4OB3B

Crystal structure of nitrile hydratase from pseudonocardia thermophila : a reference structure to boronic acid inhibition of nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
229
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 66
structure length 229
sequence length 229
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob3B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob3B02
1UGPB 4ZGDB 3WVDB 2PUOB 2ZPBB 1GXIE 1UGSB 2WSFE 2DD4A 3X20B 2CZ0B 2PU9B 4RKUE 1AHJB 4OB1B 3WVEB 1V29B 2D0QB 1UGQB 3VYHB 3LW5E 3A8OB 3VYGB 1JB0E 1PSFA 3A8HB 2DXCB 3QZ9B 4FM4B 2ZCFB 3QYHB 3X28B 1PSEA 3A8MB 1QP3A 2DD4B 1UGRB 2ZPFB 2ZPHB 2O01E 2ZPGB 3A8GB 2ZPIB 2CYZB 3QYGB 2PUKB 4ZGJB 2DXBA 2DD5A 2PVOB 3HHTB 3QZ5B 3QXEB 3X26B 3A8LB 2ZPEB 3X24B 2CZ7B 2WSEE 2ZZDA 4Y28E 2CZ6B 4L6V5 2PVDB 3X25B 4XK8E 2PVGB 2WSCE 4OB0B 4OB3B 1QP2A 2AHJB 1IREB 4KT0E 2CZ1B 4OB2B 2QDYB 2DXBB 5L8RE 2DD5B 3VYGA 1DJ7B 2DPPB 2DXCA 4ZGEB 2ZZDB
chains in the Genus database with same CATH superfamily
3BHUB 2QDJA 5EG2A 2RQRA 3FEOA 4MDXA 4F7NB 4C92G 3L2VA 2CCIB 2EKOA 4FIBA 2OTLQ 4X34A 5GAOp 2UUEB 3CC7T 5I5ZB 2JXBA 3OYHA 3G4SQ 1YP5A 4CFNB 2CGHA 2CP7A 4NSTB 1ABQA 2EGCA 1JJ2S 2COYA 2QYZA 1KHIA 2KT8A 2RJEA 1OEBA 3PIOA 4HKEA 3BDUA 4DBQA 3GTMS 1GH6B 2QXFA 3CMET 4EC8B 2WHBB 2QF7A 5GMKm 1H641 4EC9B 5ICPB 2P0PA 4OGRB 1IGUA 1BU2A 3MO8A 2AKLA 1N5ZA 2IW9B 4A4FA 4C92A 5AT1B 3EG3A 5FWBA 1YFNA 2PHGA 1OQKA 1RI9A 1WXBA 2B8AA 2K6DA 3QKJA 2K2VA 2PUKB 2DL8A 2IW8B 3H6ZA 3CCSA 2M16A 1VQ9A 3LH0A 1U1SA 1K73C 2A3LA 2EGEA 2H8HA 4PLIA 4CFWB 1KJWA 2HBPA 2OAWA 2HSEB 2P0QA 4Y28E 5EFQB 3J7AF 3SWNB 3CCSQ 1VQ9Q 2EQUA 2PVDB 3GBQA 4L5GA 1VINA 2V1RA 3QJYA 2KGTA 2LJ3A 2RI2A 3VUBA 1QQJA 5CQXA 1W2BP 4F7LB 4AG2C 2YXYA 4E7SA 1TTHB 1NPPA 4KUDK 1AZGB 2LX9A 1VQLA 3UF4A 1FYNA 4M75B 2NYSA 2V1QA 1ZUUA 4J9GA 2WEVB 3E19A 3V7SA 3A5ZB 4E47A 3CMAT 1W2BS 3SB2A 3CC7A 1VQLQ 3CC2Q 2EQIA 1JEGA 4F04B 1ZBXA 4MDWA 2F69A 1QVFP 2K9GA 1UGSB 2WSFE 3FC3A 4EMKA 4M78C 3V8LA 1Y0MA 4E7ZA 2BE9B 1KD1U 1PHTA 3JCMX 4PL6A 2KDSA 3M0UA 4IURA 1E9HB 3EGDB 4C8QE 4EOMB 4BCNB 4PKCC 3CMEA 4PJNA 4RUGA 2I0NA 3C94A 4HL4A 5LMKB 1QVFS 3VYGB 4UN0A 4M7DE 4N0AC 2L89A 3MHXA 3DB4A 3QZ9B 4LUDA 1U06A 2V26A 3EFOB 2UZDB 4J83A 4OMLA 4BCMB 5L2WB 1AWXA 4M7AB 5KYYA 2K5FA 5GAOl 1I4K1 5GANg 4M77F 4HXJA 2RK1A 2HQHA 1TUGB 3JB9I 2DIGA 4MZTA 5DQVA 4RTUA 4CFUB 1SHGA 5M9OA 4DQ2A 2LQNA 3I55T 1K9MU 1X43A 3HKSA 3MKDA 1B3QA 1H1SB 3QHRB 5KE3A 2JTEA 3M4GA 2FPEA 2WSEE 1TD6A 3I56T 1I81A 2QGFB 2G9XB 3OW2P 5A0DA 1PRLC 3FRNA 4CC7A 1C6VX 4BE1A 4FYXB 3PMIA 2KK4A 4J9EA 2ED1A 1VA7A 3UATA 4X9DA 3POMA 3TVTA 2CJMB 2WIHB 4XU1A 4FW2A 1VIFA 4LDWA 1XO2A 2DL3A 4FW1A 4BY6C 2DXBB 1XNIA 5LJ3j 3CCVT 2DD5B 4RTTA 2W9FA 3CMAA 2QFZA 4M77G 3OSVA 4OP0A 1OI1A 1IRXA 1GUXB 3CCRT 3WXMB 2J6FA 2WIPB 2FVUA 3CMAQ 2LJ0A 3MEAA 1HD3A 2X51A 3TW7A 1IZ6A 1WZOA 3EGXB 1Q86C 2QDLA 3BE3A 8AT1B 1AOJA 3P8DA 4TTHA 3TNHB 1RAEB 2VXEA 3V8JA 4C0DB 1VOMA 1M27C 2LDMA 4C92C 2RQWA 1WFWA 3MY1B 2RD1A 2RM4A 5GMKj 2G6FX 2JN0A 1VUBA 1KSWA 1HYOA 5A0LA 3QWLA 4I3ZB 4M77A 3OYJA 2R5AA 4GLKA 1ZA1B 2LQKA 3RKXA 3E1SA 5FU7C 2RN8A 2PJQA 4OF1A 1K0XA 1BKBA 1UUEA 4AI6A 3I55A 3CD6T 3LX7A 4BDZA 3HHTB 4AMCA 4RG8A 3HFOA 3GNFB 1JSTB 1C1AA 3L2RA 1SG5A 4BI4A 1K8AC 4XU0A 1Y7XA 3I55Q 1N6AA 2GFUA 4NOYA 4II5B 1O9SA 1Z9ZA 4M78E 3CCET 3H0IA 3I9QA 2HAXA 4C8QD 2VKNA 1OOTA 4ESRA 2FRWA 1M30A 3OYNA 3EG9B 1WHGA 1RADB 2DKGA 4BUGA 3CCVA 1UNLD 2YWWA 4M7DD 4PFZA 1R0BG 1K8AR 2E10A 3JCMP 1ZQ1A 3DJBA 2COZA 4EMKC 5LJ3g 5HVYB 4EMHA 2BS4A 1QKWA 1KQ1A 3CCVQ 1N9SA 3L2UA 3CCRA 1GRIA 2YLBA 1PM3A 1M4ZA 2K4YA 2W0ZA 3VS5A 1AISB 2MAMA 2DRKA 3Q1JA 3QO3A 1AD5A 3JCMb 3SEMA 1UNHD 1WHHA 3CCRQ 5FU6C 4DEXA 3PTAA 4WF2A 4LN2A 5HK3A 2M51A 1EFNA 4RCCA 1M9SA 1JXMA 4A4GA 