3B57A

Crystal structure of the lin1889 protein (q92an1) from listeria innocua. northeast structural consortium target lkr65
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
203
structure length
180
Chain Sequence
MNKEEIILSAKNWMHSHFHDWSHIKRVWKLSKEIQSKEGGDLFTIELAALFHDYSDQEATKTLINWMETKEIPSELIKKIIRIIQSVSALTIEEKIVQDADRLDAIGAIGIARTFTYGGAHNREIANQNPKNTTLQHFYDKLLLIKDQLNTETAKTIAKEKQKIMQDFIQALEKELKVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin1889 protein
publication title Crystal structure of the Lin1889 protein (Q92AN1) from Listeria innocua.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
total genus 61
structure length 180
sequence length 203
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3b57A01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b57A02
2PJQA 3DTOA 3B57A 5IHYA 3DJBA 2QGSA 5DQWA 5DQVA
chains in the Genus database with same CATH superfamily
2ZMAA 3FB2A 4CI3B 1HS7A 3O0GD 4YOOA 4UF0A 3CQXC 5HYAA 3K8PC 4WW0A 1E7PA 4IE4A 5E0OA 3QYEA 2E5LT 4BCQD 3KVBA 2BKOA 3QC9A 2V5CA 2CXDA 1D1AA 2M6BA 4AKGA 5LJNA 4N78D 5BMVE 5ACBA 2I0MA 4X65T 1MMGA 4HWIB 3BHTB 2YOEA 3N9PA 1OGUB 2XY8B 5CYIB 1ENWA 5JDLA 3NZPA 4BCGB 2VQET 3QUJA 2HH7A 2LRLA 4ZI7E 3POMA 3DJBA 4HN9A 2WU2A 2V7KA 1HX8A 5FXVA 5IDNB 1GQEA 4HWDA 3ZYLA 2IN3A 3AA6B 4WYVA 4AI6A 3DTOA 3ZMZB 1OIUB 5ADXL 4ADZA 4U7IA 5CJ5A 4ILUA 4CFXB 2EHOD 4IE5A 4GYRA 2KT9A 4Z6YA 3LK2B 4MIMA 4OB0B 3PUQA 5BR8T 2LOPA 4HFVA 1UX5A 2NW8A 2XM2A 4LOCA 3UTKA 5HEHA 2WAUA 4EZHA 3ZMTB 1W9RA 4AKRB 2BG9C 4ELLA 2X9XA 2CZ7B 3UQ4A 2CBIA 4NSTB 2KLQA 3GWHA 1MNEA 2BS2A 4CFUB 2YKSA 5HBJB 2VL8A 3EDUA 2LHRA 3UQ7A 5FXZA 3FBLA 2UXDT 2JQHA 1AISB 1UURA 3T1YT 3PJAJ 4HNTA 3ZYKA 2LSIA 4O4HE 3EOCB 3MI9B 4O4JE 3H37A 1VOMA 4O4LE 2CMRA 4ZGEB 3HI2A 4BCQB 4NXNT 2W2HA 1W09A 3PUVF 4H9QC 3IA3A 3TW6A 3A8LB 4OB3B 3AXJB 3N9NA 1I6ZA 5F3JA 5IWAT 2BBHA 2CJMB 3FXDB 2QF7A 4LF8T 4EB6E 2XPKA 1G73A 3ETUA 4DR5T 1I94T 2NTXA 3I0QA 4QH5A 3CWZB 4HLQA 4QH4A 2LRKA 1UUSA 2DXCB 4B6XA 4BBRM 5FNVE 3NBXX 4X20E 2WDRA 3E22E 4EAHA 2H7VC 1LKXA 2VK9A 3CQCB 2LSGA 4YFSA 4ROCA 2X0YA 2CHNA 5HXHA 5AQQB 4UEMA 2UZDB 4CFWB 3EI0A 2VKOA 3PUGA 2N9DA 4IGUA 2XAGB 1JSUB 2DWKA 3L8RA 1E2AA 3SS1A 4BCPB 3AXJA 5L4EA 2FJEA 5EK2A 5ICPB 3S4UA 3EUHA 3Q2MA 4TV9E 3LK3B 4UVCB 5J2UE 4JI1T 3CX7B 2C6TB 3KDSE 2IUBA 4NIQA 4OYJA 4GYSA 4P0AA 2WXVB 1KF6A 4OR5B 1N32T 4ZI3C 5HEUA 4EV6A 2WWVA 3NDQA 4NUVA 3PURA 3AE1A 3IBPA 4L9IA 1R8IA 1ZEEA 2MBGA 3TNIB 4IREA 1VINA 1MMNA 1O3XA 1J5WA 3N2GE 4CN1A 2JGZB 3PUYF 2NTYA 3BG3A 4YSZA 3RYHE 1ZKEA 2EHOA 1KNPA 5IF1B 1Z8UA 2XQ6A 4JYAT 2N1GA 2HN2A 4HFDA 1WRDA 2J1DG 2V7MA 3CPZA 4BXXX 5FMNA 1T98A 5AQVB 3HB9A 4ZI3D 3ZMSB 2UZEB 2D2SA 4YOZA 3P8CD 2RP4A 3MXZA 3MA9A 4BCIB 3TW7A 3FXEB 4JI6T 5A1LA 2ES0A 1X79A 3UUNA 2LOSA 5JDNA 1GUXB 3VYHB 2WB5A 2CCIB 3L09A 4JBWF 4UVAB 1UGQB 4FM4B 2X0HA 1D3UB 4EOPB 4BA9A 2YK0A 4EIWA 2GK9A 2UUAT 3VHLA 5L3BB 2JMHA 2ZM6T 5AQFB 4PK6A 1HR0T 4FX3B 2VKHA 2D9DA 4DV2T 1ZOYA 2XJ7A 3A8GB 4ILBA 4JV5T 4DV0T 3BQLA 4IDNA 2WZHA 2A72A 5H6QB 5FY1A 4ZEYA 2YINA 4I43B 4X1YE 2VWAA 3AE7A 4BCMB 3HR0A 3AE8A 1HF8A 3QZ5B 2YDSA 3J7Yq 3X20B 2Q9QB 3MZKB 2E9XC 3RGLA 1VOLA 3JCFA 4MBQA 3PU3A 5AQLB 2KWHA 3CIRA 3AECA 2PBIA 1GUXA 4I50E 3QYGB 3RH3A 2VKJA 3DP7A 1C9BA 2NP9A 4AQFC 3WAJA 4U72A 1XNRT 3G06A 5L3GB 4JEHB 4OHFA 5BNJB 2JRKA 3LJCA 3ZJ1A 3PUSA 4K0KT 4MFEA 1H1RB 1YXRA 5LGUB 4ISSA 3X25B 1XWMA 2IHR1 2VVSA 5HXSA 4YHHT 3ZSSA 1HG5A 2E9XD 3BQKA 4IMYB 4QX7B 4F6UB 1FEWA 4X66T 4LF7T 1DU2A 3OJAA 3Q5WA 1FKMA 1D0YA 1UNHD 2K24A 4DBQA 2LKHA 5AQIB 3KFWX 3KV4A 2VKDA 1FVVB 2Q9QA 4M1PA 2XQ4A 3RRCA 2HN1A 5CA0E 4P09A 1BR0A 5EK4A 2DMEA 3PUWF 2X1NB 3AVRA 3UFEA 2Z6EA 3EIDB 2ODUA 5HXEA 3H3MA 4OK0A 3X26B 5FXXA 1JKWA 4QHOA 2QYWA 2Y8DA 4GOUA 3M03A 1XDPA 5C3JA 2PHGA 2CZ1B 3SRZA 3ESLA 3HZJA 1FMVA 3BG5A 4QH1A 4JLEA 4EYYR 3C4XA 3ZMUB 3CQGB 3PU8A 1SUMB 3FBZA 3PUZF 3ZT7A 4C91A 4GKKT 2VASA 2C5KT 3I1AA 4PK4A 3ETVA 2JJ9A 1OKWB 1SE7A 3J9X1 2WY2A 1OEDC 1Z0PA 1YQ3A 3ZEFB 4HNUA 3FZHB 4X1KE 1MMDA 1SHZC 4PNIA 3ZN0B 5JDGA 2BVMA 2ZPHB 2G0UA 1BR1A 2LSYA 4DUZT 3VYGB 2XHEB 5FGKB 2BKNA 4LF4T 2XQ3A 3FZKB 2VL0A 5L2LA 3P7IA 4IT4A 2QDYB 3HKDE 1NENA 5LCYA 1TFBA 3R84B 4ZI2C 2YDQA 1J1JA 3AVSA 3UULA 5HQ0B 1WYBA 1G3NC 3KV5A 4JX5A 3M3ZB 1N4MA 1XNQT 3A5XA 4CFMB 4H63V 2ZPEB 4CXXA 2CXFA 5I5ZB 2F4VT 3VKGA 3BLQB 1BR2A 5LGTB 4DIDB 2UU9T 1V29B 5HEJA 2LE8A 1OWAA 3BQIA 4QWNB 4UR9A 2I53A 3LQ5B 4ELJA 4GK5E 4U33A 3AEBA 5J1GA 4CN6A 2YN6A 4Z90A 3OTOT 2C5JA 2QA7A 5LHIB 4JI0T 3TN8B 2W0GA 4PJNA 1LVFA 3AAEB 4Z8XA 2QQ8A 5C2TA 1MIWA 2J4GA 5EZYE 3VRBA 3V5SA 4KBMB 4EOJB 2IW5B 3MJXA 1W0AA 2IVXA 1UNLD 1IREB 4UN0A 1WLXA 2WDVA 4A98A 2UUEB 4UVBB 3ZCJA 1B7TA 3UU3A 3MK7C 4BAYB 4DUYT 4HGAA 4OX9T 5HCJA 5JRCB 2BKPA 3AE9A 1QMZB 2KMGA 4BCJB 3L39A 4H9SE 4IL9A 1YKHB 2X9WA 3NVOA 5HEGA 1UGPB 4EOOB 3EABA 3K1SA 3RYFE 4J2CA 3DDPB 4YSYA 4PJMA 2FBWA 3IEEA 4F6WB 4JX4A 5LBMA 4JEUB 3N5LA 4HKAA 2LM9A 3NKZA 2ZCFB 3PO3S 3L3PA 5HEOA 1KXUA 3BLHB 1XDOA 