3B57A

Crystal structure of the lin1889 protein (q92an1) from listeria innocua. northeast structural consortium target lkr65
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
180
Chain Sequence
MNKEEIILSAKNWMHSHFHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDQEATKTLINWMETKEIPSELIKKIIRIIQSVSALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNPKNTTLQHFYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin1889 protein
publication title Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
total genus 61
structure length 180
sequence length 203
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3b57A01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b57A02
2PJQA 5DQVA 3DTOA 5IHYA 5DQWA 3DJBA 3B57A 2QGSA
chains in the Genus database with same CATH superfamily
4IDPA 3UU8A 1E9HB 3SFDA 2B1EA 3LK3B 4IREA 1H25B 2LHNA 3AXJA 1OIUB 2VKDA 3TLVA 1L0VA 2KNDA 3JAEA 2FJDA 3BQLA 2MTQA 3CPZA 2LOSA 3NRYA 4O4IE 4EAHA 2D9DA 4EIWA 5LHGB 1Z0PA 2CCHB 4EOSB 1DU2A 4ILBA 4OB3B 4B3MT 4O4LE 3BG5A 1Y01A 4XAXB 1ZV4X 2CWOA 1KNRA 4PK4A 4LMJA 3HKEE 5HEUA 2UU9T 2PTFA 4FI5A 5JR9C 3MY1B 5LJNA 4HFVA 3UU6A 3QXEB 5LA6E 4MFRA 4EONB 2NW8A 3PDYA 4HGAA 5E0OA 3BG9A 4IHJE 2XQ3A 4JX5A 5FGKB 2K24A 3EAMA 3HHTB 2H89A 4EZ4A 5HXRA 3ZMZB 5DJQC 4JI8T 1GY3B 4H9RC 2XY8B 2Z6EA 4IL9A 3AEEA 3QZ5B 4ZEYA 1Z8UA 1HTJF 4TUYE 2EHOD 2C5XB 2UXBT 2IVXA 5IF1B 3PO3S 3RIFA 3ZC1A 3WAJA 4BCQB 2XM2A 4KRCB 3AEGA 2D2SA 4YSXA 3A8LB 4ZI3C 2ZMAA 2WWUA 3M65A 2VK9A 2D5UA 5CB4E 4BCFB 3X20B 3HO8A 2IAKA 4ZZCA 3AE9A 3UQ7A 1D0YA 2XQ7A 1ZEEA 4LF6T 3Q9DA 4CN1A 2C5KT 4EC8B 4TV8E 2WSSV 2P9BA 3CX7B 4B3RT 3KDSE 3TNWB 3UFGA 4F6WB 4Z6YA 1ZP0A 1W0AA 4DV5T 4DUZT 3CK6A 1HX8A 4H9OC 1QMZB 1YKHB 3H3MA 2BS4A 1J5ET 4X65T 3UUMA 4O4JE 4DR2T 2E2AA 2A72A 5L4HA 3ONJA 5ABHA 3HKDE 2C4GB 2AXDS 1FMVA 4JUYA 4GYRA 4JX4A 5FXZA 2LEHA 1OWAA 5HXHA 2CBJA 1US7B 1OEDB 4PK6A 5AQQB 3X1DA 2NTYA 3MJXA 3ZT6A 3VHLA 3PUVF 2YK0A 3BHVB 3ZYKA 4QXCB 2RP4A 3P7IA 4HWDA 2BBJA 1D3UB 3KV4A 1H26B 2UUBT 2IHR1 2JQQA 4DV6T 4BCKB 3OBVE 4AQGA 4CQIA 3H37A 4EOZB 1O9KB 4CFNB 5LHIB 4BBRM 4LMLA 1OGUB 3B5MA 2WY2A 3ANWA 2JPFA 2WBLA 3ETVA 3T1HT 4JI2T 3UU5A 2VKHA 2CYZB 5HEGA 2W9FA 2DCFA 4PAGA 4ZXLA 1QUUA 4CFWB 2JQHA 4OB0B 3HKCE 4U7YA 1VINA 4JV5T 5AQOB 2XSAA 1MIYA 3Q2MA 1WYBA 5L47A 1V9DA 5F8PA 4KHZF 5M4YA 1VOMA 4B3ST 3HR0A 2QQ8A 1VRBA 3FZMB 2KT9A 2V5CA 5LOVE 4CI3B 2X51A 2PMIB 3DP7A 4QSHA 4OYJA 2ODVA 4EC9B 5HEJA 5C3JA 2XUEA 3AE4A 4Z90A 5HNBB 1MNEA 2UUCT 2VKOA 4XZCA 2BVMA 1KEYA 3CMLA 1O3XA 4OHFA 4U31A 2ZM6T 2V6YB 4C91A 2Y8DA 4YLHA 3F2EA 4CFXB 4BCIB 1URCB 3R84B 4PJLA 1UGQB 3PJAJ 3FZLB 4HFEA 3CVRA 3VRBA 4H9NC 1P5EB 4C90A 1HG5A 1KNPA 4ASKA 1FINB 2LM9A 1C9BA 3ZCIA 2V1DB 4AIUA 5J0ZA 3P4SA 2ZCFB 5LBMA 4LFCT 2ZPGB 1LRZA 1OEDC 3LQ5B 3KV5A 1H28B 1IAPA 4U33A 3C51A 5FMNA 1LKXA 4ZI3D 1W9RA 2V26A 2R6GF 2XPKA 5AQKB 4YFSA 1QLBA 2RA1A 3FBLA 2GK9A 2WXVB 2EUFA 2H7VC 3PUAA 1X9BA 2J1DG 4DBQA 2JQ9A 3AA1B 3NZQA 3N2OA 2LRLA 2IDOB 2CHOA 3L8RA 3AAEB 3UUXB 4CFUD 3A5XA 4O2BE 3AE1A 5IWAT 4DR5T 3FXEB 2DI4A 3D0TA 2I0MA 2NW9A 4F6SB 4DV1T 3ZN0B 1SHZC 2NP9A 1AISB 1XNRT 2V7KA 2BPMB 5ETWA 1FMWA 3K7AM 2VQET 2F2CA 1SA0E 5DABA 2CXDA 3DTOA 1IBKT 2EHOC 3PURA 2H7OA 4ZI7E 1I94T 4ROEA 2LSGA 4IE6A 3Q5DA 4AKLA 2YU1A 2MOZA 1HCIA 3L39A 4MIMA 2L3LA 3RX6A 4YTMA 1KNZA 3LSVA 4CXAB 4QH5A 3RKGA 3PE0A 4DIDB 3QK6A 2DPPB 3N9OA 2YDQA 1UNLD 2X9HA 2QA7A 2WPAB 3BG3A 4DVDA 4QXHB 3E22E 5J2TE 3E08A 3C98B 1TFBA 1UGSB 3ABVA 5JR9A 2DD4B 4HNTA 3IEEA 3VRAA 4P0BA 2WHBB 4TX5A 3GN5A 4QHOA 3ONXA 1H1RB 2WZHA 4LFBT 5L3CB 1GH6B 4BCNB 4YJ3E 2PFVA 3ZLIA 3CQGB 5LHHB 2IW5B 3WVEB 2WZIA 2ZZDB 1BR2A 1HR0T 2JJ9A 2BDEA 2KSRA 3AE8A 3EABA 4OFZA 3TNHB 2I53A 3R6NA 3AAIA 4BCQD 3HI2A 5JDHA 3LBXA 2CXLA 3BQIA 1IREB 5CA1E 2WAUA 3A8HB 2KZ7B 5AQIB 2HN2A 2V7MA 4HFDA 4WZXA 4YTPA 4F7JB 1UNHD 3MKDA 4IMYB 2YU2A 3MA9A 4F7SB 3FB2A 1H1QB 4BCMB 3UU3A 4H63V 3PU3A 5LJMA 3QYEA 2MAWA 5L3BB 1J5WA 1MNDA 4KMCA 3VYGB 3QB5K 2WFYB 3GA8A 5H6RB 4H63H 4OX9T 2K9AA 3QYBA 2BG9B 4U74A 2NTXA 2V5DA 3VKHA 5H6QB 3ZSSA 2LJLA 4IE5A 2E9XB 4KRDB 1VCSA 4YHJA 3KV9A 1F5QB 4EOJB 4UXNB 3ZMUB 4BCHB 2IW6B 3QC9A 4TV9E 1PKDB 2PJQA 3LK42 2VVSA 4JI7T 1AD6A 3OJAA 4CFMB 2M6IA 2QGSA 3L3PA 3OYXA 5ABFA 4A98A 4PJMA 4ELLA 4L9IA 4LF5T 4ISTA 4UIGA 4CXWA 1H7CA 4M6VA 3CKDA 2PBIA 4HFCA 4Q25A 5HXEA 4A97A 4OYKA 3C50A 5EK3A 5L3EB 3MXZA 1H24B 4GKKT 3EOCB 2XAJB 4H9PC 1FIOA 1E7PA 4EXTA 4EYYR 4EOPB 2YEVC 2G0UA 2WDRA 3RHWA 4HWHA 2A2FX 2WJ9A 1E2AA 2CEAA 3N9NA 3FBZA 4WNKA 1UCUA 4OB1B 2IC9A 2K3WA 4JI6T 2V22B 4UN0A 2WP9A 2J47A 2W0GA 3QZ9B 2H3RA 4DV2T 3RRWA 4KI0F 4NIQA 2DNXA 2XAFB 3FZKB 5LCYA 2PK2A 3PUWF 2KWHA 3RC3A 3AB3B 1OKVB 2A3DA 1D1BA 2DWGA 4UVCB 3N9QA 2CE7A 3OYZA 2X67A 3PTRB 2YDRA 1BU2A 3TN8B 2CHNA 2FJEA 2W96A 4X20E 3AVRA 2W61A 3UU4A 2W67A 3ESLA 4TZ4C 4BY7X 1UGOA 2BBHA 4EV6A 1KXUA 3DDPB 1HFAA 2R7GA 4PFOA 2N9DA 1OL2B 3MIAB 2IMLA 3EIDB 4YTNA 2W9ZA 4YSZA 1OKWB 3TKLB 3Q5WA 3C4WA 2XASB 4AISA 