3B57A

Crystal structure of the lin1889 protein (q92an1) from listeria innocua. northeast structural consortium target lkr65
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
180
Chain Sequence
MNKEEIILSAKNWMHSHFHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDQEATKTLINWMETKEIPSELIKKIIRIIQSVSALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNPKNTTLQHFYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
molecule keywords Lin1889 protein
total genus 61
structure length 180
sequence length 203
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3b57A01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b57A02
3DTOA 5IHYA 5DQWA 3DJBA 2PJQA 5DQVA 3B57A 2QGSA
chains in the Genus database with same CATH superfamily
4N78D 5BMVE 3BLQB 3FZFB 2JQKA 4CN4A 5FL1A 2J4GA 4Z90A 5L3CB 2CMRA 4QWNB 3O1HA 2Q9QD 3QYGB 2ES0A 2ZPGB 3NWIA 4PFOA 4OGRB 3GN5A 1IBLT 1D1CA 3KBUA 4BCQB 1M7KA 4CN1A 1D0XA 4RODA 4ELJA 3SS1A 3ZMSB 2K48A 2AHJB 3LFMA 3AA1B 5FVKA 2A3DA 1T7SA 2FBWA 2YN6A 4P1NA 5HCJA 5FP3A 2JQ9A 2V8SV 5CA1E 2BBHA 2CEAA 2IN3A 1H1PB 4EOPB 2YU1A 3Q5WA 4PNIA 2CLYC 1BR2A 1H24B 3X25B 1S35A 3CIRA 3CWZB 2ZPFB 2YU2A 2YDQA 3C98B 4JI6T 4I55E 2BG9A 4U2YA 4EOOB 4UXNB 2DMEA 3AE8A 4GYSA 4A97A 2CCHB 4EIWA 4EOIB 4OB1B 2BG9B 5L47A 1V9DA 2KR6A 1OWAA 5AQLB 2IIUA 3MI9B 2UXCT 4UIGA 2PHGA 3N5LA 1XO2A 5AQTB 1UURA 4CN6A 4QH5A 3FZHB 5IUXA 3ZT6A 4U7YA 3ZYLA 3QYBA 5ABEA 3PUXF 2X68A 3ETUA 1XMQT 3PUAA 2HPLA 5HXEA 4BAYB 1OKVB 2LE8A 5AQHB 3EAMA 4ZEYA 1HG5A 3BK9A 2M67A 4TV8E 2CBJA 2HHHT 3KVAA 5FYMA 4EGWA 5HXSA 1W9RA 1XNQT 2UZDB 4KHZF 2V7MA 3S4UA 3NRYA 3PUGA 3RC8A 1SHZC 2X0LB 4U31A 3N9LA 5FXVA 3TNWB 4JI0T 1NENA 3SRZA 4AKRB 1UGRB 4UELA 4HNVA 2A72A 4JV5T 5EK4A 4B3RT 1JNRA 1WLXA 2EHOC 4U74A 5L3DB 2F4VT 5L3FB 3TW7A 1ZP0A 4C91A 4X64T 2HN1A 3OYZA 5JDQA 3N9PA 4XBFB 4ASKA 3VKGA 2JRKA 4H9RC 5JDMA 2CZ7B 2H88A 4IL9A 3UU6A 4LF4T 2WMAB 1AHJB 3BHTB 3A8OB 2ZPEB 4DBRA 4HWDA 4KRCB 1KK7A 4CFUD 4O4LE 2IDOB 1QLBA 4JEUB 1MIYA 3MXZA 5J2TE 2PFVA 4LFBT 3TLSA 2DNXA 4PK5A 4ZZBA 4DV6T 1U4QA 5AQNB 2A2FX 4F7LB 2CPTA 2RP4A 3NZPA 2D0TA 2EHOA 3Q5XA 4DUYT 2WAUA 3MIAB 4MFRA 4ADZA 4TTHA 1C9BA 1VRBA 2FJEA 4BCND 3LBXA 2H7OA 4HGAA 1AISB 5HBJB 1IAPA 2LM2A 2C5KT 1YQ3A 2CCIB 1VYWB 3GWHA 2CLYB 2VKJA 5JR9B 2Q9QA 4YJ3E 1XDOA 4DNDA 3C4ZA 4WYVA 2W0GA 4C90A 3H3MA 3CX6B 5LB7B 2K24A 2WDRA 2QYWA 5ABHA 3HHTB 5FY7A 4ILAA 4ZI7E 4DV3T 3Q5DA 1VINA 2VVSA 3TLUA 2XAGB 2CHOA 4DMVA 1JKWA 3UUMA 4KBMB 4IE6A 1IBKT 1HNWT 3RPUA 4PFPA 4CFXB 4PW8A 2ZPBB 5HCMA 1HR0T 2IVXA 4M6VA 1W0AA 1VOLA 2KLQA 3D0TA 4UN0A 4U3CA 4IL4A 3GA8A 4X1KE 3BLRB 3F2EA 1LVKA 4HWCA 3PUSA 2MBGA 4AKLA 4HFDA 2CA5A 1FEWA 2EUFA 2VKDA 1T72A 2LKHA 4IE5A 3AB3B 2V6YB 4JI8T 2WJ9A 1ZEEA 2WZHA 4JI2T 4WBOA 4TX5A 4X1IE 1OEDC 5LYJE 1P5EB 2V7JA 5JDGA 4X65T 3PUZF 4DR3T 3VR8A 3ZEFB 1OL1B 2WU5A 1OIYB 4F6UB 4DBQA 2WMOA 3O4XE 4EOJB 2PK2A 1N36T 4OB3B 4JX5A 2PTFA 4XAXB 1V29B 1WFDA 4CFWB 3C51A 5LMNT 3K3NA 1OEDB 4UF0A 2G77A 2OLTA 3KV9A 3RYHE 1H7CA 3ONXA 2X9YA 2XTLA 4YOZA 3AAIA 4LF6T 4U33A 1J1JA 4IE7A 5IYZE 5L2WB 4LF5T 3VKHA 4HLQA 4YY3T 3AAAB 5TAOA 1FVVB 2V7IA 3RGFB 4DIDB 2V7KA 5FY1A 3PDYA 5A1LA 2K5BB 2XM2A 2D0UA 4BCKB 2BZBA 5ICPB 5LBQB 4I0UA 2NOXA 3BQKA 1Z0PA 3RGLA 3KINB 4G6LB 2BVMA 4AQFC 1S94A 2WFYB 5LA6E 2LRKA 1FMWA 3CQXC 2VQET 1NAFA 4E7ZA 5C8YE 2JQHA 4YT0A 4CXYA 5FXZA 4DV0T 2XHEB 3UU8A 2AE9A 4IREA 5JR9C 1KNRA 1TD6A 2JMKA 1AJ3A 3K3QC 2XSAA 5CGMA 2V6YA 2LEHA 5HEOA 2DXBB 4HL4A 4DR2T 2DWKA 3QC9A 4LMKA 4PAGA 2VL0A 4BBSM 2QDYB 2KXPB 5BNJB 4UR9A 3AEGA 1BR4A 1BR1A 2VQFT 3VRBA 4LF8T 3OKQA 4BCFB 3LJCA 4ZGEB 1JSUB 2WY2A 2WM9A 2KNDA 2LRLA 2W4XA 2XQ6A 3WVEB 3Q2MA 5ABGA 2XAFB 5IHYA 4GKKT 4BCMB 3PJAJ 3MZKB 5HEUA 3L09A 3WVDB 1B7TA 4FJOA 4JI4T 3V5UA 4JBWF 3CMLA 5CYIB 2ACXA 1DU2A 2IHR1 2YDRA 3K8PC 2KMGA 2DWGA 2KWIB 3OVUA 1IBMT 3NZQA 4B3TT 4F7SB 4BJMA 1TFBA 1NWMX 4G2AA 5AQIB 4YJ2E 3A8YC 1E7PA 4LFAT 1M62A 5HXCA 4O4JE 1XWMA 4TNVA 3ZN1B 3QWLA 3J9X1 4U72A 4H9PC 3UTKA 4F8HA 1CHUA 5FKYA 5LHHB 3AE1A 4PJLA 4K0UA 5HNBB 4PJNA 2MYSA 2CBIA 2XJ7A 2V7LA 2AXDS 1GH6B 3PUYF 3RLFF 2UXNB 4ILUA 2YOEA 1CUNA 4AXPA 4NXMT 2C5NB 5LNKA 3IBPA 2WB5A 1WCRA 1BR0A 5ETWA 1VCSA 5AQGB 3B13A 4PK6A 2CWYA 2IUBA 5JDNA 4ZGJB 4ZI3D 2LKGA 4QH4A 5H6RB 4CQIA 3G33B 5J0ZA 5LG3A 3VYGB 5F3JA 4L9IA 4B3MT 3VRAA 2WDQA 3CX7B 2W62A 4GIWA 1WYBA 2VKHA 4F70B 2BDEA 1QSDA 3EOCB 2NW7A 3DL1A 3L8RA 5HAXA 5LQFB 2X67A 2DHRA 3SWHA 1SUMB 5EFQB 2XQ5A 3NBXX 4YSZA 4BCQD 1KFYA 2W2UA 2C6TB 3P4SA 4MALA 5JRCB 2FJBA 4BCPB 1OGUB 3IA3A 3ZC0A 4QSHA 4KUMB 1G73A 4EONB 3P7IA 3M3ZB 4DO0A 1MMAA 2NWBA 4AKIA 4DVDA 4AQYT 2JJ9A 2PK9B 3HA4A 2DCFA 3ONJA 5HXHA 2PJQA 4I50E 3SFDA 3BQLA 3O9XA 4HWIB 4YLHA 2BVLA 5F5WA 4ANJA 4ZHQE 5AQVB 3PURA 4AQFA 5C2TA 1KF6A 3QB5A 3DJBA 4II5B 5FNVE 2ZLYA 4CI1B 4OB0B 1HF8A 1JSTB 2R6GF 4X5TA 4Q25A 3BQIA 1YXRA 4BCIB 1UGSB 4IDZA 4DR7T 2ZM6T 5HVYB 1YQ4A 1W0BA 4DV2T 3OBVE 2V26A 4B6XA 2BG9E 5ADXL 5LGUB 2C0SA 1YKEB 2N9DA 4B3ST 1HFAA 