4OB3B

Crystal structure of nitrile hydratase from pseudonocardia thermophila : a reference structure to boronic acid inhibition of nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
229
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 66
structure length 229
sequence length 229
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob3B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob3B02
3QYHB 2DPPB 2ZZDA 2PUKB 2ZPFB 3LW5E 2ZPEB 4OB1B 4ZGEB 2PU9B 2ZCFB 1DJ7B 3WVDB 3VYGA 4OB2B 1UGQB 2DD5B 4L6V5 2AHJB 2CYZB 3QZ9B 4FM4B 3A8LB 2WSCE 5L8RE 1JB0E 3X24B 3A8GB 2ZPBB 2DD4B 2CZ1B 4ZGJB 3VYGB 2O01E 1UGRB 1PSFA 3A8OB 1QP3A 3X26B 2ZZDB 3X28B 2DXCA 1IREB 1QP2A 4ZGDB 2DXCB 1V29B 3QYGB 2CZ6B 3VYHB 2WSFE 3HHTB 1PSEA 2ZPGB 3WVEB 2ZPIB 4XK8E 3QZ5B 2QDYB 3QXEB 4OB3B 2DD4A 1GXIE 2ZPHB 4KT0E 2PUOB 2PVDB 2PVOB 1UGPB 1AHJB 2D0QB 1UGSB 2WSEE 4RKUE 2DXBB 2DD5A 3A8MB 2PVGB 3X20B 2DXBA 2CZ0B 2CZ7B 4Y28E 3A8HB 4OB0B 3X25B
chains in the Genus database with same CATH superfamily
2UUEB 3VS2A 1YFNA 4MMKA 2VKNA 4BCJB 1PKTA 1MMNA 1R0BG 1GH6B 1NYGA 4C8QG 2A0FB 2W0ZA 3JAME 2BZYA 4C0GA 1E7PA 2DRKA 4C5HA 3RKWA 4KGVB 3CC4T 1FVVB 2KMGA 4FX3B 5DY9A 2BUDA 1T0HA 2LQKA 5HNBB 1D1BA 3HZJA 4BI3A 2CYZB 1QWEA 3CMEA 3OYCA 1MMGA 2QYZA 4M7DC 3EFSA 3CMAT 4O5VA 2DNUA 2BE7D 4R0KA 1H3ZA 3RDVA 2YUOA 1VIFA 2FPFA 3M0TA 1VUBA 3NGPA 4CFUB 1SF9A 4KULA 4EC8B 2RA2A 3X28B 4PJJA 3PVLA 1X6OA 2JMAA 1GRIA 1W2BS 1YIJA 4R56A 3A5ZB 2YRVA 1VQMA 2DL8A 1MMAA 1QVGS 2ROLA 5HBJB 2L3SA 2LTOA 3OYJA 2X9HA 4FU6A 1AZEA 1M1FA 1TU0B 1NEBA 4E7IA 2RQTA 2DL4A 4D8DA 3JB9H 3EG0A 4BE2A 3FRNA 4NSTB 3UPUA 1QVFS 2PVDB 3V8LA 2D0QB 3QUIA 1E9HB 2YSQA 4DEXA 2HZYA 4M75A 1NPRA 1WQ7A 3REBB 1SRLA 3CCVA 3DTOA 1VQPA 2KAFA 2VC8A 1N8RU 3LX7A 3NMZC 5LJ3f 1GY3B 1WHGA 1VQ8A 4JUVA 4EOOB 2W96A 1Q86C 1VQ6A 2GTOA 1AD5A 1YP5A 4Y91A 4DOWA 1IHVA 1SG5A 3BW1A 5CKHA 1BBZA 5CKBA 2C0OA 2HMAA 1VQMQ 2C06A 4PJOA 3CBPA 2G3RA 1YJ9T 4IURA 1KQSP 2UZDB 1BKBA 4M7DG 4EMKA 3OBWA 2FRWA 1FMWA 2DETA 3CPWS 2LJ3A 4M78D 2DJZA 2HSPA 4ANJA 2AKLA 4DEYA 4OMFB 2CREA 3EGXA 1WFWA 4XU1A 1B34A 3KHIA 2WACA 1RI0A 4AI6A 1G3NC 1VQ4A 2E1HA 3CC4A 1YJWQ 4M7AE 4A54A 5GAMj 2QQ8A 2J6FA 5HKCA 4F7JB 2WXVB 1O75A 1RLPC 3WXMB 3L2WA 4X9DA 3TNHB 3M0PA 1I5LA 4M77C 2EYQA 3G7ZA 2B8AA 1N6AA 4M78F 1CSKA 3VYHB 3VS0A 2M0OA 4JX4A 1PSEA 1T3LA 1JO8A 4RCCA 4R55A 3QZ5B 4KRCB 2JNGA 1K9MU 2XD0A 4ROEA 1GCPA 1MUZA 2EUFA 3INZA 1XNIA 5GANg 1N8RR 2WFYB 5FU6B 2EGCA 2DZCA 2A36A 1GXIE 3BDUA 4HNVA 2PVOB 2EKOA 2QEXT 1Q82R 2YHTA 1ACMB 4BCIB 1VQ7Q 4M75G 2KROA 1Q7YC 3CC2T 3BLRB 3CCJQ 5KE2A 4NS5A 2IVWA 4BCQB 2QI2A 2XHCA 1J3TA 2V1RA 3CBMA 3A8HB 4XTWA 3VV0A 3CXCS 5HK3A 2RI2A 4EORB 2YUPA 5GAN2 3DL1A 2RQUA 4M75F 1D3UB 1WNLA 2P0QA 2GNCA 2DE0X 1YJNA 2NUZA 2O9VA 2V26A 4HXJA 4L59A 1PKSA 3M4GA 2H3EB 3L2VA 4BY6C 2K3XA 3QJ6A 1OULA 3VYGA 5GAN7 1GBRA 5EC7A 2EJGA 3QZ9B 3A8LB 2KQWA 4A53A 1HXDA 2YUNA 2YUQA 3PO3S 1O9SA 5GAMf 3M59A 1I0CA 2E3IA 4M75D 2CP3A 3VYGB 3F5XB 1ABQA 2M1HA 4PJOC 4YOSA 5D6WA 3CCRT 2DL7A 2VYTA 1M4ZA 1YHQA 2SEMA 1D09B 2A37A 4CFWB 1I4K1 1OZ3A 3HFNA 1IREB 1OPLA 1IXDA 2FL7A 3MHXA 4FT2A 2DZ9A 2E10A 4C5EA 1G5VA 4PFPA 1EIFA 1D3BB 3SEMA 5GAMh 2IPOB 2KSSA 1H641 3META 3SWNB 1M5Q1 1ZQ1A 2O4XA 4EOMB 2MMPA 3DDQB 4JJCA 2AZSA 1K8AR 2V8IA 3C94A 1K8AC 2FO0A 3MPUB 2GTJA 3QYEA 1IB8A 2D9TA 2DD4A 2IW9B 5CR2A 4Y72B 2QA4T 1R77A 4E7KA 2WIPB 4EMKB 3CCQA 4M77E 2ZAEA 4C92C 1HD3A 2PMIB 3M5AA 1BIAA 2EPDA 1X6GA 1MNEA 4XQ3A 2E3HA 1BU1A 3QDFA 1ZSGA 4KUDK 2BTTA 4B9WA 5M9OA 3CD6A 2MCNA 4QW2A 4BY1X 1MV0B 5FWCA 2K5FA 2LJ1A 1Q82C 4JRIA 2MWPA 1EFNA 2CP5A 1M1KR 1QVPA 3CC2A 2M9UA 2DXTA 2Y4YA 2CP2A 3PTAA 5GJWB 5CKDA 3CCRQ 1UFFA 3HFOA 2KEAA 5KYNA 5D6XA 2JTFA 4ZGEB 3QYBA 2PU9B 1VQLA 4CI0C 2C0IA 2XI9A 4ZN1A 1D3BA 2MWOA 2RN8A 1RAGB 3BHTB 1E7OA 4BACA 1WLPB 4F7UE 1FYNA 3VS3A 3CCVT 1QVFP 2DIQA 1PD0A 4HL4A 3JCMV 1PCXA 2VV5A 4N0AA 1QLBA 2Y90A 1UDLA 2DERA 1B07A 1W6XA 1G3WA 1TWBA 1JXMA 2V1QA 5GMKj 3HO8A 2LQNA 2XKOC 3URGA 2G77A 1ZA2B 1YJNQ 3THKA 3R6OA 2DTIA 2BPMB 1YJWT 2KT8A 2J05A 4KRDB 3OSVA 2K3BA 5FW9A 4ZTJA 2P4RA 3GF5A 3LWIA 1URCB 3MY1B 4AG2C 2L89A 2KMTA 3VRYA 1I07A 3H0IA 2ZPHB 3VU3C 2C5XB 3CBOA 2KXCA 3OYGA 4LN2A 2XDDA 1TUDA 5BNJB 1WJRA 5KE3A 1VQ5A 3X20B 3DB3A 2EYZA 1VQ9Q 1N9SA 3SFMA 4JZ4A 2R5AA 4F04B 5L2WB 2LCSA 4PJNA 3QSUA 1F1BB 4F7LB 2DIGA 2RHXA 2CT3A 2JGZB 4C92E 4AFZC 4HVVA 1NJIR 1VYVA 1UGVA 4PJLA 5CKEA 1TFBA 4F7SB 2KXDA 4M6VA 1GL5A 4MFEA 1QQJA 1K76A 1U06A 5CO7A 4JPBW 1OU8A 3M0RA 3EFRA 1Q7YU 4PNOA 1QVGA 1NBEB 2O9SA 4M7AA 3DKMA 2CCIB 2NWMA 2DKGA 3PNWC 5GAN8 5LQFB 4RTTA 5KYUA 4LUDA 3HBLA 3I56T 1IGUA 4M7DF 4FM4B 1X43A 3JRZA 5LJ3e 3OW2P 1RUWA 1VOMA 3ME9A 5LJ3d 2LQWA 4JZ3A 4B6MA 1AD6A 4BE1A 2DD4B 2HAXA 2MOXA 4QVDA 3JCMd 2OTLA 4KGZB 2FRYA 4OF1A 2FEIA 1T3SA 2UZBB 2LCCA 5GAN4 4AT1B 3TNIB 5HVYB 3GNGA 5DLOA 2HD0A 3PMTA 2DM1A 3LYIA 1YNZA 3SHWA 3V8KA 5FRNA 5HBEB 1UUEA 2ZPIB 4XK8E 1WJSA 4EOIB 2FHDA 1SEMA 3JCMQ 2X4YA 5FU7C 5IH2A 4BCNB 2UZEB 2LP5A 1WZOA 2KR3A 1Q95G 3VS7A 1VQ9T 1B3QA 1ZA1B 2DMOA 1EZZB 3GTMS 2WSEE 3PIOA 4E6RA 1WIEA 1M8VA 3OW2A 1UB4A 2RPNA 2DXBA 4C92B 1RAIB 1RL2A 5LJ5g 5GANj 1IO6A 1QKXA 1JSTB 4Z6YA 3CCJT 2EW3A 3M4YA 3E19A 8ATCB 2P4TA 2E12A 1VQNT 3H8ZA 4ZNXA 1TUCA 2DEQA 1QMCA 1WXBA 1VQ5T 2EFIA 1X2KA 4F70B 5CQYA 4N4IA 4HNUA 1X01A 4J9IA 1OL2B 2CCHB 2L2PA 3L42A 4GLMA 2HKQB 3H6ZA 1KQSA 5CQXA 1G3SA 2ENMA 1YITQ 2QTVA 4J7FA 3TREA 1WQWA 4PFOA 1M1KU 3OS0A 1X27A 3EGDB 1YHQQ 3CCSA 3AT1B 1Q81U 4F6SB 4C8QD 3GP8A 1BI2A 4BCOB 2BKDN 3A1PA 5DQWA 3ER0A 1YITA 1WA7A 3CCMQ 4PK4A 2VXEA 1PSFA 3NTKA 4HKEA 2RQVA 3PGGA 4XTUA 4NC6A 3JCMg 4E7SA 2R58A 2FZCB 3FLGA 4J8OA 1BIBA 4HNTA 2C5VB 3JV3A 4Y92A 4OGRB 1QP2A 4E2FB 1OZ2A 1VYUA 4IUVA 5KYYA 1RLQC 2EYYA 4J83A 1X2QA 5ECAA 3MY5B 3KUFA 2H3JA 3TSWA 1KK7A 4P5NA 3EG1A 1N27A 1ZP2A 1UHCA 5IAYA 2KVQG 1AWJA 2MK5A 3OYYA 1QCOA 1NZ9A 1XJWB 2L5QA 5GAMd 2PK2A 3CCMT 1XQHA 2RM4A 1CKAA 2M51A 2Z0WA 4E7HA 2JM9A 1K9MC 1NYFA 3H4CA 4AKGA 1O9KA 1Y96B 2DRMA 1ARKA 3QO3A 2NUPA 3HSBA 2M0YA 1YHQT 3FC3A 5GAMg 4FYVB 2HL5C 2D8HA 2EIFA 3ULRB 2AK5A 1S1NA 1AVZC 2LJ0A 3MKDA 2L0AA 4QQGA 5GANh 5A2QE 3CC7A 4F6UB 4M78A 2X3WD 5CKFA 3JCMh 2PUKB 2K5IA 3JB9F 1LJOA 1H92A 3LW5E 3RKXA 2KE9A 2DEUA 4ORZA 1PM3A 4OP0A 3OYAA 3TSZA 2OTJQ 2LC4A 4OGEA 4C92F 1JJ2A 4LDUA 1WHMA 2QGFB 3EG2A 2DD5B 2O2OA 4A4HA 1GUXB 2COYA 3CC4Q 5IXFA 3UWNA 1WPYA 4AFUC 2KNBB 2RJEA 2OTLQ 2E4HA 5J39A 5IHKA 5I22A 4JDSA 4Z89A 2QQRA 1N5ZA 4M75B 4M7DE 4JLGA 1VQOA 5A0LA 4A4EA 1FXXA 2X51A 4HCBA 1OIYB 2HEQA 2EBPA 3EJ1B 3G6EA 2KI7A 4ZGDB 2ROTA 3BY7A 4M77B 2JW4A 1UJ0A 1K4US 3UDCA 5CEIB 5GAN6 4JJNK 1QCNA 2NUTA 2IIMA 4MIMA 2CUDA 2RHUA 2IW6B 3M0QA 5J3BA 1Q81R 4GBQA 4BCHB 5C0MA 1ZUUA 4IIMA 5GMKi 2X4WA 2BZXA 4IIOA 4OR5B 2ESWA 2YLBA 3CEYA 4QQ6A 3CPWA 2QQ9A 1VQ8Q 2M02A 1NE8A 2GCXA 2PVGB 3QWXX 2OTJT 2JN0A 1U5SA 1GFDA 2CZ7B 5GAMe 3LGLA 1FWZA 3TW7A 4FSXA 3I55T 4DQ2A 2COZA 3EGUA 3X25B 2AKKA 3G4SQ 4CC7A 5EG2A 3DOGB 4BE0A 2G6FX 4KGXB 2PK9B 5FLXE 1AZGB 4J6WA 4RG2A 1M8MA 3G33B 4A4GA 4G6LB 3MEUA 2OAWA 2BS3A 5AT1B 3B57A 