4OB3B

Crystal structure of nitrile hydratase from pseudonocardia thermophila : a reference structure to boronic acid inhibition of nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
229
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 66
structure length 229
sequence length 229
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob3B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob3B02
3WVEB 2DXCA 4RKUE 3X26B 4Y28E 2WSCE 3QYGB 1PSEA 2DXBB 5L8RE 2ZPHB 2CZ0B 2DXCB 2PVDB 2PVOB 4ZGJB 2DD4A 1AHJB 2CYZB 2ZPGB 2PUOB 2DXBA 3A8OB 4OB3B 2ZZDA 3X20B 3HHTB 4KT0E 2DD4B 2QDYB 4OB1B 2DD5B 2ZPFB 3X28B 3QZ9B 4XK8E 1GXIE 2ZZDB 4OB2B 3A8MB 2CZ1B 3QXEB 2ZPBB 4ZGEB 4FM4B 1UGPB 2O01E 2WSEE 2DD5A 4OB0B 1IREB 1QP2A 1JB0E 2CZ7B 1UGSB 1DJ7B 3QZ5B 3VYHB 2PUKB 1UGQB 3A8HB 1V29B 3A8LB 3X25B 1UGRB 3WVDB 2PVGB 2AHJB 1PSFA 3VYGB 3A8GB 3QYHB 3LW5E 2CZ6B 2D0QB 2WSFE 2PU9B 2ZCFB 3VYGA 2DPPB 4L6V5 4ZGDB 1QP3A 2ZPEB 2ZPIB 3X24B
chains in the Genus database with same CATH superfamily
1MMAA 4LN2A 1SSHA 4J6WA 4M7DE 1S72T 1AD6A 1G3SA 2K9GA 4N4HA 3C0CA 3G6EQ 1QKXA 3QWYA 4RTTA 2QQ9A 2VB6A 1NJIC 2FHDA 3SFMA 1M4ZA 3M53A 2KGTA 1MGQA 3OS5A 2ED0A 3DB3A 3POMA 2DX1A 4AG2C 1VQ9A 5GAOn 3JSCA 1EFNA 2PUOB 1YJWQ 1OPLA 2RHZA 1I4K1 4TVRA 2QEXT 3M56A 4A4FA 2DRKA 1K73R 2QDYB 1M2VB 2BPMB 3HFNA 2X4WA 4BCKB 4A4GA 2F69A 2C06A 2LT4A 1U1SA 5CKBA 3A8MB 5KE3A 3QXEB 2JOYA 4RTZA 2E41A 4PJOC 2HL5C 1N8RR 4KH0B 1TUDA 2DE0X 1C6VX 3RKYA 5LJ5h 4II1A 4XU3A 3CMAA 1GCQC 5GAN8 5I21A 1H24B 1J3TA 4CC3A 4ELJA 3CCRQ 1KC8R 2EFIA 5I22A 2NWMA 4HVVA 2F5KA 3G4ST 3CPWA 3JB9I 2QQ8A 1N27A 3DKMA 4C0FA 4CRLB 4A63B 2DBKA 4D8KA 4C8QA 3FDRA 2PQWA 1RAIB 4M77E 3L2RA 3KFVA 3MIAB 2V8JA 1K76A 2IG0A 4C8QF 1QLBA 1ZSZB 1UE9A 4MFDA 8AT1B 2BZXA 1TUGB 2VKNA 5KYYA 2CKKA 2VXFA 2E3IA 3I56A 3CXCP 1D3BA 3V7SA 2Y90A 3BG5A 3VYGA 4PLIA 4EOSB 4MZTA 1TXQA 5LJ5d 4J83A 1D1CA 1YHQA 5KH6A 4J9EA 2RHIA 4M7AF 1M1GA 3SWNA 2X4JA 2HEQA 3P8BB 4GLMA 3TU4K 1TG0A 3O8VA 1C1AA 5FRNA 1EIFA 1WXTA 2R58A 2O4XA 2YRDA 1FMWA 4IUQA 1WA7A 1H1SB 4A4EA 4WF2A 2DBMA 2CYZB 1B34B 3RKXA 3PO3S 3G71Q 2JMCA 2X35A 1KSWA 4B6MA 4WTOB 2KR3A 2AKLA 2RI5A 1YITA 3HHTB 2GGRA 3SD4A 4FL6A 1WZOA 1G5VA 4C92D 2DZ9A 4CC4B 4OB2B 4Y72B 2GFAA 1VQ4A 1K73U 2DL8A 1ZSZC 5D7UA 3CCUT 3PNWC 1O9KB 1AZGB 1R8OB 4JDSA 3F5XB 4M75B 3EHQA 2O01E 3OYBA 2KQWA 2DERA 5HY6A 1H3ZA 4LE9A 4DBQA 2P0QA 3OYEA 2RB6A 1N8RU 1PC0A 1GFCA 2E1HA 1GUXA 1DJ7B 3M57A 2CSQA 3OYLA 5IDNB 1VQNA 3MP6A 1QQJA 4F17A 1CSKA 3R6NA 3S3MA 2X9HA 1Z9ZA 2WJ9A 1VQOQ 1KC8U 5I11A 1UTIA 4J9HA 1UNHD 2KK4A 2BS2A 3LH5A 4JS4A 1UGRB 2OX7A 3WVDB 4YTLA 3PMTA 3G7ZA 2QTVA 2CH4W 3VS6A 2L0AA 2B9RA 3EGDA 2QDLA 3CMEA 3CC2A 1VQ6T 5CQYA 4LNPA 1Q81C 3TSWA 4Z89A 4FX3B 1Q82R 4C5EA 3PT9A 2HQHA 3MJXA 1WQ7A 3VS0A 1QP3A 3K7AM 1M3BA 3BFMA 3P8HA 3EG2A 3CMAT 2A28A 5HBJB 3OS2A 1AISB 2RJCA 3QJYA 2PTKA 3HSBA 4I3ZB 4LDUA 1UDLA 1X75C 4GY5A 2K5LA 1YCSB 2EQMA 5FGKB 1ACMB 2RI2A 1QKWA 2KMTA 3CCEA 2BE9B 2DF6A 1KQ1A 4EMHA 1OX9A 4C92E 3CC7T 2DXCB 2RK1A 2XU8A 3M59A 3RBBB 4HLQA 2M9UA 2CP5A 2QI2A 1VQLQ 4LXCA 4BCOB 5GMKl 3EGXA 1OPKA 3CCJT 1TD6A 1BU2A 2D8JA 1Q86R 5I5ZB 5I2MA 2BZ8A 4PK4A 2LCSA 1OGUB 4CFUB 2LQ8A 1VQ8Q 2LCCA 2ZPFB 3JB9H 2VV5A 1PRMC 2G3RA 2LW4A 1E6GA 3G33B 1RI9A 2CZ1B 4K11A 2YT6A 2DNUA 4BCND 1JOWA 4BUGA 4PJOD 4C0GA 4MZMA 5FWCA 3OW2P 2EPDA 1RLQC 1WI7A 4JS5A 2NUTB 1UGSB 1VQMA 4O5VA 4YOSA 4DEYA 1ZX6A 1RADB 1ZQ1A 2G6FX 1KHIA 2BUDA 2XMFA 1G3TA 4IKFA 4VUBA 2QQAA 1ABOA 1RAHB 1VYVA 4KBMB 2HQEA 3MP1A 2EYQA 3GBQA 4O6JA 4FYXB 4XTWA 2CP7A 2CT4A 3JRZA 1NLOC 1WHLA 1YIJA 1QWFA 1GBRA 4CI0C 2LDMA 2RD1A 3OYCA 3TSZA 3EIDB 2RQTA 3CBMA 1SG5A 3HRTA 2HCKA 3CXCA 4FCYA 4QVDA 1KG1A 3I35A 4EONB 3UF4A 2QG9B 3QG1A 1Q82U 2W2HA 5IHNA 3L1AA 3SDZA 3EFOB 4XTXA 4PLLA 3VS7A 1WHHA 2F2CA 2D8HA 2E6ZA 2KVQG 4LUEA 2EJFA 3ZBDA 3FRNA 2MWPA 1SHFA 2JW4A 5HNBB 4BY1X 1AWXA 1H1QB 1VQPA 2DL5A 2HMAA 1E7PA 4RG8A 2RM4A 3VU3C 4F7UB 1K9AA 3CCUQ 3E1SA 4QT7A 3CQTA 4NS5A 1FMKA 4EMKA 2GTJA 2KI7A 5CIUA 3CPFA 5GJWB 2ED1A 1CKBA 4BY6B 2OTLA 1ZLMA 2ZZDA 4BCIB 1NLPC 1ZP2A 3REBB 2LMJA 1I1JA 4MDWA 1UJYA 2BZYA 3VS1A 1M1KC 1Q86U 4M78A 1VQ9Q 1VOMA 1X6OA 2F2WA 4BBRM 1SSFA 4PJNA 1H641 1Y0MA 4RTYA 3TNIB 5DM7R 4QVCA 1LJOA 2P0PA 2LQKA 2MAMA 1RAEB 2DZCA 3OS1A 4M7DA 3LQ5B 3EH2A 3CBPA 1UGQB 1BBZA 3F70A 5KCOA 3G6ET 3MI9B 4M78G 3INZA 3CCVA 2K3BA 4FW2A 5ACBA 1HK9A 2CP6A 3QSUA 2FRWA 4EMGA 3JB9G 4OR5B 5LJ3e 3CMAQ 2RQVA 2PMIB 2PVGB 1F5QB 2LQNA 3HZJA 4AG1C 2WHBB 2KT1A 4M7DG 4BCPB 2C5NB 5KYUA 2RH2A 1OU9A 4C5GA 2ABLA 2YUOA 2NUPA 2R7GA 3VRZA 3CC7Q 2E6NA 1M1FA 3C95A 3CPWS 4BCHB 5D6YA 4X9DA 5GAMe 2DPPB 1U3OA 4J6XA 2KXCA 4N0AA 1R0CB 2KAFA 4PKCC 4AFZC 5A0LA 2L8DA 5LJ3j 1MMGA 3PMIA 3REAB 2OI3A 2PHGA 1K8AC 3OS0A 1LPLA 5LJ3f 2RHUA 5LJ3g 3QYGB 3I56Q 4LD9K 1AEYA 4CXAB 4J8OA 3CCRT 4M75D 3PGGA 5IDPB 4MZPA 4KH1B 2F1LA 3LWIA 2PVDB 4JJNK 1YIJT 1YHQQ 4HNUA 2BKZB 3MY1B 4M4ZA 2UZBB 2XICA 4LDVA 5GAMj 4F16A 4OGRB 5GAMg 2MYSA 4M77A 2YXYA 4LOCA 2LTOA 5IXBA 4BCQB 3JB9J 1O75A 4HT9A 4G6LB 2IN3A 2XIDA 3ZL7C 1W2BS 1M30A 3OSVA 1N4MA 1Y71A 2F2XA 3JCMV 3L2VA 4M77G 1YITQ 1PKSA 4HVUA 2VC8A 1IREB 2FPFA 2CUDA 2KDSA 3URGA 3EH1A 1BI0A 2QA4A 2IVXA 3OYJA 1SHGA 2EQKA 3VS3A 1QVGS 5GAOl 4PFPA 4J6YA 1FX7A 4AFUC 1QMCA 1RUWA 1AWWA 3OBWA 1IRXA 5KYYB 4KGZB 2Z0WA 1H26B 1BIBA 2O9SA 1D3BB 4B9WA 1GFDA 4JJCA 1AZEA 1PSFA 3VYGB 1T0JA 2QASA 2V22B 2VGNA 5J3BA 1VQNQ 3M9QA 1WJSA 2RJDA 3M0QA 4M75E 5CK9A 1FINB 1SRLA 2F2VA 2MCNA 4R55A 5EC7A 4CFUD 5GAOr 1K0XA 3H9NA 1D0ZA 4MMLA 2E3HA 1LVKA 3BDLA 1WX6A 1NYFA 3CMEQ 1M8MA 2MMPA 5GAN3 3JCMW 3X26B 3EAEA 3VJPA 2E70A 4HVWA 3OYNA 1QCNA 2KROA 3HBLA 2QF7A 1QVFS 1C9BA 2E64A 2R57A 1HXDA 4CFWB 3JCMf 3JCMg 1H1RB 1YJNA 1N8RC 2Y4XA 3RNJA 1M9SA 4C8QC 3OY9A 5CO7A 1D1BA 3DL1A 4C0DC 3BLHB 2FO0A 4FW1A 3RMSA 3A8OB 3CCSA 3CCEQ 5HVYB 1OIUB 1QVPA 4OP0A 2J7IA 4ANJA 2DM1A 2DD4B 1IB8A 5LJ3h 2A08A 1PM3A 1WPYA 4ELLA 2QQRA 2HKQB 3OMGA 4HCCA 1TS9A 3M55A 2DYIA 1PWTA 1GUXB 2HSPA 2OAWA 1QCOA 1PG5B 3CBOA 3SWNC 4ZTFA 3PFSA 3U23A 2KXDA 2YRVA 5IHIA 5GAMh 2CZ7B 2AZVA 4Y91A 2CCHB 1QLYA 2MIOA 3QZ5B 4X34A 1UB4A 3BDUA 3EGDB 3UA6A 5A2QE 3A8LB 4MFEA 4OMPA 4JPBW 3VS4A 1JU5C 2DYBA 2QGSA 4C92F 1VQLT 3X25B 4RMOA 1F1BB 1VQMQ 3LGFA 4JJDA 4KGXB 4ESRA 4F14A 3LWHA 2BTTA 2CGHA 2YUPA 3RR6A 2VGMA 1IGUA 2K3YA 3EHRA 3HKSA 1VQ8T 2ZCFB 2JN0A 5GMKi 1HYOA 1WDXA 2KE9A 2PK2A 3CCMA 2NLUA 3I5RA 2ZGWA 1W1FA 4PJMA 5FU7C 1YIJQ 4OMNA 3VUBA 1X01A 2EKOA 3H0FA 2DIGA 2WPAB 3N5BB 6AT1B 2ZPIB 3JCMb 4E7ZA 4ZTJA 1RABB 5CKEA 4QVZA 2FZGB 1T3SA 3OYDA 4JJBA 1GBQA 2HZYA 3VS2A 5GMKe 2LJ1A 2RMOA 3CD6A 4UC4A 1X6GA 3M0SA 3CXCS 1Y96A 2HL3A 4PJJA 2IIMA 3JCMc 2EQJA 2DO3A 3MPUB 4PNOA 3E2UA 2OTJA 2FL7A 4M7AA 1EZZB 1NJIR 2C5XB 2JMAA 4C8QG 2RJFA 3QIIA 3UWNA 1VQ5T 2EQIA 2X3WD 4OB3B 1YI2A 2CJMB 3LH0A 3X20B 2C0OA 2KYBA 4FIBA 5CVIA 1VQPQ 2WXVB 2KY9A 4RUGA 4B9XA 3C94A 3OYIA 4JRKA 4F7LB 3GLXA 4M7AG 3JCMh 2CSIA 1XJWB 4EPCA 4AKGA 1W70A 4OMOA 4AMCA 3BHTB 2HBWA 1N5ZA 4C0ZA 1QMZB 3GIBA 3C4SA 1JJ2A 1WFWA 3S3OA 4F7UE 1M8VA 3H8ZA 2LQWA 1OX8A 1U1TA 3UA7A 