3V5UA 4YOZA 4QH4A 3N5LA 2LSKA 4JLEA 2Q9QA 4DR4T 3ZT5A 3QOFA 3MZKB 1ZHCA 2E9XC 3ZMVB 2QDJA 3A8GB 2WMAB 4H9QC 3FZHB 1H1PB 2KWIB 1WCRA 2W99A 4II5B 4ERRA 3JCFA 1ZKEA 1J1JA 3AECA 4CN4A 4GIWA 4X1YE 2QYWA 4LF4T 2YDSA 4X66T 5HQ0B 4M1PA 5HYAA 2UUEB 4U3CA 4DMWA 4UELA 5ABGA 3DL1A 5HAXA 3P4WA 2CJMB 4IE4A 1OEDA 3O9XA 3RPUA 5JDLA 3FHNA 2HH7A 4O8SA 2W2HA 5LXTE 3O1IA 4G63A 1HX1B 1D1CA 3CQXC 4MALA 2CRBA 3X25B 4BCJB 4DV3T 2ZLYA 4BCGB 3MI9B 3TLTA 5IDPB 5L4EA 1T98A 1WFDA 3LFMA 2BKOA 2XM1A 3EDUA 4GK0E 3OTOT 2CWYA 3TW7A 3ZPOA 2I6HA 3RGLA 4JI4T 4FM4B 1NEKA 4AXPA 4NXMT 2CCQA 1OEDE 1UURA 3JC6C 4PW8A 4U2YA 4HL4A 1I6ZA 3AEDA 4CI1B 3B57A 4GOUA 4CRLB 4EB6E 3EUHA 4TWHA 1JOWA 1N4MA 1S35A 4NXNT 1XNQT 4AI6A 1FEWA 4PJJA 3AE7A 2IW8B 4DMVA 2C5JA 3CX6B 2EHOA 4BJMA 4AQFC 1LVKA 2KMFA 2KLQA 4KHPT 2BKNA 1MMGA 2BVLA 2WB5A 3PUSA 3BHTB 4AKGA 5BR8T 1YKEB 3G33B 4FJOA 5LMUT 1T72A 4ANJA 5C2TA 5HBJB 1XZYA 2KINB 2LW4A 3M3ZB 3E0ZA 3A8OB 5FKYA 5HEHA 1IZNB 3LDQB 2CM0A 2JGZB 1GUXA 4U7IA 4EZHA 3RYIE 4CXXA 2XQ4A 4GYSA 2FJBA 4BCND 2LRKA 1UK5A 3O0GD 3UFEA 2HPLA 3HBLA 2CXFA 4I55E 3RF1A 2CCIB 3RI5A 3I0QA 4JEUB 3RYFE 5FL0A 2XHEB 2CBIA 4IDNA 1N32T 4XBFB 2DMEA 2WMOA 1EZ3A 4CXYA 2CZ1B 4I4TE 5AQPB 2IW9B 3UUBA 3HA4A 1CHUA 1OL1B 5HEOA 2CZ0B 5EK2A 2FUPA 4QH1A 4HFHA 4PFPA 3VU7H 5IHYA 1T7SA 5HXSA 5FY1A 1YD8G 5JREA 4YXDA 1E1HB 3W15B 4F7NB 4ILAA 2YOEA 5AFUL 4ZS2A 2ZM0A 3J7Yq 1U5PA 2CZ7B 2LSJA 3WVDB 2WIHB 2XQYA 3K3OA 2WDVA 3AE2A 1G8XA 4BXXX 4DR3T 2L9QA 2BS3A 3RLFF 2UZEB 4WBNE 1HNXT 2W62A 5JH7E 4YHHT 1XDOA 3KHIA 4HFIA 4HNUA 1H27B 1H1SB 3RKOA 2X9XA 5I5ZB 5FXVA 2E9XD 3RQUA 4WYVA 2BS2A 5L3GB 2V6XA 2DHRA 1R8IA 4BAYB 3MY5B 5AQTB 1GQEA 2SPCA 3EHZA 2QF7A 5EK4A 3ZSTA 2DL1A 4IE0A 4BA9A 2JRKA 4YY3T 1HG2A 3AVSA 3LJCA 2C6TB 3U3IA 2CLYB 3G06A 3POMA 1MMDA 4CI2B 5CA0E 1HF8A 1XWMA 2CMRA 3NVOA 1AJ3A 2LE8A 3OKQA 5AQJB 2UZBB 1OIYB 2NW7A 4MBQA 1W98B 1BR0A 1YQ4A 3JADA 3TW6A 1FJGT 1S94A 5JRCA 3ONLC 3UTKA 3SS1A 4HFBA 4PNIA 4K0UA 3TLWA 4E7ZA 2D0UA 3RYHE 4YJ2E 2M67A 4B6XA 5EZYE 3ZEFB 1N33T 3O4XE 4EOQB 3TLUA 1JSUB 3N9PA 4EOIB 3EVYA 4UV8B 3KV6A 5LMNT 3ZC0A 5LQFB 4EOMB 4EYUA 5HWYA 1D0ZA 4DR6T 1WRDA 3JC6D 5KDMC 2D0TA 2C5IT 3A8MB 3U78A 5L2WB 4BBSM 2L8KA 3QHWB 1KFYA 1H4LD 3KFWX 4IT4A 2X1NB 1JSTB 2WU5A 3J9X1 4ZGDB 3I9WA 5L2LA 3AA7B 1JKWA 1OXZA 2B76A 3BLQB 4V1Av 2ACZA 4UEMA 4TN7B 1CUNA 2WS3A 2XAGB 3B13A 2VL0A 3F31A 3K1SA 2NWBA 4LF7T 4UVAB 4P09A 4HKAA 1WR0A 4HWIB 1HNZT 3P4QA 2Y48B 3N9LA 4L5GA 2HPJA 3M03A 3QHRB 4OR5B 1IJ6A 4QX8B 2OLTA 3NWIA 5J1GA 4G2AA 4Z91A 5JQGE 4F6RC 3ZYMA 4IE7A 2NR4A 3P50A 3RIAA 3T1YT 4EOOB 3WI3A 1QSDA 4TWDA 2KMGA 4BJNA 3GWHA 4UR9A 1IBMT 2E5VA 3L09A 2XAHB 1V29B 2X9WA 4QX7B 5HVYB 2E9XA 4UF0B 3X26B 5ICPB 4EORB 5EJCA 3LK2B 5FP3A 4Y72B 1WR6A 2FJAA 3RYCE 3ZT7A 3PU8A 3CQCB 3PUYF 4AKHA 4E7SA 5L3DB 3RQWA 4N78D 1W09A 3K8PC 5FVKA 3F5XB 1YXRA 3AEBA 5JDMA 2BG9E 1TD6A 2ZPBB 1XMQT 3HKBE 4TNVA 3QWLA 4ZZBA 4P1NA 2LSIA 1XMOT 4WW0A 3PUXF 3O1HA 4RODA 3IF8B 4AKRB 2PHGA 3AXJB 1BR1A 3RIUC 4UV9B 2V7LA 3O1JA 3DDQB 4HLQA 4G6LB 5AQNB 4F6UB 4ZHQE 5DQWA 4BCPB 3AAAB 5JDNA 4JI0T 5ABFB 1YQ3A 2X9YA 4X64T 1B7TA 3NZPA 2UZLB 4U2ZA 3N2KE 4YOSA 4TTHA 2ZM2A 3NBXX 3PUQA 5CEIB 4ROCA 4ZI2C 1FKMA 1YW0A 4WBOA 5KMGP 4HWFA 4U72A 4HEAA 3N2GE 3AE6A 2WEVB 4PJNA 2WQYA 4HN9A 5LB7B 3QUJA 4DBRA 2XSBA 4MLKA 1AHJB 3WAKA 3LG7A 2Y6XA 2ZPHB 2BKPA 4AKIA 4AQFA 2XQ9A 1U4QA 5LGNB 3VR9A 3RGFB 3GTMS 2ZPFB 5LP6E 1JNRA 2KXPB 3TLSA 2V7IA 4IDQA 3QB5A 3BK9A 4OGRB 4OB2B 4EEBA 2HN1A 2C5VB 3QNUA 3VYHB 3H4CA 1NAFA 2WDQA 1IBLT 2M6BA 2ODUA 4DR1T 4JEHB 1HNWT 2BG9C 2LKGA 2X0LB 1UGRB 2XQ6A 2X66A 5AQRB 1LVFA 4NC6A 2X0HA 4X5TA 4MHCA 4LFAT 3FXDB 5HBHB 1ENWA 2NOXA 4I0UA 2C5NB 2DXBB 2G77A 1UUSA 4L0RA 2ZPIB 5HBEB 4OK0A 4ILCA 3FZFB 2IUBA 3UULA 2B9RA 2N2NA 1VYWB 1VOLA 3AA6B 2A9UA 4LF9T 3P8CD 3PUGA 2DXCB 2Q9QB 3UT5E 1KF6A 5IUXA 4CFVB 1UX5A 2VWAA 1ZP2A 4B3TT 2W00A 3K3QC 1VCTA 2C5OB 2YN6A 3NDQA 4NSTB 4X1KE 3C64A 3VR8A 2F4VT 4HTEA 1MIVA 4HNVA 1UNGD 2XZEA 2VB6A 4I3ZB 3F57A 3GMIA 4X62T 3NRXA 2JMKA 5AQMB 5TAOA 4DUYT 1SE7A 1O9KA 4FX3B 3OVUA 2DLRA 4EGWA 4JX6A 4YT0A 4JBWF 1KK7A 3H3AA 4HE8A 5HCMA 4KP3C 4DV0T 4O2AE 5AQGB 4I50E 2AE9A 4X1IE 4A5XA 3IHRA 4KBMB 4ILUA 3TNIB 4NPPA 4IGUA 4F70B 2QVAA 1BR4A 1UGPB 2VKJA 2VURA 4IL4A 2W63A 3T8OA 3PUZF 5FXWA 2LLYA 3A7MA 3ANWB 2J62A 3HL6A 1M62A 5J2UE 3EDVA 4F8HA 2ZM8A 3BQKA 4AQYT 3RRCA 3ZN1B 4GK5E 3X28B 4ZGJB 3BLRB 3SWHA 2CA5A 1JNZA 2OA5A 3EI0A 4UVBB 3CIRA 2E5LT 2ACXA 2V6YA 2EHOB 2LOPA 3P4RA 2MBGA 3OPCA 5CJ5A 1Y64B 2D0QB 5JDFA 3S4UA 5KX5E 3ZKRA 5CGMA 5AQUB 2RPAA 4J2CA 5ADXL 2UXXB 3AE5A 5CYIB 3X24B 2N1GA 1WLXA 2Q9QC 3JAFA 1XDPA 4ZI2D 2XQAA 1W0BA 3ZJ1A 1GUXB 4ZGEB 4CN6A 4A56A 2V8SV 4ZS3A 4HWCA 1N36T 5CFBA 4DV7T 2ZPEB 4BY1X 3IBPA 4TWFA 2UXCT 1M7KA 5AQLB 2HHHT 5FNVE 4TNWA 5AQHB 3I1AA 4H9SE 2J4GA 3MK7C 4ZOLE 4BCMD 3K3NA 3ZCJA 3KBUA 3QYHB 5FY0A 4YOOA 5EFQB 3ZYLA 3IA3A 1X79A 3ETUA 2IIUA 5FXXA 2QRXA 2BKZB 3I0OA 3KINB 3ZMSB 3CWZB 4IIJE 4MFEA 2JMHA 3DJBA 2DWKA 