1JSTB 3KV6A 2W99A 1IZNB 4CN4A 3K3QC 1H1PB 3CMLA 4ZXLA 2XQYA 3KBUA 4EGWA 1CUNA 5AQSB 5JRCA 4QX8B 2CLYB 4EC8B 2CA5A 3AEDA 4DV4T 3AE4A 2VURA 4DV5T 4IE0A 3TKLB 2E2AA 4TX5A 4F7JB 1M62A 3V5UA 3C50A 3MKDA 1BR4A 2ZPBB 3N9QA 4MHCA 4X5TA 2WFYB 1KK7A 2WCAA 1XMQT 3RYIE 3VR8A 3QWLA 3B5MA 3OKQA 5LG3A 3P4SA 4E7ZA 3ZKRA 4PFPA 1J5ET 2C0SA 3TNWB 4QXHB 1WFDA 3RHWA 3F5XB 4F7LB 2KSRA 3U3IA 2C5XB 2FUPA 3RIAA 4KRDB 1KNRA 4FI5A 3QB5K 4PFOA 3K3OA 2C5VB 4X62T 2L8KA 2OV9A 3RRWA 1P5EB 3HA4A 4H9PC 5DABA 1W98B 2MYSA 2KINB 2V6YB 3GA8A 2EHOB 1WYCA 4HWHA 4U2ZA 1KEYA 2EUFA 2V7LA 5AQMB 1HNWT 4YTPA 3AEGA 5EFQB 2C5IT 2DPPB 4WNKA 2XASB 4H9OC 2CBJA 2K5BB 2W67A 2BVLA 4PAGA 3AE5A 2W96A 3VRAA 2BDEA 1T8BA 5KMGP 2CWOA 4IDPA 4YXDA 4GK0E 1HTJF 5M4YA 5AQTB 1H4LD 4TZ4C 3X1DA 3SFDA 3AB3B 4IHJE 5HXCA 3AAIA 5DJQC 2UZBB 2ZM0A 2WMAB 4IDOA 4EC9B 2V7JA 3JAEA 3WI3A 5JR9C 2K48A 2AHJB 3T1HT 4O2BE 2CWYA 4KHZF 3W15B 5J0ZA 5AQRB 3R6NA 4B3RT 1T7SA 4KP3C 4TV8E 2DD4B 3HBLA 2DHRA 2PK9B 2BG9B 3SOLA 2R6GF 3A7MA 1FMWA 2V6YA 2B1EA 2WPAB 5L3FB 2XAHB 3DOGB 4NXMT 2BPMB 1H28B 1H7CA 5LXTE 2IW6B 3RIUC 4NC6A 1IBMT 4I55E 3ANWB 3UUBA 4K0UA 2KR6A 3QK6A 4PJJA 1D0ZA 2XQ7A 5FVLA 4YC3B 5KXJA 4TTHA 1OIYB 2MTQA 3SWHA 4DV1T 2ZLYA 5JDMA 2W00A 5DQVA 4BJMA 1IJ5A 2QDJA 4U7YA 5AQUB 3E0ZA 3IHRA 2JMKA 2UXCT 4KI0F 2CZ6B 4L5GA 1QLBA 4Z91A 2N2NA 3NZQA 2IW9B 1UGOA 2IAKA 1MMAA 3B13A 3Q5DA 4A97A 5LHHB 3X28B 4TNWA 4G63A 2BG9A 5LBQB 1IBLT 2ACXA 2BS3A 2ZM8A 5HBHB 3AE2A 2WP9A 2UUBT 4KUMB 4WBOA 4GIWA 2WU5A 5GONE 4DR7T 2WMBB 2DCFA 1D1CA 3P50A 4IIJE 4HL4A 5HWYA 4EOSB 3ANWA 2Y6XA 3VR9A 3NWIA 4JI8T 4M6VA 1TD6A 1BU2A 4IDZA 2XQ8A 4LMKA 2JIWA 3CX6B 2W66A 2BBJA 4F8HA 3A8MB 2XAQB 5JREA 3A8OB 1L0VA 4AXPA 2PMIB 3CX8B 5LQFB 4QXCB 2XUEA 2B76A 3WAKA 1S35A 4HNVA 3E08A 2CZ0B 4BCND 5KX5E 4KX6A 5L3CB 2NR4A 1U4QA 1N33T 4A56A 3EJ1B 4DR2T 5L2WB 1N36T 3TLUA 4DMVA 4HWCA 1QSDA 1HNXT 1OKVB 2QFZA 3F31A 4DV3T 4U3CA 1SA0E 2R7GA 4BY1X 2XZEA 3QYHB 3RI5A 4B3ST 2X51A 3P4QA 2XQ9A 2LEHA 2XSBA 5DQWA 2P9BA 4I3ZB 2IC6A 1UX4A 3ZMVB 5TAOA 2DD5B 2KZ7B 4BCOB 3GN5A 4YLHA 3FZMB 4AKIA 1LVKA 3ZN1B 2X0LB 4GKJT 4XZCA 4JUYA 3WVEB 2BS4A 4ZS3A 3BG9A 2W4XA 2KXPB 3AEAA 1AHJB 2W9FA 4TUYE 3LSVA 2CCQA 1VCSA 3OYXA 5LNKA 3UUXB 3RLFF 4HFIA 4F7NB 3PUXF 3MACA 1NWMX 2XTLA 4ILCA 2CHOA 2UZLB 4MFDA 5AQJB 4A5XA 5AQGB 3AEFA 3OPCA 4ASKA 1OI9B 4EEDA 2WIPB 2QGSA 2WMNA 2V6XA 4EOIB 2IIUA 2PG8A 2YEVC 1WR0A 1HCIA 5FL0A 3ONLC 4CRLB 2XQAA 2CPTA 2IC9A 2WDQA 3IF8B 4AISA 3ZC1A 3Q5EA 3KINB 2E9XB 3D0TA 4BCKB 4DV7T 4OGRB 3UU4A 4YOSA 2K9AA 3AA1B 4Q25A 5CEIB 3P4RA 4IE6A 3QHRB 5HAXA 3JC6C 4OYKA 2D5UA 3I9YA 1JOWA 1E9HB 1O9KB 1HG2A 4ZGJB 1PKDB 3UFGA 5LJMA 2WEVB 4CXAB 4X1IE 3BHUB 4CQIA 3O1JA 4FJOA 4H63H 3EDVA 1N34T 4ZI2D 2WS3A 3EHZA 3ZSTA 1UK5A 3PE0A 5JDFA 1YW0A 3O1HA 4CZZB 3RC3A 3OBVE 2ZPGB 5LGNB 1IAPA 5FL1A 4COFA 2YU2A 5AQNB 4QXBB 2V8SV 4EZ4A 4IE7A 4H9NC 3QZ9B 2MPKA 2X9YA 3ZPOA 1JNZA 5ABGA 5AQKB 4BCHB 3N9LA 3KVAA 2UXNB 4CI1B 4DR3T 3KBTA 4C90A 3M65A 2W9ZA 2KMFA 1XZYA 2E9XA 1MNDA 2MOZA 5ABFA 3EVYA 4QKNA 1OL2B 3VKHA 3EAMA 5JVDE 1UGRB 5JH7E 4U31A 3RYCE 2W63A 2IW8B 1O9KA 3LG7A 2PFVA 1Y01A 1EZ3A 2YU1A 3QOFA 2A9UA 5LYJE 4HFHA 4YJ2E 4AQFA 4YSXA 3HO8A 4P0BA 2ZPIB 2EHOC 4H9RC 3LFMA 1D0XA 5JQGE 5IHYA 5ABHA 2CYZB 2HPLA 1MIYA 4G6LB 3RKGA 1NAFA 5J2TE 1D1BA 3SFEA 5JDHA 1AD6A 3UU6A 2V5DA 2FJAA 2H7OA 4XBFB 4Y72B 3QNUA 5HCMA 1OEDB 5AFUL 2WQYA 4PW8A 3Q9DA 4U2YA 2XAFB 5IDPB 2M6IA 2KWIB 1GY3B 5HXRA 4JX6A 4XAXB 2VVNA 2XSAA 2H3RA 4HFEA 5LMKB 4EOLB 1T72A 3A8HB 5C8YE 1FJGT 1W0BA 2FJDA 4HTEA 4CXYA 4EYUA 4MALA 3QHWB 2WZIA 1H24B 4ZGDB 5AQHB 5L47A 1H26B 2BG9E 3MIAB 2V7IA 2WM9A 2C5OB 3B57A 4OB1B 2IMLA 2KNDA 4AIUA 2MAWA 3RQUA 3C4WA 4UV8B 2LSKA 3CVRA 4B3TT 1FIOA 4O2AE 1UNGD 5EK3A 1IJ6A 5IUXA 5JDQA 3MY1B 5LG4A 1Y64B 2W2UA 2WHBB 3KV9A 1OEDA 4ANJA 4OB2B 3AA7B 3TLSA 2RPAA 5HWXA 2ODVA 2ZZDB 4UELA 2DI4A 3HKCE 2G77A 5EJCA 4ZS2A 3PUAA 3F2EA 2NWBA 4ZZCA 2LLYA 3F57A 3AA0B 4EOQB 1XO2A 2X66A 2D0TA 3HKEE 2ZM2A 1OL1B 5LOVE 4KMCA 5H6RB 2CE7A 3PV0F 4EOZB 3CKDA 4WBNE 3N2KE 4CFNB 1U5PA 4O4IE 4BBSM 5CA1E 2A3DA 3ZT5A 1AJ3A 2Q9QC 2XM1A 4DO0A 2QRXA 5HBEB 2JQKA 1UCUA 1VYWB 2LW4A 4HE8A 2HHHT 4V1Av 4L0RA 1MIVA 1OXZA 2X9HA 5LB7B 1CHUA 5HNBB 5LA6E 3QXEB 4CFVB 4B3MT 1ZHCA 1ZP0A 4BCMD 4DBRA 3N9MA 4NUUA 3G33B 2Q9QD 1KNZA 2JQ9A 4TWDA 2LJLA 4YTNA 3WVDB 5FYMA 3KHIA 2I6HA 4U74A 3P4WA 4AKHA 1HFAA 1VRBA 2L3LA 3TLTA 2J47A 2UXBT 3RC8A 3RGFB 4DR4T 3AE3A 3RPUA 2I59A 3GMIA 3FZFB 3C4ZA 3PDYA 4F7SB 3N2OA 3MY5B 3RKOA 2C5NB 2PJQA 2CRBA 1GH6B 1KFYA 4LF6T 4KHPT 3HKBE 4EORB 3NRYA 1VCTA 4YTMA 2C4GB 1NEKA 4EOMB 1S94A 4II5B 2WWUA 4HEAA 3LK42 4E7SA 1FINB 1HNZT 1M7KA 2V26A 2LM2A 4AKLA 3NRXA 4IL4A 2QVAA 4LMLA 5CGMA 3O1IA 2V1DB 3HL6A 1UGSB 4TNVA 4DVDA 3RX6A 3JAFA 4ZHQE 2CM0A 4I0UA 4KRCB 4HFCA 2J62A 3H3AA 3T8OA 3A8YC 4YY3T 2Y48B 1LRZA 5CB4E 5LMUT 2RA1A 2K3WA 5AQOB 1US7B 2LKGA 2WSSV 2WBLA 4IDQA 5FY0A 3VU7H 3K7AM 2M67A 5FP3A 2DNXA 2ZPFB 2UUCT 5CFBA 2ACZA 1H1QB 3ZC0A 4BCFB 2AE9A 2XQ5A 4HFBA 