1VQNT 2VV5A 1WI7A 1HXDA 2HKQB 1XTDA 2ZAEA 3ZL7C 2NWMA 1N4MA 5CKEA 3EG0A 4MZPA 1G3WA 2DLPA 3QHSA 3VYHB 5GMKl 3M59A 5LJ3h 1J3TA 1P5EB 3QG1A 1H27B 4RTWA 1QCFA 1Q81R 3QHWB 3H4CA 2J05A 1W1FA 1FVVB 1D1AA 2FG0A 3OS5A 1Y96B 2JOYA 1WJQA 1BI2A 1HSQA 4BBSM 3CBMA 4HVUA 1BK2A 1AT1B 1K73U 2O01E 3CD6A 1YJNT 5AYFA 5LJ5j 2VGMA 3LYIA 2F2WA 3FB9A 2NUTA 3M55A 2DTIA 2E4HA 4ROEA 3CD6Q 1GCQA 5KH6A 2Z0WA 1S72T 3MEUA 1D3BB 2OI3A 4PJOF 2FHDA 3CCEA 2KVQG 4JUVA 3C4SA 3RR6A 3LWHA 3VU3C 3F5XB 1KQ2A 2UZEB 2DVJA 5GMKh 2E64A 5A2QE 4FX3B 2OAUA 5KYXA 5GAOm 1KD1R 2YUPA 2YRCA 3CCEQ 3DB3A 3JCMf 5J39A 4KRDB 2EYWA 1WHJA 3MP8A 3FJ5A 2CP5A 2B9RA 5GANf 4F6SB 1RABB 3OBWA 4TVRA 3CCMT 4DBRA 2YUNA 1M1FA 5CO7A 7AT1B 4NL3A 1VQ4T 2RQTA 4FSXA 3S6WA 2KYMA 4GBQA 1MMDA 3VV0A 2A28A 1G3SA 3RKWA 5DLOA 1T0HA 1I0CA 1TH7A 4JX5A 1VQNA 1MUZA 4PJOG 4YC3B 2DA9A 2GBQA 2QA4T 1VYTA 2XI9A 3M0QA 3TEEA 3EGUA 2X3XD 3DDQB 2E70A 1LNXA 1G3NC 5FWCA 4AFQC 5HKCA 4PNOA 5KYUB 2K3BA 4M77C 2DMEA 1SSFA 2EAYA 2HL5C 1K9MR 3RKYA 3VKGA 2DETA 1VQNQ 2CS7A 1FWZA 3HRUA 4M78D 1OZ2A 2WJ9A 1NBEB 4LOCA 3A8HB 3EG2A 1NJIC 4Y91A 4F7JB 2CSIA 1NE8A 2LCSA 4FM4B 2QTVA 2BS3A 2ZCFB 4OVAA 1QVGP 1OV3A 1YJNA 1TFBA 4AT1B 3A8MB 2QI2A 2XIDA 1OX8A 2DE0X 3NTIA 3MY5B 3SDZA 1OU9A 3TN8B 8ATCB 3PO3S 1W98B 4AFZC 4JRKA 3VRYA 5LJ5g 1YJNQ 1M5Q1 1QMCA 4PJOA 2QEXT 2AZSA 5CK9A 1S72A 2XDBA 2I53A 2HD0A 1NJIR 1OKVB 1D09B 1QVGS 5CYIB 1OPKA 2KROA 2ESWA 3OS1A 3DLMA 2ZZDA 4Y72B 3PMTA 2FB7A 2M0OA 3OYEA 2F5TX 1WXUA 2GFAA 4M75F 4EOOB 4IUVA 4IIMA 5IF1B 4J6WA 1UJYA 3M57A 4J7IA 3LH5A 1SRLA 1E7PA 2COWA 3EH2A 4LNPA 4JS4A 2AHJB 1G3TA 3NPFA 4EMGA 1I8FA 4EONB 1BI1A 1BIBA 3CCMA 2KRNA 2VUBA 1VQPT 2A08A 2B86A 2PK9B 2GGRA 1T3SA 1KQSP 5LJ5h 3HZJA 3OBYA 5GAOq 3G1JA 1VQ4A 2CP3A 4XAXB 5IDNB 2CCHB 1DJ7B 2EYXA 3CCMQ 5GAMf 2LT4A 3BDLA 3I5RA 2A0FB 2KMGA 5J3BA 4EPCA 1Q86U 1VQ4Q 2ZPBB 5HNBB 1WJRA 2QA4A 1URCB 1UECA 1KQSS 4MFDA 4D8DA 1OI9B 1I5LA 2K2MA 2EUFA 2YRVA 4BI3A 2FYKA 4BDYA 5IAYA 4VUBA 4ELZC 4M75G 1BYMA 1B34B 3MP6A 3M56A 2QA4Q 4JRPA 4ZTJA 1GBRA 3EG1A 2JUFA 3ZBDA 1X01A 1VQOT 1RUWA 3RIRA 2MWOA 4CC2A 3OYIA 4HNTA 3REAB 1BI0A 3J80E 2MYSA 2HDAA 3DLLA 1YJWT 1H1PB 5LJ3f 1H26B 3B57A 3SWNA 3TQ7P 5IHKA 1OULA 3OQ5A 5CVIA 5IHNA 4Q5WA 2PNIA 3EAEA 4HT8A 2XU8A 3G33B 4OMOA 2E5QA 5I2SA 1OZ3A 1GCQC 3MP1A 4DOVA 3CCUT 2O9SA 2WMAB 4C92D 3OS0A 3CPWP 4BXXX 2QEXA 1CKBA 1E7OA 3VS2A 2DK3A 3RESA 1K8AU 4AFSC 3QDRB 3RERA 2PTKA 4BCKB 2E41A 1GY3B 1HJDA 3QXEB 4M75A 2O4XB 1RL2A 1KK7A 2LC4A 4F7UE 2PK2A 2QEXQ 1JJ2A 4J8OA 3PNWC 2CP6A 4PK4A 4M7AG 1H92A 1VQMT 3OA6A 4RCBA 4J5YA 3CPWS 4RMOA 2W2HA 4EDUA 5GANj 1OYXA 4E7LA 3N5BB 2EBPA 2C0IA 1Y71A 2L5QA 3M0PA 4F70B 1VQPA 4XQ3A 4J6XA 2RJFA 3EGDA 4FL6A 4K11A 1O9KB 4KT0E 4OB2B 1KC8C 3HO8A 2UZBB 4C5IA 5CAIA 1VQPQ 1W4SA 3C12A 5IDPB 1Q81U 3UA7A 3VYGA 1YITT 2CP0A 1X6OA 1UGPB 1TU0B 3EFOA 3CQTA 4OMQA 2FL7A 4C5EA 4M7AA 2EJFA 3FLGA 1K73R 4BCHB 4AKHA 1QCNA 1IHWA 4PJMA 4FT4A 2CDTA 1VQOA 4BCIB 4CFMB 4JLIA 2RQVA 1Q95G 1FX7A 1BCOA 1AD6A 4LDVA 5GAN5 5GAN7 1YJWA 1C9BA 1V76A 4DBHA 3JAME 1F5QB 2WFYB 5DLQE 2KR6A 4QT7A 1OL1B 2J7IA 2QK0A 1WGSA 5A0GA 3CBPA 2KBTA 3CCUA 4PJOC 1YJWQ 4JJNK 1GL5A 3P8HA 3CC7Q 1H1QB 3ULRB 2VVKA 1AVZC 1WLPB 5DM7R 3K7AM 2KXCA 3V8KA 1W70A 1W2BA 2XD0A 2K3XA 3SHWA 4FYWB 1WPYA 3CCUQ 3M54A 4ELLA 2DXBA 1IHVA 2DD5A 2RMOA 1U5SA 1VQMA 1B07A 1QVPA 4KRCB 1WNLA 1IXDA 3CMEQ 1IB8A 1GUXA 3JCMg 1JBMA 4J9DA 4KULA 4OGEA 2DXUA 2LCLA 2AZVA 5KYNA 4HCZA 4JS5A 1U8RA 1EZZB 1QVFA 2CT4A 2PVGB 3M03A 2FO0A 2RJCA 3PVQA 1RAAB 3V7RA 2D8HA 3EGXA 3OSSC 2GTJA 5GAMj 2PMIB 4A4HA 4MFEA 2WPAB 3URGA 1YITA 2G77A 1PNJA 1WHKA 2M02A 4EOPB 2LMJA 5IXFA 5LJ5f 3CCJT 1KFZA 2QTXA 1K4US 2IN3A 4IUPA 3EJ1B 4J9HA 2RB6A 2EQKA 3GLXA 3JCMh 5HQ0B 1YITQ 1A0NB 2DJQA 5GANh 3NTHA 1YCSB 1YNZA 