4YC3B 1N34T 4MFDA 2YKSA 5LNKA 2G9XB 1T8BA 3KBTA 3AA0B 2I40B 5LG4A 5LMKB 2WIPB 2VASA 3P4PA 5JDGA 3Q5EA 5HWXA 4IDZA 1G3NC 2LM2A 2WCAA 3CX8B 4KUMB 1XO2A 3NKZA 4LF8T 2W66A 2FBWA 1MIWA 1D1AA 3HB9A 5ABEA 4LOCA 3ZMTB 3BHUB 2XQ8A 5C8YE 1ZOYA 2VVNA 2K48A 4JYAT 2UZDB 2MPKA 3BLHB 4JI5T 3C4XA 4PK5A 1MMAA 5LBQB 3RC8A 5JDQA 3UUNA 1IJ5A 1MMNA 3MACA 3ZJ2A 3SFEA 5BNJB 4JI1T 4ISSA 5FY7A 2QFZA 4ELJA 5HCJA 4I43B 5DQVA 2ES0A 2IC6A 4NUUA 2LT3A 3VKGA 3AEAA 3C4ZA 3RIUA 4K0KT 2WMBB 2WM9A 2LKHA 5BMVE 3EJ1B 4ADZA 4EOKB 4F7LB 3KVBA 5LGTB 3I9YA 2VL8A 2W4XA 5JTGA 2DD5B 1WYCA 4BCOB 4YSYA 3AEFA 2WWVA 2X68A 5JRCB 3HZJA 3A8YC 1G73A 3V5SA 2PK9B 1OI9B 2YINA 2XJ7A 4QKNA 2WU2A 2QDYB 4DV4T 5IDNB 5JR9B 4LMKA 1SUMB 4COFA 5GONE 5F5WA 5LG3A 3GN5B 5LGUB 3PJAA 2XQ5A 4O4HE 2XTLA 4CZZB 3DOGB 3AE3A 4IDOA 3SRZA 2V7JA 1FVVB 2AHJB 2OV9A 1HS7A 2CPTA 2X0YA 2C0SA 3LBXB 4DNDA 4KX6A 5KXJA 3UQ4A 2I59A 3PV0F 5L3FB 3RH3A 2UUAT 5IYZE 2H88A 5FVLA 2BZBA 4EOLB 1D0XA 2VQFT 5LYJE 3N9MA 2LHRA 2KR6A 2BG9A 4UF0A 2IN3A 2MYSA 5HXCA 5AQSB 5JVDE 2UXNB 4P0AA 2WMNA 4GKJT 3SOLA 2K5BB 2JQKA 2LSYA 5A1LA 2CLYC 2PG8A 2Q9QD 2CZ6B 4EEDA 5FL1A 4Z8XA 3Q5XA 4NUVA 5FYMA 1NWMX 4DO0A 4DR7T 4QXBB 1UX4A 2E8IA 2W2UA 3QYGB 4CFUB 2JIWA 3KVAA 5ACBA 4JI3T 1NENA 4QWNB 2UXDT 5AQVB 5AQFB 5F3JA 2XAQB
chains in the Genus database with same CATH topology
4OK0A 1IZNB 2L3LA 2CM0A 3RX6A 1KNZA 3UULA 4EZHA 3RYIE 4CXXA 4GYSA 3PE0A 2B1EA 2N2NA 3LK3B 3QK6A 2LHNA 2VKDA 3N9OA 2KNDA 3AA6B 3P8CD 3PUGA 3UFEA 2X9HA 2HPLA 2Q9QB 3BQLA 2QA7A 2MTQA 3CPZA 3UT5E 2CXFA 4I55E 4DVDA 4QXHB 3E22E 3I0QA 5J2TE 1UX5A 4JEUB 3E08A 2LOSA 3RYFE 2XHEB 3C98B 3NRYA 4O4IE 2VWAA 4EAHA 4XBFB 4EIWA 2WMOA 5LHGB 1EZ3A 1Z0PA 5JR9A 2W00A 4CXYA 3IEEA 3K3QC 4O4LE 4I4TE 4P0BA 4TX5A 4XAXB 3HA4A 3GN5A 4QHOA 4X1KE 1ZV4X 3C64A 2CWOA 3ONXA 4HTEA 1MIVA 5L3CB 4PK4A 4YJ3E 3HKEE 2PFVA 4FI5A 3ZLIA 5EK2A 5JR9C 5LJNA 3CQGB 5LHHB 2IW5B 4PFPA 4HFVA 3VU7H 5IHYA 2VB6A 3F57A 3GMIA 5HXSA 1BR2A 5FY1A 1YD8G 5JREA 2JJ9A 3NRXA 5LA6E 2BDEA 2JMKA 4MFRA 1E1HB 5TAOA 3W15B 2NW8A 4OFZA 3PDYA 4HGAA 5E0OA 3R6NA 5AFUL 3AAIA 4ZS2A 3HI2A 2ZM0A 4IHJE 5JDHA 3J7Yq 1U5PA 3LBXA 2K24A 2DLRA 2LSJA 1KK7A 2CXLA 2XQYA 3BQIA 3H3AA 3K3OA 4HE8A 5CA1E 1G8XA 2WAUA 4KP3C 4O2AE 2KZ7B 2V7MA 4I50E 2L9QA 4X1IE 4WBNE 4EZ4A 5HXRA 3ZMZB 5DJQC 3IHRA 4KBMB 4ILUA 4H9RC 2W62A 2Z6EA 5JH7E 3MKDA 4IGUA 2YU2A 3MA9A 1BR4A 1HTJF 3RKOA 4TUYE 2EHOD 2VKJA 2X9XA 3FB2A 2W63A 4H63V 3PU3A 5FXVA 3ZC1A 3WAJA 2E9XD 3T8OA 5LJMA 5FXWA 5L3BB 2D2SA 3ANWB 1MNDA 4KMCA 5L3GB 2DHRA 3HL6A 4ZI3C 2ZMAA 5J2UE 3EDVA 3GA8A 2ZM8A 2WWUA 3M65A 2VK9A 2D5UA 5H6RB 2SPCA 4BAYB 3BQKA 4H63H 5CB4E 5EK4A 3RRCA 4BA9A 4IE0A 2JRKA 2IAKA 3ZN1B 1HG2A 3AVSA 3LJCA 2K9AA 4GK5E 3U3IA 1D0YA 3SWHA 2CA5A 2CLYB 1ZEEA 2OA5A 4UVBB 1MMDA 4U74A 2ACXA 2NTXA 3Q9DA 4CI2B 5CA0E 3VKHA 2C5KT 5H6QB 2EHOB 1HF8A 2LOPA 2CMRA 4TV8E 2MBGA 2WSSV 1AJ3A 2P9BA 2LE8A 2LJLA 3CX7B 3OKQA 4IE5A 2E9XB 2NW7A 4MBQA 4YHJA 1Y64B 3KDSE 1BR0A 3KV9A 5JDFA 3S4UA 4UXNB 5KX5E 1S94A 3ZMUB 5JRCA 3QC9A 3UTKA 3SS1A 1HX8A 4PNIA 4TV9E 4K0UA 2PJQA 4H9OC 3LK42 4J2CA 4E7ZA 3OJAA 5ADXL 1YKHB 2UXXB 2QGSA 3L3PA 2D0UA 3RYHE 4YJ2E 2M67A 3UUMA 4B6XA 2N1GA 1WLXA 2Q9QC 3OYXA 4O4JE 4ZI2D 4PJMA 5EZYE 3ZEFB 3O4XE 4L9IA 4ISTA 4UIGA 4CXWA 2A72A 1H7CA 3ZJ1A 3CKDA 2PBIA 3HKDE 3N9PA 4A56A 5HXEA 3EVYA 4UV8B 4ZS3A 3KV6A 4OYKA 3C50A 5EK3A 3ZC0A 5L3EB 3MXZA 3IBPA 1FMVA 4EYUA 4JUYA 5HWYA 2XAJB 4GYRA 1D0ZA 5FXZA 4H9PC 1WRDA 1FIOA 3JC6D 5KDMC 2D0TA 4EXTA 2LEHA 4EYYR 2YEVC 2C5IT 2G0UA 5FNVE 1OWAA 3I1AA 3U78A 2A2FX 2L8KA 4H9SE 5HXHA 3MK7C 1US7B 4ZOLE 4PK6A 3KFWX 2CEAA 3N9NA 3FBZA 4WNKA 1UCUA 2IC9A 3K3NA 3ZCJA 3KBUA 2NTYA 3MJXA 3J9X1 5FY0A 3VHLA 3I9WA 5L2LA 3AA7B 1OXZA 2YK0A 2W0GA 3ZYKA 4QXCB 2RP4A 4V1Av 3ZYLA 2H3RA 4UEMA 3RRWA 3P7IA 1X79A 4TN7B 1CUNA 3ETUA 5FXXA 2XAGB 2DNXA 2XAFB 3B13A 5LCYA 3I0OA 3F31A 3KINB 3ZMSB 3CWZB 4IIJE 3KV4A 2NWBA 2JMHA 3DJBA 2JQQA 2DWKA 2KWHA 4UVAB 4P09A 4HKAA 3OBVE 4AQGA 3RC3A 2Y48B 3AB3B 2HPJA 2DWGA 2A3DA 1D1BA 1IJ6A 3H37A 3N9LA 3N9QA 4L5GA 4QX8B 4UVCB 4CQIA 4EOZB 2CE7A 3OYZA 5J1GA 5LNKA 2X67A 3PTRB 4G2AA 5LHIB 5JQGE 4F6RC 3KBTA 3AA0B 3ANWA 2JPFA 2WBLA 3ETVA 5LG4A 3ZYMA 4X20E 3AVRA 2W61A 4IE7A 2VASA 2VKHA 5JDGA 3ESLA 2DCFA 4PAGA 4TZ4C 5HWXA 4IDZA 1QUUA 3WI3A 3CX8B 4KUMB 1QSDA 3HKCE 1HFAA 4BJNA 1MIWA 1D1AA 3GWHA 4PFOA 2N9DA 3ZMTB 1MIYA 3L09A 2XAHB 1WYBA 3Q2MA 5C8YE 1V9DA 5F8PA 2K48A 5M4YA 1VOMA 3TKLB 3Q5WA 3C4WA 2X9WA 3C4XA 2E9XA 3HR0A 4PK5A 4QX7B 1MMAA 4UF0B 5LBQB 1VRBA 3RC8A 5JDQA 3UUNA 2KT9A 1IJ5A 5LOVE 2XASB 1MMNA 4CI3B 3MACA 2X51A 3LK2B 5FP3A 3V5UA 3ZJ2A 3DP7A 3N5LA 2LSKA 1WR6A 3RYCE 4OYJA 2ODVA 4JLEA 2Q9QA 3PU8A 2XUEA 3CQCB 4ISSA 5FY7A 3MZKB 1MNEA 4E7SA 5L3DB 4AKHA 2VKOA 4XZCA 2BVMA 1ZHCA 2E9XC 3ZMVB 4I43B 4N78D 5DQVA 2ES0A 2IC6A 3K8PC 4H9QC 4NUUA 3CMLA 1O3XA 2LT3A 4OHFA 3VKGA 3C4ZA 2KWIB 4ERRA 5JDMA 4C91A 2WM9A 5BMVE 1ZKEA 2Y8DA 3HKBE 4YLHA 4ADZA 3F2EA 4GIWA 2LSIA 3KVBA 4WW0A 3O1HA 4X1YE 5LGTB 