4OB3B

Crystal structure of nitrile hydratase from pseudonocardia thermophila : a reference structure to boronic acid inhibition of nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
229
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 66
structure length 229
sequence length 229
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob3B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob3B02
2ZZDB 1AHJB 2WSEE 3A8LB 3X24B 3A8MB 2CZ0B 3QYGB 2O01E 1PSEA 3HHTB 1GXIE 4Y28E 3QZ5B 3X20B 2DXCA 2PVDB 4OB0B 1JB0E 4RKUE 3QYHB 1UGPB 1V29B 1IREB 1QP2A 3WVDB 4ZGDB 1QP3A 2ZPBB 2DPPB 3X28B 2D0QB 2DXCB 5L8RE 2WSCE 4OB1B 4KT0E 3VYHB 2DD4B 1DJ7B 2DD5B 1UGRB 4OB3B 2ZPEB 2ZPHB 2ZCFB 3QXEB 2QDYB 2DD4A 3VYGA 3A8OB 2PUKB 3X25B 4ZGJB 4FM4B 2DXBA 3A8HB 2PVOB 2ZPGB 4OB2B 3LW5E 2CZ7B 2ZPFB 1PSFA 2DXBB 3A8GB 4ZGEB 3WVEB 1UGQB 2CZ6B 2AHJB 2CZ1B 2ZPIB 3X26B 2PUOB 2ZZDA 2PU9B 2WSFE 1UGSB 4XK8E 2PVGB 2DD5A 4L6V5 2CYZB 3QZ9B 3VYGB
chains in the Genus database with same CATH superfamily
1Q81R 1D3BA 1AHJB 4RCBA 3OS1A 1VQ5T 1QVPA 3HSBA 1S72T 3CMAQ 3PO3S 1MMDA 2BS2A 2DXTA 3REAB 3HHTB 2X3XD 1I5LA 1Q86R 3CMEQ 3QZ5B 4EOKB 1FMVA 5CKBA 1H4LD 4E7HA 1WYXA 1QLYA 2LTOA 4AG1C 3PVLA 2J05A 2RNAA 4FCYA 2DO3A 3G1JA 2CH4W 2VVKA 2OTJQ 1RAFB 2AT1B 1SHGA 1M2VB 2B8AA 2P0KA 2EQJA 1QLBA 1TG0A 3RBBB 2G3RA 4OMPA 3VS6A 2DAQA 3PIPA 5KYXA 5DQWA 3LGFA 2DMOA 2EJ9A 2M0OA 3RERA 2NWMA 3CC7A 1IGUA 1VOMA 1OU9A 3G71A 3I5SA 3TVTA 1YJWQ 4JLIA 5FWCA 1ZUYA 2MWPA 1D1AA 4DOVA 5LJ5e 3G4SQ 4TTHA 4F70B 3M54A 5GAN4 4LUEA 2ZAEA 4BDYA 4FYYB 1XNIA 4J9IA 3THKA 2WPAB 1W70A 2CP5A 5HBEB 4PJOA 3GOXA 2YHTA 1LCKA 4NSTB 3M0SA 3MP1A 1VQ8A 3TSWA 2RPNA 1H27B 1KG1A 4BCIB 2PHGA 2EPDA 2DL8A 2CKKA 3EGXA 5FU6C 4HL4A 4MZTA 5GMKj 4RTYA 4M7DE 1OIUB 3UDCA 4BBRM 2O9VA 4BUGA 2XHCA 3OYHA 1GBRA 3OW2P 2EQMA 2XICA 4J9FA 3KHIA 2KGTA 3NMZC 1K0SA 2RHYA 3URGA 1S1NA 2WIHB 2JVVA 5AYFA 1OI1A 4J8OA 2K3YA 3GF5A 3V8LA 5GMKl 1QCFA 1WXTA 3E2UA 3VS1A 4OR5B 3CCQA 1MMNA 2DERA 2ATCB 1WIEA 2LT4A 3PIOA 1E7PA 4C5IA 1FX7A 3JCMX 2DXCA 1NEGA 1G8XA 1TXQA 2G77A 5DLQE 1SPKA 2O31A 1UG1A 5KH6A 3A98A 4XTVA 3RNJA 1NLOC 1QP2A 4C8QF 1TUDA 2QASA 5LJ5f 2E65A 3FLGA 3CXCS 3CCST 4C92A 4MDWA 2A7YA 2DK3A 1B3QA 1H641 2YRCA 1TH7A 2QAZA 2XD0A 3NTKA 1UTIA 4OGCA 4OMLA 1PG5B 1IXDA 1GL5A 2UUEB 1MMGA 3VKIA 1W2BP 4A4FA 2QDYB 4ESRA 1QVGP 2HKQB 2QGFB 5CKEA 1G3YA 1OPLA 2LNHB 1W4SA 2J6KA 4FT4A 1FVVB 4ZGJB 2D0NA 2EQUA 3OYBA 1FINB 2I2LA 1UHFA 3CPFA 4AG2C 4P5NA 5FU6B 4A4HA 1SSFA 2I40B 2XDDA 1KC8R 3D7SB 3O0GD 1PKTA 2DL5A 3VUZA 5IAYA 3CCVT 3G6EA 3JCMb 3WVEB 2DILA 3TREA 4KRCB 3NGPA 1IB8A 3CC4T 2R5MA 4PFZA 3M5AA 3HP9A 2FRWA 1H8KA 4WF2A 1BIAA 4LXCA 5FU7B 3H0FA 4G6LB 1ZSZB 2WMBB 4M78G 3CMAT 2MIOA 2L0AA 5LJ3e 5IHKA 3EH2A 4M77D 3JAME 1FYNA 2W9FA 4MFDA 3E1SA 1VQ9A 2OTLA 3H41A 4HNVA 3M53A 1WJQA 2WSEE 2EYWA 3SD4A 3G7ZA 3EGUA 3G6ET 1GBQA 3VJPA 3CQTA 3EHRA 3EG1A 4AFSC 5GAOq 1Y96B 1JXMA 3CMET 4ZTJA 4CRIA 1X2KA 3CCSQ 2H3JA 2HBWA 3E19A 4XTZA 3X20B 1SSHA 3JCMg 4FU6A 1YJNQ 1ZP2A 3MP6A 4BDZA 3V7CA 4HCCA 4HT9A 3EAEA 2M9UA 2BPMB 1N8RR 1YJ9A 4II1A 2E64A 1QP3A 2WACA 4M7DC 1Y71A 4BB7A 1OZ3A 2CUBA 4M78D 2LP5A 5C6SA 3L2RA 2RD1A 4FIBA 2W0ZA 2K6DA 3BG5A 5L8RE 2WSCE 2X4YA 1M1KR 2HL5C 3QYEA 2DD5B 4QQ6A 2E70A 3OYNA 2KT1A 5GAOr 4CFXB 4BY7X 2DD4A 2RHIA 3I55T 3META 1N6AA 1OGUB 5FRNA 1EIFA 4E7LA 1JJ2S 3X25B 3IQLA 2E3HA 1SRLA 2EGEA 3A8HB 4C5HA 4BBSM 2HQXA 4X34A 4EOMB 4IUVA 3OMCA 2EJFA 1MHNA 2YUOA 1OEBA 2CUDA 2MYSA 3E9FA 4PJOB 1RAEB 1UGQB 2L3RA 1TSFA 2JN0A 2ZPIB 3MEWA 1AEYA 2LW4A 2YT6A 2X9HA 4RUGA 5GANd 2K5LA 2K4YA 1EZZB 1X2QA 1IHWA 1J3TA 5GAMh 5M9OA 1QCNA 4PJNA 3QHRB 2YUPA 4A63B 3JCMP 2P84A 4M7AD 3POMA 3EFOB 4E6RA 1K0XA 4ELJA 1OU8A 3OBWA 3SHWA 3TEEA 4GY5A 3U23A 2E4HA 1M1KU 3EG3A 3JCMc 1M1KC 1R8OB 1UJ0A 2E41A 2A36A 1SF9A 3X24B 3NDQA 2LNVA 2OTLQ 1C9BA 3PMTA 4RG8A 4MFEA 4JJDA 1S72Q 5KYNA 4KRDB 4C92G 2DJZA 2XMFA 4CC2A 4AKGA 4NOYA 1X69A 4ZNXA 4F6UB 5CKHA 1KHIA 1VYTA 2GFAA 1N8RU 4BI4A 2EAYA 4BCJB 2F5TX 3CCLQ 2MF2A 2LQ8A 2A08A 4Y72B 3V7RA 4E7IA 2HL3A 3PFSA 2QGSA 4JX5A 2C0TA 4BCKB 1YJ9T 3LGLA 1B34A 1PWTA 2F1LA 5GAOp 3CD6Q 1Z9QA 2LQWA 4KRTA 5GMKe 3O8VA 3CD6T 1KD1R 1YITT 3V8KA 4J6XA 2GGRA 2XDBA 1UGRB 4O6JA 3PVQA 2J6OA 4J83A 4C8QG 3CCUQ 1VQ6A 1NZ9A 4F16A 4M77C 2PQWA 4HT8A 3UA7A 5A2QE 2GBQA 4M77G 4PJOD 5HBJB 5A0GA 3LW5E 2BKZB 1MNDA 2DL3A 1GY3B 2LDMA 3CCEA 5KE3A 1PSFA 2DXBB 2F2XA 1VQPT 2CZ6B 1RACB 1JJ2P 1KC8C 2RF0A 1X6BA 5GAOm 2OTLT 2DEUA 4JRKA 2IW8B 1Q82C 4JJNK 3OY9A 1WHMA 2QK0A 2O2OA 1U8RA 1WHGA 4EONB 3G33B 2HEQA 4DBHA 4C0FA 5CAIA 1UJYA 2FPEA 3N5BB 1KD1U 9ATCB 3VS7A 2VC8A 3LX7A 4QKUA 2PTKA 3PNWC 2XKOC 4HLQA 4RTTA 2C5NB 2K5FA 1QVFS 2E6NA 4MZPA 1Q95G 1NG2A 4Z8AA 2KY9A 1Q7YR 2D9TA 1WPYA 1JRIA 2X35A 2DZCA 3ZEHA 2CP3A 1HK9A 4FYXB 5L2WB 2IW6B 4FT2A 2A37A 3QKJA 1YIJQ 4ATOA 2NUPB 4FW1A 2K9GA 4JX6A 3SB2A 4C92E 3FB9A 2JOYA 2EW3A 3OYGA 3DDQB 2DZ9A 4DQ2A 2BZXA 2JT4A 2FPFA 2AZSA 4C92D 2ECZA 3VRYA 1LJOA 2R58A 3FC3A 1VQMT 3TU4K 4BCHB 3GNGA 3S3OA 2JTEA 1K9MU 4JZ4A 1OPKA 3UF4A 4C0DC 4IUUA 2HCKA 2CT3A 3ER0A 3EHQA 4L59A 5D6YA 5DLOA 1M90C 1UECA 4C92B 2QA4A 3BG9A 4EOLB 2EUFA 1HYOA 2C06A 2DETA 4BCQD 4B6MA 1SHFA 5GAMd 2QTXA 4A4KA 2CH4A 3CCJT 3RKWA 2SRCA 4BY6C 1OYXA 3OB9A 5IXFA 2MCNA 4A54A 5ACBA 1MV0B 2Z0WA 4CFUB 1V76A 3FIFA 3C0CA 4JRPA 1H28B 2YLCA 3G6EQ 5HY6A 4F7UA 2K7AA 1W2BS 3QHSA 4LN2A 2OJ2A 4Z88A 1WXUA 1BU1A 1PHTA 2QTVA 3V7SA 4BCGB 5KYWA 1NEBA 2LJ3A 1VIEA 2AKLA 2R5AA 4OMFB 2SEMA 4IURA 1VQLT 4M77A 4ME7A 3QZ9B 3PE0A 4KH1B 2FYKA 2RHZA 4HCBA 2JJ9A 1KHCA 4ANJA 4CFNB 1QVGS 2CZ0B 1HD3A 2K2MA 1VQ8T 1ACMB 1I81A 1VOLA 2QQ9A 4LE9A 2COZA 1KQSS 3V8JA 2DL7A 2JUFA 4PLIA 3JSCA 4Y28E 1CKAA 2HD0A 1N4MA 2EYZA 2BE7D 2K79A 1NYFA 4OB0B 1M27C 4KGXB 1H3ZA 4E7SA 2YRDA 2D8HA 3M56A 3TSZA 4GBQA 2A3LA 3CXCP 3CCEQ 2K3XA 2E10A 1P5EB 2J6FA 2EIFA 1KIKA 2V26A 5IF1B 3DTOA 2DPPB 3CCMA 2PNIA 3JRZA 2QQSA 1ZHIA 4EPCA 1VIFA 4E7JA 1T3LA 3CPWS 2EFIA 1C0MA 4WCIA 4F14A 5CVIA 4XTUA 3OYFA 2WFYB 4PNOA 2J06A 4J7IA 3S3NA 4DBRA 3AT1B 2BS3A 1WJSA 1M2VA 3TNHB 3RESA 3I55Q 2ZPEB 2LQNA 5KYYA 4C0GA 3SDZA 4OF1A 1S72A 2E6ZA 4BE0A 3CCJQ 2PZ1A 4F7JB 1ZSZC 1XQHA 1AT1B 1U06A 1Z9ZA 2CP0A 1W6XA 2XU8A 2L5QA 2B86A 1C1AA 1VYWB 4Z02A 2OAUA 4EOQB 3P8BB 1YP5A 2LX9A 2QDJA 5LJ3j 1YIJA 2AHJB 1NM7A 4IIMA 4HA8A 4QSHA 2QDLA 2EJGA 1UE9A 1WX6A 3LQ5B 4EIKA 2DE0X 4K11A 1O9KB 1M8MA 2P4TA 2V8KA 3CCJA 3DB3A 1VQKA 3CCET 3JB9I 2V8JA 2C4GB 1VQOA 1RABB 4IMYB 1FMWA 1PC0A 3G4ST 4BXXX 1VQ6Q 1KD1C 4FL6A 1N8RC 4LDYA 1RAGB 1P92A 4IIOA 4JDSA 1BCOA 1JEGA 4C8QA 3OBYA 4J7FA 4F7NB 5FROA 1YCSB 1AWWA 2RJDA 4JJBA 1Q82U 1GCPA 2CP6A 4DOWA 2FPDA 5LJ5j 5LJ5h 1E6HA 2HKNA 3M9QA 1T0HA 2JTFA 2HSPA 1UGPB 3VUBA 4N4IA 2IN3A 3OYCA 2W99A 5GAN5 4LDWA 3MJXA 4Y92A 2DA9A 4E7ZA 5GMKm 5GAMe 4DBFA 3OYLA 3C94A 1AVZC 5GJVB 2LCCA 3CMEA 1NLPC 1PRLC 2EWNA 4OMNA 5HNBB 2KR3A 1EX4A 5GAMj 3JB9D 5EFQB 2JMCA 2RQUA 3TNIB 3M0QA 3J81E 3OYJA 2OTJA 4EOJB 3PGGA 4QQGA 3RKYA 3MI9B 4FSSA 2K3BA 2X1NB 1I5OB 2A0FB 4CXAB 3H9NA 1D0XA 5HQ0B 4AT1B 1Q86U 3EFOA 3RMSA 3HO8A 2KXDA 