3BLRB 1G3YA 2RK2A 3GF5A 3ZFJA 3MEWA 1YBYA 4FYVB 4LD6A 3SWNC 4ME7A 2HQXA 1NJIU 4KH0B 4OMPA 4B6MA 1V29B 2I40B 1M3CA 5CKFA 2NUPB 1E6GA 4CC3A 2ED0A 2F5KA 4FSSA 3CXCP 1PSFA 3BFMA 3M9QA 2W9ZA 2DEUA 4BY1X 3CBOA 3OW2A 4M77D 2HEQA 4NC6A 3H0HA 3QWXX 4M75C 4O5VA 3VS1A 2W10A 1QP3A 4C0ZA 3EG9A 1FMKA 3T9NA 3JCMe 1OL2B 2YLCA 1UB4A 2XG8D 3VS4A 3CXCS 5I2MA 2ZPIB 3DL1A 2RHUA 5GANe 5I11A 2LZ6B 4A54A 1YWPA 2JJ9A 2X4WA 3M4YA 4C8QF 4FU6A 1K76A 3R6OA 1AEYA 1Q86R 3JCMJ 2C06A 4ZTFA 4L59A 4M7DF 2CSQA 2MI6A 3MEVA 2H3JA 4XK8E 2BZ8A 2J6KA 1E6HA 4BY7X 1WX6A 2Y90A 4J9FA 3QIIA 4F6UB 2DFUA 2J6OA 4D6WA 5GAMg 3LGFA 2FZGB 3QWYA 3I56A 2PZ1A 3QJ6A 4AKIA 1VYUA 1UJ0A 3CCJA 4M7AC 1AWJA 6AT1B 5HY6A 3CC4T 2W96A 3G71T 1NG2A 4IUQA 4HNVA 2DBMA 3I56Q 2EQJA 2DJZA 4BCQD 4XTVA 4CRIA 1FXXA 1JRIA 3CCJQ 5HCKA 3MCAB 1TS9A 2LNHB 4JJDA 2X9HA 2R7GA 3NTKA 5CQYA 1H4LD 4QQDA 1Y96A 2BE7D 4IIOA 4Z6YA 1FINB 2PU9B 4KGZB 4LXCA 5KYWB 2DEQA 3WVEB 2L0AA 3TCJA 5GAMh 4E7JA 2D9TA 4HVWA 1T3LA 4BCFB 4JZ4A 1VQKT 4F7UB 1NYFA 2MF2A 3LW5E 2DIQA 1JB0E 1D3BA 1Q7YC 1X2QA 5EC7A 3CPFA 2DXCB 1MMAA 4E7KA 5HK0A 5IT9E 1RLPC 2YT6A 1PC0A 2RI5A 3BLHB 4PJLA 1GFDA 2L2PA 2DXTA 4A4KA 2GQVA 2SRCA 4YTLA 4Z02A 1QWFA 2CUBA 4N4GA 2RQUA 3DOGB 5HBJB 4FYYB 2LNVA 2X3WD 1XQHA 5KCOA 4N4HA 1SHFA 2LTOA 5GJVB 3M0TA 1N9RA 2HKNA 2XHCA 5GAMe 4XU2A 3UT1A 2FZCB 3TSZA 3I5SA 3JCMQ 2QQBA 3NHNA 3CCQT 1KC8U 2CP2A 4C0DC 4C0FA 3OYCA 3O8VA 1M2VB 4LD9K 4FCYA 3BG9A 5GAN2 1RI0A 2EJGA 5KYUA 1QMZB 2L3RA 3CC4A 1M8MA 2X4YA 3G71A 3EIDB 3PT9A 2HSPA 1ZHIA 3U23A 4B9XA 1UEBA 1FMWA 1I1JA 1M3BA 2D0QB 2E5KA 5LJ3e 2R57A 1JO8A 3RDVA 3CC4Q 3QSUA 4M75E 4ZGDB 2BTTA 3G71Q 2LQ8A 1Y57A 2CREA 3MPUB 2DZ9A 4X9CA 4QW2A 4C8QB 2KEAA 2L3QA 2DYIA 3LGLA 3MIAB 2JM9A 2KY9A 2XDDA 4C92E 3EHRA 1VQKA 3OYMA 3M0SA 1MMNA 4M7DB 3QYEA 2D0NA 5GAN4 3JCMV 4J9IA 2Y4YA 1LVKA 3E9FA 4ZNXA 4EOQB 2EPDA 4OMNA 1VQKQ 3JCMd 1M1GA 5ECAA 3QYBA 2O31A 1MV0B 4P5NA 2KAFA 5D6YA 4JLGA 2C0TA 5GANd 4QSHA 4PFOA 3FIFA 3JB9F 4QKUA 2RHXA 5BNJB 5GMKe 2M1HA 1M2OA 3D7SB 4XTZA 3UWNA 1KIKA 5LQFB 3BY7A 3RMQA 2BUDA 1M90C 4M7AE 3CCLT 2MIOA 4GY5A 3QUIA 4PJOD 2XMFA 2MCNA 4JRIA 3A8LB 2EJ9A 1SPKA 1JOWA 4F7SB 2CZ7B 2XICA 4M4ZA 3CCQA 2CH4A 3EFSA 3TSWA 5CCAA 2MWPA 2LVMA 4E7HA 4UC4A 2WACA 5FLXE 4DA4A 1S1NA 2MOXA 3V7CA 2HCKA 3GPLA 1G2BA 3G4ST 1SEMA 2LT1A 3CCQQ 1IO6A 2PQWA 4ZN1A 2CKKA 4NL2A 1W6XA 1MV3A 1B34A 4E2FB 1AWWA 2RNAA 1R8OB 5IXBA 2EYYA 4RTYA 2AK5A 2V8JA 5IN1A 3OS2A 4KGVB 3JB9G 3GIBA 1Q82C 4CRLB 1M1KC 2HQEA 2KMTA 4ORZA 1H24B 4IMYB 1WQWA 3G6ET 1UTIA 2DPPB 4KBMB 1S72Q 3META 2M9UA 2DL4A 4ELYC 3VRZA 3L1AA 2BKZB 1EIFA 2PUOB 1QVGA 2EQMA 5CKDA 3L2ZA 4OGCA 4HCCA 3J81E 3JSCA 1NM7A 2RJDA 3M53A 2QQ8A 1JXOA 2KXDA 3AHUA 1RACB 1MNEA 4N4IA 1JU5C 3H8ZA 5IHIA 4BI8B 1LOJA 4HNUA 1GCPA 2YHTA 2O4XA 4JJCA 4IUTA 4OMMA 1CKAA 1MMGA 3HTRA 4DBFA 1ACMB 4C5HA 3BLQB 4MMKA 2DERA 4YOZA 2FRYA 3RMSA 2DNUA 1NLPC 3CCST 4YOOA 3OMCA 9ATCB 5FGKB 5GAN3 1OGUB 1BU1A 1PSEA 2V8IA 4PFPA 3CCLA 2DD4B 4DOWA 3REBB 2ZPFB 4OR5B 1PKTA 3HL8A 5GAMd 3SD4A 1O9KA 4GLMA 1D3UB 4V2SA 2F2VA 1KQSA 3CCLQ 1B7TA 4PJJA 4MZMA 4F17A 2OTJT 2JS2A 2K5LA 4M75D 2E6ZA 4QVCA 5LJ5e 2LP5A 4II1A 4M78B 3OYFA 2R5MA 1F1BB 3X24B 2RA2A 3NFCA 1ZX6A 4KGXB 3BW1A 4FT2A 1JKWA 3VS3A 3CC2T 4F16A 5GMKi 2ROTA 1QW1A 3G4SA 4BCJB 2C6TB 4BD3A 1K0SA 2DTHA 4R56A 2WSCE 2HNIA 2EKHA 1OU8A 4OMFB 2KR3A 1XOVA 2RH2A 1UDLA 2RHYA 2YUOA 4ANJA 4C0GA 5LJ3d 2OX7A 2D8JA 2LJ1A 4J9CA 3NMZC 4AFUC 3ER0A 4BCND 2QDYB 3G6EA 2QQAA 5D6XA 2DO3A 3JB9H 3JV3A 3EH1A 4MMLA 3VS6A 1BCMA 2O2OA 4ZGEB 2JMCA 3G6EQ 2YSQA 2KNBB 2X4XA 2V8KA 4BCMD 4M7AD 1GXIE 4M77E 1NYGA 1KG1A 1SRMA 1ZSZA 5DY9A 3VKIA 1YJ9T 2QQSA 3A1PA 3CPWA 1UFFA 1WHMA 5IHYA 1Q7YU 2WXVB 4CFUD 2X4JA 2RPNA 3C0CA 1VIEA 5GAOr 4X1VA 5ACBA 3A8OB 2VC8A 3OYKA 2L3PA 1BB9A 