3B57A

Crystal structure of the lin1889 protein (q92an1) from listeria innocua. northeast structural consortium target lkr65
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
180
Chain Sequence
b'MNKEEIILSAKNWMHSHFHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDQEATKTLINWMETKEIPSELIKKIIRIIQSVSALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNPKNTTLQHFYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin1889 protein
publication title Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
total genus 61
structure length 180
sequence length 203
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3b57A01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b57A02
3DTOA 2PJQA 3B57A 3DJBA 5DQVA 5IHYA 5DQWA 2QGSA
chains in the Genus database with same CATH superfamily
4HE8A 2CBIA 3JAEA 4OHFA 5IYZE 4H9NC 4FM4B 3AEAA 2XZEA 3CQXC 3B5MA 2IC9A 1Y64B 1FVVB 5HQ0B 4ZZBA 4GK5E 3ZN1B 2IUBA 4OB2B 1WRDA 4LOCA 3UU8A 4BCNB 5L47A 4I43B 4DUZT 2XQ4A 4KRCB 2JQQA 5JDFA 4YTPA 1HX8A 2FJBA 1OKVB 4EEDA 4LF9T 3O4XE 2CYZB 5KXJA 3WVEB 2JRKA 2HN2A 3UU4A 3LK2B 2WWUA 1QSDA 4IL4A 3UUNA 3ONLC 4COFA 4CI3B 4FX3B 4EEBA 2J62A 3K1SA 3Q9DA 5EJCA 1KFYA 2CXLA 4UR9A 4HLQA 2DLRA 1YQ3A 3ONXA 4EOJB 2DXBB 3A8HB 2BKNA 3UULA 1ENWA 3I9WA 1YQ4A 5AQPB 4UV9B 4EV6A 1UGSB 5AQTB 4ROEA 4LMJA 4MFDA 4AIUA 4M6VA 3OBVE 3N9NA 4IREA 1E7PA 3ZCJA 1BR0A 2VKOA 4O2AE 2M6BA 5HXHA 3MACA 1T7SA 2OV9A 4LMKA 3RQWA 1JOWA 5KMGP 2X0LB 4X1IE 3VR9A 2KZ7B 1NAFA 3P4SA 2WBLA 5C8YE 2Y6XA 3O1HA 5HEUA 2WP9A 4HTEA 3C51A 2W2HA 2IDOB 1GY3B 3AE3A 4G2AA 3CQGB 2E9XB 5ACBA 1OIUB 4CFMB 3ZEFB 4DR5T 4LFBT 1LRZA 2N2NA 2WCAA 4LF7T 5CGMA 5AQFB 4QXBB 4IE4A 3AEBA 2XSAA 2WWVA 1TFBA 4BJMA 2MPKA 3RIUC 1M62A 4OYKA 5LJMA 2JQHA 4ADZA 1UNHD 1UUSA 2LEHA 5AQGB 2BBJA 1CUNA 5FY1A 5HXCA 1E9HB 3WAKA 4JI5T 2L8KA 1LVFA 1LKXA 2YOEA 1WR6A 3HKDE 1SHZC 3TNHB 3TN8B 4AISA 3RGFB 3EUHA 2MTQA 1CHUA 2L3LA 3GN5B 4JI4T 2UXCT 2DL1A 5IDPB 3RQUA 2CPTA 2WMAB 3LBXB 2B1EA 2XAFB 4E7SA 1E1HB 5LHHB 4NXNT 3Q5WA 4TV8E 1VOLA 1V29B 4AKHA 2VKHA 3ZYKA 2BKPA 3AAIA 3PUVF 4BCPB 4TZ4C 4EOPB 4DR6T 2VB6A 5LP6E 1H24B 4AKLA 4FJOA 4JX4A 5JDQA 2HN1A 5HBHB 2X66A 3X20B 2C5JA 4CFVB 5AQQB 1KNPA 4OGRB 2DWGA 3VR8A 4CXYA 4PNIA 4TWFA 2C5XB 1UNLD 4PFOA 3Q2MA 1VOMA 2LW4A 5JVDE 3RGLA 2P9BA 4CI1B 4ZEYA 2QRXA 3RYIE 3UU5A 1GUXA 2WPAB 2WS3A 5H6QB 3X1DA 2CWOA 1J5ET 2ODUA 4EXTA 4H9QC 1XMOT 2G0UA 1ZKEA 1IZNB 2B76A 3PUSA 4BCFB 2C6TB 3K7AM 5HVYB 3EABA 3MK7C 3AA6B 3NWIA 2QVAA 2ZM6T 4IDZA 2Z6EA 4J2CA 4ZGEB 2DWKA 2C5NB 2NR4A 1T8BA 4BCGB 4CXWA 3P4WA 2E2AA 2CJMB 3F57A 4IDNA 1MNEA 5FYMA 4TNVA 1ZP0A 3E22E 3FZMB 3FZKB 4DMVA 1OEDE 3TLSA 3RKOA 2V8SV 4QXCB 3RC8A 3R84B 2CBJA 2WY2A 3ZC1A 5EK2A 4B3ST 4OB1B 1US7B 4YJ2E 2V6XA 2YKSA 3IHRA 4HWIB 2A3DA 1AD6A 2V7MA 3DTOA 2WB5A 2W63A 3BQKA 4H9SE 4EC8B 2XAQB 4YTMA 5JTGA 4QKNA 3RHWA 3HKBE 2JQKA 2XTLA 4AKRB 5JDHA 1OL2B 2G9XB 1ZV4X 5M4YA 2XUEA 1ZEEA 4YC3B 4IGUA 2K24A 1PKDB 4OK0A 3V5SA 4YHJA 4XZCA 3T8OA 1J1JA 2CZ0B 3NVOA 3P8CD 1OXZA 3RIFA 3OYXA 3JC6D 3MXZA 2JMKA 4IDQA 3ZLIA 2PG8A 4EOLB 2LSYA 4UVCB 2IN3A 4ILAA 2W2UA 5AQJB 4U72A 1G73A 2LKHA 3I1AA 4A5XA 4F8HA 5CA0E 2PHGA 4JI1T 3ETVA 3QYHB 2CCQA 3MZKB 2KINB 3BG3A 4DNDA 2DMEA 3AECA 3SWHA 1MNDA 4ZS3A 3P50A 4ILBA 4P09A 4NPPA 4EAHA 2PTFA 5HXRA 4AQYT 3BG5A 4QH1A 3IBPA 4F6SB 1WCRA 2UUBT 4BCND 2E9XC 2XPKA 3VRBA 2DD5B 1O3XA 3NDQA 2SPCA 5LBQB 2W0GA 4BCOB 3CK6A 3QOFA 2UZEB 2VVNA 5DQVA 5L4EA 3P4PA 4A56A 3A8MB 5E0OA 4KBMB 4EONB 1XO2A 2ZM8A 5ABFA 4JI8T 2EHOD 4HEAA 3H3AA 2LRLA 3ZN0B 4BCJB 2X68A 5DQWA 2N1GA 2UUCT 5EK4A 3PV0F 3TW6A 4PFPA 3O9XA 3PTRB 4JYAT 1W9RA 1WR0A 1GUXB 1JKWA 1AHJB 4BY1X 2FJAA 2X1NB 2FUPA 5JRCB 1V9DA 1F5QB 1BR2A 1YKEB 3AE1A 4X1YE 3AA7B 3QYBA 3GN5A 4BCQB 1U4QA 3I0OA 3LFMA 2YEVC 2PJQA 2HHHT 3KFWX 3LBXA 3O1JA 5LG4A 3KINB 5L3DB 3T1YT 2WIHB 4TX5A 3FXEB 1MMDA 3DJBA 2A2FX 2D0TA 3ZJ1A 2UXNB 3ZMZB 4IHJE 4CN1A 2AHJB 3AE9A 4IE7A 2V5DA 3P4QA 2IVXA 2JJ9A 4O4LE 1OEDB 4XAXB 3L39A 2N9DA 5JDGA 4H9PC 4GKJT 3DP7A 1XNQT 4DO0A 5GONE 3EJ1B 5LNKA 1P5EB 3HHTB 1KF6A 2WXVB 2CXFA 3BHVB 3RLFF 2ES0A 4KHPT 3IEEA 2YN6A 3EVYA 4ZI3D 2HPLA 1S35A 4TWHA 5KX5E 4A97A 5JDMA 3A8YC 4GOUA 2H7OA 4UVBB 3H37A 1HNWT 2K3WA 3CX6B 1KNRA 3DDPB 2XHEB 1YXRA 1OGUB 3I9YA 4JLEA 4BCMD 3Q5XA 2X9HA 3CPZA 5J2UE 1HNXT 2I6HA 3MKDA 2NTYA 4K0UA 2BS4A 2RP4A 4EC9B 2WMNA 2WAUA 4ZS2A 1D0YA 2XSBA 4CRLB 5DJQC 1MMNA 1H28B 4EOMB 4TWDA 1LVKA 4DV3T 1TD6A 2DNXA 3X24B 3AE4A 5HBEB 2ZCFB 4ANJA 3VYHB 3M3ZB 3AE7A 2ODVA 3SFEA 2RPAA 4JI0T 3RRWA 3UFGA 3JADA 4CQIA 3GWHA 4QXHB 5LGNB 3PURA 2X67A 3J7Yq 3QHWB 1QLBA 4DBRA 5J1GA 3K3OA 2A72A 1ZHCA 4PJNA 2ZPBB 4CFUB 1KK7A 2LJLA 3GMIA 3X26B 2IMLA 2VKDA 3VKGA 1W09A 2YINA 1UURA 3C64A 4RODA 3K3NA 2J4GA 3ZMTB 1OKWB 2X9YA 2V7KA 4U3CA 3KBTA 1VCSA 4YOOA 2HH7A 5L3FB 3W15B 4UELA 3BQIA 1E2AA 5IHYA 4BJNA 5ABFB 1MIWA 3QYGB 1XZYA 5ADXL 2ZPFB 3F5XB 2L9QA 3N5LA 3L09A 1UGRB 3EI0A 4WW0A 2XAGB 5JH7E 2BS2A 4GYRA 2QYWA 1D1CA 2D0UA 4YSZA 4UF0B 