3B57A

Crystal structure of the lin1889 protein (q92an1) from listeria innocua. northeast structural consortium target lkr65
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
180
Chain Sequence
MNKEEIILSAKNWMHSHFHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDQEATKTLINWMETKEIPSELIKKIIRIIQSVSALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNPKNTTLQHFYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
molecule keywords Lin1889 protein
total genus 61
structure length 180
sequence length 203
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3b57A01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b57A02
3DTOA 2QGSA 5DQWA 3B57A 5IHYA 3DJBA 2PJQA 5DQVA
chains in the Genus database with same CATH superfamily
3ZT7A 3GA8A 1YXRA 4O2BE 2DD4B 4AISA 3DL1A 4QH4A 4EONB 3A8HB 3NDQA 4KHZF 1C9BA 2W99A 3AEAA 1OXZA 2IMLA 2D5UA 3EABA 1HTJF 2AXDS 1VOLA 3SFDA 2V7IA 4IE5A 4XZCA 3GN5B 5HYAA 2XY8B 5FY0A 3A8MB 4BCHB 4JI7T 3NWIA 5HXRA 2XAHB 3PUYF 5L4HA 5KDMC 4YTNA 2CBIA 3T1HT 3VR8A 2XJ7A 4DV6T 3PTRB 4OB2B 4OB0B 2M6IA 1I6ZA 1WYBA 2WEVB 5ICPB 2VK9A 3DDPB 2WQYA 2LE8A 2HH7A 3RPUA 3CX6B 3AE3A 4IE4A 1WCRA 5ADXL 4ZHQE 1SE7A 3U78A 3TNWB 5KX5E 4ZGDB 5LG3A 2V7LA 2PK2A 2AHJB 1H4LD 3LDQB 3H4CA 3GMIA 4DR7T 5L3BB 3KINB 2VVSA 3RLFF 1VCSA 5LYJE 4HWCA 4DR5T 4EOJB 3FHNA 4JYAT 3JAEA 2CWOA 4B3MT 4JI8T 4BCMD 4IHJE 2LJLA 3K7AM 5AQLB 4EOLB 4JI5T 2HN1A 2YN6A 5FL0A 3Q5XA 2JQKA 3HO8A 3ZJ2A 5HWYA 1X9BA 2DMEA 3VYHB 2SPCA 3HBLA 2W63A 2NW7A 2XM2A 4MLKA 4ZI2D 2W9FA 1IBMT 5FXVA 1M7KA 1CUNA 2V7MA 4GKKT 2XAGB 1CHUA 2CZ7B 4GK0E 2VASA 1LRZA 4PJJA 5AQOB 3CQCB 5C2TA 5AQMB 4O4LE 2GK9A 5JR9B 3VYGB 3CVRA 2CCIB 4F7NB 2IW9B 4CN4A 3ZSTA 5LMUT 1SUMB 3RF1A 2XQ6A 3O1JA 3C98B 3BHVB 4EOPB 2CBJA 5HVYB 4QXCB 1O3XA 2IW5B 1XMQT 3OPCA 3BHTB 3ZYMA 1WRDA 2XQ5A 3MXZA 3I0QA 4X64T 5J2TE 1BR4A 5AQRB 2CRBA 3KVAA 3FZMB 4PNIA 3MACA 5AQJB 1BR0A 2BG9A 2K5BB 1VOMA 2N9DA 4HWIB 4NIQA 1MIVA 1OI9B 4GIWA 2MOZA 4H9PC 4H9SE 3P4SA 5CA1E 1FINB 2V5CA 3O9XA 5LBQB 2WHBB 1N4MA 3QYGB 1N34T 3C51A 3G06A 5JH7E 5ETWA 3FBZA 3GWHA 2RP4A 3QXEB 3X20B 3B5MA 3L09A 2KT9A 4JI3T 1ZP0A 2PJQA 3RYHE 4DUZT 5A1LA 5AQFB 2I53A 3EUHA 1HR0T 3QOFA 2ZM2A 2QYWA 4FM4B 3N2OA 4HN9A 2J4GA 1FMVA 1UNGD 3ZKRA 3ZSSA 3Q9DA 4HGAA 3O1IA 1OKWB 2V6YB 3CQXC 4U2YA 3DP7A 3LBXA 4L5GA 3MIAB 1UK5A 1MNEA 4CFVB 1W09A 1HG2A 2D0TA 4BCIB 2RPAA 2WY2A 1AJ3A 3C4WA 4EOZB 4F6RC 4HEAA 3KBUA 5GONE 2FJDA 4YSZA 4NXNT 3TNIB 2IDOB 3LFMA 3MA9A 5IYZE 5HXCA 2VKHA 4NPPA 3UU8A 2BG9E 4ZZCA 5M4YA 1JSTB 1QSDA 3C64A 4OB1B 4II5B 1UGQB 5FNVE 2W61A 5ABFB 1H1SB 4EOMB 3UT5E 4NSTB 5JDQA 3UTKA 4PAGA 3ZMZB 4HFDA 4BJNA 3SRZA 4EC8B 2XSAA 4UV9B 2ES0A 3VHLA 2WS3A 3FB2A 2VB6A 4JI1T 4EORB 1UUSA 2V22B 3K8PC 3ESLA 1HFAA 5LHHB 1BR1A 1UGPB 5HCMA 4WZXA 4WBNE 2UXBT 5IHYA 5L3DB 3ZN0B 1JKWA 4L0RA 1R8IA 3RIUA 1W0BA 4YSXA 5BMVE 4CI1B 3ZYKA 3HZJA 2WDVA 3T8OA 1QLBA 3AECA 3RHWA 2KNDA 5FGKB 1Y64B 4Z90A 2Y48B 2CM0A 5IDNB 5J1GA 4UR9A 5FKYA 3ANWB 2DI4A 5DQVA 3FBLA 4CRLB 1OIUB 4F70B 2LSJA 4NC6A 2WJ9A 2BBHA 3TW7A 5IF1B 4L9IA 5AQSB 2B76A 3EIDB 3DTOA 1FVVB 5H6QB 4F6UB 5EFQB 2W2UA 2VKJA 1VRBA 4DR6T 2WWVA 2UZLB 4ZOLE 2C5NB 5HEGA 3PDYA 2WMOA 4WYVA 5JVDE 4BA9A 1P5EB 5JDMA 4IDNA 3IHRA 4HKAA 2ZM0A 5JREA 1SA0E 4F6WB 1OGUB 5LNKA 2PHGA 1TFBA 4JEHB 4U72A 4PW8A 4X62T 3H3AA 4CN6A 1PKDB 3KVBA 4LF9T 1UNLD 3QYHB 2JQHA 4ILUA 4ZZBA 2BS3A 3DDQB 1V29B 5F8PA 4DR2T 5L2WB 2EHOC 2R6GF 5FVLA 2KZ7B 3EAMA 2WZIA 2QGSA 5FYMA 2QDYB 5FXWA 2V8SV 4BCFB 2WIHB 2YU2A 4IT4A 2D9DA 3P4QA 4HNTA 2V7KA 1M62A 1XNRT 4GKJT 3GTMS 3TLUA 2CXLA 5C8YE 4H9OC 4U31A 4EZ4A 3Q5EA 3TLSA 3VU7H 4F8HA 3FZHB 4YJ2E 2R7GA 4KBMB 4B3TT 1YD8G 1D0YA 2QVAA 4ZEYA 5L4EA 2IAKA 2LKHA 3RYCE 4BCOB 1G73A 4NXMT 3MZKB 1JOWA 3N2KE 3KV5A 3AA6B 4YOZA 1MMDA 2LM9A 3NZPA 2K9AA 1H1QB 2ZMAA 3ZPOA 5AQIB 2A3DA 4GK5E 3QYBA 3RRWA 3N9LA 4CI3B 5LHIB 3UUMA 2DHRA 2UUEB 4YFSA 1JSUB 2X66A 4PFPA 2BPMB 2JIWA 4I3ZB 2WPAB 2X0YA 1ZP2A 3DJBA 4TV8E 3A8GB 2PMIB 5AQNB 3TW6A 4CFMB 2B1EA 3KHIA 2H7VC 1OL2B 4AKGA 2W2HA 4LFBT 2LM2A 1NENA 5EZYE 2UZDB 3FZFB 1U5PA 2UZBB 2LLYA 2C5XB 3B13A 2E9XD 5AQTB 3MY5B 4X66T 2WMBB 5DJQC 2ZZDB 2I59A 4YHJA 4YOOA 3RGFB 4P0AA 2IC6A 2M67A 2KINB 4E7ZA 2BKNA 2G77A 1BR2A 1F5QB 2KLQA 2CCHB 3Q2MA 4MFDA 2UU9T 1YKEB 1UX4A 2XZEA 1KNRA 4ISSA 3Q5WA 3ONXA 3AEGA 4H63H 2V5DA 2HPJA 3AAIA 3POMA 4A97A 4N78D 3MJXA 3HR0A 3ZMSB 5CA0E 5EK3A 2X67A 3RQWA 2NTYA 4IDQA 5CGMA 1URCB 4BY7X 4OYKA 4QWNB 4G63A 4UELA 3PUXF 4ZGJB 4EEBA 4F6SB 2BG9B 4DV0T 5LMNT 1OEDB 2LOPA 3EOCB 1YQ3A 2QDJA 2OA5A 1OKVB 2K3WA 2X9HA 3ETVA 2WP9A 2LW4A 3AA7B 4WBOA 2WFYB 4AQFA 2E9XB 4DV2T 2XHEB 2Y8DA 3EI0A 3NRYA 3SS1A 1MIYA 4Y72B 3TKLB 4ZGEB 4A98A 3ZC0A 2KSRA 4EXTA 3M65A 3UQ4A 2VVNA 2EHOD 2VKDA 5JR9C 4DVDA 4EC9B 2X9WA 5AQGB 2WWUA 1GY3B 4BJMA 1QUUA 3WVDB 1J5WA 2CXFA 3ZYLA 4O2AE 4IDZA 3RKOA 3KV4A 3N9PA 1Z0PA 4DR3T 4ERRA 2UZEB 4OHFA 1GQEA 2W9ZA 4TV9E 2CYZB 3M3ZB 2WU2A 4H9NC 1NEKA 3ONJA 2NWBA 3HI2A 1J5ET 1QMZB 2KMGA 