1PD0A 4KRTA 4JJBA 1WHLA 3GOXA 5KE2A 1KC8R 4BY6B 2K57A 1X75C 3RNJA 3PIPA 2LRQA 3INZA 4QVDA 2OTJA 3VUZA 3QYGB 4BCGB 4HCBA 3DDPB 2H3EB 2AIRB 1SKUB 4J6YA 4A63B 1VQOQ 1VQ8T 1YN8A 3HFNA 4R55A 1WDXA 3CC2A 2OTJQ 2NLUA 1ZP2A 2EVRA 1P92A 3QDFA 3R6NA 1ZSZB 3NDQA 4A4EA 3F70A 4KUIA 2DX1A 3ASKA 1WXTA 1K1ZA 4ATOA 4OB0B 1QP2A 2HZYA 4C92B 2XKOC 3FDRA 2HBWA 4CC4B 2DZCA 1ZUKA 2KRMA 1PCXA 5HBEB 3H41A 1YHQT 1VQ5T 1VQ6T 3S3MA 1QWEA 3L42A 4BCPB 2E1HA 2NUPA 2V22B 2IPOB 1ZA2B 3PFSA 5FU7B 1VQMQ 3TNWB 1I07A 4BB7A 4RODA 3UA6A 4F7UF 2YRDA 1G8XA 4JDSA 1YJ9A 1BI3A 1RLQC 3HP9A 2GNCA 1IGQA 4WCIA 2EGAA 1KXUA 2F2CA 3ME9A 4HT9A 2QASA 1ENWA 5LL6S 3M0RA 1YJ9Q 4Z8AA 1U3OA 2HL3A 2KYBA 2BZYA 3UDCA 1RAHB 2DAQA 3HB9A 4Z89A 4BE2A 1TSFA 2W99A 2JW4A 3SFMA 4D8KA 3OYGA 2G3RA 2XK0A 2EYZA 2IVWA 1M90U 1H3HA 4EOKB 1NZ9A 4XU3A 1NEBA 4EMKB 5IH2A 5LJ5d 2OJ2A 2ZPHB 5GJWB 4JPBW 5FROA 1G83A 2JM8A 4F7UG 2VGNA 2NUZA 1U1TA 4Y92A 3PE0A 1VQ8A 3BG3A 3C95A 1RAIB 2C0OA 1LCKA 2PVOB 4AG1C 3QZ5B 2ENMA 2VYTA 3AT1B 4CFXB 2C4GB 3JRZA 3OY9A 5FU6B 3OW2S 4EOLB 3BG5A 1VQ8Q 1X6GA 3LLRA 5FW9A 4AKGA 5D7UA 2CZ6B 5CEIB 2VASA 3IQLA 3VS0A 4JZ3A 2M0YA 2QG9B 5KYYB 4OB3B 2ZGWA 1Q82U 2E12A 1M1KU 1G5VA 3KXTA 1YHQA 2J06A 1NEGA 1VQ5A 1D1CA 5KYWA 2FZKB 1VQ6A 2A36A 3MJXA 4Z88A 2I2LA 1Z9QA 3EOCB 4HCKA 4F7UA 2LX7A 1ZSZC 1N8RC 2VXFA 1M8VA 1YHQQ 1VQ5Q 3CXCA 1VQ6Q 4ZN3A 2DL5A 2DXCA 1VQ7T 1X2KA 1TUDA 2P4RA 2KRSA 2P84A 1ARKA 2QQ9A 5CR2A 2C5VB 1BIAA 2LQWA 3OYYA 1WYXA 4KH1B 3O0GD 3TNIB 3VS7A 1AZEA 2AT1B 1PD1A 2UZLB 1N8RR 1AHJB 4OB1B 1YCYA 2E65A 5CIUA 2QGSA 4EOIB 1OIYB 2RHZA 4O6JA 3HSBA 2Y4XA 4PJOE 1H28B 4XTUA 3PVLA 1FKMA 1T0JA 4C8QG 1NPRA 1VOLA 3QYHB 3LQ5B 1QLBA 1VYWB 4B9WA 2FEIA 1M2VA 4M7DG 5CKHA 3KFVA 1YIJT 2JTFA 1MGQA 1H1RB 1QLYA 1D1BA 4E7IA 4F14A 4IUUA 2R58A 4RTVA 1V1CA 3JCMc 1QKXA 1O75A 4JX4A 4EOSB 4ZGJB 1VYVA 2DRMA 2IW6B 2ABLA 3E2UA 2QQRA 5D6WA 5I21A 2ZPEB 5CKBA 3VJPA 3OYDA 2IVXA 2C5OB 2BPMB 2F2XA 3FJPA 1LPLA 3RBBB 3TW6A 4EIKA 4M77B 3QPHA 4WTOB 1WJSA 2JNGA 4C8QA 2A37A 3OMGA 4BACA 3DKMA 1UG1A 3L2QA 3M58A 1Q81C 1Q7YR 2JZ2A 1CSKA 1D0XA 1R77A 4JX6A 1IREB 1TWBA 2DL7A 3RUXA 2CZ1B 1GFCA 4M7DA 2MMPA 5GAN8 3RGFB 3HRSA 1VQ7A 2A7YA 2C5NB 2DVEA 2E3IA 1YI2T 3HPWA 1MNDA 2IIMA 1QCOA 1R0CB 2P4TA 3WVDB 1HK9A 1VQ7Q 3EHQA 2HMAA 3DTOA 3X20B 5C6SA 1X6BA 1WA7A 2E6NA 2CZ0B 4XTYA 1JQQA 3JCMW 4RKUE 5I22A 4J7FA 2MK5A 2F1LA 1M3AA 1KD1C 1GBQA 1JSUB 1UNGD 2EIFA 3KHIA 2BZXA 4BCQB 1EX4A 2SEMA 1I5OB 3L2WA 2EFIA 3QBYA 2GCXA 4M78F 3H0FA 3OYLA 2DM1A 4RTZA 3X28B 2K3YA 1YIJA 3S3OA 2DMOA 3MI9B 5DQWA 2GTOA 4LE9A 1MHNA 1UGRB 2GQIA 1PRMC 4QQGA 1RAFB 2AKKA 3VKHA 4PLLA 2ZPGB 2L3SA 1TXQA 1TG0A 4M6VA 2JT4A 2CYZB 4BCOB 1YIJQ 4C5GA 4LDUA 1RAGB 2O9VA 5FRNA 3UPUA 1UHFA 3BHVB 4LUEA 4CXAB 1TUCA 2YUQA 3JB9J 1OPLA 2RO0A 5J26A 1X69A 1LJOA 4R0KA 4G6LB 3OYAA 2X35A 4HA8A 1K9MC 3BHTB 1XJWB 5HBHB 1UGVA 2EYQA 4J9BA 2JS0A 1ZLMA 2BS2A 1ZSGA 4HLQA 4JRQA 5C0MA 1H25B 4M78G 2LCCA 1AWOA 2P0KA 3E9GA 2CUDA 2NUTB 4XTXA 5GAOn 1YI2A 5L8RE 3ZEHA 4DEYA 2DTOA 1SF9A 1BBZA 2VWFA 4CI0C 4BE0A 1N27A 4E6RA 2DYBA 2RHIA 2WMBB 2BIVA 3TREA 1M90R 4CFVB 1SSHA 2FPFA 2OTLT 1FMVA 1YI2Q 4EORB 3GP8A 3O5ZA 5FRMA 5KYXB 3LWIA 2K79A 3G7ZA 3OYBA 2DD4A 4RTXA 2JTMA 4F6WB 2L8DA 2O88A 3TU4K 1H3ZA 2K7AA 2QAZA 1OX9A 2YDLA 1D0YA 2ATCB 4MIMA 4ROCA 2KT1A 3PGGA 2CH4W 1YWOA 3GNGA 2KI7A 2LW4A 1UGQB 2XDPA 1C0MA 4M78A 4A53A 4BBRM 2CT3A 1KHCA 2KE9A 3JB9D 2RF0A 2KQWA 5L23A 2K5IA 3HRTA 2DBKA 1X27A 3A98A 2DF6A 2KSSA 2QGGA 3H9NA 3THKA 1Q82R 1PG5B 1M1KR 4QQ6A 4QVZA 4YOSA 4ELJA 2D1XA 4N0AA 3EFRA 1H8KA 3A8GB 3P8BB 2RI3A 5GAN6 1UE9A 2BKDN 2JMAA 1PKDB 3NGPA 2E3HA 4C92F 4C8QC 3S3NA 3X26B 3HBLA 1Y07A 2JGZB 2DILA 1PWTA 3OB9A 2ECZA 1VQ9T 2EW3A 2GF7A 1D0ZA 1UHCA 4LDXA 3M5AA 4M7DC 4L6V5 1WQ7A 3X25B 4LDYA 2C5XB 3KUFA 4HVVA 1ZBJA 1ZUYA 4IKFA 1TOVA 1N8RU 3KBGA 4NS5A 2D6FA 3CEYA 3I35A 1ABOA 4PJOB 4EOJB 1NLOC 4M7AF 4XTWA 5EJCA 2OTLA 2JVVA 2ROLA 2IG0A 2MPXC 4RG2A 5KCHA 1JJ2P 1PKSA 1K9AA 1VQLT 2X1NB 1OIUB 2VB6A 1WIEA 2EWNA 1OKWB 2FPDA 2ZZDB