4NL3A 2LMJA 4GLKA 1C6VX 3JV3A 2RQTA 3AHUA 4V2SA 1QMCA 3LWHA 4Z89A 4BCFB 2KRSA 2FZGB 2NUTB 4HVUA 4BACA 1XTDA 1XOVA 1YI2T 2EQKA 3QG1A 1WXBA 4PK4A 2EYXA 1QMZB 4D6WA 3KXTA 2W9ZA 3JB9H 3VKHA 1MMAA 4M75F 4XK8E 4M77B 2DD5A 4M75E 2KK4A 2L89A 2KR6A 1Q81C 1K8AC 5KYWB 4EOSB 2MAMA 1UNGD 1QKWA 2ENMA 5CCAA 2BIVA 3I56Q 4RG2A 4JX4A 1Q81U 4M78E 2OX7A 2D8JA 3RDVA 3VU3C 4C5EA 1RL2A 4QT7A 4QW2A 3MY1B 4EMKC 2PMIB 2QI2A 4IUTA 3CBOA 2KAFA 2KE9A 2DL4A 3CCMT 4F7LB 5CEIB 5D7UA 3LLRA 2L3QA 3RUXA 3HPWA 3J7AF 3QYHB 4EMKA 1WA7A 3WVDB 1KQ2A 2MMPA 1ZQ1A 2P0QA 2IW9B 3OS5A 4RODA 1TUCA 2VKNA 4R55A 4J6WA 5GANj 5C0MA 5I11A 2WIPB 5DQVA 1YN8A 4KUIA 1K8AR 2W2HA 4YOOA 4A53A 4QVCA 5I2SA 1H1RB 1ZSZA 4CFWB 4M7DF 2F69A 4CFVB 2E1HA 2F2VA 5CKFA 1WQ7A 3R6OA 2GTOA 2KI7A 2JZ2A 4AFUC 4LNPA 2YSQA 5LMKB 5LJ3d 2YUNA 5LJ3f 3P8DA 3ME9A 1FMKA 5LJ5d 1K1ZA 5HK3A 1YJNT 4J9DA 2QFZA 3QO3A 5FRMA 2G9XB 1ARKA 3VV0A 5HKCA 4DA4A 3RKXA 2ZZDA 4CFUD 2RB6A 2VASA 1FXXA 2X3WD 1PD0A 3I56T 1X6OA 2DF6A 1GUXB 1UUEA 3QDFA 4PJMA 2DRKA 2ABLA 3J80E 4HVVA 2UZDB 4L6V5 2JNGA 3CCUT 2FZKB 2JS2A 2CCIB 3JCMJ 2IVXA 5I5ZB 4BCQB 5I22A 1VQ7T 3QPHA 3M4YA 2DBMA 2C0OA 3BLQB 4M7AE 2QA4T 2KMTA 5DY9A 1ZUUA 4CC4B 2KBTA 4BI8B 3L42A 3EG0A 3VS3A 4BI3A 3OYMA 2IG0A 3BLHB 2GQVA 2EYQA 2X4WA 5KE2A 3OA6A 1ZA2B 4PJOG 2JM8A 2BUDA 3KBGA 3JCMW 1JQQA 2RM4A 5BNJB 2CSIA 3Q1JA 3CCLT 1AD6A 4BCOB 4RTUA 5HK0A 3K7AM 4PFOA 2O88A 2J7IA 1JB0E 4ROCA 4FYWB 3VS4A 4B9WA 2RK1A 5EC7A 1O75A 5CYIB 2RA2A 3CXCA 5FU7C 2K5IA 5CO7A 2V1QA 1TU0B 2DXCB 1I1JA 3HRUA 4DBQA 5CK9A 1R0BG 4XU2A 2C6TB 1H25B 4GLMA 1GFCA 2ZGWA 1RLQC 3TN8B 1DJ7B 1OX8A 1AZGB 2C5XB 1K8AU 1H1QB 1OZ2A 4PJOF 5LQFB 4MMLA 1YBYA 1RADB 4EORB 1BIBA 1CKBA 3VRZA 5GANg 1K76A 3S3MA 4KBMB 2PUKB 3BFMA 1H92A 3MO8A 3SFMA 2K57A 2LZ6B 4CC7A 1M90R 2X4XA 1T3SA 1F5QB 4CFMB 2E5KA 2CZ7B 2QF7A 3GNFB 5GAOl 4A4EA 4JS5A 1VQ4A 3EIDB 5CQYA 2KXCA 4XTYA 2EVRA 3CCQQ 1BI2A 4LUDA 1KQSP 1E7OA 1ABOA 5I2MA 3FJ5A 2ED0A 1G2BA 3JCMe 1NJIC 2KSSA 4F6SB 4EMHA 3CCMQ 2QQRA 2CJMB 4D8DA 1VQ7A 4EC8B 2M51A 3M57A 4ZN1A 2QEXA 1XJWB 2RQWA 1BI3A 2K2VA 2CREA 4M78C 2JMAA 3BHVB 2DYBA 1VQKQ 1K73C 4C8QE 4M7DD 2RJFA 4HNUA 4NC6A 1NPPA 4ELZC 3L2VA 4E47A 5LL6S 2COYA 2HAXA 1RLPC 2HQHA 2NLUA 3GIBA 2DXUA 5ICPB 4C8QD 1AWOA 5GANe 1VQNT 1HJDA 1N5ZA 1FKMA 1PD1A 3BHUB 3PMIA 1YIJT 2EKOA 3A1PA 2MI6A 1OULA 3M0RA 3OYEA 3CCSA 1G3TA 4KGZB 3LWIA 1VA7A 4JJCA 2WHBB 3CC2A 1UEBA 1YI2Q 2F5KA 4BCND 3MPUB 3L2UA 2WEVB 2QQ8A 2XK0A 2DFUA 1YHQA 4YOZA 2DX1A 3DDPB 1D3BB 2AK5A 1X75C 3L2ZA 1YITA 4AMCA 3CPWP 2H8HA 3G71Q 1LNXA 4JZ3A 2DD4B 2JS0A 3H6ZA 3R6NA 2RHUA 5I21A 3DB4A 1X01A 1K9AA 2ZCFB 3EFSA 3QXEB 3ULRB 1T0JA 3CC2Q 5GAMf 4HVWA 1WHHA 2JM9A 1Y0MA 1E6GA 2VGNA 1UNLD 2KDSA 2YRVA 3CC2T 1OL1B 4FM4B 4BY1X 3FJPA 1NE8A 3H4CA 2NYSA 5GAN2 5FW9A 3SWNC 3CC4Q 3KFVA 4AI6A 1BI1A 4LDVA 3H0HA 3CCVQ 1HXDA 3EFRA 3ZFJA 4M6VA 4OMQA 2PJQA 2AIRB 2X4JA 2IVWA 2R57A 5LJ5g 3BW1A 3I9QA 2UZLB 3EGDB 1G5VA 1IO6A 3SWNB 2JGZB 1BBZA 1JJ2A 2CYZB 1Y96A 1URCB 4PJOE 1F1BB 1WDXA 4OGEA 1QVFA 3OYYA 3OYKA 5GAN3 4XQ3A 3A8LB 2VGMA 1QCOA 3HL8A 1GXIE 1OI9B 5HBHB 1GUXA 4JS4A 1VQMA 4JUVA 1JSTB 1X6GA 1D1BA 4M75A 1ZLMA 1MGQA 2FB7A 4N0AC 1KC8U 4F7SB 4M78B 2V8IA 3JCMQ 4LDXA 4E7KA 5J39A 5J26A 1M8VA 5GAN6 1MNEA 4RTXA 3L2WA 3JCMV 2QYZA 2DRMA 5GMKi 3MEVA 3BDLA 1H1SB 1PNJA 2KMGA 1VQ9Q 2HSEB 3C95A 3QSUA 2JTMA 1I07A 1UHCA 2M16A 3HRSA 2DVEA 3EG9B 4XTXA 3GP8A 2IPOB 2GTJA 3VYGA 3GLXA 3A8OB 4IUPA 3INZA 1H1PB 4LOCA 1YJWT 5A0DA 4NS5A 4OB2B 1ZA1B 2QQBA 3CCQT 2B9RA 2FEIA 5GAN7 2BTTA 3CC4A 4F7UB 4HCKA 1IGQA 4XAXB 3X26B 4YC3B 4ELLA 1VQPQ 1SG5A 3GBQA 3HBLA 3BG3A 5GAOn 3HFOA 2CS7A 3HKSA 1WNLA 3G4SA 1PRMC 2FZCB 2C5OB 3M59A 1YFNA 4X9DA 2V1RA 4C92F 3EG2A 1OOTA 3TQ7P 1JU5C 1VYUA 2PK2A 2W96A 4N4HA 3F70A 4PL6A 1KQ1A 4PJJA 5IHYA 1OKWB 1JXOA 1RI0A 3QYGB 2Y90A 1PSEA 2AZVA 1YITQ 1M3AA 5GANh 1VQ5Q 2EQIA 2CP7A 5L23A 3M58A 2VUBA 3TNWB 2RH2A 4J6YA 5GMKh 1YHQT 1WLPB 1D0ZA 3EGXB 2VV5A 3ZL7C 2XDPA 1G3NC 4F04B 1BU2A 2EGCA 1IREB 4ZGDB 1D3UB 1D09B 5CR2A 1WJRA 1YNZA 2BKDN 3RIRA 2RI2A 1UGVA 1KSWA 4RMOA 1U3OA 2UZEB 2VYTA 3VKGA 1QW1A 1G83A 2IIMA 4KGVB 3QWLA 1YWPA 1Y07A 1PCXA 2DLPA 1TD6A 1X27A 1E9HB 1WHKA 2OAWA 4EMGA 1UDLA 3OSVA 4M75G 4F7UG 4OB3B 4LDUA 4BD3A 3OS0A 4UN0A 2P4RA 4MIMA 3MCAB 1Q7YU 2GQIA 5KYXB 1D1CA 3PTAA 1H3HA 1SKUB 1OV3A 2UZBB 2ZPGB 2FO0A 2DTIA 1VQ4Q 4VUBA 3UA6A 2VWFA 2RQRA 1R77A 3TW7A 2RN8A 4HCZA 1X43A 2DYIA 4E2FB 4O5VA 1YI2A 2CZ1B 5KCHA 4ELYC 4EOPB 4EOOB 1JO8A 3QWXX 1LVKA 4JPBW 2DTHA 1A0NB 1JSUB 2L3PA 2O4XB 1I0CA 4J9GA 3DLLA 3M55A 2HBPA 3CCUA 1TTHB 2XG8D 3JCMd 4J9BA 1JOWA 2ROLA 1W98B 1UNHD 1GCQA 4LD9K 2GNCA 2FL7A 4MZMA 1SRMA 2ED1A 1QWEA 2D6FA 3EOCB 3CBPA 3SWNA 4M7DA 2QXFA 3GTMS 1HSQA 1U5SA 1GH6B 4FSXA 1B07A 2NUZA 1U1TA 2DEQA 2ESWA 2MWOA 1AZEA 1I8FA 3BY7A 4M7AB 4EMKB 1GRIA 1QWFA 2LCLA 1UFFA 1B34B 3M03A 1N9RA 2KQWA 5IN1A 1VQOQ 5FWBA 1VQ6T 4EC9B 1K73U 4MMKA 2HQEA 4FX3B 1M9SA 4M4ZA 2BZ8A 3MHXA 1OKVB 3CD6A 2DJQA 3X28B 4TVRA 1MUZA 1WQWA 5HCKA 1KXUA 2D0QB 1CSKA 5GANf 2M0YA 2KRMA 2HMAA 3PT9A 3WXMB 1EFNA 3BDUA 3EH1A 2D1XA 4OMMA 5KYUB 2QEXQ 4C8QC 2DVJA 1AWXA 3KUFA 4F17A 3LYIA 1M3CA 4II5B 5KYYB 4IKFA 5DM7R 1BYMA 2FRYA 2ZPHB 3MEAA 4AFQC 5A0LA 1WHJA 3L1AA 1M4ZA 1PKSA 1QVGA 3UATA 1RAIB 1H24B 3C4SA 1KFZA 2HZYA 1FWZA 5EJCA 1RAHB 1WI7A 2M1HA 1QQJA 3RGFB 3LH5A 1PM3A 2LC4A 2HDAA 3LH0A 4KULA 2EBPA 1AD5A 4ZGEB 3L2QA 2RQVA 3JB9J 4X1VA 2XI9A 3QJYA 1K73R 1K9MC 3CCVA 3NFCA 2CT4A 3QWYA 1VUBA 3DKMA 4M77E 2F2CA 3OQ5A 3QJ6A 3MP8A 1AOJA 2R7GA 3RMQA 2PVGB 4CI0C 3NTIA 1KK7A 2RHXA 5ECAA 4ORZA 4BCMB 4ROEA 5IH2A 3VS5A 4BE2A 5J3BA 2RI5A 1K9MR 1OQKA 1I4K1 2DM1A 4M7AC 1OL2B 5D6XA 3CMAA 1VQLQ 3MEUA 2HNIA 4J5YA 2OTJT 2DIQA 3DJBA 3CCRT 3QBYA 1H26B 1TS9A 4BCNB 2E5QA 1LOJA 1O9SA 4YOSA 1TOVA 4F7UF 1NJIR 3OYIA 3G71T 2YWWA 3OSSC 4DEYA 2BE9B 2YXYA 3C12A 1SEMA 2WMAB 4KUDK 2RO0A 4QQDA 2MPXC 1XO2A 1VQ8Q 2PVDB 4M75D 3QHWB 1M2OA 4B9XA 2YDLA 4RKUE 2COWA 3QUIA 1V29B 1WHLA 1R0CB 1QKXA 1W1FA 2KNBB 5FGKB 3CBMA 3MIAB 1RI9A 2LRQA 1JBMA 4J9HA 5CKDA 4C0DB 1IRXA 3CC7Q 2PK9B 2VXFA 3HRTA 3T9NA 4AKHA 3BE3A 4KT0E 1ABQA 4LD6A 3VYHB 5EG2A 5IHNA 1VQNQ 1AISB 4PFPA 4RTWA 2DKGA 1IHVA 2KVQG 2MK5A 1WFWA 1O9KA 4JRIA 2FG0A 4A4GA 4I3ZB 4C5GA 2CGHA 1JKWA 3DOGB 3CCLA 4R0KA 1NPRA 2CSQA 2PVOB 5IDNB 2QGGA 3HZJA 3FDRA 2WJ9A 3SEMA 4AFZC 4PJOC 2I53A 3A8GB 2JW4A 4RTZA 1GFDA 4PLLA 2C0IA 4JLGA 2NUPA 4OVAA 2ROTA 5IT9E 1ENWA 1N27A 2GFUA 4PJLA 3MY5B 5IHIA 2VXEA 2LCSA 5IXBA 2KEAA 1VQMQ 1VQPA 1GCQC 2V22B 1VQKT 3RR6A 4HKEA 3TCJA 1RAAB 7AT1B 3BHTB 3NTHA 4IUQA 1M3BA 1M5Q1 2ZZDB 2DMEA 3CC7T 2KT8A 4JRQA 4UC4A 4N0AA 4Q5WA 2O01E 4XU0A 4MDXA 4OGRB 3VS2A 2FHDA 3E9GA 4XTWA 4CC3A 3F5XB 2L8DA 3M4GA 5CIUA 4C0ZA 4R56A 2QQAA 4X9CA 4CRLB 4BY6B 2KRNA 2CCHB 2LVMA 4BCPB 3JCMf 1LPLA 2ZPBB 4BE1A 1MV3A 2OI3A 2DNUA 1NBEB 3CPWA 1V1CA 1BK2A 1ZSGA 1NYGA 4L5GA 3QDRB 1ZUKA 1Q7YC 3CCRQ 3HFNA 4EOIB 2F2WA 2L3SA 3MKDA 4QVZA 3FEOA 2LT1A 2BS4A 1BKBA 2MOXA 2RJEA 2DBKA 4M7DG 1YWOA 1M30A 1M1FA 8ATCB 4ZN3A 4F7UE 1VQNA 1PKDB 1NJIU 4ZTFA 3S6WA 5KCOA 1VQ7Q 2FVUA 4YTLA 3QYBA 