1WXUA 4QKUA 2LRQA 3C4SA 4WCIA 2GF7A 1QKWA 1P92A 4XTYA 3E9GA 2V22B 1LVKA 2PHGA 1QMZB 2PZ1A 4J9BA 2OJ2A 3BE3A 3C12A 3BHVB 4LD6A 5KYXA 2J6OA 2KRSA 1LPLA 3WVDB 1Y71A 2K2VA 1NPPA 3DLMA 4BY6B 3I9QA 5CVIA 2RD1A 2HBPA 2AHJB 4J9EA 1E6GA 2MF2A 2WSCE 1I81A 2IW8B 2JOYA 1YI2T 3CXCP 2K4YA 2NUTB 2LT1A 3JCMb 3MEVA 3P8BB 2E5KA 2I2LA 2JVVA 1IHWA 1N8RC 1H26B 4CFVB 5GANe 4RTUA 3MI9B 5CYIB 4A4KA 4AFSC 4BBSM 3HTRA 3TU4K 1F5QB 4WTOB 3QWYA 1KXUA 4YOOA 3GBQA 4OVAA 5A0DA 3CC7Q 3I55Q 1ZUYA 4HCZA 2WSFE 4DBQA 2KR6A 4I3ZB 2ZPGB 1KC8U 5IXBA 2AIRB 4RTVA 2R57A 4BCFB 1AWOA 1OI1A 1Q81C 4M7DA 4N4HA 4F7UG 5LJ5j 4DOVA 1JJ2P 2WHBB 2JT4A 3PE0A 3VS5A 3RMQA 1JQQA 1YCSB 3O8VA 1RAHB 4J6XA 2D6FA 1C1AA 1WX6A 2JTEA 2E70A 4PJOG 2R7GA 3NHNA 3S3OA 1OYXA 3MJXA 5KYYB 2DTOA 3OYNA 3L2ZA 1H27B 3HKSA 1ABOA 1M9SA 4EIKA 2CP7A 4J9FA 4M77F 1OI9B 5DM7R 3OMGA 2QAZA 3R6NA 1VQ8T 3FDRA 3M0UA 2YXYA 2DFUA 2BS4A 3PVQA 4RMOA 1K9AA 1BI1A 4DA4A 2DPPB 2G9XB 1U8RA 3POMA 2NUPB 1JXOA 3G71A 1H28B 2VUBA 2O88A 4CC4B 5DQVA 4BD3A 3OYLA 2FVUA 2LCLA 1N4MA 3G4ST 5I2MA 3I55A 1HJDA 2QQBA 4MDXA 4OMMA 2WPAB 4M4ZA 1K8AU 1K0SA 2WMAB 3H9NA 1R0CB 1V76A 4OB2B 2X3XD 3ASKA 1OPKA 4L6V5 4PLIA 3GPLA 1TTHB 2EKHA 2ECZA 1JB0E 2JTMA 3OYFA 2KT1A 3ZBDA 1IZ6A 5IN1A 1PG5B 1VQ6T 2QEXQ 2XIDA 1M2VA 3QJYA 1UGRB 1G3TA 3EGDA 3VS4A 4IUPA 4LNPA 2P84A 2EYWA 5EJCA 3GOXA 1VQKA 4BCMB 3PIPA 3GLXA 2DXCA 2W9FA 4JX5A 1H1SB 1YI2A 2LVMA 2JXBA 1S72Q 1C9BA 3QYGB 1Q7YR 1MHNA 2CZ6B 2YT6A 1HSQA 4BCND 2DILA 2RQRA 2I0NA 1RAEB 1KC8C 2A3LA 2VWFA 2KY9A 3CCLT 3MCAB 3CCUT 3CCST 4NOYA 1XTDA 5IHIA 2W10A 1QLYA 5HK0A 1VQ7A 2F2CA 1UHFA 3GIBA 1AHJB 1E6HA 4PKCC 3J80E 2EQKA 4HT9A 2AT1B 1YN8A 2E6NA 2XK0A 3JCMJ 5GAOq 4OMOA 4OMLA 2XDPA 4JLIA 2A28A 1A0NB 4A4FA 1RI9A 1SPKA 1WXTA 2RH2A 2WIHB 4EOLB 2DLPA 4M77A 4BUGA 4LXCA 2RHZA 5IHYA 2BIVA 4EOJB 3P8DA 4OB0B 2EVRA 4TVRA 3BHUB 1V1CA 3QDRB 1ZBXA 4RODA 1P5EB 2CP0A 6AT1B 3QBYA 4B9XA 3OS1A 5LMKB 1VOLA 1PC0A 4OB1B 1AWXA 2QASA 3OY9A 2DXUA 2QA4A 1VQMT 5GANd 3S6WA 5LJ3h 2L3QA 3L2QA 2QG9B 1UEBA 2C5OB 5C6SA 2ZCFB 3MO8A 3OYBA 1WYXA 2DVJA 3NPFA 3H0FA 3EG9A 2CKKA 1KSWA 1D1CA 4D8KA 4II5B 1G8XA 4GLKA 1ENWA 4M78E 4F7UA 2JM8A 2DAQA 2LW4A 5GMKm 4HVUA 4J9DA 2EQMA 3QIIA 2CH4W 4FYWB 2CDTA 1VQ6Q 1AISB 1RADB 2KYBA 1TG0A 2Y4XA 4IUTA 2KBTA 4IUUA 2RK2A 2XG8D 8AT1B 5GAOp 3HHTB 4C0ZA 2QQSA 3EG3A 4IKFA 1VQPQ 4M75E 1VQLT 3TCJA 3D7SB 2RJCA 3OW2S 2RF0A 4OMQA 3L2RA 2VASA 1W70A 4BCGB 1G83A 4BI8B 4ME7A 4EMKC 4RUGA 3TNWB 2V8KA 2PQWA 2CJMB 4BCPB 4M7AF 2LNHB 3OYHA 3M55A 2R5MA 1M90U 3U23A 5D6YA 3CMET 1B7TA 5I11A 1SSHA 3BDLA 4LUEA 4QQDA 2MYSA 3N5BB 3CCJA 1OKWB 2GFAA 4D6WA 2QGGA 4HA8A 3CCVQ 5EFQB 1M3CA 2B86A 4F17A 3LGFA 4A63B 2DVEA 4ESRA 3VUBA 2YWWA 1YIJQ 4N4GA 4EC9B 2QFZA 3K7AM 3E2UA 2QDJA 1M2VB 3OB9A 4QVCA 2W2HA 3QG1A 1RACB 2DX1A 4EDUA 5I5ZB 1JBMA 3LQ5B 3REAB 3HP9A 3RNJA 4Z88A 2M16A 2HQEA 2JUFA 3RMSA 4XTVA 1KD1R 4F7NB 1I8FA 4BCMD 3V7SA 3RESA 1S72A 2VB6A 3QPHA 2K57A 1NM7A 5L8RE 1FKMA 2L3RA 4OGCA 3JB9J 2C0TA 1RABB 2LDMA 5IF1B 2K7AA 3CQTA 1NEGA 2X4JA 4EONB 1U3OA 1VYTA 5GAOn 4ZGJB 2UZLB 2EJ9A 2CP6A 4FCYA 2O01E 4UN0A 4HLQA 2YRDA 3JCMe 3PFSA 4JS5A 3BG5A 1H8KA 5GMKe 2ZZDB 2HBWA 2DJQA 5I21A 3RGFB 2QDLA 2BE9B 2DL5A 4J9CA 3EH2A 5IT9E 4FSSA 2EJFA 4AKHA 1K73C 5LJ3j 1M3BA 1D0YA 3CMEQ 3M0SA 3PMIA 4DBFA 2K3YA 3MEWA 2KRMA 5FRMA 1ZSZB 4Q5WA 1K73U 5GAOm 2DYIA 2F5KA 2KGTA 3FJPA 4PJOF 5HCKA 2KDSA 1Y7XA 4EOPB 3SWNA 1M30A 5GAOl 1QCFA 1TXQA 2HQXA 3TQ7P 1ZSZA 3HRSA 1UNGD 4N0AC 2W99A 3DB4A 3CCUQ 1UGSB 1I1JA 1SHFA 3MP8A 3UATA 4BBRM 4RTZA 3CPFA 3HPWA 1JEGA 2ED0A 1NJIU 4LOCA 2EYXA 3VUZA 2I40B 4GY5A 5D7UA 4C8QF 1MGQA 3JCMW 1PRMC 1GUXA 2J6KA 3V7RA 1AOJA 1ZX6A 1VQ4T 2HL3A 3QYHB 1M1KC 1C0MA 1BCMA 4X1VA 3EOCB 3TVTA 4JRKA 2YRCA 3TEEA 5LJ5f 1YBYA 2W9ZA 4IMYB 2ZPEB 3T9NA 3BLQB 1QWFA 4JRPA 2K6DA 2EQJA 1KIKA 4QT7A 3RERA 3VRZA 1M90R 1H24B 4HT8A 4FYXB 4NL3A 1VQKQ 3M53A 1UGQB 3JB9G 2DF6A 4KH0B 4CFNB 4Z02A 2DBMA 1OX9A 3BG3A 1OGUB 1KHIA 3CMAA 3F70A 1BCOA 4CC2A 4RTXA 4ROCA 4E7LA 4C92A 3CCRA 4DBHA 1OKVB 3EG9B 3V8JA 1FINB 2QF7A 5FROA 3MP1A 1UJYA 2RHYA 2F69A 3I35A 2RB6A 1ZLMA 4RTWA 2E6ZA 2D8JA 4C0DB 4M7AC 3LH0A 1TSFA 2AZVA 1R8OB 1AT1B 4RCBA 4M78B 1Z9ZA 3HRUA 2DMEA 4J9HA 1VQNQ 1C6VX 2LX9A 4EPCA 1WI7A 1YCYA 5KYWA 3I56A 7AT1B 2RO0A 1OX8A 2GGRA 4PL6A 3M56A 3CCQQ 1UNLD 3CCLQ 2ZGWA 4IUQA 4V2SA 1K0XA 1YITT 4MZPA 4C92D 3A8MB 1FX7A 1H4LD 3VS6A 2DA9A 2PNIA 3L2UA 2SRCA 1SRMA 3FJ5A 2LX7A 2LNVA 4MFDA 1Q82U 4M7DD 2VXFA 3JCMX 2J06A 1JSUB 3RKYA 1M1GA 3KFVA 2JS0A 4PLLA 3S3NA 4Y28E 3UA6A 4KBMB 2RNAA 2RI5A 5J26A 3JSCA 3RUXA 4PJOB 2K2MA 4K11A 3L1AA 5ICPB 3J7AF 3NDQA 3SWNC 3CPWP 3CCUA 3MIAB 2EQUA 2LZ6B 2CSQA 1D0ZA 1ZSZC 2IG0A 1KHCA 3VKHA 1W4SA 3Q1JA 1QVGP 1YJWA 2KYMA 4FL6A 4E7JA 1YJ9Q 4CFMB 1GBQA 3VS1A 1G3YA 4MDWA 5CIUA 4C8QB 5KYXB 4PJOE 1PKDB 1B34B 3JCMP 2DYBA 3CCSQ 3OYEA 3VKIA 3LLRA 3OS2A 5CCAA 3CCQT 1Y57A 3KBGA 1FMKA 2FZGB 4C8QA 1JRIA 3CC7T 1QP3A 3X26B 2EQIA 4FW2A 4J5YA 3VJPA 3LWHA 1VYWB 3CD6T 4JJBA 2DK3A 4F16A 3J81E 4C8QE 4ELZC 1IGQA 1OOTA 1JU5C 1TH7A 4QSHA 5FU7B 1SSFA 2RQWA 4C5IA 1TUGB 3HB9A 4JX6A 2FG0A 5FU6C 2FPEA 5L23A 2OX7A 4E7ZA 2D1XA 2JJ9A 5LJ5e 2XU8A 3EGXB 4XU3A 1G2BA 4Z8AA 3CC2Q 1XOVA 3AHUA 2P0KA 2OI3A 2RMOA 4M77G 1JOWA 4M7DB 2YDLA 4LDYA 2DO3A 4XAXB 5LJ5h 2DXBB 1BB9A 2BKZB 3S3MA 2BS2A 1KQ2A 1HYOA 1KFZA 2CZ0B 4QVZA 2ATCB 1M3AA 1Y0MA 2D0NA 4ZN3A 2QGSA 1BK2A 1BI3A 3M58A 1BI0A 4C0FA 4TTHA 1UNHD 2K5LA 4EOKB 3G6ET 1AEYA 1KJWA 1WDXA 4FW1A 4BY7X 4J9GA 5GMKl 5HQ0B 4M7AG 4FIBA 4LDXA 2OTLT 4AKIA 2EWNA 2O4XB 4PJOD 2ZZDA 1Y07A 2FPDA 2F5TX 3HL8A 2X1NB 2HDAA 2E41A 3RR6A 4RTYA 1I5OB 1YIJT 2PJQA 2QK0A 2CS7A 1KC8R 1LOJA 4LE9A 2RI3A 4DBRA 3H0HA 1GCQC 2E5QA 2C5NB 3JCMc 3DDPB 2RK1A 1DJ7B 2H8HA 2LMJA 1LCKA 2MIOA 2KRNA 1ZHIA 1HK9A 4OMNA 5IDPB 4J6YA 2XMFA 2GQVA 5GAN3 3JB9I 1OU9A 2P0PA 1NLOC 2K9GA 4CC3A 3FEOA 1WHJA 2XDBA 1W98B 1MMDA 3RBBB 2HQHA 2CGHA 1OIUB 2I53A 1OV3A 1KQ1A 2DXCB 3EIDB 1V29B 2GBQA 3CXCA 2RJFA 3WVEB 3OYKA 3EFOB 1H1RB 2QDYB 3QXEB 4XTXA 4M7AB 4C0DC 1UG1A 5LL6S 1S72T 2YLCA 4OB3B 5ACBA 3JB9D 4ZTFA 4KUIA 5AYFA 3DLLA 5HY6A 1VQ9A 2PUOB 1WHKA 1PWTA 2QTXA 3OBYA 2C4GB 2E65A 3C95A 3ZFJA 1KG1A 2X4XA 4C8QC 2C6TB 3JCMf 2F2WA 4HCKA 4FYYB 3UT1A 5GAOr 1O9KB 1RAAB 4II1A 5CAIA 4X34A 4CRLB 1T0JA 4XU0A 4JJDA 2A08A 2FZKB 3A98A 4KH1B 4BB7A 4F7UF 3I56Q 3OYIA 2JZ2A 2F2XA 4EMGA 1VQNA 1W1FA 1YI2Q 3KXTA 2MAMA 5KYWB 1K73R 1KD1C 4C92G 4PFZA 1Z9QA 4UC4A 3TW6A 2ABLA 1UECA 3IQLA 1VIEA 4F7UB 1D0XA 1BYMA 3OMCA 2XICA 2CUBA 3H41A 4O6JA 4LD9K 4AMCA 1X69A 3HRTA 1EX4A 1MV3A 3C0CA 1PRLC 2WMBB 1TS9A 1OQKA 1XO2A 2JS2A 3CMAQ 1M90C 3M9QA 3P8HA 3VKGA 2CH4A 1H1QB 3PT9A 1PNJA 4BCQD 1YJ9A 2COWA 4F14A 4C5GA 5GAN5 4YTLA 1SHGA 3DJBA 1WGSA 3CCET 4M77D 2CT4A 1VQ4Q 3X24B 4YC3B 3A8GB 3CCMA 1OEBA 2V8JA 3EAEA 2CZ1B 1M27C 3OSSC 1IRXA 5GMKh 3M54A 3NFCA 3EHRA 1BU2A 2K79A 5LJ5d 1ZUKA 1VQPT 3OS5A 4EOSB 1WHLA 2HKNA 2WJ9A 4EOQB 2IVXA 2RHIA 4HCCA 5HBHB 1GCQA 4FT4A 2DTHA 4AFQC 4WF2A 3UF4A 2VGMA 3OYMA 3OYDA 2QA4Q 5CK9A 2EAYA 2LT4A 5KCOA 3FB9A 2O31A 4MZTA 1H1PB 3V7CA 3TN8B 4M78C 