chains in the Genus database with same CATH topology
4XTVA 4CRIA 1FXXA 2QDJA 1JRIA 4BB7A 4F7UF 3MCAB 5EG2A 3VV0A 3FEOA 4MDXA 4C92G 3L2VA 1G3SA 3NTKA 2EKOA 4JDSA 1YJ9A 5CQYA 4FIBA 3RKWA 4QQDA 4X34A 1BI3A 1Y96A 5DLOA 5GAOp 3CC7T 3HP9A 3OYHA 3S6WA 4Z6YA 1TH7A 4JX5A 1VQNA 4PJOG 2CGHA 3ME9A 4HT9A 2QA4T 1JJ2S 2XI9A 2PU9B 3TEEA 1KHIA 2RJEA 2E70A 5LL6S 1LNXA 2DEQA 3WVEB 5HKCA 3TCJA 5GAMh 4PNOA 4HKEA 3PIOA 2D9TA 4M77C 3BDUA 3UDCA 2EAYA 1SSFA 4E7JA 2QXFA 3VKGA 3RKYA 1VQKT 4F7UB 2CS7A 2DAQA 1FWZA 2MF2A 3HRUA 3LW5E 4M78D 1OZ2A 3HB9A 3CMET 2DIQA 1JB0E 4BE2A 2WJ9A 1D3BA 1Q7YC 2QF7A 3SFMA 4LOCA 5GMKm 3A8HB 1H641 2DXCB 3CPFA 1NJIC 2P0PA 4Y91A 1NE8A 3MO8A 3OYGA 2G3RA 4FM4B 2XK0A 2IVWA 1M90U 4E7KA 5HK0A 2BS3A 2ZCFB 4OVAA 5IT9E 1NZ9A 1YJNA 2RI5A 4XU3A 3A8MB 4EMKB 2QI2A 5LJ5d 2XIDA 4A4FA 4C92A 2ZPHB 5FROA 3NTIA 2DXTA 3SDZA 4A4KA 4F7UG 2B8AA 2VGNA 1U1TA 1VQ8A 2GQVA 3BG3A 4JRKA 4YTLA 3C95A 4Z02A 5LJ5g 3QKJA 2K2VA 2PUKB 4N4GA 3H6ZA 1M5Q1 4PJOA 2QEXT 5CK9A 1S72A 3CCSA 2XDBA 2M16A 2HD0A 2PVOB 5KCOA 3LH0A 2LNVA 1VQ9A 3QZ5B 1U1SA 1XQHA 4N4HA 1QVGS 1K73C 2A3LA 2VYTA 2LTOA 4PLIA 1N9RA 3JRZA 3OY9A 5FU6B 3OS1A 2XHCA 3DLMA 3OW2S 3BG5A 2HBPA 5GAMe 2ZZDA 4XU2A 3PMTA 2FB7A 2M0OA 3OYEA 2F5TX 3UT1A 2P0QA 4Y28E 2GFAA 3LLRA 3J7AF 4M75F 3SWNB 4AKGA 2CZ6B 2EQUA 2PVDB 4IUVA 3JCMQ 2QQBA 3CCQT 4L5GA 4J6WA 3QJYA 4C0DC 1KC8U 3M57A 4C0FA 3OYCA 2RI2A 3O8VA 4J7IA 4OB3B 1E7PA 2ZGWA 3VUBA 4LD9K 4JS4A 5CQXA 2AHJB 1Q82U 2E12A 3BG9A 1M1KU 1G3TA 4EMGA 5GAN2 1I8FA 1G5VA 3KXTA 1YHQA 1VQ5A 1BI1A 1RI0A 1BIBA 3CCMA 1VQ6A 2EJGA 2VUBA 1VQPT 1NPPA 4KUDK 2L3RA 2LX9A 1VQLA 3CC4A 2I2LA 2X4YA 5LJ5h 3G71A 3HZJA 3OBYA 5GAOq 1VQ4A 4F7UA 3PT9A 4XAXB 4M75B 1ZHIA 1N8RC 2VXFA 1M8VA 1DJ7B 4B9XA 1UEBA 3E19A 3CXCA 3V7SA 4ZN3A 5GAMf 2DXCA 1VQ7T 2LT4A 2D0QB 3A5ZB 4E47A 3BDLA 5LJ3e 3SB2A 2R57A 2KMGA 5J3BA 2QQ9A 5CR2A 3CC7A 4M75E 4EPCA 4ZGDB 3QSUA 1Q86U 1BIAA 2LQ8A 1ZBXA 2ZPBB 2F69A 3OYYA 4MDWA 1WJRA 2DZ9A 2QA4A 1UGSB 2WSFE 3FC3A 1KQSS 4X9CA 4QW2A 4C8QB 4MFDA 4EMKA 4M78C 3V8LA 1I5LA 3LGLA 1KD1U 4BI3A 2KY9A 2YRVA 2FYKA 3JCMX 4PL6A 4BDYA 5IAYA 2XDDA 2KDSA 4VUBA 4C92E 4IURA 4ELZC 4M75G 1BYMA 1VQKA 1B34B 1AHJB 4OB1B 1YCYA 2E65A 5CIUA 4C8QE 3OYMA 3MP6A 3M56A 4PKCC 4M7DB 3CMEA 3QYEA 4JRPA 4ZTJA 2RHZA 2JUFA 4O6JA 5GAN4 2Y4XA 1X01A 3ZBDA 3C94A 1VQOT 4HL4A 3HSBA 4PJOE 3JCMV 1QVFS 2Y4YA 3E9FA 3RIRA 2MWOA 4XTUA 3OYIA 5FU7B 3VYGB 4HNTA 1BI0A 3J80E 4M7DE 4N0AC 1FKMA 3JCMd 1M1GA 3DLLA 2L89A 1YJWT 4C8QG 3QYBA 1NPRA 5LJ3f 3MHXA 4P5NA 2KAFA 3DB4A 3QZ9B 5D6YA 3SWNA 4JLGA 3OQ5A 5CVIA 4Q5WA 5GANd 4QSHA 3EAEA 4HT8A 3QYHB 4J83A 2XU8A 4M7AB 3FIFA 1QLBA 3JB9F 2RHXA 4B9WA 5GMKe 2K5FA 2E5QA 2M1HA 1OZ3A 4XTZA 3UWNA 3MP1A 4DOVA 5CKHA 1I4K1 5I2SA 3CCUT 4M7DG 1YI2A 5GANg 4C92D 3BY7A 1YIJT 2JTFA 1MGQA 3OS0A 4M77F 2BUDA 3RMQA 2QEXA 4IUUA 3CCLT 2R58A 4E7IA 1M90C 2DK3A 2RK1A 4M7AE 4GY5A 3RESA 3JCMc 3JB9I 3CMAT 2DIGA 1K8AU 1O75A 4MZTA 4JX4A 3QDRB 3RERA 4ZGJB 3QUIA 4PJOD 2E41A 5M9OA 4JRIA 3QXEB 4M75A 2O4XB 4DQ2A 1RL2A 3I55T 1K9MU 3A8LB 2LC4A 2QQRA 3HKSA 2EJ9A 5D6WA 4F7UE 5I21A 2ZPEB 5KE3A 5CKBA 3VJPA 3OYDA 3M4GA 1JJ2A 4J8OA 3PNWC 4M7AG 2CZ7B 2WSEE 2XICA 3I56T 3CCQA 1VQMT 3OA6A 4RCBA 1I81A 3EFSA 4J5YA 3FJPA 2MWPA 5CCAA 4RMOA 3CPWS 2LVMA 4E7HA 4EDUA 4UC4A 2WACA 5A0DA 5FLXE 1OYXA 3FRNA 5GANj 4DA4A 4E7LA 3TW6A 4M77B 3QPHA 3N5BB 4BE1A 3GIBA 1WJSA 2JNGA 1Y71A 3V7CA 4C8QA 3PMIA 2KK4A 3OMGA 3GPLA 4BACA 3DKMA 3G4ST 2L5QA 1VQPA 2LT1A 4X9DA 3L2QA 3M58A 4XQ3A 2PQWA 4ZN1A 1Q81C 2JZ2A 2CKKA 4NL2A 4J6XA 