2EGAA 3ASKA 4PKCC 5IDPB 3HB9A 1Q82R 2RI3A 4OMOA 2ZPFB 2EYYA 4M7AF 1OX9A 5HVYB 2QEXT 4M78F 4FW2A 3UPUA 3B57A 3A5ZB 2PUOB 2Y4XA 1VQ5A 2QA4Q 3OYAA 2G6FX 2E12A 2RMOA 4QVDA 2WSFE 1UGSB 3UT1A 5FLXE 4XU3A 2LX7A 2X51A 1Y7XA 1VINA 5GAMg 1QVFP 4EDUA 3GPLA 1YCYA 1VQOT 1IZ6A 1KQSA 3REBB 1BI0A 3OS2A 1YJWA 4FYVB 3VYGB 1N9SA 2KYMA 5AT1B 1YHQQ 3A8MB 3OW2S 4J9CA 2NUTA 3EG9A 1ZX6A 1TFBA 2QG9B 3OW2A 1U1SA 3EJ1B 4RTVA 3OYDA 1YJNA 6AT1B 1WGSA 2LJ0A 4F6WB 3H0IA 1K4US 3HTRA 1M1GA 3I55A 2XIDA 2CDTA 3FRNA 4XU1A 2DIGA 2KYBA 1D0YA 5GJWB 2W10A 4Y91A 5GAN8 3OMGA 3TW6A 4Z6YA 3DL1A 1ZBXA 2VB6A 3P8HA 4M78A 1Q86C 4DEXA 4M7AG 1B7TA 1KJWA 3NHNA 4M75B 4J9EA 3CEYA 2GCXA 5KYUA 3ZBDA 4M77F 2E3IA 2M02A 8AT1B 3DLMA 4OB1B 4RCCA 3CCRA 1TUGB 2AKKA 2YUQA 3NPFA 1TWBA 2LJ1A 1ZBJA 2KROA 3UWNA 3EGDA 2RK2A 3M0TA 3BLRB 4M75C 4HNTA 2P0PA 3JCMh 3M0PA 1G3SA 2JXBA 2C5VB 1G3WA 1VYVA 3JB9F 4BCMD 1BB9A 2DXBA 3I5RA 1RUWA 2Y4YA 2DTOA 4C92C 1M90U 5LJ3g 1W2BA 1BCMA 3O5ZA 2YLBA 4AKIA 3JB9G 3M0UA 3VS0A 5D6WA 4C8QB 2LQKA 2H3EB 1VQ4T 3QIIA 2WXVB 2A28A 1VQ9T 5LJ3h 1YJ9Q 1AWJA 2PU9B 1WZOA 1Y57A 2EKHA 4HXJA 4N4GA 4NL2A 4M7DB 4D8KA 2O9SA 3I35A 4KH0B 5CQXA 2GF7A 2I0NA 4M7AA 2L2PA 3H8ZA 2BZYA 2RJCA 1VQLA 3I56A 4WTOB 1OIYB 1UB4A 4OP0A 2O4XA 2CP2A
chains in the Genus database with same CATH topology
3PNWC 2KMTA 2XKOC 5DY9A 2QA4T 1D3BA 1AHJB 4HLQA 1QVFS 2K5FA 4RCBA 3L42A 4BI8B 2E6NA 4MZPA 1U1TA 2DEQA 1QVPA 4BI3A 3OS1A 1S72T 1VQ5T 3OYMA 3HSBA 2IG0A 2GQVA 2EYQA 2BS2A 2MWOA 2X4WA 2DXTA 5KE2A 2KY9A 3HHTB 3OA6A 4PJOG 2D9TA 2BUDA 1I5LA 1I8FA 1WPYA 3BY7A 3KBGA 4M7AB 1JRIA 4EMKB 2X35A 3QZ5B 2DZCA 3JCMW 5CKBA 3ZEHA 1HK9A 4E7HA 2LCLA 2RM4A 3Q1JA 4FT2A 3QKJA 3CCLT 1B34B 5HK0A 4ATOA 1N9RA 2KQWA 2LTOA 5IN1A 4JX6A 1JB0E 1VQ6T 3SB2A 4C92E 3FB9A 2DO3A 2JOYA 4B9WA 1K73U 4MMKA 2HQEA 3OYGA 2RK1A 1M9SA 2DZ9A 4DQ2A 1O75A 2RA2A 3MHXA 3CD6A 2B8AA 5FU7C 2K5IA 4C92D 3CXCA 2P0KA 3X28B 2EQJA 1LJOA 4TVRA 5CO7A 2R58A 3FC3A 1QLBA 1VQMT 1WQWA 3TU4K 2D0QB 2DXCB 2G3RA 5GANf 3GNGA 2DAQA 3HRUA 5CK9A 3S3OA 3PT9A 4XU2A 3WXMB 3PIPA 1K9MU 3LGFA 2EJ9A 2M0OA 3BDUA 4C0DC 2ZGWA 3RERA 4C8QC 4IUUA 1DJ7B 3ER0A 3KUFA 1K8AU 3LYIA 4L59A 5D6YA 5DLOA 3CC7A 1OZ2A 1M90C 4PJOF 4C92B 4MMLA 1YBYA 3G71A 4IKFA 1BIBA 5DM7R 2QA4A 4PJOC 1BYMA 4JLIA 2ZPHB 5GANg 2MWPA 3BG9A 4DOVA 5LJ5e 3S3MA 3MEAA 4KBMB 3M54A 5A0LA 5GAN4 2PUKB 2C06A 4BDYA 3L1AA 1XNIA 3LX7A 3BFMA 1M4ZA 1QVGA 3MO8A 3C4SA 3SFMA 5GAMd 2K57A 2QTXA 4A4KA 3CCJT 1FWZA 3RKWA 4PJOA 2X4XA 3GOXA 2YHTA 4BY6C 5EJCA 2M1HA 1OYXA 2CZ7B 2QF7A 3OB9A 3GNFB 2LC4A 3MP1A 4A54A 5GAOl 1VQ8A 3LH0A 4KULA 4A4EA 4JS5A 1VQ4A 5CQYA 4ZGEB 1KG1A 4XTYA 3L2QA 3JB9J 1BI2A 3FIFA 2XI9A 3QJYA 2CKKA 5FU6C 4JRPA 1K9MC 3CCVA 2YLCA 3NFCA 5HY6A 4HL4A 4F7UA 5I2MA 1W2BS 3QHSA 4MZTA 5GMKj 1VUBA 3DKMA 4FSXA 4M77E 3JCMe 1NJIC 4M7DE 3OQ5A 3QJ6A 3V7SA 2KSSA 4EMHA 3MP8A 3RMQA 4CI0C 2QQRA 2PVGB 3UDCA 4BBRM 1VIEA 4BUGA 1VQ7A 3M57A 2R5AA 2XHCA 3NTIA 2RHXA 4ZN1A 2QEXA 4OMFB 4IURA 3OYHA 1BI3A 2K2VA 4M78C 1VQLT 4BE2A 2EQMA 2XICA 4M77A 4ME7A 2RI5A 5J3BA 3QZ9B 1K73C 1I4K1 4C8QE 3KHIA 2RJFA 4M7DD 4M7AC 4HNUA 4NC6A 2FYKA 2RHYA 2RHZA 5D6XA 1NPPA 4ELZC 3L2VA 3CMAA 1KHCA 4HCBA 3URGA 4E47A 2JVVA 5LL6S 3MEUA 2HNIA 4J5YA 5AYFA 2HAXA 1OI1A 2NLUA 4J8OA 1QVGS 3GIBA 2DXUA 2K3YA 3GF5A 3V8LA 2DIQA 5GMKl 2CZ0B 3CCRT 2OTJT 3QBYA 1VQ8T 1I81A 4C8QD 2QQ9A 4F7UF 2E5QA 1LOJA 1O9SA 3V8JA 5GANe 3CCQA 2JUFA 1KQSS 1VQNT 4PLIA 1FKMA 3OYIA 3JSCA 4Y28E 3G71T 3OSSC 3PMIA 2LT4A 3PIOA 1YIJT 2EKOA 2HD0A 1E7PA 4C5IA 2MI6A 3C12A 3OYEA 4KUDK 2RO0A 1FX7A 4QQDA 3JCMX 2DXCA 2PVDB 4OB0B 4M75D 2G77A 5DLQE 3CCSA 1G3TA 1H3ZA 3LWIA 4B9XA 4RKUE 5KH6A 3M56A 4XTVA 3QUIA 1V29B 3CC2A 2A3LA 1QP2A 2K3XA 2E10A 1UEBA 4C8QF 2F5KA 5LJ5f 2E65A 3FLGA 2EIFA 3L2UA 3CXCS 2QQ8A 2XK0A 3CCST 1YHQA 2DPPB 3CBMA 4C92A 3CCMA 4MDWA 3JRZA 2LRQA 1D3BB 2A7YA 2DK3A 2QQSA 1Q86U 1JBMA 1ZHIA 4EPCA 1X75C 1VIFA 4E7JA 1H641 3L2ZA 2EFIA 3CPWS 5CKDA 4C0DB 5CVIA 1YITA 1TH7A 2VXFA 3HRTA 3T9NA 4AKHA 2XD0A 4XTUA 3NTKA 4KT0E 4LD6A 5EG2A 3VYHB 1LNXA 4PNOA 3OYFA 2DD4B 3H6ZA 4OGCA 4J7IA 3S3NA 2DKGA 2KVQG 2RHUA 5I21A 2BS3A 1WJSA 3DB4A 3RESA 2ZPEB 1X01A 4C0GA 3VKIA 2ZCFB 3EFSA 4A4FA 3QXEB 2QDYB 4JRIA 3SDZA 4OF1A 5GAMf 4A4GA 1S72A 2E6ZA 4C5GA 2CGHA 4BE0A 5CKEA 1G3YA 1W4SA 2VGNA 1XQHA 3CCLA 2KDSA 2YRVA 4FT4A 3CC2T 4ZGJB 1NPRA 2EQUA 4FM4B 3FJPA 3OYBA 2I2LA 3CPFA 1NE8A 2PVOB 2L5QA 3H4CA 2XU8A 4P5NA 5FU6B 5GAN2 3SWNC 4A4HA 4Z02A 1SSFA 2XDDA 2OAUA 4AI6A 1BI1A 4LDVA 3HZJA 3FDRA 3P8BB 2WJ9A 2LX9A 3VUZA 5IAYA 3CCVT 3G6EA 2QDJA 3A8GB 5LJ3j 3JCMb 1YIJA 3WVEB 1HXDA 2AHJB 3TREA 4HA8A 3EFRA 4PLLA 4QSHA 4M6VA 3ZFJA 3CC4T 2R5MA 2X4JA 2IVWA 2R57A 2EJGA 4JLGA 3M5AA 3HP9A 4OVAA 5LJ5g 5IT9E 4WF2A 1BIAA 3BW1A 1G5VA 5FU7B 1N27A 2GFUA 2VXEA 2P4TA 4M78G 2V8KA 3SWNB 3CCJA 1VQPA 3DB3A 3CMAT 1VQKT 1VQKA 3CCET 3JB9I 1JJ2A 2CYZB 2V8JA 1Y96A 4HKEA 3TCJA 5LJ3e 1VQOA 4PJOE 3JAME 4M77D 4MFDA 3E1SA 1VQ9A 4OGEA 3NTHA 4IUQA 2OTLA 3G4ST 1QVFA 4HNVA 1KD1C 3OYYA 3M53A 1WJQA 4FL6A 5A0DA 1M5Q1 5GAN3 4LDYA 4XQ3A 3OYKA 2ZZDB 2WSEE 3SD4A 1N8RC 3A8LB 3G7ZA 1P92A 4JDSA 3G6ET 3CC7T 4JRQA 4UC4A 4N0AA 4C8QA 3OBYA 3VJPA 4J7FA 2VGMA 2O01E 4Q5WA 4XU0A 4MDXA 5FROA 3HL8A 5GAOq 1Y96B 1GXIE 3CMET 4ZTJA 4CRIA 2FHDA 3E9GA 4XTWA 2H3JA 2RJDA 3E19A 1Q82U 4XTZA 2L8DA 4DOWA 3X20B 5LJ5j 3M4GA 4JS4A 1VQMA 5CIUA 3JCMg 4JUVA 4FU6A 4M75A 3MP6A 5LJ5h 1MGQA 4C0ZA 2FB7A 4BDZA 4N0AC 3M9QA 3V7CA 4HCCA 4HT9A 4R56A 3EAEA 2M9UA 2JTFA 1KC8U 4M78B 2V8IA 3JCMQ 4LDXA 4E7KA 1UGPB 2QQAA 4II1A 4X9CA 5J26A 3VUBA 5J39A 1YJ9A 1M8VA 5GAN6 4N4IA 4BY6B 3OYCA 2E64A 1QP3A 2LVMA 2WACA 5GAN5 3JCMf 4M7DC 1Y71A 4BB7A 2ZPBB 1OZ3A 4BE1A 4LDWA 4M78D 3L2WA 3JCMV 5C6SA 3L2RA 5GMKm 5GAMe 3CPWA 2RD1A 5GMKi 4FIBA 3MEVA 3BDLA 3C94A 4L5GA 3OYLA 3QDRB 2LCCA 1Q7YC 3CMEA 3BG5A 3HFNA 5L8RE 2KMGA 2WSCE 2X4YA 2EWNA 2LT1A 3FEOA 4QVZA 2BS4A 3C95A 3QSUA 3QYEA 2DD5B 4QQ6A 2JTMA 1BKBA 2RJEA 2M16A 2E70A 4M7DG 3HRSA 2DVEA 1M1FA 5GAMj 3OYNA 5GAOr 3JB9D 4ZN3A 4F7UE 1VQNA 4XTXA 3GP8A 2RHIA 2DD4A 4ZTFA 3J81E 3OYJA 3META 3S6WA 3VYGA 3I55T 5KCOA 1NJIU 1N6AA 2OTJA 3GLXA 3PGGA 3A8OB 5FRNA 4QQGA 4IUPA 3RKYA 2FVUA 1EIFA 4E7LA 3INZA 1JJ2S 4LOCA 3X25B 4YTLA 1YJWT 3A8HB 3QYBA 3ASKA 3RMSA 3HO8A 4PKCC 4C5HA 4BBSM 4NS5A 4OB2B 2HQXA 4NL3A 4X34A 3HB9A 4IUVA 2RI3A 2ZPFB 3OMCA 2QQBA 4GLKA 3CCQT 4M7AF 2EJFA 1MHNA 5GAN7 2QEXT 4V2SA 3E9FA 4M78F 3AHUA 4PJOB 3LWHA 3UPUA 3CC4A 1UGQB 2L3RA 4F7UB 2JN0A 2ZPIB 4XAXB 3MEWA 1XTDA 3X26B 1XOVA 3A5ZB 2EQKA 2PUOB 3QG1A 1YI2T 2Y4XA 5GANd 2K5LA 1VQ5A 2K4YA 4D6WA 3HBLA 3OYAA 3KXTA 3JB9H 3BG3A 5GAMh 2E12A 3HFOA 3VKHA 2CS7A 3HKSA 4M75F 2WSFE 4QVDA 5M9OA 5GAOn 1UGSB 1WNLA 4XK8E 4M77B 3UT1A 5FLXE 3G4SA 4XU3A 3JCMP 1Y7XA 2DD5A 4M75E 4M7AD 2KK4A 3M59A 4C92F 4X9DA 5GAMg 4EDUA 2L89A 2KR6A 1YCYA 1IZ6A 3GPLA 1VQOT 1Q81C 1KQSA 1K8AC 1BI0A 3OS2A 4ELJA 2MAMA 3OBWA 3TEEA 1YJWA 4GY5A 5CCAA 1M1KU 2BIVA 3JCMc 3VYGB 1N9SA 1M1KC 1R8OB 4N4HA 4RG2A 3F70A 4JX4A 4PL6A 2E41A 1Q81U 1KQ1A 3X24B 3A8MB 4M78E 2LNVA 3OW2S 1RI0A 3QYGB 2Y90A 3PMTA 3VU3C 4C5EA 1PSEA 