2WIPB

Structure of cdk2-cyclin a complexed with 8-anilino-1-methyl-4,5-dihydro- 1h-pyrazolo[4,3-h] quinazoline-3-carboxylic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Identification of N,1,4,4-Tetramethyl-8-{[4-(4-Methylpiperazin-1-Yl)Phenyl]Amino}-4,5-Dihydro-1H-Pyrazolo[4,3-H]Quinazoline-3-Carboxamide (Pha-848125), a Potent, Orally Available Cyclin Dependent Kinase Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wipB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2wipB02
3BLHB 1OGUB 4RODA 5CEIB 4CRLB 4KRCB 4CFXB 1KXUA 4EOMB 1O9KA 3POMA 1OIYB 2UZLB 1N4MA 5LMKB 4IMYB 4BCNB 1H4LD 1JSUB 2B9RA 4NSTB 3EIDB 3RGFB 2JGZB 4BCKB 1JKWA 2UUEB 2W9ZA 2PMIB 2IW9B 4TTHA 3DDQB 4BCQD 1JOWA 1OI9B 1VYWB 5ICPB 3K7AM 1OL1B 3MI9B 4EOSB 1AISB 2WIPB 4EONB 2BPMB 3QHWB 4BCHB 2PK2A 4F7LB 2W96A 4EORB 1O9KB 5HVYB 1BU2A 1QMZB 3DDPB 1TFBA 5IF1B 3G33B 1FVVB 4F6SB 4YOZA 4BCIB 4Y72B 4ROEA 4CFVB 4ROCA 4YOSA 2QDJA 2WFYB 2IW6B 2PK9B 1H1SB 1H25B 5EFQB 4BCOB 1FINB 2CJMB 2PHGA 4F7NB 1UNGD 2CCHB 1JSTB 2W9FA 5LQFB 2W2HA 5CYIB 2C5VB 5IDNB 4EOQB 2C5OB 2IVXA 3TNIB 4BCMD 4CFUD 5IDPB 4ELJA 1H1QB 1VINA 5ACBA 4YC3B 2C6TB 4BCQB 1OKWB 4F7SB 4UN0A 1F5QB 3TNWB 4F6UB 1E9HB 2WHBB 1OL2B 2WMBB 1ZP2A 2UZEB 1GUXA 5I5ZB 2UZBB 4I3ZB 4CFNB 3EJ1B 4EOLB 1OIUB 4CXAB 5HBHB 1UNLD 2G9XB 1G3NC 1W98B 4BCGB 2WMAB 4F6WB 4ELLA 1VOLA 1XO2A 4BCJB 1GUXB 3MY5B 4EC9B 3DOGB 2C4GB 5HBJB 4BCFB 1H28B 2I40B 2R7GA 4CFUB 4KRDB 3EOCB 4EOKB 4G6LB 4BCPB 1PKDB 1GH6B 3BHVB 2WPAB 4FX3B 1H26B 4CFMB 4EOIB 2C5XB 1H1PB 4BCND 4F70B 1AD6A 3MY1B 2BKZB 2F2CA 2X1NB 3BHTB 3TN8B 2WXVB 4EOOB 5FGKB 1H27B 3BLQB 1UNHD 4EOPB 5BNJB 1H24B 4II5B 1H1RB 2W99A 5HQ0B 3H4CA 2WIHB 4OR5B 2EUFA 2V22B 4EC8B 3M03A 1OKVB 2I53A 1D3UB 3O0GD 5HNBB 4EOJB 5L2WB 4YOOA 4CFWB 4OGRB 2WEVB 3BLRB 2CCIB 1URCB 1C9BA 3BHUB 2IW8B 3LQ5B 3TNHB 4BCMB 4F7JB 5HBEB 1P5EB 2C5NB 3QHRB 2UZDB 1GY3B 3F5XB 3MIAB
chains in the Genus database with same CATH superfamily