2RJFA 4FL6A 1B34A 4JX6A 1IREB 3RUXA 4KT0E 4XU1A 1R8OB 2CZ1B 4OB2B 1VIFA 4LDWA 4M7DA 1KC8C 3HO8A 4BY6C 2MMPA 2DXBB 1XNIA 2V8JA 3HRSA 5IN1A 4C5IA 5CAIA 5LJ3j 5GAN8 3OS2A 2DD5B 3CCVT 1VQ7A 1Q82C 1M1KC 2A7YA 2HQEA 1W4SA 2QFZA 2KMTA 3C12A 3CMAA 1WQWA 1Q81U 3VYGA 3G6ET 2DPPB 4KBMB 3OSVA 2DVEA 4M77G 1YITT 3META 1YI2T 4OP0A 3HPWA 1OI1A 2M9UA 4ELYC 1X6OA 1UGPB 3L1AA 2P4TA 3WVDB 1HK9A 1EIFA 3CCRT 2PUOB 3WXMB 2FL7A 2EQMA 2FVUA 4C5EA 1QVGA 4M7AA 2EJFA 5CKDA 3MEAA 3L2ZA 3FLGA 4OGCA 4HCCA 3J81E 3JSCA 3M53A 2RJDA 3X20B 5C6SA 2E6NA 3TW7A 4AKHA 2CZ0B 1IZ6A 4XTYA 3JCMW 2QQ8A 1Q86C 3AHUA 4RKUE 4FT4A 1VQOA 4N4IA 4JLIA 4J7FA 1FX7A 3P8DA 3H8ZA 4BI8B 1LOJA 4HNUA 4LDVA 2VXEA 2YHTA 2O4XA 5GAN7 4IUTA 5GAN5 3JAME 1YJWA 1KD1C 3V8JA 4C0DB 2LDMA 4C92C 4C5HA 4MMKA 5DLQE 2EIFA 2RD1A 3KHIA 2RM4A 5GMKj 2KR6A 2JN0A 1VUBA 1WGSA 3RMSA 5A0GA 3L2WA 3CBPA 2EFIA 3QBYA 5A0LA 3QWLA 2GCXA 3CCST 3CCUA 4PJOC 4M77A 4M78F 3OMCA 4JJNK 3OYLA 3OYJA 3X28B 2K3YA 2R5AA 3P8HA 4GLKA 3S3OA 5GAN3 1YIJA 1PSEA 2V8IA 5DM7R 3CCLA 2DD4B 4DOWA 1MHNA 1UGRB 2LQKA 3RKXA 3V8KA 3E1SA 2ZPFB 4QQGA 5FU7C 1W2BA 3VKHA 2K3XA 4PLLA 2XD0A 4OF1A 3HL8A 2ZPGB 5GAMd 3SD4A 1BKBA 1WPYA 4M6VA 4AI6A 2CYZB 3I55A 3M54A 4V2SA 2DXBA 3CD6T 4C5GA 1KQSA 4LDUA 3LX7A 2DD5A 4BDZA 4MZMA 3HHTB 5FRNA 2OTJT 1VQMA 3UPUA 1QVPA 2K5LA 1WNLA 2E6ZA 4M75D 3HFOA 4RG8A 4QVCA 5LJ5e 4II1A 4M78B 3GNFB 3OYFA 2R5MA 3X24B 2RA2A 3L2RA 4BI4A 3NFCA 3JB9J 4XU0A 1K8AC 1Y7XA 2RO0A 5J26A 3JCMg 1JBMA 3BW1A 4KULA 4FT2A 1N6AA 2DXUA 2GFUA 1LJOA 4OGEA 4NOYA 1O9SA 2LCLA 3CC2T 5GAOr 4M78E 5GAOl 5GMKi 2X35A 1QW1A 4HA8A 4HCZA 3OYAA 3G4SA 1K9MC 4JS5A 1U8RA 2EYQA 3CCET 4BD3A 3JB9G 1QVFA 2DTHA 2PVGB 2HAXA 4R56A 2BS2A 2WSCE 4C8QD 2HNIA 2RJCA 3OYNA 3V7RA 4OMFB 4HLQA 1XOVA 2RH2A 2RHYA 3OSSC 5GAMj 4JRQA 5C0MA 4C0GA 4A4HA 4MFEA 2DKGA 4BUGA 3CCVA 5LJ3d 4M78G 2LCCA 3ER0A 4M7DD 2P0KA 3E9GA 2QDYB 3URGA 3G6EA 4XTXA 5GAOn 1YITA 2G77A 2E10A 2QQAA 5L8RE 1ZQ1A 2DTOA 5D6XA 2DO3A 3ZEHA 4EMKC 5LJ3g 3JCMP 3JB9H 4CI0C 4EMHA 4BE0A 1N27A 5LJ5f 5GMKl 2BS4A 2RHIA 1KQ1A 4MMLA 3CCJT 1N9SA 2QTXA 3L2UA 3CCRA 2BIVA 4IUPA 3TREA 2YLBA 2K4YA 1M4ZA 4ZGEB 2OTLT 2RB6A 2EQKA 3GLXA 3JCMh 2MAMA 1W2BS 2X4XA 3Q1JA 3GP8A 2V8KA 3QO3A 4M7AD 1GXIE 4M77E 5FRMA 3JCMb 3LWIA 3G7ZA 3OYBA 5GANh 2DD4A 1KG1A 3NTHA 5DY9A 5FU6C 3VKIA 1G3YA 3PTAA 1YJ9T 2RK2A 3GF5A 4WF2A 2JTMA 5HK3A 2QQSA 3ZFJA 2L8DA 3CPWA 4RCCA 1M9SA 3MEWA 1YBYA 4A4GA 4LD6A 3TU4K 3SWNC 1Q7YU 4ME7A 1H3ZA 1VQNT 2VV5A 1HXDA 2HQXA 1NJIU 1XTDA 2X4JA 4MIMA 1V29B 3PGGA 5CKEA 3GNGA 4MZPA 1VIEA 1G3WA 1UGQB 3VYHB 2XDPA 3QHSA 4M78A 3M59A 5CKFA 3A8OB 5LJ3h 4A53A 2VC8A 3OYKA 4BBRM 2F5KA 3QG1A 1KHCA 1PSFA 3BFMA 3JB9D 3M9QA 2KQWA 2K5IA 3HRTA 3GOXA 3H4CA 3CBOA 5KE2A 3OW2A 4M77D 4BY6B 2K57A 1X75C 4NC6A 2KSSA 3OS5A 3PIPA 1Y96B 2JOYA 4M75C 1WJQA 4O5VA 1BI2A 1QP3A 4BBSM 4QQ6A 2LRQA 3CBMA 4C0ZA 4QVZA 4ELJA 1K73U 2O01E 3CD6A 4N0AA 3T9NA 3JCMe 1YJNT 5AYFA 2YLCA 3EFRA 3INZA 1UB4A 2XG8D 3A8GB 4QVDA 5LJ5j 3P8BB 3CXCS 5I2MA 2ZPIB 2RI3A 3VUZA 5GAN6 2OTJA 3DL1A 2BKDN 3QYGB 2VGMA 3LYIA 2RHUA 4HCBA 3FB9A 5GANe 4J6YA 4A54A 4C92F 3M55A 4C8QC 2DTIA 2X4WA 3M4YA 3S3NA 1VQ8T 3X26B 4C8QF 3HBLA 1Y07A 3HFNA 4R55A 4FU6A 5KH6A 3OB9A 3CC2A 1S72T 3R6OA 2NLUA 3MEUA 1D3BB 1VQ9T 2GF7A 2C06A 3JCMJ 4PJOF 2FHDA 3CCEA 4ZTFA 2KVQG 1P92A 4JUVA 3C4SA 4LDXA 3M5AA 4L59A 4M7DC 3LWHA 3VU3C 4M7DF 4L6V5 2MI6A 3MEVA 5GMKh 1WQ7A 3X25B 4A4EA 1KQ2A 2H3JA 2E64A 4XK8E 5A2QE 4LDYA 3F70A 2OAUA 4KUIA 5GAOm 3ASKA 3KUFA 4ATOA 4OB0B 1QP2A 2Y90A 4IKFA 4C92B 2XKOC 3DB3A 3QIIA 3JCMf 3FDRA 1N8RU 3KBGA 4NS5A 5J39A 3MP8A 2DZCA 4D6WA 5GAMg 3LGFA 2D6FA 3I56A 3QJ6A 3CEYA 5GANf 4AKIA 3OBWA 1YHQT 4TVRA 3CCJA 1VQ5T 4M7AC 4PJOB 3CCMT 4M7AF 1VQ6T 3S3MA 4XTWA 5EJCA 2OTLA 3L42A 5HY6A 2E1HA 1M1FA 