4MFEA 4RG8A 1RL2A 3OW2A 1U1SA 4QW2A 5GANh 3OYDA 4EMKC 2QI2A 4IUTA 3CBOA 4C92G 2DJZA 1YJNA 2KAFA 1WGSA 3M58A 4AKGA 4NOYA 2VUBA 2RH2A 5CKHA 3CCMT 1KHIA 4J6YA 5GMKh 1YHQT 2GFAA 1M1GA 3I55A 2XIDA 3LLRA 1N8RU 4BI4A 3RUXA 3FRNA 2VV5A 4XU1A 2XDPA 2DIGA 3HPWA 3J7AF 3QYHB 1IREB 2EAYA 4EMKA 2F5TX 3WVDB 4Y91A 4ZGDB 5GAN8 5CR2A 1WJRA 3OMGA 2MF2A 2LQ8A 2BKDN 3TW6A 1KQ2A 4Z6YA 3DL1A 1ZBXA 2RI2A 2MMPA 3P8HA 3RIRA 4E7IA 3V7RA 4M78A 4RMOA 1Q86C 3PFSA 1ZQ1A 2P0QA 3OS5A 4M7AG 4JX5A 1YJ9T 4M75B 3VKGA 1QW1A 2VYTA 3CEYA 2GCXA 3LGLA 1B34A 3ZBDA 3QWLA 5GAOp 4M77F 1Y07A 4R55A 3DLMA 4J6WA 5C0MA 4OB1B 5GMKe 3O8VA 5GANj 3CD6T 1YITT 3V8KA 4RCCA 4J6XA 4KUIA 3CCRA 2XDBA 4EMGA 3OSVA 4A53A 1UGRB 4M75G 4F7UG 4QVCA 4OB3B 4LDUA 4BD3A 5I2SA 4O6JA 4J83A 4C8QG 3OS0A 1VQ6A 3UWNA 4BACA 2RK2A 4M7DF 2F69A 1NZ9A 4MIMA 2E1HA 3MCAB 4M75C 4M77C 1Q7YU 2PQWA 4HNTA 2P0PA 3JCMh 4HT8A 3PTAA 5CKFA 1G3SA 1WQ7A 3R6OA 1G3WA 5A2QE 3JB9F 2JZ2A 4M77G 2DXBA 4PJOD 2ZPGB 2Y4YA 5A0GA 2DTIA 3LW5E 5LJ3d 4VUBA 2DTOA 4C92C 1M90U 5LJ3g 5LJ3f 1W2BA 3TW7A 3ME9A 3P8DA 2YLBA 4AKIA 2LDMA 3CCEA 4HCZA 5KE3A 1PSFA 5LJ5d 3JB9G 2DXBB 4O5VA 5HK3A 1YI2A 2CZ6B 1YJNT 1VQPT 2CZ1B 2QFZA 3QO3A 1KC8C 5FRMA 5D6WA 3VV0A 2LQKA 4C8QB 4ELYC 5KCHA 5HKCA 5GAOm 1VQ4T 3QIIA 2OTLT 4DA4A 2DTHA 1VQ9T 3RKXA 2ZZDA 4JRKA 5LJ3h 2RB6A 1FXXA 2O4XB 2PU9B 1Q82C 3I56T 1X6OA 3DLLA 4JJNK 3M55A 2HBPA 4N4GA 3CCUA 2XG8D 4NL2A 4M7DB 3JCMd 3J80E 3OY9A 4LD9K 5CQXA 2GF7A 1U8RA 4L6V5 4M7AA 2FL7A 2JNGA 3H8ZA 4MZMA 3CCUT 2RJCA 2D6FA 1VQLA 3JCMJ 3I56A 4C0FA 5CAIA 1UB4A 3CBPA 3SWNA 4M7DA 2QXFA 1VQ7T 3N5BB 3M4YA 3QPHA 1KD1U 4OP0A 2VC8A 2O4XA 4M7AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZD B;  1AHJ B;  2WSE E;  3A8L B;  3X24 B;  3A8M B;  2CZ0 B;  3QYG B;  2O01 E;  1PSE A;  3HHT B;  1GXI E;  4Y28 E;  3QZ5 B;  3X20 B;  2DXC A;  2PVD B;  4OB0 B;  1JB0 E;  4RKU E;  3QYH B;  1UGP B;  1V29 B;  1IRE B;  1QP2 A;  3WVD B;  4ZGD B;  1QP3 A;  2ZPB B;  2DPP B;  3X28 B;  2D0Q B;  2DXC B;  5L8R E;  2WSC E;  4OB1 B;  4KT0 E;  3VYH B;  2DD4 B;  1DJ7 B;  2DD5 B;  1UGR B;  4OB3 B;  2ZPE B;  2ZPH B;  2ZCF B;  3QXE B;  2QDY B;  2DD4 A;  3VYG A;  3A8O B;  2PUK B;  3X25 B;  4ZGJ B;  4FM4 B;  2DXB A;  3A8H B;  2PVO B;  2ZPG B;  4OB2 B;  3LW5 E;  2CZ7 B;  2ZPF B;  1PSF A;  2DXB B;  3A8G B;  4ZGE B;  3WVE B;  1UGQ B;  2CZ6 B;  2AHJ B;  2CZ1 B;  2ZPI B;  3X26 B;  2PUO B;  2ZZD A;  2PU9 B;  2WSF E;  1UGS B;  4XK8 E;  2PVG B;  2DD5 A;  4L6V 5;  2CYZ B;  3QZ9 B;  3VYG B; 
#chains in the Genus database with same CATH topology
 1Q81 R;  1D3B A;  1AHJ B;  4RCB A;  3OS1 A;  1VQ5 T;  1QVP A;  3HSB A;  1S72 T;  3CMA Q;  3PO3 S;  1MMD A;  2BS2 A;  2DXT A;  3REA B;  3HHT B;  2X3X D;  1I5L A;  1Q86 R;  3CME Q;  3QZ5 B;  4EOK B;  1FMV A;  5CKB A;  1H4L D;  4E7H A;  1WYX A;  1QLY A;  2LTO A;  4AG1 C;  3PVL A;  2J05 A;  2RNA A;  4FCY A;  2DO3 A;  3G1J A;  2CH4 W;  2VVK A;  2OTJ Q;  1RAF B;  2AT1 B;  1SHG A;  1M2V B;  2B8A A;  2P0K A;  2EQJ A;  1QLB A;  1TG0 A;  3RBB B;  2G3R A;  4OMP A;  3VS6 A;  2DAQ A;  3PIP A;  5KYX A;  5DQW A;  3LGF A;  2DMO A;  2EJ9 A;  2M0O A;  3RER A;  2NWM A;  3CC7 A;  1IGU A;  1VOM A;  1OU9 A;  3G71 A;  3I5S A;  3TVT A;  1YJW Q;  4JLI A;  5FWC A;  1ZUY A;  2MWP A;  1D1A A;  4DOV A;  5LJ5 e;  3G4S Q;  4TTH A;  4F70 B;  3M54 A;  5GAN 4;  4LUE A;  2ZAE A;  4BDY A;  4FYY B;  1XNI A;  4J9I A;  3THK A;  2WPA B;  1W70 A;  2CP5 A;  5HBE B;  4PJO A;  3GOX A;  2YHT A;  1LCK A;  4NST B;  3M0S A;  3MP1 A;  1VQ8 A;  3TSW A;  2RPN A;  1H27 B;  1KG1 A;  4BCI B;  2PHG A;  2EPD A;  2DL8 A;  2CKK A;  3EGX A;  5FU6 C;  4HL4 A;  4MZT A;  5GMK j;  4RTY A;  4M7D E;  1OIU B;  3UDC A;  4BBR M;  2O9V A;  4BUG A;  2XHC A;  3OYH A;  1GBR A;  3OW2 P;  2EQM A;  2XIC A;  4J9F A;  3KHI A;  2KGT A;  3NMZ C;  1K0S A;  2RHY A;  3URG A;  1S1N A;  2WIH B;  2JVV A;  5AYF A;  1OI1 A;  4J8O A;  2K3Y A;  3GF5 A;  3V8L A;  5GMK l;  1QCF A;  1WXT A;  3E2U A;  3VS1 A;  4OR5 B;  3CCQ A;  1MMN A;  2DER A;  2ATC B;  1WIE A;  2LT4 A;  3PIO A;  1E7P A;  4C5I A;  1FX7 A;  3JCM X;  2DXC A;  1NEG A;  1G8X A;  1TXQ A;  2G77 A;  5DLQ E;  1SPK A;  2O31 A;  1UG1 A;  5KH6 A;  3A98 A;  4XTV A;  3RNJ A;  1NLO C;  1QP2 A;  4C8Q F;  1TUD A;  2QAS A;  5LJ5 f;  2E65 A;  3FLG A;  3CXC S;  3CCS T;  4C92 A;  4MDW A;  2A7Y A;  2DK3 A;  1B3Q A;  1H64 1;  2YRC A;  1TH7 A;  2QAZ A;  2XD0 A;  3NTK A;  1UTI A;  4OGC A;  4OML A;  1PG5 B;  1IXD A;  1GL5 A;  2UUE B;  1MMG A;  3VKI A;  1W2B P;  4A4F A;  2QDY B;  4ESR A;  1QVG P;  2HKQ B;  2QGF B;  5CKE A;  1G3Y A;  1OPL A;  2LNH B;  1W4S A;  2J6K A;  4FT4 A;  1FVV B;  4ZGJ B;  2D0N A;  2EQU A;  3OYB A;  1FIN B;  2I2L A;  1UHF A;  3CPF A;  4AG2 C;  4P5N A;  5FU6 B;  4A4H A;  1SSF A;  2I40 B;  2XDD A;  1KC8 R;  3D7S B;  3O0G D;  1PKT A;  2DL5 A;  3VUZ A;  5IAY A;  3CCV T;  3G6E A;  3JCM b;  3WVE B;  2DIL A;  3TRE A;  4KRC B;  3NGP A;  1IB8 A;  3CC4 T;  2R5M A;  4PFZ A;  3M5A A;  3HP9 A;  2FRW A;  1H8K A;  4WF2 A;  1BIA A;  4LXC A;  5FU7 B;  3H0F A;  4G6L B;  1ZSZ B;  2WMB B;  4M78 G;  3CMA T;  2MIO A;  2L0A A;  5LJ3 e;  5IHK A;  3EH2 A;  4M77 D;  3JAM E;  1FYN A;  2W9F A;  4MFD A;  3E1S A;  1VQ9 A;  2OTL A;  3H41 A;  4HNV A;  3M53 A;  1WJQ A;  2WSE E;  2EYW A;  3SD4 A;  3G7Z A;  3EGU A;  3G6E T;  1GBQ A;  3VJP A;  3CQT A;  3EHR A;  3EG1 A;  4AFS C;  5GAO q;  1Y96 B;  1JXM A;  3CME T;  4ZTJ A;  4CRI A;  1X2K A;  3CCS Q;  2H3J A;  2HBW A;  3E19 A;  4XTZ A;  3X20 B;  1SSH A;  3JCM g;  4FU6 A;  1YJN Q;  1ZP2 A;  3MP6 A;  4BDZ A;  3V7C A;  4HCC A;  4HT9 A;  3EAE A;  2M9U A;  2BPM B;  1N8R R;  1YJ9 A;  4II1 A;  2E64 A;  1QP3 A;  2WAC A;  4M7D C;  1Y71 A;  4BB7 A;  1OZ3 A;  2CUB A;  4M78 D;  2LP5 A;  5C6S A;  3L2R A;  2RD1 A;  4FIB A;  2W0Z A;  2K6D A;  3BG5 A;  5L8R E;  2WSC E;  2X4Y A;  1M1K R;  2HL5 C;  3QYE A;  2DD5 B;  4QQ6 A;  2E70 A;  3OYN A;  2KT1 A;  5GAO r;  4CFX B;  4BY7 X;  2DD4 A;  2RHI A;  3I55 T;  3MET A;  1N6A A;  1OGU B;  5FRN A;  1EIF A;  4E7L A;  1JJ2 S;  3X25 B;  3IQL A;  2E3H A;  1SRL A;  2EGE A;  3A8H B;  4C5H A;  4BBS M;  2HQX A;  4X34 A;  4EOM B;  4IUV A;  3OMC A;  2EJF A;  1MHN A;  2YUO A;  1OEB A;  2CUD A;  2MYS A;  3E9F A;  4PJO B;  1RAE B;  1UGQ B;  2L3R A;  1TSF A;  2JN0 A;  2ZPI B;  3MEW A;  1AEY A;  2LW4 A;  2YT6 A;  2X9H A;  4RUG A;  5GAN d;  2K5L A;  2K4Y A;  1EZZ B;  1X2Q A;  1IHW A;  1J3T A;  5GAM h;  5M9O A;  1QCN A;  4PJN A;  3QHR B;  2YUP A;  4A63 B;  3JCM P;  2P84 A;  4M7A D;  3POM A;  3EFO B;  4E6R A;  1K0X A;  4ELJ A;  1OU8 A;  3OBW A;  3SHW A;  3TEE A;  4GY5 A;  3U23 A;  2E4H A;  1M1K U;  3EG3 A;  3JCM c;  1M1K C;  1R8O B;  1UJ0 A;  2E41 A;  2A36 A;  1SF9 A;  3X24 B;  3NDQ A;  2LNV A;  2OTL Q;  1C9B A;  3PMT A;  4RG8 A;  4MFE A;  4JJD A;  1S72 Q;  5KYN A;  4KRD B;  4C92 G;  2DJZ A;  2XMF A;  4CC2 A;  4AKG A;  4NOY A;  1X69 A;  4ZNX A;  4F6U B;  5CKH A;  1KHI A;  1VYT A;  2GFA A;  1N8R U;  4BI4 A;  2EAY A;  4BCJ B;  2F5T X;  3CCL