3B57A

Crystal structure of the lin1889 protein (q92an1) from listeria innocua. northeast structural consortium target lkr65
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
180
Chain Sequence
MNKEEIILSAKNWMHSHFHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDQEATKTLINWMETKEIPSELIKKIIRIIQSVSALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNPKNTTLQHFYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Lin1889 protein
publication title Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua.
rcsb
source organism Listeria innocua clip11262
total genus 61
structure length 180
sequence length 203
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3b57A01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b57A02
5IHYA 5DQWA 3DJBA 2PJQA 5DQVA 2QGSA 3B57A 3DTOA
chains in the Genus database with same CATH superfamily
1MNDA 2IAKA 4BXXX 4HWHA 2G9XB 4B3TT 4LFAT 1UX5A 1J5ET 5LOVE 4GKJT 5HXEA 4HE8A 2M6BA 4IDQA 4KP3C 3QZ9B 4H9PC 4CRLB 4O8SA 3GMIA 3I1AA 4EZ4A 4F70B 2LSJA 4LF5T 2IW9B 4MLKA 3DDPB 2D5UA 1T98A 4IT4A 4PJLA 3C98B 4U3CA 4OYKA 4B3RT 2V26A 1ENWA 3BLQB 5FVKA 4U2ZA 1JNZA 3ZT6A 1JSTB 4HEAA 3MACA 3LJCA 3CX7B 2FUPA 5FY7A 4NUVA 1PKDB 2UXDT 2I53A 1IZNB 3AE8A 3P4PA 2WZIA 4PK5A 3HKCE 5F8PA 3AEEA 4PAGA 5FMNA 3RLFF 4X66T 4A97A 3I9WA 5L4EA 2HPLA 3DTOA 2C5OB 3FZFB 2HN2A 2KXPB 2UXXB 5JQGE 4UN0A 4U7IA 4YSXA 5J1GA 5HXRA 3Q2MA 4H9SE 1VINA 2BBJA 1UCUA 1V9DA 1OGUB 1ZKEA 1HNXT 4GK0E 2I40B 4HNUA 5JDFA 4HNTA 2W9FA 1P5EB 2X68A 4PW8A 5JREA 2BZBA 2V7JA 4DV0T 4KI0F 4WNKA 3PUQA 4NXMT 4I0UA 5L3DB 5HCMA 3ETVA 4DV7T 4DR4T 3AVRA 2WXVB 3GN5B 1UGQB 1CUNA 3MK7C 2D2SA 2FJEA 4JI4T 5DQVA 4YOSA 4ELLA 4HFBA 2DXCB 2CXLA 3A5XA 4NSTB 4E7SA 4IE0A 2I59A 4ZGDB 2WWVA 2UXCT 2ZPHB 2W2UA 3AXJA 5JH7E 2G0UA 2LEHA 4UIGA 1UNHD 3HZJA 2LKHA 5IUXA 4NIQA 4U2YA 2D0QB 3LK2B 5FVLA 1XNQT 4O4JE 4C90A 3BHUB 2X67A 5ABEA 4U74A 4LFCT 3Q5DA 4ADZA 2YEVC 2WDVA 4CXYA 4CFMB 1IJ6A 2X9WA 3SFEA 2C5VB 4TWFA 3P7IA 4TUYE 5AQVB 2EHOC 1UNLD 4EIWA 2NR4A 1M62A 4HFHA 2YU2A 2XTLA 3RYHE 5AQSB 5ACBA 3BQIA 2ZM2A 3UFEA 2VVSA 2CWOA 2PFVA 2XJ7A 3T1YT 2WWUA 4ILAA 4JEHB 2D9DA 5BNJB 2HH7A 4Z6YA 2PK2A 4YHHT 3A8LB 1KNZA 5LYJE 4K0UA 4EAHA 5HXSA 2V5DA 1H1RB 2LW4A 5HWXA 4BY7X 4EOMB 4C91A 4LMKA 5JR9B 4UEMA 1ZP0A 3JAFA 5ICPB 3PE0A 2W62A 2WQYA 1N36T 3I0OA 2W99A 5IDNB 3VRAA 3K7AM 3P4RA 3LDQB 4EGWA 2X0LB 1YQ3A 4NPPA 5LB7B 4YFSA 5AQJB 1XDOA 1FKMA 1GQEA 4BCMB 2FBWA 3AE3A 2BKPA 3ZC0A 4DR3T 4IDOA 1ZEEA 1LVKA 4CN1A 2CLYC 4YLHA 3P50A 3ZMZB 3Q9DA 2CA5A 1NEKA 1J5WA 3ZMSB 1H1PB 3VYGB 4L5GA 1U4QA 2ZM0A 3TKLB 3P4SA 2UUBT 3EJ1B 4HFCA 4FX3B 4CFUB 2W66A 4AIUA 3RH3A 3KHIA 5FP3A 2SPCA 4XAXB 3RIAA 2PMIB 1NWMX 2E2AA 3RIUA 5L2WB 5HNBB 3AA6B 2BVMA 2L3LA 3BLRB 2CZ6B 2ZPBB 4B6XA 3N9PA 3UFGA 3T8OA 3OPCA 3P8CD 3ZT7A 3AE6A 3JAEA 2E9XC 4O4LE 1FIOA 4NC6A 2M67A 4U72A 3M3ZB 3RKGA 1T8BA 2QGSA 1LRZA 1ZOYA 4TV9E 3L3PA 5FGKB 2V6XA 4LMJA 3D0TA 3QOFA 4YSYA 3DJBA 1T7SA 3PURA 3ZJ2A 4YC3B 3UU5A 2XHEB 4N78D 2IUBA 2CCQA 3X26B 4GYSA 4TNVA 2V6YB 5H6QB 1LKXA 3QWLA 3H3MA 4LF4T 3UUBA 3A8OB 1I6ZA 4AQFA 4CZZB 5LCYA 1N32T 4YOZA 4TWHA 1IBMT 2F2CA 2UUCT 2LLYA 1HNWT 2DHRA 3RGFB 4ZZCA 4EXTA 1FJGT 4F6RC 4Z8XA 4GK5E 5ABGA 5JDQA 2A72A 3PV0F 4KRDB 3CKDA 3UT5E 1O9KB 5C8YE 5C3JA 2X0HA 5ABFB 4HWFA 4I4TE 5FXWA 3ZYKA 4PJNA 3TLWA 2IW8B 3PUXF 4DNDA 4BJNA 2J62A 5LGNB 2BG9C 3UU8A 3KFWX 5L3BB 2Q9QA 1UGRB 2WBLA 3K3QC 4WYVA 1VCTA 4X1IE 4H9QC 4EOOB 3QYGB 4AI6A 3RC3A 1OEDC 5AQHB 3SOLA 5AQMB 2HHHT 4MFEA 3ONLC 3LBXA 2JIWA 2VKJA 4X65T 4X1YE 4HNVA 2FJAA 3QYHB 4X62T 4F7LB 4KHZF 5IYZE 1TD6A 1H1SB 2XZEA 4QX8B 1N34T 5IHYA 1OL1B 4HLQA 2C5XB 2LRKA 3ZMVB 4U31A 3V5SA 4KMCA 1UK5A 3KV9A 1HCIA 1Y01A 2KZ7B 5HBJB 2CXFA 3NBXX 1W0AA 1T72A 2VWAA 4CFUD 2ACZA 2H89A 3UTKA 2W4XA 2DI4A 2YINA 4BCFB 1FEWA 3NZPA 4MBQA 5CA0E 2BVLA 5L3GB 4JI3T 1KNRA 5L3FB 3VKGA 3E22E 4HWDA 2KSRA 4UR9A 4HL4A 1G3NC 5L4HA 5F5WA 1UGOA 4EC9B 3RYCE 3PJAA 1R8IA 2CYZB 4WW0A 2BPMB 3ZEFB 1YW0A 4ZI7E 3MJXA 3FZLB 1H28B 2XQ8A 2WMAB 5L47A 4CFXB 1Y64B 4AXPA 4BAYB 4EOIB 2BKZB 4KX6A 5DABA 2K5BB 1E2AA 2QFZA 5AQTB 3EDVA 3WVDB 2WIHB 2OA5A 3Q5WA 2JRKA 2QYWA 2RPAA 2KR6A 2X9HA 1DU2A 4HFDA 4IE4A 1O3XA 3UUMA 2XAFB 4EYUA 3FZHB 1W98B 4ZEYA 5CGMA 2A9UA 1YKEB 4HTEA 1WRDA 3C64A 3J9X1 3CPZA 5LG4A 3CMLA 2K9AA 2DCFA 1S94A 1L0VA 3RI5A 4IGUA 1GY3B 4TZ4C 4JX6A 2WP9A 4OB2B 3IHRA 2LSYA 5EK3A 3LK42 1BR0A 5KXJA 2IW5B 5LMNT 3JC6D 2ZMAA 4BCNB 1VOMA 3LFMA 4IHJE 4TN7B 1UURA 2CCHB 2LSGA 2PHGA 2XSBA 4GOUA 4M1PA 3GN5A 1BR4A 4ROEA 1VCSA 2UZEB 3NRXA 4P1NA 1KF6A 2J47A 1BU2A 3DP7A 3NRYA 3RX6A 3FHNA 4QHOA 1WFDA 1WR6A 5AQLB 4JI6T 4YOOA 4LOCA 5J2UE 4BCJB 5JRCB 5LHHB 1BR2A 4HKAA 3ONJA 5L2LA 4Y72B 2WDQA 2C5KT 4IDPA 5IF1B 4XBFB 4BBSM 4ILUA 3KV6A 2LOPA 4CFVB 3X28B 2KMFA 4L9IA 4GKKT 4ZS3A 2IDOB 3HKEE 4DV4T 1W09A 2XQAA 3FZKB 3N2OA 3AEGA 4UVAB 2BS2A 1SUMB 4OHFA 2Q9QD 4QXHB 4BA9A 2VL0A 2DNXA 1E1HB 4BCQB 3C4XA 3HO8A 1OI9B 5HQ0B 4G6LB 3NDQA 2JQHA 1H26B 2E5VA 4FM4B 3ZYLA 4BCKB 