3TLTA 2K9AA 2OA5A 5L4EA 1KEYA 5LBMA 4U7IA 5LJNA 3RYCE 4TNWA 2CZ1B 1ZHCA 4HKAA 4X66T 2LJLA 3I0QA 4TN7B 4CFVB 2XAQB 2VL8A 5FXWA 2BKZB 4PJMA 4BBRM 3MA9A 3ANWA 2XASB 1O9KB 1OI9B 1VOMA 1W98B 2LSJA 4NXNT 4DMWA 1F5QB 1D0YA 1UCUA 5LCYA 2XAJB 3QYEA 2NTYA 4DR5T 3SFEA 1UGQB 3P4PA 3KBTA 5JDHA 2L3LA 3NVOA 1J5WA 4TWDA 4AKHA 3HKCE 1Z8UA 4HFCA 3N2OA 3R6NA 2HN2A 3EDVA 5LMKB 4U2ZA 2M6IA 3ZCIA 3H3AA 3T1YT 2WDVA 3N2GE 3TW6A 4HNUA 1HNZT 2SPCA 3P4WA 5LP6E 4H9QC 2BKNA 3GTMS 3ZSSA 4HWFA 3RQUA 3ZMUB 2ZMAA 4QXCB 4DV1T 5LHGB 4YTNA 5AFUL 3C64A 3OJAA 1N32T 5LXTE 2R7GA 2ZCFB 3T1HT 2EHOD 1XDPA 1X9BA 3AEDA 1FJGT 3JADA 3M65A 4EC8B 3CX8B 1I94T 1OXZA 3W15B 4KP3C 4QXBB 3OTOT 4MHCA 2D9DA 4X1YE 2NW8A 5HBEB 2I53A 2W9FA 4P0AA 3PU8A 3QOFA 3T8OA 3KHIA 2D5UA 1YKHB 2JPFA 4GK0E 3C4XA 4JI3T 3OPCA 4HNTA 1GUXA 3KFWX 2LHNA 3AE9A 3RIUC 3BG9A 2Y8DA 3L39A 1FMVA 4QKNA 3EIDB 5AQFB 4OHFA 2XQ8A 1HG2A 1US7B 3PJAA 4QXHB 2W61A 1H1RB 4TUYE 5HQ0B 4BCOB 4I43B 2PBIA 3UFEA 4CXXA 2WHBB 4WZXA 2QFZA 5AQSB 3PV0F 5ACBA 4PJJA 3UU3A 2WEVB 3LG7A 5FMNA 1MNEA 3CPZA 1WYCA 4TWHA 2CRBA 4YSXA 1LVFA 2DL1A 2E9XD 4YC3B 5LGNB 2ZM0A 4O2BE 3LDQB 2I40B 2YEVC 3ZYKA 5HEHA 3I9YA 2UUAT 4NUUA 4QHOA 4CFNB 4EOLB 2G0UA 2VK9A 3AEBA 3AE3A 1KNPA 4L0RA 4ILBA 2WIHB 1QUUA 1IJ6A 3FZMB 3UUXB 3DDPB 2X1NB 2DD4B 3ABVA 4EOKB 4JEHB 5HWXA 3C4WA 1UK5A 3A8HB 2X51A 3HL6A 3HZJA 4MFDA 2WSSV 2XSBA 3MY5B 2DD5B 2WS3A 2IAKA 1H1QB 1H25B 1MMGA 3EDUA 3ZMTB 4MIMA 2BS3A 4ZI2C 3GMIA 4EZ4A 5KMGP 1N4MA 2FUPA 2WMNA 3FZKB 2Q9QC 1PKDB 2Y6XA 1JNZA 4GOUA 3RQWA 5L3EB 4TZ4C 2WWUA 2WWVA 3NDQA 4AQGA 2BBJA 1HX8A 1N34T 4KI0F 2E5LT 3LSVA 2ZM8A 3RKOA 2VKOA 2W96A 2E9XC 4BA9A 1E2AA 3FZLB 4EOSB 2QRXA 5JRCA 2GK9A 2E5VA 3NKZA 5E0OA 4ZXLA 2E8IA 5HYAA 4CFMB 2XQ3A 3EHZA 5LHIB 4BCNB 1X79A 3AVSA 1IJ5A 2X9WA 4CI3B 2XQ9A 4EEDA 3A8MB 4BJNA 4P0BA 3AVRA 1LKXA 2B9RA 1UNLD 4YOSA 4BCMD 2MOZA 2C5VB 2QVAA 2Z6EA 4E7SA 3TLVA 1GUXB 2UU9T 4LMLA 2KZ7B 2LOSA 3RX6A 5HBHB 4NUVA 3KDSE 3UU4A 2ZM2A 5DQVA 3N9OA 4FI5A 3IF8B 4OB2B 3TKLB 1GY3B 2W2HA 1VCTA 3AE7A 3HKBE 1JOWA 1I6ZA 4BY7X 2WCAA 5CA0E 4H63H 2LM9A 2QGSA 4HFIA 4WW0A 4XZCA 3JAFA 3A8GB 2X9HA 5L3BB 3BLHB 4YOOA 1OKWB 5HEJA 3HI2A 4MFEA 3CK6A 3ANWB 4IE4A 5JR9A 1U5PA 4HN9A 2V1DB 1URCB 3N9NA 3HKDE 5AQPB 4YXDA 2XM1A 5KX5E 4DV7T 2IC6A 4DR1T 3P50A 4NIQA 1IZNB 2DLRA 2JIWA 2XY8B 3HB9A 3RC3A 2CCQA 4IDOA 3HO8A 4MBQA 1ZP2A 4EYUA 4V1Av 1FIOA 4JX6A 3KV4A 4OYJA 4F6SB 2LOPA 3PE0A 5HEGA 3ETVA 2KT9A 4NPPA 5JREA 4Z6YA 4JI7T 2BG9C 4F6WB 3ESLA 3FXDB 3IHRA 2CJMB 4BCJB 2Q9QB 2NW9A 3UT5E 3A8LB 3QHRB 3C50A 4P09A 3FB2A 2LSGA 2N1GA 2XUEA 1IREB 4HWHA 2WXVB 2UUBT 3ZSTA 3ZN0B 2V5DA 4KHPT 4UV9B 4AKGA 3IEEA 2B76A 3RYFE 5C3JA 2WZIA 2YKSA 3LK3B 2OV9A 2DI4A 1OIUB 3TNIB 2HH7A 2NR4A 1FKMA 5KDMC 4IMYB 3KV6A 2IMLA 2UXDT 1D0ZA 5EJCA 3B57A 5AQRB 3RIUA 3QYHB 4AISA 2ZZDB 4COFA 3VU7H 4OFZA 2VWAA 3I9WA 2H89A 2WPAB 3UUNA 1O3XA 5DQWA 2L8KA 3FBZA 3H4CA 3X28B 2C4GB 4O8SA 3AAEB 3PUQA 3ONLC 2MPKA 4CZZB 2WQYA 4X20E 3K1SA 4YTMA 3N9MA 4BCGB 1MIWA 5L2LA 4O2AE 2YK0A 3DP7A 1SE7A 1XNRT 5EK3A 1NEKA 2C5IT 5M4YA 5FVLA 3F57A 4A5XA 4EOQB 2VB6A 2UZLB 3F5XB 2LW4A 3AA6B 4O4IE 5JQGE 2IW9B 3ZMZB 2PG8A 3E0ZA 4ERRA 3HBLA 1ZKEA 4M1PA 1WRDA 2UUEB 3EJ1B 1HTJF 3FXEB 5FY0A 1UGPB 3QZ5B 3POMA 4IIJE 4EORB 3ZT7A 4UVCB 2PMIB 3UFGA 2ZPIB 5FL0A 3OYXA 2X0YA 3AA0B 2J62A 4CXAB 2W99A 1L0VA 1EZ3A 2XAHB 1OEDE 1YD8G 3CKDA 4OR5B 1WR6A 5FGKB 2NTXA 3RIFA 1H26B 4JUYA 4JYAT 3MK7C 1YW0A 2BKOA 3ZLIA 2KSRA 4Y72B 4GK5E 3BG5A 4NC6A 3PUWF 4JI1T 4IT4A 5J1GA 2JMHA 4JLEA 1GQEA 2I59A 2XQYA 1MMNA 3ZCJA 4TWFA 2D0QB 2DPPB 3PO3S 1ZV4X 3CVRA 2QA7A 3KV5A 4OX9T 4TV9E 3I1AA 1OL2B 4ILCA 4H63V 3O0GD 4EOZB 1WR0A 2L9QA 3UULA 3U78A 2KINB 3AE2A 2G9XB 1O9KA 3R84B 3VYHB 2UZBB 4QX8B 1ZOYA 2CXDA 4EOMB 4Z8XA 3PTRB 5CFBA 2QQ8A 3AEAA 3B5MA 4ZI2D 3G06A 1XMOT 5IWAT 2J1DG 2IC9A 4H9SE 2EHOB 3EUHA 2ZPHB 5AQJB 3WI3A 2LHRA 3JAEA 2J47A 5LOVE 5LGTB 3QHWB 3AE5A 5ABFA 2QDJA 3X1DA 3AA7B 2BPMB 4HEAA 4KMCA 3X24B 2RPAA 3RF1A 3WAJA 1UUSA 2ODUA 3ZJ1A 3NRXA 1HX1B 4YHJA 2H3RA 3X20B 4CXWA 5IF1B 4ZZCA 1OEDA 5L4HA 2VVNA 3ZMVB 3QZ9B 1H4LD 2N2NA 2BKPA 2WMBB 5CJ5A 3PUVF 4BXXX 4CRLB 4DV4T 2XPKA 2LSKA 5EK2A 4JI5T 3Q9DA 4EC9B 4H9OC 5KXJA 3UQ7A 1G8XA 3RRCA 2E2AA 3LK42 4UF0B 5IDPB 1HCIA 2K3WA 4KRDB 5AQOB 2NP9A 3RIAA 4EXTA 2CWOA 2C5XB 2LSIA 4YTPA 4EV6A 2E9XB 4UVBB 3RHWA 4OK0A 2E9XA 3AXJA 4OYKA 3AEFA 4DUZT 2ACZA 5H6QB 5DABA 4NSTB 4IDPA 2CZ0B 3UU5A 4LF9T 5JVDE 3P4RA 3RRWA 4EZHA 2H7VC 3VHLA 3HKEE 5LG4A 3JCFA 4KX6A 5HWYA 3DTOA 3ZT5A 2RA1A 1HS7A 2QF7A 4QH1A 3HR0A 2W00A 2X0HA 5AQUB 3MACA 2W66A 4J2CA 3MKDA 4IE0A 2WU2A 3AECA 2W67A 3ZPOA 5DJQC 3VR9A 3V5SA 3EABA 4WNKA 1MMDA 3ZKRA 4LFCT 3X26B 3A7MA 2VASA 4FX3B 1UX4A 3MJXA 4YHHT 5CEIB 2DXCB 3UUBA 5I5ZB 3TN8B 2WIPB 1Y64B 4HFVA 4GKJT 4A56A 5HXRA 4HTEA 4F7NB 2MTQA 2YDSA 3QK6A 2YINA 3QNUA 3JC6D 3N9QA 3AE4A 2C5JA 1E1HB 2C5OB 4JX4A 2HPJA 2FJDA 2XQAA 4ISTA 5BR8T 4YSYA 3ZC1A 4ROCA 4FM4B 1H28B 2ODVA 5AQQB 5LMUT 2XZEA 4O4HE 1D1BA 2XQ7A 