Q;  2MF2 A;  2LQ8 A;  2A08 A;  4Y72 B;  3V7R A;  4E7I A;  2HL3 A;  3PFS A;  2QGS A;  4JX5 A;  2C0T A;  4BCK B;  1YJ9 T;  3LGL A;  1B34 A;  1PWT A;  2F1L A;  5GAO p;  3CD6 Q;  1Z9Q A;  2LQW A;  4KRT A;  5GMK e;  3O8V A;  3CD6 T;  1KD1 R;  1YIT T;  3V8K A;  4J6X A;  2GGR A;  2XDB A;  1UGR B;  4O6J A;  3PVQ A;  2J6O A;  4J83 A;  4C8Q G;  3CCU Q;  1VQ6 A;  1NZ9 A;  4F16 A;  4M77 C;  2PQW A;  4HT8 A;  3UA7 A;  5A2Q E;  2GBQ A;  4M77 G;  4PJO D;  5HBJ B;  5A0G A;  3LW5 E;  2BKZ B;  1MND A;  2DL3 A;  1GY3 B;  2LDM A;  3CCE A;  5KE3 A;  1PSF A;  2DXB B;  2F2X A;  1VQP T;  2CZ6 B;  1RAC B;  1JJ2 P;  1KC8 C;  2RF0 A;  1X6B A;  5GAO m;  2OTL T;  2DEU A;  4JRK A;  2IW8 B;  1Q82 C;  4JJN K;  3OY9 A;  1WHM A;  2QK0 A;  2O2O A;  1U8R A;  1WHG A;  4EON B;  3G33 B;  2HEQ A;  4DBH A;  4C0F A;  5CAI A;  1UJY A;  2FPE A;  3N5B B;  1KD1 U;  9ATC B;  3VS7 A;  2VC8 A;  3LX7 A;  4QKU A;  2PTK A;  3PNW C;  2XKO C;  4HLQ A;  4RTT A;  2C5N B;  2K5F A;  1QVF S;  2E6N A;  4MZP A;  1Q95 G;  1NG2 A;  4Z8A A;  2KY9 A;  1Q7Y R;  2D9T A;  1WPY A;  1JRI A;  2X35 A;  2DZC A;  3ZEH A;  2CP3 A;  1HK9 A;  4FYX B;  5L2W B;  2IW6 B;  4FT2 A;  2A37 A;  3QKJ A;  1YIJ Q;  4ATO A;  2NUP B;  4FW1 A;  2K9G A;  4JX6 A;  3SB2 A;  4C92 E;  3FB9 A;  2JOY A;  2EW3 A;  3OYG A;  3DDQ B;  2DZ9 A;  4DQ2 A;  2BZX A;  2JT4 A;  2FPF A;  2AZS A;  4C92 D;  2ECZ A;  3VRY A;  1LJO A;  2R58 A;  3FC3 A;  1VQM T;  3TU4 K;  4BCH B;  3GNG A;  3S3O A;  2JTE A;  1K9M U;  4JZ4 A;  1OPK A;  3UF4 A;  4C0D C;  4IUU A;  2HCK A;  2CT3 A;  3ER0 A;  3EHQ A;  4L59 A;  5D6Y A;  5DLO A;  1M90 C;  1UEC A;  4C92 B;  2QA4 A;  3BG9 A;  4EOL B;  2EUF A;  1HYO A;  2C06 A;  2DET A;  4BCQ D;  4B6M A;  1SHF A;  5GAM d;  2QTX A;  4A4K A;  2CH4 A;  3CCJ T;  3RKW A;  2SRC A;  4BY6 C;  1OYX A;  3OB9 A;  5IXF A;  2MCN A;  4A54 A;  5ACB A;  1MV0 B;  2Z0W A;  4CFU B;  1V76 A;  3FIF A;  3C0C A;  4JRP A;  1H28 B;  2YLC A;  3G6E Q;  5HY6 A;  4F7U A;  2K7A A;  1W2B S;  3QHS A;  4LN2 A;  2OJ2 A;  4Z88 A;  1WXU A;  1BU1 A;  1PHT A;  2QTV A;  3V7S A;  4BCG B;  5KYW A;  1NEB A;  2LJ3 A;  1VIE A;  2AKL A;  2R5A A;  4OMF B;  2SEM A;  4IUR A;  1VQL T;  4M77 A;  4ME7 A;  3QZ9 B;  3PE0 A;  4KH1 B;  2FYK A;  2RHZ A;  4HCB A;  2JJ9 A;  1KHC A;  4ANJ A;  4CFN B;  1QVG S;  2CZ0 B;  1HD3 A;  2K2M A;  1VQ8 T;  1ACM B;  1I81 A;  1VOL A;  2QQ9 A;  4LE9 A;  2COZ A;  1KQS S;  3V8J A;  2DL7 A;  2JUF A;  4PLI A;  3JSC A;  4Y28 E;  1CKA A;  2HD0 A;  1N4M A;  2EYZ A;  2BE7 D;  2K79 A;  1NYF A;  4OB0 B;  1M27 C;  4KGX B;  1H3Z A;  4E7S A;  2YRD A;  2D8H A;  3M56 A;  3TSZ A;  4GBQ A;  2A3L A;  3CXC P;  3CCE Q;  2K3X A;  2E10 A;  1P5E B;  2J6F A;  2EIF A;  1KIK A;  2V26 A;  5IF1 B;  3DTO A;  2DPP B;  3CCM A;  2PNI A;  3JRZ A;  2QQS A;  1ZHI A;  4EPC A;  1VIF A;  4E7J A;  1T3L A;  3CPW S;  2EFI A;  1C0M A;  4WCI A;  4F14 A;  5CVI A;  4XTU A;  3OYF A;  2WFY B;  4PNO A;  2J06 A;  4J7I A;  3S3N A;  4DBR A;  3AT1 B;  2BS3 A;  1WJS A;  1M2V A;  3TNH B;  3RES A;  3I55 Q;  2ZPE B;  2LQN A;  5KYY A;  4C0G A;  3SDZ A;  4OF1 A;  1S72 A;  2E6Z A;  4BE0 A;  3CCJ Q;  2PZ1 A;  4F7J B;  1ZSZ C;  1XQH A;  1AT1 B;  1U06 A;  1Z9Z A;  2CP0 A;  1W6X A;  2XU8 A;  2L5Q A;  2B86 A;  1C1A A;  1VYW B;  4Z02 A;  2OAU A;  4EOQ B;  3P8B B;  1YP5 A;  2LX9 A;  2QDJ A;  5LJ3 j;  1YIJ A;  2AHJ B;  1NM7 A;  4IIM A;  4HA8 A;  4QSH A;  2QDL A;  2EJG A;  1UE9 A;  1WX6 A;  3LQ5 B;  4EIK A;  2DE0 X;  4K11 A;  1O9K B;  1M8M A;  2P4T A;  2V8K A;  3CCJ A;  3DB3 A;  1VQK A;  3CCE T;  3JB9 I;  2V8J A;  2C4G B;  1VQO A;  1RAB B;  4IMY B;  1FMW A;  1PC0 A;  3G4S T;  4BXX X;  1VQ6 Q;  1KD1 C;  4FL6 A;  1N8R C;  4LDY A;  1RAG B;  1P92 A;  4IIO A;  4JDS A;  1BCO A;  1JEG A;  4C8Q A;  3OBY A;  4J7F A;  4F7N B;  5FRO A;  1YCS B;  1AWW A;  2RJD A;  4JJB A;  1Q82 U;  1GCP A;  2CP6 A;  4DOW A;  2FPD A;  5LJ5 j;  5LJ5 h;  1E6H A;  2HKN A;  3M9Q A;  1T0H A;  2JTF A;  2HSP A;  1UGP B;  3VUB A;  4N4I A;  2IN3 A;  3OYC A;  2W99 A;  5GAN 5;  4LDW A;  3MJX A;  4Y92 A;  2DA9 A;  4E7Z A;  5GMK m;  5GAM e;  4DBF A;  3OYL A;  3C94 A;  1AVZ C;  5GJV B;  2LCC A;  3CME A;  1NLP C;  1PRL C;  2EWN A;  4OMN A;  5HNB B;  2KR3 A;  1EX4 A;  5GAM j;  3JB9 D;  5EFQ B;  2JMC A;  2RQU A;  3TNI B;  3M0Q A;  3J81 E;  3OYJ A;  2OTJ A;  4EOJ B;  3PGG A;  4QQG A;  3RKY A;  3MI9 B;  4FSS A;  2K3B A;  2X1N B;  1I5O B;  2A0F B;  4CXA B;  3H9N A;  1D0X A;  5HQ0 B;  4AT1 B;  1Q86 U;  3EFO A;  3RMS A;  3HO8 A;  2KXD A;  4NL3 A;  2LMJ A;  4GLK A;  1C6V X;  3JV3 A;  2RQT A;  3AHU A;  4V2S A;  1QMC A;  3LWH A;  4Z89 A;  4BCF B;  2KRS A;  2FZG B;  2NUT B;  4HVU A;  4BAC A;  1XTD A;  1XOV A;  1YI2 T;  2EQK A;  3QG1 A;  1WXB A;  4PK4 A;  2EYX A;  1QMZ B;  4D6W A;  3KXT A;  2W9Z A;  3JB9 H;  3VKH A;  1MMA A;  4M75 F;  4XK8 E;  4M77 B;  2DD5 A;  4M75 E;  2KK4 A;  2L89 A;  2KR6 A;  1Q81 C;  1K8A C;  5KYW B;  4EOS B;  2MAM A;  1UNG D;  1QKW A;  2ENM A;  5CCA A;  2BIV A;  3I56 Q;  4RG2 A;  4JX4 A;  1Q81 U;  4M78 E;  2OX7 A;  2D8J A;  3RDV A;  3VU3 C;  4C5E A;  1RL2 A;  4QT7 A;  4QW2 A;  3MY1 B;  4EMK C;  2PMI B;  2QI2 A;  4IUT A;  3CBO A;  2KAF A;  2KE9 A;  2DL4 A;  3CCM T;  4F7L B;  5CEI B;  5D7U A;  3LLR A;  2L3Q A;  3RUX A;  3HPW A;  3J7A F;  3QYH B;  4EMK A;  1WA7 A;  3WVD B;  1KQ2 A;  2MMP A;  1ZQ1 A;  2P0Q A;  2IW9 B;  3OS5 A;  4ROD A;  1TUC A;  2VKN A;  4R55 A;  4J6W A;  5GAN j;  5C0M A;  5I11 A;  2WIP B;  5DQV A;  1YN8 A;  4KUI A;  1K8A R;  2W2H A;  4YOO A;  4A53 A;  4QVC A;  5I2S A;  1H1R B;  1ZSZ A;  4CFW B;  4M7D F;  2F69 A;  4CFV B;  2E1H A;  2F2V A;  5CKF A;  1WQ7 A;  3R6O A;  2GTO A;  2KI7 A;  2JZ2 A;  4AFU C;  4LNP A;  2YSQ A;  5LMK B;  5LJ3 d;  2YUN A;  5LJ3 f;  3P8D A;  3ME9 A;  1FMK A;  5LJ5 d;  1K1Z A;  5HK3 A;  1YJN T;  4J9D A;  2QFZ A;  3QO3 A;  5FRM A;  2G9X B;  1ARK A;  3VV0 A;  5HKC A;  4DA4 A;  3RKX A;  2ZZD A;  4CFU D;  2RB6 A;  2VAS A;  1FXX A;  2X3W D;  1PD0 A;  3I56 T;  1X6O A;  2DF6 A;  1GUX B;  1UUE A;  3QDF A;  4PJM A;  2DRK A;  2ABL A;  3J80 E;  4HVV A;  2UZD B;  4L6V 5;  2JNG A;  3CCU T;  2FZK B;  2JS2 A;  2CCI B;  3JCM J;  2IVX A;  5I5Z B;  4BCQ B;  5I22 A;  1VQ7 T;  3QPH A;  3M4Y A;  2DBM A;  2C0O A;  3BLQ B;  4M7A E;  2QA4 T;  2KMT A;  5DY9 A;  1ZUU A;  4CC4 B;  2KBT A;  4BI8 B;  3L42 A;  3EG0 A;  3VS3 A;  4BI3 A;  3OYM A;  2IG0 A;  3BLH B;  2GQV A;  2EYQ A;  2X4W A;  5KE2 A;  3OA6 A;  1ZA2 B;  4PJO G;  2JM8 A;  2BUD A;  3KBG A;  3JCM W;  1JQQ A;  2RM4 A;  5BNJ B;  2CSI A;  3Q1J A;  3CCL T;  1AD6 A;  4BCO B;  4RTU A;  5HK0 A;  3K7A M;  4PFO A;  2O88 A;  2J7I A;  1JB0 E;  4ROC A;  4FYW B;  3VS4 A;  4B9W A;  2RK1 A;  5EC7 A;  1O75 A;  5CYI B;  2RA2 A;  3CXC A;  5FU7 C;  2K5I A;  5CO7 A;  2V1Q A;  1TU0 B;  2DXC B;  1I1J A;  3HRU A;  4DBQ A;  5CK9 A;  1R0B G;  4XU2 A;  2C6T B;  1H25 B;  4GLM A;  1GFC A;  2ZGW A;  1RLQ C;  3TN8 B;  1DJ7 B;  1OX8 A;  1AZG B;  2C5X B;  1K8A U;  1H1Q B;  1OZ2 A;  4PJO F;  5LQF