1WHHA 1PHTA 3CD6Q 3I5RA 4BCKB 2DL3A 4BDYA 4HVWA 3FIFA 3O0GD 1N9RA 1ZBJA 1OL1B 4MMLA 1VINA 4M78G 2VGNA 4NL2A 3SD4A 3G71Q 2GFUA 3SDZA 3MP6A 1K9MR 3NTIA 4J7IA 4EMHA 4VUBA 4JS4A 1FMVA 5I2SA 1UTIA 4JRQA 1VQKT 1H25B 2NLUA 3EHQA 1YWOA 5DLQE 3E1SA 4ELLA 3RIRA 3CCEQ 1NLPC 2QXFA 3LH5A 1U1TA 2L8DA 4OMPA 2EGEA 1CKBA 4BDZA 2PTKA 3G6EQ 3CCLA 2ZPFB 3UA7A 2DBKA 4X9CA 3QKJA 4BI4A 1VQOQ 3M57A 3QHWB 1VA7A 3BG9A 1VQ7T 2OAUA 3EH1A 2LQ8A 2IN3A 1GFCA 1QW1A 4YOZA 4CFXB 1MNDA 3BLHB 2ED1A 5GJVB 1K1ZA 2HNIA 1KD1U 1Y96A 5KH6A 3EFOA 1NG2A 1U1SA 3QHSA 5IHNA 1Q86U 2MPXC 3SB2A 5LJ3g 1VQLQ 2FYKA 4E47A 2F1LA 2QEXA 1W2BA 1AWWA 2ZPBB 4CFUD 4CXAB 1JJ2S 3O5ZA 2EGAA 4LDVA 3E9FA 1M2OA 4M7AD 2QQAA 4LDWA 3OA6A 3A8OB 3NTHA 2OTJA 2GQIA 3G71T 1SKUB 2NYSA 2B9RA 1VQOT 5IDNB 4M75C 1X75C 4ELYC 1Q86R 1X6BA 1KQSS 4RG8A 2J7IA 1WJQA 2KK4A 3G4SA 2HSEB 4MZMA 3CCEA 1NJIC 1D1AA 4L5GA 2JMCA 1QVFA 1JKWA 3M03A 5A0GA 5KYUB 1LNXA 1YJNT 3G1JA 2A7YA 2BZ8A 2RJDA 4AG1C 2X35A 4KT0E 1TD6A 4ELJA 1H3HA 4BXXX 1UGPB 2FB7A 3GNFB 5GANf 4XU2A 3MEAA 9ATCB 2F2VA 4F6WB 4RKUE 3QHRB 2DD5A 2WEVB 1RAFB 2HCKA 4CRIA 3BFMA 1YWPA 3ZL7C 4XTZA 3QWLA 4PJMA 5FWBA 2CSIA 1W2BP 5FGKB 1TOVA 3ZEHA 1VQ5Q 2MI6A 2E64A 3I5SA 4KRTA 3OQ5A 1PD1A 1UE9A 2VVKA 5KCHA 2L3PA 4ATOA
chains in the Genus database with same CATH topology
2BS4A 3JSCA 5J26A 3RUXA 4PJOB 4RMOA 4DA4A 1BI1A 2DPPB 4MMKA 3L1AA 1U8RA 4C92E 3G71A 3J7AF 2VUBA 3SWNC 5CKEA 3CCUA 2EQUA 4BD3A 3OYLA 4M6VA 2IG0A 1KHCA 4MFEA 3VKHA 1W4SA 2FVUA 4C8QG 3Q1JA 2LCLA 3G4ST 5I2MA 4B9XA 5CO7A 3JAME 3I55A 2QQBA 3EFRA 4C0GA 3JB9G 1YJWA 4MDXA 1Q7YU 1E7PA 4PNOA 4C5HA 1QVGA 4M7AA 3DKMA 3RKWA 3CC4T 1K8AU 4FL6A 4E7JA 2KMGA 2DKGA 3PNWC 5GAN8 5DY9A 2BUDA 2LQKA 1G3YA 4OB2B 4MDWA 5CIUA 3ASKA 4L6V5 4C8QB 3HBLA 3HZJA 4BI3A 3I56T 4PLIA 4PJOE 4M7DF 2CYZB 3CMEA 4FM4B 1B34B 3JRZA 5LJ3e 3JCMP 3GPLA 3ME9A 3OYCA 5LJ3d 4M7DC 1JB0E 2JTMA 3EFSA 3OYEA 3VKIA 4O5VA 3CMAT 3LLRA 3OS2A 5CCAA 3OYFA 3CCQT 2DD4B 3ZBDA 4BE1A 2HAXA 1H3ZA 1IZ6A 1VIFA 5IN1A 1VQ6T 1VUBA 3KBGA 4QVDA 3JCMd 2XIDA 3QJYA 1UGRB 1G3TA 2OTLA 4IUPA 4C8QA 1JRIA 3CC7T 1QP3A 4KULA 3X26B 4OF1A 5EJCA 4J5YA 2LCCA 2RA2A 3X28B 3VJPA 3LWHA 3GOXA 1X6OA 1VQKA 3PIPA 3GLXA 5GAN4 4R56A 1YIJA 2DXCA 1W2BS 3CD6T 3A5ZB 2DK3A 4JX5A 1YI2A 2LVMA 2YRVA 3GNGA 5DLOA 3J81E 2HD0A 4C8QE 1VQMA 4ELZC 1QVGS 3QYGB 3PMTA 1TH7A 4QSHA 2LTOA 1MHNA 2CZ6B 1SSFA 3LYIA 5FU7B 4C5IA 3OYJA 3HB9A 4JX6A 3V8KA 5FRNA 4FU6A 5FU6C 2ZPIB 1M1FA 4XK8E 1WJSA 1KC8C 2A3LA 4E7IA 2FHDA 3JCMQ 2KY9A 2X4YA 5FU7C 3MCAB 3CCLT 3CCUT 5LJ5e 3CCST 2XU8A 4NOYA 1XTDA 4XU3A 3JB9H 4BE2A 3FRNA 3UPUA 5HK0A 1QVFS 1XOVA 1VQ7A 3AHUA 2PVDB 2P0KA 1VQ9T 3GIBA 4M77G 3V8LA 4M7DB 1AHJB 2D0QB 4LDYA 2DO3A 3QUIA 4PKCC 4XAXB 3J80E 2EQKA 3PIOA 2WSEE 4HT9A 5LJ5h 2DXBB 2E6NA 2XK0A 3JCMJ 3S3MA 5GAOq 2BS2A 1M8VA 1KQ2A 2XDPA 4JLIA 3OW2A 1UB4A 4A4FA 4M75A 2DXBA 2CZ0B 4C92B 4QVZA 1NPRA 1WQ7A 2RH2A 1RL2A 5LJ5g 3CCVA 1VQPA 5GANj 2KAFA 2VC8A 4M77A 4BUGA 4ZN3A 1N8RU 2RHZA 3LX7A 5LJ3f 1BI3A 3M58A 4Z6YA 1BI0A 4JUVA 4C0FA 3CCJT 1VQ8A 3E19A 3M4YA 2BIVA 2K5LA 3G6ET 3P8DA 4OB0B 2P4TA 4TVRA 1Q86C 2E12A 5GMKl 1VQ6A 1VQNT 4M7AG 3QDRB 3H8ZA 4FIBA 4Y91A 1ZBXA 4DOWA 4LDXA 2OTLT 4AKIA 2EWNA 3BW1A 2DEQA 5CKHA 2O4XB 4PJOD 2ZZDA 5CKBA 1Y07A 2EFIA 1VQ5T 2C06A 3QBYA 4PJOA 5CQYA 3CBPA 2G3RA 2F5TX 3HL8A 4IURA 4N4IA 4HNUA 1X01A 1BKBA 1YJ9T 2E41A 3OS1A 4M7DG 1YIJT 3L42A 4EMKA 3H6ZA 1KQSA 5CQXA 3OBWA 4OB1B 1G3SA 2CS7A 3OY9A 2DXUA 1LOJA 2QA4A 1VQMT 2RI3A 5GANd 3S6WA 5LJ3h 4J7FA 3CPWS 3L2QA 1UEBA 3TREA 2E5QA 5C6SA 4M78D 2ZCFB 1WQWA 3MO8A 2DJZA 3JCMc 3OYBA 2RK1A 1DJ7B 1KD1U 1M1KU 3OS0A 2CKKA 3CCSA 1ZHIA 1HK9A 4OMFB 1Q81U 4J6YA 4C8QD 3GP8A 1BI2A 2GQVA 5GAN3 3JB9I 4XU1A 2BKDN 1B34A 3KHIA 2WACA 2P0PA 3ER0A 1YITA 1RI0A 4GLKA 4AI6A 1VQ4A 2E1HA 4M78E 2VXEA 1PSFA 3NTKA 4HKEA 4F7UA 3CC4A 4M7AE 2DAQA 3PGGA 4XTUA 4NC6A 3JCMg 4A54A 2R58A 3FEOA 3FLGA 2QQ8A 4J8OA 5HKCA 5GMKm 5GAMj 2XDBA 1BIBA 4HNTA 2EQMA 1O75A 3QIIA 3WXMB 3L2WA 4X9DA 1I5LA 4M77C 2CGHA 1QP2A 1OZ2A 2EYQA 4IUVA 2Y4XA 1KQ1A 3G7ZA 2B8AA 4IUTA 2DXCB 1N6AA 4IUUA 1V29B 2RK2A 2XG8D 3CXCA 4M78F 2RJFA 3VYHB 5GAOp 3HHTB 2M0OA 4JX4A 2QQSA 1PSEA 4C0ZA 3WVEB 4RCCA 4J83A 4R55A 3OYKA 4IKFA 3KUFA 4M75E 2H3JA 3QZ5B 2QDYB 3QXEB 4P5NA 3TCJA 4XTXA 4M7AB 4C0DC 1VQLT 2JNGA 1N27A 1K9MU 2XD0A 5LL6S 1S72T 2YLCA 3INZA 1XNIA 4OB3B 2RJCA 5IAYA 5GANg 3JB9D 2KVQG 5FU6B 3OW2S 4ZTFA 4KUIA 5AYFA 3L2RA 2DZCA 5HY6A 3OYYA 3DLLA 1VQ9A 2PUOB 3BDUA 1NZ9A 4BI8B 1GXIE 2L5QA 4ME7A 4EMKC 4HNVA 2PVOB 5GAMd 2EKOA 2QEXT 1XQHA 2QTXA 2RM4A 2V8KA 3OBYA 3CCMT 2PQWA 2YHTA 4E7HA 2E65A 3C95A 3ZFJA 1K9MC 2X4XA 1KG1A 4M7AF 4C8QC 4M75G 3JCMf 3H4CA 4AKGA 1Y96B 1Q7YC 3CC2T 3OYHA 5KE2A 3QO3A 3M55A 4NS5A 2R5MA 1M90U 3HSBA 2IVWA 2QI2A 3UT1A 5D6YA 5GAOr 1YHQT 3FC3A 5GAMg 4II1A 5CAIA 4X34A 3CMET 4ZN1A 3BDLA 2XHCA 4QQDA 3N5BB 4XU0A 3CCJA 2GFAA 3CBMA 2EIFA 4D6WA 4BB7A 4F7UF 4ATOA 3OYIA 2JZ2A 3A8HB 4HA8A 4XTWA 4EMGA 3VV0A 1VQNA 3CXCS 5HK3A 2RI2A 2MAMA 5GAN2 3KXTA 3LGFA 3DL1A 2DVEA 4M75F 3VUBA 1WNLA 4QQGA 1KD1C 4N4GA 2P0QA 5GANh 4C92G 5A2QE 3CC7A 4M78A 2QFZA 4C92C 4UC4A 2QDJA 3TW6A 3OB9A 5CKFA 3JCMh 2PUKB 1YJNA 2K5IA 4QVCA 1VIEA 1LJOA 4F7UB 3JB9F 3QG1A 1BYMA 3OMCA 2XICA 3LW5E 4O6JA 4L59A 3RKXA 4EDUA 4LD9K 1JBMA 3HP9A 4OP0A 3HRTA 3OYAA 3M4GA 2M16A 2HQEA 3L2VA 4BY6C 2LC4A 2JUFA 4OGEA 4C92F 1JJ2A 3RMSA 4XTVA 2K3XA 3QJ6A 4LDUA 3VYGA 1I8FA 3M9QA 5GAN7 3P8HA 1M90C 3VKGA 2DD5B 3PT9A 3QPHA 3RESA 3V7SA 4A4HA 1S72A 2K57A 2EJGA 1YJ9A 3QZ9B 4C5GA 3A8LB 5GAN5 2KQWA 4A53A 1HXDA 4YTLA 1FKMA 2L3RA 4OGCA 1WGSA 5L8RE 3CCET 3JB9J 4M77D 5GAMf 1O9SA 3X24B 2LDMA 3A8GB 3CCMA 3M59A 2X4JA 2V8JA 3EAEA 3UWNA 2CZ1B 5GAOn 4ZGJB 1WPYA 4M75D 2EJ9A 3VYGB 2RJEA 2O01E 3OSSC 4HLQA 5J39A 3JCMe 3PFSA 3M54A 5GMKh 3BG5A 4JS5A 4JDSA 2M1HA 3NFCA 4PJOC 5D6WA 5GMKe 3CCRT 2ZZDB 2VYTA 2QQRA 1M4ZA 4M75B 5I21A 5LJ5d 1YHQA 4M7DE 1VQPT 3OS5A 4JLGA 1I4K1 5IT9E 1VQOA 2EJFA 4AKHA 5A0LA 1K73C 5LJ3j 1OZ3A 3HFNA 2WJ9A 4A4EA 1IREB 1FXXA 4HCBA 2FL7A 3MHXA 4HCCA 2RHIA 3PMIA 3G6EA 4FT2A 2DZ9A 2E10A 4C5EA 1G5VA 2K3YA 4ZGDB 3MEWA 1EIFA 4FT4A 5FRMA 2DTHA 1D3BB 4WF2A 4Q5WA 2VGMA 5GAMh 3OYMA 3OYDA 3BY7A 5CK9A 5GAOm 2KSSA 4M77B 1K73U 1H641 2LT4A 2EAYA 5KCOA 3META 3FB9A 2F5KA 4MZTA 3SWNB 1M5Q1 1ZQ1A 2O4XA 3FJPA 3UDCA 3V7CA 4M78C 4PJOF 5GAN6 2MMPA 2KDSA 4JJNK 4MIMA 1Y7XA 2RHUA 3SWNA 5J3BA 2V8IA 3C94A 4BDYA 1K8AC 5GAOl 3QYEA 2D9TA 2DD4A 3FIFA 5C0MA 2HQXA 5M9OA 5GMKi 5CR2A 2X4WA 3HRSA 2QA4T 4E7KA 4N0AC 1N9RA 4EMKB 3CCQA 3DB4A 4M77E 1UGSB 4MMLA 3MP8A 4M78G 2VGNA 2YLBA 3CEYA 4NL2A 2GFUA 4QQ6A 3MP6A 3M5AA 1BIAA 4BBRM 2QQ9A 3SDZA 1NE8A 2GCXA 2PVGB 3NTIA 4XQ3A 2JN0A 3CPFA 2OTJT 4J7IA 4EMHA 4VUBA 4JS4A 3HPWA 2CZ7B 4KUDK 5I2SA 5GAMe 1NJIU 1VQKT 4JRQA 4LOCA 3LGLA 1FWZA 1Q82U 4M7DD 2NLUA 3VUZA 4B9WA 4GY5A 5DLQE 3TW7A 1MGQA 3E1SA 4FSXA 4C8QF 4DQ2A 4QW2A 3I55T 3JCMW 3CD6A 3V7RA 3RIRA 3X25B 2K5FA 1VQ4T 5EG2A 2QXFA 3QYHB 4JRIA 1Q82C 4BE0A 1M1KC 1U1TA 2MWPA 2L8DA 1QVPA 3CC2A 2M9UA 4JRKA 2DXTA 2Y4YA 5FLXE 3TEEA 5LJ5f 4BDZA 4J6WA 4RG2A 1YBYA 3PTAA 