5L3DB 3ZYMA 2WIHB 2X67A 2NW7A 3K3NA 3ZT6A 1YQ4A 2DXBB 2NOXA 1H25B 1X9BA 3GN5B 4I4TE 4DR1T 4JI4T 4LFCT 4LFBT 3CK6A 3TLVA 2E8IA 2LSJA 5F5WA 5IYZE 3X24B 4G2AA 3QB5A 4X64T 3C64A 3N9OA 1HX1B 1YKEB 4OFZA 5JR9B 1H1SB 1YD8G 3RIFA 2I40B 4EOKB 2B9RA 3QYBA 3PJAA 1E1HB 2PK2A 4EONB 4BY7X 3C51A 4YHJA 4F6RC 3BLRB 2G9XB 2D0QB 4TN7B 5ETWA 3DL1A 4CXWA 5LMNT 4LF9T 3C98B 3UU5A 2CCHB 2F2CA 1WR6A 4F70B 2W61A 5L4HA 3U78A 4AQGA 4F6SB 3OYZA 4DNDA 2H89A 2LHNA 2JQQA 4MFRA 4BJNA 2BZBA 3FZLB 2D0UA 4CI2B 3FHNA 2AXDS 3ZCIA 2XAJB 3H4CA 5FKYA 5LHGB 4AQYT 2VB6A 2YDRA 4DV6T 2E5VA 3UU8A 2DWGA 3OVUA 5HVYB 3O9XA 4DR6T 4NPPA 1WCRA 2UXXB 4LFAT 4O8SA 5JR9A 3GTMS 1IBKT 4P1NA 4LF5T 2L9QA 1H27B 3I0OA 4PJLA 5LP6E 2LT3A 2DLRA 5L3EB 1ZV4X 4LMJA 3ZLIA 3LBXB 2CXLA 4UXNB 5FXWA 1F5QB 1JNRA 3RQWA 4ZOLE 3UT5E 4TWHA 3AEEA 2IDOB 4PK5A 3RIUA 4BCNB 1OEDE 1URCB 4EXTA 4EEBA 3AAAB 2CEAA 4JI3T 5ABEA 4ERRA 2CLYC 2NW9A 5ABFB 5F8PA 3ABVA 4UF0B 4ROEA 3UUMA 4UV9B 5AQPB 3TLWA 2DL1A 2W62A 4JI5T 4MLKA 2SPCA 1ZP2A 2FJBA 2BKZB 3P4PA 4ZZBA 5FVKA 1QUUA 2VQFT 3TNHB 4ISTA 5JTGA 1G8XA 3ONXA 1XMOT 2PTFA 4DMWA 4QSHA 3Q5XA 3DDQB 3O4XE 4RODA 4HWFA 4YJ3E 2X68A 3PTRB 2JPFA 2HPJA 2OA5A 3RF1A 5KDMC 2A2FX 3HHTB 4JI7T 2WJ9A 4UIGA 3BK9A 2H88A 4TWFA 3AE6A 3LBXA 3JADA 2OLTA 4YT0A 1V9DA 4CFUD 4ILAA 3BHVB 4JI2T 3JC6D 3ONJA 3LDQB 3I9WA 4WZXA 5FY7A 3ZJ2A 2WMOA 2V22B
chains in the Genus database with same CATH topology
4P09A 3HKCE 2ZMAA 3SWHA 2MTQA 3FB2A 4CI3B 5EK4A 1BR0A 4ZS2A 2ZLYA 3PUAA 5JDMA 1HS7A 2W00A 3AVRA 2NWBA 5DQVA 3F2EA 3UFEA 4UF0A 4BJMA 2Z6EA 1IJ5A 2ODUA 5HXEA 3CQXC 4OK0A 5HYAA 5FXXA 3K8PC 3F57A 4WW0A 4IE4A 3AA0B 3E0ZA 5E0OA 3IHRA 2JMKA 4QHOA 4GOUA 2X66A 2Y8DA 3KVBA 4L5GA 2D0TA 2N2NA 3SRZA 3QC9A 3ESLA 3NZQA 3HKEE 2CXDA 1D1AA 2ZM2A 1FMVA 1MMAA 2IAKA 3B13A 5LHHB 5LJNA 4AKGA 4N78D 4JLEA 4EYYR 5BMVE 4G63A 5LOVE 3C4XA 3ZMUB 5LBQB 4KMCA 2ACXA 5H6RB 1MMGA 2CE7A 3CQGB 3PU8A 4EOZB 2ZM8A 3CKDA 3N9PA 3FBZA 5JDLA 4C91A 2VASA 4WBNE 3NZPA 3N2KE 2C5KT 3I1AA 1U5PA 4PK4A 3ETVA 4O4IE 5CA1E 2JJ9A 4KUMB 4WBOA 4GIWA 3QUJA 2HH7A 5GONE 3J9X1 4ZI7E 2DCFA 2A3DA 1D1CA 1Z0PA 3DJBA 4IIJE 3ZEFB 4HN9A 5FXVA 2Q9QC 1HX8A 2V7KA 5HWYA 1AJ3A 4X1KE 3ANWA 1MMDA 1SHZC 4DO0A 4PNIA 3ZYLA 2Y6XA 3ZN0B 3AA6B 1UCUA 2BVMA 5JDGA 4AI6A 3DTOA 3ZMZB 2G0UA 1BR1A 2LSYA 4HE8A 5ADXL 4ADZA 4V1Av 2XHEB 4ILUA 4IDZA 2EHOD 3CX6B 5L2LA 4IE5A 4GYRA 2KT9A 4L0RA 1MIVA 3LK2B 3P7IA 1OXZA 3HKDE 2X9HA 5LCYA 3PUQA 3R84B 2XAQB 2LOPA 1UX5A 4HFVA 5LA6E 3AVSA 4ZI2C 3UULA 5JREA 2NW8A 1WYBA 3UTKA 1ZHCA 3KV5A 4AXPA 2WAUA 3CX8B 4DBRA 3N9MA 4QXCB 2XUEA 4EZHA 3ZMTB 4AKRB 3A5XA 3WAKA 4NUUA 4H63V 1S35A 3E08A 2X9XA 4CXXA 5KX5E 2CXFA 2Q9QD 5L3CB 2KLQA 1KNZA 1U4QA 3VKGA 2LJLA 3GWHA 4A56A 1BR2A 5FYMA 1MNEA 4U74A 5LGTB 1HFAA 2L3LA 1VRBA 4AKHA 4DMVA 2VL8A 3EDUA 3RC8A 2LE8A 1QSDA 2LHRA 1OWAA 5FXZA 3FBLA 3BQIA 4QWNB 3RPUA 4GK5E 3F31A 2I59A 5J1GA 3GMIA 2C5JA 3ZYKA 2LSIA 1SA0E 3C4ZA 4O4HE 3PDYA 2QA7A 5LHIB 3N2OA 4O4JE 3RKOA 2X51A 2W0GA 2LEHA 3H37A 2PJQA 4PJNA 1VOMA 1LVFA 3AAEB 4O4LE 4Z8XA 2CMRA 3HI2A 5DQWA 1MIWA 5EZYE 2P9BA 3V5SA 4KBMB 4H9QC 2IW5B 3HKBE 3MJXA 3NRYA 3N9NA 2IC6A 1UX4A 1WLXA 5F3JA 1S94A 2WWUA 3FXDB 4HEAA 3ZMVB 4UVBB 4EB6E 3LK42 1G73A 3ETUA 3ZCJA 5TAOA 1B7TA 4E7SA 2KZ7B 3GN5A 2V26A 3MK7C 4YLHA 2NTXA 4AKLA 4BAYB 3NRXA 4AKIA 1LVKA 4HGAA 3I0QA 3ZN1B 2X0LB 4XZCA 3CWZB 4JUYA 3O1IA 2V1DB 3HL6A 5JRCB 4ZS3A 4DVDA 2KXPB 3RX6A 4H9SE 4B6XA 4TUYE 4ZHQE 2CCQA 2CM0A 1YKHB 2X9WA 3OYXA 5FNVE 3NBXX 5LNKA 3UUXB 4X20E 3E22E 4EAHA 2H7VC 1LKXA 3H3AA 3MACA 3T8OA 1NWMX 2VK9A 3CQCB 2LSGA 2XTLA 4YFSA 3RYFE 4J2CA 2Y48B 1LRZA 5CB4E 5HXHA 2RA1A 4UEMA 4PJMA 2VKOA 1US7B 2N9DA 3PUGA 4IGUA 3IEEA 2WSSV 2WBLA 2XAGB 4ASKA 5FY0A 3VU7H 2DWKA 5LBMA 4JEUB 3N5LA 4HKAA 2LM9A 2M67A 5FP3A 3SS1A 2QGSA 2DNXA 2WMNA 3L3PA 2PG8A 2YEVC 1HCIA 3ZC0A 5L3DB 3KV6A 3ZYMA 2X67A 2NW7A 2IC9A 5EK2A 3K3NA 1IZNB 3S4UA 3IF8B 3EUHA 3Q2MA 4TV9E 3K3QC 2NOXA 3GN5B 3LK3B 4UVCB 3ZC1A 3CMLA 4I4TE 3KINB 5J2UE 2E9XB 3D0TA 3CX7B 3KDSE 2XQYA 3KBUA 4OYJA 2E8IA 1CUNA 2LSJA 4GYSA 5IYZE 2K9AA 3AA1B 4P0AA 4IE6A 4G2AA 4ZI3C 5JRCA 5HAXA 3JC6C 2CLYB 2D5UA 3C64A 3I9YA 4OYKA 4QX8B 4NUVA 3N9OA 3PURA 1YKEB 3IBPA 4L9IA 4OFZA 5JR9B 1HG2A 1YD8G 1ZEEA 2MBGA 2CA5A 5LJMA 4X1IE 1MMNA 1O3XA 3N2GE 4CQIA 3O1JA 1E1HB 4FJOA 2NTYA 4H63H 3EDVA 4IE0A 3TKLB 4TX5A 3RYHE 1ZKEA 2EHOA 4ZI2D 3V5UA 3C50A 3C51A 3MKDA 3PE0A 5JDFA 1BR4A 1YW0A 3O1HA 2N1GA 3N9QA 4MHCA 4YHJA 3RC3A 4CZZB 3OBVE 4F6RC 5LGNB 1IAPA 1WRDA 4TN7B 5ETWA 2J1DG 2YU2A 4CXWA 4QXBB 2V7MA 3C98B 4EZ4A 3CPZA 4IE7A 1WR6A 5FMNA 1KK7A 4H9NC 1T98A 2W61A 2X9YA 3U78A 3ZPOA 4ZI3D 3ZMSB 3OYZA 4AQGA 4DNDA 2LHNA 2D2SA 2JQQA 3P8CD 3RYIE 4MFRA 4BJNA 3N9LA 3KVAA 2RP4A 2BZBA 2UXNB 3MXZA 2D0UA 4CI1B 3MA9A 4CI2B 3FHNA 3OKQA 3ZCIA 2XAJB 3FXEB 3KBTA 4C90A 3M65A 4E7ZA 5LHGB 2KMFA 2VB6A 2E9XA 5A1LA 1MNDA 1X79A 2ES0A 2MOZA 4PFPA 3UUNA 3EVYA 2LOSA 4QKNA 5JDNA 2DWGA 3VKHA 5JVDE 5JH7E 2C0SA 4QXHB 3RYCE 3O9XA 2W63A 3L09A 2UXXB 4UVAB 4O8SA 