1UHCA 1C0MA 1E7OA 4J9BA 4DOWA 1BI2A 2P4RA 3ME9A 4J9DA 1X2QA 4F04B 4E7LA 1WGSA 4X9CA 1VOLA 4E47A 5CEIB 4ME7A 1Z9QA 5AYFA 4PJOF 1CKAA 3L2UA 3CCVQ 4DEXA 5KYWB 1BU1A 3RDVA 4AFSC 2EGCA 2JT4A 4XTUA 1VYTA 3RMQA 3HB9A 1VQ9T 3BG3A 1Y57A 3QDFA 3G1JA 4BCQD 1BI1A 1RAAB 4ROEA 2DTIA 1Q86C 4NC6A 3OQ5A 1VQKA 9ATCB 3ASKA 2MF2A 1I07A 1U06A 2EKHA 3WXMB 4QSHA 4OMQA 3TCJA 1I5LA 1PSEA 2CT3A 1MMNA 2COYA 2ZPHB 1X2KA 2FEIA 1FXXA 1N9SA 3C12A 1SF9A 1PRLC 1M2VA 3MY5B 2GCXA 4HKEA 4M78B 1TOVA 4AKIA 4KUIA 1VQ7A 1KIKA 2WIHB 4MIMA 3J80E 2CDTA 2E65A 4KT0E 1AWJA 4OMLA 1W4SA 1BKBA 3CCLA 1M2OA 2SRCA 2VVKA 2JTMA 1OIYB 1GXIE 4HNTA 1LCKA 4FYWB 2F5TX 2YLBA 2CREA 4M7DB 3NTKA 3QYEA 2GQVA 1Y7XA 2P0KA 1NZ9A 1H3HA 2BIVA 4OB0B 1TFBA 2WIPB 3CD6T 1H4LD 4EOPB 1S1NA 3I56T 3FB9A 2EAYA 3QWXX 1IXDA 1PHTA 5GANe 1JQQA 5LL6S 3HPWA 3MEVA 5I2SA 1YNZA 3P8DA 4IUUA 3EOCB 2FZCB 1V29B 4E7SA 1YHQT 4EMKC 4JX6A 1VA7A 2KYMA 1T0HA 2E10A 5GMKh 2LX7A 4E6RA 4ZN3A 2QA4Q 1ENWA 2AHJB 4J9IA 1GL5A 2GNCA 3OW2S 4KRTA 3CCQA 3MP8A 4CFXB 4CFMB 2DEQA 3CC4A 3LX7A 3QUIA 4M78C 2L5QA 2PU9B 4JRPA 1Q81R 2WFYB 2PNIA 3RKWA 4LD6A 4XU0A 2LRQA 5GANg 1JO8A 3EG9B 3DDPB 2DXUA 2UZDB 3X24B 4PFZA 1YITT 2HQXA 1VQ5Q 5GMKm 4M7DC 1Q7YC 3A98A 4EOKB 2H8HA 4HCKA 4E7HA 5KYNA 3BLRB 1H25B 3TREA 2JS2A 1VQ4T 4F6WB 1VIEA 2KSSA 2E5QA 2ATCB 4RTXA 5KYXB 3PVLA 3UDCA 3TW7A 4ZN1A 1H8KA 5HK0A 3JCMX 3OMCA 3OA6A 2XK0A 4Y92A 1GY3B 4J5YA 3S6WA 3MEAA 5GAOq 1VQNT 2K2VA 1P5EB 2FPEA 2LVMA 1O9KA 4OB1B 1YJNQ 1UNGD 2WMAB 2V1RA 4M75A 4Q5WA 1KD1R 2MK5A 4EC9B 2G9XB 4II5B 2YSQA 3I5SA 3HRUA 4N0AC 4M75F 4ELZC 1V1CA 3QPHA 2L3SA 3MCAB 3EG1A 1KQSA 4JZ3A 1AD5A 4PJOE 2A37A 3CC2T 3CMET 4IIMA 5L2WB 1I81A 2C5OB 1MMDA 1TTHB 1URCB 3HO8A 3V8JA 3VYHB 4KRCB 1AVZC 5EFQB 1ZUKA 2XG8D 4A4HA 4AT1B 3A8HB 1XQHA 1Y07A 2JVVA 4ELYC 2DETA 3T9NA 2EJ9A 4A4KA 4CRIA 1YCYA 2CP2A 2O9VA 2CH4A 4M77C 4JRIA 4X1VA 5HQ0B 3PIOA 2DEUA 3IQLA 1LOJA 1XNIA 4JX5A 3CEYA 2V8KA 3QYBA 4IUTA 1H28B 1AOJA 4RTVA 3CCET 3NPFA 1H1PB 1D0YA 5LQFB 2L3QA 1NM7A 4J9FA 4RCBA 2ENMA 3G71A 4DBHA 4MMKA 5IN1A 1X69A 3O0GD 1WJQA 1E6HA 1NPRA 3L2QA 2M16A 2ESWA 3ULRB 3V7CA 1IHWA 5D6WA 4AFQC 3VKGA 1ZUYA 3QKJA 2DTHA 3PE0A 3I55A 1Q81U 2RHYA 2IW8B 2GF7A 4J7FA 1VYUA 3VRYA 1JEGA 2DXCA 2K3XA 5IAYA 1TH7A 3OB9A 1UEBA 3L42A 3M58A 2YWWA 2HNIA 2SEMA 5L8RE 1G83A 4A53A 2EUFA 2EGAA 4GBQA 3OYKA 3R6OA 3CCQT 1SRMA 4BDYA 5GANh 3BE3A 2MOXA 1VQMT 4D8DA 2DXBA 4BB7A 3OYAA 3CD6Q 4AI6A 2YRCA 1K9MR 2QXFA 1AWOA 1ARKA 1P92A 2E12A 2I53A 2OJ2A 5A0GA 2OTJQ 1SEMA 3FJ5A 1S72A 5DQVA 1M1KR 2RA2A 2XDDA 1KD1U 1PNJA 2R5MA 2I2LA 4XU1A 2ZPBB 1YI2Q 2I0NA 4FM4B 2M51A 2DA9A 3S3NA 3VKIA 2GTOA 2DD5A 5GAMf 3OYYA 2A7YA 1QP2A 4HCZA 3EGUA 3DLLA 3FEOA 4QW2A 3GPLA 1M90R 2FRYA 2QEXA 2HAXA 3VV0A 1I5OB 3BY7A 2LCLA 5LJ5e 1RAGB 1T3LA 1U8RA 2AIRB 5CAIA 1M27C 1X43A 5HCKA 2E5KA 4BCMB 1I0CA 2ROTA 4EOJB 4QQGA 2D6FA 3EG3A 4XTZA 1UJ0A 1JJ2P 5CKFA 5DQWA 4C8QB 1VQPT 1VQ4Q 1M5Q1 1KQ2A 4V2SA 2MPXC 2HSEB 2IW6B 2JNGA 2VXEA 3EFOA 4M78D 4Z8AA 3TN8B 4C0DB 3M03A 1PD0A 2RO0A 4JRQA 1OI1A 3JCMP 3G4SA 2OTLT 3JB9D 4F7NB 1UG1A 2XHCA 3QHWB 2UUEB 4DBRA 2P84A 1ZA1B 3Q1JA 5HKCA 2RQWA 4M7AB 4M7DD 1GCPA 1BB9A 4RTWA 1K8AR 3LGLA 1OL2B 4C92C 1OYXA 2ECZA 2DJQA 2KNBB 3OYFA 3SWNB 1FYNA 4AKHA 2X51A 1ABQA 3DLMA 4F7UF 1PKDB 2CUBA 1BCOA 4LDWA 1VQKQ 2DXTA 3J81E 4DBFA 1AHJB 1KHCA 4QKUA 1MHNA 2O4XB 2FZKB 3QHRB 2LNVA 3CC2Q 1M3CA 1K73C 2DTOA 4NSTB 3NHNA 2K79A 3L2ZA 2KT8A 4PL6A 3CCVT 3BW1A 4R0KA 5J39A 2QGGA 1NE8A 2PK9B 3NDQA 4M6VA 1K9MU 3QZ9B 1X27A 2RQUA 4QQDA 5FRMA 5FLXE 3PTAA 2JS0A 4ZGEB 1QCFA 2DKGA 1V76A 1VQ7Q 1M1KU 4EORB 3CCLQ 2JXBA 4R56A 1VUBA 4HA8A 2YDLA 3RGFB 1U5SA 4F7JB 1IGQA 1KC8C 2LP5A 2V1QA 5FU7B 4E7KA 3MEUA 2MWOA 5CR2A 4WCIA 5FW9A 2WACA 4M7AC 4XQ3A 5KCHA 1M90U 4IIOA 1RI0A 4JUVA 2COWA 2EGEA 4OVAA 1WNLA 1YFNA 3CCUA 2H3JA 2O2OA 1OI9B 4CFNB 2A36A 1GH6B 3QWLA 2RN8A 2M02A 1FWZA 1D1AA 5DY9A 3THKA 4LDXA 2W10A 1G8XA 3M0PA 1OL1B 3BHUB 2D0QB 1D09B 2DMOA 1FMVA 4C92A 2EW3A 2KMGA 2RK2A 2ZPEB 4LDYA 3CCQQ 2HDAA 5FU6C 4FYYB 2NYSA 4DA4A 3NTIA 2EIFA 3WVEB 5LJ3d 2XD0A 3CC4Q 3FC3A 4E7JA 4HXJA 4KRDB 3SHWA 1OKVB 4EOMB 3H0IA 2NUZA 2XKOC 4C92G 1G2BA 1VQ6A 2L89A 5C0MA 1K8AU 2LT1A 3NGPA 4Z88A 1JXMA 5GAMd 2QA4T 2M0OA 2BE7D 7AT1B 4KULA 3GNGA 4N4GA 3NMZC 2A3LA 5IXFA 1ZBJA 4IMYB 2EYZA 1ZUUA 5HK3A 1D0XA 5M9OA 2DMEA 3EGXB 3DJBA 4Z02A 4XTYA 4J9GA 3LYIA 1VIFA 2DFUA 3KBGA 3CC7A 1R77A 2LZ6B 1Q95G 3HL8A 4A54A 1ZBXA 4BCGB 4RG2A 4D6WA 2GQIA 1N6AA 2VWFA 2KRMA 3O5ZA 3OYHA 2RPNA 2DAQA 4E7IA 3CCJA 5GMKj 2RQRA 2J05A 2B8AA 3FJPA 1UFFA 2CCIB 2OTLQ 2GFUA 1B3QA 1BYMA 4F70B 1WIEA 3V7RA 1KQSS 1KQSP 5C6SA 4GLKA 3UATA 4TTHA 1TSFA 3MKDA 4Z6YA 1G3YA 3LW5E 1KK7A 1Q82C 4BBSM 1YJNT 4OMFB 1WHMA 1MV3A 3B57A 2DL3A 3DB4A 1W2BA 4JLGA 2J6OA 1BCMA 1WYXA 3CCST 4P5NA 4XTVA 1RL2A 4PJOA 2DVEA 4JX4A 5J26A 2BS3A 4RKUE 4EOLB 4E2FB 1LNXA 1NBEB 3HTRA 2JM9A 1QVGA 2C4GB 2X4XA 3TQ7P 1VYWB 1GCQA 4HL4A 1RAFB 3QO3A 3JCMd 1GRIA 2CP0A 3I55Q 1N9RA 2J06A 1TU0B 2QGFB 2DD4A 4HNVA 2I40B 2VUBA 3HRSA 1OULA 4NOYA 4PJOG 3ZFJA 1B7TA 2ZPGB 2JJ9A 1WHKA 1UUEA 2W99A 1OQKA 1TWBA 2V26A 2EWNA 4EMKB 2FB7A 1WJRA 1ZA2B 2FYKA 1OZ2A 4BCMD 3X28B 4BE2A 4XK8E 2ZZDB 2VYTA 1QW1A 2DL4A 1NEBA 3TVTA 4BD3A 3JV3A 1UGPB 4CC7A 4C8QD 2WSEE 4NL3A 4FT2A 4FSSA 2FVUA 2JUFA 1NJIU 3M0TA 1S72Q 1K1ZA 1QVFA 2BKDN 1OV3A 3CCMT 2PUKB 1IZ6A 2RI3A 2JM8A 4BE0A 3RESA 3AHUA 4M7AD 1YJ9A 5GAN6 4C5HA 2O31A 2HD0A 3M0UA 2QQBA 2QEXQ 2EJGA 3A8GB 3OYMA 1JRIA 2DIQA 1NG2A 4M75C 3FLGA 2PZ1A 3JCMJ 3QBYA 1HD3A 3A5ZB 1BIAA 4EC8B 3GTMS 3NTHA 1TUCA 2Y4YA 2OTJT 5EJCA 2C0IA 5EG2A 3TW6A 4L6V5 1OU8A 4F7SB 5KYUB 3G6EA 1I8FA 1EX4A 1YI2T 2KRSA 1ZSZA 2EYYA 1AT1B 1HSQA 2IVWA 2NUPB 4XU2A 1BI3A 2QFZA 2XDPA 2O88A 1WXBA 1KD1C 2WSCE 3AT1B 4HT8A 4DQ2A 1YJWA 2CP3A 2XI9A 3EFRA 2DXBB 2E4HA 2HKNA 2DILA 2JZ2A 3G4SQ 2OAUA 1KJWA 3DOGB 1HJDA 5GANj 1O9SA 3UPUA 4ROCA 3EFSA 5GANf 3META 4FYVB 2IW9B 2YUNA 4C8QE 2B86A 4OMMA 1UNLD 2RF0A 2DL7A 1YWOA 3V8KA 2L3RA 3EJ1B 3SEMA 3TNWB 2YUQA 5GAN5 1XO2A 5DLQE 2QAZA 2DD5B 2RHXA 3L2WA 4M77B 1B34A 3VKHA 1D3UB 2QTXA 2QQSA 1FKMA 3CCRA 1PKTA 1PCXA 4M7AE 2DVJA 4PFOA 4HCBA 2LNHB 2LJ0A 3EG0A 1ZHIA 2A0FB 5GJVB 1YP5A 4FSXA 2RJEA 3M54A 2XDBA 1R0BG 2MI6A 1VINA 2L2PA 2UZLB 3MHXA 5DLOA 1QWEA 4EOIB 2KBTA 4PJLA 5CQXA 1JSTB 4YOZA 1JBMA 5IHYA 1OZ3A 4XAXB 4ZNXA 2VASA 4EIKA 1VQKT 3CCSQ 4BACA 5KYWA 4EOOB 4L59A 2J6FA 5HBEB 4OF1A 3QYHB 4ORZA 5IHKA 5CYIB 4YOOA 1H92A 3J7AF 4M75G 2CZ6B 4BI4A 4EOQB 2WSFE 3M5AA 4DOVA 4N4IA 2EBPA 3RUXA 1K0SA 4OGEA 5L23A 3DDQB 2D0NA 1SPKA 8ATCB 5KE2A 2JTEA 1VQ7T 3KXTA 1K9MC 3TNHB 3CCLT 1UHFA 3GOXA 2IPOB 1WHJA 1JSUB 2V8IA 4BXXX 1G3WA 5IF1B 2EYXA 3GP8A 4F6SB 1MNEA 1Q7YR 2DK3A 5CKDA 3BLQB 1B07A 2X4YA 2CZ0B 3LLRA 1YJ9T 4UN0A 1MUZA 2PVOB 5GAN2 2EVRA 2BS4A 4BI8B 2EQUA 4M78F 4KUDK 1RACB 1WQWA 3OSSC 1M90C 4ATOA 3JB9F 2K4YA 2C0TA 1ZSGA 3GNFB 3PIPA 2P4TA 1VQ6Q 2QDJA 3BG9A 2X3XD 3QHSA 3CCMQ 1UGVA 4L5GA 5A0DA 4IUVA 4M7DF 3QDRB 1KFZA 4QQ6A 5IH2A 2LJ3A 5AT1B 1W6XA 3SB2A 2YHTA 2K5IA 5BNJB 1OEBA 3OBYA 1VQOA 4CFVB 1YJWT 1JB0E 3CC4T 2K6DA 3FIFA 2W96A 