3CCLA 2ZPFB 4X9CA 5CKDA 4A4GA 3MEUA 3HFOA 3QKJA 4BI4A 2ZPEB 3M57A 2BS3A 3T9NA 2LRQA 3C4SA 3BG9A 1VQ7T 2OAUA 4JRPA 5D6XA 2GF7A 2JTFA 1P92A 4XTYA 2LQ8A 4ZGEB 2EQJA 3E9GA 3QYBA 1QW1A 2PU9B 3RERA 3C12A 4LD6A 1VQLA 4CI0C 4HT8A 3WVDB 2XI9A 4NL3A 2HNIA 1Y71A 2K2VA 1NPPA 1UGQB 1Y96A 3DLMA 3M53A 4BY6B 1D3BA 1U1SA 2MWOA 3QHSA 5KH6A 4BACA 5CVIA 1Q86U 3SB2A 2RD1A 4F7UE 2HBPA 2AHJB 5LJ3g 3CCVT 2FYKA 2MF2A 2WSCE 4Z02A 1I81A 2DIQA 2JOYA 1YI2T 4E47A 3BG3A 4HL4A 3JCMV 2QEXA 1W2BA 2ZPBB 2VV5A 1KHIA 2K4YA 3F70A 4N0AA 3CMAA 1JJ2S 1QLBA 4LDVA 2LT1A 2Y90A 3E9FA 3JCMb 3MEVA 3P8BB 3SD4A 4E7LA 4M7AD 4C92A 3CCRA 2I2LA 2JVVA 2QQAA 4LDWA 3OA6A 3A8OB 3NTHA 2OTJA 1N8RC 3G71T 3V8JA 1G3WA 1VQOT 5GANe 2QF7A 4M75C 1X75C 4ELYC 5FROA 5GMKj 3MP1A 4A4KA 3HO8A 1KQSS 2XKOC 4RG8A 3URGA 1WJQA 2KK4A 2RHYA 2G77A 2F69A 4BBSM 2RB6A 3G4SA 4MZMA 3CCEA 3TU4K 1NJIC 2E6ZA 4L5GA 3R6OA 1QVFA 2DTIA 4C0DB 1YJWT 3LH0A 4OVAA 5A0DA 4M7AC 4HCZA 2WSFE 5A0GA 1R8OB 2KR6A 3OSVA 4ZTJA 2ZPGB 1KC8U 4RCBA 1LNXA 4M78B 3GF5A 3HRUA 3LWIA 2R57A 1YJNT 1OI1A 2LX9A 2A7YA 2RJDA 4EPCA 1YCYA 2L89A 3I56A 3CPWA 2KMTA 2RO0A 2X35A 1Q81C 4M7DA 4N4HA 2ZPHB 4KT0E 3VU3C 4ELJA 3CBOA 4F7UG 5LJ5j 4DOVA 1UGPB 3M56A 4PL6A 3OYGA 2FB7A 3GNFB 5GANf 4XU2A 2ZGWA 4IUQA 3MEAA 4V2SA 2XDDA 3RMQA 4RKUE 1YITT 3O8VA 4J6XA 2D6FA 2DD5A 1WJRA 4MZPA 3A8MB 1FX7A 4C92D 5KE3A 1VQ5A 3X20B 2E70A 4CRIA 3BFMA 4PJOG 3L2UA 3S3OA 3DB3A 1OYXA 4XTZA 3QWLA 2LNVA 3ZEHA 1N9SA 3SFMA 4MFDA 2DTOA 2R5AA 2MI6A 2VXFA 3OYNA 2E64A 3HKSA 3L2ZA 3JCMX 3RKYA 1M9SA 1M1GA 3S3NA 4PLLA 3OQ5A 3QSUA 4Y28E 4M77F 5KCHA 3OMGA 5DM7R 1VQ8T 4KBMB 3FDRA 2DIGA 2RHXA 2RI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYH B;  2DPP B;  2ZZD A;  2PUK B;  2ZPF B;  3LW5 E;  2ZPE B;  4OB1 B;  4ZGE B;  2PU9 B;  2ZCF B;  1DJ7 B;  3WVD B;  3VYG A;  4OB2 B;  1UGQ B;  2DD5 B;  4L6V 5;  2AHJ B;  2CYZ B;  3QZ9 B;  4FM4 B;  3A8L B;  2WSC E;  5L8R E;  1JB0 E;  3X24 B;  3A8G B;  2ZPB B;  2DD4 B;  2CZ1 B;  4ZGJ B;  3VYG B;  2O01 E;  1UGR B;  1PSF A;  3A8O B;  1QP3 A;  3X26 B;  2ZZD B;  3X28 B;  2DXC A;  1IRE B;  1QP2 A;  4ZGD B;  2DXC B;  1V29 B;  3QYG B;  2CZ6 B;  3VYH B;  2WSF E;  3HHT B;  1PSE A;  2ZPG B;  3WVE B;  2ZPI B;  4XK8 E;  3QZ5 B;  2QDY B;  3QXE B;  4OB3 B;  2DD4 A;  1GXI E;  2ZPH B;  4KT0 E;  2PUO B;  2PVD B;  2PVO B;  1UGP B;  1AHJ B;  2D0Q B;  1UGS B;  2WSE E;  4RKU E;  2DXB B;  2DD5 A;  3A8M B;  2PVG B;  3X20 B;  2DXB A;  2CZ0 B;  2CZ7 B;  4Y28 E;  3A8H B;  4OB0 B;  3X25 B; 
#chains in the Genus database with same CATH topology
 2UUE B;  3VS2 A;  1YFN A;  4MMK A;  2VKN A;  4BCJ B;  1PKT A;  1MMN A;  1R0B G;  1GH6 B;  1NYG A;  4C8Q G;  2A0F B;  2W0Z A;  3JAM E;  2BZY A;  4C0G A;  1E7P A;  2DRK A;  4C5H A;  3RKW A;  4KGV B;  3CC4 T;  1FVV B;  2KMG A;  4FX3 B;  5DY9 A;  2BUD A;  1T0H A;  2LQK A;  5HNB B;  1D1B A;  3HZJ A;  4BI3 A;  2CYZ B;  1QWE A;  3CME A;  3OYC A;  1MMG A;  2QYZ A;  4M7D C;  3EFS A;  3CMA T;  4O5V A;  2DNU A;  2BE7 D;  4R0K A;  1H3Z A;  3RDV A;  2YUO A;  1VIF A;  2FPF A;  3M0T A;  1VUB A;  3NGP A;  4CFU B;  1SF9 A;  4KUL A;  4EC8 B;  2RA2 A;  3X28 B;  4PJJ A;  3PVL A;  1X6O A;  2JMA A;  1GRI A;  1W2B S;  1YIJ A;  4R56 A;  3A5Z B;  2YRV A;  1VQM A;  2DL8 A;  1MMA A;  1QVG S;  2ROL A;  5HBJ B;  2L3S A;  2LTO A;  3OYJ A;  2X9H A;  4FU6 A;  1AZE A;  1M1F A;  1TU0 B;  1NEB A;  4E7I A;  2RQT A;  2DL4 A;  4D8D A;  3JB9 H;  3EG0 A;  4BE2 A;  3FRN A;  4NST B;  3UPU A;  1QVF S;  2PVD B;  3V8L A;  2D0Q B;  3QUI A;  1E9H B;  2YSQ A;  4DEX A;  2HZY A;  4M75 A;  1NPR A;  1WQ7 A;  3REB B;  1SRL A;  3CCV A;  3DTO A;  1VQP A;  2KAF A;  2VC8 A;  1N8R U;  3LX7 A;  3NMZ C;  5LJ3 f;  1GY3 B;  1WHG A;  1VQ8 A;  4JUV A;  4EOO B;  2W96 A;  1Q86 C;  1VQ6 A;  2GTO A;  1AD5 A;  1YP5 A;  4Y91 A;  4DOW A;  1IHV A;  1SG5 A;  3BW1 A;  5CKH A;  1BBZ A;  5CKB A;  2C0O A;  2HMA A;  1VQM Q;  2C06 A;  4PJO A;  3CBP A;  2G3R A;  1YJ9 T;  4IUR A;  1KQS P;  2UZD B;  1BKB A;  4M7D G;  4EMK A;  3OBW A;  2FRW A;  1FMW A;  2DET A;  3CPW S;  2LJ3 A;  4M78 D;  2DJZ A;  2HSP A;  4ANJ A;  2AKL A;  4DEY A;  4OMF B;  2CRE A;  3EGX A;  1WFW A;  4XU1 A;  1B34 A;  3KHI A;  2WAC A;  1RI0 A;  4AI6 A;  1G3N C;  1VQ4 A;  2E1H A;  3CC4 A;  1YJW Q;  4M7A E;  4A54 A;  5GAM j;  2QQ8 A;  2J6F A;  5HKC A;  4F7J B;  2WXV B;  1O75 A;  1RLP C;  3WXM B;  3L2W A;  4X9D A;  3TNH B;  3M0P A;  1I5L A;  4M77 C;  2EYQ A;  3G7Z A;  2B8A A;  1N6A A;  4M78 F;  1CSK A;  3VYH B;  3VS0 A;  2M0O A;  4JX4 A;  1PSE A;  1T3L A;  1JO8 A;  4RCC A;  4R55 A;  3QZ5 B;  4KRC B;  2JNG A;  1K9M U;  2XD0 A;  4ROE A;  1GCP A;  1MUZ A;  2EUF A;  3INZ A;  1XNI A;  5GAN g;  1N8R R;  2WFY B;  5FU6 B;  2EGC A;  2DZC A;  2A36 A;  1GXI E;  3BDU A;  4HNV A;  2PVO B;  2EKO A;  2QEX T;  1Q82 R;  2YHT A;  1ACM B;  4BCI B;  1VQ7 Q;  4M75 G;  2KRO A;  1Q7Y C;  3CC2 T;  3BLR B;  3CCJ Q;  5KE2 A;  4NS5 A;  2IVW A;  4BCQ B;  2QI2 A;  2XHC A;  1J3T A;  2V1R A;  3CBM A;  3A8H B;  4XTW A;  3VV0 A;  3CXC S;  5HK3 A;  2RI2 A;  4EOR B;  2YUP A;  5GAN 2;  3DL1 A;  2RQU A;  4M75 F;  1D3U B;  1WNL A;  2P0Q A;  2GNC A;  2DE0 X;  1YJN A;  2NUZ A;  2O9V A;  2V26 A;  4HXJ A;  4L59 A;  1PKS A;  3M4G A;  2H3E B;  3L2V A;  4BY6 C;  2K3X A;  3QJ6 A;  1OUL A;  3VYG A;  5GAN 7;  1GBR A;  5EC7 A;  2EJG A;  3QZ9 B;  3A8L B;  2KQW A;  4A53 A;  1HXD A;  2YUN A;  2YUQ A;  3PO3 S;  1O9S A;  5GAM f;  3M59 A;  1I0C A;  2E3I A;  4M75 D;  2CP3 A;  3VYG B;  3F5X B;  1ABQ A;  2M1H A;  4PJO C;  4YOS A;  5D6W A;  3CCR T;  2DL7 A;  2VYT A;  1M4Z A;  1YHQ A;  2SEM A;  1D09 B;  2A37 A;  4CFW B;  1I4K 1;  1OZ3 A;  3HFN A;  1IRE B;  1OPL A;  1IXD A;  2FL7 A;  3MHX A;  4FT2 A;  2DZ9 A;  2E10 A;  4C5E A;  1G5V A;  4PFP A;  1EIF A;  1D3B B;  3SEM A;  5GAM h;  2IPO B;  2KSS A;  1H64 1;  3MET A;  3SWN B;  1M5Q 1;  1ZQ1 A;  2O4X A;  4EOM B;  2MMP A;  3DDQ B;  4JJC A;  2AZS A;  1K8A R;  2V8I A;  3C94 A;  1K8A C;  2FO0 A;  3MPU B;  2GTJ A;  3QYE A;  1IB8 A;  2D9T A;  2DD4 A;  2IW9 B;  5CR2 A;  4Y72 B;  2QA4 T;  1R77 A;  4E7K A;  2WIP B;  4EMK B;  3CCQ A;  4M77 E;  2ZAE A;  4C92 C;  1HD3 A;  2PMI B;  3M5A A;  1BIA A;  2EPD A;  1X6G A;  1MNE A;  4XQ3 A;  2E3H A;  1BU1 A;  3QDF A;  1ZSG A;  4KUD K;  2BTT A;  4B9W A;  5M9O A;  3CD6 A;  2MCN A;  4QW2 A;  4BY1 X;  1MV0 B;  5FWC A;  2K5F A;  2LJ1 A;  1Q82 C;  4JRI A;  2MWP A;  1EFN A;  2CP5 A;  1M1K R;  1QVP A;  3CC2 A;  2M9U A;  2DXT A;  2Y4Y A;  2CP2 A;  3PTA A;  5GJW B;  5CKD A;  3CCR Q;  1UFF A;  3HFO A;  2KEA A;  5KYN A;  5D6X A;  2JTF A;  4ZGE B;  3QYB A;  2PU9 B;  1VQL A;  4CI0 C;  2C0I A;  2XI9 A;  4ZN1 A;  1D3B A;  2MWO A;  2RN8 A;  1RAG B;  3BHT B;  1E7O A;  4BAC A;  1WLP B;  4F7U E;  1FYN A;  3VS3 A;  3CCV T;  1QVF P;  2DIQ A;  1PD0 A;  4HL4 A;  3JCM V;  1PCX A;  2VV5 A;  4N0A A;  1QLB A;  2Y90 A;  1UDL A;  2DER A;  1B07 A;  1W6X A;  1G3W A;  1TWB A;  1JXM A;  2V1Q A;  5GMK j;  3HO8 A;  2LQN A;  2XKO C;  3URG A;  2G77 A;  1ZA2 B;  1YJN