3IF8B 3I9YA 4M1PA 5HYAA 4AKRB 2VL8A 3R84B 4PJLA 1BR1A 1WYCA 4DMWA 4UV9B 4UELA 2X68A 2V7LA 3O1JA 5JRCB 5HAXA 4IE4A 3CVRA 1G73A 3V5SA 3O9XA 3RPUA 5JDLA 4ZHQE 3FHNA 2HH7A 5DQWA 2YINA 4H9NC 4O8SA 4C90A 1HG5A 3AAAB 4QKNA 5LXTE 5JDNA 3O1IA 4ASKA 2LM9A 2X9YA 4G63A 5JR9B 1D1CA 3ZCIA 2V1DB 5GONE 3CQXC 1B7TA 3NZPA 4MALA 3N2KE 5LBMA 3NBXX 2ZM2A 1LRZA 3PUQA 2ZLYA 3GN5B 5LGUB 4ZI2C 4O4HE 2XTLA 3KV5A 1T98A 1YW0A 3LFMA 1IAPA 4CZZB 3C51A 3EDUA 4WBOA 5FMNA 5KMGP 4GK0E 1LKXA 2CWYA 4U72A 4HEAA 4ZI3D 2V26A 3ZPOA 3N2GE 3SRZA 4AXPA 4PJNA 2CCQA 2V7JA 4HN9A 4YFSA 3QUJA 4DBRA 2RA1A 4MLKA 1HS7A 3FBLA 3JC6C 2GK9A 4PW8A 3WAKA 3LG7A 2Y6XA 2H7VC 3PUAA 2C0SA 3LBXB 4CI1B 3B57A 4DNDA 2J1DG 4GOUA 4AKIA 4EB6E 4AQFA 4DBQA 1U4QA 3AA1B 3NZQA 2I59A 3N2OA 5LGNB 3EUHA 3AAEB 3UUXB 5L3FB 3RH3A 3A5XA 5IYZE 1S35A 2BZBA 4O2BE 1FEWA 4AI6A 5LP6E 4PJJA 2KXPB 1D0XA 2V7IA 3FXEB 5LYJE 3N9MA 2DI4A 2LHRA 3D0TA 3BK9A 2NW9A 4DMVA 2C5JA 4UF0A 3ZN0B 2MYSA 3CX6B 2EHOA 1SHZC 5HXCA 4BJMA 2NP9A 4AQFC 2V7KA 1LVKA 2KMFA 2KLQA 5JVDE 2UXNB 4P0AA 2WMNA 5ETWA 1FMWA 1MMGA 2BVLA 3SOLA 1NAFA 2K5BB 3PUSA 1SA0E 2LSYA 5A1LA 4AKGA 5DABA 2CXDA 2CLYC 2PG8A 2ODUA 2Q9QD 3DTOA 1YKEB 4JEHB 4FJOA 2X0LB 4Z8XA 3Q5XA 4NUVA 5FYMA 4ANJA 1NWMX 4DO0A 2X66A 2EHOC 1UX4A 4QXBB 2E8IA 1LVFA 2KINB 3KVAA 3PURA 2H7OA 4ZI7E 4MHCA 4QWNB 3E0ZA 3FXDB 2LSGA 4IE6A 4AKLA 2NOXA 2YU1A 2MOZA 4L0RA 5F3JA 1HCIA 2XAQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJQ A;  5DQV A;  3DTO A;  5IHY A;  5DQW A;  3DJB A;  3B57 A;  2QGS A; 
#chains in the Genus database with same CATH topology
 4IDP A;  3UU8 A;  1E9H B;  3SFD A;  2B1E A;  3LK3 B;  4IRE A;  1H25 B;  2LHN A;  3AXJ A;  1OIU B;  2VKD A;  3TLV A;  1L0V A;  2KND A;  3JAE A;  2FJD A;  3BQL A;  2MTQ A;  3CPZ A;  2LOS A;  3NRY A;  4O4I E;  4EAH A;  2D9D A;  4EIW A;  5LHG B;  1Z0P A;  2CCH B;  4EOS B;  1DU2 A;  4ILB A;  4OB3 B;  4B3M T;  4O4L E;  3BG5 A;  1Y01 A;  4XAX B;  1ZV4 X;  2CWO A;  1KNR A;  4PK4 A;  4LMJ A;  3HKE E;  5HEU A;  2UU9 T;  2PTF A;  4FI5 A;  5JR9 C;  3MY1 B;  5LJN A;  4HFV A;  3UU6 A;  3QXE B;  5LA6 E;  4MFR A;  4EON B;  2NW8 A;  3PDY A;  4HGA A;  5E0O A;  3BG9 A;  4IHJ E;  2XQ3 A;  4JX5 A;  5FGK B;  2K24 A;  3EAM A;  3HHT B;  2H89 A;  4EZ4 A;  5HXR A;  3ZMZ B;  5DJQ C;  4JI8 T;  1GY3 B;  4H9R C;  2XY8 B;  2Z6E A;  4IL9 A;  3AEE A;  3QZ5 B;  4ZEY A;  1Z8U A;  1HTJ F;  4TUY E;  2EHO D;  2C5X B;  2UXB T;  2IVX A;  5IF1 B;  3PO3 S;  3RIF A;  3ZC1 A;  3WAJ A;  4BCQ B;  2XM2 A;  4KRC B;  3AEG A;  2D2S A;  4YSX A;  3A8L B;  4ZI3 C;  2ZMA A;  2WWU A;  3M65 A;  2VK9 A;  2D5U A;  5CB4 E;  4BCF B;  3X20 B;  3HO8 A;  2IAK A;  4ZZC A;  3AE9 A;  3UQ7 A;  1D0Y A;  2XQ7 A;  1ZEE A;  4LF6 T;  3Q9D A;  4CN1 A;  2C5K T;  4EC8 B;  4TV8 E;  2WSS V;  2P9B A;  3CX7 B;  4B3R T;  3KDS E;  3TNW B;  3UFG A;  4F6W B;  4Z6Y A;  1ZP0 A;  1W0A A;  4DV5 T;  4DUZ T;  3CK6 A;  1HX8 A;  4H9O C;  1QMZ B;  1YKH B;  3H3M A;  2BS4 A;  1J5E T;  4X65 T;  3UUM A;  4O4J E;  4DR2 T;  2E2A A;  2A72 A;  5L4H A;  3ONJ A;  5ABH A;  3HKD E;  2C4G B;  2AXD S;  1FMV A;  4JUY A;  4GYR A;  4JX4 A;  5FXZ A;  2LEH A;  1OWA A;  5HXH A;  2CBJ A;  1US7 B;  1OED B;  4PK6 A;  5AQQ B;  3X1D A;  2NTY A;  3MJX A;  3ZT6 A;  3VHL A;  3PUV F;  2YK0 A;  3BHV B;  3ZYK A;  4QXC B;  2RP4 A;  3P7I A;  4HWD A;  2BBJ A;  1D3U B;  3KV4 A;  1H26 B;  2UUB T;  2IHR 1;  2JQQ A;  4DV6 T;  4BCK B;  3OBV E;  4AQG A;  4CQI A;  3H37 A;  4EOZ B;  1O9K B;  4CFN B;  5LHI B;  4BBR M;  4LML A;  1OGU B;  3B5M A;  2WY2 A;  3ANW A;  2JPF A;  2WBL A;  3ETV A;  3T1H T;  4JI2 T;  3UU5 A;  2VKH A;  2CYZ B;  5HEG A;  2W9F A;  2DCF A;  4PAG A;  4ZXL A;  1QUU A;  4CFW B;  2JQH A;  4OB0 B;  3HKC E;  4U7Y A;  1VIN A;  4JV5 T;  5AQO B;  2XSA A;  1MIY A;  3Q2M A;  1WYB A;  5L47 A;  1V9D A;  5F8P A;  4KHZ F;  5M4Y A;  1VOM A;  4B3S T;  3HR0 A;  2QQ8 A;  1VRB A;  3FZM B;  2KT9 A;  2V5C A;  5LOV E;  4CI3 B;  2X51 A;  2PMI B;  3DP7 A;  4QSH A;  4OYJ A;  2ODV A;  4EC9 B;  5HEJ A;  5C3J A;  2XUE A;  3AE4 A;  4Z90 A;  5HNB B;  1MNE A;  2UUC T;  2VKO A;  4XZC A;  2BVM A;  1KEY A;  3CML A;  1O3X A;  4OHF A;  4U31 A;  2ZM6 T;  2V6Y B;  4C91 A;  2Y8D A;  4YLH A;  3F2E A;  4CFX B;  4BCI B;  1URC B;  3R84 B;  4PJL A;  1UGQ B;  3PJA J;  3FZL B;  4HFE A;  3CVR A;  3VRB A;  4H9N C;  1P5E B;  4C90 A;  1HG5 A;  1KNP A;  4ASK A;  1FIN B;  2LM9 A;  1C9B A;  3ZCI A;  2V1D B;  4AIU A;  5J0Z A;  3P4S A;  2ZCF B;  5LBM A;  4LFC T;  2ZPG B;  1LRZ A;  1OED C;  3LQ5 B;  3KV5 A;  1H28 B;  1IAP A;  4U33 A;  3C51 A;  5FMN A;  1LKX A;  4ZI3 D;  1W9R A;  2V26 A;  2R6G F;  2XPK A;  5AQK B;  4YFS A;  1QLB A;  2RA1 A;  3FBL A;  2GK9 A;  2WXV B;  2EUF A;  2H7V C;  3PUA A;  1X9B A;  2J1D G;  4DBQ A;  2JQ9 A;  3AA1 B;  3NZQ A;  3N2O A;  2LRL A;  2IDO B;  2CHO A;  3L8R A;  3AAE B;  3UUX B;  4CFU D;  3A5X A;  4O2B E;  3AE1 A;  5IWA T;  4DR5 T;  3FXE B;  2DI4 A;  3D0T A;  2I0M A;  