2KEAA 4J9CA 2QK0A 5D6XA 3M4YA 4BY6C 3TEEA 2GBQA 1NPPA 3DTOA 3CPWP 3OYGA 2H3EB 2K5FA 2HBPA 5GAN7 2WEVB 2NUTA 1H27B 1JKWA 2COZA 3M0RA 4C92B 2G77A 5CCAA 2DJZA 1XOVA 3CCJQ 4BE1A 3HP9A 1A0NB 4OGCA 2C6TB 3EG9A 1X6BA 2DLPA 1K4US 2JTFA 4RODA 5ICPB 5LMKB 2FG0A 2DRMA 2C5VB 1YN8A 5GANd 5GAOp 4FT4A 4ZGDB 3HFOA 2X1NB 1WXUA 3M4GA 4LUDA 2R5AA 1MNDA 4YC3B 3RIRA 1VQLA 2ROLA 4IURA 4Y28E 5CKHA 1JJ2S 5KYXA 2W0ZA 4M77F 3H0HA 2YLCA 2EYWA 2ZAEA 1UECA 2M1HA 2UZEB 1E9HB 2W9ZA 4BI3A 2PJQA 2KRNA 3JCMQ 4IUPA 2AZSA 1OKWB 1W2BP 4ZGJB 1Q7YU 1VQ8A 4F6UB 3MO8A 5LJ5j 4BY7X 3V8LA 2AT1B 1FVVB 5IT9E 4BCFB 3VS5A 5LJ5f 5LJ5g 1Y96B 2WMBB 3OW2A 3H4CA 4JLIA 2K2MA 2LC4A 3KUFA 4F7UA 1QVGP 4RTUA 3UT1A 5ECAA 4MDXA 2AKKA 4EDUA 1BK2A 1NEGA 4BDZA 2M0YA 2LX9A 2L3PA 1SKUB 5GAN4 4J7IA 2CS7A 1WLPB 1KXUA 2D9TA 3RERA 3G71T 1M3AA 1MV0B 3BHVB 2JGZB 4JZ4A 3JCMe 4RCCA 1OOTA 5FWBA 4F7UG 5HBHB 2J6KA 1VQ5A 3KHIA 1G3NC 3E9FA 1IHVA 5FU6B 2QYZA 2D1XA 5GAOm 1WHGA 3ZEHA 3I55T 1W98B 4CC2A 3PVQA 3QJ6A 1YBYA 4KGVB 3ER0A 2KR6A 1IO6A 3D7SB 2FPDA 3E9GA 2RNAA 1PD1A 1NYGA 4C5IA 1YWPA 4BCNB 1QVFP 3VUZA 3E19A 1XTDA 3GF5A 4PJOB 2K57A 2K7AA 3H41A 4FU6A 2AK5A 1YJ9Q 1JXOA 4M78E 3I9QA 4BCJB 1VQOT 3A1PA 2W9FA 3H6ZA 5FROA 1RLPC 3JAME 3MEWA 3NFCA 4NL2A 4M77D
chains in the Genus database with same CATH topology
5J26A 3PMIA 5GMKm 4M7DC 2BS3A 4RKUE 1K8AC 3OS0A 5LJ3f 1Q7YC 2RHUA 5LJ3g 3QYGB 4J6WA 4LD9K 4M7DE 1LNXA 1S72T 1G3SA 4E7HA 4N4HA 1QVGA 2X4XA 4J8OA 3TREA 3CCRT 3QO3A 4M75D 4HL4A 3PGGA 1VQ4T 3JCMd 1VIEA 4MZPA 2QQ9A 2KSSA 2E5QA 3LWIA 2PVDB 4JJNK 1NJIC 2FHDA 1YIJT 4HNUA 1N9RA 3SFMA 1M4ZA 3M53A 3UDCA 3TW7A 1MGQA 3OS5A 2XICA 4LDVA 4ZN1A 5GAMj 2DD4A 4HNVA 2VUBA 3DB3A 3HRSA 4NOYA 3OMCA 4PJOG 3ZFJA 5HK0A 3JCMX 3OA6A 1VQ9A 2XK0A 5GAOn 2ZPGB 3JSCA 2PUOB 5GAMg 4M77A 2RHZA 4LOCA 4J5YA 1I4K1 4TVRA 2QEXT 3S6WA 2LTOA 3M56A 3MEAA 4A4FA 5GAOq 1VQNT 2K2VA 3JB9J 1O75A 2QDYB 4OB1B 2EWNA 2LVMA 4EMKB 4HT9A 4M75A 2FB7A 1WJRA 4Q5WA 2FYKA 1OZ2A 3HFNA 2X4WA 3X28B 4BE2A 2XIDA 4A4GA 4XK8E 2F69A 2C06A 2ZZDB 2LT4A 2VYTA 3HRUA 4N0AC 1U1SA 4M75F 1QW1A 4ELZC 5CKBA 1W2BS 3A8MB 3QPHA 3QXEB 2JOYA 3OSVA 5KE3A 1Y71A 2E41A 4PJOC 4BD3A 3MCAB 3JCMV 3L2VA 1UGPB 4M77G 1KQSA 4C8QD 2WSEE 4PJOE 2VC8A 1IREB 4NL3A 4FT2A 3CC2T 3CMET 1I81A 2KDSA 3RKYA 3URGA 1BI0A 4II1A 5LJ5h 4XU3A 3CMAA 2FVUA 2JUFA 2QA4A 1NJIU 5GAN8 3OYJA 2EQKA 5I21A 1QVFA 3HO8A 4ELJA 2BKDN 3V8JA 3CCMT 3VYHB 2EFIA 2PUKB 1QVGS 1IZ6A 2RI3A 5GAOl 2XG8D 2F5KA 4A4HA 3A8HB 4J6YA 3G4ST 1FX7A 1XQHA 1Y07A 2JVVA 4ELYC 3JB9I 3CPWA 4BE0A 3RESA 3T9NA 3AHUA 2EJ9A 4M7AD 2QQ8A 4A4KA 1N27A 3DKMA 3OBWA 1YCYA 4CRIA 1YJ9A 5GAN6 4C0FA 4C5HA 4M77C 4JRIA 3PIOA 1LOJA 1BIBA 4JX5A 1XNIA 2HD0A 3CEYA 3FDRA 4C8QA 1D3BB 2PQWA 2V8KA 4M77E 3QYBA 4B9WA 4IUTA 3L2RA 1PSFA 3VYGB 2QQBA 3CCET 2V8JA 2EJGA 3A8GB 3OYMA 2VGNA 1JRIA 2DIQA 5J3BA 4RCBA 4M75C 3FLGA 2IG0A 4C8QF 1QLBA 3G71A 3QBYA 3JCMJ 3M9QA 4MMKA 4MFDA 1WJSA 5IN1A 3A5ZB 2RJDA 4M75E 1BIAA 5CK9A 2CKKA 3NTHA 1WJQA 2Y4YA 1NPRA 2VXFA 5EJCA 3I56A 2M16A 3L2QA 2OTJT 1D3BA 3V7SA 2Y90A 3V7CA 3BG5A 5EG2A 3TW6A 5D6WA 3VYGA 4R55A 4PLIA 3VKGA 4L6V5 3G6EA 1I8FA 4MZTA 5LJ5d 1YI2T 4J83A 5GAOr 3QKJA 2DTHA 4MMLA 3I55A 2IVWA 1Q81U 2RHYA 1YHQA 5KH6A 3BDLA 1BI3A 2GF7A 2RHIA 4J7FA 4XU2A 2QFZA 1M1GA 4M7AF 3SWNA 2DXCA 2MMPA 2X4JA 2XDPA 5GAN3 2K3XA 3P8BB 1TH7A 3X26B 3EAEA 5IAYA 3JCMW 3OB9A 2WSCE 3TU4K 1UEBA 1KD1C 3VJPA 2E70A 4HT8A 3OYNA 3O8VA 4DQ2A 5FRNA 1YJWA 3HBLA 2QF7A 3L42A 3M58A 1EIFA 1QVFS 2E64A 2HNIA 2R57A 2DXBB 2XI9A 3EFRA 1HXDA 5L8RE 2R58A 3JCMf 2JZ2A 2O4XA 3JCMg 2OAUA 4A53A 1YJNA 5GANj 1N8RC 2Y4XA 1O9SA 4IUQA 3UPUA 3EFSA 1M9SA 4C8QC 4A4EA 3OYKA 5GANf 3META 3OY9A 5CO7A 3R6OA 3CCQT 4WF2A 2CYZB 4C8QE 1B34B 4BDYA 5GANh 3DL1A 4C0DC 3RKXA 3RMSA 1VQMT 3A8OB 2DXBA 3CCSA 2X35A 4BB7A 3V8KA 2L3RA 3OYAA 4AI6A 1QVPA 4OP0A 2QXFA 2RI5A 5GAN5 1YITA 1P92A 3HHTB 2E12A 2DD4B 5DLQE 3SD4A 5LJ3h 2DD5B 4FL6A 2RHXA 5A0GA 1WPYA 3L2WA 4M77B 2QQRA 1G5VA 1S72A 1B34A 3VKHA 2DZ9A 3OMGA 4C92D 2QTXA 2QQSA 1FKMA 4HCCA 3M55A 3CCRA 4OB2B 2GFAA 1VQ4A 1K73U 4M7AE 2RA2A 3CCUT 3PNWC 2XDDA 1KD1U 4HCBA 2R5MA 1R8OB 1ZHIA 2ZPBB 2I2LA 4JDSA 4XU1A 4FM4B 3CBOA 4M75B 3SWNC 3S3NA 4ZTFA 2O01E 3VKIA 3PFSA 3OYBA 2KQWA 2DD5A 5GAMf 4FSXA 3OYYA 2A7YA 5HY6A 1QP2A 1H3ZA 4HCZA 3DLLA 2YRVA 2P0QA 2RJEA 3M54A 5GAMh 3OYEA 3FEOA 2XDBA 2RB6A 1N8RU 2MI6A 2CZ7B 4QW2A 3GPLA 2OTJA 2E1HA 4Y91A 1DJ7B 3M57A 3MHXA 3QZ5B 2QEXA 5DLOA 2HAXA 3OYLA 4X34A 5CQXA 3VV0A 1VQNA 3BY7A 3MP6A 1UB4A 2LCLA 5LJ5e 3S3MA 1JBMA 1U8RA 2WJ9A 1OZ3A 3BDUA 4XAXB 4MFEA 3A8LB 5A2QE 1KC8U 5CAIA 1VQKT 4JS4A 2KK4A 2BS2A 4C92F 4BACA 1VQLT 3X25B 4L59A 4RMOA 1UGRB 3WVDB 4YTLA 3LGFA 4QQGA 4OF1A 2D6FA 3PMTA 4XTZA 3QYHB 3G7ZA 3LWHA 2CGHA 3CC2A 3CMEA 1VQ6T 3J7AF 4M75G 2CZ6B 5CKFA 5CQYA 4BI4A 2VGMA 1Q81C 4C8QB 1VQPT 1KQ2A 1M5Q1 4V2SA 2K3YA 3HKSA 2JNGA 2VXEA 1VQ8T 2WSFE 3M5AA 4DOVA 4C5EA 2ZCFB 2JN0A 4N4IA 5GMKi 3PT9A 4M78D 4C0DB 3CCMA 3RUXA 2NLUA 5FU7C 2ZGWA 1WQ7A 4OGEA 4JRQA 2RO0A 3VUBA 1QP3A 1OI1A 1X01A 2EKOA 3JCMP 3G4SA 2DIGA 3N5BB 3BFMA 3P8HA 3JB9D 2OTLT 5KE2A 2XHCA 3CMAT 1VQ7T 3OS2A 2ZPIB 3JCMb 3KXTA 1K9MC 2RJCA 3QJYA 4ZTJA 3CCLT 5CKEA 3HSBA 3GOXA 4QVZA 4LDUA 3Q1JA 5HKCA 2V8IA 1X75C 4GY5A 2K5LA 1G3WA 4M7AB 2EQMA 3OYDA 4M7DD 3GP8A 5GMKe 2RI2A 2KMTA 3LGLA 4C92C 3CCEA 1KQ1A 2DK3A 1OYXA 3CD6A 4EMHA 5CKDA 3OYFA 4UC4A 4C92E 1YJ9T 2X4YA 2CZ0B 3LLRA 4AKHA 3SWNB 1Y96A 3CXCS 2DXCB 3DLMA 3CC7T 4F7UF 3JCMc 2EQJA 2PVOB 2DO3A 5GAN2 4PNOA 2RK1A 2XU8A 3M59A 4HLQA 2M9UA 2FL7A 2DXTA 4LDWA 2BS4A 3J81E 4BI8B 2QI2A 4M7AA 2EQUA 1AHJB 4M78F 4C8QG 1KHCA 4KUDK 2RJFA 3QIIA 1MHNA 2O4XB 5GMKl 1WQWA 3UWNA 1VQ5T 2LNVA 4OB3B 3OSSC 1YI2A 1M90C 3CCJT 1K73C 2DTOA 2K4YA 3LH0A 3JB9F 4ATOA 3X20B 4FIBA 4M7DF 5I2MA 3L2ZA 5CVIA 3GNFB 3PIPA 2P4TA 4PL6A 3CCVT 3BW1A 2QDJA 5J39A 2LQ8A 1NE8A 3BG9A 3QHSA 2KY9A 2LCCA 4B9XA 4L5GA 3C94A 4M6VA 2ZPFB 5A0DA 4IUVA 3OYIA 1K9MU 4JRKA 3QZ9B 3GLXA 3QDRB 3JB9H 2VV5A 4QQ6A 2G3RA 4QQDA 4M7AG 5FRMA 3SB2A 3JCMh 5FLXE 4NL2A 2CZ1B 3PTAA 2YHTA 2K5IA 4ZGEB 2DKGA 4EPCA 4AKGA 3OBYA 4BUGA 4PJOD 1VQOA 4C0GA 1M1KU 4C0ZA 1YJWT 4MZMA 4R56A 1VUBA 4HA8A 3GIBA 3C4SA 1JB0E 3CC4T 1JJ2A 3S3OA 3FIFA 4JS5A 1KC8C 4F7UE 1M8VA 5LJ3j 1UGSB 1VQMA 3H8ZA 4O5VA 5FU7B 5D6XA 4E7KA 3M4YA 3MEUA 4BY6C 2MWOA 1U1TA 1ZQ1A 3TEEA 5CR2A 1NPPA 1KHIA 2BUDA 2WACA 4M7AC 4DOWA 1BI2A 3OYGA 4XQ3A 5KCHA 1G3TA 3ME9A 4VUBA 1M90U 2QQAA 4IKFA 2K5FA 4E7LA 4KBMB 1WGSA 2HBPA 2HQEA 3MP1A 1RI0A 4JUVA 2EYQA 4X9CA 5GAN7 4OVAA 4O6JA 1WNLA 4XTWA 3JRZA 3CCUA 1YIJA 4C92B 2G77A 2H3JA 5CCAA 2DJZA 1XOVA 4E47A 4BE1A 3HP9A 4CI0C 2LDMA 3QWLA 2RD1A 3OYCA 4ME7A 4PJOA 1FWZA 5AYFA 4OGCA 4PJOF 3L2UA 5DY9A 4LDXA 3CBMA 3HRTA 2JTFA 2D0QB 3CXCA 4XTUA 4C92A 4QVDA 3RMQA 3HB9A 5GANd 1VQ9T 5GAOp 4FT4A 1KG1A 3BG3A 4ZGDB 3HFOA 2KMGA 2RK2A 4M77D 2ZPEB 3QG1A 4LDYA 1BI1A 1Q82U 5FU6C 2DTIA 4DA4A 3M4GA 1Q86C 3L1AA 3SDZA 4NC6A 3OQ5A 2R5AA 4XTXA 4PLLA 3NTIA 2EIFA 3RIRA 1VQKA 3ASKA 3WVEB 5LJ3d 2MF2A 2E6ZA 2KVQG 1VQLA 2XD0A 4IURA 4Y28E 5CKHA 3FC3A 2EJFA 3ZBDA 4E7JA 1JJ2S 3WXMB 