2L3LA 2MYSA 4JX5A 5L3EB 2ZPHB 1H24B 3FZKB 3L39A 3UU6A 4UVCB 3BQLA 3QZ5B 2E9XA 3RIFA 4HFHA 3J9X1 2W0GA 2LSYA 2JPFA 4K0UA 5J2UE 1O9KA 2WXVB 2PK9B 2YEVC 4KMCA 4TX5A 3LK42 4IE0A 4FI5A 4COFA 3O4XE 5E0OA 2VURA 4EOIB 4TWDA 3KV9A 4YOSA 2XPKA 3N9MA 4P0BA 2B9RA 1D1BA 1ENWA 3AXJB 3FXEB 3WAJA 3CK6A 5LG4A 3V5SA 2J62A 3UU3A 1UGOA 2V26A 4I55E 3ABVA 3L3PA 4IE6A 5HAXA 3SOLA 1FIOA 4HFEA 3HL6A 3BG9A 4CFXB 4TWHA 4Z8XA 2MAWA 1EZ3A 4U74A 1G8XA 4HFIA 5FY7A 1T8BA 2BKPA 2X1NB 2YKSA 5CJ5A 2IW6B 1VCTA 1XDPA 4OYJA 1GUXB 1XMOT 3KDSE 3QWLA 5TAOA 5LQFB 5EK4A 3AE8A 2V1DB 3OBVE 4HLQA 2WCAA 5AQQB 1E7PA 5LXTE 4HFBA 4DV5T 4HNVA 3I0OA 4BCND 5L47A 4DV3T 2CZ6B 2NW9A 3PU3A 2XAFB 4EB6E 3ZEFB 3WI3A 5L3FB 4LOCA 3QUJA 2WU5A 3E0ZA 4QH5A 3BQIA 4DV1T 3SWHA 4CQIA 2Q9QC 4AXPA 2DLRA 2RA1A 2K24A 3UFGA 3CMLA 5DQWA 5IDPB 3X1DA 2LT3A 1WR6A 4JI2T 5LA6E 4KUMB 4CXAB 3H37A 4U2ZA 4F7LB 4KRDB 3X25B 2XTLA 4E7SA 2VQFT 5FY1A 2LSGA 1H7CA 4MHCA 2X0LB 4CZZB 3ZMUB 4A5XA 2C6TB 1IZNB 4KP3C 2JJ9A 3JADA 2IVXA 4YXDA 3O1HA 4AKLA 2L9QA 3OYZA 2UUCT 4BY1X 1T72A 4AI6A 4KI0F 4YLHA 3PUAA 3AE5A 2ZCFB 1ZEEA 3MY1B 2W96A 1HX1B 5JDNA 4B3ST 3PU8A 3JAFA 3AE6A 5HEHA 1D0ZA 1H1PB 3N5LA 2ZM6T 2D0QB 5LBMA 4X20E 3OYXA 2CZ1B 5HBJB 5LGTB 2KR6A 4KRCB 4YTMA 2X9YA 2J47A 4G6LB 4PK4A 2WB5A 4YC3B 2DXCB 4TWFA 3BK9A 3ETUA 3NRXA 3UULA 3R84B 4GYSA 4RODA 3Q5DA 3H3MA 2IUBA 3RX6A 4TNWA 1XWMA 4XAXB 4M6VA 5L2LA 4QXBB 2E5LT 3F31A 4DO0A 5BNJB 5C3JA 1KF6A 3T1YT 3I9WA 1SHZC 2ZM8A 3P50A 4ZI3D 5HNBB 3X28B 4B6XA 3OJAA 2CE7A 4JEUB 2DD5B 2F4VT 2UUAT 4EYYR 3F5XB 4KX6A 2C5OB 3UUBA 2C5VB 3KFWX 1T7SA 3B57A 4BBSM 3BQKA 2DWKA 1GUXA 2LRLA 2FJBA 5LP6E 2VL8A 3O0GD 1FMWA 1AHJB 2NOXA 2HHHT 4FJOA 4IL9A 2XM1A 3QC9A 2PFVA 4U33A 2G9XB 1FKMA 3X24B 3I1AA 1IAPA 2V6YA 4AKHA 1X79A 1S35A 2G0UA 4AIUA 5AFUL 5LCYA 3QHRB 3P4PA 3IEEA 5AQPB 2BS4A 2IC9A 2PTFA 2WDQA 4AKRB 3PUZF 2BKOA 2BZBA 1WLXA 1I94T 2LRKA 4NUVA 3C50A 2MTQA 3TNHB 3AEEA 1B7TA 3NZQA 2ZPGB 3AA0B 4DBQA 5LHGB 3ZJ1A 4HFVA 4P09A 4WNKA 1D1CA 2JMHA 5AQVB 4IGUA 4DIDB 2WM9A 4H63V 5EK2A 3D0TA 2UXCT 4HL4A 4JI4T 3M03A 3ZT5A 4LF6T 2H89A 2IHR1 4BCNB 4ZI3C 3LG7A 2FUPA 4B3RT 5AQHB 2W4XA 3LJCA 4JUYA 5KXJA 3NKZA 4LF4T 1LVFA 2WMNA 1WR0A 2WMAB 4BCQB 2E9XC 2DPPB 2OV9A 3WAKA 3HKDE 4ADZA 4EYUA 4HWHA 4TTHA 3EVYA 1ZV4X 2M6BA 3CQGB 5LGNB 4DMWA 4UF0B 3UUXB 4WW0A 1D0XA 2CZ0B 3VRAA 3ZMTB 4UN0A 1H26B 5HXEA 3QB5K 4ILAA 4UF0A 2W67A 2JQ9A 3RIAA 4ASKA 2C5KT 5BR8T 1H1RB 2N1GA 3AE1A 4IIJE 3IF8B 3W15B 5HQ0B 2CHOA 2I40B 2YU1A 3NVOA 3I9YA 3GN5A 3ANWA 1UGSB 2XQYA 2DXBB 1NWMX 3P7IA 4GYRA 1HF8A 1OEDC 4AQFC 4YY3T 1MMGA 4DMVA 3PUVF 2BG9C 3KBTA 2XQ7A 4TZ4C 3TN8B 2P9BA 2X9XA 1T98A 4DV7T 1UGRB 2CWYA 2W62A 2KWHA 4TN7B 4V1Av 2V7JA 2J1DG 2X51A 4CI2B 5DABA 2IIUA 3P8CD 2X0HA 2YK0A 3VR9A 2CHNA 2FBWA 1H27B 3C4XA 5CB4E 1FJGT 2A2FX 3LBXB 3AB3B 3ZCIA 3L8RA 3PUWF 1HNXT 2UUBT 4YTPA 1OIYB 3LSVA 5JR9A 1OWAA 1KNZA 2BKZB 1KNPA 4PJLA 2H88A 5ABFA 2BVLA 3PUQA 5LJNA 4EV6A 2JGZB 2OLTA 2Q9QA 3S4UA 4ZXLA 4BBRM 4Z6YA 5HBHB 4MFEA 2IN3A 3A8LB 2KMFA 3BG3A 4JV5T 2XQ3A 3K1SA 4DV4T 2D0UA 1VYWB 3N9OA 4DNDA 3X26B 3HKCE 4EEDA 1JNRA 2CCQA 3A8OB 3EDVA 3NBXX 1LVKA 3G33B 3BLRB 3P4WA 4I43B 4Q25A 4OR5B 5I5ZB 4LF8T 4QXHB 3AVSA 4G2AA 2C4GB 4H9RC 1IJ5A 4BCMB 2ZLYA 2JMKA 5LOVE 4MALA 2LOSA 3AA1B 3AAAB 3AEDA 3UUNA 2NP9A 4C91A 2A9UA 2PG8A 3AE9A 3C4ZA 4DR4T 4UIGA 2WDRA 1WFDA 4X1YE 3CWZB 3BG5A 1W0AA 3QB5A 4QX8B 2Q9QB 1KXUA 1ZKEA 2ACZA 3PJAA 2LHRA 4U3CA 2NW8A 2XQ9A 2C5IT 2LEHA 4MFRA 4U7IA 4CFWB 4YJ3E 3E22E 4ROEA 1NAFA 2A72A 2MBGA 3TLTA 1VINA 2DWGA 3KV6A 4EOQB 4JX4A 4BCGB 4ZS2A 4X1IE 5FMNA 2ZPIB 2ODUA 2UXDT 5J0ZA 2YDRA 3R6NA 4OFZA 1YKHB 2XAJB 3A7MA 4LFCT 4AKIA 1OEDA 2EHOA 2LSIA 4O4JE 2XUEA 1MMNA 3CPZA 3LK2B 3AE7A 2E5VA 3BHUB 3RRCA 4LF7T 3FXDB 2XQ4A 3P4RA 3ZLIA 2YDSA 2Y6XA 4ELLA 1UURA 2XQAA 1XZYA 2YINA 3RIUC 3MK7C 3HA4A 2VKOA 1HG5A 4UXNB 2X68A 4EOKB 1XDOA 4DR1T 3E08A 3RC8A 2LKGA 2Q9QD 4PK5A 2WIPB 4ROCA 4CXWA 5JDLA 1N36T 3EHZA 1W9RA 2QQ8A 2CA5A 4BCQD 4ISTA 3OVUA 3TLWA 2PBIA 2I0MA 2QA7A 4ILCA 3RH3A 1H25B 1YQ4A 4ZS3A 1HX8A 5CYIB 4HNUA 1IBKT 5FXXA 4HWFA 4A56A 2F2CA 4HE8A 5ACBA 4EIWA 3RI5A 5HXSA 4GOUA 2AE9A 4CFUB 1TD6A 4J2CA 5IWAT 4CN1A 4LMKA 3PUGA 4I0UA 4BXXX 4QHOA 4EOOB 4YSYA 5ABHA 3N2GE 3JC6C 1LKXA 4HWDA 2VWAA 3N9NA 5JRCA 4OK0A 3VKGA 3HKEE 1XNQT 2DNXA 4UV8B 4PFOA 2VQET 2YOEA 1KFYA 4BCKB 3AEBA 2ODVA 4OX9T 2FJEA 1G3NC 5CFBA 3VKHA 2QFZA 4IDPA 3CIRA 4PJMA 2KXPB 1KEYA 3EDUA 5JDFA 5JDHA 3JC6D 4JI0T 2WAUA 3LQ5B 5AQUB 1IREB 1S94A 4YHHT 4DBRA 1US7B 2ZPEB 3ZC1A 3RYFE 2EHOB 4CFUD 1N33T 4QX7B 1E1HB 1AISB 4LMJA 4Z91A 5ABEA 3BLQB 3PV0F 3RYIE 3AAEB 5LMKB 3AXJA 4BCPB 4JX6A 3CX8B 3DOGB 3BLHB 4ILBA 5FXZA 5FVKA 2XQ8A 4DUYT 2ZPBB 3UU4A 3HB9A 4JI6T 3FZLB 2W66A 5F5WA 4IL4A 5HXHA 5HCJA 4MIMA 3QK6A 4YT0A 1WYCA 5LB7B 2CJMB 2HN2A 3PUSA 3PJAJ 3RGLA 5HBEB 2LSKA 4JLEA 4EOSB 3OKQA 5JTGA 2UXXB 2BS2A 4JBWF 4IMYB 1JNZA 1V9DA 5JDGA 4CXYA 1MMAA 2E8IA 4AQYT 5CEIB 4UVAB 1BU2A 3UU5A 4X65T 1HNZT 4U7YA 2WBLA 3UFEA 