2JVVA 2IG0A 5CO7A 4RG2A 5KCHA 3CC4T 1VQLT 3PFSA 3G71T 4IUQA 4HNVA 2EWNA 4NL3A 1VQ4T 2EQJA 2DJZA 4FSXA 2ZZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGP B;  4ZGD B;  3WVD B;  2PUO B;  2ZPB B;  1GXI E;  1UGS B;  2WSF E;  2DD4 A;  3X20 B;  2CZ0 B;  2PU9 B;  4RKU E;  1AHJ B;  4OB1 B;  3WVE B;  1V29 B;  2D0Q B;  1UGQ B;  3VYH B;  3LW5 E;  3A8O B;  3VYG B;  1JB0 E;  1PSF A;  3A8H B;  2DXC B;  3QZ9 B;  4FM4 B;  2ZCF B;  3QYH B;  3X28 B;  1PSE A;  3A8M B;  1QP3 A;  2DD4 B;  1UGR B;  2ZPF B;  2ZPH B;  2O01 E;  2ZPG B;  3A8G B;  2ZPI B;  2CYZ B;  3QYG B;  2PUK B;  4ZGJ B;  2DXB A;  2DD5 A;  2PVO B;  3HHT B;  3QZ5 B;  3QXE B;  3X26 B;  3A8L B;  2ZPE B;  3X24 B;  2CZ7 B;  2WSE E;  2ZZD A;  4Y28 E;  2CZ6 B;  4L6V 5;  2PVD B;  3X25 B;  4XK8 E;  2PVG B;  2WSC E;  4OB0 B;  4OB3 B;  1QP2 A;  2AHJ B;  1IRE B;  4KT0 E;  2CZ1 B;  4OB2 B;  2QDY B;  2DXB B;  5L8R E;  2DD5 B;  3VYG A;  1DJ7 B;  2DPP B;  2DXC A;  4ZGE B;  2ZZD B; 
#chains in the Genus database with same CATH topology
 3BHU B;  2QDJ A;  5EG2 A;  2RQR A;  3FEO A;  4MDX A;  4F7N B;  4C92 G;  3L2V A;  2CCI B;  2EKO A;  4FIB A;  2OTL Q;  4X34 A;  5GAO p;  2UUE B;  3CC7 T;  5I5Z B;  2JXB A;  3OYH A;  3G4S Q;  1YP5 A;  4CFN B;  2CGH A;  2CP7 A;  4NST B;  1ABQ A;  2EGC A;  1JJ2 S;  2COY A;  2QYZ A;  1KHI A;  2KT8 A;  2RJE A;  1OEB A;  3PIO A;  4HKE A;  3BDU A;  4DBQ A;  3GTM S;  1GH6 B;  2QXF A;  3CME T;  4EC8 B;  2WHB B;  2QF7 A;  5GMK m;  1H64 1;  4EC9 B;  5ICP B;  2P0P A;  4OGR B;  1IGU A;  1BU2 A;  3MO8 A;  2AKL A;  1N5Z A;  2IW9 B;  4A4F A;  4C92 A;  5AT1 B;  3EG3 A;  5FWB A;  1YFN A;  2PHG A;  1OQK A;  1RI9 A;  1WXB A;  2B8A A;  2K6D A;  3QKJ A;  2K2V A;  2PUK B;  2DL8 A;  2IW8 B;  3H6Z A;  3CCS A;  2M16 A;  1VQ9 A;  3LH0 A;  1U1S A;  1K73 C;  2A3L A;  2EGE A;  2H8H A;  4PLI A;  4CFW B;  1KJW A;  2HBP A;  2OAW A;  2HSE B;  2P0Q A;  4Y28 E;  5EFQ B;  3J7A F;  3SWN B;  3CCS Q;  1VQ9 Q;  2EQU A;  2PVD B;  3GBQ A;  4L5G A;  1VIN A;  2V1R A;  3QJY A;  2KGT A;  2LJ3 A;  2RI2 A;  3VUB A;  1QQJ A;  5CQX A;  1W2B P;  4F7L B;  4AG2 C;  2YXY A;  4E7S A;  1TTH B;  1NPP A;  4KUD K;  1AZG B;  2LX9 A;  1VQL A;  3UF4 A;  1FYN A;  4M75 B;  2NYS A;  2V1Q A;  1ZUU A;  4J9G A;  2WEV B;  3E19 A;  3V7S A;  3A5Z B;  4E47 A;  3CMA T;  1W2B S;  3SB2 A;  3CC7 A;  1VQL Q;  3CC2 Q;  2EQI A;  1JEG A;  4F04 B;  1ZBX A;  4MDW A;  2F69 A;  1QVF P;  2K9G A;  1UGS B;  2WSF E;  3FC3 A;  4EMK A;  4M78 C;  3V8L A;  1Y0M A;  4E7Z A;  2BE9 B;  1KD1 U;  1PHT A;  3JCM X;  4PL6 A;  2KDS A;  3M0U A;  4IUR A;  1E9H B;  3EGD B;  4C8Q E;  4EOM B;  4BCN B;  4PKC C;  3CME A;  4PJN A;  4RUG A;  2I0N A;  3C94 A;  4HL4 A;  5LMK B;  1QVF S;  3VYG B;  4UN0 A;  4M7D E;  4N0A C;  2L89 A;  3MHX A;  3DB4 A;  3QZ9 B;  4LUD A;  1U06 A;  2V26 A;  3EFO B;  2UZD B;  4J83 A;  4OML A;  4BCM B;  5L2W B;  1AWX A;  4M7A B;  5KYY A;  2K5F A;  5GAO l;  1I4K 1;  5GAN g;  4M77 F;  4HXJ A;  2RK1 A;  2HQH A;  1TUG B;  3JB9 I;  2DIG A;  4MZT A;  5DQV A;  4RTU A;  4CFU B;  1SHG A;  5M9O A;  4DQ2 A;  2LQN A;  3I55 T;  1K9M U;  1X43 A;  3HKS A;  3MKD A;  1B3Q A;  1H1S B;  3QHR B;  5KE3 A;  2JTE A;  3M4G A;  2FPE A;  2WSE E;  1TD6 A;  3I56 T;  1I81 A;  2QGF B;  2G9X B;  3OW2 P;  5A0D A;  1PRL C;  3FRN A;  4CC7 A;  1C6V X;  4BE1 A;  4FYX B;  3PMI A;  2KK4 A;  4J9E A;  2ED1 A;  1VA7 A;  3UAT A;  4X9D A;  3POM A;  3TVT A;  2CJM B;  2WIH B;  4XU1 A;  4FW2 A;  1VIF A;  4LDW A;  1XO2 A;  2DL3 A;  4FW1 A;  4BY6 C;  2DXB B;  1XNI A;  5LJ3 j;  3CCV T;  2DD5 B;  4RTT A;  2W9F A;  3CMA A;  2QFZ A;  4M77 G;  3OSV A;  4OP0 A;  1OI1 A;  1IRX A;  1GUX B;  3CCR T;  3WXM B;  2J6F A;  2WIP B;  2FVU A;  3CMA Q;  2LJ0 A;  3MEA A;  1HD3 A;  2X51 