B;  4MML A;  1YBY A;  1RAD B;  4EOR B;  1BIB A;  1CKB A;  3VRZ A;  5GAN g;  1K76 A;  3S3M A;  4KBM B;  2PUK B;  3BFM A;  1H92 A;  3MO8 A;  3SFM A;  2K57 A;  2LZ6 B;  4CC7 A;  1M90 R;  2X4X A;  1T3S A;  1F5Q B;  4CFM B;  2E5K A;  2CZ7 B;  2QF7 A;  3GNF B;  5GAO l;  4A4E A;  4JS5 A;  1VQ4 A;  3EID B;  5CQY A;  2KXC A;  4XTY A;  2EVR A;  3CCQ Q;  1BI2 A;  4LUD A;  1KQS P;  1E7O A;  1ABO A;  5I2M A;  3FJ5 A;  2ED0 A;  1G2B A;  3JCM e;  1NJI C;  2KSS A;  4F6S B;  4EMH A;  3CCM Q;  2QQR A;  2CJM B;  4D8D A;  1VQ7 A;  4EC8 B;  2M51 A;  3M57 A;  4ZN1 A;  2QEX A;  1XJW B;  2RQW A;  1BI3 A;  2K2V A;  2CRE A;  4M78 C;  2JMA A;  3BHV B;  2DYB A;  1VQK Q;  1K73 C;  4C8Q E;  4M7D D;  2RJF A;  4HNU A;  4NC6 A;  1NPP A;  4ELZ C;  3L2V A;  4E47 A;  5LL6 S;  2COY A;  2HAX A;  1RLP C;  2HQH A;  2NLU A;  3GIB A;  2DXU A;  5ICP B;  4C8Q D;  1AWO A;  5GAN e;  1VQN T;  1HJD A;  1N5Z A;  1FKM A;  1PD1 A;  3BHU B;  3PMI A;  1YIJ T;  2EKO A;  3A1P A;  2MI6 A;  1OUL A;  3M0R A;  3OYE A;  3CCS A;  1G3T A;  4KGZ B;  3LWI A;  1VA7 A;  4JJC A;  2WHB B;  3CC2 A;  1UEB A;  1YI2 Q;  2F5K A;  4BCN D;  3MPU B;  3L2U A;  2WEV B;  2QQ8 A;  2XK0 A;  2DFU A;  1YHQ A;  4YOZ A;  2DX1 A;  3DDP B;  1D3B B;  2AK5 A;  1X75 C;  3L2Z A;  1YIT A;  4AMC A;  3CPW P;  2H8H A;  3G71 Q;  1LNX A;  4JZ3 A;  2DD4 B;  2JS0 A;  3H6Z A;  3R6N A;  2RHU A;  5I21 A;  3DB4 A;  1X01 A;  1K9A A;  2ZCF B;  3EFS A;  3QXE B;  3ULR B;  1T0J A;  3CC2 Q;  5GAM f;  4HVW A;  1WHH A;  2JM9 A;  1Y0M A;  1E6G A;  2VGN A;  1UNL D;  2KDS A;  2YRV A;  3CC2 T;  1OL1 B;  4FM4 B;  4BY1 X;  3FJP A;  1NE8 A;  3H4C A;  2NYS A;  5GAN 2;  5FW9 A;  3SWN C;  3CC4 Q;  3KFV A;  4AI6 A;  1BI1 A;  4LDV A;  3H0H A;  3CCV Q;  1HXD A;  3EFR A;  3ZFJ A;  4M6V A;  4OMQ A;  2PJQ A;  2AIR B;  2X4J A;  2IVW A;  2R57 A;  5LJ5 g;  3BW1 A;  3I9Q A;  2UZL B;  3EGD B;  1G5V A;  1IO6 A;  3SWN B;  2JGZ B;  1BBZ A;  1JJ2 A;  2CYZ B;  1Y96 A;  1URC B;  4PJO E;  1F1B B;  1WDX A;  4OGE A;  1QVF A;  3OYY A;  3OYK A;  5GAN 3;  4XQ3 A;  3A8L B;  2VGM A;  1QCO A;  3HL8 A;  1GXI E;  1OI9 B;  5HBH B;  1GUX A;  4JS4 A;  1VQM A;  4JUV A;  1JST B;  1X6G A;  1D1B A;  4M75 A;  1ZLM A;  1MGQ A;  2FB7 A;  4N0A C;  1KC8 U;  4F7S B;  4M78 B;  2V8I A;  3JCM Q;  4LDX A;  4E7K A;  5J39 A;  5J26 A;  1M8V A;  5GAN 6;  1MNE A;  4RTX A;  3L2W A;  3JCM V;  2QYZ A;  2DRM A;  5GMK i;  3MEV A;  3BDL A;  1H1S B;  1PNJ A;  2KMG A;  1VQ9 Q;  2HSE B;  3C95 A;  3QSU A;  2JTM A;  1I07 A;  1UHC A;  2M16 A;  3HRS A;  2DVE A;  3EG9 B;  4XTX A;  3GP8 A;  2IPO B;  2GTJ A;  3VYG A;  3GLX A;  3A8O B;  4IUP A;  3INZ A;  1H1P B;  4LOC A;  1YJW T;  5A0D A;  4NS5 A;  4OB2 B;  1ZA1 B;  2QQB A;  3CCQ T;  2B9R A;  2FEI A;  5GAN 7;  2BTT A;  3CC4 A;  4F7U B;  4HCK A;  1IGQ A;  4XAX B;  3X26 B;  4YC3 B;  4ELL A;  1VQP Q;  1SG5 A;  3GBQ A;  3HBL A;  3BG3 A;  5GAO n;  3HFO A;  2CS7 A;  3HKS A;  1WNL A;  3G4S A;  1PRM C;  2FZC B;  2C5O B;  3M59 A;  1YFN A;  4X9D A;  2V1R A;  4C92 F;  3EG2 A;  1OOT A;  3TQ7 P;  1JU5 C;  1VYU A;  2PK2 A;  2W96 A;  4N4H A;  3F70 A;  4PL6 A;  1KQ1 A;  4PJJ A;  5IHY A;  1OKW B;  1JXO A;  1RI0 A;  3QYG B;  2Y90 A;  1PSE A;  2AZV A;  1YIT Q;  1M3A A;  5GAN h;  1VQ5 Q;  2EQI A;  2CP7 A;  5L23 A;  3M58 A;  2VUB A;  3TNW B;  2RH2 A;  4J6Y A;  5GMK h;  1YHQ T;  1WLP B;  1D0Z A;  3EGX B;  2VV5 A;  3ZL7 C;  2XDP A;  1G3N C;  4F04 B;  1BU2 A;  2EGC A;  1IRE B;  4ZGD B;  1D3U B;  1D09 B;  5CR2 A;  1WJR A;  1YNZ A;  2BKD N;  3RIR A;  2RI2 A;  1UGV A;  1KSW A;  4RMO A;  1U3O A;  2UZE B;  2VYT A;  3VKG A;  1QW1 A;  1G83 A;  2IIM A;  4KGV B;  3QWL A;  1YWP A;  1Y07 A;  1PCX A;  2DLP A;  1TD6 A;  1X27 A;  1E9H B;  1WHK A;  2OAW A;  4EMG A;  1UDL A;  3OSV A;  4M75 G;  4F7U G;  4OB3 B;  4LDU A;  4BD3 A;  3OS0 A;  4UN0 A;  2P4R A;  4MIM A;  3MCA B;  1Q7Y U;  2GQI A;  5KYX B;  1D1C A;  3PTA A;  1H3H A;  1SKU B;  1OV3 A;  2UZB B;  2ZPG B;  2FO0 A;  2DTI A;  1VQ4 Q;  4VUB A;  3UA6 A;  2VWF A;  2RQR A;  1R77 A;  3TW7 A;  2RN8 A;  4HCZ A;  1X43 A;  2DYI A;  4E2F B;  4O5V A;  1YI2 A;  2CZ1 B;  5KCH A;  4ELY C;  4EOP B;  4EOO B;  1JO8 A;  3QWX X;  1LVK A;  4JPB W;  2DTH A;  1A0N B;  1JSU B;  2L3P A;  2O4X B;  1I0C A;  4J9G A;  3DLL A;  3M55 A;  2HBP A;  3CCU A;  1TTH B;  2XG8 D;  3JCM d;  4J9B A;  1JOW A;  2ROL A;  1W98 B;  1UNH D;  1GCQ A;  4LD9 K;  2GNC A;  2FL7 A;  4MZM A;  1SRM A;  2ED1 A;  1QWE A;  2D6F A;  3EOC B;  3CBP A;  3SWN A;  4M7D A;  2QXF A;  3GTM S;  1HSQ A;  1U5S A;  1GH6 B;  4FSX A;  1B07 A;  2NUZ A;  1U1T A;  2DEQ A;  2ESW A;  2MWO A;  1AZE A;  1I8F A;  3BY7 A;  4M7A B;  4EMK B;  1GRI A;  1QWF A;  2LCL A;  1UFF A;  1B34 B;  3M03 A;  1N9R A;  2KQW A;  5IN1 A;  1VQO Q;  5FWB A;  1VQ6 T;  4EC9 B;  1K73 U;  4MMK A;  2HQE A;  4FX3 B;  1M9S A;  4M4Z A;  2BZ8 A;  3MHX A;  1OKV B;  3CD6 A;  2DJQ A;  3X28 B;  4TVR A;  1MUZ A;  1WQW A;  5HCK A;  1KXU A;  2D0Q B;  1CSK A;  5GAN f;  2M0Y A;  2KRM A;  2HMA A;  3PT9 A;  3WXM B;  1EFN A;  3BDU A;  3EH1 A;  2D1X A;  4OMM A;  5KYU B;  2QEX Q;  4C8Q C;  2DVJ A;  1AWX A;  3KUF A;  4F17 A;  3LYI A;  1M3C A;  4II5 B;  5KYY B;  4IKF A;  5DM7 R;  1BYM A;  2FRY A;  2ZPH B;  3MEA A;  4AFQ C;  5A0L A;  1WHJ A;  3L1A A;  1M4Z A;  1PKS A;  1QVG A;  3UAT A;  1RAI B;  1H24 B;  3C4S A;  1KFZ A;  2HZY A;  1FWZ A;  5EJC A;  1RAH B;  1WI7 A;  2M1H A;  1QQJ A;  3RGF B;  3LH5 A;  1PM3 A;  2LC4 A;  2HDA A;  3LH0 A;  4KUL A;  2EBP A;  1AD5 A;  4ZGE B;  3L2Q A;  2RQV A;  3JB9 J;  4X1V A;  2XI9 A;  3QJY A;  1K73 R;  1K9M C;  3CCV A;  3NFC A;  2CT4 A;  3QWY A;  1VUB A;  3DKM A;  4M77 E;  2F2C A;  3OQ5 A;  3QJ6 A;  3MP8 A;  1AOJ A;  2R7G A;  3RMQ A;  2PVG B;  4CI0 C;  3NTI A;  1KK7 A;  2RHX A;  5ECA A;  4ORZ A;  4BCM B;  4ROE A;  5IH2 A;  3VS5 A;  4BE2 A;  5J3B A;  2RI5 A;  1K9M R;  1OQK A;  1I4K 1;  2DM1 A;  4M7A C;  1OL2 B;  5D6X A;  3CMA A;  1VQL Q;  3MEU A;  2HNI A;  4J5Y A;  2OTJ T;  2DIQ A;  3DJB A;  3CCR T;  3QBY A;  1H26 B;  1TS9 A;  4BCN B;  2E5Q A;  1LOJ A;  1O9S A;  4YOS A;  1TOV A;  4F7U F;  1NJI R;  3OYI A;  3G71 T;  2YWW A;  3OSS C;  4DEY A;  2BE9 B;  2YXY A;  3C12 A;  1SEM A;  2WMA B;  4KUD K;  2RO0 A;  4QQD A;  2MPX C;  1XO2 A;  1VQ8 Q;  2PVD B;  4M75 D;  3QHW B;  1M2O A;  4B9X A;  2YDL A;  4RKU E;  2COW A;  3QUI A;  1V29 B;  1WHL A;  1R0C B;  1QKX A;  1W1F A;  2KNB B;  5FGK B;  3CBM A;  3MIA B;  1RI9 A;  2LRQ A;  1JBM A;  4J9H A;  5CKD A;  4C0D B;  1IRX A;  3CC7 Q;  2PK9 B;  2VXF A;  3HRT A;  3T9N A;  4AKH A;  3BE3 A;  4KT0 E;  1ABQ A;  4LD6 A;  3VYH B;  5EG2 A;  5IHN A;  1VQN Q;  1AIS B;  4PFP A;  4RTW A;  2DKG A;  1IHV A;  2KVQ G;  2MK5 A;  1WFW A;  1O9K A;  4JRI A;  2FG0 A;  4A4G A;  4I3Z B;  4C5G A;  2CGH A;  1JKW A;  3DOG B;  3CCL A;  4R0K A;  1NPR A;  2CSQ A;  2PVO B;  5IDN B;  2QGG A;  3HZJ A;  3FDR A;  2WJ9 A;  3SEM A;  4AFZ C;  4PJO C;  2I53 A;  3A8G B;  2JW4 A;  4RTZ A;  1GFD A;  4PLL A;  2C0I A;  4JLG A;  2NUP A;  