2NW9 A;  4F6S B;  4DV1 T;  3ZN0 B;  1SHZ C;  2NP9 A;  1AIS B;  1XNR T;  2V7K A;  2BPM B;  5ETW A;  1FMW A;  3K7A M;  2VQE T;  2F2C A;  1SA0 E;  5DAB A;  2CXD A;  3DTO A;  1IBK T;  2EHO C;  3PUR A;  2H7O A;  4ZI7 E;  1I94 T;  4ROE A;  2LSG A;  4IE6 A;  3Q5D A;  4AKL A;  2YU1 A;  2MOZ A;  1HCI A;  3L39 A;  4MIM A;  2L3L A;  3RX6 A;  4YTM A;  1KNZ A;  3LSV A;  4CXA B;  4QH5 A;  3RKG A;  3PE0 A;  4DID B;  3QK6 A;  2DPP B;  3N9O A;  2YDQ A;  1UNL D;  2X9H A;  2QA7 A;  2WPA B;  3BG3 A;  4DVD A;  4QXH B;  3E22 E;  5J2T E;  3E08 A;  3C98 B;  1TFB A;  1UGS B;  3ABV A;  5JR9 A;  2DD4 B;  4HNT A;  3IEE A;  3VRA A;  4P0B A;  2WHB B;  4TX5 A;  3GN5 A;  4QHO A;  3ONX A;  1H1R B;  2WZH A;  4LFB T;  5L3C B;  1GH6 B;  4BCN B;  4YJ3 E;  2PFV A;  3ZLI A;  3CQG B;  5LHH B;  2IW5 B;  3WVE B;  2WZI A;  2ZZD B;  1BR2 A;  1HR0 T;  2JJ9 A;  2BDE A;  2KSR A;  3AE8 A;  3EAB A;  4OFZ A;  3TNH B;  2I53 A;  3R6N A;  3AAI A;  4BCQ D;  3HI2 A;  5JDH A;  3LBX A;  2CXL A;  3BQI A;  1IRE B;  5CA1 E;  2WAU A;  3A8H B;  2KZ7 B;  5AQI B;  2HN2 A;  2V7M A;  4HFD A;  4WZX A;  4YTP A;  4F7J B;  1UNH D;  3MKD A;  4IMY B;  2YU2 A;  3MA9 A;  4F7S B;  3FB2 A;  1H1Q B;  4BCM B;  3UU3 A;  4H63 V;  3PU3 A;  5LJM A;  3QYE A;  2MAW A;  5L3B B;  1J5W A;  1MND A;  4KMC A;  3VYG B;  3QB5 K;  2WFY B;  3GA8 A;  5H6R B;  4H63 H;  4OX9 T;  2K9A A;  3QYB A;  2BG9 B;  4U74 A;  2NTX A;  2V5D A;  3VKH A;  5H6Q B;  3ZSS A;  2LJL A;  4IE5 A;  2E9X B;  4KRD B;  1VCS A;  4YHJ A;  3KV9 A;  1F5Q B;  4EOJ B;  4UXN B;  3ZMU B;  4BCH B;  2IW6 B;  3QC9 A;  4TV9 E;  1PKD B;  2PJQ A;  3LK4 2;  2VVS A;  4JI7 T;  1AD6 A;  3OJA A;  4CFM B;  2M6I A;  2QGS A;  3L3P A;  3OYX A;  5ABF A;  4A98 A;  4PJM A;  4ELL A;  4L9I A;  4LF5 T;  4IST A;  4UIG A;  4CXW A;  1H7C A;  4M6V A;  3CKD A;  2PBI A;  4HFC A;  4Q25 A;  5HXE A;  4A97 A;  4OYK A;  3C50 A;  5EK3 A;  5L3E B;  3MXZ A;  1H24 B;  4GKK T;  3EOC B;  2XAJ B;  4H9P C;  1FIO A;  1E7P A;  4EXT A;  4EYY R;  4EOP B;  2YEV C;  2G0U A;  2WDR A;  3RHW A;  4HWH A;  2A2F X;  2WJ9 A;  1E2A A;  2CEA A;  3N9N A;  3FBZ A;  4WNK A;  1UCU A;  4OB1 B;  2IC9 A;  2K3W A;  4JI6 T;  2V22 B;  4UN0 A;  2WP9 A;  2J47 A;  2W0G A;  3QZ9 B;  2H3R A;  4DV2 T;  3RRW A;  4KI0 F;  4NIQ A;  2DNX A;  2XAF B;  3FZK B;  5LCY A;  2PK2 A;  3PUW F;  2KWH A;  3RC3 A;  3AB3 B;  1OKV B;  2A3D A;  1D1B A;  2DWG A;  4UVC B;  3N9Q A;  2CE7 A;  3OYZ A;  2X67 A;  3PTR B;  2YDR A;  1BU2 A;  3TN8 B;  2CHN A;  2FJE A;  2W96 A;  4X20 E;  3AVR A;  2W61 A;  3UU4 A;  2W67 A;  3ESL A;  4TZ4 C;  4BY7 X;  1UGO A;  2BBH A;  4EV6 A;  1KXU A;  3DDP B;  1HFA A;  2R7G A;  4PFO A;  2N9D A;  1OL2 B;  3MIA B;  2IML A;  3EID B;  4YTN A;  2W9Z A;  4YSZ A;  1OKW B;  3TKL B;  3Q5W A;  3C4W A;  2XAS B;  4AIS A;  3V5U A;  4YOZ A;  4QH4 A;  3N5L A;  2LSK A;  4JLE A;  2Q9Q A;  4DR4 T;  3ZT5 A;  3QOF A;  3MZK B;  1ZHC A;  2E9X C;  3ZMV B;  2QDJ A;  3A8G B;  2WMA B;  4H9Q C;  3FZH B;  1H1P B;  2KWI B;  1WCR A;  2W99 A;  4II5 B;  4ERR A;  3JCF A;  1ZKE A;  1J1J A;  3AEC A;  4CN4 A;  4GIW A;  4X1Y E;  2QYW A;  4LF4 T;  2YDS A;  4X66 T;  5HQ0 B;  4M1P A;  5HYA A;  2UUE B;  4U3C A;  4DMW A;  4UEL A;  5ABG A;  3DL1 A;  5HAX A;  3P4W A;  2CJM B;  4IE4 A;  1OED A;  3O9X A;  3RPU A;  5JDL A;  3FHN A;  2HH7 A;  4O8S A;  2W2H A;  5LXT E;  3O1I A;  4G63 A;  1HX1 B;  1D1C A;  3CQX C;  4MAL A;  2CRB A;  3X25 B;  4BCJ B;  4DV3 T;  2ZLY A;  4BCG B;  3MI9 B;  3TLT A;  5IDP B;  5L4E A;  1T98 A;  1WFD A;  3LFM A;  2BKO A;  2XM1 A;  3EDU A;  4GK0 E;  3OTO T;  2CWY A;  3TW7 A;  3ZPO A;  2I6H A;  3RGL A;  4JI4 T;  4FM4 B;  1NEK A;  4AXP A;  4NXM T;  2CCQ A;  1OED E;  1UUR A;  3JC6 C;  4PW8 A;  4U2Y A;  4HL4 A;  1I6Z A;  3AED A;  4CI1 B;  3B57 A;  4GOU A;  4CRL B;  4EB6 E;  3EUH A;  4TWH A;  1JOW A;  1N4M A;  1S35 A;  4NXN T;  1XNQ T;  4AI6 A;  1FEW A;  4PJJ A;  3AE7 A;  2IW8 B;  4DMV A;  2C5J A;  3CX6 B;  2EHO A;  4BJM A;  4AQF C;  1LVK A;  2KMF A;  2KLQ A;  4KHP T;  2BKN A;  1MMG A;  2BVL A;  2WB5 A;  3PUS A;  3BHT B;  4AKG A;  5BR8 T;  1YKE B;  3G33 B;  4FJO A;  5LMU T;  1T72 A;  4ANJ A;  5C2T A;  5HBJ B;  1XZY A;  2KIN B;  2LW4 A;  3M3Z B;  3E0Z A;  3A8O B;  5FKY A;  5HEH A;  1IZN B;  3LDQ B;  2CM0 A;  2JGZ B;  1GUX A;  4U7I A;  4EZH A;  3RYI E;  4CXX A;  2XQ4 A;  4GYS A;  2FJB A;  4BCN D;  2LRK A;  1UK5 A;  3O0G D;  3UFE A;  2HPL A;  3HBL A;  2CXF A;  4I55 E;  3RF1 A;  2CCI B;  3RI5 A;  3I0Q A;  4JEU B;  3RYF E;  5FL0 A;  2XHE B;  2CBI A;  4IDN A;  1N32 T;  4XBF B;  2DME A;  2WMO A;  1EZ3 A;  4CXY A;  2CZ1 B;  4I4T E;  5AQP B;  2IW9 B;  3UUB A;  3HA4 A;  1CHU A;  1OL1 B;  5HEO A;  2CZ0 B;  5EK2 A;  2FUP A;  4QH1 A;  4HFH A;  4PFP A;  3VU7 H;  5IHY A;  1T7S A;  5HXS A;  5FY1 A;  1YD8 G;  5JRE A;  4YXD A;  1E1H B;  3W15 B;  4F7N B;  4ILA A;  2YOE A;  5AFU L;  4ZS2 A;  2ZM0 A;  3J7Y q;  1U5P A;  2CZ7 B;  2LSJ A;  3WVD B;  