Q;  3THK A;  3R6O A;  2DTI A;  2BPM B;  1YJW T;  2KT8 A;  2J05 A;  4KRD B;  3OSV A;  2K3B A;  5FW9 A;  4ZTJ A;  2P4R A;  3GF5 A;  3LWI A;  1URC B;  3MY1 B;  4AG2 C;  2L89 A;  2KMT A;  3VRY A;  1I07 A;  3H0I A;  2ZPH B;  3VU3 C;  2C5X B;  3CBO A;  2KXC A;  3OYG A;  4LN2 A;  2XDD A;  1TUD A;  5BNJ B;  1WJR A;  5KE3 A;  1VQ5 A;  3X20 B;  3DB3 A;  2EYZ A;  1VQ9 Q;  1N9S A;  3SFM A;  4JZ4 A;  2R5A A;  4F04 B;  5L2W B;  2LCS A;  4PJN A;  3QSU A;  1F1B B;  4F7L B;  2DIG A;  2RHX A;  2CT3 A;  2JGZ B;  4C92 E;  4AFZ C;  4HVV A;  1NJI R;  1VYV A;  1UGV A;  4PJL A;  5CKE A;  1TFB A;  4F7S B;  2KXD A;  4M6V A;  1GL5 A;  4MFE A;  1QQJ A;  1K76 A;  1U06 A;  5CO7 A;  4JPB W;  1OU8 A;  3M0R A;  3EFR A;  1Q7Y U;  4PNO A;  1QVG A;  1NBE B;  2O9S A;  4M7A A;  3DKM A;  2CCI B;  2NWM A;  2DKG A;  3PNW C;  5GAN 8;  5LQF B;  4RTT A;  5KYU A;  4LUD A;  3HBL A;  3I56 T;  1IGU A;  4M7D F;  4FM4 B;  1X43 A;  3JRZ A;  5LJ3 e;  3OW2 P;  1RUW A;  1VOM A;  3ME9 A;  5LJ3 d;  2LQW A;  4JZ3 A;  4B6M A;  1AD6 A;  4BE1 A;  2DD4 B;  2HAX A;  2MOX A;  4QVD A;  3JCM d;  2OTL A;  4KGZ B;  2FRY A;  4OF1 A;  2FEI A;  1T3S A;  2UZB B;  2LCC A;  5GAN 4;  4AT1 B;  3TNI B;  5HVY B;  3GNG A;  5DLO A;  2HD0 A;  3PMT A;  2DM1 A;  3LYI A;  1YNZ A;  3SHW A;  3V8K A;  5FRN A;  5HBE B;  1UUE A;  2ZPI B;  4XK8 E;  1WJS A;  4EOI B;  2FHD A;  1SEM A;  3JCM Q;  2X4Y A;  5FU7 C;  5IH2 A;  4BCN B;  2UZE B;  2LP5 A;  1WZO A;  2KR3 A;  1Q95 G;  3VS7 A;  1VQ9 T;  1B3Q A;  1ZA1 B;  2DMO A;  1EZZ B;  3GTM S;  2WSE E;  3PIO A;  4E6R A;  1WIE A;  1M8V A;  3OW2 A;  1UB4 A;  2RPN A;  2DXB A;  4C92 B;  1RAI B;  1RL2 A;  5LJ5 g;  5GAN j;  1IO6 A;  1QKX A;  1JST B;  4Z6Y A;  3CCJ T;  2EW3 A;  3M4Y A;  3E19 A;  8ATC B;  2P4T A;  2E12 A;  1VQN T;  3H8Z A;  4ZNX A;  1TUC A;  2DEQ A;  1QMC A;  1WXB A;  1VQ5 T;  2EFI A;  1X2K A;  4F70 B;  5CQY A;  4N4I A;  4HNU A;  1X01 A;  4J9I A;  1OL2 B;  2CCH B;  2L2P A;  3L42 A;  4GLM A;  2HKQ B;  3H6Z A;  1KQS A;  5CQX A;  1G3S A;  2ENM A;  1YIT Q;  2QTV A;  4J7F A;  3TRE A;  1WQW A;  4PFO A;  1M1K U;  3OS0 A;  1X27 A;  3EGD B;  1YHQ Q;  3CCS A;  3AT1 B;  1Q81 U;  4F6S B;  4C8Q D;  3GP8 A;  1BI2 A;  4BCO B;  2BKD N;  3A1P A;  5DQW A;  3ER0 A;  1YIT A;  1WA7 A;  3CCM Q;  4PK4 A;  2VXE A;  1PSF A;  3NTK A;  4HKE A;  2RQV A;  3PGG A;  4XTU A;  4NC6 A;  3JCM g;  4E7S A;  2R58 A;  2FZC B;  3FLG A;  4J8O A;  1BIB A;  4HNT A;  2C5V B;  3JV3 A;  4Y92 A;  4OGR B;  1QP2 A;  4E2F B;  1OZ2 A;  1VYU A;  4IUV A;  5KYY A;  1RLQ C;  2EYY A;  4J83 A;  1X2Q A;  5ECA A;  3MY5 B;  3KUF A;  2H3J A;  3TSW A;  1KK7 A;  4P5N A;  3EG1 A;  1N27 A;  1ZP2 A;  1UHC A;  5IAY A;  2KVQ G;  1AWJ A;  2MK5 A;  3OYY A;  1QCO A;  1NZ9 A;  1XJW B;  2L5Q A;  5GAM d;  2PK2 A;  3CCM T;  1XQH A;  2RM4 A;  1CKA A;  2M51 A;  2Z0W A;  4E7H A;  2JM9 A;  1K9M C;  1NYF A;  3H4C A;  4AKG A;  1O9K A;  1Y96 B;  2DRM A;  1ARK A;  3QO3 A;  2NUP A;  3HSB A;  2M0Y A;  1YHQ T;  3FC3 A;  5GAM g;  4FYV B;  2HL5 C;  2D8H A;  2EIF A;  3ULR B;  2AK5 A;  1S1N A;  1AVZ C;  2LJ0 A;  3MKD A;  2L0A A;  4QQG A;  5GAN h;  5A2Q E;  3CC7 A;  4F6U B;  4M78 A;  2X3W D;  5CKF A;  3JCM h;  2PUK B;  2K5I A;  3JB9 F;  1LJO A;  1H92 A;  3LW5 E;  3RKX A;  2KE9 A;  2DEU A;  4ORZ A;  1PM3 A;  4OP0 A;  3OYA A;  3TSZ A;  2OTJ Q;  2LC4 A;  4OGE A;  4C92 F;  1JJ2 A;  4LDU A;  1WHM A;  2QGF B;  3EG2 A;  2DD5 B;  2O2O A;  4A4H A;  1GUX B;  2COY A;  3CC4 Q;  5IXF A;  3UWN A;  1WPY A;  4AFU C;  2KNB B;  2RJE A;  2OTL Q;  2E4H A;  5J39 A;  5IHK A;  5I22 A;  4JDS A;  4Z89 A;  2QQR A;  1N5Z A;  4M75 B;  4M7D E;  4JLG A;  1VQO A;  5A0L A;  4A4E A;  1FXX A;  2X51 A;  4HCB A;  1OIY B;  2HEQ A;  2EBP A;  3EJ1 B;  3G6E A;  2KI7 A;  4ZGD B;  2ROT A;  3BY7 A;  4M77 B;  2JW4 A;  1UJ0 A;  1K4U S;  3UDC A;  5CEI B;  5GAN 6;  4JJN K;  1QCN A;  2NUT A;  2IIM A;  4MIM A;  2CUD A;  2RHU A;  2IW6 B;  3M0Q A;  5J3B A;  1Q81 R;  4GBQ A;  4BCH B;  5C0M A;  1ZUU A;  4IIM A;  5GMK i;  2X4W A;  2BZX A;  4IIO A;  4OR5 B;  2ESW A;  2YLB A;  3CEY A;  4QQ6 A;  3CPW A;  2QQ9 A;  1VQ8 Q;  2M02 A;  1NE8 A;  2GCX A;  2PVG B;  3QWX X;  2OTJ T;  2JN0 A;  1U5S A;  1GFD A;  2CZ7 B;  5GAM e;  3LGL A;  1FWZ A;  3TW7 A;  4FSX A;  3I55 T;  4DQ2 A;  2COZ A;  3EGU A;  3X25 B;  2AKK A;  3G4S Q;  4CC7 A;  5EG2 A;  3DOG B;  4BE0 A;  2G6F X;  4KGX B;  2PK9 B;  5FLX E;  1AZG B;  4J6W A;  4RG2 A;  1M8M A;  3G33 B;  4A4G A;  4G6L B;  3MEU A;  2OAW A;  2BS3 A;  5AT1 B;  3B57 A;  1WXU A;  4QKU A;  2LRQ A;  3C4S A;  4WCI A;  2GF7 A;  1QKW A;  1P92 A;  4XTY A;  3E9G A;  2V22 B;  1LVK A;  2PHG A;  1QMZ B;  2PZ1 A;  4J9B A;  2OJ2 A;  3BE3 A;  3C12 A;  3BHV B;  4LD6 A;  5KYX A;  2J6O A;  2KRS A;  1LPL A;  3WVD B;  1Y71 A;  2K2V A;  1NPP A;  3DLM A;  4BY6 B;  3I9Q A;  5CVI A;  2RD1 A;  2HBP A;  2AHJ B;  4J9E A;  1E6G A;  2MF2 A;  2WSC E;  1I81 A;  2IW8 B;  2JOY A;  1YI2 T;  3CXC P;  2K4Y A;  2NUT B;  2LT1 A;  3JCM b;  3MEV A;  3P8B B;  2E5K A;  2I2L A;  2JVV A;  1IHW A;  1N8R C;  1H26 B;  4CFV B;  5GAN e;  4RTU A;  3MI9 B;  5CYI B;  4A4K A;  4AFS C;  4BBS M;  3HTR A;  3TU4 K;  1F5Q B;  4WTO B;  3QWY A;  1KXU A;  4YOO A;  3GBQ A;  4OVA A;  5A0D A;  3CC7 Q;  3I55 Q;  1ZUY A;  4HCZ A;  2WSF E;  4DBQ A;  2KR6 A;  4I3Z B;  2ZPG B;  1KC8 U;  5IXB A;  2AIR B;  4RTV A;  2R57 A;  4BCF B;  1AWO A;  1OI1 A;  1Q81 C;  4M7D A;  4N4H A;  4F7U G;  5LJ5 j;  4DOV A;  1JJ2 P;  2WHB B;  2JT4 A;  3PE0 A;  3VS5 A;  3RMQ A;  1JQQ A;  1YCS B;  3O8V A;  1RAH B;  4J6X A;  2D6F A;  1C1A A;  1WX6 A;  2JTE A;  2E70 A;  4PJO G;  2R7G A;  3NHN A;  3S3O A;  1OYX A;  3MJX A;  5KYY B;  2DTO A;  3OYN A;  3L2Z A;  1H27 B;  3HKS A;  1ABO A;  1M9S A;  4EIK A;  2CP7 A;  4J9F A;  4M77 F;  1OI9 B;  5DM7 R;  3OMG A;  2QAZ A;  3R6N A;  1VQ8 T;  3FDR A;  3M0U A;  2YXY A;  2DFU A;  2BS4 A;  3PVQ A;  4RMO A;  1K9A A;  1BI1 A;  4DA4 A;  2DPP B;  2G9X B;  1U8R A;  3POM A;  2NUP B;  1JXO A;  3G71 A;  1H28 B;  2VUB A;  2O88 A;  4CC4 B;  5DQV A;  4BD3 A;  3OYL A;  2FVU A;  2LCL A;  1N4M A;  3G4S T;  5I2M A;  3I55 A;  1HJD A;  2QQB A;  4MDX A;  4OMM A;  2WPA B;  4M4Z A;  1K8A U;  1K0S A;  2WMA B;  3H9N A;  1R0C B;  1V76 A;  4OB2 B;  2X3X D;  3ASK A;  1OPK A;  4L6V 5;  4PLI A;  3GPL A;  1TTH B;  2EKH A;  2ECZ A;  1JB0 E;  2JTM A;  3OYF A;  2KT1 A;  3ZBD A;  1IZ6 A;  5IN1 A;  1PG5 B;  1VQ6 T;  2QEX Q;  2XID A;  1M2V A;  3QJY A;  1UGR B;  1G3T A;  3EGD A;  3VS4 A;  4IUP A;  4LNP A;  2P84 A;  2EYW A;  5EJC A;  3GOX A;  1VQK A;  4BCM B;  3PIP A;  3GLX A;  2DXC A;  2W9F A;  4JX5 A;  1H1S B;  1YI2 A;  2LVM A;  2JXB A;  1S72 Q;  1C9B A;  3QYG B;  1Q7Y R;  1MHN A;  2CZ6 B;  2YT6 A;  1HSQ A;  4BCN D;  2DIL A;  2RQR A;  2I0N A;  1RAE B;  1KC8 C;  2A3L A;  2VWF A;  2KY9 A;  3CCL T;  3MCA B;  3CCU T;  3CCS T;  4NOY A;  1XTD A;  5IHI A;  2W10 A;  1QLY A;  5HK0 A;  1VQ7 A;  2F2C A;  1UHF A;  3GIB A;  1AHJ B;  1E6H A;  4PKC C;  3J80 E;  2EQK A;  4HT9 A;  2AT1 