4H9NC 2IW8B 5L3GB 4ZGDB 3RKGA 5JH7E 2LSYA 3J7Yq 3PU3A 3BHVB 2UXBT 3BG3A 4X62T 4GYRA 2CHNA 3DOGB 4UV8B 1FINB 2X66A 3UQ4A 1KXUA 2V6XA 2UZEB 3ZYMA 4G63A 1T8BA 3E22E 4I4TE 3MY1B 2W9ZA 4EAHA 3M03A 1T98A 4F6RC 5JDLA 4QX7B 1H27B 4EYYR 4DR6T 4I3ZB 3F31A 2I6HA 3Q5EA 3ZJ2A 5J2UE 3QB5K 4HFHA 4ZS2A 3RYIE 2KMFA 4HFEA 2CM0A 3AXJB 4AIUA 2A9UA 2IW5B 1QMZB 3E08A 4ISSA 4Z91A 1MIVA 2WP9A 5F8PA 2B1EA 2M6BA 2V5CA 4ZS3A 1KNZA 3QXEB 1Y01A 3JC6C 3O1IA 2W63A 3P4QA 3O1JA 3AE6A 5IDNB 5CB4E 1LRZA 1UX5A 3TLWA 4IHJE 5GONE 5AQMB 4UEMA 3LBXB 4UVAB 4ZOLE 3RI5A 1E9HB 4A98A 2I0MA 1HNXT 1BU2A 2XQ4A 1D1AA 3SOLA 3K3OA 1R8IA 4DR4T 4BY1X 4PK4A 4HFBA 2CE7A 2FJAA 5JDFA 1UNHD 3LQ5B 4DV5T 3A5XA 3I0OA 3QUJA 1W09A 5FXXA 3P8CD 3N2KE 4IDNA 2MAWA 2UXXB 4IGUA 4LF7T 2CZ6B 3L3PA 3FBLA 5AQKB 3KVBA 4BCHB 2KWHA 2LLYA 3CQCB 1H1SB 4IDQA 4ROEA 4MLKA 3GN5B 2CXLA 2X9XA 1ENWA 3U3IA 3WAKA 5LJMA 5JTGA 4WBNE 2JQQA 2BS2A 2F2CA 2WBLA 4CI2B 4K0KT 2Y48B 2IW6B 2V22B 1XZYA 3BHUB 2P9BA 2JGZB 3DDQB 2LT3A 4EB6E 4ELLA 4LOCA 1UGOA 3FHNA 3AEEA 5EZYE 4CFUB 1D3UB 1MNDA 1AD6A 2VURA 2CYZB 1UNGD 1G3NC 3TNHB 2CXFA 1N33T 4AI6A 4ZI3C 1SA0E 3H37A 4YFSA 5ABFB 3K7AM 2D2SA 4F7JB 4HE8A 3LK2B 2BS4A 3CQGB 3EI0A 4EEBA 3EVYA 2UUCT 4L5GA 1J5ET 4LMJA 3RH3A
chains in the Genus database with same CATH topology
3KV5A 4N78D 5IHYA 4TV9E 5BMVE 3I1AA 3MZKB 4H63V 2YEVC 3ZYKA 4EOZB 2L9QA 3L09A 3UULA 3U78A 3I9YA 1B7TA 2KINB 4FJOA 5L3CB 3V5UA 2CMRA 4QWNB 3R84B 3O1HA 3CMLA 2ACXA 4NUUA 2Q9QD 4QHOA 4QX8B 3K8PC 2CXDA 2G0UA 4Z8XA 2VK9A 2ES0A 3PTRB 4PFOA 4ZI2D 2DWGA 2KWIB 2J1DG 3NZQA 3GN5A 4L0RA 4BJMA 1NWMX 1D1CA 2IC9A 2EHOB 3KBUA 4G2AA 4H9SE 4YJ2E 1QUUA 1IJ6A 3UUXB 3EUHA 1D0XA 3WI3A 2LHRA 5HXCA 3SS1A 4JEHB 3ZMSB 2K48A 5HWXA 4O4JE 3C4WA 3LFMA 3AA1B 5LOVE 2X51A 3HL6A 2A3DA 2WSSV 5LGTB 3ZN1B 5FP3A 2IAKA 3J9X1 5CA1E 1MMGA 2CEAA 4U72A 3EDUA 3ZMTB 2YU1A 4H9PC 3Q5WA 3AA7B 4PNIA 3UTKA 2CLYC 1BR2A 4ZI2C 1S35A 4HEAA 3GMIA 4KMCA 4EZ4A 5LHHB 3WAJA 5KMGP 4PJLA 4K0UA 2ODUA 2WMNA 3ZJ1A 3NRXA 3CWZB 2Q9QC 4PJNA 2YU2A 2MYSA 2Y6XA 4YHJA 2V7LA 4GOUA 2H3RA 5L3EB 3C98B 4TZ4C 2WWUA 4CXWA 2UXNB 4AQGA 4I55E 3ZMVB 1HX8A 4UXNB 4ILUA 2N2NA 4GYSA 2ZM8A 1CUNA 3RKOA 4EIWA 2VKOA 4AXPA 2E9XC 4BA9A 1V9DA 5LNKA 1OWAA 3IBPA 2LSKA 5EK2A 2GK9A 5JRCA 1BR0A 5ETWA 5E0OA 4UIGA 3N5LA 3Q9DA 2E8IA 3B13A 4H9OC 4PK6A 2CWYA 5JDNA 5HYAA 4ZI3D 1G8XA 3RRCA 3LK42 4UF0B 1HCIA 5H6RB 5LHIB 1X79A 2NP9A 4CQIA 3AVSA 4EXTA 1IJ5A 2X9WA 4CI3B 4BJNA 2CWOA 4P0BA 2LSIA 3AVRA 1LKXA 2E9XB 4UVBB 5F3JA 3ZYLA 4L9IA 2X68A 3CX7B 3ETUA 4OK0A 2E9XA 2HPLA 2MOZA 3PUAA 4BAYB 5HXEA 4OYKA 2Z6EA 4E7SA 2W62A 2LE8A 4GIWA 1WYBA 2VKHA 2BDEA 5H6QB 1HG5A 3BK9A 2M67A 4TV8E 5DABA 1QSDA 2KZ7B 2NW7A 5HAXA 5JVDE 3KVAA 2X67A 2LOSA 2DHRA 5FYMA 3RRWA 2H7VC 4EZHA 3VHLA 3RX6A 3SWHA 5HXSA 4NUVA 3KDSE 2V7MA 3S4UA 3NRYA 2ZM2A 5DQVA 3PUGA 3N9OA 3RC8A 4FI5A 3HKEE 1SHZC 3IF8B 3NBXX 5LG4A 3TKLB 5HWYA 3DTOA 2X0LB 3HKBE 4MALA 5JRCB 3N9LA 2RA1A 5FXVA 1HS7A 3SRZA 3ZC0A 3HR0A 2W00A 4AKRB 5CA0E 4H63H 2LM9A 4KUMB 2QGSA 1G73A 4UELA 3MACA 2A72A 3P7IA 4WW0A 4J2CA 3MKDA 4XZCA 5EK4A 4DO0A 4IE0A 1WLXA 5L3DB 2EHOC 4U74A 2X9HA 3ZPOA 5L3FB 1MMAA 5L3BB 5DJQC 4C91A 2NWBA 3OYZA 4AKIA 5JDQA 3N9PA 4DVDA 4XBFB 4ASKA 2JJ9A 3V5SA 2JRKA 3HA4A 2DCFA 3VKGA 4H9RC 3HI2A 5JDMA 5HXHA 3ANWB 4IE4A 2PJQA 5JR9A 1U5PA 4WNKA 1MMDA 4HN9A 4I50E 2V1DB 3BQLA 3N9NA 3O9XA 2VASA 4YLHA 3HKDE 1UX4A 3MJXA 4DBRA 2BVLA 1KK7A 4O4LE 5KX5E 4JEUB 4ANJA 4ZHQE 1MIYA 2IC6A 3MXZA 5J2TE 2PFVA 1IZNB 2DLRA 1Y64B 2DNXA 3RC3A 4PK5A 2CCQA 4HFVA 3PURA 4MBQA 4AQFA 1U4QA 4A56A 4EYUA 2A2FX 4V1Av 5HXRA 1FIOA 2RP4A 4HTEA 3DJBA 3KV4A 4OYJA 5FNVE 2ZLYA 3NZPA 2LOPA 2MTQA 2D0TA 2EHOA 3QK6A 2YINA 4CI1B 3JC6D 3Q5XA 3N9QA 3PE0A 2C5JA 3ETVA 1HF8A 1E1HB 2KT9A 2WAUA 4MFRA 4ADZA 2HPJA 1VRBA 3BQIA 5JREA 4ISTA 3LBXA 3ZC1A 4IDZA 3ESLA 3FXDB 2H7OA 2V26A 3OBVE 3IHRA 4HGAA 2ODVA 4B6XA 2Q9QB 4O4HE 2NW9A 3UT5E 3C50A 1IAPA 2C5KT 1D1BA 5ADXL 4P09A 5LGUB 4H9NC 3FB2A 3GWHA 2LSGA 2N1GA 2C0SA 2CLYB 2VKJA 1YKEB 2N9DA 2Q9QA 1HFAA 2XUEA 5JR9B 5L3GB 4YJ3E 2K9AA 4DNDA 2OA5A 3C4ZA 5LBMA 2W0GA 3ZN0B 4C90A 5JH7E 2LSYA 5LJNA 3J7Yq 3PU3A 3CX6B 3RYCE 2K24A 4UV9B 4GYRA 4AKGA 5FY7A 1ZHCA 3IEEA 4ZI7E 3RYFE 4HKAA 2XAGB 3LK3B 4DMVA 4UV8B 3UUMA 2DI4A 2HH7A 4KBMB 2X66A 4IE6A 5KDMC 2LJLA 3I0QA 3KV6A 4TN7B 3RPUA 3ZYMA 4PFPA 2XAQB 2VL8A 4G63A 3E22E 5FXWA 4I4TE 4PW8A 1D0ZA 4EAHA 1T98A 3B57A 4F6RC 5JDLA 4PJMA 4QX7B 4EYYR 2KLQA 3D0TA 3MA9A 3ANWA 3F31A 2XASB 3GA8A 4X1KE 1VOMA 3ZJ2A 3F2EA 1LVKA 2MBGA 3PUSA 4AKLA 2LSJA 5J2UE 3VU7H 4DMWA 4OFZA 1D0YA 2CA5A 1FEWA 1UCUA 5LCYA 2XAJB 2VWAA 4ZS2A 3RYIE 2KMFA 3I9WA 2NTYA 3UUNA 2CM0A 2VKDA 1O3XA 2IW5B 3E08A 5DQWA 4IE5A 1MIVA 4ISSA 2L8KA 3AB3B 3FBZA 3KBTA 1ZEEA 4WBOA 5F8PA 2B1EA 5JDHA 4O8SA 2L3LA 4TX5A 4X1IE 5LYJE 3AAEB 3PUQA 2V7JA 5JDGA 4AKHA 4ZS3A 4CZZB 1KNZA 3HKCE 3JC6C 3ZEFB 4X20E 3N2OA 3O1IA 3R6NA 2W63A 3N9MA 3O1JA 3EDVA 1MIWA 5L2LA 4O2AE 1LRZA 5CB4E 2YK0A 1UX5A 3DP7A 4IHJE 5GONE 