2HPLA 2C0SA 2XSBA 2WSSV 4C90A 3WVEB 2ZPFB 5FL1A 1L0VA 2DL1A 2JRKA 4ANJA 5LJMA 5F3JA 3CKDA 2D2SA 2MPKA 3ONLC 3AVRA 2NTXA 1OEDE 2WZHA 3PE0A 1D1AA 3ZMVB 4TNVA 2DCFA 5ABGA 2UXNB 1HS7A 4HFCA 3RQUA 3ZCJA 4I4TE 3IBPA 2CPTA 3ZT6A 1UX5A 1H28B 2BDEA 3PURA 4LMLA 5JQGE 2C5JA 2E2AA 1IJ6A 2Z6EA 4IREA 3N9QA 4EGWA 5IUXA 5L3GB 4I50E 2CMRA 3AEFA 2CXDA 2NR4A 1IBLT 1MNDA 1Y01A 3J7Yq 4CFNB 2W00A 3AE4A 1UCUA 3A5XA 2CLYB 4KHPT 3HHTB 3IA3A 2KWIB 1O9KB 2K48A 3A8YC 4F7SB 2QF7A 5JRCB 1E9HB 3QHWB 1UNHD 2CEAA 4P1NA 3V5UA 4LFAT 2L8KA 3F2EA 1ZHCA 4O8SA 2N2NA 2EUFA 5HEOA 1FEWA 2H7OA 4LF5T 4O4HE 3K3OA 1J1JA 1KK7A 3K3QC 5HWXA 1W98B 4CXXA 4UEMA 3TLVA 1ZOYA 1HNWT 4AQGA 1Z8UA 3LK3B 1E2AA 5HEJA 3QYEA 2JQQA 3RC3A 4OGRB 1MIWA 4ZI7E 4HTEA 4IDOA 4BCJB 1OL1B 3UQ7A 5L3CB 1HCIA 3AE2A 2I6HA 3U3IA 4ELJA 4XBFB 5HEUA 2BBJA 3JCFA 2LHNA 4TUYE 1AD6A 5H6RB 4X1KE 4K0KT 3HKBE 3PO3S 4H9QC 1DU2A 2FJAA 2BVMA 1YW0A 5AQKB 2XAQB 3RKGA 4IE7A 4BAYB 2IW8B 4QKNA 4FX3B 3ZN1B 3CX7B 2H3RA 4M1PA 2YDQA 4EZHA 3QZ9B 4EAHA 3K3NA 4UVBB 5LGUB 1U4QA 2V6XA 4F7JB 1D3UB 4QSHA 4PJNA 4X5TA 3MI9B 4MBQA 1XO2A 4PK6A 5FP3A 1N32T 5EJCA 4NUUA 5KMGP 1GH6B 4ZI2C 3F57A 4QH1A 3MKDA 2CLYC 3SFEA 4O4IE 2ACXA 3OTOT 4OB3B 3EJ1B 2XASB 3VRBA 3QNUA 2VL0A 2QRXA
chains in the Genus database with same CATH topology
3N5LA 2YU2A 3GA8A 2V7KA 4O2BE 2CXLA 3RC8A 5C8YE 4H9OC 5LBMA 2Q9QD 4X20E 4PK5A 4EZ4A 3OYXA 5LGTB 4CXWA 5JDLA 3VU7H 2X9YA 4PK4A 1OXZA 2D5UA 4YJ2E 1HTJF 2CA5A 2V7IA 4IE5A 4XZCA 3GN5B 4ISTA 5HYAA 2PBIA 5FY0A 3BK9A 4KBMB 2QA7A 1YD8G 3ETUA 1D0YA 3NRXA 3UULA 3RH3A 5HXRA 4ZS3A 2XAHB 1HX8A 3R84B 2IAKA 5KDMC 4GYSA 5FXXA 3PTRB 3RYCE 4A56A 1G73A 4HE8A 1WYBA 3MZKB 3RX6A 3N2KE 2VK9A 4EIWA 4XAXB 3KV5A 3AA6B 5L2LA 4QXBB 2LE8A 1MMDA 2HH7A 5HXSA 2LM9A 4GOUA 3RPUA 3F31A 4DO0A 3NZPA 3CX6B 4IE4A 2K9AA 5ADXL 4ZHQE 2ZMAA 3ZPOA 3I9WA 1SHZC 3U78A 4J2CA 2ZM8A 2A3DA 5KX5E 4GK5E 4ZI3D 4B6XA 2V7LA 3RRWA 3N9LA 4CI3B 3OJAA 2CE7A 3PUGA 4JEUB 5LHIB 3UUMA 2DHRA 4QHOA 4YFSA 2X66A 3GMIA 4PFPA 3N2GE 3JC6C 5L3BB 3KINB 4EYYR 1LKXA 2VWAA 3N9NA 5JRCA 4OK0A 5LYJE 3HKEE 3VKGA 3DJBA 2DNXA 4TV8E 3FHNA 4UV8B 3KFWX 4PFOA 2CWOA 3B57A 2B1EA 3BQKA 2H7VC 2ODVA 4IHJE 2DWKA 4AKGA 2LJLA 5EZYE 3VKHA 5LP6E 2VL8A 4PJMA 1U5PA 2KXPB 1FMWA 3Q5XA 3ZJ2A 3B13A 2E9XD 3EDUA 5HWYA 5JDFA 2NOXA 5JDHA 4FJOA 5DJQC 3QC9A 2PFVA 3JC6D 2I59A 4YHJA 2WAUA 3I1AA 1IAPA 1X79A 4AKHA 1S35A 2SPCA 2G0UA 1S94A 2W63A 2IC6A 2M67A 2KINB 5AFUL 4E7ZA 4P0AA 2NW7A 5LCYA 1BR2A 4DBRA 2KLQA 1US7B 4MLKA 4ZI2D 3IEEA 5FXVA 3Q2MA 3ZC1A 2IC9A 3RYFE 2EHOB 1CUNA 2V7MA 1YKEB 1UX4A 2XAGB 4AKRB 4GK0E 4ISSA 2VASA 3Q5WA 1LRZA 3ONXA 4QX7B 4PJJA 1E1HB 4H63H 2HPJA 3CQCB 2BZBA 3AAIA 4O4LE 2GK9A 5JR9B 1WLXA 3RYIE 3AAEB 3C50A 4N78D 4NUVA 2MTQA 3HR0A 3CVRA 3MJXA 1B7TA 3CX8B 3AA0B 3NZQA 4DBQA 5LHGB 3ZJ1A 3ZMSB 5CA0E 4HFVA 5EK3A 4P09A 4WNKA 2X67A 1D1CA 2NTYA 2JMHA 4IGUA 3O1JA 3C98B 5FXZA 4OYKA 4QWNB 2WM9A 4H63V 4QXCB 5EK2A 3D0TA 4G63A 4UELA 1O3XA 2IW5B 4ZI3C 3LG7A 5HXHA 3ZYMA 3LJCA 1WRDA 2LOPA 3QK6A 4JUYA 1LVFA 3MXZA 2OA5A 2WMNA 1WYCA 3PUSA 3I0QA 5J2TE 2X9HA 3ETVA 1BR4A 2E9XC 2LSKA 4JLEA 3AA7B 3WAKA 4WBOA 3KVAA 3OKQA 3HKDE 4ADZA 4EYUA 4PNIA 2UXXB 4AQFA 2E9XB 2XHEB 2Y8DA 3NRYA 3SS1A 1V9DA 1MIYA 3MACA 5JDGA 3TKLB 4CXYA 1BR0A 3EVYA 1ZV4X 1MMAA 2E8IA 3CQGB 2K5BB 1VOMA 3ZC0A 5LGNB 4DMWA 4UF0B 2N9DA 3M65A 3UUXB 4EXTA 4WW0A 1MIVA 4UVAB 1D0XA 2EHOD 2VKDA 4GIWA 2MOZA 4H9PC 3ZMTB 5JR9C 4H9SE 5CA1E 5HXEA 2WBLA 3UFEA 2HPLA 3O9XA 5LBQB 4DVDA 2C0SA 4UF0A 2X9WA 3C51A 2WWUA 5JH7E 4ASKA 4BJMA 2WSSV 2C5KT 5ETWA 1QUUA 3FBZA 2N1GA 4IIJE 3GWHA 2RP4A 3IF8B 3W15B 4C90A 3L09A 2YU1A 2CXFA 3GN5A 3I9YA 3ZYLA 4O2AE 3ANWA 2KT9A 4IDZA 3RKOA 2XQYA 3KV4A 3N9PA 5LJMA 2JRKA 4ANJA 5F3JA 3CKDA 2D2SA 2PJQA 3AVRA 3RYHE 1Z0PA 1NWMX 2NTXA 3P7IA 5A1LA 4GYRA 4ERRA 1HF8A 4AQFC 3PE0A 1MMGA 3EUHA 4OHFA 1D1AA 3ZMVB 4DMVA 2DCFA 2UXNB 1HS7A 2ZM2A 4TV9E 3ZCJA 4I4TE 3IBPA 3KBTA 1UX5A 4TZ4C 2BDEA 3N2OA 2P9BA 3PURA 4H9NC 4HN9A 2X9XA 1T98A 5JQGE 2C5JA 2NWBA 3HI2A 2CWYA 1FMVA 2W62A 2L3LA 1IJ6A 2Z6EA 2KWHA 2MYSA 3N9QA 4TN7B 4V1Av 5L3EB 5L3GB 4I50E 2V7JA 2CMRA 4UVCB 3Q9DA 3BQLA 2E9XA 2CXDA 4HGAA 3O1IA 1MNDA 2J1DG 2X51A 4CI2B 3CQXC 3J9X1 2W0GA 2LSYA 2JPFA 3DP7A 3LBXA 4K0UA 2W00A 4L5GA 5DABA 3J7Yq 3P8CD 5J2UE 1UCUA 3A5XA 1MNEA 2YK0A 1HG2A 2YEVC 2D0TA 4KMCA 4TX5A 3LK42 3C4XA 4FI5A 4IE0A 2CLYB 5CB4E 2A2FX 3LBXB 1AJ3A 3C4WA 3O4XE 3AB3B 3ZCIA 4EOZB 4HEAA 4F6RC 5E0OA 3KBUA 5GONE 3KV9A 3N9MA 2KWIB 2K48A 4P0BA 3LFMA 3MA9A 5JRCB 5IYZE 5HXCA 5JR9A 2CEAA 2VKHA 3V5UA 1D1BA 1OWAA 1KNZA 2L8KA 4PJLA 3F2EA 1ZHCA 2BVLA 2N2NA 4O8SA 5M4YA 1FEWA 3PUQA 2H7OA 1QSDA 3C64A 3FXEB 5LJNA 4O4HE 3WAJA 3K3OA 5LG4A 3V5SA 2Q9QA 3S4UA 2V26A 4I55E 5FNVE 2W61A 1KK7A 3L3PA 4IE6A 5HAXA 3K3QC 3UT5E 5HWXA 3SOLA 1FIOA 2KMFA 3HL6A 4CXXA 5JDQA 4UEMA 3UTKA 4PAGA 2D0UA 3N9OA 4Z8XA 3ZMZB 4BJNA 4DNDA 3SRZA 1EZ3A 3HKCE 4U74A 4AQGA 2CCQA 1G8XA 3EDVA 3NBXX 5FY7A 4UV9B 1LVKA 2ES0A 3LK3B 3VHLA 3FB2A 2VB6A 