4I3ZB 3RQWA 3VR9A 4Z90A 3FXEB 2CXDA 2WEVB 1GUXB 2VQFT 4A56A 3ZCJA 2XAJB 3QHWB 3PDYA 5KMGP 4ISTA 3EIDB 3UUNA 4EONB 2QRXA 3MKDA 5BR8T 2W96A 3R6NA 5JR9A 1W9RA 1QUUA 2MTQA 2PK9B 4O4HE 3QK6A 4AKHA 2J1DG 1KXUA 2ODUA 2J4GA 4IDNA 3CQCB 3O1IA 2XY8B 4LMLA 4ZGEB 2V22B 2IHR1 3HKBE 3ZC1A 1D1BA 3OBVE 4F6SB 3NVOA 5AFUL 4X20E 3VRBA 2XSAA 3K3NA 2XAGB 5LHIB 1HFAA 4ZI2D 4I55E 4ZS2A 4UVCB 2XQ9A 3RYFE 4E7ZA 3TNWB 4EOSB 2WFYB 1J1JA 2KT9A 4BCPB 4XZCA 3A8YC 2V7LA 4AQGA 1AJ3A 4UF0A 5FL0A 2PJQA 3MIAB 3EVYA 4YT0A 3F31A 3ZCIA 4AKRB 3RRWA 3BHTB 4DR7T 2DL1A 4A5XA 2H7OA 2CZ1B 2FJBA 2CEAA 2BDEA 2P9BA 4PNIA 2C0SA 4OFZA 2EHOB 4A98A 5HEOA 5AQPB 4Z91A 1D1AA 4LF6T 4MFRA 4B3ST 1H4LD 2IIUA 4JI2T 3ZMTB 1KEYA 1I94T 1ZHCA 5JDMA 2KWHA 3QB5A 1G73A 4IE5A 4FJOA 5FXVA 3ZN0B 5HXCA 2QQ8A 2L9QA 2ZLYA 1IJ5A 2OLTA 4IREA 5M4YA 3K8PC 2NTYA 4L0RA 2N2NA 2W63A 2WM9A 1XMOT 2LHNA 3U78A 4PFPA 1ZP2A 4O4IE 3MY5B 3RRCA 4UF0B 4JUYA 3CK6A 4TWDA 2C5NB 4UELA 1CHUA 3OYXA 4U7YA 4X5TA 3V5UA 4CQIA 4PFOA 2V6YA 3VYHB 2MAWA 4KUMB 2C6TB 4M6VA 4X64T 3RC8A 5HBHB 3TW7A 3IBPA 1YXRA 1E9HB 2NW9A 3EAMA 4GYRA 3AEDA 4HFVA 5CJ5A 2I6HA 1D0ZA 3U3IA 5F3JA 4BJMA 3KVAA 3AVSA 4V1Av 2CLYB 4EOPB 1O9KA 1AISB 2KWIB 2MOZA 4HFIA 5ABFA 2A3DA 5LGTB 2UXNB 3P4QA 5AQOB 5AQQB 5HWYA 2UZDB 2K48A 3RIUC 3UQ7A 1EZ3A 1HG5A 4UV8B 5FXXA 5JDGA 5EFQB 1YQ4A 3GWHA 1WLXA 4X1KE 1MIVA 3TNHB 1MMAA 4ASKA 5IWAT 4OX9T 4EORB 3CX6B 2YKSA 5LBMA 4EZHA 2JQKA 3KV5A 2WMNA 5LHGB 2X51A 5HBEB 2JPFA 3GTMS 1IBLT 3RKOA 4G2AA 3O4XE 5FNVE 5HEUA 2XAQB 1OKVB 5ABHA 3ABVA 3ZJ1A 2N1GA 3AAIA 4YHJA 3PUAA 2WMOA 4OB1B 3AECA 3SWHA 4CFNB 2E9XB 3BG5A 4CI1B 1IREB 3VHLA 1SHZC 3C50A 4H9RC 4ILBA 2LM9A 3X1DA 3DOGB 3JC6C 3AA1B 3QNUA 5AQIB 4QSHA 4PK6A 5HXHA 3A8GB 2CZ0B 2G77A 4IL9A 1ZV4X 2BG9A 3CQXC 3E08A 2LKGA 5GONE 4IMYB 3PTRB 1JOWA 2CHOA 3WI3A 2AXDS 4EB6E 3O9XA 1WCRA 4IE7A 4JLEA 2XQ3A 4ANJA 3S4UA 4RODA 3BLHB 2WZHA 3QYEA 2DXBB 3SFDA 3MZKB 4CI3B 2X1NB 4BCMD 3N9MA 1YD8G 4B3MT 5LJMA 2D0TA 2JJ9A 2L8KA 4DV6T 1XZYA 4EOZB 3OVUA 3PUVF 2Q9QC 4TV8E 2FJDA 4JI1T 2W61A 1B7TA 3KBTA 3QYBA 2ZZDB 1H27B 3LK3B 4KBMB 4DV5T 3Q5XA 1JKWA 2BG9B 4PJMA 4DUZT 3RIFA 3X20B 3K1SA 3IF8B 4DUYT 2IC9A 3C4WA 1FMVA 3AEFA 4PJJA 4DMWA 3F2EA 4OB0B 1Z8UA 3OJAA 1H1QB 1OEDB 1H7CA 3N9LA 3PUGA 2CMRA 2CRBA 4AKIA 4MALA 3UUXB 4ILCA 4CXAB 4JV5T 2BS3A 5LP6E 5HVYB 1H24B 1X9BA 1HX8A 3RF1A 3HI2A 4DR2T 2VURA 2LSKA 4JEUB 2LOSA 3JCFA 1GH6B 4YTNA 4ELJA 3OKQA 1D0YA 3BK9A 2CPTA 2WMBB 1BR1A 2XPKA 4KRCB 2Y48B 1AD6A 2NW8A 2W9ZA 3AB3B 4ZI2C 1LVFA 3UULA 4F6UB 2XM2A 2JMHA 3QC9A 4WZXA 3FBZA 2BS4A 2IMLA 2M6IA 4ERRA 5JDHA 4HWIB 3L09A 1MIWA 2UUEB 4QKNA 3F5XB 3NKZA 4PK4A 2YDQA 5A1LA 1XNRT 3ZT5A 3MA9A 2Z6EA 3VR8A 5JRCA 3TW6A 3BQKA 4DBRA 4JI8T 2Y8DA 3AAAB 2XASB 5AQGB 4UVBB 4BCHB 3TLUA 4OR5B 3TLVA 2VB6A 3EDUA 2WJ9A 1HNZT 3ONXA 2W67A 4EC8B 4OGRB 3DL1A 3MXZA 4EOKB 3HA4A 3H4CA 2B9RA 3OTOT 1FVVB 2DWKA 4COFA 4JX4A 2CHNA 2JMKA 5EK2A 4CXWA 4QWNB 1H25B 3AAEB 3PUYF 5HCJA 2D0UA 5J2TE 2ZM8A 2BBHA 3EHZA 4GIWA 1GUXA 4CI2B 2RP4A 4BCIB 2XM1A 4J2CA 4JBWF 5JDLA 2KINB 4LF8T 3W15B 3FBLA 5LJNA 5FY0A 3DDQB 3AE7A 1OIYB 2WIPB 3N2GE 3N9OA 3AE4A 3IA3A 2IVXA 4ZI3D 3LQ5B 5JDNA 2K3WA 4FI5A 2QA7A 3O1JA 3SS1A 2VQET 3VKHA 4LFBT 4MFDA 3X25B 3F57A 2LM2A 5H6RB 4IDZA 2XQ6A 3AE9A 2W0GA 4LF7T 4H63V 4AKLA 5L3CB 1E7PA 3O0GD 5KDMC 3AE2A 3ZPOA 3PUWF 5JTGA 5EJCA 2ZPFB 2QVAA 3RPUA 3BG9A 5FY1A 4DV2T 1XWMA 4JI7T 1V29B 2LT3A 4H9NC 2MPKA 2B76A 3HKDE 5J0ZA 4DO0A 1HX1B 2YDSA 3L8RA 4DV3T 1WYBA 4HFEA 2KMGA 4QX7B 3I0QA 1OXZA 3AEAA 2CM0A 3PU3A 3KINB 5E0OA 2EHOA 3RGLA 4CN4A 2ACXA 4I43B 3A7MA 3N5LA 2E5LT 4EOLB 3SRZA 1XDPA 3MI9B 2CZ7B 2X9XA 3KV4A 5HEJA 5JR9C 2AHJB 4DMVA 3HR0A 5FYMA 4F7NB 3B13A 4ZXLA 5KX5E 4YSZA 2CWYA 5FKYA 5LBQB 3CQGB 2UXBT 5EK4A 2DPPB 1HF8A 2CBIA 5HYAA 4P09A 1NAFA 2IN3A 4I50E 5CEIB 2ZPEB 2X0YA 4ZZBA 4DR6T 2DD4B 3PU8A 2UZBB 4CN6A 4AQYT 5HEHA 1HTJF 1N4MA 2QDJA 3AXJB 4BCND 1MMDA 2LE8A 3PUSA 2ZPGB 1XO2A 1W0BA 4YJ3E 4F8HA 3HBLA 3FZMB 1US7B 2E8IA 3T1HT 2XQ7A 3CWZB 3B5MA 3ESLA 3NZQA 3WAJA 2R6GF 3R84B 5FXZA 2WPAB 1UGPB 2HN1A 3BG3A 1NENA 2VKDA 4O2AE 4G63A 4NUUA 2UU9T 2F4VT 2YDRA 2MBGA 2HPJA 2QDYB 2YU1A 4AKGA 1UNGD 1X79A 4MHCA 4CFWB 3QXEB 5AQNB 2I0MA 2UZLB 1XMQT 5CB4E 4MIMA 1OWAA 4YY3T 3A8HB 2NTXA 3QHRB 3ETUA 4DBQA 3TN8B 4F6WB 4WBOA 3CX8B 1F5QB 2MYSA 3WVEB 4KHPT 4LF9T 1G8XA 4BCQD 1AHJB 2V5CA 2UUAT 1HR0T 4DV1T 2V8SV 3NWIA 3ZN1B 2R7GA 1QSDA 1SA0E 2LSIA 5AQRB 2E9XA 2VKHA 2GK9A 5FL1A 2NW7A 2WAUA 4ROCA 4H9OC 2QF7A 1KNPA 2XQ5A 3PUZF 5JVDE 1IBKT 1WR0A 3QZ5B 4YTPA 2XQ4A 3FB2A 2CCIB 2IW6B 4NXNT 5ETWA 4ZGJB 4P0BA 4EEDA 1VYWB 3N9QA 2JQQA 2IC6A 2WU2A 3QUJA 3CIRA 5LMKB 2H7VC 2H88A 5CYIB 2WDRA 1OL2B 2JQ9A 2WCAA 2KLQA 3A8MB 2ZPIB 1SE7A 3OYZA 2ZM6T 3M03A 1D0XA 5HEGA 2VKOA 3UQ4A 5LGUB 1OIUB 4JI0T 3G06A 2ODVA 4K0KT 4UXNB 3QB5K 3RYIE 4IE6A 4JX5A 5IDPB 2V7MA 4JI5T 4II5B 3M65A 3KBUA 5HAXA 4HGAA 4QH5A 3RHWA 1JSUB 4ZOLE 3UU3A 3Q5EA 3ZSSA 3B57A 5L3EB 3AE5A 2LRLA 2VASA 2WY2A 1HS7A 2JGZB 2OV9A 4F7JB 3HL6A 