4DBQA 4UEMA 2WMOA 3LBXB 3O4XE 4UVAB 4ZOLE 4XAXB 3ZCIA 3H3AA 3N2GE 2SPCA 5EK3A 2C5IT 5M4YA 3C51A 5LP6E 3K3NA 4H9QC 3F57A 1D1AA 3SOLA 3K3OA 4UF0A 3KV9A 4PK4A 3RYHE 2VB6A 2CE7A 1H7CA 3ONXA 2ZMAA 4QXCB 3ZMUB 5JDFA 2X9YA 2XTLA 5LHGB 3A5XA 5AFUL 3AA6B 3I0OA 3AAIA 4O4IE 5JQGE 3QUJA 3ZMZB 3C64A 2PG8A 3OJAA 3P8CD 5FXXA 3E0ZA 3N2KE 4IE7A 2UXXB 4ERRA 4IGUA 5IYZE 5LXTE 3VKHA 1ZKEA 4M1PA 1WRDA 2EHOD 1HTJF 3L3PA 3FBLA 3AAAB 3KVBA 5TAOA 2V7IA 3FXEB 3M65A 3CX8B 2V7KA 5FY0A 5FY1A 2KWHA 1OXZA 3CQCB 3W15B 3PDYA 4IIJE 5A1LA 2K5BB 4KP3C 4QXBB 2D0UA 2BZBA 4MHCA 5LBQB 4UVCB 4X1YE 4MLKA 2NW8A 2NOXA 3GN5B 2CXLA 3BQKA 1Z0PA 2X9XA 3KINB 3OYXA 2BVMA 3AA0B 4P0AA 4AQFC 1S94A 3U3IA 5LA6E 3WAKA 3PU8A 5LJMA 1FMWA 3CQXC 4WBNE 1NAFA 2JQQA 4E7ZA 5C8YE 3T8OA 2D5UA 2WBLA 4CI2B 1YKHB 2JPFA 2Y48B 4GK0E 4CXYA 3C4XA 5FXZA 2P9BA 3KFWX 1EZ3A 2LHNA 2XHEB 2XAHB 2LT3A 4EB6E 2Y8DA 5JR9C 1YD8G 3CKDA 1FMVA 4QKNA 2JMKA 3FHNA 1AJ3A 1WR6A 3K3QC 5EZYE 2LEHA 1MNDA 4OHFA 2NTXA 1HG2A 4JUYA 1US7B 2DWKA 3QC9A 3MK7C 1YW0A 2W61A 4QXHB 4TUYE 4PAGA 3ZLIA 4I43B 2PBIA 3UFEA 4GK5E 4CXXA 2KXPB 2CXFA 4AI6A 1BR4A 1BR1A 4ZI3C 1SA0E 3H37A 4YFSA 5J1GA 4PJJA 2JMHA 4JLEA 2D2SA 3LG7A 3OKQA 4HE8A 5FMNA 2I59A 3LJCA 2XQYA 1MNEA 3CPZA 3LK2B 1WYCA 1MMNA 3CQGB 3ZCJA 3EVYA 4L5GA 2WM9A 2KNDA 1LVFA 1ZV4X 2E9XD 3CVRA 3Q2MA 3RH3A 5LGNB 2ZM0A 4O2BE 2XAFB 2QA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTO A;  5IHY A;  5DQW A;  3DJB A;  2PJQ A;  5DQV A;  3B57 A;  2QGS A; 
#chains in the Genus database with same CATH topology
 4N78 D;  5BMV E;  3BLQ B;  3FZF B;  2JQK A;  4CN4 A;  5FL1 A;  2J4G A;  4Z90 A;  5L3C B;  2CMR A;  4QWN B;  3O1H A;  2Q9Q D;  3QYG B;  2ES0 A;  2ZPG B;  3NWI A;  4PFO A;  4OGR B;  3GN5 A;  1IBL T;  1D1C A;  3KBU A;  4BCQ B;  1M7K A;  4CN1 A;  1D0X A;  4ROD A;  4ELJ A;  3SS1 A;  3ZMS B;  2K48 A;  2AHJ B;  3LFM A;  3AA1 B;  5FVK A;  2A3D A;  1T7S A;  2FBW A;  2YN6 A;  4P1N A;  5HCJ A;  5FP3 A;  2JQ9 A;  2V8S V;  5CA1 E;  2BBH A;  2CEA A;  2IN3 A;  1H1P B;  4EOP B;  2YU1 A;  3Q5W A;  4PNI A;  2CLY C;  1BR2 A;  1H24 B;  3X25 B;  1S35 A;  3CIR A;  3CWZ B;  2ZPF B;  2YU2 A;  2YDQ A;  3C98 B;  4JI6 T;  4I55 E;  2BG9 A;  4U2Y A;  4EOO B;  4UXN B;  2DME A;  3AE8 A;  4GYS A;  4A97 A;  2CCH B;  4EIW A;  4EOI B;  4OB1 B;  2BG9 B;  5L47 A;  1V9D A;  2KR6 A;  1OWA A;  5AQL B;  2IIU A;  3MI9 B;  2UXC T;  4UIG A;  2PHG A;  3N5L A;  1XO2 A;  5AQT B;  1UUR A;  4CN6 A;  4QH5 A;  3FZH B;  5IUX A;  3ZT6 A;  4U7Y A;  3ZYL A;  3QYB A;  5ABE A;  3PUX F;  2X68 A;  3ETU A;  1XMQ T;  3PUA A;  2HPL A;  5HXE A;  4BAY B;  1OKV B;  2LE8 A;  5AQH B;  3EAM A;  4ZEY A;  1HG5 A;  3BK9 A;  2M67 A;  4TV8 E;  2CBJ A;  2HHH T;  3KVA A;  5FYM A;  4EGW A;  5HXS A;  1W9R A;  1XNQ T;  2UZD B;  4KHZ F;  2V7M A;  3S4U A;  3NRY A;  3PUG A;  3RC8 A;  1SHZ C;  2X0L B;  4U31 A;  3N9L A;  5FXV A;  3TNW B;  4JI0 T;  1NEN A;  3SRZ A;  4AKR B;  1UGR B;  4UEL A;  4HNV A;  2A72 A;  4JV5 T;  5EK4 A;  4B3R T;  1JNR A;  1WLX A;  2EHO C;  4U74 A;  5L3D B;  2F4V T;  5L3F B;  3TW7 A;  1ZP0 A;  4C91 A;  4X64 T;  2HN1 A;  3OYZ A;  5JDQ A;  3N9P A;  4XBF B;  4ASK A;  3VKG A;  2JRK A;  4H9R C;  5JDM A;  2CZ7 B;  2H88 A;  4IL9 A;  3UU6 A;  4LF4 T;  2WMA B;  1AHJ B;  3BHT B;  3A8O B;  2ZPE B;  4DBR A;  4HWD A;  4KRC B;  1KK7 A;  4CFU D;  4O4L E;  2IDO B;  1QLB A;  4JEU B;  1MIY A;  3MXZ A;  5J2T E;  2PFV A;  4LFB T;  3TLS A;  2DNX A;  4PK5 A;  4ZZB A;  4DV6 T;  1U4Q A;  5AQN B;  2A2F X;  4F7L B;  2CPT A;  2RP4 A;  3NZP A;  2D0T A;  2EHO A;  3Q5X A;  4DUY T;  2WAU A;  3MIA B;  4MFR A;  4ADZ A;  4TTH A;  1C9B A;  1VRB A;  2FJE A;  4BCN D;  3LBX A;  2H7O A;  4HGA A;  1AIS B;  5HBJ B;  1IAP A;  2LM2 A;  2C5K T;  1YQ3 A;  2CCI B;  1VYW B;  3GWH A;  2CLY B;  2VKJ A;  5JR9 B;  2Q9Q A;  4YJ3 E;  1XDO A;  4DND A;  3C4Z A;  4WYV A;  2W0G A;  4C90 A;  3H3M A;  3CX6 B;  5LB7 B;  2K24 A;  2WDR A;  2QYW A;  5ABH A;  3HHT B;  5FY7 A;  4ILA A;  4ZI7 E;  4DV3 T;  3Q5D A;  1VIN A;  2VVS A;  3TLU A;  2XAG B;  2CHO A;  4DMV A;  1JKW A;  3UUM A;  4KBM B;  4IE6 A;  1IBK T;  1HNW T;  3RPU A;  4PFP A;  4CFX B;  4PW8 A;  2ZPB B;  5HCM A;  1HR0 T;  2IVX A;  4M6V A;  1W0A A;  1VOL A;  2KLQ A;  3D0T A;  4UN0 A;  4U3C A;  4IL4 A;  3GA8 A;  4X1K E;  3BLR B;  3F2E A;  1LVK A;  4HWC A;  3PUS A;  2MBG A;  4AKL A;  4HFD A;  2CA5 A;  1FEW A;  2EUF A;  2VKD A;  1T72 A;  2LKH A;  4IE5 A;  3AB3 B;  2V6Y B;  4JI8 T;  2WJ9 A;  1ZEE A;  2WZH A;  4JI2 T;  4WBO A;  4TX5 A;  4X1I E;  1OED C;  5LYJ E;  1P5E B;  2V7J A;  5JDG A;  4X65 T;  3PUZ F;  4DR3 T;  3VR8 A;  3ZEF B;  1OL1 B;  2WU5 A;  1OIY B;  4F6U B;  4DBQ A;  2WMO A;  3O4X E;  4EOJ B;  2PK2 A;  1N36 T;  4OB3 B;  4JX5 A;  2PTF A;  4XAX B;  1V29 B;  1WFD A;  4CFW B;  3C51 A;  5LMN T;  3K3N A;  1OED B;  4UF0 A;  2G77 A;  2OLT A;  3KV9 A;  3RYH E;  1H7C A;  3ONX A;  2X9Y A;  2XTL A;  4YOZ A;  3AAI A;  4LF6 