3U3IA 5JR9A 3LG7A 2PFVA 1EZ3A 2YU1A 4FI5A 4PFOA 4BA9A 4EIWA 2YK0A 5LYJE 2GK9A 3K3OA 4AQFA 4YJ2E 3VHLA 2L8KA 5L3BB 2JMHA 4P0BA 3RRWA 3HA4A 2L9QA 2EHOC 4H9PC 4PK6A 2VKHA 4H9RC 3LFMA 1D0XA 5DABA 5JQGE 5IHYA 2MYSA 3I0OA 2HPLA 2KINB 1MIYA 4PJLA 3GA8A 5LP6E 2EHOB 1WYCA 2LT3A 2DLRA 3BQLA 5L3EB 1NAFA 1ZV4X 5J2TE 1D1BA 2A72A 2V7LA 5FY1A 5H6QB 3ZLIA 5JDHA 2YINA 2C5IT 3LBXB 4I43B 2CXLA 4WNKA 2XASB 4H9OC 4UXNB 5FXWA 4X1YE 2VWAA 2K5BB 3HR0A 2H7OA 2BVLA 1HF8A 4XBFB 4PAGA 4ZOLE 3UT5E 4PK5A 2BDEA 5AFUL 5KMGP 3J7Yq 2CWOA 4PW8A 2Q9QB 3MZKB 3Q9DA 4GK0E 4EXTA 2E9XC 1HTJF 5M4YA 2XAFB 3AAAB 2CEAA 4TZ4C 4MBQA 2KWIB 3PU3A 3AB3B 4IHJE 5HXCA 4ERRA 3AAIA 5HXRA 5DJQC 2KWHA 4XAXB 2CLYC 2NW9A 2ZM0A 2PBIA 2H3RA 5F8PA 2V7JA 4UF0B 4I50E 3RH3A 3UUMA 3WI3A 2VKJA 3DP7A 5JR9C 2NP9A 2K48A 4UV9B 4O2BE 2CWYA 2W62A 4MLKA 5C8YE 2SPCA 4AQFC 3W15B 3WAJA 4U72A 4HTEA 3R6NA 1QUUA 5L3GB 4CXYA 4JEHB 4EYUA 4OHFA 4MALA 2JRKA 4ISTA 3LJCA 4KP3C 4TV8E 1G8XA 3ZJ1A 3ONXA 2DHRA 3PUSA 4DMWA 3Q5XA 3SOLA 1FMWA 5LGUB 3O4XE 4ISSA 2V7IA 2B1EA 5HXSA 2WM9A 3B57A 2KNDA 4YJ3E 2X68A 3PTRB 1HG5A 2E9XD 2JPFA 3BQKA 5L3FB 3C4WA 2HPJA 2OA5A 4QX7B 5KDMC 2XAHB 2A2FX 4UV8B 3BK9A 1FEWA 2LSKA 3LBXA 3CVRA 4UIGA 1FIOA 1H7CA 4O2AE 3OJAA 3Q5WA 5LXTE 5EK3A 1D0YA 1IJ6A 5JDQA 2K24A 1V9DA 5LG4A 1Y64B 4DBQA 4I55E 3ANWB 4K0UA 3QK6A 3KV9A 4ANJA 3JC6D 3KFWX 3AA7B 3KV4A 2VKDA 4PJJA 2Q9QA 1D0ZA 4M1PA 3I9WA 3RRCA 5FY7A 3ZJ2A 5CA0E 5HWXA 2WMOA 2ODVA 4UELA 2DI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJQ A;  3DTO A;  3B57 A;  5IHY A;  3DJB A;  2QGS A;  5DQW A;  5DQV A; 
#chains in the Genus database with same CATH topology
 2ZMA A;  3FB2 A;  4CI3 B;  1HS7 A;  3O0G D;  4YOO A;  4UF0 A;  3CQX C;  5HYA A;  3K8P C;  4WW0 A;  1E7P A;  4IE4 A;  5E0O A;  3QYE A;  2E5L T;  4BCQ D;  3KVB A;  2BKO A;  3QC9 A;  2V5C A;  2CXD A;  1D1A A;  2M6B A;  4AKG A;  5LJN A;  4N78 D;  5BMV E;  5ACB A;  2I0M A;  4X65 T;  1MMG A;  4HWI B;  3BHT B;  2YOE A;  3N9P A;  1OGU B;  2XY8 B;  5CYI B;  1ENW A;  5JDL A;  3NZP A;  4BCG B;  2VQE T;  3QUJ A;  2HH7 A;  2LRL A;  4ZI7 E;  3POM A;  3DJB A;  4HN9 A;  2WU2 A;  2V7K A;  1HX8 A;  5FXV A;  5IDN B;  1GQE A;  4HWD A;  3ZYL A;  2IN3 A;  3AA6 B;  4WYV A;  4AI6 A;  3DTO A;  3ZMZ B;  1OIU B;  5ADX L;  4ADZ A;  4U7I A;  5CJ5 A;  4ILU A;  4CFX B;  2EHO D;  4IE5 A;  4GYR A;  2KT9 A;  4Z6Y A;  3LK2 B;  4MIM A;  4OB0 B;  3PUQ A;  5BR8 T;  2LOP A;  4HFV A;  1UX5 A;  2NW8 A;  2XM2 A;  4LOC A;  3UTK A;  5HEH A;  2WAU A;  4EZH A;  3ZMT B;  1W9R A;  4AKR B;  2BG9 C;  4ELL A;  2X9X A;  2CZ7 B;  3UQ4 A;  2CBI A;  4NST B;  2KLQ A;  3GWH A;  1MNE A;  2BS2 A;  4CFU B;  2YKS A;  5HBJ B;  2VL8 A;  3EDU A;  2LHR A;  3UQ7 A;  5FXZ A;  3FBL A;  2UXD T;  2JQH A;  1AIS B;  1UUR A;  3T1Y T;  3PJA J;  4HNT A;  3ZYK A;  2LSI A;  4O4H E;  3EOC B;  3MI9 B;  4O4J E;  3H37 A;  1VOM A;  4O4L E;  2CMR A;  4ZGE B;  3HI2 A;  4BCQ B;  4NXN T;  2W2H A;  1W09 A;  3PUV F;  4H9Q C;  3IA3 A;  3TW6 A;  3A8L B;  4OB3 B;  3AXJ B;  3N9N A;  1I6Z A;  5F3J A;  5IWA T;  2BBH A;  2CJM B;  3FXD B;  2QF7 A;  4LF8 T;  4EB6 E;  2XPK A;  1G73 A;  3ETU A;  4DR5 T;  1I94 T;  2NTX A;  3I0Q A;  4QH5 A;  3CWZ B;  4HLQ A;  4QH4 A;  2LRK A;  1UUS A;  2DXC B;  4B6X A;  4BBR M;  5FNV E;  3NBX X;  4X20 E;  2WDR A;  3E22 E;  4EAH A;  2H7V C;  1LKX A;  2VK9 A;  3CQC B;  2LSG A;  4YFS A;  4ROC A;  2X0Y A;  2CHN A;  5HXH A;  5AQQ B;  4UEM A;  2UZD B;  4CFW B;  3EI0 A;  2VKO A;  3PUG A;  2N9D A;  4IGU A;  2XAG B;  1JSU B;  2DWK A;  3L8R A;  1E2A A;  3SS1 A;  4BCP B;  3AXJ A;  5L4E A;  2FJE A;  5EK2 A;  5ICP B;  3S4U A;  3EUH A;  3Q2M A;  4TV9 E;  3LK3 B;  4UVC B;  5J2U E;  4JI1 T;  3CX7 B;  2C6T B;  3KDS E;  2IUB A;  4NIQ A;  4OYJ A;  4GYS A;  4P0A A;  2WXV B;  1KF6 A;  4OR5 B;  1N32 T;  4ZI3 C;  5HEU A;  4EV6 A;  2WWV A;  3NDQ A;  4NUV A;  3PUR A;  3AE1 A;  3IBP A;  4L9I A;  1R8I A;  1ZEE A;  2MBG A;  3TNI B;  4IRE A;  1VIN A;  1MMN A;  1O3X A;  1J5W A;  3N2G E;  4CN1 A;  2JGZ B;  3PUY F;  2NTY A;  3BG3 A;  4YSZ A;  3RYH E;  1ZKE A;  2EHO A;  1KNP A;  5IF1 B;  1Z8U A;  2XQ6 A;  4JYA T;  2N1G A;  2HN2 A;  4HFD A;  1WRD A;  2J1D G;  2V7M A;  3CPZ A;  4BXX X;  5FMN A;  1T98 A;  5AQV B;  3HB9 A;  4ZI3 D;  3ZMS B;  2UZE B;  2D2S A;  4YOZ A;  3P8C D;  2RP4 A;  3MXZ A;  3MA9 A;  4BCI B;  3TW7 A;  3FXE B;  4JI6 T;  5A1L A;  2ES0 A;  1X79 A;  3UUN A;  2LOS A;  5JDN A;  1GUX B;  3VYH B;  2WB5 A;  2CCI B;  3L09 A;  4JBW F;  4UVA B;  1UGQ B;  4FM4 B;  2X0H A;  1D3U B;  4EOP B;  4BA9 A;  2YK0 A;  4EIW A;  2GK9 A;  2UUA T;  3VHL A;  5L3B B;  2JMH A;  2ZM6 T;  5AQF B;  4PK6 A;  1HR0 T;  4FX3 B;  2VKH A;  2D9D A;  4DV2 T;  1ZOY A;  2XJ7 A;  3A8G B;  4ILB A;  4JV5 T;  4DV0 T;  3BQL A;  4IDN A;  2WZH A;  2A72 A;  5H6Q B;  5FY1 A;  4ZEY A;  2YIN A;  4I43 B;  4X1Y E;  2VWA A;  3AE7 A;  4BCM B;  3HR0 A;  3AE8 A;  1HF8 A;  3QZ5 B;  2YDS A;  3J7Y q;  3X20 B;  2Q9Q B;  