4UV9B 1S35A 2XUEA 4P0AA 3PO3S 4OK0A 3UU4A 4O2BE 5LG3A 2DD5B 1WYCA 5LXTE 3CVRA 4AQFC 3BHVB 2RA1A 4DIDB 5DQWA 3EABA 5ADXL 3N9NA 3X24B 3AE1A 2C5IT 4CXXA 3KVBA 2VL8A 4EV6A 4HWCA 2BKOA 3LG7A 2EHOD 3JADA 2PBIA 1OEDA 1UUSA 4EYYR 4BY1X 3C4ZA 1JNRA 2XQYA 1C9BA 3BQLA 2V1DB 2WSSV 3WAKA 4IIJE 4ZI3C 3J7Yq 4QH4A 3E0ZA 1KFYA 4YXDA 5LMUT 1N33T 4EOQB 4YJ2E 2K24A 3IEEA 4DR1T 3TNIB 2EUFA 4OYJA 3EI0A 4WBNE 1MIYA 2VK9A 3LSVA 3ZKRA 2DLRA 4BCGB 3EOCB 2AE9A 1OKWB 1QMZB 2W00A 2C5JA 4ZHQE 3MY1B 3C51A 3I9YA 4YTMA 4ISSA 1Z0PA 2YOEA 2PG8A 1VOLA 3K3OA 2X66A 1MMNA 3FXDB 2Y6XA 4BCOB 4Q25A 5I5ZB 1QLBA 1D3UB 3TLSA 3UU6A 1VRBA 4TNWA 2DWGA 3ZSTA 4BBRM 4OB3B 5CFBA 3AA0B 4EEBA 3KDSE 5LNKA 3L39A 1HG2A 3G33B 2YN6A 4EOJB 3AA7B 3ANWA 1M7KA 2N9DA 2VVNA 5AQKB 2WU5A 3TLTA 3HHTB 2V7IA 5BMVE 2CBJA 2CE7A 5LQFB 1U5PA 2ZCFB 3N2KE 2W2HA 2Q9QB 2LJLA 1MNEA 4DVDA 5CA1E 2NOXA 2NWBA 5AQFB 3H3AA 1MMGA 1FMWA 4IL4A 5AQUB 2C4GB 1D1CA 3P4WA 2WB5A 1KK7A 2WHBB 4QXBB 2YK0A 4QXCB 4H63H 2ES0A 3H37A 1IAPA 4AISA 1URCB 3LBXB 2A2FX 4HN9A 2WS3A 3ZLIA 2X9YA 2BKNA 2BG9E 4F7SB 3ZMUB 2LHRA 3VU7H 1UX4A 4TX5A 3RQUA 1UGSB 3O1HA 4QH1A 2PTFA 3ANWB 3EUHA 2XAHB 5DJQC 1YKHB 1OEDE 2E9XD 4U33A 3PJAJ 2V7KA 3GA8A 5LA6E 5TAOA 3ZYMA 2CJMB 3AEBA 4DR5T 2NP9A 5EZYE 1FINB 1TFBA 5C2TA 2DMEA 2KNDA 2B1EA 3HB9A 3POMA 4TTHA 4JYAT 2H3RA
chains in the Genus database with same CATH topology
3I0QA 1MNDA 2IAKA 4KUMB 1OXZA 2CM0A 3RC8A 3PU3A 4AI6A 3KINB 3RC3A 3IBPA 1UX5A 5E0OA 5LOVE 5HXEA 2EHOA 3SOLA 4HE8A 3LBXA 2NW9A 2ACXA 2VKJA 4KP3C 4GYRA 5LJNA 4X1YE 4I43B 4HFVA 4H9PC 4O8SA 5IYZE 3GMIA 3N5LA 3I1AA 4EZ4A 2LSJA 3SRZA 4QX8B 1D0ZA 3U3IA 4MLKA 5F3JA 5IHYA 2D5UA 4BJMA 3KVAA 1T98A 3AVSA 4V1Av 2CLYB 2X9XA 3ZMVB 4PJLA 3KV4A 3C98B 5JR9C 3V5SA 4OYKA 2V26A 2KWIB 2MOZA 4KMCA 3KV9A 4DMVA 2A3DA 1HCIA 3HR0A 2KZ7B 2UXNB 5FYMA 5LGTB 3B13A 2CXFA 4HEAA 5HWYA 3NBXX 5KX5E 3MACA 2K48A 2CWYA 5LBQB 3LJCA 2VWAA 3CQGB 3CX7B 5FY7A 5EK4A 1EZ3A 1HG5A 4NUVA 4UV8B 5FXXA 3UTKA 1HF8A 5JDGA 2DI4A 3GWHA 1WLXA 4X1KE 2YINA 1MIVA 1MMAA 4ASKA 5HYAA 1FEWA 1IZNB 3NZPA 4P09A 3CX6B 4MBQA 5CA0E 2BVLA 5L3GB 1NAFA 4PK5A 3HKCE 4I50E 5LBMA 5L3FB 4EZHA 3VKGA 3E22E 5F8PA 3KV5A 2WMNA 5LHGB 4PAGA 5FMNA 3PU8A 2X51A 2JPFA 3I9WA 1HTJF 3RKOA 2HPLA 4G2AA 3DTOA 1MMDA 2LE8A 3O4XE 5FNVE 3RYCE 2XAQB 3PUSA 2KXPB 4YJ3E 3ZJ1A 2N1GA 3AAIA 4YHJA 2UXXB 4WW0A 5JQGE 1US7B 2WMOA 3PUAA 3SWHA 2E8IA 3CWZB 5J1GA 3ZEFB 3ESLA 5HXRA 3NZQA 2E9XB 1YW0A 3Q2MA 3MJXA 4H9SE 3R84B 4ZI7E 3WAJA 4CI1B 5FXZA 4QX7B 1UCUA 1V9DA 1ZKEA 4O2AE 2VKDA 4GK0E 3VHLA 1SHZC 3C50A 1Y64B 4H9RC 4G63A 4NUUA 4AXPA 4BAYB 2LM9A 5JDFA 3JC6C 3AA1B 2MBGA 2HPJA 2X68A 2YU1A 4PW8A 4AKGA 5JREA 1X79A 5DABA 2BZBA 2K5BB 4MHCA 2V7JA 4PK6A 5HXHA 4WNKA 3EDVA 3PUQA 1ZV4X 5L3DB 3ETVA 2OA5A 3Q5WA 2JRKA 3CQXC 3E08A 5GONE 3PTRB 2X9HA 3AVRA 5CB4E 3WI3A 3GN5B 4EB6E 3O9XA 1CUNA 1OWAA 3MK7C 2D2SA 4IE7A 4JLEA 5DQVA 4ANJA 2NTXA 3ETUA 4IE4A 1O3XA 2CXLA 3A5XA 4E7SA 3UUMA 4IE0A 4DBQA 2I59A 3S4UA 4WBOA 2XAFB 4EYUA 3CX8B 2MYSA 1G8XA 1YKEB 4HTEA 5JH7E 1WRDA 2G0UA 3MZKB 4CI3B 3C64A 3J9X1 2LEHA 3CPZA 4UIGA 3N9MA 1YD8G 5LG4A 3ZN1B 5LJMA 1QSDA 1SA0E 2D0TA 2JJ9A 2K9AA 2LSIA 3CMLA 2L8KA 2E9XA 2DCFA 1S94A 3LK2B 4EOZB 2VKHA 4O4JE 4C90A 2GK9A 2Q9QC 4IGUA 2X67A 4TZ4C 2NW7A 2WAUA 4TV8E 4H9OC 4U74A 2W61A 3IHRA 1B7TA 4ADZA 2YEVC 5JVDE 3KBTA 2LSYA 4CXYA 5EK3A 3LK42 3LK3B 4KBMB 1BR0A 1IJ6A 2X9WA 2IW5B 3Q5XA 3FB2A 3P7IA 4TUYE 5ETWA 3JC6D 2ZMAA 4P0BA 2EHOC 4PJMA 1VOMA 3LFMA 3N9QA 2JQQA 4EIWA 4IHJE 2IC6A 3QUJA 2LSGA 4M1PA 4TN7B 4GOUA 3IF8B 2YU2A 3GN5A 1BR4A 2IC9A 2XTLA 3RYHE 2H7VC 3NRXA 3C4WA 1FMVA 2KLQA 3BQIA 2ZM2A 4PJJA 3F2EA 3UFEA 4DMWA 3DP7A 3NRYA 3RX6A 3FHNA 2CWOA 2PFVA 3OJAA 3OYZA 2WWUA 4QHOA 1WR6A 4JEHB 1H7CA 3N9LA 1D0XA 2HH7A 2VKOA 5LGUB 5J2UE 3PUGA 2CMRA 2ODVA 1KNZA 4MALA 4AKIA 3UUXB 4UXNB 5JRCB 3RYIE 4IE6A 5LYJE 2V7MA 4K0UA 4EAHA 3M65A 5HXSA 5LHHB 1BR2A 3KBUA 5HAXA 4HKAA 4HGAA 5L2LA 5LP6E 4ZOLE 2C5KT 5HWXA 1HX8A 4XBFB 4C91A 3HI2A 4ILUA 3KV6A 5JR9B 2LSKA 3B57A 5L3EB 4JEUB 2LOPA 2LOSA 4UEMA 3OKQA 2VASA 1D0YA 3BK9A 1HS7A 2KMFA 4L9IA 4ZS3A 1BR1A 3PE0A 3HL6A 2W62A 3HKEE 3I0OA 3N2OA 4UV9B 1S35A 2XUEA 4P0AA 4UVAB 2Y48B 4OHFA 2NW8A 4OK0A 2Q9QD 4O2BE 4QXHB 3AB3B 2X0LB 4ZI2C 4BA9A 1LVFA 3UULA 1WYCA 2DNXA 1E1HB 5LXTE 2JMHA 3CVRA 3C4XA 4AQFC 2RA1A 4YFSA 5DQWA 5ADXL 3QC9A 3N9NA 2C5IT 4CXXA 3KVBA 2VL8A 3FBZA 3ZYLA 3ZC0A 3LG7A 2EHOD 4ERRA 5JDHA 2PBIA 1ZEEA 3FXEB 2CXDA 3C4ZA 4EYYR 1LVKA 3L09A 1MIWA 2CLYC 4YLHA 2XQYA 3BQLA 3ZMZB 4QKNA 2V1DB 3Q9DA 2CA5A 2WSSV 4A56A 3ZCJA 2XAJB 4PK4A 5A1LA 3WAKA 3MA9A 2Z6EA 3PDYA 4IIJE 4ZI3C 3ZMSB 5KMGP 3J7Yq 5JRCA 4ISTA 3E0ZA 4L5GA 1U4QA 3BQKA 2ZM0A 3UUNA 4DBRA 4YJ2E 2K24A 2Y8DA 3AAAB 2XASB 3MKDA 3TKLB 3IEEA 4UVBB 3R6NA 5JR9A 3RH3A 2VB6A 3EDUA 4OYJA 1QUUA 4WBNE 5FP3A 2MTQA 1MIYA 2VK9A 3ONXA 4O4HE 3QK6A 4AKHA 2SPCA 2J1DG 4XAXB 2DLRA 2ODUA 1NWMX 3MXZA 3CQCB 3AA6B 3HA4A 2W00A 3O1IA 2C5JA 4ZHQE 3C51A 3I9YA 4ISSA 2BVMA 3HKBE 3ZC1A 1Z0PA 2L3LA 