T;  4U33 A;  1J1J A;  4IE7 A;  5IYZ E;  5L2W B;  4LF5 T;  3VKH A;  4HLQ A;  4YY3 T;  3AAA B;  5TAO A;  1FVV B;  2V7I A;  3RGF B;  4DID B;  2V7K A;  5FY1 A;  3PDY A;  5A1L A;  2K5B B;  2XM2 A;  2D0U A;  4BCK B;  2BZB A;  5ICP B;  5LBQ B;  4I0U A;  2NOX A;  3BQK A;  1Z0P A;  3RGL A;  3KIN B;  4G6L B;  2BVM A;  4AQF C;  1S94 A;  2WFY B;  5LA6 E;  2LRK A;  1FMW A;  3CQX C;  2VQE T;  1NAF A;  4E7Z A;  5C8Y E;  2JQH A;  4YT0 A;  4CXY A;  5FXZ A;  4DV0 T;  2XHE B;  3UU8 A;  2AE9 A;  4IRE A;  5JR9 C;  1KNR A;  1TD6 A;  2JMK A;  1AJ3 A;  3K3Q C;  2XSA A;  5CGM A;  2V6Y A;  2LEH A;  5HEO A;  2DXB B;  4HL4 A;  4DR2 T;  2DWK A;  3QC9 A;  4LMK A;  4PAG A;  2VL0 A;  4BBS M;  2QDY B;  2KXP B;  5BNJ B;  4UR9 A;  3AEG A;  1BR4 A;  1BR1 A;  2VQF T;  3VRB A;  4LF8 T;  3OKQ A;  4BCF B;  3LJC A;  4ZGE B;  1JSU B;  2WY2 A;  2WM9 A;  2KND A;  2LRL A;  2W4X A;  2XQ6 A;  3WVE B;  3Q2M A;  5ABG A;  2XAF B;  5IHY A;  4GKK T;  4BCM B;  3PJA J;  3MZK B;  5HEU A;  3L09 A;  3WVD B;  1B7T A;  4FJO A;  4JI4 T;  3V5U A;  4JBW F;  3CML A;  5CYI B;  2ACX A;  1DU2 A;  2IHR 1;  2YDR A;  3K8P C;  2KMG A;  2DWG A;  2KWI B;  3OVU A;  1IBM T;  3NZQ A;  4B3T T;  4F7S B;  4BJM A;  1TFB A;  1NWM X;  4G2A A;  5AQI B;  4YJ2 E;  3A8Y C;  1E7P A;  4LFA T;  1M62 A;  5HXC A;  4O4J E;  1XWM A;  4TNV A;  3ZN1 B;  3QWL A;  3J9X 1;  4U72 A;  4H9P C;  3UTK A;  4F8H A;  1CHU A;  5FKY A;  5LHH B;  3AE1 A;  4PJL A;  4K0U A;  5HNB B;  4PJN A;  2MYS A;  2CBI A;  2XJ7 A;  2V7L A;  2AXD S;  1GH6 B;  3PUY F;  3RLF F;  2UXN B;  4ILU A;  2YOE A;  1CUN A;  4AXP A;  4NXM T;  2C5N B;  5LNK A;  3IBP A;  2WB5 A;  1WCR A;  1BR0 A;  5ETW A;  1VCS A;  5AQG B;  3B13 A;  4PK6 A;  2CWY A;  2IUB A;  5JDN A;  4ZGJ B;  4ZI3 D;  2LKG A;  4QH4 A;  5H6R B;  4CQI A;  3G33 B;  5J0Z A;  5LG3 A;  3VYG B;  5F3J A;  4L9I A;  4B3M T;  3VRA A;  2WDQ A;  3CX7 B;  2W62 A;  4GIW A;  1WYB A;  2VKH A;  4F70 B;  2BDE A;  1QSD A;  3EOC B;  2NW7 A;  3DL1 A;  3L8R A;  5HAX A;  5LQF B;  2X67 A;  2DHR A;  3SWH A;  1SUM B;  5EFQ B;  2XQ5 A;  3NBX X;  4YSZ A;  4BCQ D;  1KFY A;  2W2U A;  2C6T B;  3P4S A;  4MAL A;  5JRC B;  2FJB A;  4BCP B;  1OGU B;  3IA3 A;  3ZC0 A;  4QSH A;  4KUM B;  1G73 A;  4EON B;  3P7I A;  3M3Z B;  4DO0 A;  1MMA A;  2NWB A;  4AKI A;  4DVD A;  4AQY T;  2JJ9 A;  2PK9 B;  3HA4 A;  2DCF A;  3ONJ A;  5HXH A;  2PJQ A;  4I50 E;  3SFD A;  3BQL A;  3O9X A;  4HWI B;  4YLH A;  2BVL A;  5F5W A;  4ANJ A;  4ZHQ E;  5AQV B;  3PUR A;  4AQF A;  5C2T A;  1KF6 A;  3QB5 A;  3DJB A;  4II5 B;  5FNV E;  2ZLY A;  4CI1 B;  4OB0 B;  1HF8 A;  1JST B;  2R6G F;  4X5T A;  4Q25 A;  3BQI A;  1YXR A;  4BCI B;  1UGS B;  4IDZ A;  4DR7 T;  2ZM6 T;  5HVY B;  1YQ4 A;  1W0B A;  4DV2 T;  3OBV E;  2V26 A;  4B6X A;  2BG9 E;  5ADX L;  5LGU B;  2C0S A;  1YKE B;  2N9D A;  4B3S T;  1HFA A;  3TLT A;  2K9A A;  2OA5 A;  5L4E A;  1KEY A;  5LBM A;  4U7I A;  5LJN A;  3RYC E;  4TNW A;  2CZ1 B;  1ZHC A;  4HKA A;  4X66 T;  2LJL A;  3I0Q A;  4TN7 B;  4CFV B;  2XAQ B;  2VL8 A;  5FXW A;  2BKZ B;  4PJM A;  4BBR M;  3MA9 A;  3ANW A;  2XAS B;  1O9K B;  1OI9 B;  1VOM A;  1W98 B;  2LSJ A;  4NXN T;  4DMW A;  1F5Q B;  1D0Y A;  1UCU A;  5LCY A;  2XAJ B;  3QYE A;  2NTY A;  4DR5 T;  3SFE A;  1UGQ B;  3P4P A;  3KBT A;  5JDH A;  2L3L A;  3NVO A;  1J5W A;  4TWD A;  4AKH A;  3HKC E;  1Z8U A;  4HFC A;  3N2O A;  3R6N A;  2HN2 A;  3EDV A;  5LMK B;  4U2Z A;  2M6I A;  3ZCI A;  3H3A A;  3T1Y T;  2WDV A;  3N2G E;  3TW6 A;  4HNU A;  1HNZ T;  2SPC A;  3P4W A;  5LP6 E;  4H9Q C;  2BKN A;  3GTM S;  3ZSS A;  4HWF A;  3RQU A;  3ZMU B;  2ZMA A;  4QXC B;  4DV1 T;  5LHG B;  4YTN A;  5AFU L;  3C64 A;  3OJA A;  1N32 T;  5LXT E;  2R7G A;  2ZCF B;  3T1H T;  2EHO D;  1XDP A;  1X9B A;  3AED A;  1FJG T;  3JAD A;  3M65 A;  4EC8 B;  3CX8 B;  1I94 T;  1OXZ A;  3W15 B;  4KP3 C;  4QXB B;  3OTO T;  4MHC A;  2D9D A;  4X1Y E;  2NW8 A;  5HBE B;  2I53 A;  2W9F A;  4P0A A;  3PU8 A;  3QOF A;  3T8O A;  3KHI A;  2D5U A;  1YKH B;  2JPF A;  4GK0 E;  3C4X A;  4JI3 T;  3OPC A;  4HNT A;  1GUX A;  3KFW X;  2LHN A;  3AE9 A;  3RIU C;  3BG9 A;  2Y8D A;  3L39 A;  1FMV A;  4QKN A;  3EID B;  5AQF B;  4OHF A;  2XQ8 A;  1HG2 A;  1US7 B;  3PJA A;  4QXH B;  2W61 A;  1H1R B;  4TUY E;  5HQ0 B;  4BCO B;  4I43 B;  2PBI A;  3UFE A;  4CXX A;  2WHB B;  4WZX A;  2QFZ A;  5AQS B;  3PV0 F;  5ACB A;  4PJJ A;  3UU3 A;  2WEV B;  3LG7 A;  5FMN A;  1MNE A;  3CPZ A;  1WYC A;  4TWH A;  2CRB A;  4YSX A;  1LVF A;  2DL1 A;  2E9X D;  4YC3 B;  5LGN B;  2ZM0 A;  4O2B E;  3LDQ B;  2I40 B;  2YEV C;  3ZYK A;  5HEH A;  3I9Y A;  2UUA T;  4NUU A;  4QHO A;  4CFN B;  4EOL B;  2G0U A;  2VK9 A;  3AEB A;  3AE3 A;  1KNP A;  4L0R A;  4ILB A;  2WIH B;  1QUU A;  1IJ6 A;  3FZM B;  3UUX B;  3DDP B;  2X1N B;  2DD4 B;  3ABV A;  4EOK B;  4JEH B;  5HWX A;  3C4W A;  1UK5 A;  3A8H B;  2X51 A;  3HL6 A;  3HZJ A;  4MFD A;  2WSS V;  2XSB A;  3MY5 B;  