1I94T 5LQFB 1W98B 4QH5A 3AE2A 4H63V 3VHLA 1VYWB 5C2TA 2QQ8A 3L8RA 2CHNA 3LDQB 4IDOA 1GQEA 2CRBA 3VKHA 3FHNA 5KDMC 3TW7A 5J0ZA 4ERRA 4ZGDB 1HTJF 2KLQA 4TTHA 4OX9T 3ONJA 2WSSV 4F7SB 3SRZA 2CHOA 1OL1B 2PK9B 2LHRA 4IDPA 2LOSA 4G6LB 3OJAA 2W9FA 3BLRB 5L4HA 5JR9B 2NW8A 4LF8T 4HFEA 4L5GA 2C5VB 4GIWA 1NEKA 2PBIA 4LF6T 4DV6T 5L3CB 2V7JA 4Z8XA 5FMNA 2LKGA 5FGKB 4Z90A 4NXMT 3HO8A 2V7IA 3NZPA 3EAMA 4UIGA 5HEGA 5LBMA 2NW7A 4BCIB 2QFZA 1EZ3A 2XM1A 1KXUA 4F7JB 2Q9QD 1KEYA 3POMA 1OWAA 2H7VC 3UQ7A 4KI0F 4QHOA 4LFCT 2CCIB 4EORB 2CWYA 2MBGA 4ROCA 4JEHB 5EFQB 3ANWB 2B9RA 3QZ9B 3AEDA 4Z6YA 4JI3T 2DXCB 3HB9A 4UEMA 2FJDA 2IHR1 4BAYB 2WJ9A 5JRCA 3RPUA 1SUMB 5LYJE 1BR4A 2H3RA 1MMGA 1O9KB 1MMAA 4KX6A 1OEDC 4IT4A 4NUVA 3AAAB 1FJGT 4F7NB 5LHGB 3N2OA 2IAKA 1FINB 1D1AA 2OA5A 2IW5B 5AFUL 3E0ZA 5EK3A 5LCYA 4YFSA 2ACZA 2VVSA 4CXAB 2C5OB 1J5WA 3PU8A 4MFRA 3TLVA 2VL8A 4DV5T 2D5UA 4GYSA 1JNZA 4MBQA 2KXPB 3OPCA 4X62T 1UGQB 4P1NA 1OEDA 3F31A 4ZI2C 3KV5A 4UN0A 1HX1B 4TN7B 1U5PA 5IF1B 5C3JA 4I55E 4HNTA 1L0VA 3PUYF 5AQMB 1N33T 3GA8A 1H26B 4QX8B 2QDYB 4C90A 3TLTA 2R7GA 4HNUA 2ZLYA 1W0AA 4Q25A 2PMIB 4H9OC 3LK3B 1IBKT 2NWBA 4JV5T 5ABHA 4YOZA 4N78D 5LHIB 4B3RT 3PE0A 1OIYB 4OB0B 3RYFE 2I53A 2CM0A 2W66A 2W9ZA 5JDNA 3C4WA 1JSUB 4JUYA 2CZ1B 4DR7T 2LHNA 2X9WA 2BG9C 3NRXA 3RF1A 2XQ6A 2WIPB 5L3GB 4HGAA 2CZ6B 3BG9A 2MOZA 1HCIA 4HWDA 4HFVA 3G06A 2UXBT 2YU1A 3JCFA 2JQ9A 4O4JE 5L3BB 4F6WB 2KT9A 3MY1B 3M65A 5EZYE 4CN4A 4HKAA 1HNZT 3LQ5B 2F2CA 2IW6B 2NOXA 5FVKA 4CFXB 2XQ7A 4U2YA 2BG9E 1HS7A 2J47A 4HL4A 2BG9A 3ZC0A 2XAHB 1JNRA 3NBXX 5H6RB 2X0YA 5HYAA 4ILCA 4DR2T 3AB3B 2ZPEB 4YXDA 1IJ5A 2WDQA 1YW0A 2DHRA 4Z91A 5LXTE 2XY8B 3PDYA 5I5ZB 3DDQB 2KSRA 1BU2A 2LM9A 2LSIA 4EOIB 2IC6A 4HFBA 3KV9A 2K48A 4ISSA 2EHOA 2CXDA 5CFBA 5ICPB 2W00A 1H1SB 4P0AA 4LF4T 3U3IA 2YU2A 3K3QC 3PJAA 3N2KE 1Z8UA 2VL0A 4F6UB 3H4CA 5CB4E 4NC6A 1HR0T 5FXXA 2UXXB 2Y8DA 3KVBA 3IF8B 5L3EB 2WDVA 4TUYE 5FVLA 4AQFC 4CZZB 2WU5A 4X20E 4BCHB 5JDLA 1HFAA 1X79A 3G33B 4U31A 3A8OB 3VRAA 4UF0A 3QYEA 4NUUA 5CA1E 2XASB 5JR9C 4ISTA 4YSYA 2XQ8A 4BXXX 4HFDA 2IW8B 1WYCA 3UU6A 3PUZF 5BMVE 5LG3A 3KBUA 2I0MA 5IUXA 3UT5E 4ZGJB 4AQFA 5DABA 4EZHA 2NP9A 1SE7A 4E7ZA 2E9XD 5FKYA 3H3MA 3AEEA 3TNIB 2LSJA 3MJXA 4I0UA 1XMQT 3CX8B 3AEFA 2IIUA 4DV1T 5JR9A 2XQAA 4ZOLE 1H25B 1QUUA 4BY7X 3FB2A 3V5UA 4JX6A 2AXDS 3AXJA 3TLUA 3QWLA 4QH4A 4PK5A 3N9QA 4AKIA 1VRBA 3P4RA 3PUAA 3F2EA 3AA0B 4I4TE 2VURA 2E5VA 2QF7A 2YDQA 4HFHA 2BVMA 3WI3A 3WAJA 2EUFA 4AKGA 3BLHB 3Q5EA 2OLTA 2VK9A 5HCMA 3C50A 3HR0A 5LA6E 3KV6A 5FXZA 3UUBA 2PFVA 1UX4A 1AISB 3ZMUB 4DR4T 1KNZA 4IMYB 4ZXLA 3VU7H 1D0ZA 3HL6A 2VKJA 4H63H 4BBSM 5AQHB 3ANWA 3ETUA 4UV8B 4A98A 2JGZB 2GK9A 2CE7A 5AQLB 3N2GE 4X1KE 2UU9T 3BQLA 4JEUB 2ZPIB 1VCTA 1MIVA 2CLYB 1O9KA 2ZZDB 3FZHB 3ZSTA 5LMUT 2I59A 4QWNB 2BPMB 3T1HT 1Z0PA 4IE6A 1H4LD 2XJ7A 3LG7A 3S4UA 3RYCE 4QX7B 4EOSB 3ZT5A 1IAPA 4O4HE 4KP3C 5BR8T 3EOCB 4XBFB 2ZPHB 4HNVA 4B3MT 3B57A 2E5LT 1FEWA 4MHCA 3HBLA 2C5KT 4CI2B 4PJMA 3M03A 2RA1A 2XQ5A 4JI2T 3HA4A 3ZT6A 4U7YA 4C91A 3OYZA 4TNWA 4EOKB 1N32T 2BG9B 2X0HA 3ESLA 1AJ3A 4YT0A 4YHHT 3OVUA 3AAEB 4OYJA 5FXWA 5TAOA 3N9PA 5AQIB 1OI9B 3WVDB 5HWXA 4YY3T 1H27B 1R8IA 1D0XA 3CQCB 4YSXA 4QSHA 3MY5B 5FXVA 3SFDA 5IDNB 5FY0A 2EHOB 2H88A 1BR1A 3NKZA 4EIWA 2UUEB 1WFDA 2FJEA 4OFZA 1YKHB 3BLQB 3ZJ2A 3Q5DA 4AXPA 2A9UA 5AQNB 5HEOA 1UNGD 1MIYA 1HG2A 2WHBB 5LOVE 4CFWB 2KMGA 4KUMB 4GKKT 1Y01A 2V5CA 2V26A 4X5TA 2QA7A 3AA1B 2YDSA 5ETWA 3PUXF 4EGWA 3N9MA 4KMCA 4IE0A 2CEAA 4DVDA 3TNWB 5LB7B 1XNRT 1G3NC 4BA9A 5HBJB 2F4VT 4P0BA 1UCUA 2UUAT 5F3JA 3K8PC 2Q9QC 2WQYA 4X66T 4K0KT 4ILUA 1UGPB 3HZJA 4ZI7E 3O0GD 1T72A 4HN9A 2DCFA 2DD4B 2Y48B 4LMLA 3UQ4A 1SA0E 2LT3A 4UVAB 5JREA 2WDRA 4PJJA 5F5WA 5IWAT 3C98B 3CMLA 2LE8A 4I3ZB 3O1IA 3MA9A 3EHZA 2G77A 3X25B 2D2SA 3UTKA 2Q9QA 2UZDB 2XAJB 2XQ9A 3AXJB 3UUXB 2JIWA 5HEHA 4JI6T 2W96A 2BZBA 5HEJA 1N4MA 2YDRA 3RIUA 4ELJA 2BBHA 2ZMAA 2D0QB 2J1DG 4H9RC 3JAFA 4G63A 2HPJA 4EOOB 5L2LA 3KVAA 3BHTB 3PJAJ 4O2BE 5FY7A 2JPFA 5AQKB 4BCMB 4O4IE 4WBOA 5LGUB 4PAGA 2LRKA 1JSTB 2WU2A 3PUGA 4CFNB 3ZCIA 3A8LB 5HNBB 4MLKA 4TV9E 3KHIA 2BVLA 1FKMA 1UX5A 2E8IA 3QHRB 2C4GB 3LSVA 4JX5A 4U7IA 2V6YA 4WYVA 3N9LA 2PK2A 4ELLA 1M7KA 4PK4A 1IBMT 1FIOA 2I40B 5LMKB 3FBLA 4II5B 4PW8A 5LJNA 3PO3S 1VINA 2V22B 3RKGA 5BNJB 2BKOA 2C0SA 2ACXA 4HWCA 3CX7B 3JC6C 2NW9A 4ZZCA 4YTNA 1URCB 2AE9A 3AVRA 2UZBB 2WZIA 4U2ZA 5AQSB 4KHZF 1X9BA 4BCKB 3TLWA 5CJ5A 2LLYA 3QXEB 3AEGA 1T98A 3ZSSA 3RC3A 4EZ4A 2KMFA 2CLYC 4AQGA 1GH6B 3DOGB 1S94A 3FBZA 1IBLT 3UUMA 2CCHB 1NWMX 5AQOB 3ZKRA 3ZMVB 3QNUA 4BCQD 3FZFB 4U74A 3R6NA 3C4ZA 3QUJA 3EDUA 2QDJA 5L2WB 4IIJE 2LM2A 2ZPGB 4OR5B 3RX6A 3FXDB 3RRCA 1H1RB 2H89A 3MIAB 5FP3A 3EIDB 1H1QB 4ZHQE 4DV4T 4X65T 4F70B 4M1PA 4BBRM 3OTOT 1UGOA 3QB5K 2MYSA 1UK5A 4CXXA 3LJCA 3MI9B 3J9X1 3RIAA 2KNDA 3BHUB 4YJ3E 4F6RC 2WFYB 4HWHA 3TKLB 4B6XA 1HF8A 5LGTB 2C5IT 2WM9A 3AVSA 4V1Av 4DMWA 2X51A 1YD8G 4MFEA 3EDVA 2WZHA 4DV0T 3ZMSB 2K5BB 