4RODA 1OGUB 2KR6A 4CFXB 3HHTB 4EOMB 5LMKB 3WVDB 4HNUA 1JKWA 2PMIB 2IW9B 4BCQD 1JOWA 1OI9B 2CZ0B 4EOSB 1AISB 2W96A 3GTMS 3G33B 2QF7A 2ZPHB 4BCIB 1TD6A 4Y72B 2DXBB 4ROEA 4ROCA 2WFYB 5EJCA 1H1SB 5EFQB 4HL4A 1UNGD 5LQFB 2W9FA 2C5OB 4CFUD 4HNVA 3X25B 2C6TB 1IREB 4UN0A 3HZJA 2WHBB 2WMBB 1GUXA 5I5ZB 3EJ1B 1OIUB 1UNLD 3TW6A 5DQVA 1G3NC 2WMAB 4JX4A 1VOLA 4HLQA 2D0QB 4HNTA 1QLBA 1GUXB 2C4GB 3QZ9B 2WJ9A 4EOKB 3PO3S 3BHVB 2WPAB 4FX3B 1H26B 4F70B 4BCND 3MY1B 2F2CA 4EOOB 4AKHA 3DL1A 5FGKB 3X28B 3VYGB 4EOPB 4BY1X 2W99A 2WIHB 4MIMA 2BS4A 3M03A 2I53A 1ENWA 4OGRB 2WEVB 3BHUB 3LQ5B 1P5EB 2C5NB 3DTOA 4QSHA 3BLHB 5CEIB 4OB1B 4KRCB 1KXUA 2QQ8A 2PJQA 3KHIA 1JSUB 3QYBA 3BG3A 4NSTB 2ZPBB 3RGFB 2W9ZA 4TTHA 4ZGDB 5ICPB 3VKGA 3X24B 2BPMB 4BCHB 2PK2A 2DD5B 5HVYB 1BU2A 1QMZB 1AHJB 3DDPB 2QFZA 3NDQA 2ZPEB 4YOSA 2QDJA 4BY7X 1H25B 1UGRB 1JSTB 4EOQB 2DMEA 5ACBA 4BCQB 4F7SB 1E9HB 2LW4A 3WVEB 5HBHB 2G9XB 3B57A 4BCGB 2BS2A 4BCJB 1UGPB 2QDYB 2ZPGB 3MY5B 1H28B 2I40B 5DQWA 4CFUB 2DXCB 4KRDB 1PKDB 2KMGA 4EOIB 3X26B 3TN8B 3BG9A 3BLQB 5BNJB 4II5B 5HQ0B 4OR5B 1OKVB 1D3UB 3O0GD 3DJBA 4Z6YA 2CCIB 3X20B 2CZ1B 4BCMB 3TNHB 4F7JB 2UZDB 3F5XB 3A8LB 4CRLB 1O9KA 3POMA 4BCNB 1H4LD 2B9RA 3EIDB 4BCKB 2JGZB 2UUEB 3A8GB 3DDQB 1VYWB 5IHYA 1OL1B 2WIPB 4M6VA 4MFEA 1O9KB 5IF1B 1TFBA 1FVVB 4F6SB 4LOCA 2BS3A 4YOZA 4AKGA 4CFVB 1E7PA 2IW6B 3VYHB 2CJMB 2CCHB 4AI6A 2W2HA 5CYIB 1V29B 3QYEA 2C5VB 2IVXA 3TNIB 4ELJA 1H1QB 1VINA 1OKWB 1OL2B 3HO8A 2UZEB 2ZZDB 2UZBB 4CFNB 4EOLB 4CXAB 4F6WB 4ELLA 3QYGB 3HBLA 4EC9B 3DOGB 4OB0B 2R7GA 4BCPB 1GH6B 4CFMB 2C5XB 1H1PB 1AD6A 3BHTB 4AKIA 2WXVB 2CZ6B 4ZGJB 2ZCFB 1H27B 1H24B 2G77A 2QGSA 1H1RB 2CZ7B 2EUFA 4EC8B 4NC6A 4EOJB 5L2WB 4YOOA 1C9BA 2ZPFB 4MFDA 2IW8B 4BBSM 3QHRB 3MIAB 2IN3A 1OIYB 2UZLB 1N4MA 4IMYB 4JX6A 4BBRM 3BG5A 3QXEB 3K7AM 3QWLA 3MI9B 4EONB 3QHWB 4F7LB 4EORB 2CYZB 2PK9B 4BCOB 1FINB 2PHGA 4F7NB 3QZ5B 2AHJB 5IDNB 4BCMD 5IDPB 4YC3B 4FM4B 3TNWB 1F5QB 4F6UB 2DD4B 1ZP2A 4BXXX 3A8HB 4OB2B 4I3ZB 1UGQB 4ZGEB 1W98B 3TW7A 1XO2A 3QYHB 2ZPIB 1FKMA 3HB9A 2DPPB 5HBJB 4BCFB 3EOCB 4G6LB 1UGSB 3VKHA 2BKZB 2X1NB 1UNHD 3A8MB 3H4CA 2V22B 4JX5A 5HNBB 4OB3B 4CFWB 3BLRB 1URCB 5HBEB 3A8OB 1GY3B
chains in the Genus database with same CATH topology