2DD5 B;  2WS3 A;  2IAK A;  1H1Q B;  1H25 B;  1MMG A;  3EDU A;  3ZMT B;  4MIM A;  2BS3 A;  4ZI2 C;  3GMI A;  4EZ4 A;  5KMG P;  1N4M A;  2FUP A;  2WMN A;  3FZK B;  2Q9Q C;  1PKD B;  2Y6X A;  1JNZ A;  4GOU A;  3RQW A;  5L3E B;  4TZ4 C;  2WWU A;  2WWV A;  3NDQ A;  4AQG A;  2BBJ A;  1HX8 A;  1N34 T;  4KI0 F;  2E5L T;  3LSV A;  2ZM8 A;  3RKO A;  2VKO A;  2W96 A;  2E9X C;  4BA9 A;  1E2A A;  3FZL B;  4EOS B;  2QRX A;  5JRC A;  2GK9 A;  2E5V A;  3NKZ A;  5E0O A;  4ZXL A;  2E8I A;  5HYA A;  4CFM B;  2XQ3 A;  3EHZ A;  5LHI B;  4BCN B;  1X79 A;  3AVS A;  1IJ5 A;  2X9W A;  4CI3 B;  2XQ9 A;  4EED A;  3A8M B;  4BJN A;  4P0B A;  3AVR A;  1LKX A;  2B9R A;  1UNL D;  4YOS A;  4BCM D;  2MOZ A;  2C5V B;  2QVA A;  2Z6E A;  4E7S A;  3TLV A;  1GUX B;  2UU9 T;  4LML A;  2KZ7 B;  2LOS A;  3RX6 A;  5HBH B;  4NUV A;  3KDS E;  3UU4 A;  2ZM2 A;  5DQV A;  3N9O A;  4FI5 A;  3IF8 B;  4OB2 B;  3TKL B;  1GY3 B;  2W2H A;  1VCT A;  3AE7 A;  3HKB E;  1JOW A;  1I6Z A;  4BY7 X;  2WCA A;  5CA0 E;  4H63 H;  2LM9 A;  2QGS A;  4HFI A;  4WW0 A;  4XZC A;  3JAF A;  3A8G B;  2X9H A;  5L3B B;  3BLH B;  4YOO A;  1OKW B;  5HEJ A;  3HI2 A;  4MFE A;  3CK6 A;  3ANW B;  4IE4 A;  5JR9 A;  1U5P A;  4HN9 A;  2V1D B;  1URC B;  3N9N A;  3HKD E;  5AQP B;  4YXD A;  2XM1 A;  5KX5 E;  4DV7 T;  2IC6 A;  4DR1 T;  3P50 A;  4NIQ A;  1IZN B;  2DLR A;  2JIW A;  2XY8 B;  3HB9 A;  3RC3 A;  2CCQ A;  4IDO A;  3HO8 A;  4MBQ A;  1ZP2 A;  4EYU A;  4V1A v;  1FIO A;  4JX6 A;  3KV4 A;  4OYJ A;  4F6S B;  2LOP A;  3PE0 A;  5HEG A;  3ETV A;  2KT9 A;  4NPP A;  5JRE A;  4Z6Y A;  4JI7 T;  2BG9 C;  4F6W B;  3ESL A;  3FXD B;  3IHR A;  2CJM B;  4BCJ B;  2Q9Q B;  2NW9 A;  3UT5 E;  3A8L B;  3QHR B;  3C50 A;  4P09 A;  3FB2 A;  2LSG A;  2N1G A;  2XUE A;  1IRE B;  4HWH A;  2WXV B;  2UUB T;  3ZST A;  3ZN0 B;  2V5D A;  4KHP T;  4UV9 B;  4AKG A;  3IEE A;  2B76 A;  3RYF E;  5C3J A;  2WZI A;  2YKS A;  3LK3 B;  2OV9 A;  2DI4 A;  1OIU B;  3TNI B;  2HH7 A;  2NR4 A;  1FKM A;  5KDM C;  4IMY B;  3KV6 A;  2IML A;  2UXD T;  1D0Z A;  5EJC A;  3B57 A;  5AQR B;  3RIU A;  3QYH B;  4AIS A;  2ZZD B;  4COF A;  3VU7 H;  4OFZ A;  2VWA A;  3I9W A;  2H89 A;  2WPA B;  3UUN A;  1O3X A;  5DQW A;  2L8K A;  3FBZ A;  3H4C A;  3X28 B;  2C4G B;  4O8S A;  3AAE B;  3PUQ A;  3ONL C;  2MPK A;  4CZZ B;  2WQY A;  4X20 E;  3K1S A;  4YTM A;  3N9M A;  4BCG B;  1MIW A;  5L2L A;  4O2A E;  2YK0 A;  3DP7 A;  1SE7 A;  1XNR T;  5EK3 A;  1NEK A;  2C5I T;  5M4Y A;  5FVL A;  3F57 A;  4A5X A;  4EOQ B;  2VB6 A;  2UZL B;  3F5X B;  2LW4 A;  3AA6 B;  4O4I E;  5JQG E;  2IW9 B;  3ZMZ B;  2PG8 A;  3E0Z A;  4ERR A;  3HBL A;  1ZKE A;  4M1P A;  1WRD A;  2UUE B;  3EJ1 B;  1HTJ F;  3FXE B;  5FY0 A;  1UGP B;  3QZ5 B;  3POM A;  4IIJ E;  4EOR B;  3ZT7 A;  4UVC B;  2PMI B;  3UFG A;  2ZPI B;  5FL0 A;  3OYX A;  2X0Y A;  3AA0 B;  2J62 A;  4CXA B;  2W99 A;  1L0V A;  1EZ3 A;  2XAH B;  1OED E;  1YD8 G;  3CKD A;  4OR5 B;  1WR6 A;  5FGK B;  2NTX A;  3RIF A;  1H26 B;  4JUY A;  4JYA T;  3MK7 C;  1YW0 A;  2BKO A;  3ZLI A;  2KSR A;  4Y72 B;  4GK5 E;  3BG5 A;  4NC6 A;  3PUW F;  4JI1 T;  4IT4 A;  5J1G A;  2JMH A;  4JLE A;  1GQE A;  2I59 A;  2XQY A;  1MMN A;  3ZCJ A;  4TWF A;  2D0Q B;  2DPP B;  3PO3 S;  1ZV4 X;  3CVR A;  2QA7 A;  3KV5 A;  4OX9 T;  4TV9 E;  3I1A A;  1OL2 B;  4ILC A;  4H63 V;  3O0G D;  4EOZ B;  1WR0 A;  2L9Q A;  3UUL A;  3U78 A;  2KIN B;  3AE2 A;  2G9X B;  1O9K A;  3R84 B;  3VYH B;  2UZB B;  4QX8 B;  1ZOY A;  2CXD A;  4EOM B;  4Z8X A;  3PTR B;  5CFB A;  2QQ8 A;  3AEA A;  3B5M A;  4ZI2 D;  3G06 A;  1XMO T;  5IWA T;  2J1D G;  2IC9 A;  4H9S E;  2EHO B;  3EUH A;  2ZPH B;  5AQJ B;  3WI3 A;  2LHR A;  3JAE A;  2J47 A;  5LOV E;  5LGT B;  3QHW B;  3AE5 A;  5ABF A;  2QDJ A;  3X1D A;  3AA7 B;  2BPM B;  4HEA A;  4KMC A;  3X24 B;  2RPA A;  3RF1 A;  3WAJ A;  1UUS A;  2ODU A;  3ZJ1 A;  3NRX A;  1HX1 B;  4YHJ A;  2H3R A;  3X20 B;  4CXW A;  5IF1 B;  4ZZC A;  1OED A;  5L4H A;  2VVN A;  3ZMV B;  3QZ9 B;  1H4L D;  2N2N A;  2BKP A;  2WMB B;  5CJ5 A;  3PUV F;  4BXX X;  4CRL B;  4DV4 T;  2XPK A;  2LSK A;  5EK2 A;  4JI5 T;  3Q9D A;  4EC9 B;  4H9O C;  5KXJ A;  3UQ7 A;  1G8X A;  3RRC A;  2E2A A;  3LK4 2;  4UF0 B;  5IDP B;  1HCI A;  2K3W A;  4KRD B;  5AQO B;  2NP9 A;  3RIA A;  4EXT A;  2CWO A;  2C5X B;  2LSI A;  4YTP A;  4EV6 A;  2E9X B;  4UVB B;  3RHW A;  4OK0 A;  2E9X A;  3AXJ A;  4OYK A;  3AEF A;  4DUZ T;  2ACZ A;  5H6Q B;  5DAB A;  4NST B;  4IDP A;  2CZ0 B;  3UU5 A;  4LF9 T;  5JVD E;  3P4R A;  3RRW A;  4EZH A;  2H7V C;  3VHL A;  3HKE E;  5LG4 A;  3JCF A;  4KX6 A;  5HWY A;  3DTO A;  3ZT5 A;  2RA1 A;  1HS7 A;  2QF7 A;  4QH1 A;  3HR0 A;  2W00 A;  2X0H A;  5AQU B;  3MAC A;  2W66 A;  4J2C A;  3MKD A;  4IE0 A;  2WU2 A;  3AEC A;  2W67 A;  3ZPO A;  5DJQ C;  3VR9 A;  3V5S A;  3EAB A;  4WNK A;  1MMD A;  3ZKR A;  4LFC T;  3X26 B;  3A7M A;  2VAS A;  4FX3 B;  1UX4 A;  3MJX A;  4YHH T;  5CEI