2WIH B;  2XQY A;  3K3O A;  2WDV A;  3AE2 A;  1G8X A;  4BXX X;  4DR3 T;  2L9Q A;  2BS3 A;  3RLF F;  2UZE B;  4WBN E;  1HNX T;  2W62 A;  5JH7 E;  4YHH T;  1XDO A;  3KHI A;  4HFI A;  4HNU A;  1H27 B;  1H1S B;  3RKO A;  2X9X A;  5I5Z B;  5FXV A;  2E9X D;  3RQU A;  4WYV A;  2BS2 A;  5L3G B;  2V6X A;  2DHR A;  1R8I A;  4BAY B;  3MY5 B;  5AQT B;  1GQE A;  2SPC A;  3EHZ A;  2QF7 A;  5EK4 A;  3ZST A;  2DL1 A;  4IE0 A;  4BA9 A;  2JRK A;  4YY3 T;  1HG2 A;  3AVS A;  3LJC A;  2C6T B;  3U3I A;  2CLY B;  3G06 A;  3POM A;  1MMD A;  4CI2 B;  5CA0 E;  1HF8 A;  1XWM A;  2CMR A;  3NVO A;  1AJ3 A;  2LE8 A;  3OKQ A;  5AQJ B;  2UZB B;  1OIY B;  2NW7 A;  4MBQ A;  1W98 B;  1BR0 A;  1YQ4 A;  3JAD A;  3TW6 A;  1FJG T;  1S94 A;  5JRC A;  3ONL C;  3UTK A;  3SS1 A;  4HFB A;  4PNI A;  4K0U A;  3TLW A;  4E7Z A;  2D0U A;  3RYH E;  4YJ2 E;  2M67 A;  4B6X A;  5EZY E;  3ZEF B;  1N33 T;  3O4X E;  4EOQ B;  3TLU A;  1JSU B;  3N9P A;  4EOI B;  3EVY A;  4UV8 B;  3KV6 A;  5LMN T;  3ZC0 A;  5LQF B;  4EOM B;  4EYU A;  5HWY A;  1D0Z A;  4DR6 T;  1WRD A;  3JC6 D;  5KDM C;  2D0T A;  2C5I T;  3A8M B;  3U78 A;  5L2W B;  4BBS M;  2L8K A;  3QHW B;  1KFY A;  1H4L D;  3KFW X;  4IT4 A;  2X1N B;  1JST B;  2WU5 A;  3J9X 1;  4ZGD B;  3I9W A;  5L2L A;  3AA7 B;  1JKW A;  1OXZ A;  2B76 A;  3BLQ B;  4V1A v;  2ACZ A;  4UEM A;  4TN7 B;  1CUN A;  2WS3 A;  2XAG B;  3B13 A;  2VL0 A;  3F31 A;  3K1S A;  2NWB A;  4LF7 T;  4UVA B;  4P09 A;  4HKA A;  1WR0 A;  4HWI B;  1HNZ T;  3P4Q A;  2Y48 B;  3N9L A;  4L5G A;  2HPJ A;  3M03 A;  3QHR B;  4OR5 B;  1IJ6 A;  4QX8 B;  2OLT A;  3NWI A;  5J1G A;  4G2A A;  4Z91 A;  5JQG E;  4F6R C;  3ZYM A;  4IE7 A;  2NR4 A;  3P50 A;  3RIA A;  3T1Y T;  4EOO B;  3WI3 A;  1QSD A;  4TWD A;  2KMG A;  4BJN A;  3GWH A;  4UR9 A;  1IBM T;  2E5V A;  3L09 A;  2XAH B;  1V29 B;  2X9W A;  4QX7 B;  5HVY B;  2E9X A;  4UF0 B;  3X26 B;  5ICP B;  4EOR B;  5EJC A;  3LK2 B;  5FP3 A;  4Y72 B;  1WR6 A;  2FJA A;  3RYC E;  3ZT7 A;  3PU8 A;  3CQC B;  3PUY F;  4AKH A;  4E7S A;  5L3D B;  3RQW A;  4N78 D;  1W09 A;  3K8P C;  5FVK A;  3F5X B;  1YXR A;  3AEB A;  5JDM A;  2BG9 E;  1TD6 A;  2ZPB B;  1XMQ T;  3HKB E;  4TNV A;  3QWL A;  4ZZB A;  4P1N A;  2LSI A;  1XMO T;  4WW0 A;  3PUX F;  3O1H A;  4ROD A;  3IF8 B;  4AKR B;  2PHG A;  3AXJ B;  1BR1 A;  3RIU C;  4UV9 B;  2V7L A;  3O1J A;  3DDQ B;  4HLQ A;  4G6L B;  5AQN B;  4F6U B;  4ZHQ E;  5DQW A;  4BCP B;  3AAA B;  5JDN A;  4JI0 T;  5ABF B;  1YQ3 A;  2X9Y A;  4X64 T;  1B7T A;  3NZP A;  2UZL B;  4U2Z A;  3N2K E;  4YOS A;  4TTH A;  2ZM2 A;  3NBX X;  3PUQ A;  5CEI B;  4ROC A;  4ZI2 C;  1FKM A;  1YW0 A;  4WBO A;  5KMG P;  4HWF A;  4U72 A;  4HEA A;  3N2G E;  3AE6 A;  2WEV B;  4PJN A;  2WQY A;  4HN9 A;  5LB7 B;  3QUJ A;  4DBR A;  2XSB A;  4MLK A;  1AHJ B;  3WAK A;  3LG7 A;  2Y6X A;  2ZPH B;  2BKP A;  4AKI A;  4AQF A;  2XQ9 A;  1U4Q A;  5LGN B;  3VR9 A;  3RGF B;  3GTM S;  2ZPF B;  5LP6 E;  1JNR A;  2KXP B;  3TLS A;  2V7I A;  4IDQ A;  3QB5 A;  3BK9 A;  4OGR B;  4OB2 B;  4EEB A;  2HN1 A;  2C5V B;  3QNU A;  3VYH B;  3H4C A;  1NAF A;  2WDQ A;  1IBL T;  2M6B A;  2ODU A;  4DR1 T;  4JEH B;  1HNW T;  2BG9 C;  2LKG A;  2X0L B;  1UGR B;  2XQ6 A;  2X66 A;  5AQR B;  1LVF A;  4NC6 A;  2X0H A;  4X5T A;  4MHC A;  4LFA T;  3FXD B;  5HBH B;  1ENW A;  2NOX A;  4I0U A;  2C5N B;  2DXB B;  2G77 A;  1UUS A;  4L0R A;  2ZPI B;  5HBE B;  4OK0 A;  4ILC A;  3FZF B;  2IUB A;  3UUL A;  2B9R A;  2N2N A;  1VYW B;  1VOL A;  3AA6 B;  2A9U A;  4LF9 T;  3P8C D;  3PUG A;  2DXC B;  2Q9Q B;  3UT5 E;  1KF6 A;  5IUX A;  4CFV B;  1UX5 A;  2VWA A;  1ZP2 A;  4B3T T;  2W00 A;  3K3Q C;  1VCT A;  2C5O B;  2YN6 A;  3NDQ A;  4NST B;  4X1K E;  3C64 A;  3VR8 A;  2F4V T;  4HTE A;  1MIV A;  4HNV A;  1UNG D;  2XZE A;  2VB6 A;  4I3Z B;  3F57 A;  3GMI A;  4X62 T;  3NRX A;  2JMK A;  5AQM B;  5TAO A;  4DUY T;  1SE7 A;  1O9K A;  4FX3 B;  3OVU A;  2DLR A;  4EGW A;  4JX6 A;  4YT0 A;  4JBW F;  1KK7 A;  3H3A A;  4HE8 A;  5HCM A;  4KP3 C;  4DV0 T;  4O2A E;  5AQG B;  4I50 E;  2AE9 A;  4X1I E;  4A5X A;  3IHR A;  4KBM B;  4ILU A;  3TNI B;  4NPP A;  4IGU A;  4F70 B;  2QVA A;  1BR4 A;  1UGP B;  2VKJ A;  2VUR A;  4IL4 A;  2W63 A;  3T8O A;  3PUZ F;  5FXW A;  2LLY A;  3A7M A;  3ANW B;  2J62 A;  3HL6 A;  1M62 A;  5J2U E;  3EDV A;  4F8H A;  2ZM8 A;  3BQK A;  4AQY T;  3RRC A;  3ZN1 B;  4GK5 E;  3X28 B;  4ZGJ B;  3BLR B;  3SWH A;  2CA5 A;  1JNZ A;  2OA5 A;  3EI0 A;  4UVB B;  3CIR A;  2E5L T;  2ACX A;  2V6Y A;  2EHO B;  2LOP A;  3P4R A;  2MBG A;  3OPC A;  5CJ5 A;  1Y64 B;  2D0Q B;  5JDF A;  3S4U A;  5KX5 E;  3ZKR A;  5CGM A;  5AQU B;  2RPA A;  4J2C A;  5ADX L;  2UXX B;  3AE5 A;  5CYI B;  3X24 B;  2N1G A;  1WLX A;  2Q9Q C;  3JAF A;  1XDP A;  4ZI2 D;  2XQA A;  1W0B A;  3ZJ1 A;  1GUX B;  4ZGE B;  4CN6 A;  4A56 A;  2V8S V;  4ZS3 A;  4HWC A;  1N36 T;  5CFB A;  4DV7 T;  2ZPE B;  4BY1 X;  3IBP A;  4TWF A;  2UXC T;  1M7K