3MZK B;  2E9X C;  3RGL A;  1VOL A;  3JCF A;  4MBQ A;  3PU3 A;  5AQL B;  2KWH A;  3CIR A;  3AEC A;  2PBI A;  1GUX A;  4I50 E;  3QYG B;  3RH3 A;  2VKJ A;  3DP7 A;  1C9B A;  2NP9 A;  4AQF C;  3WAJ A;  4U72 A;  1XNR T;  3G06 A;  5L3G B;  4JEH B;  4OHF A;  5BNJ B;  2JRK A;  3LJC A;  3ZJ1 A;  3PUS A;  4K0K T;  4MFE A;  1H1R B;  1YXR A;  5LGU B;  4ISS A;  3X25 B;  1XWM A;  2IHR 1;  2VVS A;  5HXS A;  4YHH T;  3ZSS A;  1HG5 A;  2E9X D;  3BQK A;  4IMY B;  4QX7 B;  4F6U B;  1FEW A;  4X66 T;  4LF7 T;  1DU2 A;  3OJA A;  3Q5W A;  1FKM A;  1D0Y A;  1UNH D;  2K24 A;  4DBQ A;  2LKH A;  5AQI B;  3KFW X;  3KV4 A;  2VKD A;  1FVV B;  2Q9Q A;  4M1P A;  2XQ4 A;  3RRC A;  2HN1 A;  5CA0 E;  4P09 A;  1BR0 A;  5EK4 A;  2DME A;  3PUW F;  2X1N B;  3AVR A;  3UFE A;  2Z6E A;  3EID B;  2ODU A;  5HXE A;  3H3M A;  4OK0 A;  3X26 B;  5FXX A;  1JKW A;  4QHO A;  2QYW A;  2Y8D A;  4GOU A;  3M03 A;  1XDP A;  5C3J A;  2PHG A;  2CZ1 B;  3SRZ A;  3ESL A;  3HZJ A;  1FMV A;  3BG5 A;  4QH1 A;  4JLE A;  4EYY R;  3C4X A;  3ZMU B;  3CQG B;  3PU8 A;  1SUM B;  3FBZ A;  3PUZ F;  3ZT7 A;  4C91 A;  4GKK T;  2VAS A;  2C5K T;  3I1A A;  4PK4 A;  3ETV A;  2JJ9 A;  1OKW B;  1SE7 A;  3J9X 1;  2WY2 A;  1OED C;  1Z0P A;  1YQ3 A;  3ZEF B;  4HNU A;  3FZH B;  4X1K E;  1MMD A;  1SHZ C;  4PNI A;  3ZN0 B;  5JDG A;  2BVM A;  2ZPH B;  2G0U A;  1BR1 A;  2LSY A;  4DUZ T;  3VYG B;  2XHE B;  5FGK B;  2BKN A;  4LF4 T;  2XQ3 A;  3FZK B;  2VL0 A;  5L2L A;  3P7I A;  4IT4 A;  2QDY B;  3HKD E;  1NEN A;  5LCY A;  1TFB A;  3R84 B;  4ZI2 C;  2YDQ A;  1J1J A;  3AVS A;  3UUL A;  5HQ0 B;  1WYB A;  1G3N C;  3KV5 A;  4JX5 A;  3M3Z B;  1N4M A;  1XNQ T;  3A5X A;  4CFM B;  4H63 V;  2ZPE B;  4CXX A;  2CXF A;  5I5Z B;  2F4V T;  3VKG A;  3BLQ B;  1BR2 A;  5LGT B;  4DID B;  2UU9 T;  1V29 B;  5HEJ A;  2LE8 A;  1OWA A;  3BQI A;  4QWN B;  4UR9 A;  2I53 A;  3LQ5 B;  4ELJ A;  4GK5 E;  4U33 A;  3AEB A;  5J1G A;  4CN6 A;  2YN6 A;  4Z90 A;  3OTO T;  2C5J A;  2QA7 A;  5LHI B;  4JI0 T;  3TN8 B;  2W0G A;  4PJN A;  1LVF A;  3AAE B;  4Z8X A;  2QQ8 A;  5C2T A;  1MIW A;  2J4G A;  5EZY E;  3VRB A;  3V5S A;  4KBM B;  4EOJ B;  2IW5 B;  3MJX A;  1W0A A;  2IVX A;  1UNL D;  1IRE B;  4UN0 A;  1WLX A;  2WDV A;  4A98 A;  2UUE B;  4UVB B;  3ZCJ A;  1B7T A;  3UU3 A;  3MK7 C;  4BAY B;  4DUY T;  4HGA A;  4OX9 T;  5HCJ A;  5JRC B;  2BKP A;  3AE9 A;  1QMZ B;  2KMG A;  4BCJ B;  3L39 A;  4H9S E;  4IL9 A;  1YKH B;  2X9W A;  3NVO A;  5HEG A;  1UGP B;  4EOO B;  3EAB A;  3K1S A;  3RYF E;  4J2C A;  3DDP B;  4YSY A;  4PJM A;  2FBW A;  3IEE A;  4F6W B;  4JX4 A;  5LBM A;  4JEU B;  3N5L A;  4HKA A;  2LM9 A;  3NKZ A;  2ZCF B;  3PO3 S;  3L3P A;  5HEO A;  1KXU A;  3BLH B;  1XDO A;  1JST B;  3KV6 A;  2W99 A;  1IZN B;  4CN4 A;  3K3Q C;  1H1P B;  3CML A;  4ZXL A;  2XQY A;  3KBU A;  4EGW A;  1CUN A;  5AQS B;  5JRC A;  4QX8 B;  2CLY B;  4EC8 B;  2CA5 A;  3AED A;  4DV4 T;  3AE4 A;  2VUR A;  4DV5 T;  4IE0 A;  3TKL B;  2E2A A;  4TX5 A;  4F7J B;  1M62 A;  3V5U A;  3C50 A;  3MKD A;  1BR4 A;  2ZPB B;  3N9Q A;  4MHC A;  4X5T A;  2WFY B;  1KK7 A;  2WCA A;  1XMQ T;  3RYI E;  3VR8 A;  3QWL A;  3B5M A;  3OKQ A;  5LG3 A;  3P4S A;  4E7Z A;  3ZKR A;  4PFP A;  1J5E T;  2C0S A;  3TNW B;  4QXH B;  1WFD A;  3RHW A;  3F5X B;  4F7L B;  2KSR A;  3U3I A;  2C5X B;  2FUP A;  3RIA A;  4KRD B;  1KNR A;  4FI5 A;  3QB5 K;  4PFO A;  3K3O A;  2C5V B;  4X62 T;  2L8K A;  2OV9 A;  3RRW A;  1P5E B;  3HA4 A;  4H9P C;  5DAB A;  1W98 B;  2MYS A;  2KIN B;  2V6Y B;  3GA8 A;  2EHO B;  1WYC A;  4HWH A;  4U2Z A;  1KEY A;  2EUF A;  2V7L A;  5AQM B;  1HNW T;  4YTP A;  3AEG A;  5EFQ B;  2C5I T;  2DPP B;  4WNK A;  2XAS B;  4H9O C;  2CBJ A;  2K5B B;  2W67 A;  2BVL A;  4PAG A;  3AE5 A;  2W96 A;  3VRA A;  2BDE A;  1T8B A;  5KMG P;  2CWO A;  4IDP A;  4YXD A;  4GK0 E;  1HTJ F;  5M4Y A;  5AQT B;  1H4L D;  4TZ4 C;  3X1D A;  3SFD A;  3AB3 B;  4IHJ E;  5HXC A;  3AAI A;  5DJQ C;  2UZB B;  2ZM0 A;  2WMA B;  4IDO A;  4EC9 B;  2V7J A;  3JAE A;  3WI3 A;  5JR9 C;  2K48 A;  2AHJ B;  3T1H T;  4O2B E;  2CWY A;  4KHZ F;  3W15 B;  5J0Z A;  5AQR B;  3R6N A;  4B3R T;  1T7S A;  4KP3 C;  4TV8 E;  2DD4 B;  3HBL A;  2DHR A;  2PK9 B;  2BG9 B;  3SOL A;  2R6G F;  3A7M A;  1FMW A;  2V6Y A;  2B1E A;  2WPA B;  5L3F B;  2XAH B;  3DOG B;  4NXM T;  2BPM B;  1H28 B;  1H7C A;  5LXT E;  2IW6 B;  3RIU C;  4NC6 A;  1IBM T;  4I55 E;  3ANW B;  3UUB A;  4K0U A;  2KR6 A;  3QK6 A;  4PJJ A;  1D0Z A;  2XQ7 A;  5FVL A;  4YC3 B;  5KXJ A;  4TTH A;  1OIY B;  2MTQ A;  3SWH A;  4DV1 T;  2ZLY A;  5JDM A;  2W00 A;  5DQV A;  4BJM A;  1IJ5 A;  2QDJ A;  4U7Y A;  5AQU B;  3E0Z A;  3IHR A;  2JMK A;  2UXC T;  4KI0 F;  2CZ6 B;  4L5G A;  1QLB A;  4Z91 A;  2N2N A;  3NZQ A;  2IW9 B;  1UGO A;  2IAK A;  1MMA A;  3B13 A;  3Q5D A;  4A97 A;  5LHH B;  3X28 B;  4TNW A;  4G63 A;  2BG9 A;  5LBQ B;  1IBL T;  2ACX A;  2BS3 A;  2ZM8 A;  5HBH B;  3AE2 A;  2WP9 A;  2UUB T;  4KUM B;  