1OI9 B;  3X28 B;  2QFZ A;  4EOS B;  2WFY B;  2ZPG B;  1H1Q B;  5CYI B;  5HBE B;  1AIS B;  4CFN B;  1UNG D;  3NDQ A;  1FKM A;  1GH6 B;  3LQ5 B;  3G33 B;  1D3U B;  3QYB A;  2DPP B;  1H26 B;  4YOZ A;  2DD4 B;  3EJ1 B;  4IMY B;  2WIH B;  5ACB A;  4F6W B;  4FM4 B;  3EOC B;  4ZGJ B;  2C5X B;  1UGR B;  2BS3 A;  5LQF B;  2WJ9 A;  2W96 A;  3TW6 A;  3QXE B;  1AHJ B;  4EOK B;  3KHI A;  2QDJ A;  4BY7 X;  5CEI B;  1H24 B;  2WPA B;  2JGZ B;  4BCJ B;  4CXA B;  2PK2 A;  3A8L B;  2CCI B;  1QMZ B;  1TD6 A;  3RGF B;  1OL1 B;  3QWL A;  4F6U B;  3A8M B;  1UGS B;  4JX5 A;  3TNW B;  5BNJ B;  3X24 B;  4AKH A;  2PJQ A;  4ZGE B;  2ZPI B;  1OKV B;  2WMA B;  4ELL A;  3BG5 A;  4ZGD B;  4ROE A;  4Z6Y A;  1URC B;  1BU2 A;  4YC3 B;  1IRE B;  1OGU B;  2DXB B;  5DQW A;  1E7P A;  3POM A;  4HNT A;  2QF7 A;  3DTO A;  3TNH B;  2UZD B;  4Y72 B;  2CJM B;  1AD6 A;  2BKZ B;  2IW9 B;  2IN3 A;  1G3N C;  1VOL A;  2W99 A;  3A8O B;  5HNB B;  4EC9 B;  2QQ8 A;  2BS4 A;  2CZ0 B;  3WVE B;  2C4G B;  1JST B;  4QSH A;  2W9Z A;  1H1P B;  2ZCF B;  3BHU B;  5IDN B;  1JSU B;  4BCK B;  1VIN A;  2WMB B;  2W9F A;  3BHT B;  4BY1 X;  3BLQ B;  4UN0 A;  2PMI B;  4BCM B;  3M03 A;  3HBL A;  2X1N B;  2ZPH B;  2ZPB B;  1OIU B;  3BHV B;  4OB0 B;  4CFU D;  4F6S B;  3BLH B;  3DJB A;  4YOS A;  4AI6 A;  5L2W B;  4LOC A;  4BCP B;  2B9R A;  5HBJ B;  1ZP2 A;  3QZ5 B;  2D0Q B;  1H28 B;  4BCH B;  1P5E B;  4BCN B;  4EOQ B;  1UNL D;  4BXX X;  4EOJ B;  1ENW A;  3QHR B;  2W2H A;  1OIY B;  2QDY B;  4HLQ A;  1N4M A;  1H1R B;  2V22 B;  2CZ7 B;  1V29 B;  3X20 B;  1UGQ B;  3HZJ A;  3VKG A;  3HO8 A;  4KRD B;  5EFQ B;  4BBR M;  3QYG B;  4AKG A;  3BG9 A;  4CFM B;  4OB1 B;  3X25 B;  2CYZ B;  2WXV B;  3DOG B;  2LW4 A;  3DL1 A;  3A8G B;  3WVD B;  3K7A M;  4F7L B;  3BG3 A;  4F7S B;  1UNH D;  3F5X B;  1H4L D;  1E9H B;  4OR5 B;  2IW6 B;  4AKI A;  1FIN B;  1GY3 B;  4ROD A;  4BBS M;  2BPM B;  2R7G A;  4KRC B;  3QYH B;  1GUX A;  4F7N B;  3TNI B;  4OGR B;  2AHJ B;  5EJC A;  4EON B;  4F70 B;  5ICP B;  2I40 B;  4CRL B;  2WIP B;  2KR6 A;  2PHG A;  4I3Z B;  2DXC B;  5IHY A;  1H27 B;  4EOL B;  4JX4 A;  1UGP B;  2IW8 B;  1KXU A;  3HB9 A;  2UZL B;  3QHW B;  1F5Q B;  3VYH B;  1O9K A;  3HHT B;  2DME A;  3MY1 B;  2ZPF B;  2IVX A;  4EOO B;  2CZ6 B;  2ZPE B;  3GTM S; 