4I43B 2JQQA 3RC3A 4QXHB 3AVSA 1MIWA 4ZI7E 4HTEA 4OYJA 3K8PC 4G2AA 3ESLA 5L3CB 1HFAA 3KDSE 5LHHB 1BR1A 5TAOA 5EK4A 4H9RC 2V1DB 3OBVE 1IJ5A 2ZLYA 1HCIA 2JMKA 4WBNE 5LOVE 5LXTE 5IHYA 5L3DB 4MALA 3ZN0B 2LOSA 4L0RA 3AA1B 3AAAB 5BMVE 3I0OA 3U3IA 3ZYKA 4CI1B 3UUNA 2NP9A 2NW9A 4XBFB 4C91A 2PG8A 3T8OA 3C4ZA 3PU3A 2KNDA 4UIGA 2XAFB 4EB6E 1Y64B 2LHNA 4TUYE 2Y48B 2CM0A 5H6RB 3ZEFB 3WI3A 4X1KE 4X1YE 3HKBE 5L3FB 3CWZB 5J1GA 3ANWB 3QUJA 3E0ZA 2DI4A 4QX8B 5DQVA 3BQIA 2Q9QB 4H9QC 3FBLA 1ZKEA 2BVMA 2LHRA 2NW8A 3SWHA 1YW0A 2C5IT 2LEHA 2LSJA 4CQIA 4MFRA 2Q9QC 2XAQB 4IE7A 4AXPA 4YJ3E 2DLRA 4L9IA 2RA1A 3E22E 2K24A 1NAFA 3DTOA 3CMLA 5DQWA 5H6QB 4BAYB 2A72A 2MBGA 2VKJA 1VRBA 2LT3A 1WR6A 5LA6E 4KUMB 4QKNA 3ZN1B 3CX7B 2H3RA 4ZOLE 2DWGA 3H37A 4M1PA 3KV6A 4EZHA 2XTLA 3PDYA 4ZS2A 4EAHA 4X1IE 5FMNA 3K3NA 2WMOA 5JVDE 2ODUA 4UVBB 4BA9A 4E7SA 5JDMA 5FY1A 3IHRA 4HKAA 2ZM0A 3R6NA 5JREA 4OFZA 1YKHB 1SA0E 2XAJB 5LGUB 1U4QA 2LSGA 4AKIA 4PJNA 5LNKA 1H7CA 2EHOA 4MHCA 4JEHB 4U72A 4MBQA 2LSIA 4PW8A 2X0LB 4CZZB 3ZMUB 4O4JE 2XUEA 1MMNA 3CPZA 4PK6A 1IZNB 5FP3A 4KP3C 2JJ9A 3H3AA 3LK2B 3KVBA 4NUUA 3O1HA 3RRCA 4ILUA 5KMGP 4AKLA 2L9QA 3OYZA 3FXDB 4ZI2C 3ZLIA 3F57A 2Y6XA 2CLYC 3MKDA 5F8PA 4AI6A 4O4IE 4YLHA 2ACXA 2EHOC 3PUAA 1ZEEA 2KZ7B 2YINA 3MK7C 3HA4A 2VKOA 1HG5A 2QGSA 2XASB 4UXNB 2X68A 5FYMA 5JDNA 3PU8A 5FXWA 3E08A 1D0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTO A;  2QGS A;  5DQW A;  3B57 A;  5IHY A;  3DJB A;  2PJQ A;  5DQV A; 
#chains in the Genus database with same CATH topology
 3ZT7 A;  3GA8 A;  1YXR A;  4O2B E;  2DD4 B;  4AIS A;  3DL1 A;  4QH4 A;  4EON B;  3A8H B;  3NDQ A;  4KHZ F;  1C9B A;  2W99 A;  3AEA A;  1OXZ A;  2IML A;  2D5U A;  3EAB A;  1HTJ F;  2AXD S;  1VOL A;  3SFD A;  2V7I A;  4IE5 A;  4XZC A;  3GN5 B;  5HYA A;  2XY8 B;  5FY0 A;  3A8M B;  4BCH B;  4JI7 T;  3NWI A;  5HXR A;  2XAH B;  3PUY F;  5L4H A;  5KDM C;  4YTN A;  2CBI A;  3T1H T;  3VR8 A;  2XJ7 A;  4DV6 T;  3PTR B;  4OB2 B;  4OB0 B;  2M6I A;  1I6Z A;  1WYB A;  2WEV B;  5ICP B;  2VK9 A;  3DDP B;  2WQY A;  2LE8 A;  2HH7 A;  3RPU A;  3CX6 B;  3AE3 A;  4IE4 A;  1WCR A;  5ADX L;  4ZHQ E;  1SE7 A;  3U78 A;  3TNW B;  5KX5 E;  4ZGD B;  5LG3 A;  2V7L A;  2PK2 A;  2AHJ B;  1H4L D;  3LDQ B;  3H4C A;  3GMI A;  4DR7 T;  5L3B B;  3KIN B;  2VVS A;  3RLF F;  1VCS A;  5LYJ E;  4HWC A;  4DR5 T;  4EOJ B;  3FHN A;  4JYA T;  3JAE A;  2CWO A;  4B3M T;  4JI8 T;  4BCM D;  4IHJ E;  2LJL A;  3K7A M;  5AQL B;  4EOL B;  4JI5 T;  2HN1 A;  2YN6 A;  5FL0 A;  3Q5X A;  2JQK A;  3HO8 A;  3ZJ2 A;  5HWY A;  1X9B A;  2DME A;  3VYH B;  2SPC A;  3HBL A;  2W63 A;  2NW7 A;  2XM2 A;  4MLK A;  4ZI2 D;  2W9F A;  1IBM T;  5FXV A;  1M7K A;  1CUN A;  2V7M A;  4GKK T;  2XAG B;  1CHU A;  2CZ7 B;  4GK0 E;  2VAS A;  1LRZ A;  4PJJ A;  5AQO B;  3CQC B;  5C2T A;  5AQM B;  4O4L E;  2GK9 A;  5JR9 B;  3VYG B;  3CVR A;  2CCI B;  4F7N B;  2IW9 B;  4CN4 A;  3ZST A;  5LMU T;  1SUM B;  3RF1 A;  2XQ6 A;  3O1J A;  3C98 B;  3BHV B;  4EOP B;  2CBJ A;  5HVY B;  4QXC B;  1O3X A;  2IW5 B;  1XMQ T;  3OPC A;  3BHT B;  3ZYM A;  1WRD A;  2XQ5 A;  3MXZ A;  3I0Q A;  4X64 T;  5J2T E;  1BR4 A;  5AQR B;  2CRB A;  3KVA A;  3FZM B;  4PNI A;  3MAC A;  5AQJ B;  1BR0 A;  2BG9 A;  2K5B B;  1VOM A;  2N9D A;  4HWI B;  4NIQ A;  1MIV A;  1OI9 B;  4GIW A;  2MOZ A;  4H9P C;  4H9S E;  3P4S A;  5CA1 E;  1FIN B;  2V5C A;  3O9X A;  5LBQ B;  2WHB B;  1N4M A;  3QYG B;  1N34 T;  3C51 A;  3G06 A;  5JH7 E;  5ETW A;  3FBZ A;  3GWH A;  2RP4 A;  3QXE B;  3X20 B;  3B5M A;  3L09 A;  2KT9 A;  4JI3 T;  1ZP0 A;  2PJQ A;  3RYH E;  4DUZ T;  5A1L A;  5AQF B;  2I53 A;  3EUH A;  1HR0 T;  3QOF A;  2ZM2 A;  2QYW A;  4FM4 B;  3N2O A;  4HN9 A;  2J4G A;  1FMV A;  1UNG D;  3ZKR A;  3ZSS A;  3Q9D A;  4HGA A;  3O1I A;  1OKW B;  2V6Y B;  3CQX C;  4U2Y A;  3DP7 A;  3LBX A;  4L5G A;  3MIA B;  1UK5 A;  1MNE A;  4CFV B;  1W09 A;  1HG2 A;  2D0T A;  4BCI B;  2RPA A;  2WY2 A;  1AJ3 A;  3C4W A;  4EOZ B;  4F6R C;  4HEA A;  3KBU A;  5GON E;  2FJD A;  4YSZ A;  4NXN T;  3TNI B;  2IDO B;  3LFM A;  3MA9 A;  5IYZ E;  5HXC A;  2VKH A;  4NPP A;  3UU8 A;  2BG9 E;  4ZZC A;  5M4Y A;  1JST B;  1QSD A;  3C64 A;  4OB1 B;  4II5 B;  1UGQ B;  5FNV E;  2W61 A;  5ABF B;  1H1S B;  4EOM B;  3UT5 E;  4NST B;  5JDQ A;  3UTK A;  4PAG A;  3ZMZ B;  4HFD A;  4BJN A;  3SRZ A;  4EC8 B;  2XSA A;  4UV9 B;  2ES0 A;  3VHL A;  2WS3 A;  3FB2 A;  2VB6 A;  4JI1 T;  4EOR B;  1UUS A;  2V22 B;  3K8P C;  3ESL A;  1HFA A;  5LHH B;  1BR1 A;  1UGP B;  5HCM A;  4WZX A;  4WBN E;  2UXB T;  5IHY A;  5L3D B;  3ZN0 B;  1JKW A;  4L0R A;  1R8I A;  3RIU A;  1W0B A;  4YSX A;  5BMV E;  4CI1 B;  3ZYK A;  3HZJ A;  2WDV A;  3T8O A;  1QLB A;  3AEC A;  3RHW A;  2KND A;  5FGK B;  1Y64 B;  4Z90 A;  2Y48 B;  2CM0 A;  5IDN B;  5J1G A;  4UR9 A;  5FKY A;  3ANW B;  2DI4 A;  5DQV A;  3FBL A;  4CRL B;  1OIU B;  4F70 B;  2LSJ A;  4NC6 A;  2WJ9 A;  2BBH