B;  2DXC B;  3UUB A;  5I5Z B;  3TN8 B;  2WIP B;  1Y64 B;  4HFV A;  4GKJ T;  4A56 A;  5HXR A;  4HTE A;  4F7N B;  2MTQ A;  2YDS A;  3QK6 A;  2YIN A;  3QNU A;  3JC6 D;  3N9Q A;  3AE4 A;  2C5J A;  1E1H B;  2C5O B;  4JX4 A;  2HPJ A;  2FJD A;  2XQA A;  4IST A;  5BR8 T;  4YSY A;  3ZC1 A;  4ROC A;  4FM4 B;  1H28 B;  2ODV A;  5AQQ B;  5LMU T;  2XZE A;  4O4H E;  1D1B A;  2XQ7 A;  4H9N C;  2IW8 B;  5L3G B;  4ZGD B;  3RKG A;  5JH7 E;  2LSY A;  3J7Y q;  3PU3 A;  3BHV B;  2UXB T;  3BG3 A;  4X62 T;  4GYR A;  2CHN A;  3DOG B;  4UV8 B;  1FIN B;  2X66 A;  3UQ4 A;  1KXU A;  2V6X A;  2UZE B;  3ZYM A;  4G63 A;  1T8B A;  3E22 E;  4I4T E;  3MY1 B;  2W9Z A;  4EAH A;  3M03 A;  1T98 A;  4F6R C;  5JDL A;  4QX7 B;  1H27 B;  4EYY R;  4DR6 T;  4I3Z B;  3F31 A;  2I6H A;  3Q5E A;  3ZJ2 A;  5J2U E;  3QB5 K;  4HFH A;  4ZS2 A;  3RYI E;  2KMF A;  4HFE A;  2CM0 A;  3AXJ B;  4AIU A;  2A9U A;  2IW5 B;  1QMZ B;  3E08 A;  4ISS A;  4Z91 A;  1MIV A;  2WP9 A;  5F8P A;  2B1E A;  2M6B A;  2V5C A;  4ZS3 A;  1KNZ A;  3QXE B;  1Y01 A;  3JC6 C;  3O1I A;  2W63 A;  3P4Q A;  3O1J A;  3AE6 A;  5IDN B;  5CB4 E;  1LRZ A;  1UX5 A;  3TLW A;  4IHJ E;  5GON E;  5AQM B;  4UEM A;  3LBX B;  4UVA B;  4ZOL E;  3RI5 A;  1E9H B;  4A98 A;  2I0M A;  1HNX T;  1BU2 A;  2XQ4 A;  1D1A A;  3SOL A;  3K3O A;  1R8I A;  4DR4 T;  4BY1 X;  4PK4 A;  4HFB A;  2CE7 A;  2FJA A;  5JDF A;  1UNH D;  3LQ5 B;  4DV5 T;  3A5X A;  3I0O A;  3QUJ A;  1W09 A;  5FXX A;  3P8C D;  3N2K E;  4IDN A;  2MAW A;  2UXX B;  4IGU A;  4LF7 T;  2CZ6 B;  3L3P A;  3FBL A;  5AQK B;  3KVB A;  4BCH B;  2KWH A;  2LLY A;  3CQC B;  1H1S B;  4IDQ A;  4ROE A;  4MLK A;  3GN5 B;  2CXL A;  2X9X A;  1ENW A;  3U3I A;  3WAK A;  5LJM A;  5JTG A;  4WBN E;  2JQQ A;  2BS2 A;  2F2C A;  2WBL A;  4CI2 B;  4K0K T;  2Y48 B;  2IW6 B;  2V22 B;  1XZY A;  3BHU B;  2P9B A;  2JGZ B;  3DDQ B;  2LT3 A;  4EB6 E;  4ELL A;  4LOC A;  1UGO A;  3FHN A;  3AEE A;  5EZY E;  4CFU B;  1D3U B;  1MND A;  1AD6 A;  2VUR A;  2CYZ B;  1UNG D;  1G3N C;  3TNH B;  2CXF A;  1N33 T;  4AI6 A;  4ZI3 C;  1SA0 E;  3H37 A;  4YFS A;  5ABF B;  3K7A M;  2D2S A;  4F7J B;  4HE8 A;  3LK2 B;  2BS4 A;  3CQG B;  3EI0 A;  4EEB A;  3EVY A;  2UUC T;  4L5G A;  1J5E T;  4LMJ A;  3RH3 A; 
#chains in the Genus database with same CATH homology
 3KV5 A;  4N78 D;  5IHY A;  4TV9 E;  5BMV E;  3I1A A;  3MZK B;  4H63 V;  2YEV C;  3ZYK A;  4EOZ B;  2L9Q A;  3L09 A;  3UUL A;  3U78 A;  3I9Y A;  1B7T A;  2KIN B;  4FJO A;  5L3C B;  3V5U A;  2CMR A;  4QWN B;  3R84 B;  3O1H A;  3CML A;  2ACX A;  4NUU A;  2Q9Q D;  4QHO A;  4QX8 B;  3K8P C;  2CXD A;  2G0U A;  4Z8X A;  2VK9 A;  2ES0 A;  3PTR B;  4PFO A;  4ZI2 D;  2DWG A;  2KWI B;  2J1D G;  3NZQ A;  3GN5 A;  4L0R A;  4BJM A;  1NWM X;  1D1C A;  2IC9 A;  2EHO B;  3KBU A;  4G2A A;  4H9S E;  4YJ2 E;  1QUU A;  1IJ6 A;  3UUX B;  3EUH A;  1D0X A;  3WI3 A;  2LHR A;  5HXC A;  3SS1 A;  4JEH B;  3ZMS B;  2K48 A;  5HWX A;  4O4J E;  3C4W A;  3LFM A;  3AA1 B;  5LOV E;  2X51 A;  3HL6 A;  2A3D A;  2WSS V;  5LGT B;  3ZN1 B;  5FP3 A;  2IAK A;  3J9X 1;  5CA1 E;  1MMG A;  2CEA A;  4U72 A;  3EDU A;  3ZMT B;  2YU1 A;  4H9P C;  3Q5W A;  3AA7 B;  4PNI A;  3UTK A;  2CLY C;  1BR2 A;  4ZI2 C;  1S35 A;  4HEA A;  3GMI A;  4KMC A;  4EZ4 A;  5LHH B;  3WAJ A;  5KMG P;  4PJL A;  4K0U A;  2ODU A;  2WMN A;  3ZJ1 A;  3NRX A;  3CWZ B;  2Q9Q C;  4PJN A;  2YU2 A;  2MYS A;  2Y6X A;  4YHJ A;  2V7L A;  4GOU A;  2H3R A;  5L3E B;  3C98 B;  4TZ4 C;  2WWU A;  4CXW A;  2UXN B;  4AQG A;  4I55 E;  3ZMV B;  1HX8 A;  4UXN B;  4ILU A;  2N2N A;  4GYS A;  2ZM8 A;  1CUN A;  3RKO A;  4EIW A;  2VKO A;  4AXP A;  2E9X C;  4BA9 A;  1V9D A;  5LNK A;  1OWA A;  3IBP A;  2LSK A;  5EK2 A;  2GK9 A;  5JRC A;  1BR0 A;  5ETW A;  5E0O A;  4UIG A;  3N5L A;  3Q9D A;  2E8I A;  3B13 A;  4H9O C;  4PK6 A;  2CWY A;  5JDN A;  5HYA A;  4ZI3 D;  1G8X A;  3RRC A;  3LK4 2;  4UF0 B;  1HCI A;  5H6R B;  5LHI B;  1X79 A;  2NP9 A;  4CQI A;  3AVS A;  4EXT A;  1IJ5 A;  2X9W A;  4CI3 B;  4BJN A;  2CWO A;  4P0B A;  2LSI A;  3AVR A;  1LKX A;  2E9X B;  4UVB B;  5F3J A;  3ZYL A;  4L9I A;  2X68 A;  3CX7 B;  3ETU A;  4OK0 A;  2E9X A;  2HPL A;  2MOZ A;  3PUA A;  4BAY B;  5HXE A;  4OYK A;  2Z6E A;  4E7S A;  2W62 A;  2LE8 A;  4GIW A;  1WYB A;  2VKH A;  2BDE A;  5H6Q B;  1HG5 A;  3BK9 A;  2M67 A;  4TV8 E;  5DAB A;  1QSD A;  2KZ7 B;  2NW7 A;  5HAX A;  5JVD E;  3KVA A;  2X67 A;  2LOS A;  2DHR A;  5FYM A;  3RRW A;  2H7V C;  4EZH A;  3VHL A;  3RX6 A;  3SWH A;  5HXS A;  4NUV A;  3KDS E;  2V7M A;  3S4U A;  3NRY A;  2ZM2 A;  5DQV A;  3PUG A;  3N9O A;  3RC8 A;  4FI5 A;  3HKE E;  1SHZ C;  3IF8 B;  3NBX X;  5LG4 A;  3TKL B;  5HWY A;  3DTO A;  2X0L B;  3HKB E;  4MAL A;  5JRC B;  3N9L A;  2RA1 A;  5FXV A;  1HS7 A;  3SRZ A;  3ZC0 A;  3HR0 A;  2W00 A;  4AKR B;  5CA0 E;  4H63 H;  2LM9 A;  4KUM B;  2QGS A;  1G73 A;  4UEL A;  3MAC A;  2A72 A;  3P7I A;  4WW0 A;  