3BLHB 1OGUB 4RODA 5CEIB 4CRLB 4KRCB 4CFXB 1KXUA 4EOMB 1O9KA 3POMA 1OIYB 2UZLB 1N4MA 5LMKB 4IMYB 4BCNB 1H4LD 1JSUB 2B9RA 4NSTB 3EIDB 3RGFB 2JGZB 4BCKB 1JKWA 2UUEB 2W9ZA 2PMIB 2IW9B 4TTHA 3DDQB 4BCQD 1JOWA 1OI9B 1VYWB 5ICPB 3K7AM 1OL1B 3MI9B 4EOSB 1AISB 2WIPB 4EONB 2BPMB 3QHWB 4BCHB 2PK2A 4F7LB 2W96A 4EORB 1O9KB 5HVYB 1BU2A 1QMZB 3DDPB 1TFBA 5IF1B 3G33B 1FVVB 4F6SB 4YOZA 4BCIB 4Y72B 4ROEA 4CFVB 4ROCA 4YOSA 2QDJA 2WFYB 2IW6B 2PK9B 1H1SB 1H25B 5EFQB 4BCOB 1FINB 2CJMB 2PHGA 4F7NB 1UNGD 2CCHB 1JSTB 2W9FA 5LQFB 2W2HA 5CYIB 2C5VB 5IDNB 4EOQB 2C5OB 2IVXA 3TNIB 4BCMD 4CFUD 5IDPB 4ELJA 1H1QB 1VINA 5ACBA 4YC3B 2C6TB 4BCQB 1OKWB 4F7SB 4UN0A 1F5QB 3TNWB 4F6UB 1E9HB 2WHBB 1OL2B 2WMBB 1ZP2A 2UZEB 1GUXA 5I5ZB 2UZBB 4I3ZB 4CFNB 3EJ1B 4EOLB 1OIUB 4CXAB 5HBHB 1UNLD 2G9XB 1G3NC 1W98B 4BCGB 2WMAB 4F6WB 4ELLA 1VOLA 1XO2A 4BCJB 1GUXB 3MY5B 4EC9B 3DOGB 2C4GB 5HBJB 4BCFB 1H28B 2I40B 2R7GA 4CFUB 4KRDB 3EOCB 4EOKB 4G6LB 4BCPB 1PKDB 1GH6B 3BHVB 2WPAB 4FX3B 1H26B 4CFMB 4EOIB 2C5XB 1H1PB 4BCND 4F70B 1AD6A 3MY1B 2BKZB 2F2CA 2X1NB 3BHTB 3TN8B 2WXVB 4EOOB 5FGKB 1H27B 3BLQB 1UNHD 4EOPB 5BNJB 1H24B 4II5B 1H1RB 2W99A 5HQ0B 3H4CA 2WIHB 4OR5B 2EUFA 2V22B 4EC8B 3M03A 1OKVB 2I53A 1D3UB 3O0GD 5HNBB 4EOJB 5L2WB 4YOOA 4CFWB 4OGRB 2WEVB 3BLRB 2CCIB 1URCB 1C9BA 3BHUB 2IW8B 3LQ5B 3TNHB 4BCMB 4F7JB 5HBEB 1P5EB 2C5NB 3QHRB 2UZDB 1GY3B 3F5XB 3MIAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLH B;  1OGU B;  4ROD A;  5CEI B;  4CRL B;  4KRC B;  4CFX B;  1KXU A;  4EOM B;  1O9K A;  3POM A;  1OIY B;  2UZL B;  1N4M A;  5LMK B;  4IMY B;  4BCN B;  1H4L D;  1JSU B;  2B9R A;  4NST B;  3EID B;  3RGF B;  2JGZ B;  4BCK B;  1JKW A;  2UUE B;  2W9Z A;  2PMI B;  2IW9 B;  4TTH A;  3DDQ B;  4BCQ D;  1JOW A;  1OI9 B;  1VYW B;  5ICP B;  3K7A M;  1OL1 B;  3MI9 B;  4EOS B;  1AIS B;  2WIP B;  4EON B;  2BPM B;  3QHW B;  4BCH B;  2PK2 A;  4F7L B;  2W96 A;  4EOR B;  1O9K B;  5HVY B;  1BU2 A;  1QMZ B;  3DDP B;  1TFB A;  5IF1 B;  3G33 B;  1FVV B;  4F6S B;  4YOZ A;  4BCI B;  4Y72 B;  4ROE A;  4CFV B;  4ROC A;  4YOS A;  2QDJ A;  2WFY B;  2IW6 B;  2PK9 B;  1H1S B;  1H25 B;  5EFQ B;  4BCO B;  1FIN B;  2CJM B;  2PHG A;  4F7N B;  1UNG D;  2CCH B;  1JST B;  2W9F A;  5LQF B;  2W2H A;  5CYI B;  2C5V B;  5IDN B;  4EOQ B;  2C5O B;  2IVX A;  3TNI B;  4BCM D;  4CFU D;  5IDP B;  4ELJ A;  1H1Q B;  1VIN A;  5ACB A;  4YC3 B;  2C6T B;  4BCQ B;  1OKW