A;  3TW7 A;  5IF1 B;  4L9I A;  5AQS B;  2B76 A;  3EID B;  3DTO A;  1FVV B;  5H6Q B;  4F6U B;  5EFQ B;  2W2U A;  2VKJ A;  1VRB A;  4DR6 T;  2WWV A;  2UZL B;  4ZOL E;  2C5N B;  5HEG A;  3PDY A;  2WMO A;  4WYV A;  5JVD E;  4BA9 A;  1P5E B;  5JDM A;  4IDN A;  3IHR A;  4HKA A;  2ZM0 A;  5JRE A;  1SA0 E;  4F6W B;  1OGU B;  5LNK A;  2PHG A;  1TFB A;  4JEH B;  4U72 A;  4PW8 A;  4X62 T;  3H3A A;  4CN6 A;  1PKD B;  3KVB A;  4LF9 T;  1UNL D;  3QYH B;  2JQH A;  4ILU A;  4ZZB A;  2BS3 A;  3DDQ B;  1V29 B;  5F8P A;  4DR2 T;  5L2W B;  2EHO C;  2R6G F;  5FVL A;  2KZ7 B;  3EAM A;  2WZI A;  2QGS A;  5FYM A;  2QDY B;  5FXW A;  2V8S V;  4BCF B;  2WIH B;  2YU2 A;  4IT4 A;  2D9D A;  3P4Q A;  4HNT A;  2V7K A;  1M62 A;  1XNR T;  4GKJ T;  3GTM S;  3TLU A;  2CXL A;  5C8Y E;  4H9O C;  4U31 A;  4EZ4 A;  3Q5E A;  3TLS A;  3VU7 H;  4F8H A;  3FZH B;  4YJ2 E;  2R7G A;  4KBM B;  4B3T T;  1YD8 G;  1D0Y A;  2QVA A;  4ZEY A;  5L4E A;  2IAK A;  2LKH A;  3RYC E;  4BCO B;  1G73 A;  4NXM T;  3MZK B;  1JOW A;  3N2K E;  3KV5 A;  3AA6 B;  4YOZ A;  1MMD A;  2LM9 A;  3NZP A;  2K9A A;  1H1Q B;  2ZMA A;  3ZPO A;  5AQI B;  2A3D A;  4GK5 E;  3QYB A;  3RRW A;  3N9L A;  4CI3 B;  5LHI B;  3UUM A;  2DHR A;  2UUE B;  4YFS A;  1JSU B;  2X66 A;  4PFP A;  2BPM B;  2JIW A;  4I3Z B;  2WPA B;  2X0Y A;  1ZP2 A;  3DJB A;  4TV8 E;  3A8G B;  2PMI B;  5AQN B;  3TW6 A;  4CFM B;  2B1E A;  3KHI A;  2H7V C;  1OL2 B;  4AKG A;  2W2H A;  4LFB T;  2LM2 A;  1NEN A;  5EZY E;  2UZD B;  3FZF B;  1U5P A;  2UZB B;  2LLY A;  2C5X B;  3B13 A;  2E9X D;  5AQT B;  3MY5 B;  4X66 T;  2WMB B;  5DJQ C;  2ZZD B;  2I59 A;  4YHJ A;  4YOO A;  3RGF B;  4P0A A;  2IC6 A;  2M67 A;  2KIN B;  4E7Z A;  2BKN A;  2G77 A;  1BR2 A;  1F5Q B;  2KLQ A;  2CCH B;  3Q2M A;  4MFD A;  2UU9 T;  1YKE B;  1UX4 A;  2XZE A;  1KNR A;  4ISS A;  3Q5W A;  3ONX A;  3AEG A;  4H63 H;  2V5D A;  2HPJ A;  3AAI A;  3POM A;  4A97 A;  4N78 D;  3MJX A;  3HR0 A;  3ZMS B;  5CA0 E;  5EK3 A;  2X67 A;  3RQW A;  2NTY A;  4IDQ A;  5CGM A;  1URC B;  4BY7 X;  4OYK A;  4QWN B;  4G63 A;  4UEL A;  3PUX F;  4ZGJ B;  4EEB A;  4F6S B;  2BG9 B;  4DV0 T;  5LMN T;  1OED B;  2LOP A;  3EOC B;  1YQ3 A;  2QDJ A;  2OA5 A;  1OKV B;  2K3W A;  2X9H A;  3ETV A;  2WP9 A;  2LW4 A;  3AA7 B;  4WBO A;  2WFY B;  4AQF A;  2E9X B;  4DV2 T;  2XHE B;  2Y8D A;  3EI0 A;  3NRY A;  3SS1 A;  1MIY A;  4Y72 B;  3TKL B;  4ZGE B;  4A98 A;  3ZC0 A;  2KSR A;  4EXT A;  3M65 A;  3UQ4 A;  2VVN A;  2EHO D;  2VKD A;  5JR9 C;  4DVD A;  4EC9 B;  2X9W A;  5AQG B;  2WWU A;  1GY3 B;  4BJM A;  1QUU A;  3WVD B;  1J5W A;  2CXF A;  3ZYL A;  4O2A E;  4IDZ A;  3RKO A;  3KV4 A;  3N9P A;  1Z0P A;  4DR3 T;  4ERR A;  2UZE B;  4OHF A;  1GQE A;  2W9Z A;  4TV9 E;  2CYZ B;  3M3Z B;  2WU2 A;  4H9N C;  1NEK A;  3ONJ A;  2NWB A;  3HI2 A;  1J5E T;  1QMZ B;  2KMG A;  2L3L A;  2MYS A;  4JX5 A;  5L3E B;  2ZPH B;  1H24 B;  3FZK B;  3L39 A;  3UU6 A;  4UVC B;  3BQL A;  3QZ5 B;  2E9X A;  3RIF A;  4HFH A;  3J9X 1;  2W0G A;  2LSY A;  2JPF A;  4K0U A;  5J2U E;  1O9K A;  2WXV B;  2PK9 B;  2YEV C;  4KMC A;  4TX5 A;  3LK4 2;  4IE0 A;  4FI5 A;  4COF A;  3O4X E;  5E0O A;  2VUR A;  4EOI B;  4TWD A;  3KV9 A;  4YOS A;  2XPK A;  3N9M A;  4P0B A;  2B9R A;  1D1B A;  1ENW A;  3AXJ B;  3FXE B;  3WAJ A;  3CK6 A;  5LG4 A;  3V5S A;  2J62 A;  3UU3 A;  1UGO A;  2V26 A;  4I55 E;  3ABV A;  3L3P A;  4IE6 A;  5HAX A;  3SOL A;  1FIO A;  4HFE A;  3HL6 A;  3BG9 A;  4CFX B;  4TWH A;  4Z8X A;  2MAW A;  1EZ3 A;  4U74 A;  1G8X A;  4HFI A;  5FY7 A;  1T8B A;  2BKP A;  2X1N B;  2YKS A;  5CJ5 A;  2IW6 B;  1VCT A;  1XDP A;  4OYJ A;  1GUX B;  1XMO T;  3KDS E;  3QWL A;  5TAO A;  5LQF B;  5EK4 A;  3AE8 A;  2V1D B;  3OBV E;  4HLQ A;  2WCA A;  5AQQ B;  1E7P A;  5LXT E;  4HFB A;  4DV5 T;  4HNV A;  3I0O A;  4BCN D;  5L47 A;  4DV3 T;  2CZ6 B;  2NW9 A;  3PU3 A;  2XAF B;  4EB6 E;  3ZEF B;  3WI3 A;  5L3F B;  4LOC A;  3QUJ A;  2WU5 A;  3E0Z A;  4QH5 A;  3BQI A;  4DV1 T;  3SWH A;  4CQI A;  2Q9Q C;  4AXP A;  2DLR A;  2RA1 A;  2K24 A;  3UFG A;  3CML A;  5DQW A;  5IDP B;  3X1D A;  2LT3 A;  1WR6 A;  4JI2 T;  5LA6 E;  4KUM B;  4CXA B;  3H37 A;  4U2Z A;  4F7L B;  4KRD B;  3X25 B;  2XTL A;  4E7S A;  2VQF T;  5FY1 A;  2LSG A;  1H7C A;  4MHC A;  2X0L B;  4CZZ B;  3ZMU B;  4A5X A;  2C6T B;  1IZN B;  4KP3 C;  2JJ9 A;  3JAD A;  2IVX A;  4YXD A;  3O1H A;  4AKL A;  2L9Q A;  3OYZ A;  2UUC T;  4BY1 X;  1T72 A;  4AI6 A;  4KI0 F;  4YLH A;  3PUA A;  3AE5 A;  2ZCF B;  1ZEE A;  3MY1 B;  2W96 A;  1HX1 B;  5JDN A;  4B3S T;  3PU8 A;  3JAF A;  3AE6 A;  5HEH A;  1D0Z A;  1H1P B;  3N5L A;  2ZM6 T;  2D0Q B;  5LBM A;  4X20 E;  3OYX A;  2CZ1 B;  5HBJ B;  5LGT B;  2KR6 A;  4KRC B;  4YTM A;  2X9Y A;  2J47 A;  4G6L B;  4PK4 A;  2WB5 A;  4YC3 B;  2DXC B;  4TWF A;  3BK9 A;  3ETU A;  3NRX A;  3UUL A;  3R84 B;  4GYS A;  4ROD A;  3Q5D A;  3H3M A;  2IUB A;  3RX6 A;  4TNW A;  1XWM A;  4XAX B;  