4WBO A;  4GIW A;  2WU5 A;  5GON E;  4DR7 T;  2WMB B;  2DCF A;  1D1C A;  3P50 A;  4IIJ E;  4HL4 A;  5HWY A;  4EOS B;  3ANW A;  2Y6X A;  3VR9 A;  3NWI A;  4JI8 T;  4M6V A;  1TD6 A;  1BU2 A;  4IDZ A;  2XQ8 A;  4LMK A;  2JIW A;  3CX6 B;  2W66 A;  2BBJ A;  4F8H A;  3A8M B;  2XAQ B;  5JRE A;  3A8O B;  1L0V A;  4AXP A;  2PMI B;  3CX8 B;  5LQF B;  4QXC B;  2XUE A;  2B76 A;  3WAK A;  1S35 A;  4HNV A;  3E08 A;  2CZ0 B;  4BCN D;  5KX5 E;  4KX6 A;  5L3C B;  2NR4 A;  1U4Q A;  1N33 T;  4A56 A;  3EJ1 B;  4DR2 T;  5L2W B;  1N36 T;  3TLU A;  4DMV A;  4HWC A;  1QSD A;  1HNX T;  1OKV B;  2QFZ A;  3F31 A;  4DV3 T;  4U3C A;  1SA0 E;  2R7G A;  4BY1 X;  2XZE A;  3QYH B;  3RI5 A;  4B3S T;  2X51 A;  3P4Q A;  2XQ9 A;  2LEH A;  2XSB A;  5DQW A;  2P9B A;  4I3Z B;  2IC6 A;  1UX4 A;  3ZMV B;  5TAO A;  2DD5 B;  2KZ7 B;  4BCO B;  3GN5 A;  4YLH A;  3FZM B;  4AKI A;  1LVK A;  3ZN1 B;  2X0L B;  4GKJ T;  4XZC A;  4JUY A;  3WVE B;  2BS4 A;  4ZS3 A;  3BG9 A;  2W4X A;  2KXP B;  3AEA A;  1AHJ B;  2W9F A;  4TUY E;  3LSV A;  2CCQ A;  1VCS A;  3OYX A;  5LNK A;  3UUX B;  3RLF F;  4HFI A;  4F7N B;  3PUX F;  3MAC A;  1NWM X;  2XTL A;  4ILC A;  2CHO A;  2UZL B;  4MFD A;  5AQJ B;  4A5X A;  5AQG B;  3AEF A;  3OPC A;  4ASK A;  1OI9 B;  4EED A;  2WIP B;  2QGS A;  2WMN A;  2V6X A;  4EOI B;  2IIU A;  2PG8 A;  2YEV C;  1WR0 A;  1HCI A;  5FL0 A;  3ONL C;  4CRL B;  2XQA A;  2CPT A;  2IC9 A;  2WDQ A;  3IF8 B;  4AIS A;  3ZC1 A;  3Q5E A;  3KIN B;  2E9X B;  3D0T A;  4BCK B;  4DV7 T;  4OGR B;  3UU4 A;  4YOS A;  2K9A A;  3AA1 B;  4Q25 A;  5CEI B;  3P4R A;  4IE6 A;  3QHR B;  5HAX A;  3JC6 C;  4OYK A;  2D5U A;  3I9Y A;  1JOW A;  1E9H B;  1O9K B;  1HG2 A;  4ZGJ B;  1PKD B;  3UFG A;  5LJM A;  2WEV B;  4CXA B;  4X1I E;  3BHU B;  4CQI A;  3O1J A;  4FJO A;  4H63 H;  3EDV A;  1N34 T;  4ZI2 D;  2WS3 A;  3EHZ A;  3ZST A;  1UK5 A;  3PE0 A;  5JDF A;  1YW0 A;  3O1H A;  4CZZ B;  3RC3 A;  3OBV E;  2ZPG B;  5LGN B;  1IAP A;  5FL1 A;  4COF A;  2YU2 A;  5AQN B;  4QXB B;  2V8S V;  4EZ4 A;  4IE7 A;  4H9N C;  3QZ9 B;  2MPK A;  2X9Y A;  3ZPO A;  1JNZ A;  5ABG A;  5AQK B;  4BCH B;  3N9L A;  3KVA A;  2UXN B;  4CI1 B;  4DR3 T;  3KBT A;  4C90 A;  3M65 A;  2W9Z A;  2KMF A;  1XZY A;  2E9X A;  1MND A;  2MOZ A;  5ABF A;  3EVY A;  4QKN A;  1OL2 B;  3VKH A;  3EAM A;  5JVD E;  1UGR B;  5JH7 E;  4U31 A;  3RYC E;  2W63 A;  2IW8 B;  1O9K A;  3LG7 A;  2PFV A;  1Y01 A;  1EZ3 A;  2YU1 A;  3QOF A;  2A9U A;  5LYJ E;  4HFH A;  4YJ2 E;  4AQF A;  4YSX A;  3HO8 A;  4P0B A;  2ZPI B;  2EHO C;  4H9R C;  3LFM A;  1D0X A;  5JQG E;  5IHY A;  5ABH A;  2CYZ B;  2HPL A;  1MIY A;  4G6L B;  3RKG A;  1NAF A;  5J2T E;  1D1B A;  3SFE A;  5JDH A;  1AD6 A;  3UU6 A;  2V5D A;  2FJA A;  2H7O A;  4XBF B;  4Y72 B;  3QNU A;  5HCM A;  1OED B;  5AFU L;  2WQY A;  4PW8 A;  3Q9D A;  4U2Y A;  2XAF B;  5IDP B;  2M6I A;  2KWI B;  1GY3 B;  5HXR A;  4JX6 A;  4XAX B;  2VVN A;  2XSA A;  2H3R A;  4HFE A;  5LMK B;  4EOL B;  1T72 A;  3A8H B;  5C8Y E;  1FJG T;  1W0B A;  2FJD A;  4HTE A;  4CXY A;  4EYU A;  4MAL A;  3QHW B;  2WZI A;  1H24 B;  4ZGD B;  5AQH B;  5L47 A;  1H26 B;  2BG9 E;  3MIA B;  2V7I A;  2WM9 A;  2C5O B;  3B57 A;  4OB1 B;  2IML A;  2KND A;  4AIU A;  2MAW A;  3RQU A;  3C4W A;  4UV8 B;  2LSK A;  3CVR A;  4B3T T;  1FIO A;  4O2A E;  1UNG D;  5EK3 A;  1IJ6 A;  5IUX A;  5JDQ A;  3MY1 B;  5LG4 A;  1Y64 B;  2W2U A;  2WHB B;  3KV9 A;  1OED A;  4ANJ A;  4OB2 B;  3AA7 B;  3TLS A;  2RPA A;  5HWX A;  2ODV A;  2ZZD B;  4UEL A;  2DI4 A;  3HKC E;  2G77 A;  5EJC A;  4ZS2 A;  3PUA A;  3F2E A;  2NWB A;  4ZZC A;  2LLY A;  3F57 A;  3AA0 B;  4EOQ B;  1XO2 A;  2X66 A;  2D0T A;  3HKE E;  2ZM2 A;  1OL1 B;  5LOV E;  4KMC A;  5H6R B;  2CE7 A;  3PV0 F;  4EOZ B;  3CKD A;  4WBN E;  3N2K E;  4CFN B;  1U5P A;  4O4I E;  4BBS M;  5CA1 E;  2A3D A;  3ZT5 A;  1AJ3 A;  2Q9Q C;  2XM1 A;  4DO0 A;  2QRX A;  5HBE B;  2JQK A;  1UCU A;  1VYW B;  2LW4 A;  4HE8 A;  2HHH T;  4V1A v;  4L0R A;  1MIV A;  1OXZ A;  2X9H A;  5LB7 B;  1CHU A;  5HNB B;  5LA6 E;  3QXE B;  4CFV B;  4B3M T;  1ZHC A;  1ZP0 A;  4BCM D;  4DBR A;  3N9M A;  4NUU A;  3G33 B;  2Q9Q D;  1KNZ A;  2JQ9 A;  4TWD A;  2LJL A;  4YTN A;  3WVD B;  5FYM A;  3KHI A;  2I6H A;  4U74 A;  3P4W A;  4AKH A;  1HFA A;  1VRB A;  2L3L A;  3TLT A;  2J47 A;  2UXB T;  3RC8 A;  3RGF B;  4DR4 T;  3AE3 A;  3RPU A;  2I59 A;  3GMI A;  3FZF B;  3C4Z A;  3PDY A;  4F7S B;  3N2O A;  3MY5 B;  3RKO A;  2C5N B;  2PJQ A;  2CRB A;  1GH6 B;  1KFY A;  4LF6 T;  4KHP T;  3HKB E;  4EOR B;  3NRY A;  1VCT A;  4YTM A;  2C4G B;  1NEK A;  4EOM B;  1S94 A;  4II5 B;  2WWU A;  4HEA A;  3LK4 2;  4E7S A;  1FIN B;  1HNZ T;  1M7K A;  2V26 A;  2LM2 A;  4AKL A;  3NRX A;  4IL4 A;  2QVA A;  4LML A;  5CGM A;  3O1I A;  2V1D B;  3HL6 A;  1UGS B;  4TNV A;  4DVD A;  3RX6 A;  3JAF A;  4ZHQ E;  2CM0 A;  4I0U A;  4KRC B;  4HFC A;  2J62 A;  3H3A A;  3T8O A;  3A8Y C;  4YY3 T;  2Y48 B;  1LRZ A;  5CB4 E;  5LMU T;  2RA1 A;  2K3W A;  5AQO B;  1US7 B;  2LKG A;  2WSS V;  2WBL A;  4IDQ A;  5FY0 A;  3VU7 H;  3K7A M;  2M67 A;  5FP3 A;  2DNX A;  2ZPF B;  2UUC T;  5CFB A;  2ACZ A;  1H1Q B;  3ZC0 A;  4BCF B;  2AE9 A;  2XQ5 A;  4HFB A;  5L3D B;  3ZYM A;  2WIH B;  2X67 A;  2NW7 A;  3K3N A;  3ZT6 A;  1YQ4 A;  2DXB B;  2NOX A;  1H25 B;  1X9B A;  3GN5 B;  4I4T E;  4DR1 T;  4JI4 T;  4LFC T;  4LFB T;  3CK6 A;  3TLV A;  2E8I A;  2LSJ A;  5F5W A;  5IYZ E;  3X24 B;  4G2A A;  3QB5 A;  4X64 T;  3C64 A;  3N9O A;  1HX1 B;  1YKE B;  4OFZ A;  5JR9 B;  1H1S B;  1YD8 G;  3RIF A;  2I40 B;  4EOK B;  2B9R A;  3QYB A;  3PJA A;  1E1H B;  2PK2 A;  4EON B;  4BY7 X;  3C51 A;  4YHJ A;  4F6R C;  3BLR B;  2G9X B;  2D0Q B;  4TN7 B;  5ETW A;  3DL1 A;  4CXW A;  5LMN T;  4LF9 T;  3C98 B;  3UU5 A;  2CCH B;  2F2C A;  1WR6 A;  4F70 B;  2W61 A;  5L4H A;  3U78 A;  4AQG A;  4F6S B;  3OYZ A;  4DND A;  2H89 A;  2LHN A;  2JQQ A;  4MFR A;  4BJN A;  2BZB A;  3FZL B;  2D0U A;  4CI2 B;  3FHN A;  2AXD S;  3ZCI A;  2XAJ B;  3H4C A;  5FKY A;  5LHG B;  4AQY T;  2VB6 A;  2YDR A;  4DV6 T;  2E5V A;  3UU8 A;  2DWG A;  3OVU A;  5HVY B;  3O9X A;  4DR6 T;  4NPP A;  1WCR A;  2UXX B;  4LFA T;  4O8S A;  5JR9 A;  3GTM S;  1IBK T;  4P1N A;  4LF5 T;  2L9Q A;  1H27 B;  3I0O A;  4PJL A;  5LP6 E;  2LT3 A;  2DLR A;  5L3E B;  1ZV4 X;  4LMJ A;  3ZLI A;  3LBX B;  2CXL A;  4UXN B;  5FXW A;  1F5Q B;  1JNR A;  3RQW A;  4ZOL E;  3UT5 E;  4TWH A;  3AEE A;  2IDO B;  4PK5 A;  3RIU A;  4BCN B;  1OED E;  1URC B;  4EXT A;  4EEB A;  3AAA B;  2CEA A;  4JI3 T;  5ABE A;  4ERR A;  2CLY C;  2NW9 A;  5ABF B;  5F8P A;  3ABV A;  4UF0 B;  4ROE A;  3UUM A;  4UV9 B;  5AQP B;  3TLW A;  2DL1 A;  2W62 A;  4JI5 T;  4MLK A;  2SPC A;  1ZP2 A;  2FJB A;  2BKZ B;  3P4P A;  4ZZB A;  5FVK A;  1QUU A;  2VQF T;  3TNH B;  4IST A;  5JTG A;  1G8X A;  3ONX A;  1XMO T;  2PTF A;  4DMW A;  4QSH A;  3Q5X A;  3DDQ B;  3O4X E;  4ROD A;  4HWF A;  4YJ3 E;  2X68 A;  3PTR B;  2JPF A;  2HPJ A;  2OA5 A;  3RF1 A;  5KDM C;  2A2F X;  3HHT B;  4JI7 T;  2WJ9 A;  4UIG A;  3BK9 A;  2H88 A;  4TWF A;  3AE6 A;  3LBX A;  3JAD A;  2OLT A;  4YT0 A;  1V9D A;  4CFU D;  4ILA A;  3BHV B;  4JI2 T;  3JC6 D;  3ONJ A;  3LDQ B;  3I9W A;  4WZX A;  5FY7 A;  3ZJ2 A;  2WMO A;  2V22 B; 
#chains in the Genus database with same CATH homology
 4P09 A;  3HKC E;  2ZMA A;  3SWH A;  2MTQ A;  3FB2 A;  4CI3 B;  5EK4 A;  1BR0 A;  4ZS2 A;  2ZLY A;  3PUA A;  5JDM A;  1HS7 A;  2W00 A;  3AVR A;  2NWB A;  5DQV A;  3F2E A;  3UFE A;  4UF0 A;  4BJM A;  2Z6E A;  1IJ5 A;  2ODU A;  5HXE A;  3CQX C;  4OK0 A;  5HYA A;  5FXX A;  3K8P C;  3F57 A;  4WW0 A;  4IE4 A;  3AA0 B;  3E0Z A;  5E0O A;  3IHR A;  2JMK A;  4QHO A;  4GOU A;  2X66 A;  2Y8D A;  3KVB A;  4L5G A;  2D0T A;  2N2N A;  3SRZ A;  3QC9 A;  3ESL A;  3NZQ A;  3HKE E;  2CXD A;  1D1A A;  2ZM2 A;  1FMV A;  1MMA A;  2IAK A;  3B13 A;  5LHH B;  5LJN A;  4AKG A;  4N78 D;  4JLE A;  4EYY R;  5BMV E;  4G63 A;  5LOV E;  3C4X A;  3ZMU B;  5LBQ B;  4KMC A;  2ACX A;  5H6R B;  1MMG A;  2CE7 A;  3CQG B;  3PU8 A;  4EOZ B;  2ZM8 A;  3CKD A;  3N9P A;  3FBZ A;  5JDL A;  4C91 A;  2VAS A;  4WBN E;  3NZP A;  3N2K E;  2C5K T;  3I1A A;  1U5P A;  4PK4 A;  3ETV A;  4O4I E;  5CA1 E;  2JJ9 A;  4KUM B;  4WBO A;  4GIW A;  3QUJ A;  2HH7 A;  5GON E;  3J9X 1;  4ZI7 E;  2DCF A;  2A3D A;  1D1C A;  1Z0P A;  3DJB A;  4IIJ E;  3ZEF B;  4HN9 A;  5FXV A;  2Q9Q C;  1HX8 A;  2V7K A;  5HWY A;  1AJ3 A;  4X1K E;  3ANW A;  1MMD A;  1SHZ C;  4DO0 A;  4PNI A;  3ZYL A;  2Y6X A;  3ZN0 B;  3AA6 B;  1UCU A;  2BVM A;  5JDG A;  4AI6 A;  3DTO A;  3ZMZ B;  2G0U A;  1BR1 A;  2LSY A;  4HE8 A;  5ADX L;  4ADZ A;  4V1A v;  2XHE B;  4ILU A;  4IDZ A;  2EHO D;  3CX6 B;  5L2L A;  4IE5 A;  4GYR A;  2KT9 A;  4L0R A;  1MIV A;  3LK2 B;  3P7I A;  1OXZ A;  3HKD E;  2X9H A;  5LCY A;  3PUQ A;  3R84 B;  2XAQ B;  2LOP A;  1UX5 A;  4HFV A;  5LA6 E;  3AVS A;  4ZI2 C;  3UUL A;  5JRE A;  2NW8 A;  1WYB A;  3UTK A;  1ZHC A;  3KV5 A;  4AXP A;  2WAU A;  3CX8 B;  4DBR A;  3N9M A;  4QXC B;  2XUE A;  4EZH A;  3ZMT B;  4AKR B;  3A5X A;  3WAK A;  4NUU A;  4H63 V;  1S35 A;  3E08 A;  2X9X A;  4CXX A;  5KX5 E;  2CXF A;  2Q9Q D;  5L3C B;  2KLQ A;  1KNZ A;  1U4Q A;  3VKG A;  2LJL A;  3GWH A;  4A56 A;  1BR2 A;  5FYM A;  1MNE A;  4U74 A;  5LGT B;  1HFA A;  2L3L A;  1VRB A;  4AKH A;  4DMV A;  2VL8 A;  3EDU A;  3RC8 A;  2LE8 A;  1QSD A;  2LHR A;  1OWA A;  5FXZ A;  3FBL A;  3BQI A;  4QWN B;  3RPU A;  4GK5 E;  3F31 A;  2I59 A;  5J1G A;  3GMI A;  2C5J A;  3ZYK A;  2LSI A;  1SA0 E;  3C4Z A;  4O4H E;  3PDY A;  2QA7 A;  5LHI B;  3N2O A;  4O4J E;  3RKO A;  2X51 A;  2W0G A;  2LEH A;  3H37 A;  2PJQ A;  4PJN A;  1VOM A;  1LVF A;  3AAE B;  4O4L E;  4Z8X A;  2CMR A;  3HI2 A;  5DQW A;  1MIW A;  5EZY E;  2P9B A;  3V5S A;  4KBM B;  4H9Q C;  2IW5 B;  3HKB E;  3MJX A;  3NRY A;  3N9N A;  2IC6 A;  1UX4 A;  1WLX A;  5F3J A;  1S94 A;  2WWU A;  