4M77F 4QSHA 2YLCA 2M1HA 3FRNA 3TCJA 2MWPA 4BI3A 1I5LA 1PSEA 2XKOC 4C92G 2ZPHB 3JCMQ 4IUPA 1VQ6A 2L89A 5C0MA 1K8AU 1VQPA 4ZGJB 1Q7YU 1VQ8A 2LT1A 1E7PA 3MO8A 2RM4A 4RG8A 3VU3C 4F7UB 5LJ5j 1FXXA 1N9SA 3E1SA 3C12A 3V8LA 4NS5A 4EMKA 5GAMd 2QA4T 5IT9E 5LJ5f 2GCXA 5CIUA 4HKEA 1Y96B 2M0OA 3CPFA 5LJ5g 4M78B 3OW2A 3H4CA 4BY6B 2OTLA 4AKIA 4JLIA 4KUIA 4KULA 1VQ7A 2ZZDA 3GNGA 4N4GA 2A3LA 2LC4A 4MIMA 3J80E 2E65A 4KT0E 4MDWA 3CCLA 1W4SA 1BKBA 3KUFA 4F7UA 3UT1A 5HK3A 4MDXA 1M1KC 5M9OA 4EDUA 1Q86U 2JTMA 1GXIE 4HNTA 4M78A 4XTYA 4Z02A 2F5TX 2LX9A 2YLBA 1VIFA 3LYIA 1X6OA 3KBGA 4BDZA 4M7DB 4BBRM 1SSFA 3NTKA 5GAN4 3CC7A 3QYEA 2GQVA 1H641 1Y7XA 2CS7A 2P0KA 3HL8A 4J7IA 4A54A 1NZ9A 2D9TA 1ZBXA 3RERA 2BIVA 3G71T 5DM7R 4OB0B 4QVCA 4RG2A 1LJOA 4D6WA 3CD6T 3JCMe 1N6AA 4RCCA 2P0PA 2LQKA 2MAMA 3OYHA 2DAQA 3FB9A 2EAYA 2DZCA 4F7UG 3I56T 3OS1A 4M7DA 1VQ5A 3KHIA 4E7IA 3CCJA 3CBPA 3E9FA 5GANe 5LL6S 1UGQB 3F70A 3HPWA 5KCOA 3G6ET 3MEVA 5I2SA 3P8DA 5GMKj 4M78G 5FU6B 3INZA 2B8AA 4IUUA 3CCVA 1V29B 3FJPA 5GAOm 3ZEHA 3I55T 1YHQT 1HK9A 4EMKC 4JX6A 3QSUA 3QJ6A 4EMGA 1YBYA 2E10A 3ER0A 5GMKh 3JB9G 5LJ3e 2GFUA 1BYMA 4ZN3A 3V7RA 1KQSS 2KR6A 5C6SA 2PVGB 4GLKA 2AHJB 3E9GA 3OW2S 3HZJA 4Z6YA 3MP8A 1G3YA 3LW5E 3CCQA 4M7DG 2DEQA 4C5IA 2RH2A 4C5GA 1Q82C 4BBSM 1YJNT 3VUZA 3E19A 1XTDA 3CC4A 3GF5A 3LX7A 4PJOB 3QUIA 2K57A 4M78C 4FU6A 2L5QA 4OMFB 2PU9B 4JRPA 2E6NA 3DB4A 4M78E 1M1FA 3C95A 3CPWS 3RKWA 5D6YA 4X9DA 5GAMe 1VQOT 1W2BA 2DPPB 4JLGA 4LD6A 4J6XA 4XU0A 2LRQA 5GANg 3CCST 3H6ZA 5FROA 2DXUA 4N0AA 4P5NA 2KAFA 3JAME 3X24B 3MEWA 3NFCA 4PKCC 2HQXA 1RL2A 4XTVA 5A0LA 2L8DA 2DVEA 1YITT 4JX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVE B;  2DXC A;  4RKU E;  3X26 B;  4Y28 E;  2WSC E;  3QYG B;  1PSE A;  2DXB B;  5L8R E;  2ZPH B;  2CZ0 B;  2DXC B;  2PVD B;  2PVO B;  4ZGJ B;  2DD4 A;  1AHJ B;  2CYZ B;  2ZPG B;  2PUO B;  2DXB A;  3A8O B;  4OB3 B;  2ZZD A;  3X20 B;  3HHT B;  4KT0 E;  2DD4 B;  2QDY B;  4OB1 B;  2DD5 B;  2ZPF B;  3X28 B;  3QZ9 B;  4XK8 E;  1GXI E;  2ZZD B;  4OB2 B;  3A8M B;  2CZ1 B;  3QXE B;  2ZPB B;  4ZGE B;  4FM4 B;  1UGP B;  2O01 E;  2WSE E;  2DD5 A;  4OB0 B;  1IRE B;  1QP2 A;  1JB0 E;  2CZ7 B;  1UGS B;  1DJ7 B;  3QZ5 B;  3VYH B;  2PUK B;  1UGQ B;  3A8H B;  1V29 B;  3A8L B;  3X25 B;  1UGR B;  3WVD B;  2PVG B;  2AHJ B;  1PSF A;  3VYG B;  3A8G B;  3QYH B;  3LW5 E;  2CZ6 B;  2D0Q B;  2WSF E;  2PU9 B;  2ZCF B;  3VYG A;  2DPP B;  4L6V 5;  4ZGD B;  1QP3 A;  2ZPE B;  2ZPI B;  3X24 B; 
#chains in the Genus database with same CATH topology
 1MMA A;  4LN2 A;  1SSH A;  4J6W A;  4M7D E;  1S72 T;  1AD6 A;  1G3S A;  2K9G A;  4N4H A;  3C0C A;  3G6E Q;  1QKX A;  3QWY A;  4RTT A;  2QQ9 A;  2VB6 A;  1NJI C;  2FHD A;  3SFM A;  1M4Z A;  3M53 A;  2KGT A;  1MGQ A;  3OS5 A;  2ED0 A;  3DB3 A;  3POM A;  2DX1 A;  4AG2 C;  1VQ9 A;  5GAO n;  3JSC A;  1EFN A;  2PUO B;  1YJW Q;  1OPL A;  2RHZ A;  1I4K 1;  4TVR A;  2QEX T;  3M56 A;  4A4F A;  2DRK A;  1K73 R;  2QDY B;  1M2V B;  2BPM B;  3HFN A;  2X4W A;  4BCK B;  4A4G A;  2F69 A;  2C06 A;  2LT4 A;  1U1S A;  5CKB A;  3A8M B;  5KE3 A;  3QXE B;  2JOY A;  4RTZ A;  2E41 A;  4PJO C;  2HL5 C;  1N8R R;  4KH0 B;  1TUD A;  2DE0 X;  1C6V X;  3RKY A;  5LJ5 h;  4II1 A;  4XU3 A;  3CMA A;  1GCQ C;  5GAN 8;  5I21 A;  1H24 B;  1J3T A;  4CC3 A;  4ELJ A;  3CCR Q;  1KC8 R;  2EFI A;  5I22 A;  2NWM A;  4HVV A;  2F5K A;  3G4S T;  3CPW A;  3JB9 I;  2QQ8 A;  1N27 A;  3DKM A;  4C0F A;  4CRL B;  4A63 B;  2DBK A;  4D8K A;  4C8Q A;  3FDR A;  2PQW A;  1RAI B;  4M77 E;  3L2R A;  3KFV A;  3MIA B;  2V8J A;  1K76 A;  2IG0 A;  4C8Q F;  1QLB A;  1ZSZ B;  1UE9 A;  4MFD A;  8AT1 B;  2BZX A;  1TUG B;  2VKN A;  5KYY A;  2CKK A;  2VXF A;  2E3I A;  3I56 A;  3CXC P;  1D3B A;  3V7S A;  2Y90 A;  3BG5 A;  3VYG A;  4PLI A;  4EOS B;  4MZT A;  1TXQ A;  5LJ5 d;  4J83 A;  1D1C A;  1YHQ A;  5KH6 A;  4J9E A;  2RHI A;  4M7A F;  1M1G A;  3SWN A;  2X4J A;  2HEQ A;  3P8B B;  4GLM A;  3TU4 K;  1TG0 A;  3O8V A;  1C1A A;  5FRN A;  1EIF A;  1WXT A;  2R58 A;  2O4X A;  2YRD A;  1FMW A;  4IUQ A;  1WA7 A;  1H1S B;  4A4E A;  4WF2 A;  2DBM A;  2CYZ B;  1B34 B;  3RKX A;  3PO3 S;  3G71 Q;  2JMC A;  2X35 A;  1KSW A;  4B6M A;  4WTO B;  2KR3 A;  2AKL A;  2RI5 A;  1YIT A;  3HHT B;  2GGR A;  3SD4 A;  4FL6 A;  1WZO A;  1G5V A;  4C92 D;  2DZ9 A;  4CC4 B;  4OB2 B;  4Y72 B;  2GFA A;  1VQ4 A;  1K73 U;  2DL8 A;  1ZSZ C;  5D7U A;  3CCU T;  3PNW C;  1O9K B;  1AZG B;  1R8O B;  4JDS A;  3F5X B;  4M75 B;  3EHQ A;  2O01 E;  3OYB A;  2KQW A;  2DER A;  5HY6 A;  1H3Z A;  4LE9 A;  4DBQ A;  2P0Q A;  3OYE A;  2RB6 A;  1N8R U;  1PC0 A;  1GFC A;  2E1H A;  1GUX A;  1DJ7 B;  3M57 A;  2CSQ A;  3OYL A;  5IDN B;  1VQN A;  3MP6 A;  1QQJ A;  4F17 A;  1CSK A;  3R6N A;  3S3M A;  2X9H A;  1Z9Z A;  2WJ9 A;  1VQO Q;  1KC8 U;  5I11 A;  1UTI A;  4J9H A;  1UNH D;  2KK4 A;  2BS2 A;  3LH5 A;  4JS4 A;  1UGR B;  2OX7 A;  3WVD B;  4YTL A;  3PMT A;  3G7Z A;  2QTV A;  2CH4 W;  3VS6 A;  2L0A A;  2B9R A;  3EGD A;  2QDL A;  3CME A;  3CC2 A;  1VQ6 T;  5CQY A;  4LNP A;  1Q81 C;  3TSW A;  4Z89 A;  4FX3 B;  1Q82 R;  4C5E A;  3PT9 A;  2HQH A;  3MJX A;  1WQ7 A;  3VS0 A;  1QP3 A;  3K7A M;  1M3B A;  3BFM A;  3P8H A;  3EG2 A;  3CMA T;  2A28 A;  5HBJ B;  3OS2 A;  1AIS B;  2RJC A;  3QJY A;  2PTK A;  3HSB A;  4I3Z B;  4LDU A;  1UDL A;  1X75 C;  4GY5 A;  2K5L A;  1YCS B;  2EQM A;  5FGK B;  1ACM B;  2RI2 A;  1QKW A;  2KMT A;  3CCE A;  2BE9 B;  2DF6 A;  1KQ1 A;  4EMH A;  1OX9 A;  4C92 E;  3CC7 T;  2DXC B;  2RK1 A;  2XU8 A;  3M59 A;  3RBB B;  4HLQ A;  2M9U A;  2CP5 A;  2QI2 A;  1VQL Q;  4LXC A;  4BCO B;  5GMK l;  3EGX A;  1OPK A;  3CCJ T;  1TD6 A;  1BU2 A;  2D8J A;  1Q86 R;  5I5Z B;  5I2M A;  2BZ8 A;  4PK4 A;  2LCS A;  1OGU B;  4CFU B;  2LQ8 A;  1VQ8 Q;  2LCC A;  2ZPF B;  3JB9 H;  2VV5 A;  1PRM C;  2G3R A;  2LW4 A;  1E6G A;  3G33 B;  1RI9 A;  2CZ1 B;  4K11 A;  2YT6 A;  2DNU A;  4BCN D;  1JOW A;  4BUG A;  4PJO D;  4C0G A;  4MZM A;  5FWC A;  3OW2 P;  2EPD A;  1RLQ C;  1WI7 A;  4JS5 A;  2NUT B;  1UGS B;  1VQM A;  4O5V A;  4YOS A;  4DEY A;  1ZX6 A;  1RAD B;  1ZQ1 A;  2G6F X;  1KHI A;  2BUD A;  2XMF A;  1G3T A;  4IKF A;  4VUB A;  2QQA A;  1ABO A;  1RAH B;  1VYV A;  4KBM B;  2HQE A;  3MP1 A;  2EYQ A;  3GBQ A;  4O6J A;  4FYX B;  4XTW A;  2CP7 A;  2CT4 A;  3JRZ A;  1NLO C;  1WHL A;  1YIJ A;  1QWF A;  1GBR A;  4CI0 C;  2LDM A;  2RD1 A;  3OYC A;  3TSZ A;  3EID B;  2RQT A;  3CBM A;  1SG5 A;  3HRT A;  2HCK A;  3CXC A;  4FCY A;  4QVD A;  1KG1 A;  3I35 A;  4EON B;  3UF4 A;  2QG9 B;  3QG1 A;  1Q82 U;  2W2H A;  5IHN A;  3L1A A;  3SDZ A;  3EFO B;  4XTX A;  4PLL A;  3VS7 A;  1WHH A;  2F2C A;  2D8H A;  2E6Z A;  2KVQ G;  4LUE A;  2EJF A;  3ZBD A;  3FRN A;  2MWP A;  1SHF A;  2JW4 A;  5HNB B;  4BY1 X;  1AWX A;  1H1Q B;  1VQP A;  2DL5 A;  2HMA A;  1E7P A;  4RG8 A;  2RM4 A;  3VU3 C;  4F7U B;  1K9A A;  3CCU Q;  3E1S A;  4QT7 A;  3CQT A;  4NS5 A;  1FMK A;  4EMK A;  2GTJ A;  2KI7 A;  5CIU A;  3CPF