4OVA A;  2ROT A;  5IT9 E;  1ENW A;  1N27 A;  2GFU A;  4PJL A;  3MY5 B;  5IHI A;  2VXE A;  2LCS A;  5IXB A;  2KEA A;  1VQM Q;  1VQP A;  1GCQ C;  2V22 B;  1VQK T;  3RR6 A;  4HKE A;  3TCJ A;  1RAA B;  7AT1 B;  3BHT B;  3NTH A;  4IUQ A;  1M3B A;  1M5Q 1;  2ZZD B;  2DME A;  3CC7 T;  2KT8 A;  4JRQ A;  4UC4 A;  4N0A A;  4Q5W A;  2O01 E;  4XU0 A;  4MDX A;  4OGR B;  3VS2 A;  2FHD A;  3E9G A;  4XTW A;  4CC3 A;  3F5X B;  2L8D A;  3M4G A;  5CIU A;  4C0Z A;  4R56 A;  2QQA A;  4X9C A;  4CRL B;  4BY6 B;  2KRN A;  2CCH B;  2LVM A;  4BCP B;  3JCM f;  1LPL A;  2ZPB B;  4BE1 A;  1MV3 A;  2OI3 A;  2DNU A;  1NBE B;  3CPW A;  1V1C A;  1BK2 A;  1ZSG A;  1NYG A;  4L5G A;  3QDR B;  1ZUK A;  1Q7Y C;  3CCR Q;  3HFN A;  4EOI B;  2F2W A;  2L3S A;  3MKD A;  4QVZ A;  3FEO A;  2LT1 A;  2BS4 A;  1BKB A;  2MOX A;  2RJE A;  2DBK A;  4M7D G;  1YWO A;  1M30 A;  1M1F A;  8ATC B;  4ZN3 A;  4F7U E;  1VQN A;  1PKD B;  1NJI U;  4ZTF A;  3S6W A;  5KCO A;  1VQ7 Q;  2FVU A;  4YTL A;  3QYB A;  2EGA A;  3ASK A;  4PKC C;  5IDP B;  3HB9 A;  1Q82 R;  2RI3 A;  4OMO A;  2ZPF B;  2EYY A;  4M7A F;  1OX9 A;  5HVY B;  2QEX T;  4M78 F;  4FW2 A;  3UPU A;  3B57 A;  3A5Z B;  2PUO B;  2Y4X A;  1VQ5 A;  2QA4 Q;  3OYA A;  2G6F X;  2E12 A;  2RMO A;  4QVD A;  2WSF E;  1UGS B;  3UT1 A;  5FLX E;  4XU3 A;  2LX7 A;  2X51 A;  1Y7X A;  1VIN A;  5GAM g;  1QVF P;  4EDU A;  3GPL A;  1YCY A;  1VQO T;  1IZ6 A;  1KQS A;  3REB B;  1BI0 A;  3OS2 A;  1YJW A;  4FYV B;  3VYG B;  1N9S A;  2KYM A;  5AT1 B;  1YHQ Q;  3A8M B;  3OW2 S;  4J9C A;  2NUT A;  3EG9 A;  1ZX6 A;  1TFB A;  2QG9 B;  3OW2 A;  1U1S A;  3EJ1 B;  4RTV A;  3OYD A;  1YJN A;  6AT1 B;  1WGS A;  2LJ0 A;  4F6W B;  3H0I A;  1K4U S;  3HTR A;  1M1G A;  3I55 A;  2XID A;  2CDT A;  3FRN A;  4XU1 A;  2DIG A;  2KYB A;  1D0Y A;  5GJW B;  2W10 A;  4Y91 A;  5GAN 8;  3OMG A;  3TW6 A;  4Z6Y A;  3DL1 A;  1ZBX A;  2VB6 A;  3P8H A;  4M78 A;  1Q86 C;  4DEX A;  4M7A G;  1B7T A;  1KJW A;  3NHN A;  4M75 B;  4J9E A;  3CEY A;  2GCX A;  5KYU A;  3ZBD A;  4M77 F;  2E3I A;  2M02 A;  8AT1 B;  3DLM A;  4OB1 B;  4RCC A;  3CCR A;  1TUG B;  2AKK A;  2YUQ A;  3NPF A;  1TWB A;  2LJ1 A;  1ZBJ A;  2KRO A;  3UWN A;  3EGD A;  2RK2 A;  3M0T A;  3BLR B;  4M75 C;  4HNT A;  2P0P A;  3JCM h;  3M0P A;  1G3S A;  2JXB A;  2C5V B;  1G3W A;  1VYV A;  3JB9 F;  4BCM D;  1BB9 A;  2DXB A;  3I5R A;  1RUW A;  2Y4Y A;  2DTO A;  4C92 C;  1M90 U;  5LJ3 g;  1W2B A;  1BCM A;  3O5Z A;  2YLB A;  4AKI A;  3JB9 G;  3M0U A;  3VS0 A;  5D6W A;  4C8Q B;  2LQK A;  2H3E B;  1VQ4 T;  3QII A;  2WXV B;  2A28 A;  1VQ9 T;  5LJ3 h;  1YJ9 Q;  1AWJ A;  2PU9 B;  1WZO A;  1Y57 A;  2EKH A;  4HXJ A;  4N4G A;  4NL2 A;  4M7D B;  4D8K A;  2O9S A;  3I35 A;  4KH0 B;  5CQX A;  2GF7 A;  2I0N A;  4M7A A;  2L2P A;  3H8Z A;  2BZY A;  2RJC A;  1VQL A;  3I56 A;  4WTO B;  1OIY B;  1UB4 A;  4OP0 A;  2O4X A;  2CP2 A; 
#chains in the Genus database with same CATH homology
 3PNW C;  2KMT A;  2XKO C;  5DY9 A;  2QA4 T;  1D3B A;  1AHJ B;  4HLQ A;  1QVF S;  2K5F A;  4RCB A;  3L42 A;  4BI8 B;  2E6N A;  4MZP A;  1U1T A;  2DEQ A;  1QVP A;  4BI3 A;  3OS1 A;  1S72 T;  1VQ5 T;  3OYM A;  3HSB A;  2IG0 A;  2GQV A;  2EYQ A;  2BS2 A;  2MWO A;  2X4W A;  2DXT A;  5KE2 A;  2KY9 A;  3HHT B;  3OA6 A;  4PJO G;  2D9T A;  2BUD A;  1I5L A;  1I8F A;  1WPY A;  3BY7 A;  3KBG A;  4M7A B;  1JRI A;  4EMK B;  2X35 A;  3QZ5 B;  2DZC A;  3JCM W;  5CKB A;  3ZEH A;  1HK9 A;  4E7H A;  2LCL A;  2RM4 A;  3Q1J A;  4FT2 A;  3QKJ A;  3CCL T;  1B34 B;  5HK0 A;  4ATO A;  1N9R A;  2KQW A;  2LTO A;  5IN1 A;  4JX6 A;  1JB0 E;  1VQ6 T;  3SB2 A;  4C92 E;  3FB9 A;  2DO3 A;  2JOY A;  4B9W A;  1K73 U;  4MMK A;  2HQE A;  3OYG A;  2RK1 A;  1M9S A;  2DZ9 A;  4DQ2 A;  1O75 A;  2RA2 A;  3MHX A;  3CD6 A;  2B8A A;  5FU7 C;  2K5I A;  4C92 D;  3CXC A;  2P0K A;  3X28 B;  2EQJ A;  1LJO A;  4TVR A;  5CO7 A;  2R58 A;  3FC3 A;  1QLB A;  1VQM T;  1WQW A;  3TU4 K;  2D0Q B;  2DXC B;  2G3R A;  5GAN f;  3GNG A;  2DAQ A;  3HRU A;  5CK9 A;  3S3O A;  3PT9 A;  4XU2 A;  3WXM B;  3PIP A;  1K9M U;  3LGF A;  2EJ9 A;  2M0O A;  3BDU A;  4C0D C;  2ZGW A;  3RER A;  4C8Q C;  4IUU A;  1DJ7 B;  3ER0 A;  3KUF A;  1K8A U;  3LYI A;  4L59 A;  5D6Y A;  5DLO A;  3CC7 A;  1OZ2 A;  1M90 C;  4PJO F;  4C92 B;  4MML A;  1YBY A;  3G71 A;  4IKF A;  1BIB A;  5DM7 R;  2QA4 A;  4PJO C;  1BYM A;  4JLI A;  2ZPH B;  5GAN g;  2MWP A;  3BG9 A;  4DOV A;  5LJ5 e;  3S3M A;  3MEA A;  4KBM B;  3M54 A;  5A0L A;  5GAN 4;  2PUK B;  2C06 A;  4BDY A;  3L1A A;  1XNI A;  3LX7 A;  3BFM A;  1M4Z A;  1QVG A;  3MO8 A;  3C4S A;  3SFM A;  5GAM d;  2K57 A;  2QTX A;  4A4K A;  3CCJ T;  1FWZ A;  3RKW A;  4PJO A;  2X4X A;  3GOX A;  2YHT A;  4BY6 C;  5EJC A;  2M1H A;  1OYX A;  2CZ7 B;  2QF7 A;  3OB9 A;  3GNF B;  2LC4 A;  3MP1 A;  4A54 A;  5GAO l;  1VQ8 A;  3LH0 A;  4KUL A;  4A4E A;  4JS5 A;  1VQ4 A;  5CQY A;  4ZGE B;  1KG1 A;  4XTY A;  3L2Q A;  3JB9 J;  1BI2 A;  3FIF A;  2XI9 A;  3QJY A;  2CKK A;  5FU6 C;  4JRP A;  1K9M C;  3CCV A;  2YLC A;  3NFC A;  5HY6 A;  4HL4 A;  4F7U A;  5I2M A;  1W2B S;  3QHS A;  4MZT A;  5GMK j;  1VUB A;  3DKM A;  4FSX A;  4M77 E;  3JCM e;  1NJI C;  4M7D E;  3OQ5 A;  3QJ6 A;  3V7S A;  2KSS A;  4EMH A;  3MP8 A;  3RMQ A;  4CI0 C;  2QQR A;  2PVG B;  3UDC A;  4BBR M;  1VIE A;  4BUG A;  1VQ7 A;  3M57 A;  2R5A A;  2XHC A;  3NTI A;  2RHX A;  4ZN1 A;  2QEX A;  4OMF B;  4IUR A;  3OYH A;  1BI3 A;  2K2V A;  4M78 C;  1VQL T;  4BE2 A;  2EQM A;  2XIC A;  4M77 A;  4ME7 A;  2RI5 A;  5J3B A;  3QZ9 B;  1K73 C;  1I4K 1;  4C8Q E;  3KHI A;  2RJF A;  4M7D D;  4M7A C;  4HNU A;  4NC6 A;  2FYK A;  2RHY A;  2RHZ A;  5D6X A;  1NPP A;  4ELZ C;  3L2V A;  3CMA A;  1KHC A;  4HCB A;  3URG A;  4E47 A;  2JVV A;  5LL6 S;  3MEU A;  2HNI A;  4J5Y A;  5AYF A;  2HAX A;  1OI1 A;  2NLU A;  4J8O A;  1QVG S;  3GIB A;  2DXU A;  2K3Y A;  3GF5 A;  3V8L A;  2DIQ A;  5GMK l;  2CZ0 B;  3CCR T;  2OTJ T;  3QBY A;  1VQ8 T;  1I81 A;  4C8Q D;  2QQ9 A;  4F7U F;  2E5Q A;  1LOJ A;  1O9S A;  3V8J A;  5GAN e;  3CCQ A;  2JUF A;  1KQS S;  1VQN T;  4PLI A;  1FKM A;  3OYI A;  3JSC A;  4Y28 E;  3G71 T;  3OSS C;  3PMI A;  2LT4 A;  3PIO A;  1YIJ T;  2EKO A;  2HD0 A;  1E7P A;  4C5I A;  2MI6 A;  3C12 A;  3OYE A;  4KUD K;  2RO0 A;  1FX7 A;  4QQD A;  3JCM X;  2DXC A;  2PVD B;  4OB0 B;  4M75 D;  2G77 A;  5DLQ E;  3CCS A;  1G3T A;  1H3Z A;  3LWI A;  4B9X A;  4RKU E;  5KH6 A;  3M56 A;  4XTV A;  3QUI A;  1V29 B;  3CC2 A;  2A3L A;  1QP2 A;  2K3X A;  2E10 A;  1UEB A;  4C8Q F;  2F5K A;  5LJ5 f;  2E65 A;  3FLG A;  2EIF A;  3L2U A;  3CXC S;  2QQ8 A;  2XK0 A;  3CCS T;  1YHQ A;  2DPP B;  3CBM A;  4C92 A;  3CCM A;  4MDW A;  3JRZ A;  2LRQ A;  1D3B B;  2A7Y A;  2DK3 A;  2QQS A;  1Q86 U;  1JBM A;  1ZHI A;  4EPC A;  1X75 C;  1VIF A;  4E7J A;  1H64 1;  3L2Z A;  2EFI A;  3CPW S;  5CKD A;  4C0D B;  5CVI A;  1YIT A;  1TH7 A;  2VXF A;  3HRT A;  3T9N A;  4AKH A;  2XD0 A;  4XTU A;  3NTK A;  4KT0 E;  4LD6 A;  5EG2 A;  3VYH B;  1LNX A;  4PNO A;  3OYF A;  2DD4 B;  3H6Z A;  4OGC A;  4J7I A;  3S3N A;  2DKG A;  2KVQ G;  2RHU A;  5I21 A;  2BS3 A;  1WJS A;  3DB4 A;  3RES A;  2ZPE B;  1X01 A;  4C0G A;  3VKI A;  2ZCF B;  3EFS A;  4A4F A;  3QXE B;  2QDY B;  4JRI A;  3SDZ A;  4OF1 A;  5GAM f;  4A4G A;  1S72 A;  2E6Z A;  4C5G A;  2CGH A;  4BE0 A;  5CKE A;  1G3Y A;  1W4S A;  2VGN A;  1XQH A;  3CCL A;  2KDS A;  2YRV A;  4FT4 A;  3CC2 T;  4ZGJ B;  1NPR A;  2EQU A;  4FM4 B;  3FJP A;  3OYB A;  2I2L A;  3CPF A;  1NE8 A;  2PVO B;  2L5Q A;  3H4C A;  2XU8 A;  4P5N A;  5FU6 B;  5GAN 2;  3SWN C;  4A4H A;  4Z02 A;  1SSF A;  2XDD A;  2OAU A;  4AI6 A;  1BI1 A;  4LDV A;  3HZJ A;  3FDR A;  3P8B B;  2WJ9 A;  2LX9 A;  3VUZ A;  5IAY A;  3CCV T;  3G6E A;  2QDJ A;  3A8G B;  5LJ3 j;  3JCM b;  1YIJ A;  3WVE B;  1HXD A;  2AHJ B;  3TRE A;  4HA8 A;  3EFR A;  4PLL A;  4QSH A;  4M6V A;  3ZFJ A;  3CC4 T;  2R5M A;  2X4J A;  2IVW A;  2R57 A;  2EJG A;  4JLG A;  3M5A A;  3HP9 A;  4OVA A;  5LJ5 g;  5IT9 E;  4WF2 A;  1BIA A;  3BW1 A;  1G5V A;  5FU7 B;  1N27 A;  2GFU A;  2VXE A;  2P4T A;  4M78 G;  2V8K A;  3SWN B;  3CCJ A;  1VQP A;  3DB3 A;  3CMA T;  1VQK T;  1VQK A;  3CCE T;  3JB9 I;  1JJ2 A;  2CYZ B;  2V8J A;  1Y96 A;  4HKE A;  3TCJ A;  5LJ3 e;  1VQO A;  4PJO E;  3JAM E;  4M77 D;  4MFD A;  3E1S A;  1VQ9 A;  4OGE A;  3NTH A;  4IUQ A;  2OTL A;  3G4S T;  1QVF A;  4HNV A;  1KD1 C;  3OYY A;  3M53 A;  1WJQ A;  4FL6 A;  5A0D A;  1M5Q 1;  5GAN 3;  4LDY A;  4XQ3 A;  3OYK A;  2ZZD B;  2WSE E;  3SD4 A;  1N8R C;  3A8L B;  3G7Z A;  1P92 A;  4JDS A;  3G6E T;  3CC7 T;  4JRQ A;  4UC4 A;  4N0A A;  4C8Q A;  3OBY A;  3VJP A;  4J7F A;  2VGM A;  2O01 E;  4Q5W A;  4XU0 A;  4MDX A;  5FRO A;  3HL8 A;  5GAO q;  1Y96 B;  1GXI E;  3CME T;  4ZTJ A;  4CRI A;  2FHD A;  3E9G A;  4XTW A;  2H3J A;  2RJD A;  3E19 A;  1Q82 U;  4XTZ A;  2L8D A;  4DOW A;  3X20 B;  5LJ5 j;  3M4G A;  4JS4 A;  1VQM A;  5CIU A;  3JCM g;  4JUV A;  4FU6 A;  4M75 A;  3MP6 A;  5LJ5 h;  1MGQ A;  4C0Z A;  2FB7 A;  4BDZ A;  4N0A C;  3M9Q A;  3V7C A;  4HCC A;  4HT9 A;  4R56 A;  3EAE A;  2M9U A;  2JTF A;  1KC8 U;  4M78 B;  2V8I A;  3JCM Q;  4LDX A;  4E7K A;  1UGP B;  2QQA A;  4II1 A;  4X9C A;  5J26 A;  3VUB A;  5J39 A;  1YJ9 A;  1M8V A;  5GAN 6;  4N4I A;  4BY6 B;  3OYC A;  2E64 A;  1QP3 A;  2LVM A;  2WAC A;  5GAN 5;  3JCM f;  4M7D C;  1Y71 A;  4BB7 A;  2ZPB B;  1OZ3 A;  4BE1 A;  4LDW A;  4M78 D;  3L2W A;  3JCM V;  5C6S A;  3L2R A;  5GMK m;  5GAM e;  3CPW A;  2RD1 A;  5GMK i;  4FIB A;  3MEV A;  3BDL A;  3C94 A;  4L5G A;  3OYL A;  3QDR B;  2LCC A;  1Q7Y C;  3CME A;  3BG5 A;  3HFN A;  5L8R E;  2KMG A;  2WSC E;  2X4Y A;  2EWN A;  2LT1 A;  3FEO A;  4QVZ A;  2BS4 A;  3C95 A;  3QSU A;  3QYE A;  2DD5 B;  4QQ6 A;  2JTM A;  1BKB A;  2RJE A;  2M16 A;  2E70 A;  4M7D G;  3HRS A;  2DVE A;  1M1F A;  5GAM j;  3OYN A;  5GAO r;  3JB9 D;  4ZN3 A;  4F7U E;  1VQN A;  4XTX A;  3GP8 A;  2RHI A;  2DD4 A;  4ZTF A;  3J81 E;  3OYJ A;  3MET A;  3S6W A;  3VYG A;  3I55 T;  5KCO A;  1NJI U;  1N6A A;  2OTJ A;  3GLX A;  3PGG A;  3A8O B;  5FRN A;  4QQG A;  4IUP A;  3RKY A;  2FVU A;  1EIF A;  4E7L A;  3INZ A;  1JJ2 S;  4LOC A;  3X25 B;  4YTL A;  1YJW T;  3A8H B;  3QYB A;  3ASK A;  3RMS A;  3HO8 A;  4PKC C;  4C5H A;  4BBS M;  4NS5 A;  4OB2 B;  2HQX A;  4NL3 A;  4X34 A;  3HB9 A;  4IUV A;  2RI3 A;  2ZPF B;  3OMC A;  2QQB A;  4GLK A;  3CCQ T;  4M7A F;  2EJF A;  1MHN A;  5GAN 7;  2QEX T;  4V2S A;  3E9F A;  4M78 F;  3AHU A;  4PJO B;  3LWH A;  3UPU A;  3CC4 A;  1UGQ B;  2L3R A;  4F7U B;  2JN0 A;  2ZPI B;  4XAX B;  3MEW A;  1XTD A;  3X26 B;  1XOV A;  3A5Z B;  2EQK A;  2PUO B;  3QG1 A;  1YI2 T;  2Y4X A;  5GAN d;  2K5L A;  1VQ5 A;  2K4Y A;  4D6W A;  3HBL A;  3OYA A;  3KXT A;  3JB9 H;  3BG3 A;  5GAM h;  2E12 A;  3HFO A;  3VKH A;  2CS7 A;  3HKS A;  4M75 F;  2WSF E;  4QVD A;  5M9O A;  5GAO n;  1UGS B;  1WNL A;  4XK8 E;  4M77 B;  3UT1 A;  5FLX E;  3G4S A;  4XU3 A;  3JCM P;  1Y7X A;  2DD5 A;  4M75 E;  4M7A D;  2KK4 A;  3M59 A;  4C92 F;  4X9D A;  5GAM g;  4EDU A;  2L89 A;  2KR6 A;  1YCY A;  1IZ6 A;  3GPL A;  1VQO T;  1Q81 C;  1KQS A;  1K8A C;  1BI0 A;  3OS2 A;  4ELJ A;  2MAM A;  3OBW A;  3TEE A;  1YJW A;  4GY5 A;  5CCA A;  1M1K U;  2BIV A;  3JCM c;  3VYG B;  1N9S A;  1M1K C;  1R8O B;  4N4H A;  4RG2 A;  3F70 A;  4JX4 A;  4PL6 A;  2E41 A;  1Q81 U;  1KQ1 A;  3X24 B;  3A8M B;  4M78 E;  2LNV A;  3OW2 S;  1RI0 A;  3QYG B;  2Y90 A;  3PMT A;  3VU3 C;  4C5E A;  1PSE A;  4MFE A;  4RG8 A;  1RL2 A;  3OW2 A;  1U1S A;  4QW2 A;  5GAN h;  3OYD A;  4EMK C;  2QI2 A;  4IUT A;  3CBO A;  4C92 G;  2DJZ A;  1YJN A;  2KAF A;  1WGS A;  3M58 A;  4AKG A;  4NOY A;  2VUB A;  2RH2 A;  5CKH A;  3CCM T;  1KHI A;  4J6Y A;  5GMK h;  1YHQ T;  2GFA A;  1M1G A;  3I55 A;  2XID A;  3LLR A;  1N8R U;  4BI4 A;  3RUX A;  3FRN A;  2VV5 A;  4XU1 A;  2XDP A;  2DIG A;  3HPW A;  3J7A F;  3QYH B;  1IRE B;  2EAY A;  4EMK A;  2F5T X;  3WVD B;  4Y91 A;  4ZGD B;  5GAN 8;  5CR2 A;  1WJR A;  3OMG A;  2MF2 A;  2LQ8 A;  2BKD N;  3TW6 A;  1KQ2 A;  4Z6Y A;  3DL1 A;  1ZBX A;  2RI2 A;  2MMP A;  3P8H A;  3RIR A;  4E7I A;  3V7R A;  4M78 A;  4RMO A;  1Q86 C;  3PFS A;  1ZQ1 A;  2P0Q A;  3OS5 A;  4M7A G;  4JX5 A;  1YJ9 T;  4M75 B;  3VKG A;  1QW1 A;  2VYT A;  3CEY A;  2GCX A;  3LGL A;  1B34 A;  3ZBD A;  3QWL A;  5GAO p;  4M77 F;  1Y07 A;  4R55 A;  3DLM A;  4J6W A;  5C0M A;  4OB1 B;  5GMK e;  3O8V A;  5GAN j;  3CD6 T;  1YIT T;  3V8K A;  4RCC A;  4J6X A;  4KUI A;  3CCR A;  2XDB A;  4EMG A;  3OSV A;  4A53 A;  1UGR B;  4M75 G;  4F7U G;  4QVC A;  4OB3 B;  4LDU A;  4BD3 A;  5I2S A;  4O6J A;  4J83 A;  4C8Q G;  3OS0 A;  1VQ6 A;  3UWN A;  4BAC A;  2RK2 A;  4M7D F;  2F69 A;  1NZ9 A;  4MIM A;  2E1H A;  3MCA B;  4M75 C;  4M77 C;  1Q7Y U;  2PQW A;  4HNT A;  2P0P A;  3JCM h;  4HT8 A;  3PTA A;  5CKF A;  1G3S A;  1WQ7 A;  3R6O A;  1G3W A;  5A2Q E;  3JB9 F;  2JZ2 A;  4M77 G;  2DXB A;  4PJO D;  2ZPG B;  2Y4Y A;  5A0G A;  2DTI A;  3LW5 E;  5LJ3 d;  4VUB A;  2DTO A;  4C92 C;  1M90 U;  5LJ3 g;  5LJ3 f;  1W2B A;  3TW7 A;  3ME9 A;  3P8D A;  2YLB A;  4AKI A;  2LDM A;  3CCE A;  4HCZ A;  5KE3 A;  1PSF A;  5LJ5 d;  3JB9 G;  2DXB B;  4O5V A;  5HK3 A;  1YI2 A;  2CZ6 B;  1YJN T;  1VQP T;  2CZ1 B;  2QFZ A;  3QO3 A;  1KC8 C;  5FRM A;  5D6W A;  3VV0 A;  2LQK A;  4C8Q B;  4ELY C;  5KCH A;  5HKC A;  5GAO m;  1VQ4 T;  3QII A;  2OTL T;  4DA4 A;  2DTH A;  1VQ9 T;  3RKX A;  2ZZD A;  4JRK A;  5LJ3 h;  2RB6 A;  1FXX A;  2O4X B;  2PU9 B;  1Q82 C;  3I56 T;  1X6O A;  3DLL A;  4JJN K;  3M55 A;  2HBP A;  4N4G A;  3CCU A;  2XG8 D;  4NL2 A;  4M7D B;  3JCM d;  3J80 E;  3OY9 A;  4LD9 K;  5CQX A;  2GF7 A;  1U8R A;  4L6V 5;  4M7A A;  2FL7 A;  2JNG A;  3H8Z A;  4MZM A;  3CCU T;  2RJC A;  2D6F A;  1VQL A;  3JCM J;  3I56 A;  4C0F A;  5CAI A;  1UB4 A;  3CBP A;  3SWN A;  4M7D A;  2QXF A;  1VQ7 T;  3N5B B;  3M4Y A;  3QPH A;  1KD1 U;  4OP0 A;  2VC8 A;  2O4X A;  4M7A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...