B;  1YN8 A;  2E6N A;  2XK0 A;  3JCM J;  5GAO q;  4OMO A;  4OML A;  2XDP A;  4JLI A;  2A28 A;  1A0N B;  4A4F A;  1RI9 A;  1SPK A;  1WXT A;  2RH2 A;  2WIH B;  4EOL B;  2DLP A;  4M77 A;  4BUG A;  4LXC A;  2RHZ A;  5IHY A;  2BIV A;  4EOJ B;  3P8D A;  4OB0 B;  2EVR A;  4TVR A;  3BHU B;  1V1C A;  3QDR B;  1ZBX A;  4ROD A;  1P5E B;  2CP0 A;  6AT1 B;  3QBY A;  4B9X A;  3OS1 A;  5LMK B;  1VOL A;  1PC0 A;  4OB1 B;  1AWX A;  2QAS A;  3OY9 A;  2DXU A;  2QA4 A;  1VQM T;  5GAN d;  3S6W A;  5LJ3 h;  2L3Q A;  3L2Q A;  2QG9 B;  1UEB A;  2C5O B;  5C6S A;  2ZCF B;  3MO8 A;  3OYB A;  1WYX A;  2DVJ A;  3NPF A;  3H0F A;  3EG9 A;  2CKK A;  1KSW A;  1D1C A;  4D8K A;  4II5 B;  1G8X A;  4GLK A;  1ENW A;  4M78 E;  4F7U A;  2JM8 A;  2DAQ A;  2LW4 A;  5GMK m;  4HVU A;  4J9D A;  2EQM A;  3QII A;  2CH4 W;  4FYW B;  2CDT A;  1VQ6 Q;  1AIS B;  1RAD B;  2KYB A;  1TG0 A;  2Y4X A;  4IUT A;  2KBT A;  4IUU A;  2RK2 A;  2XG8 D;  8AT1 B;  5GAO p;  3HHT B;  4C0Z A;  2QQS A;  3EG3 A;  4IKF A;  1VQP Q;  4M75 E;  1VQL T;  3TCJ A;  3D7S B;  2RJC A;  3OW2 S;  2RF0 A;  4OMQ A;  3L2R A;  2VAS A;  1W70 A;  4BCG B;  1G83 A;  4BI8 B;  4ME7 A;  4EMK C;  4RUG A;  3TNW B;  2V8K A;  2PQW A;  2CJM B;  4BCP B;  4M7A F;  2LNH B;  3OYH A;  3M55 A;  2R5M A;  1M90 U;  3U23 A;  5D6Y A;  3CME T;  1B7T A;  5I11 A;  1SSH A;  3BDL A;  4LUE A;  4QQD A;  2MYS A;  3N5B B;  3CCJ A;  1OKW B;  2GFA A;  4D6W A;  2QGG A;  4HA8 A;  3CCV Q;  5EFQ B;  1M3C A;  2B86 A;  4F17 A;  3LGF A;  4A63 B;  2DVE A;  4ESR A;  3VUB A;  2YWW A;  1YIJ Q;  4N4G A;  4EC9 B;  2QFZ A;  3K7A M;  3E2U A;  2QDJ A;  1M2V B;  3OB9 A;  4QVC A;  2W2H A;  3QG1 A;  1RAC B;  2DX1 A;  4EDU A;  5I5Z B;  1JBM A;  3LQ5 B;  3REA B;  3HP9 A;  3RNJ A;  4Z88 A;  2M16 A;  2HQE A;  2JUF A;  3RMS A;  4XTV A;  1KD1 R;  4F7N B;  1I8F A;  4BCM D;  3V7S A;  3RES A;  1S72 A;  2VB6 A;  3QPH A;  2K57 A;  1NM7 A;  5L8R E;  1FKM A;  2L3R A;  4OGC A;  3JB9 J;  2C0T A;  1RAB B;  2LDM A;  5IF1 B;  2K7A A;  3CQT A;  1NEG A;  2X4J A;  4EON B;  1U3O A;  1VYT A;  5GAO n;  4ZGJ B;  2UZL B;  2EJ9 A;  2CP6 A;  4FCY A;  2O01 E;  4UN0 A;  4HLQ A;  2YRD A;  3JCM e;  3PFS A;  4JS5 A;  3BG5 A;  1H8K A;  5GMK e;  2ZZD B;  2HBW A;  2DJQ A;  5I21 A;  3RGF B;  2QDL A;  2BE9 B;  2DL5 A;  4J9C A;  3EH2 A;  5IT9 E;  4FSS A;  2EJF A;  4AKH A;  1K73 C;  5LJ3 j;  1M3B A;  1D0Y A;  3CME Q;  3M0S A;  3PMI A;  4DBF A;  2K3Y A;  3MEW A;  2KRM A;  5FRM A;  1ZSZ B;  4Q5W A;  1K73 U;  5GAO m;  2DYI A;  2F5K A;  2KGT A;  3FJP A;  4PJO F;  5HCK A;  2KDS A;  1Y7X A;  4EOP B;  3SWN A;  1M30 A;  5GAO l;  1QCF A;  1TXQ A;  2HQX A;  3TQ7 P;  1ZSZ A;  3HRS A;  1UNG D;  4N0A C;  2W99 A;  3DB4 A;  3CCU Q;  1UGS B;  1I1J A;  1SHF A;  3MP8 A;  3UAT A;  4BBR M;  4RTZ A;  3CPF A;  3HPW A;  1JEG A;  2ED0 A;  1NJI U;  4LOC A;  2EYX A;  3VUZ A;  2I40 B;  4GY5 A;  5D7U A;  4C8Q F;  1MGQ A;  3JCM W;  1PRM C;  1GUX A;  2J6K A;  3V7R A;  1AOJ A;  1ZX6 A;  1VQ4 T;  2HL3 A;  3QYH B;  1M1K C;  1C0M A;  1BCM A;  4X1V A;  3EOC B;  3TVT A;  4JRK A;  2YRC A;  3TEE A;  5LJ5 f;  1YBY A;  2W9Z A;  4IMY B;  2ZPE B;  3T9N A;  3BLQ B;  1QWF A;  4JRP A;  2K6D A;  2EQJ A;  1KIK A;  4QT7 A;  3RER A;  3VRZ A;  1M90 R;  1H24 B;  4HT8 A;  4FYX B;  4NL3 A;  1VQK Q;  3M53 A;  1UGQ B;  3JB9 G;  2DF6 A;  4KH0 B;  4CFN B;  4Z02 A;  2DBM A;  1OX9 A;  3BG3 A;  1OGU B;  1KHI A;  3CMA A;  3F70 A;  1BCO A;  4CC2 A;  4RTX A;  4ROC A;  4E7L A;  4C92 A;  3CCR A;  4DBH A;  1OKV B;  3EG9 B;  3V8J A;  1FIN B;  2QF7 A;  5FRO A;  3MP1 A;  1UJY A;  2RHY A;  2F69 A;  3I35 A;  2RB6 A;  1ZLM A;  4RTW A;  2E6Z A;  2D8J A;  4C0D B;  4M7A C;  3LH0 A;  1TSF A;  2AZV A;  1R8O B;  1AT1 B;  4RCB A;  4M78 B;  1Z9Z A;  3HRU A;  2DME A;  4J9H A;  1VQN Q;  1C6V X;  2LX9 A;  4EPC A;  1WI7 A;  1YCY A;  5KYW A;  3I56 A;  7AT1 B;  2RO0 A;  1OX8 A;  2GGR A;  4PL6 A;  3M56 A;  3CCQ Q;  1UNL D;  3CCL Q;  2ZGW A;  4IUQ A;  4V2S A;  1K0X A;  1YIT T;  4MZP A;  4C92 D;  3A8M B;  1FX7 A;  1H4L D;  3VS6 A;  2DA9 A;  2PNI A;  3L2U A;  2SRC A;  1SRM A;  3FJ5 A;  2LX7 A;  2LNV A;  4MFD A;  1Q82 U;  4M7D D;  2VXF A;  3JCM X;  2J06 A;  1JSU B;  3RKY A;  1M1G A;  3KFV A;  2JS0 A;  4PLL A;  3S3N A;  4Y28 E;  3UA6 A;  4KBM B;  2RNA A;  2RI5 A;  5J26 A;  3JSC A;  3RUX A;  4PJO B;  2K2M A;  4K11 A;  3L1A A;  5ICP B;  3J7A F;  3NDQ A;  3SWN C;  3CPW P;  3CCU A;  3MIA B;  2EQU A;  2LZ6 B;  2CSQ A;  1D0Z A;  1ZSZ C;  2IG0 A;  1KHC A;  3VKH A;  1W4S A;  3Q1J A;  1QVG P;  1YJW A;  2KYM A;  4FL6 A;  4E7J A;  1YJ9 Q;  4CFM B;  1GBQ A;  3VS1 A;  1G3Y A;  4MDW A;  5CIU A;  4C8Q B;  5KYX B;  4PJO E;  1PKD B;  1B34 B;  3JCM P;  2DYB A;  3CCS Q;  3OYE A;  3VKI A;  3LLR A;  3OS2 A;  5CCA A;  3CCQ T;  1Y57 A;  3KBG A;  1FMK A;  2FZG B;  4C8Q A;  1JRI A;  3CC7 T;  1QP3 A;  3X26 B;  2EQI A;  4FW2 A;  4J5Y A;  3VJP A;  3LWH A;  1VYW B;  3CD6 T;  4JJB A;  2DK3 A;  4F16 A;  3J81 E;  4C8Q E;  4ELZ C;  1IGQ A;  1OOT A;  1JU5 C;  1TH7 A;  4QSH A;  5FU7 B;  1SSF A;  2RQW A;  4C5I A;  1TUG B;  3HB9 A;  4JX6 A;  2FG0 A;  5FU6 C;  2FPE A;  5L23 A;  2OX7 A;  4E7Z A;  2D1X A;  2JJ9 A;  5LJ5 e;  2XU8 A;  3EGX B;  4XU3 A;  1G2B A;  4Z8A A;  3CC2 Q;  1XOV A;  3AHU A;  2P0K A;  2OI3 A;  2RMO A;  4M77 G;  1JOW A;  4M7D B;  2YDL A;  4LDY A;  2DO3 A;  4XAX B;  5LJ5 h;  2DXB B;  1BB9 A;  2BKZ B;  3S3M A;  2BS2 A;  1KQ2 A;  1HYO A;  1KFZ A;  2CZ0 B;  4QVZ A;  2ATC B;  1M3A A;  1Y0M A;  2D0N A;  4ZN3 A;  2QGS A;  1BK2 A;  1BI3 A;  3M58 A;  1BI0 A;  4C0F A;  4TTH A;  1UNH D;  2K5L A;  4EOK B;  3G6E T;  1AEY A;  1KJW A;  1WDX A;  4FW1 A;  4BY7 X;  4J9G A;  5GMK l;  5HQ0 B;  4M7A G;  4FIB A;  4LDX A;  2OTL T;  4AKI A;  2EWN A;  2O4X B;  4PJO D;  2ZZD A;  1Y07 A;  2FPD A;  2F5T X;  3HL8 A;  2X1N B;  2HDA A;  2E41 A;  3RR6 A;  4RTY A;  1I5O B;  1YIJ T;  2PJQ A;  2QK0 A;  2CS7 A;  1KC8 R;  1LOJ A;  4LE9 A;  2RI3 A;  4DBR A;  3H0H A;  1GCQ C;  2E5Q A;  2C5N B;  3JCM c;  3DDP B;  2RK1 A;  1DJ7 B;  2H8H A;  2LMJ A;  1LCK A;  2MIO A;  2KRN A;  1ZHI A;  1HK9 A;  4OMN A;  5IDP B;  4J6Y A;  2XMF A;  2GQV A;  5GAN 3;  3JB9 I;  1OU9 A;  2P0P A;  1NLO C;  2K9G A;  4CC3 A;  3FEO A;  1WHJ A;  2XDB A;  1W98 B;  1MMD A;  3RBB B;  2HQH A;  2CGH A;  1OIU B;  2I53 A;  1OV3 A;  1KQ1 A;  2DXC B;  3EID B;  1V29 B;  2GBQ A;  3CXC A;  2RJF A;  3WVE B;  3OYK A;  3EFO B;  1H1R B;  2QDY B;  3QXE B;  4XTX A;  4M7A B;  4C0D C;  1UG1 A;  5LL6 S;  1S72 T;  2YLC A;  4OB3 B;  5ACB A;  3JB9 D;  4ZTF A;  4KUI A;  5AYF A;  3DLL A;  5HY6 A;  1VQ9 A;  2PUO B;  1WHK A;  1PWT A;  2QTX A;  3OBY A;  2C4G B;  2E65 A;  3C95 A;  3ZFJ A;  1KG1 A;  2X4X A;  4C8Q C;  2C6T B;  3JCM f;  2F2W A;  4HCK A;  4FYY B;  3UT1 A;  5GAO r;  1O9K B;  1RAA B;  4II1 A;  5CAI A;  4X34 A;  4CRL B;  1T0J A;  4XU0 A;  4JJD A;  2A08 A;  2FZK B;  3A98 A;  4KH1 B;  4BB7 A;  4F7U F;  3I56 Q;  3OYI A;  2JZ2 A;  2F2X A;  4EMG A;  1VQN A;  1W1F A;  1YI2 Q;  3KXT A;  2MAM A;  