A;  5GJW B;  2ED1 A;  1CKB A;  4BY6 B;  2OTL A;  1ZLM A;  2ZZD A;  4BCI B;  1NLP C;  1ZP2 A;  3REB B;  2LMJ A;  1I1J A;  4MDW A;  1UJY A;  2BZY A;  3VS1 A;  1M1K C;  1Q86 U;  4M78 A;  1VQ9 Q;  1VOM A;  1X6O A;  2F2W A;  4BBR M;  1SSF A;  4PJN A;  1H64 1;  1Y0M A;  4RTY A;  3TNI B;  5DM7 R;  4QVC A;  1LJO A;  2P0P A;  2LQK A;  2MAM A;  1RAE B;  2DZC A;  3OS1 A;  4M7D A;  3LQ5 B;  3EH2 A;  3CBP A;  1UGQ B;  1BBZ A;  3F70 A;  5KCO A;  3G6E T;  3MI9 B;  4M78 G;  3INZ A;  3CCV A;  2K3B A;  4FW2 A;  5ACB A;  1HK9 A;  2CP6 A;  3QSU A;  2FRW A;  4EMG A;  3JB9 G;  4OR5 B;  5LJ3 e;  3CMA Q;  2RQV A;  2PMI B;  2PVG B;  1F5Q B;  2LQN A;  3HZJ A;  4AG1 C;  2WHB B;  2KT1 A;  4M7D G;  4BCP B;  2C5N B;  5KYU A;  2RH2 A;  1OU9 A;  4C5G A;  2ABL A;  2YUO A;  2NUP A;  2R7G A;  3VRZ A;  3CC7 Q;  2E6N A;  1M1F A;  3C95 A;  3CPW S;  4BCH B;  5D6Y A;  4X9D A;  5GAM e;  2DPP B;  1U3O A;  4J6X A;  2KXC A;  4N0A A;  1R0C B;  2KAF A;  4PKC C;  4AFZ C;  5A0L A;  2L8D A;  5LJ3 j;  1MMG A;  3PMI A;  3REA B;  2OI3 A;  2PHG A;  1K8A C;  3OS0 A;  1LPL A;  5LJ3 f;  2RHU A;  5LJ3 g;  3QYG B;  3I56 Q;  4LD9 K;  1AEY A;  4CXA B;  4J8O A;  3CCR T;  4M75 D;  3PGG A;  5IDP B;  4MZP A;  4KH1 B;  2F1L A;  3LWI A;  2PVD B;  4JJN K;  1YIJ T;  1YHQ Q;  4HNU A;  2BKZ B;  3MY1 B;  4M4Z A;  2UZB B;  2XIC A;  4LDV A;  5GAM j;  4F16 A;  4OGR B;  5GAM g;  2MYS A;  4M77 A;  2YXY A;  4LOC A;  2LTO A;  5IXB A;  4BCQ B;  3JB9 J;  1O75 A;  4HT9 A;  4G6L B;  2IN3 A;  2XID A;  3ZL7 C;  1W2B S;  1M30 A;  3OSV A;  1N4M A;  1Y71 A;  2F2X A;  3JCM V;  3L2V A;  4M77 G;  1YIT Q;  1PKS A;  4HVU A;  2VC8 A;  1IRE B;  2FPF A;  2CUD A;  2KDS A;  3URG A;  3EH1 A;  1BI0 A;  2QA4 A;  2IVX A;  3OYJ A;  1SHG A;  2EQK A;  3VS3 A;  1QVG S;  5GAO l;  4PFP A;  4J6Y A;  1FX7 A;  4AFU C;  1QMC A;  1RUW A;  1AWW A;  3OBW A;  1IRX A;  5KYY B;  4KGZ B;  2Z0W A;  1H26 B;  1BIB A;  2O9S A;  1D3B B;  4B9W A;  1GFD A;  4JJC A;  1AZE A;  1PSF A;  3VYG B;  1T0J A;  2QAS A;  2V22 B;  2VGN A;  5J3B A;  1VQN Q;  3M9Q A;  1WJS A;  2RJD A;  3M0Q A;  4M75 E;  5CK9 A;  1FIN B;  1SRL A;  2F2V A;  2MCN A;  4R55 A;  5EC7 A;  4CFU D;  5GAO r;  1K0X A;  3H9N A;  1D0Z A;  4MML A;  2E3H A;  1LVK A;  3BDL A;  1WX6 A;  1NYF A;  3CME Q;  1M8M A;  2MMP A;  5GAN 3;  3JCM W;  3X26 B;  3EAE A;  3VJP A;  2E70 A;  4HVW A;  3OYN A;  1QCN A;  2KRO A;  3HBL A;  2QF7 A;  1QVF S;  1C9B A;  2E64 A;  2R57 A;  1HXD A;  4CFW B;  3JCM f;  3JCM g;  1H1R B;  1YJN A;  1N8R C;  2Y4X A;  3RNJ A;  1M9S A;  4C8Q C;  3OY9 A;  5CO7 A;  1D1B A;  3DL1 A;  4C0D C;  3BLH B;  2FO0 A;  4FW1 A;  3RMS A;  3A8O B;  3CCS A;  3CCE Q;  5HVY B;  1OIU B;  1QVP A;  4OP0 A;  2J7I A;  4ANJ A;  2DM1 A;  2DD4 B;  1IB8 A;  5LJ3 h;  2A08 A;  1PM3 A;  1WPY A;  4ELL A;  2QQR A;  2HKQ B;  3OMG A;  4HCC A;  1TS9 A;  3M55 A;  2DYI A;  1PWT A;  1GUX B;  2HSP A;  2OAW A;  1QCO A;  1PG5 B;  3CBO A;  3SWN C;  4ZTF A;  3PFS A;  3U23 A;  2KXD A;  2YRV A;  5IHI A;  5GAM h;  2CZ7 B;  2AZV A;  4Y91 A;  2CCH B;  1QLY A;  2MIO A;  3QZ5 B;  4X34 A;  1UB4 A;  3BDU A;  3EGD B;  3UA6 A;  5A2Q E;  3A8L B;  4MFE A;  4OMP A;  4JPB W;  3VS4 A;  1JU5 C;  2DYB A;  2QGS A;  4C92 F;  1VQL T;  3X25 B;  4RMO A;  1F1B B;  1VQM Q;  3LGF A;  4JJD A;  4KGX B;  4ESR A;  4F14 A;  3LWH A;  2BTT A;  2CGH A;  2YUP A;  3RR6 A;  2VGM A;  1IGU A;  2K3Y A;  3EHR A;  3HKS A;  1VQ8 T;  2ZCF B;  2JN0 A;  5GMK i;  1HYO A;  1WDX A;  2KE9 A;  2PK2 A;  3CCM A;  2NLU A;  3I5R A;  2ZGW A;  1W1F A;  4PJM A;  5FU7 C;  1YIJ Q;  4OMN A;  3VUB A;  1X01 A;  2EKO A;  3H0F A;  2DIG A;  2WPA B;  3N5B B;  6AT1 B;  2ZPI B;  3JCM b;  4E7Z A;  4ZTJ A;  1RAB B;  5CKE A;  4QVZ A;  2FZG B;  1T3S A;  3OYD A;  4JJB A;  1GBQ A;  2HZY A;  3VS2 A;  5GMK e;  2LJ1 A;  2RMO A;  3CD6 A;  4UC4 A;  1X6G A;  3M0S A;  3CXC S;  1Y96 A;  2HL3 A;  4PJJ A;  2IIM A;  3JCM c;  2EQJ A;  2DO3 A;  3MPU B;  4PNO A;  3E2U A;  2OTJ A;  2FL7 A;  4M7A A;  1EZZ B;  1NJI R;  2C5X B;  2JMA A;  4C8Q G;  2RJF A;  3QII A;  3UWN A;  1VQ5 T;  2EQI A;  2X3W D;  4OB3 B;  1YI2 A;  2CJM B;  3LH0 A;  3X20 B;  2C0O A;  2KYB A;  4FIB A;  5CVI A;  1VQP Q;  2WXV B;  2KY9 A;  4RUG A;  4B9X A;  3C94 A;  3OYI A;  4JRK A;  4F7L B;  3GLX A;  4M7A G;  3JCM h;  2CSI A;  1XJW B;  4EPC A;  4AKG A;  1W70 A;  4OMO A;  4AMC A;  3BHT B;  2HBW A;  1N5Z A;  4C0Z A;  1QMZ B;  3GIB A;  3C4S A;  1JJ2 A;  1WFW A;  3S3O A;  4F7U E;  1M8V A;  3H8Z A;  2LQW A;  1OX8 A;  1U1T A;  3UA7 A;  1UHC A;  1C0M A;  1E7O A;  4J9B A;  4DOW A;  1BI2 A;  2P4R A;  3ME9 A;  4J9D A;  1X2Q A;  4F04 B;  4E7L A;  1WGS A;  4X9C A;  1VOL A;  4E47 A;  5CEI B;  4ME7 A;  1Z9Q A;  5AYF A;  4PJO F;  1CKA A;  3L2U A;  3CCV Q;  4DEX A;  5KYW B;  1BU1 A;  3RDV A;  4AFS C;  2EGC A;  2JT4 A;  4XTU A;  1VYT A;  3RMQ A;  3HB9 A;  1VQ9 T;  3BG3 A;  1Y57 A;  3QDF A;  3G1J A;  4BCQ D;  1BI1 A;  1RAA B;  4ROE A;  2DTI A;  1Q86 C;  4NC6 A;  3OQ5 A;  1VQK A;  9ATC B;  3ASK A;  2MF2 A;  1I07 A;  1U06 A;  2EKH A;  3WXM B;  4QSH A;  4OMQ A;  3TCJ A;  1I5L A;  1PSE A;  2CT3 A;  1MMN A;  2COY A;  2ZPH B;  1X2K A;  2FEI A;  1FXX A;  1N9S A;  3C12 A;  1SF9 A;  1PRL C;  1M2V A;  3MY5 B;  2GCX A;  4HKE A;  4M78 B;  1TOV A;  4AKI A;  4KUI A;  1VQ7 A;  1KIK A;  2WIH B;  4MIM A;  3J80 E;  2CDT A;  2E65 A;  4KT0 E;  1AWJ A;  4OML A;  1W4S A;  1BKB A;  3CCL A;  1M2O A;  2SRC A;  2VVK A;  2JTM A;  1OIY B;  1GXI E;  4HNT A;  1LCK A;  4FYW B;  2F5T X;  2YLB A;  2CRE A;  4M7D B;  3NTK A;  3QYE A;  2GQV A;  1Y7X A;  2P0K A;  1NZ9 A;  1H3H A;  2BIV A;  4OB0 B;  1TFB A;  2WIP B;  3CD6 T;  1H4L D;  4EOP B;  1S1N A;  3I56 T;  3FB9 A;  2EAY A;  3QWX X;  1IXD A;  1PHT A;  5GAN e;  1JQQ A;  5LL6 S;  3HPW A;  3MEV A;  5I2S A;  1YNZ A;  3P8D A;  4IUU A;  3EOC B;  2FZC B;  1V29 B;  4E7S A;  1YHQ T;  4EMK C;  4JX6 A;  1VA7 A;  2KYM A;  1T0H A;  2E10 A;  5GMK h;  2LX7 A;  4E6R A;  4ZN3 A;  2QA4 Q;  1ENW A;  2AHJ B;  4J9I A;  1GL5 A;  2GNC A;  3OW2 S;  4KRT A;  3CCQ A;  3MP8 A;  4CFX B;  4CFM B;  2DEQ A;  3CC4 A;  3LX7 A;  3QUI A;  4M78 C;  2L5Q A;  2PU9 B;  4JRP A;  1Q81 R;  2WFY B;  2PNI A;  3RKW A;  4LD6 A;  4XU0 A;  2LRQ A;  5GAN g;  1JO8 A;  3EG9 B;  3DDP B;  2DXU A;  2UZD B;  3X24 B;  4PFZ A;  1YIT T;  2HQX A;  1VQ5 Q;  5GMK m;  4M7D C;  1Q7Y C;  3A98 A;  4EOK B;  2H8H A;  4HCK A;  4E7H A;  5KYN A;  3BLR B;  1H25 B;  3TRE A;  2JS2 A;  1VQ4 T;  4F6W B;  1VIE A;  2KSS A;  2E5Q A;  2ATC B;  4RTX A;  5KYX B;  3PVL A;  3UDC A;  3TW7 A;  4ZN1 A;  1H8K A;  5HK0 A;  3JCM X;  3OMC A;  3OA6 A;  2XK0 A;  4Y92 A;  1GY3 B;  4J5Y A;  3S6W A;  3MEA A;  5GAO q;  1VQN T;  2K2V A;  1P5E B;  2FPE A;  2LVM A;  1O9K A;  4OB1 B;  1YJN Q;  1UNG D;  2WMA B;  2V1R A;  4M75 A;  4Q5W A;  1KD1 R;  2MK5 A;  4EC9 B;  2G9X B;  4II5 B;  2YSQ A;  3I5S A;  3HRU A;  4N0A C;  4M75 F;  4ELZ C;  1V1C A;  3QPH A;  2L3S A;  3MCA B;  3EG1 A;  1KQS A;  4JZ3 A;  1AD5 A;  4PJO E;  2A37 A;  3CC2 T;  3CME