B;  4F7S B;  4UN0 A;  1F5Q B;  3TNW B;  4F6U B;  1E9H B;  2WHB B;  1OL2 B;  2WMB B;  1ZP2 A;  2UZE B;  1GUX A;  5I5Z B;  2UZB B;  4I3Z B;  4CFN B;  3EJ1 B;  4EOL B;  1OIU B;  4CXA B;  5HBH B;  1UNL D;  2G9X B;  1G3N C;  1W98 B;  4BCG B;  2WMA B;  4F6W B;  4ELL A;  1VOL A;  1XO2 A;  4BCJ B;  1GUX B;  3MY5 B;  4EC9 B;  3DOG B;  2C4G B;  5HBJ B;  4BCF B;  1H28 B;  2I40 B;  2R7G A;  4CFU B;  4KRD B;  3EOC B;  4EOK B;  4G6L B;  4BCP B;  1PKD B;  1GH6 B;  3BHV B;  2WPA B;  4FX3 B;  1H26 B;  4CFM B;  4EOI B;  2C5X B;  1H1P B;  4BCN D;  4F70 B;  1AD6 A;  3MY1 B;  2BKZ B;  2F2C A;  2X1N B;  3BHT B;  3TN8 B;  2WXV B;  4EOO B;  5FGK B;  1H27 B;  3BLQ B;  1UNH D;  4EOP B;  5BNJ B;  1H24 B;  4II5 B;  1H1R B;  2W99 A;  5HQ0 B;  3H4C A;  2WIH B;  4OR5 B;  2EUF A;  2V22 B;  4EC8 B;  3M03 A;  1OKV B;  2I53 A;  1D3U B;  3O0G D;  5HNB B;  4EOJ B;  5L2W B;  4YOO A;  4CFW B;  4OGR B;  2WEV B;  3BLR B;  2CCI B;  1URC B;  1C9B A;  3BHU B;  2IW8 B;  3LQ5 B;  3TNH B;  4BCM B;  4F7J B;  5HBE B;  1P5E B;  2C5N B;  3QHR B;  2UZD B;  1GY3 B;  3F5X B;  3MIA B; 
#chains in the Genus database with same CATH topology
 4ROD A;  1OGU B;  2KR6 A;  4CFX B;  3HHT B;  4EOM B;  5LMK B;  3WVD B;  4HNU A;  1JKW A;  2PMI B;  2IW9 B;  4BCQ D;  1JOW A;  1OI9 B;  2CZ0 B;  4EOS B;  1AIS B;  2W96 A;  3GTM S;  3G33 B;  2QF7 A;  2ZPH B;  4BCI B;  1TD6 A;  4Y72 B;  2DXB B;  4ROE A;  4ROC A;  2WFY B;  5EJC A;  1H1S B;  5EFQ B;  4HL4 A;  1UNG D;  5LQF B;  2W9F A;  2C5O B;  4CFU D;  4HNV A;  3X25 B;  2C6T B;  1IRE B;  4UN0 A;  3HZJ A;  2WHB B;  2WMB B;  1GUX A;  5I5Z B;  3EJ1 B;  1OIU B;  1UNL D;  3TW6 A;  5DQV A;  1G3N C;  2WMA B;  4JX4 A;  1VOL A;  4HLQ A;  2D0Q B;  4HNT A;  1QLB A;  1GUX B;  2C4G B;  3QZ9 B;  2WJ9 A;  4EOK B;  3PO3 S;  3BHV B;  2WPA B;  4FX3 B;  1H26 B;  4F70 B;  4BCN D;  3MY1 B;  2F2C A;  4EOO B;  4AKH A;  3DL1 A;  5FGK B;  3X28 B;  3VYG B;  4EOP B;  4BY1 X;  2W99 A;  2WIH B;  4MIM A;  2BS4 A;  3M03 A;  2I53 A;  1ENW A;  4OGR B;  2WEV B;  3BHU B;  3LQ5 B;  1P5E B;  2C5N B;  3DTO A;  4QSH A;  3BLH B;  5CEI B;  4OB1 B;  4KRC B;  1KXU A;  2QQ8 A;  2PJQ A;  3KHI A;  1JSU B;  3QYB A;  3BG3 A;  4NST B;  2ZPB