3X28B 4JI7T 5AQUB 2W4XA 3QB5A 2ZM2A 3A7MA 3HKEE 2EHOC 4UXNB 2KWIB 4ZI2D 5AQVB 1H1PB 1FMVA 1I6ZA 3E08A 4MALA 4F7LB 2CA5A 5JQGE 4EOQB 3FZLB 3HKCE 4FI5A 2UXDT 5CYIB 2ZM0A 1WYBA 1D3UB 1ZOYA 3LK42 2LOPA 1IREB 3PU3A 4WNKA 3BK9A 2VASA 1XDOA 5HCJA 3P7IA 4IE5A 4DUYT 3VYGB 2LSGA 3QC9A 3QZ5B 5F8PA 5LMNT 4DBQA 3N9OA 3AE6A 2JMHA 2V7LA 3DL1A 2M6IA 2Q9QB 1IJ6A 3OKQA 4HWFA 3AE5A 2M67A 3L3PA 3U78A 3CWZB 2K9AA 2YK0A 4L0RA 5ABEA 5FL0A 4YLHA 2CMRA 5AQRB 3SS1A 5FNVE 1HG5A 3QK6A 3IA3A 4DV7T 3NRYA 5HXEA 2FBWA 2IW9B 4NSTB 3AE8A 3KDSE 3RI5A 1FMWA 5ABGA 3A8GB 2D9DA 3PUWF 4CFUD 2R6GF 3RH3A 4PK6A 2E9XA 4NIQA 4L9IA 4PJLA 2W62A 4B3TT 2WEVB 3C4XA 3ZYMA 1QMZB 2BKZB 2X9XA 5J2TE 2QGSA 4MIMA 4ZI3C 3ZT7A 3CIRA 4DR1T 5HXSA 3CVRA 1ZP2A 3ABVA 3CKDA 2V6YB 1NENA 4EYYR 4DV2T 4ASKA 3B13A 4OB3B 2VQFT 4HFCA 4CN6A 2W99A 3SOLA 2XQ3A 4X64T 5FL1A 5CEIB 4JBWF 2KWHA 5HWYA 4DR3T 5HAXA 3KV4A 4GK0E 2W67A 3HI2A 3RYHE 4AI6A 4U33A 4DIDB 4EOZB 1N36T 2VWAA 3D0TA 2KR6A 2V1DB 2BDEA 4HFIA 2LSKA 4Y72B 2NTXA 5A1LA 4LF5T 4IL9A 2W61A 1XDPA 4KRDB 4O8SA 4EB6E 2DI4A 2WMOA 2CZ7B 4WBNE 2VQET 2BS3A 2XM2A 2DPPB 1G8XA 3ZPOA 1D1BA 3NZQA 2UZLB 4WZXA 1WLXA 1H7CA 1W0BA 3UU3A 4LFAT 1C9BA 4I50E 3PUQA 1XWMA 1B7TA 1DU2A 2WMBB 3GTMS 3A5XA 4YOSA 4EYUA 2XQYA 2MAWA 1N34T 3I0QA 3ZYLA 3UFEA
chains in the Genus database with same CATH topology
4HN9A 1U5PA 4TN7B 2DCFA 2Y48B 4HE8A 4I55E 4A56A 4OHFA 5IYZE 4H9NC 3GA8A 1SA0E 3CQXC 2IC9A 1Y64B 2LT3A 4QX8B 5E0OA 4UVAB 4C90A 5JREA 4KBMB 4PJJA 4GK5E 3ZN1B 2ZM8A 2ZLYA 1WRDA 2EHOD 3C98B 4HEAA 4H9OC 3CMLA 3H3AA 2LE8A 3LK3B 4I43B 3O1IA 2NWBA 3MA9A 2JQQA 2D2SA 3UTKA 5JDFA 3ZN0B 1HX8A 2Q9QA 4N78D 2X68A 2XAJB 3UUXB 5DQWA 3O4XE 5LHIB 2N1GA 3PE0A 2JRKA 5EK4A 2BZBA 3LK2B 3RYFE 4PFPA 2WWUA 1QSDA 3UUNA 3O9XA 2CM0A 4CI3B 2ZMAA 3PTRB 2J1DG 4H9RC 5JDNA 3C4WA 4JUYA 3Q9DA 4G63A 2HPJA 2LHNA 2CXLA 2DLRA 3ONXA 2X9WA 3NRXA 5L2LA 5JRCB 1V9DA 3KVAA 4O2BE 1BR2A 5FY7A 1YKEB 2JPFA 3UULA 5L3GB 4X1YE 4HGAA 3AA7B 4O4IE 3I9WA 2MOZA 4WBOA 1HCIA 3GN5A 4HFVA 5LGUB 4PAGA 1U4QA 3I0OA 2YU1A 3LFMA 4UV9B 2YEVC 2PJQA 3KFWX 3LBXA 4O4JE 3O1JA 5L3BB 5LG4A 2KT9A 3M65A 3KINB 5EZYE 3PUGA 3OBVE 4HKAA 5L3DB 3N9NA 4TX5A 3FXEB 1MMDA 2NOXA 3DJBA 3ZCIA 3ZCJA 2A2FX 2D0TA 1BR0A 4MLKA 2VKOA 4O2AE 4TV9E 3ZJ1A 5HXHA 1HS7A 3MACA 2BVLA 2UXNB 3ZMZB 4IHJE 5KMGP 1UX5A 2E8IA 2X0LB 4IE7A 3ZC0A 4X1IE 2XAHB 2KZ7B 1NAFA 3NBXX 5H6RB 5HYAA 2JJ9A 4O4LE 3N9LA 4XAXB 2WBLA 5C8YE 2N9DA 2Y6XA 3O1HA 3AB3B 5JDGA 4PK4A 4H9PC 1IJ5A 1FIOA 3DP7A 4HTEA 3FBLA 1YW0A 2DHRA 3C51A 4PW8A 5LJNA 4DO0A 5LXTE 5GONE 4G2AA 3CQGB 5LNKA 2E9XB 3PDYA 2C0SA 2ACXA 3CX7B 3JC6C 2CXFA 2NW9A 3ZEFB 1LRZA 2ES0A 2LM9A 2LSIA 2IC6A 2N2NA 3IEEA 3KV9A 2K48A 4ISSA 2EHOA 3AVRA 3EVYA 2CXDA 4ZI3D 2HPLA 1S35A 5KX5E 2W00A 5JDMA 4QXBB 4P0AA 1T98A 4IE4A 4GOUA 2H7OA 4UVBB 3RC3A 4EZ4A 3H37A 3U3IA 2KMFA 2YU2A 2CLYC 3K3QC 4BJMA 4AQGA 3CX6B 3N2KE 4OYKA 5LJMA 2XHEB 1S94A 3FBZA 3I9YA 4JLEA 3UUMA 5CB4E 3Q5XA 4ADZA 1NWMX 5FXXA 2UXXB 2X9HA 3ZMVB 2Y8DA 2LEHA 3KVBA 3IF8B 5L3EB 4U74A 1CUNA 5FY1A 3CPZA 4TUYE 3R6NA 5HXCA 5J2UE 3WAKA 2L8KA 4AQFC 3C4ZA 4CZZB 1LVFA 1LKXA 3HKDE 1WR6A 3EDUA 3MKDA 3QUJA 4X20E 1SHZC 2NTYA 4K0UA 4IIJE 5JDLA 3RX6A 2RP4A 3FXDB 1HFAA 2WMNA 2WAUA 3EUHA 4ZS2A 1X79A 5FP3A 3RRCA 1D0YA 2MTQA 2L3LA 3GN5B 4ZHQE 4UF0A 5DJQC 4NUUA 1MMNA 5CA1E 2XASB 5JR9C 1LVKA 3LBXB 4M1PA 2B1EA 4ISTA 2DNXA 2XAFB 4E7SA 1E1HB 2MYSA 4CXXA 5LHHB 3LJCA 4ANJA 3J9X1 3Q5WA 4TV8E 2KNDA 2ODVA 4YJ3E 1WYCA 3RRWA 4AKHA 2VKHA 3ZYKA 4CQIA 3GWHA 4QXHB 5BMVE 5LGNB 4F6RC 3AAIA 3KBUA 4TZ4C 3UT5E 4AQFA 3TKLB 5DABA 2VB6A 3PURA 4EZHA 5LP6E 2NP9A 2X67A 4B6XA 4AKLA 1HF8A 4FJOA 4E7ZA 2E9XD 3J7Yq 5JDQA 5LGTB 2C5IT 2WM9A 4DBRA 3AVSA 2X66A 4V1Av 5J1GA 3K3OA 4DMWA 2C5JA 2X51A 2LSJA 1YD8G 3MJXA 3CX8B 5JR9A 2A72A 1ZHCA 3EDVA 4PJNA 3ZMSB 2K5BB 2DWGA 4ZOLE 1KK7A 1QUUA 2LJLA 4CXYA 3FB2A 3V5UA 2ZM2A 3GMIA 3HKEE 4PNIA 2EHOC 4UXNB 2KWIB 2VKDA 3VKGA 4PFOA 4ZI2D 1FMVA 4PK5A 2YINA 3N9QA 3Q2MA 3E08A 4AKIA 1VRBA 1VOMA 4MALA 3C64A 2CA5A 3K3NA 5JVDE 5JQGE 3PUAA 2P9BA 3ZMTB 4CI1B 3F2EA 2X9YA 3AA0B 4I4TE 2V7KA 3KBTA 3RYIE 3HKCE 4FI5A 5H6QB 3WI3A 2BVMA 3WAJA 2HH7A 5L3FB 2CWOA 3W15B 2ODUA 4EXTA 2ZM0A 4AKGA 1WYBA 4H9QC 2G0UA 1ZKEA 1IZNB 3LK42 2LOPA 2VK9A 3PUSA 3C50A 3HR0A 4UELA 5LA6E 3PU3A 3KV6A 4WNKA 3BK9A 3BQIA 5FXZA 2VASA 5IHYA 4BJNA 3P7IA 2PFVA 3MK7C 4IE5A 3AA6B 1MIWA 1UX4A 3ZMUB 1KNZA 2LSGA 3QC9A 4IDZA 3VU7H 5ADXL 1D0ZA 5F8PA 2L9QA 3HL6A 3L09A 3N5LA 2VKJA 2Z6EA 4J2CA 4H63H 4DBQA 2DWKA 3N9OA 2JMHA 2V7LA 3ANWA 3ETUA 4UV8B 4WW0A 2XAGB 5JH7E 4GYRA 2GK9A 2Q9QB 4CXWA 1D1CA 2CE7A 1IJ6A 2D0UA 3N2GE 4X1KE 3OKQA 4UF0B 2M67A 3L3PA 3BQLA 4JEUB 3F57A 3U78A 3CWZB 2K9AA 1MNEA 5FYMA 1MIVA 2CLYB 2YK0A 4H63V 4L0RA 3VHLA 3E22E 2I59A 4DMVA 4YLHA 2CMRA 4QWNB 3SS1A 3RKOA 4QXCB 5FNVE 1HG5A 1Z0PA 3RC8A 3R84B 3QK6A 4IE6A 3NRYA 3ZC1A 5EK2A 3FHNA 3LG7A 3S4UA 5KDMC 5HXEA 3VKHA 3RYCE 4QX7B 1US7B 4YJ2E 3KDSE 4ERRA 1FMWA 3IHRA 1IAPA 1HTJF 2A3DA 2KLQA 2V7MA 