3FXD B;  4HEA A;  3ZMV B;  4UVB B;  4EB6 E;  3LK4 2;  1G73 A;  3ETU A;  3ZCJ A;  5TAO A;  1B7T A;  4E7S A;  2KZ7 B;  3GN5 A;  2V26 A;  3MK7 C;  4YLH A;  2NTX A;  4AKL A;  4BAY B;  3NRX A;  4AKI A;  1LVK A;  4HGA A;  3I0Q A;  3ZN1 B;  2X0L B;  4XZC A;  3CWZ B;  4JUY A;  3O1I A;  2V1D B;  3HL6 A;  5JRC B;  4ZS3 A;  4DVD A;  2KXP B;  3RX6 A;  4H9S E;  4B6X A;  4TUY E;  4ZHQ E;  2CCQ A;  2CM0 A;  1YKH B;  2X9W A;  3OYX A;  5FNV E;  3NBX X;  5LNK A;  3UUX B;  4X20 E;  3E22 E;  4EAH A;  2H7V C;  1LKX A;  3H3A A;  3MAC A;  3T8O A;  1NWM X;  2VK9 A;  3CQC B;  2LSG A;  2XTL A;  4YFS A;  3RYF E;  4J2C A;  2Y48 B;  1LRZ A;  5CB4 E;  5HXH A;  2RA1 A;  4UEM A;  4PJM A;  2VKO A;  1US7 B;  2N9D A;  3PUG A;  4IGU A;  3IEE A;  2WSS V;  2WBL A;  2XAG B;  4ASK A;  5FY0 A;  3VU7 H;  2DWK A;  5LBM A;  4JEU B;  3N5L A;  4HKA A;  2LM9 A;  2M67 A;  5FP3 A;  3SS1 A;  2QGS A;  2DNX A;  2WMN A;  3L3P A;  2PG8 A;  2YEV C;  1HCI A;  3ZC0 A;  5L3D B;  3KV6 A;  3ZYM A;  2X67 A;  2NW7 A;  2IC9 A;  5EK2 A;  3K3N A;  1IZN B;  3S4U A;  3IF8 B;  3EUH A;  3Q2M A;  4TV9 E;  3K3Q C;  2NOX A;  3GN5 B;  3LK3 B;  4UVC B;  3ZC1 A;  3CML A;  4I4T E;  3KIN B;  5J2U E;  2E9X B;  3D0T A;  3CX7 B;  3KDS E;  2XQY A;  3KBU A;  4OYJ A;  2E8I A;  1CUN A;  2LSJ A;  4GYS A;  5IYZ E;  2K9A A;  3AA1 B;  4P0A A;  4IE6 A;  4G2A A;  4ZI3 C;  5JRC A;  5HAX A;  3JC6 C;  2CLY B;  2D5U A;  3C64 A;  3I9Y A;  4OYK A;  4QX8 B;  4NUV A;  3N9O A;  3PUR A;  1YKE B;  3IBP A;  4L9I A;  4OFZ A;  5JR9 B;  1HG2 A;  1YD8 G;  1ZEE A;  2MBG A;  2CA5 A;  5LJM A;  4X1I E;  1MMN A;  1O3X A;  3N2G E;  4CQI A;  3O1J A;  1E1H B;  4FJO A;  2NTY A;  4H63 H;  3EDV A;  4IE0 A;  3TKL B;  4TX5 A;  3RYH E;  1ZKE A;  2EHO A;  4ZI2 D;  3V5U A;  3C50 A;  3C51 A;  3MKD A;  3PE0 A;  5JDF A;  1BR4 A;  1YW0 A;  3O1H A;  2N1G A;  3N9Q A;  4MHC A;  4YHJ A;  3RC3 A;  4CZZ B;  3OBV E;  4F6R C;  5LGN B;  1IAP A;  1WRD A;  4TN7 B;  5ETW A;  2J1D G;  2YU2 A;  4CXW A;  4QXB B;  2V7M A;  3C98 B;  4EZ4 A;  3CPZ A;  4IE7 A;  1WR6 A;  5FMN A;  1KK7 A;  4H9N C;  1T98 A;  2W61 A;  2X9Y A;  3U78 A;  3ZPO A;  4ZI3 D;  3ZMS B;  3OYZ A;  4AQG A;  4DND A;  2LHN A;  2D2S A;  2JQQ A;  3P8C D;  3RYI E;  4MFR A;  4BJN A;  3N9L A;  3KVA A;  2RP4 A;  2BZB A;  2UXN B;  3MXZ A;  2D0U A;  4CI1 B;  3MA9 A;  4CI2 B;  3FHN A;  3OKQ A;  3ZCI A;  2XAJ B;  3FXE B;  3KBT A;  4C90 A;  3M65 A;  4E7Z A;  5LHG B;  2KMF A;  2VB6 A;  2E9X A;  5A1L A;  1MND A;  1X79 A;  2ES0 A;  2MOZ A;  4PFP A;  3UUN A;  3EVY A;  2LOS A;  4QKN A;  5JDN A;  2DWG A;  3VKH A;  5JVD E;  5JH7 E;  2C0S A;  4QXH B;  3RYC E;  3O9X A;  2W63 A;  3L09 A;  2UXX B;  4UVA B;  4O8S A;  3U3I A;  5JR9 A;  3LG7 A;  2PFV A;  1EZ3 A;  2YU1 A;  4FI5 A;  4PFO A;  4BA9 A;  4EIW A;  2YK0 A;  5LYJ E;  2GK9 A;  3K3O A;  4AQF A;  4YJ2 E;  3VHL A;  2L8K A;  5L3B B;  2JMH A;  4P0B A;  3RRW A;  3HA4 A;  2L9Q A;  2EHO C;  4H9P C;  4PK6 A;  2VKH A;  4H9R C;  3LFM A;  1D0X A;  5DAB A;  5JQG E;  5IHY A;  2MYS A;  3I0O A;  2HPL A;  2KIN B;  1MIY A;  4PJL A;  3GA8 A;  5LP6 E;  2EHO B;  1WYC A;  2LT3 A;  2DLR A;  3BQL A;  5L3E B;  1NAF A;  1ZV4 X;  5J2T E;  1D1B A;  2A72 A;  2V7L A;  5FY1 A;  5H6Q B;  3ZLI A;  5JDH A;  2YIN A;  2C5I T;  3LBX B;  4I43 B;  2CXL A;  4WNK A;  2XAS B;  4H9O C;  4UXN B;  5FXW A;  4X1Y E;  2VWA A;  2K5B B;  3HR0 A;  2H7O A;  2BVL A;  1HF8 A;  4XBF B;  4PAG A;  4ZOL E;  3UT5 E;  4PK5 A;  2BDE A;  5AFU L;  5KMG P;  3J7Y q;  2CWO A;  4PW8 A;  2Q9Q B;  3MZK B;  3Q9D A;  4GK0 E;  4EXT A;  2E9X C;  1HTJ F;  5M4Y A;  2XAF B;  3AAA B;  2CEA A;  4TZ4 C;  4MBQ A;  2KWI B;  3PU3 A;  3AB3 B;  4IHJ E;  5HXC A;  4ERR A;  3AAI A;  5HXR A;  5DJQ C;  2KWH A;  4XAX B;  2CLY C;  2NW9 A;  2ZM0 A;  2PBI A;  2H3R A;  5F8P A;  2V7J A;  4UF0 B;  4I50 E;  3RH3 A;  3UUM A;  3WI3 A;  2VKJ A;  3DP7 A;  5JR9 C;  2NP9 A;  2K48 A;  4UV9 B;  4O2B E;  2CWY A;  2W62 A;  4MLK A;  5C8Y E;  2SPC A;  4AQF C;  3W15 B;  3WAJ A;  4U72 A;  4HTE A;  3R6N A;  1QUU A;  5L3G B;  4CXY A;  4JEH B;  4EYU A;  4OHF A;  4MAL A;  2JRK A;  4IST A;  3LJC A;  4KP3 C;  4TV8 E;  1G8X A;  3ZJ1 A;  3ONX A;  2DHR A;  3PUS A;  4DMW A;  3Q5X A;  3SOL A;  1FMW A;  5LGU B;  3O4X E;  4ISS A;  2V7I A;  2B1E A;  5HXS A;  2WM9 A;  3B57 A;  2KND A;  4YJ3 E;  2X68 A;  3PTR B;  1HG5 A;  2E9X D;  2JPF A;  3BQK A;  5L3F B;  3C4W A;  2HPJ A;  2OA5 A;  4QX7 B;  5KDM C;  2XAH B;  2A2F X;  4UV8 B;  3BK9 A;  1FEW A;  2LSK A;  3LBX A;  3CVR A;  4UIG A;  1FIO A;  1H7C A;  4O2A E;  3OJA A;  3Q5W A;  5LXT E;  5EK3 A;  1D0Y A;  1IJ6 A;  5JDQ A;  2K24 A;  1V9D A;  5LG4 A;  1Y64 B;  4DBQ A;  4I55 E;  3ANW B;  4K0U A;  3QK6 A;  3KV9 A;  4ANJ A;  3JC6 D;  3KFW X;  3AA7 B;  3KV4 A;  2VKD A;  4PJJ A;  2Q9Q A;  1D0Z A;  4M1P A;  3I9W A;  3RRC A;  5FY7 A;  3ZJ2 A;  5CA0 E;  5HWX A;  2WMO A;  2ODV A;  4UEL A;  2DI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...