B;  3RGF B;  2W9Z A;  4TTH A;  4ZGD B;  5ICP B;  3VKG A;  3X24 B;  2BPM B;  4BCH B;  2PK2 A;  2DD5 B;  5HVY B;  1BU2 A;  1QMZ B;  1AHJ B;  3DDP B;  2QFZ A;  3NDQ A;  2ZPE B;  4YOS A;  2QDJ A;  4BY7 X;  1H25 B;  1UGR B;  1JST B;  4EOQ B;  2DME A;  5ACB A;  4BCQ B;  4F7S B;  1E9H B;  2LW4 A;  3WVE B;  5HBH B;  2G9X B;  3B57 A;  4BCG B;  2BS2 A;  4BCJ B;  1UGP B;  2QDY B;  2ZPG B;  3MY5 B;  1H28 B;  2I40 B;  5DQW A;  4CFU B;  2DXC B;  4KRD B;  1PKD B;  2KMG A;  4EOI B;  3X26 B;  3TN8 B;  3BG9 A;  3BLQ B;  5BNJ B;  4II5 B;  5HQ0 B;  4OR5 B;  1OKV B;  1D3U B;  3O0G D;  3DJB A;  4Z6Y A;  2CCI B;  3X20 B;  2CZ1 B;  4BCM B;  3TNH B;  4F7J B;  2UZD B;  3F5X B;  3A8L B;  4CRL B;  1O9K A;  3POM A;  4BCN B;  1H4L D;  2B9R A;  3EID B;  4BCK B;  2JGZ B;  2UUE B;  3A8G B;  3DDQ B;  1VYW B;  5IHY A;  1OL1 B;  2WIP B;  4M6V A;  4MFE A;  1O9K B;  5IF1 B;  1TFB A;  1FVV B;  4F6S B;  4LOC A;  2BS3 A;  4YOZ A;  4AKG A;  4CFV B;  1E7P A;  2IW6 B;  3VYH B;  2CJM B;  2CCH B;  4AI6 A;  2W2H A;  5CYI B;  1V29 B;  3QYE A;  2C5V B;  2IVX A;  3TNI B;  4ELJ A;  1H1Q B;  1VIN A;  1OKW B;  1OL2 B;  3HO8 A;  2UZE B;  2ZZD B;  2UZB B;  4CFN B;  4EOL B;  4CXA B;  4F6W B;  4ELL A;  3QYG B;  3HBL A;  4EC9 B;  3DOG B;  4OB0 B;  2R7G A;  4BCP B;  1GH6 B;  4CFM B;  2C5X B;  1H1P B;  1AD6 A;  3BHT B;  4AKI A;  2WXV B;  2CZ6 B;  4ZGJ B;  2ZCF B;  1H27 B;  1H24 B;  2G77 A;  2QGS A;  1H1R B;  2CZ7 B;  2EUF A;  4EC8 B;  4NC6 A;  4EOJ B;  5L2W B;  4YOO A;  1C9B A;  2ZPF B;  4MFD A;  2IW8 B;  4BBS M;  3QHR B;  3MIA B;  2IN3 A;  1OIY B;  2UZL B;  1N4M A;  4IMY B;  4JX6 A;  4BBR M;  3BG5 A;  3QXE B;  3K7A M;  3QWL A;  3MI9 B;  4EON B;  3QHW B;  4F7L B;  4EOR B;  2CYZ B;  2PK9 B;  4BCO B;  1FIN B;  2PHG A;  4F7N B;  3QZ5 B;  2AHJ B;  5IDN B;  4BCM D;  5IDP B;  4YC3 B;  4FM4 B;  3TNW B;  1F5Q B;  4F6U B;  2DD4 B;  1ZP2 A;  4BXX X;  3A8H B;  4OB2 B;  4I3Z B;  1UGQ B;  4ZGE B;  1W98 B;  3TW7 A;  1XO2 A;  3QYH B;  2ZPI B;  1FKM A;  3HB9 A;  2DPP B;  5HBJ B;  4BCF B;  3EOC B;  4G6L B;  1UGS B;  3VKH A;  2BKZ B;  2X1N B;  1UNH D;  3A8M B;  3H4C A;  2V22 B;  4JX5 A;  5HNB B;  4OB3 B;  4CFW B;  3BLR B;  1URC B;  5HBE B;  3A8O B;  1GY3 B; 