1D1BA 2PG8A 3K3OA 3OBVE 4B6XA 2X66A 1MMNA 3FXDB 3N9PA 2Y6XA 5AFUL 2DWKA 3T8OA 3P8CD 4X20E 3K3NA 2XAGB 1VRBA 5LHIB 2E9XC 4O4LE 1HFAA 2JMKA 5EK2A 1FIOA 2DWGA 4ZI2D 4I55E 2M67A 4CXWA 4ZS2A 3AA0B 3KDSE 4U72A 4QWNB 5LNKA 4UVCB 3RYFE 2QGSA 1HG2A 1LRZA 4E7ZA 3AAEB 3AA7B 2D0UA 4TV9E 3L3PA 3ANWA 2N9DA 5J2TE 2ZM8A 2V7IA 3D0TA 5BMVE 2KT9A 2CE7A 4GIWA 4XZCA 4CI2B 3DJBA 2V7LA 3PURA 3ZJ2A 2RP4A 4AQGA 1U5PA 1AJ3A 4J2CA 5JDLA 2KINB 4UF0A 3W15B 3N2KE 2PJQA 2XHEB 2Q9QB 3FBLA 3EVYA 2LJLA 4N78D 5FY0A 1MNEA 4DVDA 5CA1E 2NOXA 3F31A 2CCQA 2NWBA 3ZCIA 3H3AA 4GYSA 1MMGA 1FMWA 3N2GE 1D1CA 3N9OA 4AKRB 3RRWA 1KK7A 5H6QB 4ZI3D 5JDNA 4FI5A 2QA7A 1LKXA 4QXBB 2H7OA 2YK0A 3O1JA 4QXCB 3SS1A 4H63H 2CEAA 2BDEA 2ES0A 2P9BA 3H37A 1IAPA 4PNIA 3VKHA 2C0SA 4OFZA 2EHOB 4AQFA 4CZZB 5LCYA 3LBXB 1D1AA 2A2FX 4HN9A 3F57A 4MFRA 3ZLIA 2X9YA 5H6RB 4IDZA 2DHRA 2W0GA 4EXTA 4F6RC 3ZMTB 4Z8XA 4H63V 4AKLA 1ZHCA 3ZMUB 5JDMA 2KWHA 4GK5E 1G73A 2LHRA 4IE5A 4FJOA 5JDQA 5FXVA 3VU7H 2A72A 5L3CB 3ZN0B 3CKDA 3UT5E 5HXCA 1UX4A 4TX5A 2L9QA 5KDMC 2ZLYA 5C8YE 3ZPOA 1IJ5A 5M4YA 3O1HA 3K8PC 4I4TE 5FXWA 3ZYKA 3ANWB 2NTYA 4L0RA 3EUHA 4PJNA 3RPUA 2N2NA 2XAHB 5DJQC 1YKHB 2E9XD 2W63A 2WM9A 5FY1A 2LHNA 4DNDA 3U78A 2V7KA 3GA8A 5LA6E 4PFPA 5TAOA 2LT3A 4BJNA 4O4IE 3ZYMA 4H9NC 3RRCA 4UF0B 5LGNB 4JUYA 3HKDE 3KFWX 5L3BB 2Q9QA 2WBLA 3K3QC 4UELA 2NP9A 3OYXA 4DO0A 5EZYE 3V5UA 4CQIA 1WYBA 2KNDA 4PFOA 4X1IE 2B1EA 4H9QC 2H3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHY A;  5DQW A;  3DJB A;  2PJQ A;  5DQV A;  2QGS A;  3B57 A;  3DTO A; 
#chains in the Genus database with same CATH topology
 1MND A;  2IAK A;  4BXX X;  4HWH A;  2G9X B;  4B3T T;  4LFA T;  1UX5 A;  1J5E T;  5LOV E;  4GKJ T;  5HXE A;  4HE8 A;  2M6B A;  4IDQ A;  4KP3 C;  3QZ9 B;  4H9P C;  4CRL B;  4O8S A;  3GMI A;  3I1A A;  4EZ4 A;  4F70 B;  2LSJ A;  4LF5 T;  2IW9 B;  4MLK A;  3DDP B;  2D5U A;  1T98 A;  4IT4 A;  4PJL A;  3C98 B;  4U3C A;  4OYK A;  4B3R T;  2V26 A;  1ENW A;  3BLQ B;  5FVK A;  4U2Z A;  1JNZ A;  3ZT6 A;  1JST B;  4HEA A;  3MAC A;  3LJC A;  3CX7 B;  2FUP A;  5FY7 A;  4NUV A;  1PKD B;  2UXD T;  2I53 A;  1IZN B;  3AE8 A;  3P4P A;  2WZI A;  4PK5 A;  3HKC E;  5F8P A;  3AEE A;  4PAG A;  5FMN A;  3RLF F;  4X66 T;  4A97 A;  3I9W A;  5L4E A;  2HPL A;  3DTO A;  2C5O B;  3FZF B;  2HN2 A;  2KXP B;  2UXX B;  5JQG E;  4UN0 A;  4U7I A;  4YSX A;  5J1G A;  5HXR A;  3Q2M A;  4H9S E;  1VIN A;  2BBJ A;  1UCU A;  1V9D A;  1OGU B;  1ZKE A;  1HNX T;  4GK0 E;  2I40 B;  4HNU A;  5JDF A;  4HNT A;  2W9F A;  1P5E B;  2X68 A;  4PW8 A;  5JRE A;  2BZB A;  2V7J A;  4DV0 T;  4KI0 F;  4WNK A;  3PUQ A;  4NXM T;  4I0U A;  5L3D B;  5HCM A;  3ETV A;  4DV7 T;  4DR4 T;  3AVR A;  2WXV B;  3GN5 B;  1UGQ B;  1CUN A;  3MK7 C;  2D2S A;  2FJE A;  4JI4 T;  5DQV A;  4YOS A;  4ELL A;  4HFB A;  2DXC B;  2CXL A;  3A5X A;  4NST B;  4E7S A;  4IE0 A;  2I59 A;  4ZGD B;  2WWV A;  2UXC T;  2ZPH B;  2W2U A;  3AXJ A;  5JH7 E;  2G0U A;  2LEH A;  4UIG A;  1UNH D;  3HZJ A;  2LKH A;  5IUX A;  4NIQ A;  4U2Y A;  2D0Q B;  3LK2 B;  5FVL A;  1XNQ T;  4O4J E;  4C90 A;  3BHU B;  2X67 A;  5ABE A;  4U74 A;  4LFC T;  3Q5D A;  4ADZ A;  2YEV C;  2WDV A;  4CXY A;  4CFM B;  1IJ6 A;  2X9W A;  3SFE A;  2C5V B;  4TWF A;  3P7I A;  4TUY E;  5AQV B;  2EHO C;  1UNL D;  4EIW A;  2NR4 A;  1M62 A;  4HFH A;  2YU2 A;  2XTL A;  3RYH E;  5AQS B;  5ACB A;  3BQI A;  2ZM2 A;  3UFE A;  2VVS A;  2CWO A;  2PFV A;  2XJ7 A;  3T1Y T;  2WWU A;  4ILA A;  4JEH B;  2D9D A;  5BNJ B;  2HH7 A;  4Z6Y A;  2PK2 A;  4YHH T;  3A8L B;  1KNZ A;  5LYJ E;  4K0U A;  4EAH A;  5HXS A;  2V5D A;  1H1R B;  2LW4 A;  5HWX A;  4BY7 X;  4EOM B;  4C91 A;  4LMK A;  5JR9 B;  4UEM A;  1ZP0 A;  3JAF A;  5ICP B;  3PE0 A;  2W62 A;  2WQY A;  1N36 T;  3I0O A;  2W99 A;  5IDN B;  3VRA A;  3K7A M;  3P4R A;  3LDQ B;  4EGW A;  2X0L B;  1YQ3 A;  4NPP A;  5LB7 B;  4YFS A;  5AQJ B;  1XDO A;  1FKM A;  1GQE A;  4BCM B;  2FBW A;  3AE3 A;  2BKP A;  3ZC0 A;  4DR3 T;  4IDO A;  1ZEE A;  1LVK A;  4CN1 A;  2CLY C;  4YLH A;  3P50 A;  3ZMZ B;  3Q9D A;  2CA5 A;  1NEK A;  1J5W A;  3ZMS B;  1H1P B;  3VYG B;  4L5G A;  1U4Q A;  2ZM0 A;  3TKL B;  3P4S A;  2UUB T;  3EJ1 B;  4HFC A;  4FX3 B;  4CFU B;  2W66 A;  4AIU A;  3RH3 A;  3KHI A;  5FP3 A;  2SPC A;  4XAX B;  3RIA A;  2PMI B;  1NWM X;  2E2A A;  3RIU A;  5L2W B;  5HNB B;  3AA6 B;  2BVM A;  2L3L A;  3BLR B;  2CZ6 B;  2ZPB B;  4B6X A;  3N9P A;  3UFG A;  3T8O A;  3OPC A;  3P8C D;  3ZT7 A;  3AE6 A;  3JAE A;  2E9X C;  4O4L E;  1FIO A;  4NC6 A;  2M67 A;  4U72 A;  3M3Z B;  3RKG A;  1T8B A;  2QGS A;  1LRZ A;  1ZOY A;  4TV9 E;  3L3P A;  5FGK B;  2V6X A;  4LMJ A;  3D0T A;  3QOF A;  4YSY A;  3DJB A;  1T7S A;  3PUR A;  3ZJ2 A;  4YC3 B;  3UU5 A;  2XHE B;  4N78 D;  2IUB A;  2CCQ A;  3X26 B;  4GYS A;  4TNV A;  2V6Y B;  5H6Q B;  1LKX A;  3QWL A;  3H3M A;  4LF4 T;  3UUB A;  3A8O B;  1I6Z A;  4AQF A;  4CZZ B;  5LCY A;  1N32 T;  4YOZ A;  