4J2C A;  3MKD A;  4XZC A;  5EK4 A;  4DO0 A;  4IE0 A;  1WLX A;  5L3D B;  2EHO C;  4U74 A;  2X9H A;  3ZPO A;  5L3F B;  1MMA A;  5L3B B;  5DJQ C;  4C91 A;  2NWB A;  3OYZ A;  4AKI A;  5JDQ A;  3N9P A;  4DVD A;  4XBF B;  4ASK A;  2JJ9 A;  3V5S A;  2JRK A;  3HA4 A;  2DCF A;  3VKG A;  4H9R C;  3HI2 A;  5JDM A;  5HXH A;  3ANW B;  4IE4 A;  2PJQ A;  5JR9 A;  1U5P A;  4WNK A;  1MMD A;  4HN9 A;  4I50 E;  2V1D B;  3BQL A;  3N9N A;  3O9X A;  2VAS A;  4YLH A;  3HKD E;  1UX4 A;  3MJX A;  4DBR A;  2BVL A;  1KK7 A;  4O4L E;  5KX5 E;  4JEU B;  4ANJ A;  4ZHQ E;  1MIY A;  2IC6 A;  3MXZ A;  5J2T E;  2PFV A;  1IZN B;  2DLR A;  1Y64 B;  2DNX A;  3RC3 A;  4PK5 A;  2CCQ A;  4HFV A;  3PUR A;  4MBQ A;  4AQF A;  1U4Q A;  4A56 A;  4EYU A;  2A2F X;  4V1A v;  5HXR A;  1FIO A;  2RP4 A;  4HTE A;  3DJB A;  3KV4 A;  4OYJ A;  5FNV E;  2ZLY A;  3NZP A;  2LOP A;  2MTQ A;  2D0T A;  2EHO A;  3QK6 A;  2YIN A;  4CI1 B;  3JC6 D;  3Q5X A;  3N9Q A;  3PE0 A;  2C5J A;  3ETV A;  1HF8 A;  1E1H B;  2KT9 A;  2WAU A;  4MFR A;  4ADZ A;  2HPJ A;  1VRB A;  3BQI A;  5JRE A;  4IST A;  3LBX A;  3ZC1 A;  4IDZ A;  3ESL A;  3FXD B;  2H7O A;  2V26 A;  3OBV E;  3IHR A;  4HGA A;  2ODV A;  4B6X A;  2Q9Q B;  4O4H E;  2NW9 A;  3UT5 E;  3C50 A;  1IAP A;  2C5K T;  1D1B A;  5ADX L;  4P09 A;  5LGU B;  4H9N C;  3FB2 A;  3GWH A;  2LSG A;  2N1G A;  2C0S A;  2CLY B;  2VKJ A;  1YKE B;  2N9D A;  2Q9Q A;  1HFA A;  2XUE A;  5JR9 B;  5L3G B;  4YJ3 E;  2K9A A;  4DND A;  2OA5 A;  3C4Z A;  5LBM A;  2W0G A;  3ZN0 B;  4C90 A;  5JH7 E;  2LSY A;  5LJN A;  3J7Y q;  3PU3 A;  3CX6 B;  3RYC E;  2K24 A;  4UV9 B;  4GYR A;  4AKG A;  5FY7 A;  1ZHC A;  3IEE A;  4ZI7 E;  3RYF E;  4HKA A;  2XAG B;  3LK3 B;  4DMV A;  4UV8 B;  3UUM A;  2DI4 A;  2HH7 A;  4KBM B;  2X66 A;  4IE6 A;  5KDM C;  2LJL A;  3I0Q A;  3KV6 A;  4TN7 B;  3RPU A;  3ZYM A;  4PFP A;  2XAQ B;  2VL8 A;  4G63 A;  3E22 E;  5FXW A;  4I4T E;  4PW8 A;  1D0Z A;  4EAH A;  1T98 A;  3B57 A;  4F6R C;  5JDL A;  4PJM A;  4QX7 B;  4EYY R;  2KLQ A;  3D0T A;  3MA9 A;  3ANW A;  3F31 A;  2XAS B;  3GA8 A;  4X1K E;  1VOM A;  3ZJ2 A;  3F2E A;  1LVK A;  2MBG A;  3PUS A;  4AKL A;  2LSJ A;  5J2U E;  3VU7 H;  4DMW A;  4OFZ A;  1D0Y A;  2CA5 A;  1FEW A;  1UCU A;  5LCY A;  2XAJ B;  2VWA A;  4ZS2 A;  3RYI E;  2KMF A;  3I9W A;  2NTY A;  3UUN A;  2CM0 A;  2VKD A;  1O3X A;  2IW5 B;  3E08 A;  5DQW A;  4IE5 A;  1MIV A;  4ISS A;  2L8K A;  3AB3 B;  3FBZ A;  3KBT A;  1ZEE A;  4WBO A;  5F8P A;  2B1E A;  5JDH A;  4O8S A;  2L3L A;  4TX5 A;  4X1I E;  5LYJ E;  3AAE B;  3PUQ A;  2V7J A;  5JDG A;  4AKH A;  4ZS3 A;  4CZZ B;  1KNZ A;  3HKC E;  3JC6 C;  3ZEF B;  4X20 E;  3N2O A;  3O1I A;  3R6N A;  2W63 A;  3N9M A;  3O1J A;  3EDV A;  1MIW A;  5L2L A;  4O2A E;  1LRZ A;  5CB4 E;  2YK0 A;  1UX5 A;  3DP7 A;  4IHJ E;  5GON E;  4DBQ A;  4UEM A;  2WMO A;  3LBX B;  3O4X E;  4UVA B;  4ZOL E;  4XAX B;  3ZCI A;  3H3A A;  3N2G E;  2SPC A;  5EK3 A;  2C5I T;  5M4Y A;  3C51 A;  5LP6 E;  3K3N A;  4H9Q C;  3F57 A;  1D1A A;  3SOL A;  3K3O A;  4UF0 A;  3KV9 A;  4PK4 A;  3RYH E;  2VB6 A;  2CE7 A;  1H7C A;  3ONX A;  2ZMA A;  4QXC B;  3ZMU B;  5JDF A;  2X9Y A;  2XTL A;  5LHG B;  3A5X A;  5AFU L;  3AA6 B;  3I0O A;  3AAI A;  4O4I E;  5JQG E;  3QUJ A;  3ZMZ B;  3C64 A;  2PG8 A;  3OJA A;  3P8C D;  5FXX A;  3E0Z A;  3N2K E;  4IE7 A;  2UXX B;  4ERR A;  4IGU A;  5IYZ E;  5LXT E;  3VKH A;  1ZKE A;  4M1P A;  1WRD A;  2EHO D;  1HTJ F;  3L3P A;  3FBL A;  3AAA B;  3KVB A;  5TAO A;  2V7I A;  3FXE B;  3M65 A;  3CX8 B;  2V7K A;  5FY0 A;  5FY1 A;  2KWH A;  1OXZ A;  3CQC B;  3W15 B;  3PDY A;  4IIJ E;  5A1L A;  2K5B B;  4KP3 C;  4QXB B;  2D0U A;  2BZB A;  4MHC A;  5LBQ B;  4UVC B;  4X1Y E;  4MLK A;  2NW8 A;  2NOX A;  3GN5 B;  2CXL A;  3BQK A;  1Z0P A;  2X9X A;  3KIN B;  3OYX A;  2BVM A;  3AA0 B;  4P0A A;  4AQF C;  1S94 A;  3U3I A;  5LA6 E;  3WAK A;  3PU8 A;  5LJM A;  1FMW A;  3CQX C;  4WBN E;  1NAF A;  2JQQ A;  4E7Z A;  5C8Y E;  3T8O A;  2D5U A;  2WBL A;  4CI2 B;  1YKH B;  2JPF A;  2Y48 B;  4GK0 E;  4CXY A;  3C4X A;  5FXZ A;  2P9B A;  3KFW X;  1EZ3 A;  2LHN A;  2XHE B;  2XAH B;  2LT3 A;  4EB6 E;  2Y8D A;  5JR9 C;  1YD8 G;  3CKD A;  1FMV A;  4QKN A;  2JMK A;  3FHN A;  1AJ3 A;  1WR6 A;  3K3Q C;  5EZY E;  2LEH A;  1MND A;  4OHF A;  2NTX A;  1HG2 A;  4JUY A;  1US7 B;  2DWK A;  3QC9 A;  3MK7 C;  1YW0 A;  2W61 A;  4QXH B;  4TUY E;  4PAG A;  3ZLI A;  4I43 B;  2PBI A;  3UFE A;  4GK5 E;  4CXX A;  2KXP B;  2CXF A;  4AI6 A;  1BR4 A;  1BR1 A;  4ZI3 C;  1SA0 E;  3H37 A;  4YFS A;  5J1G A;  4PJJ A;  2JMH A;  4JLE A;  2D2S A;  3LG7 A;  3OKQ A;  4HE8 A;  5FMN A;  2I59 A;  3LJC A;  2XQY A;  1MNE A;  3CPZ A;  3LK2 B;  1WYC A;  1MMN A;  3CQG B;  3ZCJ A;  3EVY A;  4L5G A;  2WM9 A;  2KND A;  1LVF A;  1ZV4 X;  2E9X D;  3CVR A;  3Q2M A;  3RH3 A;  5LGN B;  2ZM0 A;  4O2B E;  2XAF B;  2QA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...