T;  4IIM A;  5L2W B;  1I81 A;  2C5O B;  1MMD A;  1TTH B;  1URC B;  3HO8 A;  3V8J A;  3VYH B;  4KRC B;  1AVZ C;  5EFQ B;  1ZUK A;  2XG8 D;  4A4H A;  4AT1 B;  3A8H B;  1XQH A;  1Y07 A;  2JVV A;  4ELY C;  2DET A;  3T9N A;  2EJ9 A;  4A4K A;  4CRI A;  1YCY A;  2CP2 A;  2O9V A;  2CH4 A;  4M77 C;  4JRI A;  4X1V A;  5HQ0 B;  3PIO A;  2DEU A;  3IQL A;  1LOJ A;  1XNI A;  4JX5 A;  3CEY A;  2V8K A;  3QYB A;  4IUT A;  1H28 B;  1AOJ A;  4RTV A;  3CCE T;  3NPF A;  1H1P B;  1D0Y A;  5LQF B;  2L3Q A;  1NM7 A;  4J9F A;  4RCB A;  2ENM A;  3G71 A;  4DBH A;  4MMK A;  5IN1 A;  1X69 A;  3O0G D;  1WJQ A;  1E6H A;  1NPR A;  3L2Q A;  2M16 A;  2ESW A;  3ULR B;  3V7C A;  1IHW A;  5D6W A;  4AFQ C;  3VKG A;  1ZUY A;  3QKJ A;  2DTH A;  3PE0 A;  3I55 A;  1Q81 U;  2RHY A;  2IW8 B;  2GF7 A;  4J7F A;  1VYU A;  3VRY A;  1JEG A;  2DXC A;  2K3X A;  5IAY A;  1TH7 A;  3OB9 A;  1UEB A;  3L42 A;  3M58 A;  2YWW A;  2HNI A;  2SEM A;  5L8R E;  1G83 A;  4A53 A;  2EUF A;  2EGA A;  4GBQ A;  3OYK A;  3R6O A;  3CCQ T;  1SRM A;  4BDY A;  5GAN h;  3BE3 A;  2MOX A;  1VQM T;  4D8D A;  2DXB A;  4BB7 A;  3OYA A;  3CD6 Q;  4AI6 A;  2YRC A;  1K9M R;  2QXF A;  1AWO A;  1ARK A;  1P92 A;  2E12 A;  2I53 A;  2OJ2 A;  5A0G A;  2OTJ Q;  1SEM A;  3FJ5 A;  1S72 A;  5DQV A;  1M1K R;  2RA2 A;  2XDD A;  1KD1 U;  1PNJ A;  2R5M A;  2I2L A;  4XU1 A;  2ZPB B;  1YI2 Q;  2I0N A;  4FM4 B;  2M51 A;  2DA9 A;  3S3N A;  3VKI A;  2GTO A;  2DD5 A;  5GAM f;  3OYY A;  2A7Y A;  1QP2 A;  4HCZ A;  3EGU A;  3DLL A;  3FEO A;  4QW2 A;  3GPL A;  1M90 R;  2FRY A;  2QEX A;  2HAX A;  3VV0 A;  1I5O B;  3BY7 A;  2LCL A;  5LJ5 e;  1RAG B;  1T3L A;  1U8R A;  2AIR B;  5CAI A;  1M27 C;  1X43 A;  5HCK A;  2E5K A;  4BCM B;  1I0C A;  2ROT A;  4EOJ B;  4QQG A;  2D6F A;  3EG3 A;  4XTZ A;  1UJ0 A;  1JJ2 P;  5CKF A;  5DQW A;  4C8Q B;  1VQP T;  1VQ4 Q;  1M5Q 1;  1KQ2 A;  4V2S A;  2MPX C;  2HSE B;  2IW6 B;  2JNG A;  2VXE A;  3EFO A;  4M78 D;  4Z8A A;  3TN8 B;  4C0D B;  3M03 A;  1PD0 A;  2RO0 A;  4JRQ A;  1OI1 A;  3JCM P;  3G4S A;  2OTL T;  3JB9 D;  4F7N B;  1UG1 A;  2XHC A;  3QHW B;  2UUE B;  4DBR A;  2P84 A;  1ZA1 B;  3Q1J A;  5HKC A;  2RQW A;  4M7A B;  4M7D D;  1GCP A;  1BB9 A;  4RTW A;  1K8A R;  3LGL A;  1OL2 B;  4C92 C;  1OYX A;  2ECZ A;  2DJQ A;  2KNB B;  3OYF A;  3SWN B;  1FYN A;  4AKH A;  2X51 A;  1ABQ A;  3DLM A;  4F7U F;  1PKD B;  2CUB A;  1BCO A;  4LDW A;  1VQK Q;  2DXT A;  3J81 E;  4DBF A;  1AHJ B;  1KHC A;  4QKU A;  1MHN A;  2O4X B;  2FZK B;  3QHR B;  2LNV A;  3CC2 Q;  1M3C A;  1K73 C;  2DTO A;  4NST B;  3NHN A;  2K79 A;  3L2Z A;  2KT8 A;  4PL6 A;  3CCV T;  3BW1 A;  4R0K A;  5J39 A;  2QGG A;  1NE8 A;  2PK9 B;  3NDQ A;  4M6V A;  1K9M U;  3QZ9 B;  1X27 A;  2RQU A;  4QQD A;  5FRM A;  5FLX E;  3PTA A;  2JS0 A;  4ZGE B;  1QCF A;  2DKG A;  1V76 A;  1VQ7 Q;  1M1K U;  4EOR B;  3CCL Q;  2JXB A;  4R56 A;  1VUB A;  4HA8 A;  2YDL A;  3RGF B;  1U5S A;  4F7J B;  1IGQ A;  1KC8 C;  2LP5 A;  2V1Q A;  5FU7 B;  4E7K A;  3MEU A;  2MWO A;  5CR2 A;  4WCI A;  5FW9 A;  2WAC A;  4M7A C;  4XQ3 A;  5KCH A;  1M90 U;  4IIO A;  1RI0 A;  4JUV A;  2COW A;  2EGE A;  4OVA A;  1WNL A;  1YFN A;  3CCU A;  2H3J A;  2O2O A;  1OI9 B;  4CFN B;  2A36 A;  1GH6 B;  3QWL A;  2RN8 A;  2M02 A;  1FWZ A;  1D1A A;  5DY9 A;  3THK A;  4LDX A;  2W10 A;  1G8X A;  3M0P A;  1OL1 B;  3BHU B;  2D0Q B;  1D09 B;  2DMO A;  1FMV A;  4C92 A;  2EW3 A;  2KMG A;  2RK2 A;  2ZPE B;  4LDY A;  3CCQ Q;  2HDA A;  5FU6 C;  4FYY B;  2NYS A;  4DA4 A;  3NTI A;  2EIF A;  3WVE B;  5LJ3 d;  2XD0 A;  3CC4 Q;  3FC3 A;  4E7J A;  4HXJ A;  4KRD B;  3SHW A;  1OKV B;  4EOM B;  3H0I A;  2NUZ A;  2XKO C;  4C92 G;  1G2B A;  1VQ6 A;  2L89 A;  5C0M A;  1K8A U;  2LT1 A;  3NGP A;  4Z88 A;  1JXM A;  5GAM d;  2QA4 T;  2M0O A;  2BE7 D;  7AT1 B;  4KUL A;  3GNG A;  4N4G A;  3NMZ C;  2A3L A;  5IXF A;  1ZBJ A;  4IMY B;  2EYZ A;  1ZUU A;  5HK3 A;  1D0X A;  5M9O A;  2DME A;  3EGX B;  3DJB A;  4Z02 A;  4XTY A;  4J9G A;  3LYI A;  1VIF A;  2DFU A;  3KBG A;  3CC7 A;  1R77 A;  2LZ6 B;  1Q95 G;  3HL8 A;  4A54 A;  1ZBX A;  4BCG B;  4RG2 A;  4D6W A;  2GQI A;  1N6A A;  2VWF A;  2KRM A;  3O5Z A;  3OYH A;  2RPN A;  2DAQ A;  4E7I A;  3CCJ A;  5GMK j;  2RQR A;  2J05 A;  2B8A A;  3FJP A;  1UFF A;  2CCI B;  2OTL Q;  2GFU A;  1B3Q A;  1BYM A;  4F70 B;  1WIE A;  3V7R A;  1KQS S;  1KQS P;  5C6S A;  4GLK A;  3UAT A;  4TTH A;  1TSF A;  3MKD A;  4Z6Y A;  1G3Y A;  3LW5 E;  1KK7 A;  1Q82 C;  4BBS M;  1YJN T;  4OMF B;  1WHM A;  1MV3 A;  3B57 A;  2DL3 A;  3DB4 A;  1W2B A;  4JLG A;  2J6O A;  1BCM A;  1WYX A;  3CCS T;  4P5N A;  4XTV A;  1RL2 A;  4PJO A;  2DVE A;  4JX4 A;  5J26 A;  2BS3 A;  4RKU E;  4EOL B;  4E2F B;  1LNX A;  1NBE B;  3HTR A;  2JM9 A;  1QVG A;  2C4G B;  2X4X A;  3TQ7 P;  1VYW B;  1GCQ A;  4HL4 A;  1RAF B;  3QO3 A;  3JCM d;  1GRI A;  2CP0 A;  3I55 Q;  1N9R A;  2J06 A;  1TU0 B;  2QGF B;  2DD4 A;  4HNV A;  2I40 B;  2VUB A;  3HRS A;  1OUL A;  4NOY A;  4PJO G;  3ZFJ A;  1B7T A;  2ZPG B;  2JJ9 A;  1WHK A;  1UUE A;  2W99 A;  1OQK A;  1TWB A;  2V26 A;  2EWN A;  4EMK B;  2FB7 A;  1WJR A;  1ZA2 B;  2FYK A;  1OZ2 A;  4BCM D;  3X28 B;  4BE2 A;  4XK8 E;  2ZZD B;  2VYT A;  1QW1 A;  2DL4 A;  1NEB A;  3TVT A;  4BD3 A;  3JV3 A;  1UGP B;  4CC7 A;  4C8Q D;  2WSE E;  4NL3 A;  4FT2 A;  4FSS A;  2FVU A;  2JUF A;  1NJI U;  3M0T A;  1S72 Q;  1K1Z A;  1QVF A;  2BKD N;  1OV3 A;  3CCM T;  2PUK B;  1IZ6 A;  2RI3 A;  2JM8 A;  4BE0 A;  3RES A;  3AHU A;  4M7A D;  1YJ9 A;  5GAN 6;  4C5H A;  2O31 A;  2HD0 A;  3M0U A;  2QQB A;  2QEX Q;  2EJG A;  3A8G B;  3OYM A;  1JRI A;  2DIQ A;  1NG2 A;  4M75 C;  3FLG A;  2PZ1 A;  3JCM J;  3QBY A;  1HD3 A;  3A5Z B;  1BIA A;  4EC8 B;  3GTM S;  3NTH A;  1TUC A;  2Y4Y A;  2OTJ T;  5EJC A;  2C0I A;  5EG2 A;  3TW6 A;  4L6V 5;  1OU8 A;  4F7S B;  5KYU B;  3G6E A;  1I8F A;  1EX4 A;  1YI2 T;  2KRS A;  1ZSZ A;  2EYY A;  1AT1 B;  1HSQ A;  2IVW A;  2NUP B;  4XU2 A;  1BI3 A;  2QFZ A;  2XDP A;  2O88 A;  1WXB A;  1KD1 C;  2WSC E;  3AT1 B;  4HT8 A;  4DQ2 A;  1YJW A;  2CP3 A;  2XI9 A;  3EFR A;  2DXB B;  2E4H A;  2HKN A;  2DIL A;  2JZ2 A;  3G4S Q;  2OAU A;  1KJW A;  3DOG B;  1HJD A;  5GAN j;  1O9S A;  3UPU A;  4ROC A;  3EFS A;  5GAN f;  3MET A;  4FYV B;  2IW9 B;  2YUN A;  4C8Q E;  2B86 A;  4OMM A;  1UNL D;  2RF0 A;  2DL7 A;  1YWO A;  3V8K A;  2L3R A;  3EJ1 B;  3SEM A;  3TNW B;  2YUQ A;  5GAN 5;  1XO2 A;  5DLQ E;  2QAZ A;  2DD5 B;  2RHX A;  3L2W A;  4M77 B;  1B34 A;  3VKH A;  1D3U B;  2QTX A;  2QQS A;  1FKM A;  3CCR A;  1PKT A;  1PCX A;  4M7A E;  2DVJ A;  4PFO A;  4HCB A;  2LNH B;  2LJ0 A;  3EG0 A;  1ZHI A;  2A0F B;  5GJV B;  1YP5 A;  4FSX A;  2RJE A;  3M54 A;  2XDB A;  1R0B G;  2MI6 A;  1VIN A;  2L2P A;  2UZL B;  3MHX A;  5DLO A;  1QWE A;  4EOI B;  2KBT A;  4PJL A;  5CQX A;  1JST B;  4YOZ A;  1JBM A;  5IHY A;  1OZ3 A;  4XAX B;  4ZNX A;  2VAS A;  4EIK A;  1VQK T;  3CCS Q;  4BAC A;  5KYW A;  4EOO B;  4L59 A;  2J6F A;  5HBE B;  4OF1 A;  