4TWH A;  1IBM T;  2F2C A;  2UUC T;  2LLY A;  1HNW T;  2DHR A;  3RGF B;  4ZZC A;  4EXT A;  1FJG T;  4F6R C;  4Z8X A;  4GK5 E;  5ABG A;  5JDQ A;  2A72 A;  3PV0 F;  4KRD B;  3CKD A;  3UT5 E;  1O9K B;  5C8Y E;  5C3J A;  2X0H A;  5ABF B;  4HWF A;  4I4T E;  5FXW A;  3ZYK A;  4PJN A;  3TLW A;  2IW8 B;  3PUX F;  4DND A;  4BJN A;  2J62 A;  5LGN B;  2BG9 C;  3UU8 A;  3KFW X;  5L3B B;  2Q9Q A;  1UGR B;  2WBL A;  3K3Q C;  4WYV A;  1VCT A;  4X1I E;  4H9Q C;  4EOO B;  3QYG B;  4AI6 A;  3RC3 A;  1OED C;  5AQH B;  3SOL A;  5AQM B;  2HHH T;  4MFE A;  3ONL C;  3LBX A;  2JIW A;  2VKJ A;  4X65 T;  4X1Y E;  4HNV A;  2FJA A;  3QYH B;  4X62 T;  4F7L B;  4KHZ F;  5IYZ E;  1TD6 A;  1H1S B;  2XZE A;  4QX8 B;  1N34 T;  5IHY A;  1OL1 B;  4HLQ A;  2C5X B;  2LRK A;  3ZMV B;  4U31 A;  3V5S A;  4KMC A;  1UK5 A;  3KV9 A;  1HCI A;  1Y01 A;  2KZ7 B;  5HBJ B;  2CXF A;  3NBX X;  1W0A A;  1T72 A;  2VWA A;  4CFU D;  2ACZ A;  2H89 A;  3UTK A;  2W4X A;  2DI4 A;  2YIN A;  4BCF B;  1FEW A;  3NZP A;  4MBQ A;  5CA0 E;  2BVL A;  5L3G B;  4JI3 T;  1KNR A;  5L3F B;  3VKG A;  3E22 E;  4HWD A;  2KSR A;  4UR9 A;  4HL4 A;  1G3N C;  5L4H A;  5F5W A;  1UGO A;  4EC9 B;  3RYC E;  3PJA A;  1R8I A;  2CYZ B;  4WW0 A;  2BPM B;  3ZEF B;  1YW0 A;  4ZI7 E;  3MJX A;  3FZL B;  1H28 B;  2XQ8 A;  2WMA B;  5L47 A;  4CFX B;  1Y64 B;  4AXP A;  4BAY B;  4EOI B;  2BKZ B;  4KX6 A;  5DAB A;  2K5B B;  1E2A A;  2QFZ A;  5AQT B;  3EDV A;  3WVD B;  2WIH B;  2OA5 A;  3Q5W A;  2JRK A;  2QYW A;  2RPA A;  2KR6 A;  2X9H A;  1DU2 A;  4HFD A;  4IE4 A;  1O3X A;  3UUM A;  2XAF B;  4EYU A;  3FZH B;  1W98 B;  4ZEY A;  5CGM A;  2A9U A;  1YKE B;  4HTE A;  1WRD A;  3C64 A;  3J9X 1;  3CPZ A;  5LG4 A;  3CML A;  2K9A A;  2DCF A;  1S94 A;  1L0V A;  3RI5 A;  4IGU A;  1GY3 B;  4TZ4 C;  4JX6 A;  2WP9 A;  4OB2 B;  3IHR A;  2LSY A;  5EK3 A;  3LK4 2;  1BR0 A;  5KXJ A;  2IW5 B;  5LMN T;  3JC6 D;  2ZMA A;  4BCN B;  1VOM A;  3LFM A;  4IHJ E;  4TN7 B;  1UUR A;  2CCH B;  2LSG A;  2PHG A;  2XSB A;  4GOU A;  4M1P A;  3GN5 A;  1BR4 A;  4ROE A;  1VCS A;  2UZE B;  3NRX A;  4P1N A;  1KF6 A;  2J47 A;  1BU2 A;  3DP7 A;  3NRY A;  3RX6 A;  3FHN A;  4QHO A;  1WFD A;  1WR6 A;  5AQL B;  4JI6 T;  4YOO A;  4LOC A;  5J2U E;  4BCJ B;  5JRC B;  5LHH B;  1BR2 A;  4HKA A;  3ONJ A;  5L2L A;  4Y72 B;  2WDQ A;  2C5K T;  4IDP A;  5IF1 B;  4XBF B;  4BBS M;  4ILU A;  3KV6 A;  2LOP A;  4CFV B;  3X28 B;  2KMF A;  4L9I A;  4GKK T;  4ZS3 A;  2IDO B;  3HKE E;  4DV4 T;  1W09 A;  2XQA A;  3FZK B;  3N2O A;  3AEG A;  4UVA B;  2BS2 A;  1SUM B;  4OHF A;  2Q9Q D;  4QXH B;  4BA9 A;  2VL0 A;  2DNX A;  1E1H B;  4BCQ B;  3C4X A;  3HO8 A;  1OI9 B;  5HQ0 B;  4G6L B;  3NDQ A;  2JQH A;  1H26 B;  2E5V A;  4FM4 B;  3ZYL A;  4BCK B;  4I3Z B;  3RQW A;  3VR9 A;  4Z90 A;  3FXE B;  2CXD A;  2WEV B;  1GUX B;  2VQF T;  4A56 A;  3ZCJ A;  2XAJ B;  3QHW B;  3PDY A;  5KMG P;  4IST A;  3EID B;  3UUN A;  4EON B;  2QRX A;  3MKD A;  5BR8 T;  2W96 A;  3R6N A;  5JR9 A;  1W9R A;  1QUU A;  2MTQ A;  2PK9 B;  4O4H E;  3QK6 A;  4AKH A;  2J1D G;  1KXU A;  2ODU A;  2J4G A;  4IDN A;  3CQC B;  3O1I A;  2XY8 B;  4LML A;  4ZGE B;  2V22 B;  2IHR 1;  3HKB E;  3ZC1 A;  1D1B A;  3OBV E;  4F6S B;  3NVO A;  5AFU L;  4X20 E;  3VRB A;  2XSA A;  3K3N A;  2XAG B;  5LHI B;  1HFA A;  4ZI2 D;  4I55 E;  4ZS2 A;  4UVC B;  2XQ9 A;  3RYF E;  4E7Z A;  3TNW B;  4EOS B;  2WFY B;  1J1J A;  2KT9 A;  4BCP B;  4XZC A;  3A8Y C;  2V7L A;  4AQG A;  1AJ3 A;  4UF0 A;  5FL0 A;  2PJQ A;  3MIA B;  3EVY A;  4YT0 A;  3F31 A;  3ZCI A;  4AKR B;  3RRW A;  3BHT B;  4DR7 T;  2DL1 A;  4A5X A;  2H7O A;  2CZ1 B;  2FJB A;  2CEA A;  2BDE A;  2P9B A;  4PNI A;  2C0S A;  4OFZ A;  2EHO B;  4A98 A;  5HEO A;  5AQP B;  4Z91 A;  1D1A A;  4LF6 T;  4MFR A;  4B3S T;  1H4L D;  2IIU A;  4JI2 T;  3ZMT B;  1KEY A;  1I94 T;  1ZHC A;  5JDM A;  2KWH A;  3QB5 A;  1G73 A;  4IE5 A;  4FJO A;  5FXV A;  3ZN0 B;  5HXC A;  2QQ8 A;  2L9Q A;  2ZLY A;  1IJ5 A;  2OLT A;  4IRE A;  5M4Y A;  3K8P C;  2NTY A;  4L0R A;  2N2N A;  2W63 A;  2WM9 A;  1XMO T;  2LHN A;  3U78 A;  4PFP A;  1ZP2 A;  4O4I E;  3MY5 B;  3RRC A;  4UF0 B;  4JUY A;  3CK6 A;  4TWD A;  2C5N B;  4UEL A;  1CHU A;  3OYX A;  4U7Y A;  4X5T A;  3V5U A;  4CQI A;  4PFO A;  2V6Y A;  3VYH B;  2MAW A;  4KUM B;  2C6T B;  4M6V A;  4X64 T;  3RC8 A;  5HBH B;  3TW7 A;  3IBP A;  1YXR A;  1E9H B;  2NW9 A;  3EAM A;  4GYR A;  3AED A;  4HFV A;  5CJ5 A;  2I6H A;  1D0Z A;  3U3I A;  5F3J A;  4BJM A;  3KVA A;  3AVS A;  4V1A v;  2CLY B;  4EOP B;  1O9K A;  1AIS B;  2KWI B;  2MOZ A;  4HFI A;  5ABF A;  2A3D A;  5LGT B;  2UXN B;  3P4Q A;  5AQO B;  5AQQ B;  5HWY A;  2UZD B;  2K48 A;  3RIU C;  3UQ7 A;  1EZ3 A;  1HG5 A;  4UV8 B;  5FXX A;  5JDG A;  5EFQ B;  1YQ4 A;  3GWH A;  1WLX A;  4X1K E;  1MIV A;  3TNH B;  1MMA A;  4ASK A;  5IWA T;  4OX9 T;  4EOR B;  3CX6 B;  2YKS A;  5LBM A;  4EZH A;  2JQK A;  3KV5 A;  2WMN A;  5LHG B;  2X51 A;  