4M6V A;  5L2L A;  4QXB B;  2E5L T;  3F31 A;  4DO0 A;  5BNJ B;  5C3J A;  1KF6 A;  3T1Y T;  3I9W A;  1SHZ C;  2ZM8 A;  3P50 A;  4ZI3 D;  5HNB B;  3X28 B;  4B6X A;  3OJA A;  2CE7 A;  4JEU B;  2DD5 B;  2F4V T;  2UUA T;  4EYY R;  3F5X B;  4KX6 A;  2C5O B;  3UUB A;  2C5V B;  3KFW X;  1T7S A;  3B57 A;  4BBS M;  3BQK A;  2DWK A;  1GUX A;  2LRL A;  2FJB A;  5LP6 E;  2VL8 A;  3O0G D;  1FMW A;  1AHJ B;  2NOX A;  2HHH T;  4FJO A;  4IL9 A;  2XM1 A;  3QC9 A;  2PFV A;  4U33 A;  2G9X B;  1FKM A;  3X24 B;  3I1A A;  1IAP A;  2V6Y A;  4AKH A;  1X79 A;  1S35 A;  2G0U A;  4AIU A;  5AFU L;  5LCY A;  3QHR B;  3P4P A;  3IEE A;  5AQP B;  2BS4 A;  2IC9 A;  2PTF A;  2WDQ A;  4AKR B;  3PUZ F;  2BKO A;  2BZB A;  1WLX A;  1I94 T;  2LRK A;  4NUV A;  3C50 A;  2MTQ A;  3TNH B;  3AEE A;  1B7T A;  3NZQ A;  2ZPG B;  3AA0 B;  4DBQ A;  5LHG B;  3ZJ1 A;  4HFV A;  4P09 A;  4WNK A;  1D1C A;  2JMH A;  5AQV B;  4IGU A;  4DID B;  2WM9 A;  4H63 V;  5EK2 A;  3D0T A;  2UXC T;  4HL4 A;  4JI4 T;  3M03 A;  3ZT5 A;  4LF6 T;  2H89 A;  2IHR 1;  4BCN B;  4ZI3 C;  3LG7 A;  2FUP A;  4B3R T;  5AQH B;  2W4X A;  3LJC A;  4JUY A;  5KXJ A;  3NKZ A;  4LF4 T;  1LVF A;  2WMN A;  1WR0 A;  2WMA B;  4BCQ B;  2E9X C;  2DPP B;  2OV9 A;  3WAK A;  3HKD E;  4ADZ A;  4EYU A;  4HWH A;  4TTH A;  3EVY A;  1ZV4 X;  2M6B A;  3CQG B;  5LGN B;  4DMW A;  4UF0 B;  3UUX B;  4WW0 A;  1D0X A;  2CZ0 B;  3VRA A;  3ZMT B;  4UN0 A;  1H26 B;  5HXE A;  3QB5 K;  4ILA A;  4UF0 A;  2W67 A;  2JQ9 A;  3RIA A;  4ASK A;  2C5K T;  5BR8 T;  1H1R B;  2N1G A;  3AE1 A;  4IIJ E;  3IF8 B;  3W15 B;  5HQ0 B;  2CHO A;  2I40 B;  2YU1 A;  3NVO A;  3I9Y A;  3GN5 A;  3ANW A;  1UGS B;  2XQY A;  2DXB B;  1NWM X;  3P7I A;  4GYR A;  1HF8 A;  1OED C;  4AQF C;  4YY3 T;  1MMG A;  4DMV A;  3PUV F;  2BG9 C;  3KBT A;  2XQ7 A;  4TZ4 C;  3TN8 B;  2P9B A;  2X9X A;  1T98 A;  4DV7 T;  1UGR B;  2CWY A;  2W62 A;  2KWH A;  4TN7 B;  4V1A v;  2V7J A;  2J1D G;  2X51 A;  4CI2 B;  5DAB A;  2IIU A;  3P8C D;  2X0H A;  2YK0 A;  3VR9 A;  2CHN A;  2FBW A;  1H27 B;  3C4X A;  5CB4 E;  1FJG T;  2A2F X;  3LBX B;  3AB3 B;  3ZCI A;  3L8R A;  3PUW F;  1HNX T;  2UUB T;  4YTP A;  1OIY B;  3LSV A;  5JR9 A;  1OWA A;  1KNZ A;  2BKZ B;  1KNP A;  4PJL A;  2H88 A;  5ABF A;  2BVL A;  3PUQ A;  5LJN A;  4EV6 A;  2JGZ B;  2OLT A;  2Q9Q A;  3S4U A;  4ZXL A;  4BBR M;  4Z6Y A;  5HBH B;  4MFE A;  2IN3 A;  3A8L B;  2KMF A;  3BG3 A;  4JV5 T;  2XQ3 A;  3K1S A;  4DV4 T;  2D0U A;  1VYW B;  3N9O A;  4DND A;  3X26 B;  3HKC E;  4EED A;  1JNR A;  2CCQ A;  3A8O B;  3EDV A;  3NBX X;  1LVK A;  3G33 B;  3BLR B;  3P4W A;  4I43 B;  4Q25 A;  4OR5 B;  5I5Z B;  4LF8 T;  4QXH B;  3AVS A;  4G2A A;  2C4G B;  4H9R C;  1IJ5 A;  4BCM B;  2ZLY A;  2JMK A;  5LOV E;  4MAL A;  2LOS A;  3AA1 B;  3AAA B;  3AED A;  3UUN A;  2NP9 A;  4C91 A;  2A9U A;  2PG8 A;  3AE9 A;  3C4Z A;  4DR4 T;  4UIG A;  2WDR A;  1WFD A;  4X1Y E;  3CWZ B;  3BG5 A;  1W0A A;  3QB5 A;  4QX8 B;  2Q9Q B;  1KXU A;  1ZKE A;  2ACZ A;  3PJA A;  2LHR A;  4U3C A;  2NW8 A;  2XQ9 A;  2C5I T;  2LEH A;  4MFR A;  4U7I A;  4CFW B;  4YJ3 E;  3E22 E;  4ROE A;  1NAF A;  2A72 A;  2MBG A;  3TLT A;  1VIN A;  2DWG A;  3KV6 A;  4EOQ B;  4JX4 A;  4BCG B;  4ZS2 A;  4X1I E;  5FMN A;  2ZPI B;  2ODU A;  2UXD T;  5J0Z A;  2YDR A;  3R6N A;  4OFZ A;  1YKH B;  2XAJ B;  3A7M A;  4LFC T;  4AKI A;  1OED A;  2EHO A;  2LSI A;  4O4J E;  2XUE A;  1MMN A;  3CPZ A;  3LK2 B;  3AE7 A;  2E5V A;  3BHU B;  3RRC A;  4LF7 T;  3FXD B;  2XQ4 A;  3P4R A;  3ZLI A;  2YDS A;  2Y6X A;  4ELL A;  1UUR A;  2XQA A;  1XZY A;  2YIN A;  3RIU C;  3MK7 C;  3HA4 A;  2VKO A;  1HG5 A;  4UXN B;  2X68 A;  4EOK B;  1XDO A;  4DR1 T;  3E08 A;  3RC8 A;  2LKG A;  2Q9Q D;  4PK5 A;  2WIP B;  4ROC A;  4CXW A;  5JDL A;  1N36 T;  3EHZ A;  1W9R A;  2QQ8 A;  2CA5 A;  4BCQ D;  4IST A;  3OVU A;  3TLW A;  2PBI A;  2I0M A;  2QA7 A;  4ILC A;  3RH3 A;  1H25 B;  1YQ4 A;  4ZS3 A;  1HX8 A;  5CYI B;  4HNU A;  1IBK T;  5FXX A;  4HWF A;  4A56 A;  2F2C A;  4HE8 A;  5ACB A;  4EIW A;  3RI5 A;  5HXS A;  4GOU A;  2AE9 A;  4CFU B;  1TD6 A;  4J2C A;  5IWA T;  4CN1 A;  4LMK A;  3PUG A;  4I0U A;  4BXX X;  4QHO A;  4EOO B;  4YSY A;  5ABH A;  3N2G E;  3JC6 C;  1LKX A;  4HWD A;  2VWA A;  3N9N A;  5JRC A;  4OK0 A;  3VKG A;  3HKE E;  1XNQ T;  2DNX A;  4UV8 B;  4PFO A;  2VQE T;  2YOE A;  1KFY A;  4BCK B;  3AEB A;  2ODV A;  4OX9 T;  2FJE A;  1G3N C;  5CFB A;  3VKH A;  2QFZ A;  4IDP A;  3CIR A;  4PJM A;  2KXP B;  1KEY A;  3EDU A;  5JDF A;  5JDH A;  3JC6 D;  4JI0 T;  2WAU A;  3LQ5 B;  5AQU B;  1IRE B;  1S94 A;  4YHH T;  4DBR A;  1US7 B;  2ZPE B;  3ZC1 A;  3RYF E;  2EHO B;  4CFU D;  1N33 T;  4QX7 B;  1E1H B;  1AIS B;  4LMJ A;  4Z91 A;  5ABE A;  3BLQ B;  3PV0 F;  3RYI E;  3AAE B;  5LMK B;  3AXJ A;  4BCP B;  4JX6 A;  3CX8 B;  3DOG B;  3BLH B;  4ILB A;  5FXZ A;  5FVK A;  2XQ8 A;  4DUY T;  2ZPB B;  3UU4 A;  3HB9 A;  4JI6 T;  3FZL