3QYH B;  4ORZ A;  5IHK A;  5CYI B;  4YOO A;  1H92 A;  3J7A F;  4M75 G;  2CZ6 B;  4BI4 A;  4EOQ B;  2WSF E;  3M5A A;  4DOV A;  4N4I A;  2EBP A;  3RUX A;  1K0S A;  4OGE A;  5L23 A;  3DDQ B;  2D0N A;  1SPK A;  8ATC B;  5KE2 A;  2JTE A;  1VQ7 T;  3KXT A;  1K9M C;  3TNH B;  3CCL T;  1UHF A;  3GOX A;  2IPO B;  1WHJ A;  1JSU B;  2V8I A;  4BXX X;  1G3W A;  5IF1 B;  2EYX A;  3GP8 A;  4F6S B;  1MNE A;  1Q7Y R;  2DK3 A;  5CKD A;  3BLQ B;  1B07 A;  2X4Y A;  2CZ0 B;  3LLR A;  1YJ9 T;  4UN0 A;  1MUZ A;  2PVO B;  5GAN 2;  2EVR A;  2BS4 A;  4BI8 B;  2EQU A;  4M78 F;  4KUD K;  1RAC B;  1WQW A;  3OSS C;  1M90 C;  4ATO A;  3JB9 F;  2K4Y A;  2C0T A;  1ZSG A;  3GNF B;  3PIP A;  2P4T A;  1VQ6 Q;  2QDJ A;  3BG9 A;  2X3X D;  3QHS A;  3CCM Q;  1UGV A;  4L5G A;  5A0D A;  4IUV A;  4M7D F;  3QDR B;  1KFZ A;  4QQ6 A;  5IH2 A;  2LJ3 A;  5AT1 B;  1W6X A;  3SB2 A;  2YHT A;  2K5I A;  5BNJ B;  1OEB A;  3OBY A;  1VQO A;  4CFV B;  1YJW T;  1JB0 E;  3CC4 T;  2K6D A;  3FIF A;  2W96 A;  2KEA A;  4J9C A;  2QK0 A;  5D6X A;  3M4Y A;  4BY6 C;  3TEE A;  2GBQ A;  1NPP A;  3DTO A;  3CPW P;  3OYG A;  2H3E B;  2K5F A;  2HBP A;  5GAN 7;  2WEV B;  2NUT A;  1H27 B;  1JKW A;  2COZ A;  3M0R A;  4C92 B;  2G77 A;  5CCA A;  2DJZ A;  1XOV A;  3CCJ Q;  4BE1 A;  3HP9 A;  1A0N B;  4OGC A;  2C6T B;  3EG9 A;  1X6B A;  2DLP A;  1K4U S;  2JTF A;  4ROD A;  5ICP B;  5LMK B;  2FG0 A;  2DRM A;  2C5V B;  1YN8 A;  5GAN d;  5GAO p;  4FT4 A;  4ZGD B;  3HFO A;  2X1N B;  1WXU A;  3M4G A;  4LUD A;  2R5A A;  1MND A;  4YC3 B;  3RIR A;  1VQL A;  2ROL A;  4IUR A;  4Y28 E;  5CKH A;  1JJ2 S;  5KYX A;  2W0Z A;  4M77 F;  3H0H A;  2YLC A;  2EYW A;  2ZAE A;  1UEC A;  2M1H A;  2UZE B;  1E9H B;  2W9Z A;  4BI3 A;  2PJQ A;  2KRN A;  3JCM Q;  4IUP A;  2AZS A;  1OKW B;  1W2B P;  4ZGJ B;  1Q7Y U;  1VQ8 A;  4F6U B;  3MO8 A;  5LJ5 j;  4BY7 X;  3V8L A;  2AT1 B;  1FVV B;  5IT9 E;  4BCF B;  3VS5 A;  5LJ5 f;  5LJ5 g;  1Y96 B;  2WMB B;  3OW2 A;  3H4C A;  4JLI A;  2K2M A;  2LC4 A;  3KUF A;  4F7U A;  1QVG P;  4RTU A;  3UT1 A;  5ECA A;  4MDX A;  2AKK A;  4EDU A;  1BK2 A;  1NEG A;  4BDZ A;  2M0Y A;  2LX9 A;  2L3P A;  1SKU B;  5GAN 4;  4J7I A;  2CS7 A;  1WLP B;  1KXU A;  2D9T A;  3RER A;  3G71 T;  1M3A A;  1MV0 B;  3BHV B;  2JGZ B;  4JZ4 A;  3JCM e;  4RCC A;  1OOT A;  5FWB A;  4F7U G;  5HBH B;  2J6K A;  1VQ5 A;  3KHI A;  1G3N C;  3E9F A;  1IHV A;  5FU6 B;  2QYZ A;  2D1X A;  5GAO m;  1WHG A;  3ZEH A;  3I55 T;  1W98 B;  4CC2 A;  3PVQ A;  3QJ6 A;  1YBY A;  4KGV B;  3ER0 A;  2KR6 A;  1IO6 A;  3D7S B;  2FPD A;  3E9G A;  2RNA A;  1PD1 A;  1NYG A;  4C5I A;  1YWP A;  4BCN B;  1QVF P;  3VUZ A;  3E19 A;  1XTD A;  3GF5 A;  4PJO B;  2K57 A;  2K7A A;  3H41 A;  4FU6 A;  2AK5 A;  1YJ9 Q;  1JXO A;  4M78 E;  3I9Q A;  4BCJ B;  1VQO T;  3A1P A;  2W9F A;  3H6Z A;  5FRO A;  1RLP C;  3JAM E;  3MEW A;  3NFC A;  4NL2 A;  4M77 D; 
#chains in the Genus database with same CATH homology
 5J26 A;  3PMI A;  5GMK m;  4M7D C;  2BS3 A;  4RKU E;  1K8A C;  3OS0 A;  5LJ3 f;  1Q7Y C;  2RHU A;  5LJ3 g;  3QYG B;  4J6W A;  4LD9 K;  4M7D E;  1LNX A;  1S72 T;  1G3S A;  4E7H A;  4N4H A;  1QVG A;  2X4X A;  4J8O A;  3TRE A;  3CCR T;  3QO3 A;  4M75 D;  4HL4 A;  3PGG A;  1VQ4 T;  3JCM d;  1VIE A;  4MZP A;  2QQ9 A;  2KSS A;  2E5Q A;  3LWI A;  2PVD B;  4JJN K;  1NJI C;  2FHD A;  1YIJ T;  4HNU A;  1N9R A;  3SFM A;  1M4Z A;  3M53 A;  3UDC A;  3TW7 A;  1MGQ A;  3OS5 A;  2XIC A;  4LDV A;  4ZN1 A;  5GAM j;  2DD4 A;  4HNV A;  2VUB A;  3DB3 A;  3HRS A;  4NOY A;  3OMC A;  4PJO G;  3ZFJ A;  5HK0 A;  3JCM X;  3OA6 A;  1VQ9 A;  2XK0 A;  5GAO n;  2ZPG B;  3JSC A;  2PUO B;  5GAM g;  4M77 A;  2RHZ A;  4LOC A;  4J5Y A;  1I4K 1;  4TVR A;  2QEX T;  3S6W A;  2LTO A;  3M56 A;  3MEA A;  4A4F A;  5GAO q;  1VQN T;  2K2V A;  3JB9 J;  1O75 A;  2QDY B;  4OB1 B;  2EWN A;  2LVM A;  4EMK B;  4HT9 A;  4M75 A;  2FB7 A;  1WJR A;  4Q5W A;  2FYK A;  1OZ2 A;  3HFN A;  2X4W A;  3X28 B;  4BE2 A;  2XID A;  4A4G A;  4XK8 E;  2F69 A;  2C06 A;  2ZZD B;  2LT4 A;  2VYT A;  3HRU A;  4N0A C;  1U1S A;  4M75 F;  1QW1 A;  4ELZ C;  5CKB A;  1W2B S;  3A8M B;  3QPH A;  3QXE B;  2JOY A;  3OSV A;  5KE3 A;  1Y71 A;  2E41 A;  4PJO C;  4BD3 A;  3MCA B;  3JCM V;  3L2V A;  1UGP B;  4M77 G;  1KQS A;  4C8Q D;  2WSE E;  4PJO E;  2VC8 A;  1IRE B;  4NL3 A;  4FT2 A;  3CC2 T;  3CME T;  1I81 A;  2KDS A;  3RKY A;  3URG A;  1BI0 A;  4II1 A;  5LJ5 h;  4XU3 A;  3CMA A;  2FVU A;  2JUF A;  2QA4 A;  1NJI U;  5GAN 8;  3OYJ A;  2EQK A;  5I21 A;  1QVF A;  3HO8 A;  4ELJ A;  2BKD N;  3V8J A;  3CCM T;  3VYH B;  2EFI A;  2PUK B;  1QVG S;  1IZ6 A;  2RI3 A;  5GAO l;  2XG8 D;  2F5K A;  4A4H A;  3A8H B;  4J6Y A;  3G4S T;  1FX7 A;  1XQH A;  1Y07 A;  2JVV A;  4ELY C;  3JB9 I;  3CPW A;  4BE0 A;  3RES A;  3T9N A;  3AHU A;  2EJ9 A;  4M7A D;  2QQ8 A;  4A4K A;  1N27 A;  3DKM A;  3OBW A;  1YCY A;  4CRI A;  1YJ9 A;  5GAN 6;  4C0F A;  4C5H A;  4M77 C;  4JRI A;  3PIO A;  1LOJ A;  1BIB A;  4JX5 A;  1XNI A;  2HD0 A;  3CEY A;  3FDR A;  4C8Q A;  1D3B B;  2PQW A;  2V8K A;  4M77 E;  3QYB A;  4B9W A;  4IUT A;  3L2R A;  1PSF A;  3VYG B;  2QQB A;  3CCE T;  2V8J A;  2EJG A;  3A8G B;  3OYM A;  2VGN A;  1JRI A;  2DIQ A;  5J3B A;  4RCB A;  4M75 C;  3FLG A;  2IG0 A;  4C8Q F;  1QLB A;  3G71 A;  3QBY A;  3JCM J;  3M9Q A;  4MMK A;  4MFD A;  1WJS A;  5IN1 A;  3A5Z B;  2RJD A;  4M75 E;  1BIA A;  5CK9 A;  2CKK A;  3NTH A;  1WJQ A;  2Y4Y A;  1NPR A;  2VXF A;  5EJC A;  3I56 A;  2M16 A;  3L2Q A;  2OTJ T;  1D3B A;  3V7S A;  2Y90 A;  3V7C A;  3BG5 A;  5EG2 A;  3TW6 A;  5D6W A;  3VYG A;  4R55 A;  4PLI A;  3VKG A;  4L6V 5;  3G6E A;  1I8F A;  4MZT A;  5LJ5 d;  1YI2 T;  4J83 A;  5GAO r;  3QKJ A;  2DTH A;  4MML A;  3I55 A;  2IVW A;  1Q81 U;  2RHY A;  1YHQ A;  5KH6 A;  3BDL A;  1BI3 A;  2GF7 A;  2RHI A;  4J7F A;  4XU2 A;  2QFZ A;  1M1G A;  4M7A F;  3SWN A;  2DXC A;  2MMP A;  2X4J A;  2XDP A;  5GAN 3;  2K3X A;  3P8B B;  1TH7 A;  3X26 B;  3EAE A;  5IAY A;  3JCM W;  3OB9 A;  2WSC E;  3TU4 K;  1UEB A;  1KD1 C;  3VJP A;  2E70 A;  4HT8 A;  3OYN A;  3O8V A;  4DQ2 A;  5FRN A;  1YJW A;  3HBL A;  2QF7 A;  3L42 A;  3M58 A;  1EIF A;  1QVF S;  2E64 A;  2HNI A;  2R57 A;  2DXB B;  2XI9 A;  3EFR A;  1HXD A;  5L8R E;  2R58 A;  3JCM f;  2JZ2 A;  2O4X A;  3JCM g;  2OAU A;  4A53 A;  1YJN A;  5GAN j;  1N8R C;  2Y4X A;  1O9S A;  4IUQ A;  3UPU A;  3EFS A;  1M9S A;  4C8Q C;  4A4E A;  3OYK A;  5GAN f;  3MET A;  3OY9 A;  5CO7 A;  3R6O A;  3CCQ T;  4WF2 A;  2CYZ B;  4C8Q E;  1B34 B;  4BDY A;  5GAN h;  3DL1 A;  4C0D C;  3RKX A;  3RMS A;  1VQM T;  3A8O B;  2DXB A;  3CCS A;  2X35 A;  4BB7 A;  3V8K A;  2L3R A;  3OYA A;  4AI6 A;  1QVP A;  4OP0 A;  2QXF A;  2RI5 A;  5GAN 5;  1YIT A;  1P92 A;  3HHT B;  2E12 A;  2DD4 B;  5DLQ E;  3SD4 A;  5LJ3 h;  2DD5 B;  4FL6 A;  2RHX A;  5A0G A;  1WPY A;  3L2W A;  4M77 B;  2QQR A;  1G5V A;  1S72 A;  1B34 A;  3VKH A;  2DZ9 A;  3OMG A;  4C92 D;  2QTX A;  2QQS A;  1FKM A;  4HCC A;  3M55 A;  