5HBE B;  2JPF A;  3GTM S;  1IBL T;  3RKO A;  4G2A A;  3O4X E;  5FNV E;  5HEU A;  2XAQ B;  1OKV B;  5ABH A;  3ABV A;  3ZJ1 A;  2N1G A;  3AAI A;  4YHJ A;  3PUA A;  2WMO A;  4OB1 B;  3AEC A;  3SWH A;  4CFN B;  2E9X B;  3BG5 A;  4CI1 B;  1IRE B;  3VHL A;  1SHZ C;  3C50 A;  4H9R C;  4ILB A;  2LM9 A;  3X1D A;  3DOG B;  3JC6 C;  3AA1 B;  3QNU A;  5AQI B;  4QSH A;  4PK6 A;  5HXH A;  3A8G B;  2CZ0 B;  2G77 A;  4IL9 A;  1ZV4 X;  2BG9 A;  3CQX C;  3E08 A;  2LKG A;  5GON E;  4IMY B;  3PTR B;  1JOW A;  2CHO A;  3WI3 A;  2AXD S;  4EB6 E;  3O9X A;  1WCR A;  4IE7 A;  4JLE A;  2XQ3 A;  4ANJ A;  3S4U A;  4ROD A;  3BLH B;  2WZH A;  3QYE A;  2DXB B;  3SFD A;  3MZK B;  4CI3 B;  2X1N B;  4BCM D;  3N9M A;  1YD8 G;  4B3M T;  5LJM A;  2D0T A;  2JJ9 A;  2L8K A;  4DV6 T;  1XZY A;  4EOZ B;  3OVU A;  3PUV F;  2Q9Q C;  4TV8 E;  2FJD A;  4JI1 T;  2W61 A;  1B7T A;  3KBT A;  3QYB A;  2ZZD B;  1H27 B;  3LK3 B;  4KBM B;  4DV5 T;  3Q5X A;  1JKW A;  2BG9 B;  4PJM A;  4DUZ T;  3RIF A;  3X20 B;  3K1S A;  3IF8 B;  4DUY T;  2IC9 A;  3C4W A;  1FMV A;  3AEF A;  4PJJ A;  4DMW A;  3F2E A;  4OB0 B;  1Z8U A;  3OJA A;  1H1Q B;  1OED B;  1H7C A;  3N9L A;  3PUG A;  2CMR A;  2CRB A;  4AKI A;  4MAL A;  3UUX B;  4ILC A;  4CXA B;  4JV5 T;  2BS3 A;  5LP6 E;  5HVY B;  1H24 B;  1X9B A;  1HX8 A;  3RF1 A;  3HI2 A;  4DR2 T;  2VUR A;  2LSK A;  4JEU B;  2LOS A;  3JCF A;  1GH6 B;  4YTN A;  4ELJ A;  3OKQ A;  1D0Y A;  3BK9 A;  2CPT A;  2WMB B;  1BR1 A;  2XPK A;  4KRC B;  2Y48 B;  1AD6 A;  2NW8 A;  2W9Z A;  3AB3 B;  4ZI2 C;  1LVF A;  3UUL A;  4F6U B;  2XM2 A;  2JMH A;  3QC9 A;  4WZX A;  3FBZ A;  2BS4 A;  2IML A;  2M6I A;  4ERR A;  5JDH A;  4HWI B;  3L09 A;  1MIW A;  2UUE B;  4QKN A;  3F5X B;  3NKZ A;  4PK4 A;  2YDQ A;  5A1L A;  1XNR T;  3ZT5 A;  3MA9 A;  2Z6E A;  3VR8 A;  5JRC A;  3TW6 A;  3BQK A;  4DBR A;  4JI8 T;  2Y8D A;  3AAA B;  2XAS B;  5AQG B;  4UVB B;  4BCH B;  3TLU A;  4OR5 B;  3TLV A;  2VB6 A;  3EDU A;  2WJ9 A;  1HNZ T;  3ONX A;  2W67 A;  4EC8 B;  4OGR B;  3DL1 A;  3MXZ A;  4EOK B;  3HA4 A;  3H4C A;  2B9R A;  3OTO T;  1FVV B;  2DWK A;  4COF A;  4JX4 A;  2CHN A;  2JMK A;  5EK2 A;  4CXW A;  4QWN B;  1H25 B;  3AAE B;  3PUY F;  5HCJ A;  2D0U A;  5J2T E;  2ZM8 A;  2BBH A;  3EHZ A;  4GIW A;  1GUX A;  4CI2 B;  2RP4 A;  4BCI B;  2XM1 A;  4J2C A;  4JBW F;  5JDL A;  2KIN B;  4LF8 T;  3W15 B;  3FBL A;  5LJN A;  5FY0 A;  3DDQ B;  3AE7 A;  1OIY B;  2WIP B;  3N2G E;  3N9O A;  3AE4 A;  3IA3 A;  2IVX A;  4ZI3 D;  3LQ5 B;  5JDN A;  2K3W A;  4FI5 A;  2QA7 A;  3O1J A;  3SS1 A;  2VQE T;  3VKH A;  4LFB T;  4MFD A;  3X25 B;  3F57 A;  2LM2 A;  5H6R B;  4IDZ A;  2XQ6 A;  3AE9 A;  2W0G A;  4LF7 T;  4H63 V;  4AKL A;  5L3C B;  1E7P A;  3O0G D;  5KDM C;  3AE2 A;  3ZPO A;  3PUW F;  5JTG A;  5EJC A;  2ZPF B;  2QVA A;  3RPU A;  3BG9 A;  5FY1 A;  4DV2 T;  1XWM A;  4JI7 T;  1V29 B;  2LT3 A;  4H9N C;  2MPK A;  2B76 A;  3HKD E;  5J0Z A;  4DO0 A;  1HX1 B;  2YDS A;  3L8R A;  4DV3 T;  1WYB A;  4HFE A;  2KMG A;  4QX7 B;  3I0Q A;  1OXZ A;  3AEA A;  2CM0 A;  3PU3 A;  3KIN B;  5E0O A;  2EHO A;  3RGL A;  4CN4 A;  2ACX A;  4I43 B;  3A7M A;  3N5L A;  2E5L T;  4EOL B;  3SRZ A;  1XDP A;  3MI9 B;  2CZ7 B;  2X9X A;  3KV4 A;  5HEJ A;  5JR9 C;  2AHJ B;  4DMV A;  3HR0 A;  5FYM A;  4F7N B;  3B13 A;  4ZXL A;  5KX5 E;  4YSZ A;  2CWY A;  5FKY A;  5LBQ B;  3CQG B;  2UXB T;  5EK4 A;  2DPP B;  1HF8 A;  2CBI A;  5HYA A;  4P09 A;  1NAF A;  2IN3 A;  4I50 E;  5CEI B;  2ZPE B;  2X0Y A;  4ZZB A;  4DR6 T;  2DD4 B;  3PU8 A;  2UZB B;  4CN6 A;  4AQY T;  5HEH A;  1HTJ F;  1N4M A;  2QDJ A;  3AXJ B;  4BCN D;  1MMD A;  2LE8 A;  3PUS A;  2ZPG B;  1XO2 A;  1W0B A;  4YJ3 E;  4F8H A;  3HBL A;  3FZM B;  1US7 B;  2E8I A;  3T1H T;  2XQ7 A;  3CWZ B;  3B5M A;  3ESL A;  3NZQ A;  3WAJ A;  2R6G F;  3R84 B;  5FXZ A;  2WPA B;  1UGP B;  2HN1 A;  3BG3 A;  1NEN A;  2VKD A;  4O2A E;  4G63 A;  4NUU A;  2UU9 T;  2F4V T;  2YDR A;  2MBG A;  2HPJ A;  2QDY B;  2YU1 A;  4AKG A;  1UNG D;  1X79 A;  4MHC A;  4CFW B;  3QXE B;  5AQN B;  2I0M A;  2UZL B;  1XMQ T;  5CB4 E;  4MIM A;  1OWA A;  4YY3 T;  3A8H B;  2NTX A;  3QHR B;  3ETU A;  4DBQ A;  3TN8 B;  4F6W B;  4WBO A;  3CX8 B;  1F5Q B;  2MYS A;  3WVE B;  4KHP T;  4LF9 T;  1G8X A;  4BCQ D;  1AHJ B;  2V5C A;  2UUA T;  1HR0 T;  4DV1 T;  2V8S V;  3NWI A;  3ZN1 B;  2R7G A;  1QSD A;  1SA0 E;  2LSI A;  5AQR B;  2E9X A;  2VKH A;  2GK9 A;  5FL1 A;  2NW7 A;  2WAU A;  4ROC A;  4H9O C;  2QF7 A;  1KNP A;  2XQ5 A;  3PUZ F;  5JVD E;  1IBK T;  1WR0 A;  3QZ5 B;  4YTP A;  2XQ4 A;  3FB2 A;  2CCI B;  2IW6 B;  4NXN T;  5ETW A;  4ZGJ B;  4P0B A;  4EED A;  1VYW B;  3N9Q A;  2JQQ A;  2IC6 A;  2WU2 A;  3QUJ A;  3CIR A;  5LMK B;  2H7V C;  2H88 A;  5CYI B;  2WDR A;  1OL2 B;  2JQ9 A;  2WCA A;  2KLQ A;  3A8M B;  2ZPI B;  1SE7 A;  3OYZ A;  2ZM6 T;  3M03 A;  1D0X A;  5HEG A;  2VKO A;  3UQ4 A;  5LGU B;  1OIU B;  4JI0 T;  3G06 A;  2ODV A;  4K0K T;  