B;  2W66 A;  5F5W A;  4IL4 A;  5HXH A;  5HCJ A;  4MIM A;  3QK6 A;  4YT0 A;  1WYC A;  5LB7 B;  2CJM B;  2HN2 A;  3PUS A;  3PJA J;  3RGL A;  5HBE B;  2LSK A;  4JLE A;  4EOS B;  3OKQ A;  5JTG A;  2UXX B;  2BS2 A;  4JBW F;  4IMY B;  1JNZ A;  1V9D A;  5JDG A;  4CXY A;  1MMA A;  2E8I A;  4AQY T;  5CEI B;  4UVA B;  1BU2 A;  3UU5 A;  4X65 T;  1HNZ T;  4U7Y A;  2WBL A;  3UFE A;  2HPL A;  2C0S A;  2XSB A;  2WSS V;  4C90 A;  3WVE B;  2ZPF B;  5FL1 A;  1L0V A;  2DL1 A;  2JRK A;  4ANJ A;  5LJM A;  5F3J A;  3CKD A;  2D2S A;  2MPK A;  3ONL C;  3AVR A;  2NTX A;  1OED E;  2WZH A;  3PE0 A;  1D1A A;  3ZMV B;  4TNV A;  2DCF A;  5ABG A;  2UXN B;  1HS7 A;  4HFC A;  3RQU A;  3ZCJ A;  4I4T E;  3IBP A;  2CPT A;  3ZT6 A;  1UX5 A;  1H28 B;  2BDE A;  3PUR A;  4LML A;  5JQG E;  2C5J A;  2E2A A;  1IJ6 A;  2Z6E A;  4IRE A;  3N9Q A;  4EGW A;  5IUX A;  5L3G B;  4I50 E;  2CMR A;  3AEF A;  2CXD A;  2NR4 A;  1IBL T;  1MND A;  1Y01 A;  3J7Y q;  4CFN B;  2W00 A;  3AE4 A;  1UCU A;  3A5X A;  2CLY B;  4KHP T;  3HHT B;  3IA3 A;  2KWI B;  1O9K B;  2K48 A;  3A8Y C;  4F7S B;  2QF7 A;  5JRC B;  1E9H B;  3QHW B;  1UNH D;  2CEA A;  4P1N A;  3V5U A;  4LFA T;  2L8K A;  3F2E A;  1ZHC A;  4O8S A;  2N2N A;  2EUF A;  5HEO A;  1FEW A;  2H7O A;  4LF5 T;  4O4H E;  3K3O A;  1J1J A;  1KK7 A;  3K3Q C;  5HWX A;  1W98 B;  4CXX A;  4UEM A;  3TLV A;  1ZOY A;  1HNW T;  4AQG A;  1Z8U A;  3LK3 B;  1E2A A;  5HEJ A;  3QYE A;  2JQQ A;  3RC3 A;  4OGR B;  1MIW A;  4ZI7 E;  4HTE A;  4IDO A;  4BCJ B;  1OL1 B;  3UQ7 A;  5L3C B;  1HCI A;  3AE2 A;  2I6H A;  3U3I A;  4ELJ A;  4XBF B;  5HEU A;  2BBJ A;  3JCF A;  2LHN A;  4TUY E;  1AD6 A;  5H6R B;  4X1K E;  4K0K T;  3HKB E;  3PO3 S;  4H9Q C;  1DU2 A;  2FJA A;  2BVM A;  1YW0 A;  5AQK B;  2XAQ B;  3RKG A;  4IE7 A;  4BAY B;  2IW8 B;  4QKN A;  4FX3 B;  3ZN1 B;  3CX7 B;  2H3R A;  4M1P A;  2YDQ A;  4EZH A;  3QZ9 B;  4EAH A;  3K3N A;  4UVB B;  5LGU B;  1U4Q A;  2V6X A;  4F7J B;  1D3U B;  4QSH A;  4PJN A;  4X5T A;  3MI9 B;  4MBQ A;  1XO2 A;  4PK6 A;  5FP3 A;  1N32 T;  5EJC A;  4NUU A;  5KMG P;  1GH6 B;  4ZI2 C;  3F57 A;  4QH1 A;  3MKD A;  2CLY C;  3SFE A;  4O4I E;  2ACX A;  3OTO T;  4OB3 B;  3EJ1 B;  2XAS B;  3VRB A;  3QNU A;  2VL0 A;  2QRX A; 
#chains in the Genus database with same CATH homology
 3N5L A;  2YU2 A;  3GA8 A;  2V7K A;  4O2B E;  2CXL A;  3RC8 A;  5C8Y E;  4H9O C;  5LBM A;  2Q9Q D;  4X20 E;  4PK5 A;  4EZ4 A;  3OYX A;  5LGT B;  4CXW A;  5JDL A;  3VU7 H;  2X9Y A;  4PK4 A;  1OXZ A;  2D5U A;  4YJ2 E;  1HTJ F;  2CA5 A;  2V7I A;  4IE5 A;  4XZC A;  3GN5 B;  4IST A;  5HYA A;  2PBI A;  5FY0 A;  3BK9 A;  4KBM B;  2QA7 A;  1YD8 G;  3ETU A;  1D0Y A;  3NRX A;  3UUL A;  3RH3 A;  5HXR A;  4ZS3 A;  2XAH B;  1HX8 A;  3R84 B;  2IAK A;  5KDM C;  4GYS A;  5FXX A;  3PTR B;  3RYC E;  4A56 A;  1G73 A;  4HE8 A;  1WYB A;  3MZK B;  3RX6 A;  3N2K E;  2VK9 A;  4EIW A;  4XAX B;  3KV5 A;  3AA6 B;  5L2L A;  4QXB B;  2LE8 A;  1MMD A;  2HH7 A;  5HXS A;  2LM9 A;  4GOU A;  3RPU A;  3F31 A;  4DO0 A;  3NZP A;  3CX6 B;  4IE4 A;  2K9A A;  5ADX L;  4ZHQ E;  2ZMA A;  3ZPO A;  3I9W A;  1SHZ C;  3U78 A;  4J2C A;  2ZM8 A;  2A3D A;  5KX5 E;  4GK5 E;  4ZI3 D;  4B6X A;  2V7L A;  3RRW A;  3N9L A;  4CI3 B;  3OJA A;  2CE7 A;  3PUG A;  4JEU B;  5LHI B;  3UUM A;  2DHR A;  4QHO A;  4YFS A;  2X66 A;  3GMI A;  4PFP A;  3N2G E;  3JC6 C;  5L3B B;  3KIN B;  4EYY R;  1LKX A;  2VWA A;  3N9N A;  5JRC A;  4OK0 A;  5LYJ E;  3HKE E;  3VKG A;  3DJB A;  2DNX A;  4TV8 E;  3FHN A;  4UV8 B;  3KFW X;  4PFO A;  2CWO A;  3B57 A;  2B1E A;  3BQK A;  2H7V C;  2ODV A;  4IHJ E;  2DWK A;  4AKG A;  2LJL A;  5EZY E;  3VKH A;  5LP6 E;  2VL8 A;  4PJM A;  1U5P A;  2KXP B;  1FMW A;  3Q5X A;  3ZJ2 A;  3B13 A;  2E9X D;  3EDU A;  5HWY A;  5JDF A;  2NOX A;  5JDH A;  4FJO A;  5DJQ C;  3QC9 A;  2PFV A;  3JC6 D;  2I59 A;  4YHJ A;  2WAU A;  3I1A A;  1IAP A;  1X79 A;  4AKH A;  1S35 A;  2SPC A;  2G0U A;  1S94 A;  2W63 A;  2IC6 A;  2M67 A;  2KIN B;  5AFU L;  4E7Z A;  4P0A A;  2NW7 A;  5LCY A;  1BR2 A;  4DBR A;  2KLQ A;  1US7 B;  4MLK A;  4ZI2 D;  3IEE A;  5FXV A;  3Q2M A;  3ZC1 A;  2IC9 A;  3RYF E;  2EHO B;  1CUN A;  2V7M A;  1YKE B;  1UX4 A;  2XAG B;  4AKR B;  4GK0 E;  4ISS A;  2VAS A;  3Q5W A;  1LRZ A;  3ONX A;  4QX7 B;  4PJJ A;  1E1H B;  4H63 H;  2HPJ A;  3CQC B;  2BZB A;  3AAI A;  4O4L E;  2GK9 A;  5JR9 B;  1WLX A;  3RYI E;  3AAE B;  3C50 A;  4N78 D;  4NUV A;  2MTQ A;  3HR0 A;  3CVR A;  3MJX A;  1B7T A;  3CX8 B;  3AA0 B;  3NZQ A;  4DBQ A;  5LHG B;  3ZJ1 A;  3ZMS B;  5CA0 E;  4HFV A;  5EK3 A;  4P09 A;  4WNK A;  2X67 A;  1D1C A;  2NTY A;  2JMH A;  4IGU A;  3O1J A;  3C98 B;  5FXZ A;  4OYK A;  4QWN B;  2WM9 A;  4H63 V;  4QXC B;  5EK2 A;  3D0T A;  4G63 A;  4UEL A;  1O3X A;  2IW5 B;  4ZI3 C;  3LG7 A;  5HXH A;  3ZYM A;  3LJC A;  1WRD A;  2LOP A;  3QK6 A;  4JUY A;  1LVF A;  3MXZ A;  2OA5 A;  2WMN A;  1WYC A;  3PUS A;  