3RH3A 4O4HE 3DTOA 4KP3C 4PK6A 2E9XA 4XBFB 2WSSV 2W63A 3SRZA 3BQKA 4L9IA 2LHRA 4PJLA 2W62A 4H9SE 2XAQB 3B57A 2LOSA 3OJAA 4QKNA 3C4XA 1FEWA 3ZYMA 3HKBE 5JR9B 2NW8A 4MHCA 2C5KT 2XTLA 4CI2B 4PJMA 4AKRB 5JDHA 4L5GA 4GIWA 1ZV4X 2RA1A 5M4YA 2PBIA 3HA4A 2XUEA 1ZEEA 4C91A 2X9XA 3OYZA 5J2TE 4IGUA 2QGSA 4ZI3C 5L3CB 2K24A 2V7JA 4Z8XA 5FMNA 3ESLA 4OK0A 3V5SA 4YHJA 4XZCA 3T8OA 3CVRA 5HXSA 1AJ3A 3CKDA 4EYYR 2V7IA 4ASKA 3NZPA 3AAEB 3P8CD 3B13A 1OXZA 4UIGA 3OYXA 4OYJA 3JC6D 5FXWA 5LBMA 5TAOA 3N9PA 2NW7A 3MXZA 3SOLA 1EZ3A 2JMKA 3ZLIA 2PG8A 2LSYA 5HWXA 4UVCB 2Q9QD 1OWAA 2H7VC 2KWHA 5HWYA 1D0XA 4QHOA 4U72A 3CQCB 2CWYA 2MBGA 5HAXA 1G73A 3KV4A 5FXVA 3I1AA 4GK0E 5FY0A 2EHOB 3HI2A 3RYHE 4AI6A 4JEHB 3ANWB 5CA0E 1BR1A 4EIWA 3ETVA 4EOZB 4UEMA 4OFZA 1YKHB 2CCQA 2VWAA 3D0TA 3ZJ2A 4AXPA 2V1DB 4BAYB 3MZKB 2BDEA 5JRCA 2KINB 2LSKA 3RPUA 5LYJE 1BR4A 2NTXA 4DNDA 2H3RA 5A1LA 1MMGA 1MMAA 1MIYA 3SWHA 1MNDA 4ZS3A 1HG2A 5LOVE 2W61A 4NUVA 4P09A 3AAAB 4EAHA 4O8SA 4EB6E 2DI4A 2WMOA 3N2OA 2IAKA 4KUMB 5HXRA 2V26A 5LHGB 1D1AA 2QA7A 3AA1B 5ETWA 2OA5A 4WBNE 3IBPA 2IW5B 5AFUL 3E0ZA 3N9MA 5EK3A 4KMCA 5LCYA 1G8XA 4IE0A 2E9XC 2CEAA 4YFSA 4DVDA 3ZPOA 1D1BA 3NZQA 3PU8A 4BA9A 4MFRA 1WLXA 1H7CA 2VL8A 4P0BA 1O3XA 2D5UA 1UCUA 4GYSA 2SPCA 5F3JA 4MBQA 5LBQB 4I50E 3PUQA 2W0GA 2KXPB 1B7TA 3K8PC 2Q9QC 3A5XA 4EYUA 4ILUA 2XQYA 5DQVA 3F31A 4ZI2C 3I0QA 3KV5A 4ZI7E 3ZYLA 3UFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTO A;  2PJQ A;  3B57 A;  3DJB A;  5DQV A;  5IHY A;  5DQW A;  2QGS A; 
#chains in the Genus database with same CATH topology
 4HE8 A;  2CBI A;  3JAE A;  4OHF A;  5IYZ E;  4H9N C;  4FM4 B;  3AEA A;  2XZE A;  3CQX C;  3B5M A;  2IC9 A;  1Y64 B;  1FVV B;  5HQ0 B;  4ZZB A;  4GK5 E;  3ZN1 B;  2IUB A;  4OB2 B;  1WRD A;  4LOC A;  3UU8 A;  4BCN B;  5L47 A;  4I43 B;  4DUZ T;  2XQ4 A;  4KRC B;  2JQQ A;  5JDF A;  4YTP A;  1HX8 A;  2FJB A;  1OKV B;  4EED A;  4LF9 T;  3O4X E;  2CYZ B;  5KXJ A;  3WVE B;  2JRK A;  2HN2 A;  3UU4 A;  3LK2 B;  2WWU A;  1QSD A;  4IL4 A;  3UUN A;  3ONL C;  4COF A;  4CI3 B;  4FX3 B;  4EEB A;  2J62 A;  3K1S A;  3Q9D A;  5EJC A;  1KFY A;  2CXL A;  4UR9 A;  4HLQ A;  2DLR A;  1YQ3 A;  3ONX A;  4EOJ B;  2DXB B;  3A8H B;  2BKN A;  3UUL A;  1ENW A;  3I9W A;  1YQ4 A;  5AQP B;  4UV9 B;  4EV6 A;  1UGS B;  5AQT B;  4ROE A;  4LMJ A;  4MFD A;  4AIU A;  4M6V A;  3OBV E;  3N9N A;  4IRE A;  1E7P A;  3ZCJ A;  1BR0 A;  2VKO A;  4O2A E;  2M6B A;  5HXH A;  3MAC A;  1T7S A;  2OV9 A;  4LMK A;  3RQW A;  1JOW A;  5KMG P;  2X0L B;  4X1I E;  3VR9 A;  2KZ7 B;  1NAF A;  3P4S A;  2WBL A;  5C8Y E;  2Y6X A;  3O1H A;  5HEU A;  2WP9 A;  4HTE A;  3C51 A;  2W2H A;  2IDO B;  1GY3 B;  3AE3 A;  4G2A A;  3CQG B;  2E9X B;  5ACB A;  1OIU B;  4CFM B;  3ZEF B;  4DR5 T;  4LFB T;  1LRZ A;  2N2N A;  2WCA A;  4LF7 T;  5CGM A;  5AQF B;  4QXB B;  4IE4 A;  3AEB A;  2XSA A;  2WWV A;  1TFB A;  4BJM A;  2MPK A;  3RIU C;  1M62 A;  4OYK A;  5LJM A;  2JQH A;  4ADZ A;  1UNH D;  1UUS A;  2LEH A;  5AQG B;  2BBJ A;  1CUN A;  5FY1 A;  5HXC A;  1E9H B;  3WAK A;  4JI5 T;  2L8K A;  1LVF A;  1LKX A;  2YOE A;  1WR6 A;  3HKD E;  1SHZ C;  3TNH B;  3TN8 B;  4AIS A;  3RGF B;  3EUH A;  2MTQ A;  1CHU A;  2L3L A;  3GN5 B;  4JI4 T;  2UXC T;  2DL1 A;  5IDP B;  3RQU A;  2CPT A;  2WMA B;  3LBX B;  2B1E A;  2XAF B;  4E7S A;  1E1H B;  5LHH B;  4NXN T;  3Q5W A;  4TV8 E;  1VOL A;  1V29 B;  4AKH A;  2VKH A;  3ZYK A;  2BKP A;  3AAI A;  3PUV F;  4BCP B;  4TZ4 C;  4EOP B;  4DR6 T;  2VB6 A;  5LP6 E;  1H24 B;  4AKL A;  4FJO A;  4JX4 A;  5JDQ A;  2HN1 A;  5HBH B;  2X66 A;  3X20 B;  2C5J A;  4CFV B;  5AQQ B;  1KNP A;  4OGR B;  2DWG A;  3VR8 A;  4CXY A;  4PNI A;  4TWF A;  2C5X B;  1UNL D;  4PFO A;  3Q2M A;  1VOM A;  2LW4 A;  5JVD E;  3RGL A;  2P9B A;  4CI1 B;  4ZEY A;  2QRX A;  3RYI E;  3UU5 A;  1GUX A;  2WPA B;  2WS3 A;  5H6Q B;  3X1D A;  2CWO A;  1J5E T;  2ODU A;  4EXT A;  4H9Q C;  1XMO T;  2G0U A;  1ZKE A;  1IZN B;  2B76 A;  3PUS A;  4BCF B;  2C6T B;  3K7A M;  5HVY B;  3EAB A;  3MK7 C;  3AA6 B;  3NWI A;  2QVA A;  2ZM6 T;  4IDZ A;  2Z6E A;  4J2C A;  4ZGE B;  2DWK A;  2C5N B;  2NR4 A;  1T8B A;  4BCG B;  4CXW A;  3P4W A;  2E2A A;  2CJM B;  3F57 A;  4IDN A;  1MNE A;  5FYM A;  4TNV A;  1ZP0 A;  3E22 E;  3FZM B;  3FZK B;  4DMV A;  1OED E;  3TLS A;  3RKO A;  2V8S V;  4QXC B;  3RC8 A;  3R84 B;  2CBJ A;  2WY2 A;  3ZC1 A;  5EK2 A;  4B3S T;  4OB1 B;  1US7 B;  4YJ2 E;  2V6X A;  2YKS A;  3IHR A;  4HWI B;  2A3D A;  1AD6 A;  2V7M A;  3DTO A;  2WB5 A;  2W63 A;  3BQK A;  4H9S E;  4EC8 B;  2XAQ B;  4YTM A;  5JTG A;  4QKN A;  3RHW A;  3HKB E;  2JQK A;  2XTL A;  4AKR B;  5JDH A;  1OL2 B;  2G9X B;  1ZV4 X;  5M4Y A;  2XUE A;  1ZEE A;  4YC3 B;  4IGU A;  2K24 A;  1PKD B;  4OK0 A;  3V5S A;  4YHJ A;  4XZC A;  3T8O A;  1J1J A;  2CZ0 B;  3NVO A;  3P8C D;  1OXZ A;  3RIF A;  3OYX A;  3JC6 D;  3MXZ A;  2JMK A;  4IDQ A;  3ZLI A;  2PG8 A;  4EOL B;  2LSY A;  4UVC B;  2IN3 A;  4ILA A;  2W2U A;  5AQJ B;  4U72 A;  1G73 A;  2LKH A;  3I1A A;  4A5X A;  4F8H A;  5CA0 E;  2PHG A;  4JI1 T;  3ETV A;  3QYH B;  2CCQ A;  3MZK B;  2KIN B;  3BG3 A;  4DND A;  2DME A;  3AEC A;  3SWH A;  1MND A;  4ZS3 A;  3P50 A;  4ILB A;  4P09 A;  4NPP A;  4EAH A;  2PTF A;  5HXR A;  4AQY T;  3BG5 A;  4QH1 A;  3IBP A;  4F6S B;  1WCR A;  2UUB T;  4BCN D;  2E9X C;  2XPK A;  3VRB A;  2DD5 B;  1O3X A;  3NDQ A;  2SPC A;  5LBQ B;  2W0G A;  4BCO B;  3CK6 A;  3QOF A;  2UZE B;  2VVN A;  5DQV A;  5L4E A;  3P4P A;  4A56 A;  3A8M B;  5E0O A;  4KBM B;  4EON B;  1XO2 A;  2ZM8 A;  5ABF A;  4JI8 T;  2EHO D;  4HEA A;  3H3A A;  2LRL A;  3ZN0 B;  4BCJ B;  2X68 A;  5DQW A;  2N1G A;  2UUC T;  5EK4 A;  3PV0 F;  3TW6 A;  4PFP A;  3O9X A;  3PTR B;  4JYA T;  1W9R A;  1WR0 A;  1GUX B;  1JKW A;  1AHJ B;  4BY1 X;  2FJA A;  2X1N B;  2FUP A;  5JRC B;  1V9D A;  1F5Q B;  1BR2 A;  1YKE B;  3AE1 A;  4X1Y E;  3AA7 B;  3QYB A;  3GN5 A;  4BCQ B;  1U4Q A;  3I0O A;  3LFM A;  2YEV C;  2PJQ A;  2HHH T;  3KFW X;  3LBX A;  3O1J A;  5LG4 A;  3KIN B;  5L3D B;  3T1Y T;  2WIH B;  4TX5 A;  3FXE B;  1MMD A;  3DJB A;  2A2F X;  2D0T A;  3ZJ1 A;  2UXN B;  3ZMZ B;  4IHJ E;  4CN1 A;  2AHJ B;  3AE9 A;  4IE7 A;  2V5D A;  3P4Q A;  2IVX A;  2JJ9 A;  4O4L E;  1OED B;  4XAX B;  3L39 A;  2N9D A;  5JDG A;  4H9P C;  4GKJ T;  3DP7 A;  1XNQ T;  4DO0 A;  5GON E;  3EJ1 B;  5LNK A;  1P5E B;  3HHT B;  1KF6 A;  2WXV B;  2CXF A;  3BHV B;  3RLF F;  2ES0 A;  4KHP T;  3IEE A;  2YN6 A;  3EVY A;  4ZI3 D;  2HPL A;  1S35 A;  4TWH A;  5KX5 E;  4A97 A;  5JDM A;  3A8Y C;  4GOU A;  2H7O A;  4UVB B;  3H37 A;  1HNW T;  2K3W A;  3CX6 B;  1KNR A;  3DDP B;  2XHE B;  1YXR A;  1OGU B;  3I9Y A;  4JLE A;  4BCM D;  3Q5X A;  2X9H A;  3CPZ A;  5J2U E;  1HNX T;  2I6H A;  3MKD A;  2NTY A;  4K0U A;  2BS4 A;  2RP4 A;  4EC9 B;  2WMN A;  2WAU A;  4ZS2 A;  1D0Y A;  2XSB A;  4CRL B;  5DJQ C;  1MMN A;  1H28 B;  4EOM B;  4TWD A;  1LVK A;  4DV3 T;  1TD6 A;  2DNX A;  3X24 B;  3AE4 A;  5HBE B;  2ZCF B;  4ANJ A;  3VYH B;  3M3Z B;  3AE7 A;  2ODV A;  3SFE A;  2RPA A;  4JI0 T;  3RRW A;  3UFG A;  3JAD A;  4CQI A;  3GWH A;  4QXH B;  5LGN B;  3PUR A;  2X67 A;  3J7Y q;  3QHW B;  1QLB A;  4DBR A;  5J1G A;  3K3O A;  2A72 A;  1ZHC A;  4PJN A;  2ZPB B;  4CFU B;  1KK7 A;  2LJL A;  3GMI A;  3X26 B;  2IML A;  2VKD A;  3VKG A;  1W09 A;  2YIN A;  1UUR A;  3C64 A;  4ROD A;  3K3N A;  2J4G A;  3ZMT B;  1OKW B;  2X9Y A;  2V7K A;  4U3C A;  3KBT A;  1VCS A;  4YOO A;  2HH7 A;  5L3F B;  3W15 B;  4UEL A;  3BQI A;  1E2A A;  5IHY A;  4BJN A;  5ABF B;  1MIW A;  3QYG B;  1XZY A;  5ADX L;  2ZPF B;  3F5X B;  2L9Q A;  3N5L A;  3L09 A;  1UGR B;  3EI0 A;  4WW0 A;  2XAG B;  5JH7 E;  2BS2 A;  4GYR A;  2QYW A;  1D1C A;  2D0U A;  4YSZ A;  4UF0 B;  1I94 T;  5LQF B;  1W98 B;  4QH5 A;  3AE2 A;  4H63 V;  3VHL A;  1VYW B;  5C2T A;  2QQ8 A;  3L8R A;  2CHN A;  3LDQ B;  4IDO A;  1GQE A;  2CRB A;  3VKH A;  3FHN A;  5KDM C;  3TW7 A;  5J0Z A;  4ERR A;  4ZGD B;  1HTJ F;  2KLQ A;  4TTH A;  4OX9 T;  3ONJ A;  2WSS V;  4F7S B;  3SRZ A;  2CHO A;  1OL1 B;  2PK9 B;  2LHR A;  4IDP A;  2LOS A;  4G6L B;  3OJA A;  2W9F A;  3BLR B;  5L4H A;  5JR9 B;  2NW8 A;  4LF8 T;  4HFE A;  4L5G A;  2C5V B;  4GIW A;  1NEK A;  2PBI A;  4LF6 T;  4DV6 T;  5L3C B;  2V7J A;  4Z8X A;  5FMN A;  2LKG A;  5FGK B;  4Z90 A;  4NXM T;  3HO8 A;  2V7I A;  3NZP A;  3EAM A;  4UIG A;  5HEG A;  5LBM A;  2NW7 A;  4BCI B;  2QFZ A;  1EZ3 A;  2XM1 A;  1KXU A;  4F7J B;  2Q9Q D;  1KEY A;  3POM A;  1OWA A;  2H7V C;  3UQ7 A;  4KI0 F;  4QHO A;  4LFC T;  2CCI B;  4EOR B;  2CWY A;  2MBG A;  4ROC A;  4JEH B;  5EFQ B;  3ANW B;  2B9R A;  3QZ9 B;  3AED A;  4Z6Y A;  4JI3 T;  2DXC B;  3HB9 A;  4UEM A;  2FJD A;  2IHR 1;  4BAY B;  2WJ9 A;  5JRC A;  3RPU A;  1SUM B;  5LYJ E;  1BR4 A;  2H3R A;  1MMG A;  1O9K B;  1MMA A;  4KX6 A;  1OED C;  4IT4 A;  4NUV A;  3AAA B;  1FJG T;  4F7N B;  5LHG B;  3N2O A;  2IAK A;  1FIN B;  1D1A A;  2OA5 A;  2IW5 B;  5AFU L;  3E0Z A;  5EK3 A;  5LCY A;  4YFS A;  2ACZ A;  2VVS A;  4CXA B;  2C5O B;  1J5W A;  3PU8 A;  4MFR A;  3TLV A;  2VL8 A;  4DV5 T;  2D5U A;  4GYS A;  1JNZ A;  4MBQ A;  2KXP B;  3OPC A;  4X62 T;  1UGQ B;  4P1N A;  1OED A;  3F31 A;  4ZI2 C;  3KV5 A;  4UN0 A;  1HX1 B;  4TN7 B;  1U5P A;  5IF1 B;  5C3J A;  4I55 E;  4HNT A;  1L0V A;  3PUY F;  5AQM B;  1N33 T;  3GA8 A;  1H26 B;  4QX8 B;  2QDY B;  4C90 A;  3TLT A;  2R7G A;  4HNU A;  2ZLY A;  1W0A A;  4Q25 A;  2PMI B;  4H9O C;  3LK3 B;  1IBK T;  2NWB A;  4JV5 T;  5ABH A;  4YOZ A;  4N78 D;  5LHI B;  4B3R T;  3PE0 A;  1OIY B;  4OB0 B;  3RYF E;  2I53 A;  2CM0 A;  2W66 A;  2W9Z A;  5JDN A;  3C4W A;  1JSU B;  4JUY A;  2CZ1 B;  4DR7 T;  2LHN A;  2X9W A;  2BG9 C;  3NRX A;  3RF1 A;  2XQ6 A;  2WIP B;  5L3G B;  4HGA A;  2CZ6 B;  3BG9 A;  2MOZ A;  1HCI A;  4HWD A;  4HFV A;  3G06 A;  2UXB T;  2YU1 A;  3JCF A;  2JQ9 A;  4O4J E;  5L3B B;  