3CCR A;  4OB2 B;  2GFA A;  1VQ4 A;  1K73 U;  4M7A E;  2RA2 A;  3CCU T;  3PNW C;  2XDD A;  1KD1 U;  4HCB A;  2R5M A;  1R8O B;  1ZHI A;  2ZPB B;  2I2L A;  4JDS A;  4XU1 A;  4FM4 B;  3CBO A;  4M75 B;  3SWN C;  3S3N A;  4ZTF A;  2O01 E;  3VKI A;  3PFS A;  3OYB A;  2KQW A;  2DD5 A;  5GAM f;  4FSX A;  3OYY A;  2A7Y A;  5HY6 A;  1QP2 A;  1H3Z A;  4HCZ A;  3DLL A;  2YRV A;  2P0Q A;  2RJE A;  3M54 A;  5GAM h;  3OYE A;  3FEO A;  2XDB A;  2RB6 A;  1N8R U;  2MI6 A;  2CZ7 B;  4QW2 A;  3GPL A;  2OTJ A;  2E1H A;  4Y91 A;  1DJ7 B;  3M57 A;  3MHX A;  3QZ5 B;  2QEX A;  5DLO A;  2HAX A;  3OYL A;  4X34 A;  5CQX A;  3VV0 A;  1VQN A;  3BY7 A;  3MP6 A;  1UB4 A;  2LCL A;  5LJ5 e;  3S3M A;  1JBM A;  1U8R A;  2WJ9 A;  1OZ3 A;  3BDU A;  4XAX B;  4MFE A;  3A8L B;  5A2Q E;  1KC8 U;  5CAI A;  1VQK T;  4JS4 A;  2KK4 A;  2BS2 A;  4C92 F;  4BAC A;  1VQL T;  3X25 B;  4L59 A;  4RMO A;  1UGR B;  3WVD B;  4YTL A;  3LGF A;  4QQG A;  4OF1 A;  2D6F A;  3PMT A;  4XTZ A;  3QYH B;  3G7Z A;  3LWH A;  2CGH A;  3CC2 A;  3CME A;  1VQ6 T;  3J7A F;  4M75 G;  2CZ6 B;  5CKF A;  5CQY A;  4BI4 A;  2VGM A;  1Q81 C;  4C8Q B;  1VQP T;  1KQ2 A;  1M5Q 1;  4V2S A;  2K3Y A;  3HKS A;  2JNG A;  2VXE A;  1VQ8 T;  2WSF E;  3M5A A;  4DOV A;  4C5E A;  2ZCF B;  2JN0 A;  4N4I A;  5GMK i;  3PT9 A;  4M78 D;  4C0D B;  3CCM A;  3RUX A;  2NLU A;  5FU7 C;  2ZGW A;  1WQ7 A;  4OGE A;  4JRQ A;  2RO0 A;  3VUB A;  1QP3 A;  1OI1 A;  1X01 A;  2EKO A;  3JCM P;  3G4S A;  2DIG A;  3N5B B;  3BFM A;  3P8H A;  3JB9 D;  2OTL T;  5KE2 A;  2XHC A;  3CMA T;  1VQ7 T;  3OS2 A;  2ZPI B;  3JCM b;  3KXT A;  1K9M C;  2RJC A;  3QJY A;  4ZTJ A;  3CCL T;  5CKE A;  3HSB A;  3GOX A;  4QVZ A;  4LDU A;  3Q1J A;  5HKC A;  2V8I A;  1X75 C;  4GY5 A;  2K5L A;  1G3W A;  4M7A B;  2EQM A;  3OYD A;  4M7D D;  3GP8 A;  5GMK e;  2RI2 A;  2KMT A;  3LGL A;  4C92 C;  3CCE A;  1KQ1 A;  2DK3 A;  1OYX A;  3CD6 A;  4EMH A;  5CKD A;  3OYF A;  4UC4 A;  4C92 E;  1YJ9 T;  2X4Y A;  2CZ0 B;  3LLR A;  4AKH A;  3SWN B;  1Y96 A;  3CXC S;  2DXC B;  3DLM A;  3CC7 T;  4F7U F;  3JCM c;  2EQJ A;  2PVO B;  2DO3 A;  5GAN 2;  4PNO A;  2RK1 A;  2XU8 A;  3M59 A;  4HLQ A;  2M9U A;  2FL7 A;  2DXT A;  4LDW A;  2BS4 A;  3J81 E;  4BI8 B;  2QI2 A;  4M7A A;  2EQU A;  1AHJ B;  4M78 F;  4C8Q G;  1KHC A;  4KUD K;  2RJF A;  3QII A;  1MHN A;  2O4X B;  5GMK l;  1WQW A;  3UWN A;  1VQ5 T;  2LNV A;  4OB3 B;  3OSS C;  1YI2 A;  1M90 C;  3CCJ T;  1K73 C;  2DTO A;  2K4Y A;  3LH0 A;  3JB9 F;  4ATO A;  3X20 B;  4FIB A;  4M7D F;  5I2M A;  3L2Z A;  5CVI A;  3GNF B;  3PIP A;  2P4T A;  4PL6 A;  3CCV T;  3BW1 A;  2QDJ A;  5J39 A;  2LQ8 A;  1NE8 A;  3BG9 A;  3QHS A;  2KY9 A;  2LCC A;  4B9X A;  4L5G A;  3C94 A;  4M6V A;  2ZPF B;  5A0D A;  4IUV A;  3OYI A;  1K9M U;  4JRK A;  3QZ9 B;  3GLX A;  3QDR B;  3JB9 H;  2VV5 A;  4QQ6 A;  2G3R A;  4QQD A;  4M7A G;  5FRM A;  3SB2 A;  3JCM h;  5FLX E;  4NL2 A;  2CZ1 B;  3PTA A;  2YHT A;  2K5I A;  4ZGE B;  2DKG A;  4EPC A;  4AKG A;  3OBY A;  4BUG A;  4PJO D;  1VQO A;  4C0G A;  1M1K U;  4C0Z A;  1YJW T;  4MZM A;  4R56 A;  1VUB A;  4HA8 A;  3GIB A;  3C4S A;  1JB0 E;  3CC4 T;  1JJ2 A;  3S3O A;  3FIF A;  4JS5 A;  1KC8 C;  4F7U E;  1M8V A;  5LJ3 j;  1UGS B;  1VQM A;  3H8Z A;  4O5V A;  5FU7 B;  5D6X A;  4E7K A;  3M4Y A;  3MEU A;  4BY6 C;  2MWO A;  1U1T A;  1ZQ1 A;  3TEE A;  5CR2 A;  1NPP A;  1KHI A;  2BUD A;  2WAC A;  4M7A C;  4DOW A;  1BI2 A;  3OYG A;  4XQ3 A;  5KCH A;  1G3T A;  3ME9 A;  4VUB A;  1M90 U;  2QQA A;  4IKF A;  2K5F A;  4E7L A;  4KBM B;  1WGS A;  2HBP A;  2HQE A;  3MP1 A;  1RI0 A;  4JUV A;  2EYQ A;  4X9C A;  5GAN 7;  4OVA A;  4O6J A;  1WNL A;  4XTW A;  3JRZ A;  3CCU A;  1YIJ A;  4C92 B;  2G77 A;  2H3J A;  5CCA A;  2DJZ A;  1XOV A;  4E47 A;  4BE1 A;  3HP9 A;  4CI0 C;  2LDM A;  3QWL A;  2RD1 A;  3OYC A;  4ME7 A;  4PJO A;  1FWZ A;  5AYF A;  4OGC A;  4PJO F;  3L2U A;  5DY9 A;  4LDX A;  3CBM A;  3HRT A;  2JTF A;  2D0Q B;  3CXC A;  4XTU A;  4C92 A;  4QVD A;  3RMQ A;  3HB9 A;  5GAN d;  1VQ9 T;  5GAO p;  4FT4 A;  1KG1 A;  3BG3 A;  4ZGD B;  3HFO A;  2KMG A;  2RK2 A;  4M77 D;  2ZPE B;  3QG1 A;  4LDY A;  1BI1 A;  1Q82 U;  5FU6 C;  2DTI A;  4DA4 A;  3M4G A;  1Q86 C;  3L1A A;  3SDZ A;  4NC6 A;  3OQ5 A;  2R5A A;  4XTX A;  4PLL A;  3NTI A;  2EIF A;  3RIR A;  1VQK A;  3ASK A;  3WVE B;  5LJ3 d;  2MF2 A;  2E6Z A;  2KVQ G;  1VQL A;  2XD0 A;  4IUR A;  4Y28 E;  5CKH A;  3FC3 A;  2EJF A;  3ZBD A;  4E7J A;  1JJ2 S;  3WXM B;  4M77 F;  4QSH A;  2YLC A;  2M1H A;  3FRN A;  3TCJ A;  2MWP A;  4BI3 A;  1I5L A;  1PSE A;  2XKO C;  4C92 G;  2ZPH B;  3JCM Q;  4IUP A;  1VQ6 A;  2L89 A;  5C0M A;  1K8A U;  1VQP A;  4ZGJ B;  1Q7Y U;  1VQ8 A;  2LT1 A;  1E7P A;  3MO8 A;  2RM4 A;  4RG8 A;  3VU3 C;  4F7U B;  5LJ5 j;  1FXX A;  1N9S A;  3E1S A;  3C12 A;  3V8L A;  4NS5 A;  4EMK A;  5GAM d;  2QA4 T;  5IT9 E;  5LJ5 f;  2GCX A;  5CIU A;  4HKE A;  1Y96 B;  2M0O A;  3CPF A;  5LJ5 g;  4M78 B;  3OW2 A;  3H4C A;  4BY6 B;  2OTL A;  4AKI A;  4JLI A;  4KUI A;  4KUL A;  1VQ7 A;  2ZZD A;  3GNG A;  4N4G A;  2A3L A;  2LC4 A;  4MIM A;  3J80 E;  2E65 A;  4KT0 E;  4MDW A;  3CCL A;  1W4S A;  1BKB A;  3KUF A;  4F7U A;  3UT1 A;  5HK3 A;  4MDX A;  1M1K C;  5M9O A;  4EDU A;  1Q86 U;  2JTM A;  1GXI E;  4HNT A;  4M78 A;  4XTY A;  4Z02 A;  2F5T X;  2LX9 A;  2YLB A;  1VIF A;  3LYI A;  1X6O A;  3KBG A;  4BDZ A;  4M7D B;  4BBR M;  1SSF A;  3NTK A;  5GAN 4;  3CC7 A;  3QYE A;  2GQV A;  1H64 1;  1Y7X A;  2CS7 A;  2P0K A;  3HL8 A;  4J7I A;  4A54 A;  1NZ9 A;  2D9T A;  1ZBX A;  3RER A;  2BIV A;  3G71 T;  5DM7 R;  4OB0 B;  4QVC A;  4RG2 A;  1LJO A;  4D6W A;  3CD6 T;  3JCM e;  1N6A A;  4RCC A;  2P0P A;  2LQK A;  2MAM A;  3OYH A;  2DAQ A;  3FB9 A;  2EAY A;  2DZC A;  4F7U G;  3I56 T;  3OS1 A;  4M7D A;  1VQ5 A;  3KHI A;  4E7I A;  3CCJ A;  3CBP A;  3E9F A;  5GAN e;  5LL6 S;  1UGQ B;  3F70 A;  3HPW A;  5KCO A;  3G6E T;  3MEV A;  5I2S A;  3P8D A;  5GMK j;  4M78 G;  5FU6 B;  3INZ A;  2B8A A;  4IUU A;  3CCV A;  1V29 B;  3FJP A;  5GAO m;  3ZEH A;  3I55 T;  1YHQ T;  1HK9 A;  4EMK C;  4JX6 A;  3QSU A;  3QJ6 A;  4EMG A;  1YBY A;  2E10 A;  3ER0 A;  5GMK h;  3JB9 G;  5LJ3 e;  2GFU A;  1BYM A;  4ZN3 A;  3V7R A;  1KQS S;  2KR6 A;  5C6S A;  2PVG B;  4GLK A;  2AHJ B;  3E9G A;  3OW2 S;  3HZJ A;  4Z6Y A;  3MP8 A;  1G3Y A;  3LW5 E;  3CCQ A;  4M7D G;  2DEQ A;  4C5I A;  2RH2 A;  4C5G A;  1Q82 C;  4BBS M;  1YJN T;  3VUZ A;  3E19 A;  1XTD A;  3CC4 A;  3GF5 A;  3LX7 A;  4PJO B;  3QUI A;  2K57 A;  4M78 C;  4FU6 A;  2L5Q A;  4OMF B;  2PU9 B;  4JRP A;  2E6N A;  3DB4 A;  4M78 E;  1M1F A;  3C95 A;  3CPW S;  3RKW A;  5D6Y A;  4X9D A;  5GAM e;  1VQO T;  1W2B A;  2DPP B;  4JLG A;  4LD6 A;  4J6X A;  4XU0 A;  2LRQ A;  5GAN g;  3CCS T;  3H6Z A;  5FRO A;  2DXU A;  4N0A A;  4P5N A;  2KAF A;  3JAM E;  3X24 B;  3MEW A;  3NFC A;  4PKC C;  2HQX A;  1RL2 A;  4XTV A;  5A0L A;  2L8D A;  2DVE A;  1YIT T;  4JX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...