3I0Q A;  5J2T E;  2X9H A;  3ETV A;  1BR4 A;  2E9X C;  2LSK A;  4JLE A;  3AA7 B;  3WAK A;  4WBO A;  3KVA A;  3OKQ A;  3HKD E;  4ADZ A;  4EYU A;  4PNI A;  2UXX B;  4AQF A;  2E9X B;  2XHE B;  2Y8D A;  3NRY A;  3SS1 A;  1V9D A;  1MIY A;  3MAC A;  5JDG A;  3TKL B;  4CXY A;  1BR0 A;  3EVY A;  1ZV4 X;  1MMA A;  2E8I A;  3CQG B;  2K5B B;  1VOM A;  3ZC0 A;  5LGN B;  4DMW A;  4UF0 B;  2N9D A;  3M65 A;  3UUX B;  4EXT A;  4WW0 A;  1MIV A;  4UVA B;  1D0X A;  2EHO D;  2VKD A;  4GIW A;  2MOZ A;  4H9P C;  3ZMT B;  5JR9 C;  4H9S E;  5CA1 E;  5HXE A;  2WBL A;  3UFE A;  2HPL A;  3O9X A;  5LBQ B;  4DVD A;  2C0S A;  4UF0 A;  2X9W A;  3C51 A;  2WWU A;  5JH7 E;  4ASK A;  4BJM A;  2WSS V;  2C5K T;  5ETW A;  1QUU A;  3FBZ A;  2N1G A;  4IIJ E;  3GWH A;  2RP4 A;  3IF8 B;  3W15 B;  4C90 A;  3L09 A;  2YU1 A;  2CXF A;  3GN5 A;  3I9Y A;  3ZYL A;  4O2A E;  3ANW A;  2KT9 A;  4IDZ A;  3RKO A;  2XQY A;  3KV4 A;  3N9P A;  5LJM A;  2JRK A;  4ANJ A;  5F3J A;  3CKD A;  2D2S A;  2PJQ A;  3AVR A;  3RYH E;  1Z0P A;  1NWM X;  2NTX A;  3P7I A;  5A1L A;  4GYR A;  4ERR A;  1HF8 A;  4AQF C;  3PE0 A;  1MMG A;  3EUH A;  4OHF A;  1D1A A;  3ZMV B;  4DMV A;  2DCF A;  2UXN B;  1HS7 A;  2ZM2 A;  4TV9 E;  3ZCJ A;  4I4T E;  3IBP A;  3KBT A;  1UX5 A;  4TZ4 C;  2BDE A;  3N2O A;  2P9B A;  3PUR A;  4H9N C;  4HN9 A;  2X9X A;  1T98 A;  5JQG E;  2C5J A;  2NWB A;  3HI2 A;  2CWY A;  1FMV A;  2W62 A;  2L3L A;  1IJ6 A;  2Z6E A;  2KWH A;  2MYS A;  3N9Q A;  4TN7 B;  4V1A v;  5L3E B;  5L3G B;  4I50 E;  2V7J A;  2CMR A;  4UVC B;  3Q9D A;  3BQL A;  2E9X A;  2CXD A;  4HGA A;  3O1I A;  1MND A;  2J1D G;  2X51 A;  4CI2 B;  3CQX C;  3J9X 1;  2W0G A;  2LSY A;  2JPF A;  3DP7 A;  3LBX A;  4K0U A;  2W00 A;  4L5G A;  5DAB A;  3J7Y q;  3P8C D;  5J2U E;  1UCU A;  3A5X A;  1MNE A;  2YK0 A;  1HG2 A;  2YEV C;  2D0T A;  4KMC A;  4TX5 A;  3LK4 2;  3C4X A;  4FI5 A;  4IE0 A;  2CLY B;  5CB4 E;  2A2F X;  3LBX B;  1AJ3 A;  3C4W A;  3O4X E;  3AB3 B;  3ZCI A;  4EOZ B;  4HEA A;  4F6R C;  5E0O A;  3KBU A;  5GON E;  3KV9 A;  3N9M A;  2KWI B;  2K48 A;  4P0B A;  3LFM A;  3MA9 A;  5JRC B;  5IYZ E;  5HXC A;  5JR9 A;  2CEA A;  2VKH A;  3V5U A;  1D1B A;  1OWA A;  1KNZ A;  2L8K A;  4PJL A;  3F2E A;  1ZHC A;  2BVL A;  2N2N A;  4O8S A;  5M4Y A;  1FEW A;  3PUQ A;  2H7O A;  1QSD A;  3C64 A;  3FXE B;  5LJN A;  4O4H E;  3WAJ A;  3K3O A;  5LG4 A;  3V5S A;  2Q9Q A;  3S4U A;  2V26 A;  4I55 E;  5FNV E;  2W61 A;  1KK7 A;  3L3P A;  4IE6 A;  5HAX A;  3K3Q C;  3UT5 E;  5HWX A;  3SOL A;  1FIO A;  2KMF A;  3HL6 A;  4CXX A;  5JDQ A;  4UEM A;  3UTK A;  4PAG A;  2D0U A;  3N9O A;  4Z8X A;  3ZMZ B;  4BJN A;  4DND A;  3SRZ A;  1EZ3 A;  3HKC E;  4U74 A;  4AQG A;  2CCQ A;  1G8X A;  3EDV A;  3NBX X;  5FY7 A;  4UV9 B;  1LVK A;  2ES0 A;  3LK3 B;  3VHL A;  3FB2 A;  2VB6 A;  4I43 B;  2JQQ A;  3RC3 A;  4QXH B;  3AVS A;  1MIW A;  4ZI7 E;  4HTE A;  4OYJ A;  3K8P C;  4G2A A;  3ESL A;  5L3C B;  1HFA A;  3KDS E;  5LHH B;  1BR1 A;  5TAO A;  5EK4 A;  4H9R C;  2V1D B;  3OBV E;  1IJ5 A;  2ZLY A;  1HCI A;  2JMK A;  4WBN E;  5LOV E;  5LXT E;  5IHY A;  5L3D B;  4MAL A;  3ZN0 B;  2LOS A;  4L0R A;  3AA1 B;  3AAA B;  5BMV E;  3I0O A;  3U3I A;  3ZYK A;  4CI1 B;  3UUN A;  2NP9 A;  2NW9 A;  4XBF B;  4C91 A;  2PG8 A;  3T8O A;  3C4Z A;  3PU3 A;  2KND A;  4UIG A;  2XAF B;  4EB6 E;  1Y64 B;  2LHN A;  4TUY E;  2Y48 B;  2CM0 A;  5H6R B;  3ZEF B;  3WI3 A;  4X1K E;  4X1Y E;  3HKB E;  5L3F B;  3CWZ B;  5J1G A;  3ANW B;  3QUJ A;  3E0Z A;  2DI4 A;  4QX8 B;  5DQV A;  3BQI A;  2Q9Q B;  4H9Q C;  3FBL A;  1ZKE A;  2BVM A;  2LHR A;  2NW8 A;  3SWH A;  1YW0 A;  2C5I T;  2LEH A;  2LSJ A;  4CQI A;  4MFR A;  2Q9Q C;  2XAQ B;  4IE7 A;  4AXP A;  4YJ3 E;  2DLR A;  4L9I A;  2RA1 A;  3E22 E;  2K24 A;  1NAF A;  3DTO A;  3CML A;  5DQW A;  5H6Q B;  4BAY B;  2A72 A;  2MBG A;  2VKJ A;  1VRB A;  2LT3 A;  1WR6 A;  5LA6 E;  4KUM B;  4QKN A;  3ZN1 B;  3CX7 B;  2H3R A;  4ZOL E;  2DWG A;  3H37 A;  4M1P A;  3KV6 A;  4EZH A;  2XTL A;  3PDY A;  4ZS2 A;  4EAH A;  4X1I E;  5FMN A;  3K3N A;  2WMO A;  5JVD E;  2ODU A;  4UVB B;  4BA9 A;  4E7S A;  5JDM A;  5FY1 A;  3IHR A;  4HKA A;  2ZM0 A;  3R6N A;  5JRE A;  4OFZ A;  1YKH B;  1SA0 E;  2XAJ B;  5LGU B;  1U4Q A;  2LSG A;  4AKI A;  4PJN A;  5LNK A;  1H7C A;  2EHO A;  4MHC A;  4JEH B;  4U72 A;  4MBQ A;  2LSI A;  4PW8 A;  2X0L B;  4CZZ B;  3ZMU B;  4O4J E;  2XUE A;  1MMN A;  3CPZ A;  4PK6 A;  1IZN B;  5FP3 A;  4KP3 C;  2JJ9 A;  3H3A A;  3LK2 B;  3KVB A;  4NUU A;  3O1H A;  3RRC A;  4ILU A;  5KMG P;  4AKL A;  2L9Q A;  3OYZ A;  3FXD B;  4ZI2 C;  3ZLI A;  3F57 A;  2Y6X A;  2CLY C;  3MKD A;  5F8P A;  4AI6 A;  4O4I E;  4YLH A;  2ACX A;  2EHO C;  3PUA A;  1ZEE A;  2KZ7 B;  2YIN A;  3MK7 C;  3HA4 A;  2VKO A;  1HG5 A;  2QGS A;  2XAS B;  4UXN B;  2X68 A;  5FYM A;  5JDN A;  3PU8 A;  5FXW A;  3E08 A;  1D0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...