A;  5AQL B;  2HHH T;  5FNV E;  4TNW A;  5AQH B;  3I1A A;  4H9S E;  2J4G A;  3MK7 C;  4ZOL E;  4BCM D;  3K3N A;  3ZCJ A;  3KBU A;  3QYH B;  5FY0 A;  4YOO A;  5EFQ B;  3ZYL A;  3IA3 A;  1X79 A;  3ETU A;  2IIU A;  5FXX A;  2QRX A;  2BKZ B;  3I0O A;  3KIN B;  3ZMS B;  3CWZ B;  4IIJ E;  4MFE A;  2JMH A;  3DJB A;  2DWK A;  4YC3 B;  1N34 T;  4MFD A;  2YKS A;  5LNK A;  2G9X B;  1T8B A;  3KBT A;  3AA0 B;  2I40 B;  5LG4 A;  5LMK B;  2WIP B;  2VAS A;  3P4P A;  5JDG A;  3Q5E A;  5HWX A;  4IDZ A;  1G3N C;  2LM2 A;  2WCA A;  3CX8 B;  4KUM B;  1XO2 A;  3NKZ A;  4LF8 T;  2W66 A;  2FBW A;  1MIW A;  1D1A A;  3HB9 A;  5ABE A;  4LOC A;  3ZMT B;  3BHU B;  2XQ8 A;  5C8Y E;  1ZOY A;  2VVN A;  2K48 A;  4JYA T;  2UZD B;  2MPK A;  3BLH B;  4JI5 T;  3C4X A;  4PK5 A;  1MMA A;  5LBQ B;  3RC8 A;  5JDQ A;  3UUN A;  1IJ5 A;  1MMN A;  3MAC A;  3ZJ2 A;  3SFE A;  5BNJ B;  4JI1 T;  4ISS A;  5FY7 A;  2QFZ A;  4ELJ A;  5HCJ A;  4I43 B;  5DQV A;  2ES0 A;  2IC6 A;  4NUU A;  2LT3 A;  3VKG A;  3AEA A;  3C4Z A;  3RIU A;  4K0K T;  2WMB B;  2WM9 A;  2LKH A;  5BMV E;  3EJ1 B;  4ADZ A;  4EOK B;  4F7L B;  3KVB A;  5LGT B;  3I9Y A;  2VL8 A;  2W4X A;  5JTG A;  2DD5 B;  1WYC A;  4BCO B;  4YSY A;  3AEF A;  2WWV A;  2X68 A;  5JRC B;  3HZJ A;  3A8Y C;  1G73 A;  3V5S A;  2PK9 B;  1OI9 B;  2YIN A;  2XJ7 A;  4QKN A;  2WU2 A;  2QDY B;  4DV4 T;  5IDN B;  5JR9 B;  4LMK A;  1SUM B;  4COF A;  5GON E;  5F5W A;  5LG3 A;  3GN5 B;  5LGU B;  3PJA A;  2XQ5 A;  4O4H E;  2XTL A;  4CZZ B;  3DOG B;  3AE3 A;  4IDO A;  3SRZ A;  2V7J A;  1FVV B;  2AHJ B;  2OV9 A;  1HS7 A;  2CPT A;  2X0Y A;  2C0S A;  3LBX B;  4DND A;  4KX6 A;  5KXJ A;  3UQ4 A;  2I59 A;  3PV0 F;  5L3F B;  3RH3 A;  2UUA T;  5IYZ E;  2H88 A;  5FVL A;  2BZB A;  4EOL B;  1D0X A;  2VQF T;  5LYJ E;  3N9M A;  2LHR A;  2KR6 A;  2BG9 A;  4UF0 A;  2IN3 A;  2MYS A;  5HXC A;  5AQS B;  5JVD E;  2UXN B;  4P0A A;  2WMN A;  4GKJ T;  3SOL A;  2K5B B;  2JQK A;  2LSY A;  5A1L A;  2CLY C;  2PG8 A;  2Q9Q D;  2CZ6 B;  4EED A;  5FL1 A;  4Z8X A;  3Q5X A;  4NUV A;  5FYM A;  1NWM X;  4DO0 A;  4DR7 T;  4QXB B;  1UX4 A;  2E8I A;  2W2U A;  3QYG B;  4CFU B;  2JIW A;  3KVA A;  5ACB A;  4JI3 T;  1NEN A;  4QWN B;  2UXD T;  5AQV B;  5AQF B;  5F3J A;  2XAQ B; 
#chains in the Genus database with same CATH homology
 4OK0 A;  1IZN B;  2L3L A;  2CM0 A;  3RX6 A;  1KNZ A;  3UUL A;  4EZH A;  3RYI E;  4CXX A;  4GYS A;  3PE0 A;  2B1E A;  2N2N A;  3LK3 B;  3QK6 A;  2LHN A;  2VKD A;  3N9O A;  2KND A;  3AA6 B;  3P8C D;  3PUG A;  3UFE A;  2X9H A;  2HPL A;  2Q9Q B;  3BQL A;  2QA7 A;  2MTQ A;  3CPZ A;  3UT5 E;  2CXF A;  4I55 E;  4DVD A;  4QXH B;  3E22 E;  3I0Q A;  5J2T E;  1UX5 A;  4JEU B;  3E08 A;  2LOS A;  3RYF E;  2XHE B;  3C98 B;  3NRY A;  4O4I E;  2VWA A;  4EAH A;  4XBF B;  4EIW A;  2WMO A;  5LHG B;  1EZ3 A;  1Z0P A;  5JR9 A;  2W00 A;  4CXY A;  3IEE A;  3K3Q C;  4O4L E;  4I4T E;  4P0B A;  4TX5 A;  4XAX B;  3HA4 A;  3GN5 A;  4QHO A;  4X1K E;  1ZV4 X;  3C64 A;  2CWO A;  3ONX A;  4HTE A;  1MIV A;  5L3C B;  4PK4 A;  4YJ3 E;  3HKE E;  2PFV A;  4FI5 A;  3ZLI A;  5EK2 A;  5JR9 C;  5LJN A;  3CQG B;  5LHH B;  2IW5 B;  4PFP A;  4HFV A;  3VU7 H;  5IHY A;  2VB6 A;  3F57 A;  3GMI A;  5HXS A;  1BR2 A;  5FY1 A;  1YD8 G;  5JRE A;  2JJ9 A;  3NRX A;  5LA6 E;  2BDE A;  2JMK A;  4MFR A;  1E1H B;  5TAO A;  3W15 B;  2NW8 A;  4OFZ A;  3PDY A;  4HGA A;  5E0O A;  3R6N A;  5AFU L;  3AAI A;  4ZS2 A;  3HI2 A;  2ZM0 A;  4IHJ E;  5JDH A;  3J7Y q;  1U5P A;  3LBX A;  2K24 A;  2DLR A;  2LSJ A;  1KK7 A;  2CXL A;  2XQY A;  3BQI A;  3H3A A;  3K3O A;  4HE8 A;  5CA1 E;  1G8X A;  2WAU A;  4KP3 C;  4O2A E;  2KZ7 B;  2V7M A;  4I50 E;  2L9Q A;  4X1I E;  4WBN E;  4EZ4 A;  5HXR A;  3ZMZ B;  5DJQ C;  3IHR A;  4KBM B;  4ILU A;  4H9R C;  2W62 A;  2Z6E A;  5JH7 E;  3MKD A;  4IGU A;  2YU2 A;  3MA9 A;  1BR4 A;  1HTJ F;  3RKO A;  4TUY E;  2EHO D;  2VKJ A;  2X9X A;  3FB2 A;  2W63 A;  4H63 V;  3PU3 A;  5FXV A;  3ZC1 A;  3WAJ A;  2E9X D;  3T8O A;  5LJM A;  5FXW A;  5L3B B;  2D2S A;  3ANW B;  1MND A;  4KMC A;  5L3G B;  2DHR A;  3HL6 A;  4ZI3 C;  2ZMA A;  5J2U E;  3EDV A;  3GA8 A;  2ZM8 A;  2WWU A;  3M65 A;  2VK9 A;  2D5U A;  5H6R B;  2SPC A;  4BAY B;  3BQK A;  4H63 H;  5CB4 E;  5EK4 A;  3RRC A;  4BA9 A;  4IE0 A;  2JRK A;  2IAK A;  3ZN1 B;  1HG2 A;  3AVS A;  3LJC A;  2K9A A;  4GK5 E;  3U3I A;  1D0Y A;  3SWH A;  2CA5 A;  2CLY B;  1ZEE A;  2OA5 A;  4UVB B;  1MMD A;  4U74 A;  2ACX A;  2NTX A;  3Q9D A;  4CI2 B;  5CA0 E;  3VKH A;  2C5K T;  5H6Q B;  2EHO B;  1HF8 A;  2LOP A;  2CMR A;  4TV8 E;  2MBG A;  2WSS V;  1AJ3 A;  2P9B A;  2LE8 A;  2LJL A;  3CX7 B;  3OKQ A;  4IE5 A;  2E9X B;  2NW7 A;  4MBQ A;  4YHJ A;  1Y64 B;  3KDS E;  1BR0 A;  3KV9 A;  5JDF A;  3S4U A;  4UXN B;  5KX5 E;  1S94 A;  3ZMU B;  5JRC A;  3QC9 A;  3UTK A;  3SS1 A;  1HX8 A;  4PNI A;  4TV9 E;  4K0U A;  2PJQ A;  4H9O C;  3LK4 2;  4J2C A;  4E7Z A;  3OJA