#chains in the Genus database with same CATH homology
 5CYI B;  1H1Q B;  5HBE B;  4CFW B;  1AIS B;  1OKW B;  1OGU B;  4CFN B;  2UZB B;  4KRD B;  1UNG D;  4EOR B;  5FGK B;  1JKW A;  4II5 B;  3POM A;  5EFQ B;  3TNH B;  2UZD B;  1GH6 B;  4Y72 B;  4EOM B;  3LQ5 B;  2CJM B;  4CFM B;  3G33 B;  1H1S B;  1VYW B;  2WEV B;  1AD6 A;  5HQ0 B;  2BKZ B;  3EID B;  2IW9 B;  1D3U B;  1G3N C;  1VOL A;  2C6T B;  4BCG B;  2W99 A;  2WXV B;  3DOG B;  4EOP B;  5HNB B;  2PK9 B;  4EC9 B;  4CFV B;  1H26 B;  4YOZ A;  1XO2 A;  3K7A M;  4TTH A;  3TN8 B;  3O0G D;  5IF1 B;  2EUF A;  4BCQ D;  3EJ1 B;  4IMY B;  1OL2 B;  2C4G B;  2WIH B;  1JST B;  4F7L B;  5ACB A;  4F6W B;  4F7S B;  2W9Z A;  3EOC B;  1H1P B;  1UNH D;  3BHU B;  5IDN B;  1JSU B;  1TFB A;  3F5X B;  4CFX B;  2F2C A;  4BCK B;  1H4L D;  1VIN A;  2WMB B;  2C5V B;  2W9F A;  1E9H B;  3BHT B;  4OR5 B;  2IW6 B;  2C5O B;  3BLQ B;  2C5X B;  2PMI B;  4UN0 A;  4BCM B;  5I5Z B;  1W98 B;  3M03 A;  1H25 B;  1FIN B;  1GY3 B;  2G9X B;  3MI9 B;  2X1N B;  4ROD A;  2BPM B;  2R7G A;  4FX3 B;  4CFU B;  5LQF B;  1GUX B;  4BCM D;  1JOW A;  4KRC B;  3MY5 B;  2UZE B;  1GUX A;  2W96 A;  4BCI B;  1OIU B;  3BHV B;  3TNI B;  4F7N B;  4CFU D;  4OGR B;  4EOK B;  4BCF B;  4G6L B;  4ELJ A;  4F6S B;  3BLH B;  4YOS A;  4EON B;  4F70 B;  5ICP B;  5L2W B;  1C9B A;  2QDJ A;  2I40 B;  4CRL B;  4EC8 B;  4BCP B;  2UUE B;  4NST B;  2WIP B;  4YOO A;  5CEI B;  1H24 B;  2CCH B;  2WPA B;  2PHG A;  2B9R A;  2JGZ B;  4BCJ B;  4I3Z B;  5HBJ B;  1ZP2 A;  4CXA B;  1H27 B;  2PK2 A;  4EOL B;  2WHB B;  3MIA B;  1QMZ B;  2CCI B;  1H28 B;  5HBH B;  4BCH B;  1P5E B;  4BCN B;  3RGF B;  1OL1 B;  4F6U B;  2IW8 B;  4EOQ B;  1KXU A;  2I53 A;  3DDP B;  1UNL D;  5HVY B;  4BCO B;  4EOI B;  4ROC A;  3TNW B;  4BCN D;  1FVV B;  5LMK B;  4EOJ B;  2UZL B;  1O9K B;  3QHW B;  3BLR B;  3QHR B;  5BNJ B;  1F5Q B;  2W2H A;  2C5N B;  1O9K A;  4F7J B;  3H4C A;  1OIY B;  3DDQ B;  1N4M A;  1PKD B;  3MY1 B;  1OKV B;  2WMA B;  4ELL A;  2IVX A;  1H1R B;  5IDP B;  2V22 B;  4BCQ B;  4EOO B;  4ROE A;  1OI9 B;  1URC B;  1BU2 A;  4YC3 B;  4EOS B;  2WFY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...