#chains in the Genus database with same CATH homology
 3BLH B;  1OGU B;  4ROD A;  5CEI B;  4CRL B;  4KRC B;  4CFX B;  1KXU A;  4EOM B;  1O9K A;  3POM A;  1OIY B;  2UZL B;  1N4M A;  5LMK B;  4IMY B;  4BCN B;  1H4L D;  1JSU B;  2B9R A;  4NST B;  3EID B;  3RGF B;  2JGZ B;  4BCK B;  1JKW A;  2UUE B;  2W9Z A;  2PMI B;  2IW9 B;  4TTH A;  3DDQ B;  4BCQ D;  1JOW A;  1OI9 B;  1VYW B;  5ICP B;  3K7A M;  1OL1 B;  3MI9 B;  4EOS B;  1AIS B;  2WIP B;  4EON B;  2BPM B;  3QHW B;  4BCH B;  2PK2 A;  4F7L B;  2W96 A;  4EOR B;  1O9K B;  5HVY B;  1BU2 A;  1QMZ B;  3DDP B;  1TFB A;  5IF1 B;  3G33 B;  1FVV B;  4F6S B;  4YOZ A;  4BCI B;  4Y72 B;  4ROE A;  4CFV B;  4ROC A;  4YOS A;  2QDJ A;  2WFY B;  2IW6 B;  2PK9 B;  1H1S B;  1H25 B;  5EFQ B;  4BCO B;  1FIN B;  2CJM B;  2PHG A;  4F7N B;  1UNG D;  2CCH B;  1JST B;  2W9F A;  5LQF B;  2W2H A;  5CYI B;  2C5V B;  5IDN B;  4EOQ B;  2C5O B;  2IVX A;  3TNI B;  4BCM D;  4CFU D;  5IDP B;  4ELJ A;  1H1Q B;  1VIN A;  5ACB A;  4YC3 B;  2C6T B;  4BCQ B;  1OKW B;  4F7S B;  4UN0 A;  1F5Q B;  3TNW B;  4F6U B;  1E9H B;  2WHB B;  1OL2 B;  2WMB B;  1ZP2 A;  2UZE B;  1GUX A;  5I5Z B;  2UZB B;  4I3Z B;  4CFN B;  3EJ1 B;  4EOL B;  1OIU B;  4CXA B;  5HBH B;  1UNL D;  2G9X B;  1G3N C;  1W98 B;  4BCG B;  2WMA B;  4F6W B;  4ELL A;  1VOL A;  1XO2 A;  4BCJ B;  1GUX B;  3MY5 B;  4EC9 B;  3DOG B;  2C4G B;  5HBJ B;  4BCF B;  1H28 B;  2I40 B;  2R7G A;  4CFU B;  4KRD B;  3EOC B;  4EOK B;  4G6L B;  4BCP B;  1PKD B;  1GH6 B;  3BHV B;  2WPA B;  4FX3 B;  1H26 B;  4CFM B;  4EOI B;  2C5X B;  1H1P B;  4BCN D;  4F70 B;  1AD6 A;  3MY1 B;  2BKZ B;  2F2C A;  2X1N B;  3BHT B;  3TN8 B;  2WXV B;  4EOO B;  5FGK B;  1H27 B;  3BLQ B;  1UNH D;  4EOP B;  5BNJ B;  1H24 B;  4II5 B;  1H1R B;  2W99 A;  5HQ0 B;  3H4C A;  2WIH B;  4OR5 B;  2EUF A;  2V22 B;  4EC8 B;  3M03 A;  1OKV B;  2I53 A;  1D3U B;  3O0G D;  5HNB B;  4EOJ B;  5L2W B;  4YOO A;  4CFW B;  4OGR B;  2WEV B;  3BLR B;  2CCI B;  1URC B;  1C9B A;  3BHU B;  2IW8 B;  3LQ5 B;  3TNH B;  4BCM B;  4F7J B;  5HBE B;  1P5E B;  2C5N B;  3QHR B;  2UZD B;  1GY3 B;  3F5X B;  3MIA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...