A;  5ADX L;  1YKH B;  2UXX B;  2QGS A;  3L3P A;  2D0U A;  3RYH E;  4YJ2 E;  2M67 A;  3UUM A;  4B6X A;  2N1G A;  1WLX A;  2Q9Q C;  3OYX A;  4O4J E;  4ZI2 D;  4PJM A;  5EZY E;  3ZEF B;  3O4X E;  4L9I A;  4IST A;  4UIG A;  4CXW A;  2A72 A;  1H7C A;  3ZJ1 A;  3CKD A;  2PBI A;  3HKD E;  3N9P A;  4A56 A;  5HXE A;  3EVY A;  4UV8 B;  4ZS3 A;  3KV6 A;  4OYK A;  3C50 A;  5EK3 A;  3ZC0 A;  5L3E B;  3MXZ A;  3IBP A;  1FMV A;  4EYU A;  4JUY A;  5HWY A;  2XAJ B;  4GYR A;  1D0Z A;  5FXZ A;  4H9P C;  1WRD A;  1FIO A;  3JC6 D;  5KDM C;  2D0T A;  4EXT A;  2LEH A;  4EYY R;  2YEV C;  2C5I T;  2G0U A;  5FNV E;  1OWA A;  3I1A A;  3U78 A;  2A2F X;  2L8K A;  4H9S E;  5HXH A;  3MK7 C;  1US7 B;  4ZOL E;  4PK6 A;  3KFW X;  2CEA A;  3N9N A;  3FBZ A;  4WNK A;  1UCU A;  2IC9 A;  3K3N A;  3ZCJ A;  3KBU A;  2NTY A;  3MJX A;  3J9X 1;  5FY0 A;  3VHL A;  3I9W A;  5L2L A;  3AA7 B;  1OXZ A;  2YK0 A;  2W0G A;  3ZYK A;  4QXC B;  2RP4 A;  4V1A v;  3ZYL A;  2H3R A;  4UEM A;  3RRW A;  3P7I A;  1X79 A;  4TN7 B;  1CUN A;  3ETU A;  5FXX A;  2XAG B;  2DNX A;  2XAF B;  3B13 A;  5LCY A;  3I0O A;  3F31 A;  3KIN B;  3ZMS B;  3CWZ B;  4IIJ E;  3KV4 A;  2NWB A;  2JMH A;  3DJB A;  2JQQ A;  2DWK A;  2KWH A;  4UVA B;  4P09 A;  4HKA A;  3OBV E;  4AQG A;  3RC3 A;  2Y48 B;  3AB3 B;  2HPJ A;  2DWG A;  2A3D A;  1D1B A;  1IJ6 A;  3H37 A;  3N9L A;  3N9Q A;  4L5G A;  4QX8 B;  4UVC B;  4CQI A;  4EOZ B;  2CE7 A;  3OYZ A;  5J1G A;  5LNK A;  2X67 A;  3PTR B;  4G2A A;  5LHI B;  5JQG E;  4F6R C;  3KBT A;  3AA0 B;  3ANW A;  2JPF A;  2WBL A;  3ETV A;  5LG4 A;  3ZYM A;  4X20 E;  3AVR A;  2W61 A;  4IE7 A;  2VAS A;  2VKH A;  5JDG A;  3ESL A;  2DCF A;  4PAG A;  4TZ4 C;  5HWX A;  4IDZ A;  1QUU A;  3WI3 A;  3CX8 B;  4KUM B;  1QSD A;  3HKC E;  1HFA A;  4BJN A;  1MIW A;  1D1A A;  3GWH A;  4PFO A;  2N9D A;  3ZMT B;  1MIY A;  3L09 A;  2XAH B;  1WYB A;  3Q2M A;  5C8Y E;  1V9D A;  5F8P A;  2K48 A;  5M4Y A;  1VOM A;  3TKL B;  3Q5W A;  3C4W A;  2X9W A;  3C4X A;  2E9X A;  3HR0 A;  4PK5 A;  4QX7 B;  1MMA A;  4UF0 B;  5LBQ B;  1VRB A;  3RC8 A;  5JDQ A;  3UUN A;  2KT9 A;  1IJ5 A;  5LOV E;  2XAS B;  1MMN A;  4CI3 B;  3MAC A;  2X51 A;  3LK2 B;  5FP3 A;  3V5U A;  3ZJ2 A;  3DP7 A;  3N5L A;  2LSK A;  1WR6 A;  3RYC E;  4OYJ A;  2ODV A;  4JLE A;  2Q9Q A;  3PU8 A;  2XUE A;  3CQC B;  4ISS A;  5FY7 A;  3MZK B;  1MNE A;  4E7S A;  5L3D B;  4AKH A;  2VKO A;  4XZC A;  2BVM A;  1ZHC A;  2E9X C;  3ZMV B;  4I43 B;  4N78 D;  5DQV A;  2ES0 A;  2IC6 A;  3K8P C;  4H9Q C;  4NUU A;  3CML A;  1O3X A;  2LT3 A;  4OHF A;  3VKG A;  3C4Z A;  2KWI B;  4ERR A;  5JDM A;  4C91 A;  2WM9 A;  5BMV E;  1ZKE A;  2Y8D A;  3HKB E;  4YLH A;  4ADZ A;  3F2E A;  4GIW A;  2LSI A;  3KVB A;  4WW0 A;  3O1H A;  4X1Y E;  5LGT B;  3IF8 B;  3I9Y A;  4M1P A;  5HYA A;  4AKR B;  2VL8 A;  3R84 B;  4PJL A;  1BR1 A;  1WYC A;  4DMW A;  4UV9 B;  4UEL A;  2X68 A;  2V7L A;  3O1J A;  5JRC B;  5HAX A;  4IE4 A;  3CVR A;  1G73 A;  3V5S A;  3O9X A;  3RPU A;  5JDL A;  4ZHQ E;  3FHN A;  2HH7 A;  5DQW A;  2YIN A;  4H9N C;  4O8S A;  4C90 A;  1HG5 A;  3AAA B;  4QKN A;  5LXT E;  5JDN A;  3O1I A;  4ASK A;  2LM9 A;  2X9Y A;  4G63 A;  5JR9 B;  1D1C A;  3ZCI A;  2V1D B;  5GON E;  3CQX C;  1B7T A;  3NZP A;  4MAL A;  3N2K E;  5LBM A;  3NBX X;  2ZM2 A;  1LRZ A;  3PUQ A;  2ZLY A;  3GN5 B;  5LGU B;  4ZI2 C;  4O4H E;  2XTL A;  3KV5 A;  1T98 A;  1YW0 A;  3LFM A;  1IAP A;  4CZZ B;  3C51 A;  3EDU A;  4WBO A;  5FMN A;  5KMG P;  4GK0 E;  1LKX A;  2CWY A;  4U72 A;  4HEA A;  4ZI3 D;  2V26 A;  3ZPO A;  3N2G E;  3SRZ A;  4AXP A;  4PJN A;  2CCQ A;  2V7J A;  4HN9 A;  4YFS A;  3QUJ A;  4DBR A;  2RA1 A;  4MLK A;  1HS7 A;  3FBL A;  3JC6 C;  2GK9 A;  4PW8 A;  3WAK A;  3LG7 A;  2Y6X A;  2H7V C;  3PUA A;  2C0S A;  3LBX B;  4CI1 B;  3B57 A;  4DND A;  2J1D G;  4GOU A;  4AKI A;  4EB6 E;  4AQF A;  4DBQ A;  1U4Q A;  3AA1 B;  3NZQ A;  2I59 A;  3N2O A;  5LGN B;  3EUH A;  3AAE B;  3UUX B;  5L3F B;  3RH3 A;  3A5X A;  5IYZ E;  1S35 A;  2BZB A;  4O2B E;  1FEW A;  4AI6 A;  5LP6 E;  4PJJ A;  2KXP B;  1D0X A;  2V7I A;  3FXE B;  5LYJ E;  3N9M A;  2DI4 A;  2LHR A;  3D0T A;  3BK9 A;  2NW9 A;  4DMV A;  2C5J A;  4UF0 A;  3ZN0 B;  2MYS A;  3CX6 B;  2EHO A;  1SHZ C;  5HXC A;  4BJM A;  2NP9 A;  4AQF C;  2V7K A;  1LVK A;  2KMF A;  2KLQ A;  5JVD E;  2UXN B;  4P0A A;  2WMN A;  5ETW A;  1FMW A;  1MMG A;  2BVL A;  3SOL A;  1NAF A;  2K5B B;  3PUS A;  1SA0 E;  2LSY A;  5A1L A;  4AKG A;  5DAB A;  2CXD A;  2CLY C;  2PG8 A;  2ODU A;  2Q9Q D;  3DTO A;  1YKE B;  4JEH B;  4FJO A;  2X0L B;  4Z8X A;  3Q5X A;  4NUV A;  5FYM A;  4ANJ A;  1NWM X;  4DO0 A;  2X66 A;  2EHO C;  1UX4 A;  4QXB B;  2E8I A;  1LVF A;  2KIN B;  3KVA A;  3PUR A;  2H7O A;  4ZI7 E;  4MHC A;  4QWN B;  3E0Z A;  3FXD B;  2LSG A;  4IE6 A;  4AKL A;  2NOX A;  2YU1 A;  2MOZ A;  4L0R A;  5F3J A;  1HCI A;  2XAQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...