4UXN B;  3QB5 K;  3RYI E;  4IE6 A;  4JX5 A;  5IDP B;  2V7M A;  4JI5 T;  4II5 B;  3M65 A;  3KBU A;  5HAX A;  4HGA A;  4QH5 A;  3RHW A;  1JSU B;  4ZOL E;  3UU3 A;  3Q5E A;  3ZSS A;  3B57 A;  5L3E B;  3AE5 A;  2LRL A;  2VAS A;  2WY2 A;  1HS7 A;  2JGZ B;  2OV9 A;  4F7J B;  3HL6 A;  4UV9 B;  1S35 A;  2XUE A;  4P0A A;  3PO3 S;  4OK0 A;  3UU4 A;  4O2B E;  5LG3 A;  2DD5 B;  1WYC A;  5LXT E;  3CVR A;  4AQF C;  3BHV B;  2RA1 A;  4DID B;  5DQW A;  3EAB A;  5ADX L;  3N9N A;  3X24 B;  3AE1 A;  2C5I T;  4CXX A;  3KVB A;  2VL8 A;  4EV6 A;  4HWC A;  2BKO A;  3LG7 A;  2EHO D;  3JAD A;  2PBI A;  1OED A;  1UUS A;  4EYY R;  4BY1 X;  3C4Z A;  1JNR A;  2XQY A;  1C9B A;  3BQL A;  2V1D B;  2WSS V;  3WAK A;  4IIJ E;  4ZI3 C;  3J7Y q;  4QH4 A;  3E0Z A;  1KFY A;  4YXD A;  5LMU T;  1N33 T;  4EOQ B;  4YJ2 E;  2K24 A;  3IEE A;  4DR1 T;  3TNI B;  2EUF A;  4OYJ A;  3EI0 A;  4WBN E;  1MIY A;  2VK9 A;  3LSV A;  3ZKR A;  2DLR A;  4BCG B;  3EOC B;  2AE9 A;  1OKW B;  1QMZ B;  2W00 A;  2C5J A;  4ZHQ E;  3MY1 B;  3C51 A;  3I9Y A;  4YTM A;  4ISS A;  1Z0P A;  2YOE A;  2PG8 A;  1VOL A;  3K3O A;  2X66 A;  1MMN A;  3FXD B;  2Y6X A;  4BCO B;  4Q25 A;  5I5Z B;  1QLB A;  1D3U B;  3TLS A;  3UU6 A;  1VRB A;  4TNW A;  2DWG A;  3ZST A;  4BBR M;  4OB3 B;  5CFB A;  3AA0 B;  4EEB A;  3KDS E;  5LNK A;  3L39 A;  1HG2 A;  3G33 B;  2YN6 A;  4EOJ B;  3AA7 B;  3ANW A;  1M7K A;  2N9D A;  2VVN A;  5AQK B;  2WU5 A;  3TLT A;  3HHT B;  2V7I A;  5BMV E;  2CBJ A;  2CE7 A;  5LQF B;  1U5P A;  2ZCF B;  3N2K E;  2W2H A;  2Q9Q B;  2LJL A;  1MNE A;  4DVD A;  5CA1 E;  2NOX A;  2NWB A;  5AQF B;  3H3A A;  1MMG A;  1FMW A;  4IL4 A;  5AQU B;  2C4G B;  1D1C A;  3P4W A;  2WB5 A;  1KK7 A;  2WHB B;  4QXB B;  2YK0 A;  4QXC B;  4H63 H;  2ES0 A;  3H37 A;  1IAP A;  4AIS A;  1URC B;  3LBX B;  2A2F X;  4HN9 A;  2WS3 A;  3ZLI A;  2X9Y A;  2BKN A;  2BG9 E;  4F7S B;  3ZMU B;  2LHR A;  3VU7 H;  1UX4 A;  4TX5 A;  3RQU A;  1UGS B;  3O1H A;  4QH1 A;  2PTF A;  3ANW B;  3EUH A;  2XAH B;  5DJQ C;  1YKH B;  1OED E;  2E9X D;  4U33 A;  3PJA J;  2V7K A;  3GA8 A;  5LA6 E;  5TAO A;  3ZYM A;  2CJM B;  3AEB A;  4DR5 T;  2NP9 A;  5EZY E;  1FIN B;  1TFB A;  5C2T A;  2DME A;  2KND A;  2B1E A;  3HB9 A;  3POM A;  4TTH A;  4JYA T;  2H3R A; 
#chains in the Genus database with same CATH homology
 3I0Q A;  1MND A;  2IAK A;  4KUM B;  1OXZ A;  2CM0 A;  3RC8 A;  3PU3 A;  4AI6 A;  3KIN B;  3RC3 A;  3IBP A;  1UX5 A;  5E0O A;  5LOV E;  5HXE A;  2EHO A;  3SOL A;  4HE8 A;  3LBX A;  2NW9 A;  2ACX A;  2VKJ A;  4KP3 C;  4GYR A;  5LJN A;  4X1Y E;  4I43 B;  4HFV A;  4H9P C;  4O8S A;  5IYZ E;  3GMI A;  3N5L A;  3I1A A;  4EZ4 A;  2LSJ A;  3SRZ A;  4QX8 B;  1D0Z A;  3U3I A;  4MLK A;  5F3J A;  5IHY A;  2D5U A;  4BJM A;  3KVA A;  1T98 A;  3AVS A;  4V1A v;  2CLY B;  2X9X A;  3ZMV B;  4PJL A;  3KV4 A;  3C98 B;  5JR9 C;  3V5S A;  4OYK A;  2V26 A;  2KWI B;  2MOZ A;  4KMC A;  3KV9 A;  4DMV A;  2A3D A;  1HCI A;  3HR0 A;  2KZ7 B;  2UXN B;  5FYM A;  5LGT B;  3B13 A;  2CXF A;  4HEA A;  5HWY A;  3NBX X;  5KX5 E;  3MAC A;  2K48 A;  2CWY A;  5LBQ B;  3LJC A;  2VWA A;  3CQG B;  3CX7 B;  5FY7 A;  5EK4 A;  1EZ3 A;  1HG5 A;  4NUV A;  4UV8 B;  5FXX A;  3UTK A;  1HF8 A;  5JDG A;  2DI4 A;  3GWH A;  1WLX A;  4X1K E;  2YIN A;  1MIV A;  1MMA A;  4ASK A;  5HYA A;  1FEW A;  1IZN B;  3NZP A;  4P09 A;  3CX6 B;  4MBQ A;  5CA0 E;  2BVL A;  5L3G B;  1NAF A;  4PK5 A;  3HKC E;  4I50 E;  5LBM A;  5L3F B;  4EZH A;  3VKG A;  3E22 E;  5F8P A;  3KV5 A;  2WMN A;  5LHG B;  4PAG A;  5FMN A;  3PU8 A;  2X51 A;  2JPF A;  3I9W A;  1HTJ F;  3RKO A;  2HPL A;  4G2A A;  3DTO A;  1MMD A;  2LE8 A;  3O4X E;  5FNV E;  3RYC E;  2XAQ B;  3PUS A;  2KXP B;  4YJ3 E;  3ZJ1 A;  2N1G A;  3AAI A;  4YHJ A;  2UXX B;  4WW0 A;  5JQG E;  1US7 B;  2WMO A;  3PUA A;  3SWH A;  2E8I A;  3CWZ B;  5J1G A;  3ZEF B;  3ESL A;  5HXR A;  3NZQ A;  2E9X B;  1YW0 A;  3Q2M A;  3MJX A;  4H9S E;  3R84 B;  4ZI7 E;  3WAJ A;  4CI1 B;  5FXZ A;  4QX7 B;  1UCU A;  1V9D A;  1ZKE A;  4O2A E;  2VKD A;  4GK0 E;  3VHL A;  1SHZ C;  3C50 A;  1Y64 B;  4H9R C;  4G63 A;  4NUU A;  4AXP A;  4BAY B;  2LM9 A;  5JDF A;  3JC6 C;  3AA1 B;  2MBG A;  2HPJ A;  2X68 A;  2YU1 A;  4PW8 A;  4AKG A;  5JRE A;  1X79 A;  5DAB A;  2BZB A;  2K5B B;  4MHC A;  2V7J A;  4PK6 A;  5HXH A;  4WNK A;  3EDV A;  3PUQ A;  1ZV4 X;  5L3D B;  3ETV A;  2OA5 A;  3Q5W A;  2JRK A;  3CQX C;  3E08 A;  5GON E;  3PTR B;  2X9H A;  3AVR A;  5CB4 E;  3WI3 A;  3GN5 B;  4EB6 E;  3O9X A;  1CUN A;  1OWA A;  3MK7 C;  2D2S A;  4IE7 A;  4JLE A;  5DQV A;  4ANJ A;  2NTX A;  3ETU A;  4IE4 A;  1O3X A;  2CXL A;  3A5X A;  4E7S A;  3UUM A;  4IE0 A;  4DBQ A;  2I59 A;  3S4U A;  4WBO A;  2XAF B;  4EYU A;  3CX8 B;  2MYS A;  1G8X A;  1YKE B;  4HTE A;  5JH7 E;  1WRD A;  2G0U A;  3MZK B;  4CI3 B;  3C64 A;  3J9X 1;  2LEH A;  3CPZ A;  4UIG A;  3N9M A;  1YD8 G;  5LG4 A;  3ZN1 B;  5LJM A;  1QSD A;  1SA0 