4F6W B;  2KT9 A;  3MY1 B;  3M65 A;  5EZY E;  4CN4 A;  4HKA A;  1HNZ T;  3LQ5 B;  2F2C A;  2IW6 B;  2NOX A;  5FVK A;  4CFX B;  2XQ7 A;  4U2Y A;  2BG9 E;  1HS7 A;  2J47 A;  4HL4 A;  2BG9 A;  3ZC0 A;  2XAH B;  1JNR A;  3NBX X;  5H6R B;  2X0Y A;  5HYA A;  4ILC A;  4DR2 T;  3AB3 B;  2ZPE B;  4YXD A;  1IJ5 A;  2WDQ A;  1YW0 A;  2DHR A;  4Z91 A;  5LXT E;  2XY8 B;  3PDY A;  5I5Z B;  3DDQ B;  2KSR A;  1BU2 A;  2LM9 A;  2LSI A;  4EOI B;  2IC6 A;  4HFB A;  3KV9 A;  2K48 A;  4ISS A;  2EHO A;  2CXD A;  5CFB A;  5ICP B;  2W00 A;  1H1S B;  4P0A A;  4LF4 T;  3U3I A;  2YU2 A;  3K3Q C;  3PJA A;  3N2K E;  1Z8U A;  2VL0 A;  4F6U B;  3H4C A;  5CB4 E;  4NC6 A;  1HR0 T;  5FXX A;  2UXX B;  2Y8D A;  3KVB A;  3IF8 B;  5L3E B;  2WDV A;  4TUY E;  5FVL A;  4AQF C;  4CZZ B;  2WU5 A;  4X20 E;  4BCH B;  5JDL A;  1HFA A;  1X79 A;  3G33 B;  4U31 A;  3A8O B;  3VRA A;  4UF0 A;  3QYE A;  4NUU A;  5CA1 E;  2XAS B;  5JR9 C;  4IST A;  4YSY A;  2XQ8 A;  4BXX X;  4HFD A;  2IW8 B;  1WYC A;  3UU6 A;  3PUZ F;  5BMV E;  5LG3 A;  3KBU A;  2I0M A;  5IUX A;  3UT5 E;  4ZGJ B;  4AQF A;  5DAB A;  4EZH A;  2NP9 A;  1SE7 A;  4E7Z A;  2E9X D;  5FKY A;  3H3M A;  3AEE A;  3TNI B;  2LSJ A;  3MJX A;  4I0U A;  1XMQ T;  3CX8 B;  3AEF A;  2IIU A;  4DV1 T;  5JR9 A;  2XQA A;  4ZOL E;  1H25 B;  1QUU A;  4BY7 X;  3FB2 A;  3V5U A;  4JX6 A;  2AXD S;  3AXJ A;  3TLU A;  3QWL A;  4QH4 A;  4PK5 A;  3N9Q A;  4AKI A;  1VRB A;  3P4R A;  3PUA A;  3F2E A;  3AA0 B;  4I4T E;  2VUR A;  2E5V A;  2QF7 A;  2YDQ A;  4HFH A;  2BVM A;  3WI3 A;  3WAJ A;  2EUF A;  4AKG A;  3BLH B;  3Q5E A;  2OLT A;  2VK9 A;  5HCM A;  3C50 A;  3HR0 A;  5LA6 E;  3KV6 A;  5FXZ A;  3UUB A;  2PFV A;  1UX4 A;  1AIS B;  3ZMU B;  4DR4 T;  1KNZ A;  4IMY B;  4ZXL A;  3VU7 H;  1D0Z A;  3HL6 A;  2VKJ A;  4H63 H;  4BBS M;  5AQH B;  3ANW A;  3ETU A;  4UV8 B;  4A98 A;  2JGZ B;  2GK9 A;  2CE7 A;  5AQL B;  3N2G E;  4X1K E;  2UU9 T;  3BQL A;  4JEU B;  2ZPI B;  1VCT A;  1MIV A;  2CLY B;  1O9K A;  2ZZD B;  3FZH B;  3ZST A;  5LMU T;  2I59 A;  4QWN B;  2BPM B;  3T1H T;  1Z0P A;  4IE6 A;  1H4L D;  2XJ7 A;  3LG7 A;  3S4U A;  3RYC E;  4QX7 B;  4EOS B;  3ZT5 A;  1IAP A;  4O4H E;  4KP3 C;  5BR8 T;  3EOC B;  4XBF B;  2ZPH B;  4HNV A;  4B3M T;  3B57 A;  2E5L T;  1FEW A;  4MHC A;  3HBL A;  2C5K T;  4CI2 B;  4PJM A;  3M03 A;  2RA1 A;  2XQ5 A;  4JI2 T;  3HA4 A;  3ZT6 A;  4U7Y A;  4C91 A;  3OYZ A;  4TNW A;  4EOK B;  1N32 T;  2BG9 B;  2X0H A;  3ESL A;  1AJ3 A;  4YT0 A;  4YHH T;  3OVU A;  3AAE B;  4OYJ A;  5FXW A;  5TAO A;  3N9P A;  5AQI B;  1OI9 B;  3WVD B;  5HWX A;  4YY3 T;  1H27 B;  1R8I A;  1D0X A;  3CQC B;  4YSX A;  4QSH A;  3MY5 B;  5FXV A;  3SFD A;  5IDN B;  5FY0 A;  2EHO B;  2H88 A;  1BR1 A;  3NKZ A;  4EIW A;  2UUE B;  1WFD A;  2FJE A;  4OFZ A;  1YKH B;  3BLQ B;  3ZJ2 A;  3Q5D A;  4AXP A;  2A9U A;  5AQN B;  5HEO A;  1UNG D;  1MIY A;  1HG2 A;  2WHB B;  5LOV E;  4CFW B;  2KMG A;  4KUM B;  4GKK T;  1Y01 A;  2V5C A;  2V26 A;  4X5T A;  2QA7 A;  3AA1 B;  2YDS A;  5ETW A;  3PUX F;  4EGW A;  3N9M A;  4KMC A;  4IE0 A;  2CEA A;  4DVD A;  3TNW B;  5LB7 B;  1XNR T;  1G3N C;  4BA9 A;  5HBJ B;  2F4V T;  4P0B A;  1UCU A;  2UUA T;  5F3J A;  3K8P C;  2Q9Q C;  2WQY A;  4X66 T;  4K0K T;  4ILU A;  1UGP B;  3HZJ A;  4ZI7 E;  3O0G D;  1T72 A;  4HN9 A;  2DCF A;  2DD4 B;  2Y48 B;  4LML A;  3UQ4 A;  1SA0 E;  2LT3 A;  4UVA B;  5JRE A;  2WDR A;  4PJJ A;  5F5W A;  5IWA T;  3C98 B;  3CML A;  2LE8 A;  4I3Z B;  3O1I A;  3MA9 A;  3EHZ A;  2G77 A;  3X25 B;  2D2S A;  3UTK A;  2Q9Q A;  2UZD B;  2XAJ B;  2XQ9 A;  3AXJ B;  3UUX B;  2JIW A;  5HEH A;  4JI6 T;  2W96 A;  2BZB A;  5HEJ A;  1N4M A;  2YDR A;  3RIU A;  4ELJ A;  2BBH A;  2ZMA A;  2D0Q B;  2J1D G;  4H9R C;  3JAF A;  4G63 A;  2HPJ A;  4EOO B;  5L2L A;  3KVA A;  3BHT B;  3PJA J;  4O2B E;  5FY7 A;  2JPF A;  5AQK B;  4BCM B;  4O4I E;  4WBO A;  5LGU B;  4PAG A;  2LRK A;  1JST B;  2WU2 A;  3PUG A;  4CFN B;  3ZCI A;  3A8L B;  5HNB B;  4MLK A;  4TV9 E;  3KHI A;  2BVL A;  1FKM A;  1UX5 A;  2E8I A;  3QHR B;  2C4G B;  3LSV A;  4JX5 A;  4U7I A;  2V6Y A;  4WYV A;  3N9L A;  2PK2 A;  4ELL A;  1M7K A;  4PK4 A;  1IBM T;  1FIO A;  2I40 B;  5LMK B;  3FBL A;  4II5 B;  4PW8 A;  5LJN A;  3PO3 S;  1VIN A;  2V22 B;  3RKG A;  5BNJ B;  2BKO A;  2C0S A;  2ACX A;  4HWC A;  3CX7 B;  3JC6 C;  2NW9 A;  4ZZC A;  4YTN A;  1URC B;  2AE9 A;  3AVR A;  2UZB B;  2WZI A;  4U2Z A;  5AQS B;  4KHZ F;  1X9B A;  4BCK B;  3TLW A;  5CJ5 A;  2LLY A;  3QXE B;  3AEG A;  1T98 A;  3ZSS A;  3RC3 A;  4EZ4 A;  2KMF A;  2CLY C;  4AQG A;  1GH6 B;  3DOG B;  1S94 A;  3FBZ A;  1IBL T;  3UUM A;  2CCH B;  1NWM X;  5AQO B;  3ZKR A;  3ZMV B;  3QNU A;  4BCQ D;  3FZF B;  4U74 A;  3R6N A;  3C4Z A;  3QUJ A;  3EDU A;  2QDJ A;  5L2W B;  4IIJ E;  2LM2 A;  2ZPG B;  4OR5 B;  3RX6 A;  3FXD B;  3RRC A;  1H1R B;  2H89 A;  3MIA B;  5FP3 A;  3EID B;  1H1Q B;  4ZHQ E;  4DV4 T;  4X65 T;  