5KYW B;  1K73 R;  1KD1 C;  4C92 G;  4PFZ A;  1Z9Q A;  4UC4 A;  3TW6 A;  2ABL A;  1UEC A;  3IQL A;  1VIE A;  4F7U B;  1D0X A;  1BYM A;  3OMC A;  2XIC A;  2CUB A;  3H41 A;  4O6J A;  4LD9 K;  4AMC A;  1X69 A;  3HRT A;  1EX4 A;  1MV3 A;  3C0C A;  1PRL C;  2WMB B;  1TS9 A;  1OQK A;  1XO2 A;  2JS2 A;  3CMA Q;  1M90 C;  3M9Q A;  3P8H A;  3VKG A;  2CH4 A;  1H1Q B;  3PT9 A;  1PNJ A;  4BCQ D;  1YJ9 A;  2COW A;  4F14 A;  4C5G A;  5GAN 5;  4YTL A;  1SHG A;  3DJB A;  1WGS A;  3CCE T;  4M77 D;  2CT4 A;  1VQ4 Q;  3X24 B;  4YC3 B;  3A8G B;  3CCM A;  1OEB A;  2V8J A;  3EAE A;  2CZ1 B;  1M27 C;  3OSS C;  1IRX A;  5GMK h;  3M54 A;  3NFC A;  3EHR A;  1BU2 A;  2K79 A;  5LJ5 d;  1ZUK A;  1VQP T;  3OS5 A;  4EOS B;  1WHL A;  2HKN A;  2WJ9 A;  4EOQ B;  2IVX A;  2RHI A;  4HCC A;  5HBH B;  1GCQ A;  4FT4 A;  2DTH A;  4AFQ C;  4WF2 A;  3UF4 A;  2VGM A;  3OYM A;  3OYD A;  2QA4 Q;  5CK9 A;  2EAY A;  2LT4 A;  5KCO A;  3FB9 A;  2O31 A;  4MZT A;  1H1P B;  3V7C A;  3TN8 B;  4M78 C;  1WHH A;  1PHT A;  3CD6 Q;  3I5R A;  4BCK B;  2DL3 A;  4BDY A;  4HVW A;  3FIF A;  3O0G D;  1N9R A;  1ZBJ A;  1OL1 B;  4MML A;  1VIN A;  4M78 G;  2VGN A;  4NL2 A;  3SD4 A;  3G71 Q;  2GFU A;  3SDZ A;  3MP6 A;  1K9M R;  3NTI A;  4J7I A;  4EMH A;  4VUB A;  4JS4 A;  1FMV A;  5I2S A;  1UTI A;  4JRQ A;  1VQK T;  1H25 B;  2NLU A;  3EHQ A;  1YWO A;  5DLQ E;  3E1S A;  4ELL A;  3RIR A;  3CCE Q;  1NLP C;  2QXF A;  3LH5 A;  1U1T A;  2L8D A;  4OMP A;  2EGE A;  1CKB A;  4BDZ A;  2PTK A;  3G6E Q;  3CCL A;  2ZPF B;  3UA7 A;  2DBK A;  4X9C A;  3QKJ A;  4BI4 A;  1VQO Q;  3M57 A;  3QHW B;  1VA7 A;  3BG9 A;  1VQ7 T;  2OAU A;  3EH1 A;  2LQ8 A;  2IN3 A;  1GFC A;  1QW1 A;  4YOZ A;  4CFX B;  1MND A;  3BLH B;  2ED1 A;  5GJV B;  1K1Z A;  2HNI A;  1KD1 U;  1Y96 A;  5KH6 A;  3EFO A;  1NG2 A;  1U1S A;  3QHS A;  5IHN A;  1Q86 U;  2MPX C;  3SB2 A;  5LJ3 g;  1VQL Q;  2FYK A;  4E47 A;  2F1L A;  2QEX A;  1W2B A;  1AWW A;  2ZPB B;  4CFU D;  4CXA B;  1JJ2 S;  3O5Z A;  2EGA A;  4LDV A;  3E9F A;  1M2O A;  4M7A D;  2QQA A;  4LDW A;  3OA6 A;  3A8O B;  3NTH A;  2OTJ A;  2GQI A;  3G71 T;  1SKU B;  2NYS A;  2B9R A;  1VQO T;  5IDN B;  4M75 C;  1X75 C;  4ELY C;  1Q86 R;  1X6B A;  1KQS S;  4RG8 A;  2J7I A;  1WJQ A;  2KK4 A;  3G4S A;  2HSE B;  4MZM A;  3CCE A;  1NJI C;  1D1A A;  4L5G A;  2JMC A;  1QVF A;  1JKW A;  3M03 A;  5A0G A;  5KYU B;  1LNX A;  1YJN T;  3G1J A;  2A7Y A;  2BZ8 A;  2RJD A;  4AG1 C;  2X35 A;  4KT0 E;  1TD6 A;  4ELJ A;  1H3H A;  4BXX X;  1UGP B;  2FB7 A;  3GNF B;  5GAN f;  4XU2 A;  3MEA A;  9ATC B;  2F2V A;  4F6W B;  4RKU E;  3QHR B;  2DD5 A;  2WEV B;  1RAF B;  2HCK A;  4CRI A;  3BFM A;  1YWP A;  3ZL7 C;  4XTZ A;  3QWL A;  4PJM A;  5FWB A;  2CSI A;  1W2B P;  5FGK B;  1TOV A;  3ZEH A;  1VQ5 Q;  2MI6 A;  2E64 A;  3I5S A;  4KRT A;  3OQ5 A;  1PD1 A;  1UE9 A;  2VVK A;  5KCH A;  2L3P A;  4ATO A; 
#chains in the Genus database with same CATH homology
 2BS4 A;  3JSC A;  5J26 A;  3RUX A;  4PJO B;  4RMO A;  4DA4 A;  1BI1 A;  2DPP B;  4MMK A;  3L1A A;  1U8R A;  4C92 E;  3G71 A;  3J7A F;  2VUB A;  3SWN C;  5CKE A;  3CCU A;  2EQU A;  4BD3 A;  3OYL A;  4M6V A;  2IG0 A;  1KHC A;  4MFE A;  3VKH A;  1W4S A;  2FVU A;  4C8Q G;  3Q1J A;  2LCL A;  3G4S T;  5I2M A;  4B9X A;  5CO7 A;  3JAM E;  3I55 A;  2QQB A;  3EFR A;  4C0G A;  3JB9 G;  1YJW A;  4MDX A;  1Q7Y U;  1E7P A;  4PNO A;  4C5H A;  1QVG A;  4M7A A;  3DKM A;  3RKW A;  3CC4 T;  1K8A U;  4FL6 A;  4E7J A;  2KMG A;  2DKG A;  3PNW C;  5GAN 8;  5DY9 A;  2BUD A;  2LQK A;  1G3Y A;  4OB2 B;  4MDW A;  5CIU A;  3ASK A;  4L6V 5;  4C8Q B;  3HBL A;  3HZJ A;  4BI3 A;  3I56 T;  4PLI A;  4PJO E;  4M7D F;  2CYZ B;  3CME A;  4FM4 B;  1B34 B;  3JRZ A;  5LJ3 e;  3JCM P;  3GPL A;  3ME9 A;  3OYC A;  5LJ3 d;  4M7D C;  1JB0 E;  2JTM A;  3EFS A;  3OYE A;  3VKI A;  4O5V A;  3CMA T;  3LLR A;  3OS2 A;  5CCA A;  3OYF A;  3CCQ T;  2DD4 B;  3ZBD A;  4BE1 A;  2HAX A;  1H3Z A;  1IZ6 A;  1VIF A;  5IN1 A;  1VQ6 T;  1VUB A;  3KBG A;  4QVD A;  3JCM d;  2XID A;  3QJY A;  1UGR B;  1G3T A;  2OTL A;  4IUP A;  4C8Q A;  1JRI A;  3CC7 T;  1QP3 A;  4KUL A;  3X26 B;  4OF1 A;  5EJC A;  4J5Y A;  2LCC A;  2RA2 A;  3X28 B;  3VJP A;  3LWH A;  3GOX A;  1X6O A;  1VQK A;  3PIP A;  3GLX A;  5GAN 4;  4R56 A;  1YIJ A;  2DXC A;  1W2B S;  3CD6 T;  3A5Z B;  2DK3 A;  4JX5 A;  1YI2 A;  2LVM A;  2YRV A;  3GNG A;  5DLO A;  3J81 E;  2HD0 A;  4C8Q E;  1VQM A;  4ELZ C;  1QVG S;  3QYG B;  3PMT A;  1TH7 A;  4QSH A;  2LTO A;  1MHN A;  2CZ6 B;  1SSF A;  3LYI A;  5FU7 B;  4C5I A;  3OYJ A;  3HB9 A;  4JX6 A;  3V8K A;  5FRN A;  4FU6 A;  5FU6 C;  2ZPI B;  1M1F A;  4XK8 E;  1WJS A;  1KC8 C;  2A3L A;  4E7I A;  2FHD A;  3JCM Q;  2KY9 A;  2X4Y A;  5FU7 C;  3MCA B;  3CCL T;  3CCU T;  5LJ5 e;  3CCS T;  2XU8 A;  4NOY A;  1XTD A;  4XU3 A;  3JB9 H;  4BE2 A;  3FRN A;  3UPU A;  5HK0 A;  1QVF S;  1XOV A;  1VQ7 A;  3AHU A;  2PVD B;  2P0K A;  1VQ9 T;  3GIB A;  4M77 G;  3V8L A;  4M7D B;  1AHJ B;  2D0Q B;  4LDY A;  2DO3 A;  3QUI A;  4PKC C;  4XAX B;  3J80 E;  2EQK A;  3PIO A;  2WSE E;  4HT9 A;  5LJ5 h;  2DXB B;  2E6N A;  2XK0 A;  3JCM J;  3S3M A;  5GAO q;  2BS2 A;  1M8V A;  1KQ2 A;  2XDP A;  4JLI A;  3OW2 A;  1UB4 A;  4A4F A;  4M75 A;  2DXB A;  2CZ0 B;  4C92 B;  4QVZ A;  1NPR A;  1WQ7 A;  2RH2 A;  1RL2 A;  5LJ5 g;  3CCV A;  1VQP A;  5GAN j;  2KAF A;  2VC8 A;  4M77 A;  4BUG A;  4ZN3 A;  1N8R U;  2RHZ A;  3LX7 A;  5LJ3 f;  1BI3 A;  3M58 A;  4Z6Y A;  1BI0 A;  4JUV A;  4C0F A;  3CCJ T;  1VQ8 A;  3E19 A;  3M4Y A;  2BIV A;  2K5L A;  3G6E T;  3P8D A;  4OB0 B;  2P4T A;  4TVR A;  1Q86 C;  2E12 A;  5GMK l;  1VQ6 A;  1VQN T;  4M7A G;  3QDR B;  3H8Z A;  4FIB A;  4Y91 A;  1ZBX A;  4DOW A;  4LDX A;  2OTL T;  4AKI A;  2EWN A;  3BW1 A;  2DEQ A;  5CKH A;  2O4X B;  4PJO D;  2ZZD A;  5CKB A;  1Y07 A;  2EFI A;  1VQ5 T;  2C06 A;  3QBY A;  4PJO A;  5CQY A;  3CBP A;  2G3R A;  2F5T X;  3HL8 A;  4IUR A;  4N4I A;  4HNU A;  1X01 A;  1BKB A;  1YJ9 T;  2E41 A;  3OS1 A;  4M7D G;  1YIJ T;  3L42 A;  4EMK A;  3H6Z A;  1KQS A;  5CQX A;  3OBW A;  4OB1 B;  1G3S A;  2CS7 A;  3OY9 A;  2DXU A;  1LOJ A;  2QA4 A;  1VQM T;  2RI3 A;  5GAN d;  3S6W A;  5LJ3 h;  4J7F A;  3CPW S;  3L2Q A;  1UEB A;  3TRE A;  2E5Q A;  5C6S A;  4M78 D;  2ZCF B;  1WQW A;  3MO8 A;  2DJZ A;  3JCM c;  3OYB A;  2RK1 A;  1DJ7 B;  1KD1 U;  1M1K U;  3OS0 A;  2CKK A;  3CCS A;  1ZHI A;  1HK9 A;  4OMF B;  1Q81 U;  4J6Y A;  4C8Q D;  3GP8 A;  1BI2 A;  2GQV A;  5GAN 3;  3JB9 I;  4XU1 A;  2BKD N;  1B34 A;  3KHI A;  2WAC A;  2P0P A;  3ER0 A;  1YIT A;  1RI0 A;  4GLK A;  4AI6 A;  1VQ4 A;  2E1H A;  4M78 E;  2VXE A;  1PSF A;  3NTK A;  4HKE A;  4F7U A;  3CC4 A;  4M7A E;  2DAQ A;  3PGG A;  4XTU A;  4NC6 A;  3JCM g;  4A54 A;  2R58 A;  3FEO A;  3FLG A;  2QQ8 A;  4J8O A;  5HKC A;  5GMK m;  5GAM j;  2XDB A;  1BIB A;  4HNT A;  2EQM A;  1O75 A;  3QII A;  3WXM B;  3L2W A;  4X9D A;  1I5L A;  4M77 C;  2CGH A;  1QP2 A;  1OZ2 A;  2EYQ A;  4IUV A;  2Y4X A;  