E;  2D0T A;  2JJ9 A;  2K9A A;  2LSI A;  3CML A;  2L8K A;  2E9X A;  2DCF A;  1S94 A;  3LK2 B;  4EOZ B;  2VKH A;  4O4J E;  4C90 A;  2GK9 A;  2Q9Q C;  4IGU A;  2X67 A;  4TZ4 C;  2NW7 A;  2WAU A;  4TV8 E;  4H9O C;  4U74 A;  2W61 A;  3IHR A;  1B7T A;  4ADZ A;  2YEV C;  5JVD E;  3KBT A;  2LSY A;  4CXY A;  5EK3 A;  3LK4 2;  3LK3 B;  4KBM B;  1BR0 A;  1IJ6 A;  2X9W A;  2IW5 B;  3Q5X A;  3FB2 A;  3P7I A;  4TUY E;  5ETW A;  3JC6 D;  2ZMA A;  4P0B A;  2EHO C;  4PJM A;  1VOM A;  3LFM A;  3N9Q A;  2JQQ A;  4EIW A;  4IHJ E;  2IC6 A;  3QUJ A;  2LSG A;  4M1P A;  4TN7 B;  4GOU A;  3IF8 B;  2YU2 A;  3GN5 A;  1BR4 A;  2IC9 A;  2XTL A;  3RYH E;  2H7V C;  3NRX A;  3C4W A;  1FMV A;  2KLQ A;  3BQI A;  2ZM2 A;  4PJJ A;  3F2E A;  3UFE A;  4DMW A;  3DP7 A;  3NRY A;  3RX6 A;  3FHN A;  2CWO A;  2PFV A;  3OJA A;  3OYZ A;  2WWU A;  4QHO A;  1WR6 A;  4JEH B;  1H7C A;  3N9L A;  1D0X A;  2HH7 A;  2VKO A;  5LGU B;  5J2U E;  3PUG A;  2CMR A;  2ODV A;  1KNZ A;  4MAL A;  4AKI A;  3UUX B;  4UXN B;  5JRC B;  3RYI E;  4IE6 A;  5LYJ E;  2V7M A;  4K0U A;  4EAH A;  3M65 A;  5HXS A;  5LHH B;  1BR2 A;  3KBU A;  5HAX A;  4HKA A;  4HGA A;  5L2L A;  5LP6 E;  4ZOL E;  2C5K T;  5HWX A;  1HX8 A;  4XBF B;  4C91 A;  3HI2 A;  4ILU A;  3KV6 A;  5JR9 B;  2LSK A;  3B57 A;  5L3E B;  4JEU B;  2LOP A;  2LOS A;  4UEM A;  3OKQ A;  2VAS A;  1D0Y A;  3BK9 A;  1HS7 A;  2KMF A;  4L9I A;  4ZS3 A;  1BR1 A;  3PE0 A;  3HL6 A;  2W62 A;  3HKE E;  3I0O A;  3N2O A;  4UV9 B;  1S35 A;  2XUE A;  4P0A A;  4UVA B;  2Y48 B;  4OHF A;  2NW8 A;  4OK0 A;  2Q9Q D;  4O2B E;  4QXH B;  3AB3 B;  2X0L B;  4ZI2 C;  4BA9 A;  1LVF A;  3UUL A;  1WYC A;  2DNX A;  1E1H B;  5LXT E;  2JMH A;  3CVR A;  3C4X A;  4AQF C;  2RA1 A;  4YFS A;  5DQW A;  5ADX L;  3QC9 A;  3N9N A;  2C5I T;  4CXX A;  3KVB A;  2VL8 A;  3FBZ A;  3ZYL A;  3ZC0 A;  3LG7 A;  2EHO D;  4ERR A;  5JDH A;  2PBI A;  1ZEE A;  3FXE B;  2CXD A;  3C4Z A;  4EYY R;  1LVK A;  3L09 A;  1MIW A;  2CLY C;  4YLH A;  2XQY A;  3BQL A;  3ZMZ B;  4QKN A;  2V1D B;  3Q9D A;  2CA5 A;  2WSS V;  4A56 A;  3ZCJ A;  2XAJ B;  4PK4 A;  5A1L A;  3WAK A;  3MA9 A;  2Z6E A;  3PDY A;  4IIJ E;  4ZI3 C;  3ZMS B;  5KMG P;  3J7Y q;  5JRC A;  4IST A;  3E0Z A;  4L5G A;  1U4Q A;  3BQK A;  2ZM0 A;  3UUN A;  4DBR A;  4YJ2 E;  2K24 A;  2Y8D A;  3AAA B;  2XAS B;  3MKD A;  3TKL B;  3IEE A;  4UVB B;  3R6N A;  5JR9 A;  3RH3 A;  2VB6 A;  3EDU A;  4OYJ A;  1QUU A;  4WBN E;  5FP3 A;  2MTQ A;  1MIY A;  2VK9 A;  3ONX A;  4O4H E;  3QK6 A;  4AKH A;  2SPC A;  2J1D G;  4XAX B;  2DLR A;  2ODU A;  1NWM X;  3MXZ A;  3CQC B;  3AA6 B;  3HA4 A;  2W00 A;  3O1I A;  2C5J A;  4ZHQ E;  3C51 A;  3I9Y A;  4ISS A;  2BVM A;  3HKB E;  3ZC1 A;  1Z0P A;  2L3L A;  1D1B A;  2PG8 A;  3K3O A;  3OBV E;  4B6X A;  2X66 A;  1MMN A;  3FXD B;  3N9P A;  2Y6X A;  5AFU L;  2DWK A;  3T8O A;  3P8C D;  4X20 E;  3K3N A;  2XAG B;  1VRB A;  5LHI B;  2E9X C;  4O4L E;  1HFA A;  2JMK A;  5EK2 A;  1FIO A;  2DWG A;  4ZI2 D;  4I55 E;  2M67 A;  4CXW A;  4ZS2 A;  3AA0 B;  3KDS E;  4U72 A;  4QWN B;  5LNK A;  4UVC B;  3RYF E;  2QGS A;  1HG2 A;  1LRZ A;  4E7Z A;  3AAE B;  3AA7 B;  2D0U A;  4TV9 E;  3L3P A;  3ANW A;  2N9D A;  5J2T E;  2ZM8 A;  2V7I A;  3D0T A;  5BMV E;  2KT9 A;  2CE7 A;  4GIW A;  4XZC A;  4CI2 B;  3DJB A;  2V7L A;  3PUR A;  3ZJ2 A;  2RP4 A;  4AQG A;  1U5P A;  1AJ3 A;  4J2C A;  5JDL A;  2KIN B;  4UF0 A;  3W15 B;  3N2K E;  2PJQ A;  2XHE B;  2Q9Q B;  3FBL A;  3EVY A;  2LJL A;  4N78 D;  5FY0 A;  1MNE A;  4DVD A;  5CA1 E;  2NOX A;  3F31 A;  2CCQ A;  2NWB A;  3ZCI A;  3H3A A;  4GYS A;  1MMG A;  1FMW A;  3N2G E;  1D1C A;  3N9O A;  4AKR B;  3RRW A;  1KK7 A;  5H6Q B;  4ZI3 D;  5JDN A;  4FI5 A;  2QA7 A;  1LKX A;  4QXB B;  2H7O A;  2YK0 A;  3O1J A;  4QXC B;  3SS1 A;  4H63 H;  2CEA A;  2BDE A;  2ES0 A;  2P9B A;  3H37 A;  1IAP A;  4PNI A;  3VKH A;  2C0S A;  4OFZ A;  2EHO B;  4AQF A;  4CZZ B;  5LCY A;  3LBX B;  1D1A A;  2A2F X;  4HN9 A;  3F57 A;  4MFR A;  3ZLI A;  2X9Y A;  5H6R B;  4IDZ A;  2DHR A;  2W0G A;  4EXT A;  4F6R C;  3ZMT B;  4Z8X A;  4H63 V;  4AKL A;  1ZHC A;  3ZMU B;  5JDM A;  2KWH A;  4GK5 E;  1G73 A;  2LHR A;  4IE5 A;  4FJO A;  5JDQ A;  5FXV A;  3VU7 H;  2A72 A;  5L3C B;  3ZN0 B;  3CKD A;  3UT5 E;  5HXC A;  1UX4 A;  4TX5 A;  2L9Q A;  5KDM C;  2ZLY A;  5C8Y E;  3ZPO A;  1IJ5 A;  5M4Y A;  3O1H A;  3K8P C;  4I4T E;  5FXW A;  3ZYK A;  3ANW B;  2NTY A;  4L0R A;  3EUH A;  4PJN A;  3RPU A;  2N2N A;  2XAH B;  5DJQ C;  1YKH B;  2E9X D;  2W63 A;  2WM9 A;  5FY1 A;  2LHN A;  4DND A;  3U78 A;  2V7K A;  3GA8 A;  5LA6 E;  4PFP A;  5TAO A;  2LT3 A;  4BJN A;  4O4I E;  3ZYM A;  4H9N C;  3RRC A;  4UF0 B;  5LGN B;  4JUY A;  3HKD E;  3KFW X;  5L3B B;  2Q9Q A;  2WBL A;  3K3Q C;  4UEL A;  2NP9 A;  3OYX A;  4DO0 A;  5EZY E;  3V5U A;  4CQI A;  1WYB A;  2KND A;  4PFO A;  4X1I E;  2B1E A;  4H9Q C;  2H3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...