4F70 B;  4M1P A;  4BBR M;  3OTO T;  1UGO A;  3QB5 K;  2MYS A;  1UK5 A;  4CXX A;  3LJC A;  3MI9 B;  3J9X 1;  3RIA A;  2KND A;  3BHU B;  4YJ3 E;  4F6R C;  2WFY B;  4HWH A;  3TKL B;  4B6X A;  1HF8 A;  5LGT B;  2C5I T;  2WM9 A;  3AVS A;  4V1A v;  4DMW A;  2X51 A;  1YD8 G;  4MFE A;  3EDV A;  2WZH A;  4DV0 T;  3ZMS B;  2K5B B;  3X28 B;  4JI7 T;  5AQU B;  2W4X A;  3QB5 A;  2ZM2 A;  3A7M A;  3HKE E;  2EHO C;  4UXN B;  2KWI B;  4ZI2 D;  5AQV B;  1H1P B;  1FMV A;  1I6Z A;  3E08 A;  4MAL A;  4F7L B;  2CA5 A;  5JQG E;  4EOQ B;  3FZL B;  3HKC E;  4FI5 A;  2UXD T;  5CYI B;  2ZM0 A;  1WYB A;  1D3U B;  1ZOY A;  3LK4 2;  2LOP A;  1IRE B;  3PU3 A;  4WNK A;  3BK9 A;  2VAS A;  1XDO A;  5HCJ A;  3P7I A;  4IE5 A;  4DUY T;  3VYG B;  2LSG A;  3QC9 A;  3QZ5 B;  5F8P A;  5LMN T;  4DBQ A;  3N9O A;  3AE6 A;  2JMH A;  2V7L A;  3DL1 A;  2M6I A;  2Q9Q B;  1IJ6 A;  3OKQ A;  4HWF A;  3AE5 A;  2M67 A;  3L3P A;  3U78 A;  3CWZ B;  2K9A A;  2YK0 A;  4L0R A;  5ABE A;  5FL0 A;  4YLH A;  2CMR A;  5AQR B;  3SS1 A;  5FNV E;  1HG5 A;  3QK6 A;  3IA3 A;  4DV7 T;  3NRY A;  5HXE A;  2FBW A;  2IW9 B;  4NST B;  3AE8 A;  3KDS E;  3RI5 A;  1FMW A;  5ABG A;  3A8G B;  2D9D A;  3PUW F;  4CFU D;  2R6G F;  3RH3 A;  4PK6 A;  2E9X A;  4NIQ A;  4L9I A;  4PJL A;  2W62 A;  4B3T T;  2WEV B;  3C4X A;  3ZYM A;  1QMZ B;  2BKZ B;  2X9X A;  5J2T E;  2QGS A;  4MIM A;  4ZI3 C;  3ZT7 A;  3CIR A;  4DR1 T;  5HXS A;  3CVR A;  1ZP2 A;  3ABV A;  3CKD A;  2V6Y B;  1NEN A;  4EYY R;  4DV2 T;  4ASK A;  3B13 A;  4OB3 B;  2VQF T;  4HFC A;  4CN6 A;  2W99 A;  3SOL A;  2XQ3 A;  4X64 T;  5FL1 A;  5CEI B;  4JBW F;  2KWH A;  5HWY A;  4DR3 T;  5HAX A;  3KV4 A;  4GK0 E;  2W67 A;  3HI2 A;  3RYH E;  4AI6 A;  4U33 A;  4DID B;  4EOZ B;  1N36 T;  2VWA A;  3D0T A;  2KR6 A;  2V1D B;  2BDE A;  4HFI A;  2LSK A;  4Y72 B;  2NTX A;  5A1L A;  4LF5 T;  4IL9 A;  2W61 A;  1XDP A;  4KRD B;  4O8S A;  4EB6 E;  2DI4 A;  2WMO A;  2CZ7 B;  4WBN E;  2VQE T;  2BS3 A;  2XM2 A;  2DPP B;  1G8X A;  3ZPO A;  1D1B A;  3NZQ A;  2UZL B;  4WZX A;  1WLX A;  1H7C A;  1W0B A;  3UU3 A;  4LFA T;  1C9B A;  4I50 E;  3PUQ A;  1XWM A;  1B7T A;  1DU2 A;  2WMB B;  3GTM S;  3A5X A;  4YOS A;  4EYU A;  2XQY A;  2MAW A;  1N34 T;  3I0Q A;  3ZYL A;  3UFE A; 
#chains in the Genus database with same CATH homology
 4HN9 A;  1U5P A;  4TN7 B;  2DCF A;  2Y48 B;  4HE8 A;  4I55 E;  4A56 A;  4OHF A;  5IYZ E;  4H9N C;  3GA8 A;  1SA0 E;  3CQX C;  2IC9 A;  1Y64 B;  2LT3 A;  4QX8 B;  5E0O A;  4UVA B;  4C90 A;  5JRE A;  4KBM B;  4PJJ A;  4GK5 E;  3ZN1 B;  2ZM8 A;  2ZLY A;  1WRD A;  2EHO D;  3C98 B;  4HEA A;  4H9O C;  3CML A;  3H3A A;  2LE8 A;  3LK3 B;  4I43 B;  3O1I A;  2NWB A;  3MA9 A;  2JQQ A;  2D2S A;  3UTK A;  5JDF A;  3ZN0 B;  1HX8 A;  2Q9Q A;  4N78 D;  2X68 A;  2XAJ B;  3UUX B;  5DQW A;  3O4X E;  5LHI B;  2N1G A;  3PE0 A;  2JRK A;  5EK4 A;  2BZB A;  3LK2 B;  3RYF E;  4PFP A;  2WWU A;  1QSD A;  3UUN A;  3O9X A;  2CM0 A;  4CI3 B;  2ZMA A;  3PTR B;  2J1D G;  4H9R C;  5JDN A;  3C4W A;  4JUY A;  3Q9D A;  4G63 A;  2HPJ A;  2LHN A;  2CXL A;  2DLR A;  3ONX A;  2X9W A;  3NRX A;  5L2L A;  5JRC B;  1V9D A;  3KVA A;  4O2B E;  1BR2 A;  5FY7 A;  1YKE B;  2JPF A;  3UUL A;  5L3G B;  4X1Y E;  4HGA A;  3AA7 B;  4O4I E;  3I9W A;  2MOZ A;  4WBO A;  1HCI A;  3GN5 A;  4HFV A;  5LGU B;  4PAG A;  1U4Q A;  3I0O A;  2YU1 A;  3LFM A;  4UV9 B;  2YEV C;  2PJQ A;  3KFW X;  3LBX A;  4O4J E;  3O1J A;  5L3B B;  5LG4 A;  2KT9 A;  3M65 A;  3KIN B;  5EZY E;  3PUG A;  3OBV E;  4HKA A;  5L3D B;  3N9N A;  4TX5 A;  3FXE B;  1MMD A;  2NOX A;  3DJB A;  3ZCI A;  3ZCJ A;  2A2F X;  2D0T A;  1BR0 A;  4MLK A;  2VKO A;  4O2A E;  4TV9 E;  3ZJ1 A;  5HXH A;  1HS7 A;  3MAC A;  2BVL A;  2UXN B;  3ZMZ B;  4IHJ E;  5KMG P;  1UX5 A;  2E8I A;  2X0L B;  4IE7 A;  3ZC0 A;  4X1I E;  2XAH B;  2KZ7 B;  1NAF A;  3NBX X;  5H6R B;  5HYA A;  2JJ9 A;  4O4L E;  3N9L A;  4XAX B;  2WBL A;  5C8Y E;  2N9D A;  2Y6X A;  3O1H A;  3AB3 B;  5JDG A;  4PK4 A;  4H9P C;  1IJ5 A;  1FIO A;  3DP7 A;  4HTE A;  3FBL A;  1YW0 A;  2DHR A;  3C51 A;  4PW8 A;  5LJN A;  4DO0 A;  5LXT E;  5GON E;  4G2A A;  3CQG B;  5LNK A;  2E9X B;  3PDY A;  2C0S A;  2ACX A;  3CX7 B;  3JC6 C;  2CXF A;  2NW9 A;  3ZEF B;  1LRZ A;  2ES0 A;  2LM9 A;  2LSI A;  2IC6 A;  2N2N A;  3IEE A;  3KV9 A;  2K48 A;  4ISS A;  2EHO A;  3AVR A;  3EVY A;  2CXD A;  4ZI3 D;  2HPL A;  1S35 A;  5KX5 E;  2W00 A;  5JDM A;  4QXB B;  4P0A A;  1T98 A;  4IE4 A;  4GOU A;  2H7O A;  4UVB B;  3RC3 A;  4EZ4 A;  3H37 A;  3U3I A;  2KMF A;  2YU2 A;  2CLY C;  3K3Q C;  4BJM A;  4AQG A;  3CX6 B;  3N2K E;  4OYK A;  5LJM A;  2XHE B;  1S94 A;  3FBZ A;  3I9Y A;  4JLE A;  3UUM A;  5CB4 E;  3Q5X A;  4ADZ A;  1NWM X;  5FXX A;  2UXX B;  2X9H A;  3ZMV B;  2Y8D A;  2LEH A;  3KVB A;  3IF8 B;  5L3E B;  4U74 A;  1CUN A;  5FY1 A;  3CPZ A;  4TUY E;  3R6N A;  5HXC A;  5J2U E;  3WAK A;  2L8K A;  4AQF C;  3C4Z A;  4CZZ B;  1LVF A;  1LKX A;  3HKD E;  1WR6 A;  3EDU A;  3MKD A;  3QUJ A;  4X20 E;  1SHZ C;  2NTY A;  4K0U A;  4IIJ E;  5JDL A;  3RX6 A;  2RP4 A;  3FXD B;  1HFA A;  2WMN A;  2WAU A;  3EUH A;  4ZS2 A;  1X79 A;  5FP3 A;  3RRC A;  1D0Y A;  2MTQ A;  2L3L A;  3GN5 B;  4ZHQ E;  4UF0 A;  5DJQ C;  4NUU A;  1MMN A;  5CA1 E;  2XAS B;  5JR9 C;  1LVK A;  3LBX B;  4M1P A;  2B1E A;  4IST A;  2DNX A;  2XAF B;  4E7S A;  1E1H B;  2MYS A;  4CXX A;  5LHH B;  3LJC A;  4ANJ A;  3J9X 1;  3Q5W A;  4TV8 E;  2KND A;  2ODV A;  4YJ3 E;  1WYC A;  3RRW A;  4AKH A;  2VKH A;  3ZYK A;  4CQI A;  3GWH A;  4QXH B;  5BMV E;  5LGN B;  4F6R C;  3AAI A;  3KBU A;  4TZ4 C;  3UT5 E;  4AQF A;  3TKL B;  5DAB A;  2VB6 A;  3PUR A;  4EZH A;  5LP6 E;  2NP9 A;  2X67 A;  4B6X A;  4AKL A;  1HF8 A;  4FJO A;  4E7Z A;  2E9X D;  3J7Y q;  5JDQ A;  5LGT B;  2C5I T;  2WM9 A;  4DBR A;  3AVS A;  2X66 A;  4V1A v;  5J1G A;  3K3O A;  4DMW A;  2C5J A;  2X51 A;  2LSJ A;  1YD8 G;  3MJX A;  3CX8 B;  5JR9 A;  2A72 A;  1ZHC A;  3EDV A;  4PJN A;  3ZMS B;  2K5B B;  2DWG A;  4ZOL E;  1KK7 A;  1QUU A;  2LJL A;  4CXY A;  3FB2 A;  3V5U A;  2ZM2 A;  3GMI A;  3HKE E;  4PNI A;  2EHO C;  4UXN B;  2KWI B;  2VKD A;  3VKG A;  4PFO A;  4ZI2 D;  1FMV A;  4PK5 A;  2YIN A;  3N9Q A;  3Q2M A;  3E08 A;  4AKI A;  1VRB A;  1VOM A;  4MAL A;  3C64 A;  2CA5 A;  3K3N A;  5JVD E;  5JQG E;  3PUA A;  2P9B A;  3ZMT B;  4CI1 B;  3F2E A;  2X9Y A;  3AA0 B;  4I4T E;  2V7K A;  3KBT A;  3RYI E;  3HKC E;  4FI5 A;  5H6Q B;  3WI3 A;  2BVM A;  3WAJ A;  2HH7 A;  5L3F B;  2CWO A;  3W15 B;  2ODU A;  4EXT A;  2ZM0 A;  4AKG A;  1WYB A;  4H9Q C;  2G0U A;  1ZKE A;  1IZN B;  3LK4 2;  2LOP A;  2VK9 A;  3PUS A;  3C50 A;  3HR0 A;  4UEL A;  5LA6 E;  3PU3 A;  3KV6 A;  4WNK A;  3BK9 A;  3BQI A;  5FXZ A;  2VAS A;  5IHY A;  4BJN A;  3P7I A;  2PFV A;  3MK7 C;  4IE5 A;  3AA6 B;  1MIW A;  1UX4 A;  3ZMU B;  1KNZ A;  2LSG A;  3QC9 A;  4IDZ A;  3VU7 H;  5ADX L;  1D0Z A;  5F8P A;  2L9Q A;  3HL6 A;  3L09 A;  3N5L A;  2VKJ A;  2Z6E A;  4J2C A;  4H63 H;  4DBQ A;  2DWK A;  3N9O A;  2JMH A;  2V7L A;  3ANW A;  3ETU A;  4UV8 B;  4WW0 A;  2XAG B;  5JH7 E;  4GYR A;  2GK9 A;  2Q9Q B;  4CXW A;  1D1C A;  2CE7 A;  1IJ6 A;  2D0U A;  3N2G E;  4X1K E;  3OKQ A;  4UF0 B;  2M67 A;  3L3P A;  3BQL A;  4JEU B;  3F57 A;  3U78 A;  3CWZ B;  2K9A A;  1MNE A;  5FYM A;  1MIV A;  2CLY B;  2YK0 A;  4H63 V;  4L0R A;  3VHL A;  3E22 E;  2I59 A;  4DMV A;  4YLH A;  2CMR A;  4QWN B;  3SS1 A;  3RKO A;  4QXC B;  5FNV E;  1HG5 A;  1Z0P A;  3RC8 A;  3R84 B;  3QK6 A;  4IE6 A;  3NRY A;  3ZC1 A;  5EK2 A;  3FHN A;  3LG7 A;  3S4U A;  5KDM C;  5HXE A;  3VKH A;  3RYC E;  4QX7 B;  1US7 B;  4YJ2 E;  3KDS E;  4ERR A;  1FMW A;  3IHR A;  1IAP A;  1HTJ F;  2A3D A;  2KLQ A;  2V7M A;  3RH3 A;  4O4H E;  3DTO A;  4KP3 C;  4PK6 A;  2E9X A;  4XBF B;  2WSS V;  2W63 A;  3SRZ A;  3BQK A;  4L9I A;  2LHR A;  4PJL A;  2W62 A;  4H9S E;  2XAQ B;  3B57 A;  2LOS A;  3OJA A;  4QKN A;  3C4X A;  1FEW A;  3ZYM A;  3HKB E;  5JR9 B;  2NW8 A;  4MHC A;  2C5K T;  2XTL A;  4CI2 B;  4PJM A;  4AKR B;  5JDH A;  4L5G A;  4GIW A;  1ZV4 X;  2RA1 A;  5M4Y A;  2PBI A;  3HA4 A;  2XUE A;  1ZEE A;  4C91 A;  2X9X A;  3OYZ A;  5J2T E;  4IGU A;  2QGS A;  4ZI3 C;  5L3C B;  2K24 A;  2V7J A;  4Z8X A;  5FMN A;  3ESL A;  4OK0 A;  3V5S A;  4YHJ A;  4XZC A;  3T8O A;  3CVR A;  5HXS A;  1AJ3 A;  3CKD A;  4EYY R;  2V7I A;  4ASK A;  3NZP A;  3AAE B;  3P8C D;  3B13 A;  1OXZ A;  4UIG A;  3OYX A;  4OYJ A;  3JC6 D;  5FXW A;  5LBM A;  5TAO A;  3N9P A;  2NW7 A;  3MXZ A;  3SOL A;  1EZ3 A;  2JMK A;  3ZLI A;  2PG8 A;  2LSY A;  5HWX A;  4UVC B;  2Q9Q D;  1OWA A;  2H7V C;  2KWH A;  5HWY A;  1D0X A;  4QHO A;  4U72 A;  3CQC B;  2CWY A;  2MBG A;  5HAX A;  1G73 A;  3KV4 A;  5FXV A;  3I1A A;  4GK0 E;  5FY0 A;  2EHO B;  3HI2 A;  3RYH E;  4AI6 A;  4JEH B;  3ANW B;  5CA0 E;  1BR1 A;  4EIW A;  3ETV A;  4EOZ B;  4UEM A;  4OFZ A;  1YKH B;  2CCQ A;  2VWA A;  3D0T A;  3ZJ2 A;  4AXP A;  2V1D B;  4BAY B;  3MZK B;  2BDE A;  5JRC A;  2KIN B;  2LSK A;  3RPU A;  5LYJ E;  1BR4 A;  2NTX A;  4DND A;  2H3R A;  5A1L A;  1MMG A;  1MMA A;  1MIY A;  3SWH A;  1MND A;  4ZS3 A;  1HG2 A;  5LOV E;  2W61 A;  4NUV A;  4P09 A;  3AAA B;  4EAH A;  4O8S A;  4EB6 E;  2DI4 A;  2WMO A;  3N2O A;  2IAK A;  4KUM B;  5HXR A;  2V26 A;  5LHG B;  1D1A A;  2QA7 A;  3AA1 B;  5ETW A;  2OA5 A;  4WBN E;  3IBP A;  2IW5 B;  5AFU L;  3E0Z A;  3N9M A;  5EK3 A;  4KMC A;  5LCY A;  1G8X A;  4IE0 A;  2E9X C;  2CEA A;  4YFS A;  4DVD A;  3ZPO A;  1D1B A;  3NZQ A;  3PU8 A;  4BA9 A;  4MFR A;  1WLX A;  1H7C A;  2VL8 A;  4P0B A;  1O3X A;  2D5U A;  1UCU A;  4GYS A;  2SPC A;  5F3J A;  4MBQ A;  5LBQ B;  4I50 E;  3PUQ A;  2W0G A;  2KXP B;  1B7T A;  3K8P C;  2Q9Q C;  3A5X A;  4EYU A;  4ILU A;  2XQY A;  5DQV A;  3F31 A;  4ZI2 C;  3I0Q A;  3KV5 A;  4ZI7 E;  3ZYL A;  3UFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...