1KQ1 A;  3G7Z A;  2B8A A;  4IUT A;  2DXC B;  1N6A A;  4IUU A;  1V29 B;  2RK2 A;  2XG8 D;  3CXC A;  4M78 F;  2RJF A;  3VYH B;  5GAO p;  3HHT B;  2M0O A;  4JX4 A;  2QQS A;  1PSE A;  4C0Z A;  3WVE B;  4RCC A;  4J83 A;  4R55 A;  3OYK A;  4IKF A;  3KUF A;  4M75 E;  2H3J A;  3QZ5 B;  2QDY B;  3QXE B;  4P5N A;  3TCJ A;  4XTX A;  4M7A B;  4C0D C;  1VQL T;  2JNG A;  1N27 A;  1K9M U;  2XD0 A;  5LL6 S;  1S72 T;  2YLC A;  3INZ A;  1XNI A;  4OB3 B;  2RJC A;  5IAY A;  5GAN g;  3JB9 D;  2KVQ G;  5FU6 B;  3OW2 S;  4ZTF A;  4KUI A;  5AYF A;  3L2R A;  2DZC A;  5HY6 A;  3OYY A;  3DLL A;  1VQ9 A;  2PUO B;  3BDU A;  1NZ9 A;  4BI8 B;  1GXI E;  2L5Q A;  4ME7 A;  4EMK C;  4HNV A;  2PVO B;  5GAM d;  2EKO A;  2QEX T;  1XQH A;  2QTX A;  2RM4 A;  2V8K A;  3OBY A;  3CCM T;  2PQW A;  2YHT A;  4E7H A;  2E65 A;  3C95 A;  3ZFJ A;  1K9M C;  2X4X A;  1KG1 A;  4M7A F;  4C8Q C;  4M75 G;  3JCM f;  3H4C A;  4AKG A;  1Y96 B;  1Q7Y C;  3CC2 T;  3OYH A;  5KE2 A;  3QO3 A;  3M55 A;  4NS5 A;  2R5M A;  1M90 U;  3HSB A;  2IVW A;  2QI2 A;  3UT1 A;  5D6Y A;  5GAO r;  1YHQ T;  3FC3 A;  5GAM g;  4II1 A;  5CAI A;  4X34 A;  3CME T;  4ZN1 A;  3BDL A;  2XHC A;  4QQD A;  3N5B B;  4XU0 A;  3CCJ A;  2GFA A;  3CBM A;  2EIF A;  4D6W A;  4BB7 A;  4F7U F;  4ATO A;  3OYI A;  2JZ2 A;  3A8H B;  4HA8 A;  4XTW A;  4EMG A;  3VV0 A;  1VQN A;  3CXC S;  5HK3 A;  2RI2 A;  2MAM A;  5GAN 2;  3KXT A;  3LGF A;  3DL1 A;  2DVE A;  4M75 F;  3VUB A;  1WNL A;  4QQG A;  1KD1 C;  4N4G A;  2P0Q A;  5GAN h;  4C92 G;  5A2Q E;  3CC7 A;  4M78 A;  2QFZ A;  4C92 C;  4UC4 A;  2QDJ A;  3TW6 A;  3OB9 A;  5CKF A;  3JCM h;  2PUK B;  1YJN A;  2K5I A;  4QVC A;  1VIE A;  1LJO A;  4F7U B;  3JB9 F;  3QG1 A;  1BYM A;  3OMC A;  2XIC A;  3LW5 E;  4O6J A;  4L59 A;  3RKX A;  4EDU A;  4LD9 K;  1JBM A;  3HP9 A;  4OP0 A;  3HRT A;  3OYA A;  3M4G A;  2M16 A;  2HQE A;  3L2V A;  4BY6 C;  2LC4 A;  2JUF A;  4OGE A;  4C92 F;  1JJ2 A;  3RMS A;  4XTV A;  2K3X A;  3QJ6 A;  4LDU A;  3VYG A;  1I8F A;  3M9Q A;  5GAN 7;  3P8H A;  1M90 C;  3VKG A;  2DD5 B;  3PT9 A;  3QPH A;  3RES A;  3V7S A;  4A4H A;  1S72 A;  2K57 A;  2EJG A;  1YJ9 A;  3QZ9 B;  4C5G A;  3A8L B;  5GAN 5;  2KQW A;  4A53 A;  1HXD A;  4YTL A;  1FKM A;  2L3R A;  4OGC A;  1WGS A;  5L8R E;  3CCE T;  3JB9 J;  4M77 D;  5GAM f;  1O9S A;  3X24 B;  2LDM A;  3A8G B;  3CCM A;  3M59 A;  2X4J A;  2V8J A;  3EAE A;  3UWN A;  2CZ1 B;  5GAO n;  4ZGJ B;  1WPY A;  4M75 D;  2EJ9 A;  3VYG B;  2RJE A;  2O01 E;  3OSS C;  4HLQ A;  5J39 A;  3JCM e;  3PFS A;  3M54 A;  5GMK h;  3BG5 A;  4JS5 A;  4JDS A;  2M1H A;  3NFC A;  4PJO C;  5D6W A;  5GMK e;  3CCR T;  2ZZD B;  2VYT A;  2QQR A;  1M4Z A;  4M75 B;  5I21 A;  5LJ5 d;  1YHQ A;  4M7D E;  1VQP T;  3OS5 A;  4JLG A;  1I4K 1;  5IT9 E;  1VQO A;  2EJF A;  4AKH A;  5A0L A;  1K73 C;  5LJ3 j;  1OZ3 A;  3HFN A;  2WJ9 A;  4A4E A;  1IRE B;  1FXX A;  4HCB A;  2FL7 A;  3MHX A;  4HCC A;  2RHI A;  3PMI A;  3G6E A;  4FT2 A;  2DZ9 A;  2E10 A;  4C5E A;  1G5V A;  2K3Y A;  4ZGD B;  3MEW A;  1EIF A;  4FT4 A;  5FRM A;  2DTH A;  1D3B B;  4WF2 A;  4Q5W A;  2VGM A;  5GAM h;  3OYM A;  3OYD A;  3BY7 A;  5CK9 A;  5GAO m;  2KSS A;  4M77 B;  1K73 U;  1H64 1;  2LT4 A;  2EAY A;  5KCO A;  3MET A;  3FB9 A;  2F5K A;  4MZT A;  3SWN B;  1M5Q 1;  1ZQ1 A;  2O4X A;  3FJP A;  3UDC A;  3V7C A;  4M78 C;  4PJO F;  5GAN 6;  2MMP A;  2KDS A;  4JJN K;  4MIM A;  1Y7X A;  2RHU A;  3SWN A;  5J3B A;  2V8I A;  3C94 A;  4BDY A;  1K8A C;  5GAO l;  3QYE A;  2D9T A;  2DD4 A;  3FIF A;  5C0M A;  2HQX A;  5M9O A;  5GMK i;  5CR2 A;  2X4W A;  3HRS A;  2QA4 T;  4E7K A;  4N0A C;  1N9R A;  4EMK B;  3CCQ A;  3DB4 A;  4M77 E;  1UGS B;  4MML A;  3MP8 A;  4M78 G;  2VGN A;  2YLB A;  3CEY A;  4NL2 A;  2GFU A;  4QQ6 A;  3MP6 A;  3M5A A;  1BIA A;  4BBR M;  2QQ9 A;  3SDZ A;  1NE8 A;  2GCX A;  2PVG B;  3NTI A;  4XQ3 A;  2JN0 A;  3CPF A;  2OTJ T;  4J7I A;  4EMH A;  4VUB A;  4JS4 A;  3HPW A;  2CZ7 B;  4KUD K;  5I2S A;  5GAM e;  1NJI U;  1VQK T;  4JRQ A;  4LOC A;  3LGL A;  1FWZ A;  1Q82 U;  4M7D D;  2NLU A;  3VUZ A;  4B9W A;  4GY5 A;  5DLQ E;  3TW7 A;  1MGQ A;  3E1S A;  4FSX A;  4C8Q F;  4DQ2 A;  4QW2 A;  3I55 T;  3JCM W;  3CD6 A;  3V7R A;  3RIR A;  3X25 B;  2K5F A;  1VQ4 T;  5EG2 A;  2QXF A;  3QYH B;  4JRI A;  1Q82 C;  4BE0 A;  1M1K C;  1U1T A;  2MWP A;  2L8D A;  1QVP A;  3CC2 A;  2M9U A;  4JRK A;  2DXT A;  2Y4Y A;  5FLX E;  3TEE A;  5LJ5 f;  4BDZ A;  4J6W A;  4RG2 A;  1YBY A;  3PTA A;  3CCL A;  2ZPF B;  4X9C A;  5CKD A;  4A4G A;  3MEU A;  3HFO A;  3QKJ A;  4BI4 A;  2ZPE B;  3M57 A;  2BS3 A;  3T9N A;  2LRQ A;  3C4S A;  3BG9 A;  1VQ7 T;  2OAU A;  4JRP A;  5D6X A;  2GF7 A;  2JTF A;  1P92 A;  4XTY A;  2LQ8 A;  4ZGE B;  2EQJ A;  3E9G A;  3QYB A;  1QW1 A;  2PU9 B;  3RER A;  3C12 A;  4LD6 A;  1VQL A;  4CI0 C;  4HT8 A;  3WVD B;  2XI9 A;  4NL3 A;  2HNI A;  1Y71 A;  2K2V A;  1NPP A;  1UGQ B;  1Y96 A;  3DLM A;  3M53 A;  4BY6 B;  1D3B A;  1U1S A;  2MWO A;  3QHS A;  5KH6 A;  4BAC A;  5CVI A;  1Q86 U;  3SB2 A;  2RD1 A;  4F7U E;  2HBP A;  2AHJ B;  5LJ3 g;  3CCV T;  2FYK A;  2MF2 A;  2WSC E;  4Z02 A;  1I81 A;  2DIQ A;  2JOY A;  1YI2 T;  4E47 A;  3BG3 A;  4HL4 A;  3JCM V;  2QEX A;  1W2B A;  2ZPB B;  2VV5 A;  1KHI A;  2K4Y A;  3F70 A;  4N0A A;  3CMA A;  1JJ2 S;  1QLB A;  4LDV A;  2LT1 A;  2Y90 A;  3E9F A;  3JCM b;  3MEV A;  3P8B B;  3SD4 A;  4E7L A;  4M7A D;  4C92 A;  3CCR A;  2I2L A;  2JVV A;  2QQA A;  4LDW A;  3OA6 A;  3A8O B;  3NTH A;  2OTJ A;  1N8R C;  3G71 T;  3V8J A;  1G3W A;  1VQO T;  5GAN e;  2QF7 A;  4M75 C;  1X75 C;  4ELY C;  5FRO A;  5GMK j;  3MP1 A;  4A4K A;  3HO8 A;  1KQS S;  2XKO C;  4RG8 A;  3URG A;  1WJQ A;  2KK4 A;  2RHY A;  2G77 A;  2F69 A;  4BBS M;  2RB6 A;  3G4S A;  4MZM A;  3CCE A;  3TU4 K;  1NJI C;  2E6Z A;  4L5G A;  3R6O A;  1QVF A;  2DTI A;  4C0D B;  1YJW T;  3LH0 A;  4OVA A;  5A0D A;  4M7A C;  4HCZ A;  2WSF E;  5A0G A;  1R8O B;  2KR6 A;  3OSV A;  4ZTJ A;  2ZPG B;  1KC8 U;  4RCB A;  1LNX A;  4M78 B;  3GF5 A;  3HRU A;  3LWI A;  2R57 A;  1YJN T;  1OI1 A;  2LX9 A;  2A7Y A;  2RJD A;  4EPC A;  1YCY A;  2L89 A;  3I56 A;  3CPW A;  2KMT A;  2RO0 A;  2X35 A;  1Q81 C;  4M7D A;  4N4H A;  2ZPH B;  4KT0 E;  3VU3 C;  4ELJ A;  3CBO A;  4F7U G;  5LJ5 j;  4DOV A;  1UGP B;  3M56 A;  4PL6 A;  3OYG A;  2FB7 A;  3GNF B;  5GAN f;  4XU2 A;  2ZGW A;  4IUQ A;  3MEA A;  4V2S A;  2XDD A;  3RMQ A;  4RKU E;  1YIT T;  3O8V A;  4J6X A;  2D6F A;  2DD5 A;  1WJR A;  4MZP A;  3A8M B;  1FX7 A;  4C92 D;  5KE3 A;  1VQ5 A;  3X20 B;  2E70 A;  4CRI A;  3BFM A;  4PJO G;  3L2U A;  3S3O A;  3DB3 A;  1OYX A;  4XTZ A;  3QWL A;  2LNV A;  3ZEH A;  1N9S A;  3SFM A;  4MFD A;  2DTO A;  2R5A A;  2MI6 A;  2VXF A;  3OYN A;  2E64 A;  3HKS A;  3L2Z A;  3JCM X;  3RKY A;  1M9S A;  1M1G A;  3S3N A;  4PLL A;  3OQ5 A;  3QSU A;  4Y28 E;  4M77 F;  5KCH A;  3OMG A;  5DM7 R;  1VQ8 T;  4KBM B;  3FDR A;  2DIG A;  2RHX A;  2RI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...