A;  3TW7 A;  1IZ6 A;  1WZO A;  3EGX B;  1Q86 C;  2QDL A;  3BE3 A;  8AT1 B;  1AOJ A;  3P8D A;  4TTH A;  3TNH B;  1RAE B;  2VXE A;  3V8J A;  4C0D B;  1VOM A;  1M27 C;  2LDM A;  4C92 C;  2RQW A;  1WFW A;  3MY1 B;  2RD1 A;  2RM4 A;  5GMK j;  2G6F X;  2JN0 A;  1VUB A;  1KSW A;  1HYO A;  5A0L A;  3QWL A;  4I3Z B;  4M77 A;  3OYJ A;  2R5A A;  4GLK A;  1ZA1 B;  2LQK A;  3RKX A;  3E1S A;  5FU7 C;  2RN8 A;  2PJQ A;  4OF1 A;  1K0X A;  1BKB A;  1UUE A;  4AI6 A;  3I55 A;  3CD6 T;  3LX7 A;  4BDZ A;  3HHT B;  4AMC A;  4RG8 A;  3HFO A;  3GNF B;  1JST B;  1C1A A;  3L2R A;  1SG5 A;  4BI4 A;  1K8A C;  4XU0 A;  1Y7X A;  3I55 Q;  1N6A A;  2GFU A;  4NOY A;  4II5 B;  1O9S A;  1Z9Z A;  4M78 E;  3CCE T;  3H0I A;  3I9Q A;  2HAX A;  4C8Q D;  2VKN A;  1OOT A;  4ESR A;  2FRW A;  1M30 A;  3OYN A;  3EG9 B;  1WHG A;  1RAD B;  2DKG A;  4BUG A;  3CCV A;  1UNL D;  2YWW A;  4M7D D;  4PFZ A;  1R0B G;  1K8A R;  2E10 A;  3JCM P;  1ZQ1 A;  3DJB A;  2COZ A;  4EMK C;  5LJ3 g;  5HVY B;  4EMH A;  2BS4 A;  1QKW A;  1KQ1 A;  3CCV Q;  1N9S A;  3L2U A;  3CCR A;  1GRI A;  2YLB A;  1PM3 A;  1M4Z A;  2K4Y A;  2W0Z A;  3VS5 A;  1AIS B;  2MAM A;  2DRK A;  3Q1J A;  3QO3 A;  1AD5 A;  3JCM b;  3SEM A;  1UNH D;  1WHH A;  3CCR Q;  5FU6 C;  4DEX A;  3PTA A;  4WF2 A;  4LN2 A;  5HK3 A;  2M51 A;  1EFN A;  4RCC A;  1M9S A;  1JXM A;  4A4G A;  1VQN T;  2VV5 A;  1WI7 A;  1HXD A;  2HKQ B;  1XTD A;  2ZAE A;  3ZL7 C;  2NWM A;  1N4M A;  5CKE A;  3EG0 A;  4MZP A;  1G3W A;  2DLP A;  3QHS A;  3VYH B;  5GMK l;  3M59 A;  5LJ3 h;  1J3T A;  1P5E B;  3QG1 A;  1H27 B;  4RTW A;  1QCF A;  1Q81 R;  3QHW B;  3H4C A;  2J05 A;  1W1F A;  1FVV B;  1D1A A;  2FG0 A;  3OS5 A;  1Y96 B;  2JOY A;  1WJQ A;  1BI2 A;  1HSQ A;  4BBS M;  3CBM A;  4HVU A;  1BK2 A;  1AT1 B;  1K73 U;  2O01 E;  3CD6 A;  1YJN T;  5AYF A;  5LJ5 j;  2VGM A;  3LYI A;  2F2W A;  3FB9 A;  2NUT A;  3M55 A;  2DTI A;  2E4H A;  4ROE A;  3CD6 Q;  1GCQ A;  5KH6 A;  2Z0W A;  1S72 T;  3MEU A;  1D3B B;  2OI3 A;  4PJO F;  2FHD A;  3CCE A;  2KVQ G;  4JUV A;  3C4S A;  3RR6 A;  3LWH A;  3VU3 C;  3F5X B;  1KQ2 A;  2UZE B;  2DVJ A;  5GMK h;  2E64 A;  5A2Q E;  4FX3 B;  2OAU A;  5KYX A;  5GAO m;  1KD1 R;  2YUP A;  2YRC A;  3CCE Q;  3DB3 A;  3JCM f;  5J39 A;  4KRD B;  2EYW A;  1WHJ A;  3MP8 A;  3FJ5 A;  2CP5 A;  2B9R A;  5GAN f;  4F6S B;  1RAB B;  3OBW A;  4TVR A;  3CCM T;  4DBR A;  2YUN A;  1M1F A;  5CO7 A;  7AT1 B;  4NL3 A;  1VQ4 T;  2RQT A;  4FSX A;  3S6W A;  2KYM A;  4GBQ A;  1MMD A;  3VV0 A;  2A28 A;  1G3S A;  3RKW A;  5DLO A;  1T0H A;  1I0C A;  1TH7 A;  4JX5 A;  1VQN A;  1MUZ A;  4PJO G;  4YC3 B;  2DA9 A;  2GBQ A;  2QA4 T;  1VYT A;  2XI9 A;  3M0Q A;  3TEE A;  3EGU A;  2X3X D;  3DDQ B;  2E70 A;  1LNX A;  1G3N C;  5FWC A;  4AFQ C;  5HKC A;  4PNO A;  5KYU B;  2K3B A;  4M77 C;  2DME A;  1SSF A;  2EAY A;  2HL5 C;  1K9M R;  3RKY A;  3VKG A;  2DET A;  1VQN Q;  2CS7 A;  1FWZ A;  3HRU A;  4M78 D;  1OZ2 A;  2WJ9 A;  1NBE B;  4LOC A;  3A8H B;  3EG2 A;  1NJI C;  4Y91 A;  4F7J B;  2CSI A;  1NE8 A;  2LCS A;  4FM4 B;  2QTV A;  2BS3 A;  2ZCF B;  4OVA A;  1QVG P;  1OV3 A;  1YJN A;  1TFB A;  4AT1 B;  3A8M B;  2QI2 A;  2XID A;  1OX8 A;  2DE0 X;  3NTI A;  3MY5 B;  3SDZ A;  1OU9 A;  3TN8 B;  8ATC B;  3PO3 S;  1W98 B;  4AFZ C;  4JRK A;  3VRY A;  5LJ5 g;  1YJN Q;  1M5Q 1;  1QMC A;  4PJO A;  2QEX T;  2AZS A;  5CK9 A;  1S72 A;  2XDB A;  2I53 A;  2HD0 A;  1NJI R;  1OKV B;  1D09 B;  1QVG S;  5CYI B;  1OPK A;  2KRO A;  2ESW A;  3OS1 A;  3DLM A;  2ZZD A;  4Y72 B;  3PMT A;  2FB7 A;  2M0O A;  3OYE A;  2F5T X;  1WXU A;  2GFA A;  4M75 F;  4EOO B;  4IUV A;  4IIM A;  5IF1 B;  4J6W A;  1UJY A;  3M57 A;  4J7I A;  3LH5 A;  1SRL A;  1E7P A;  2COW A;  3EH2 A;  4LNP A;  4JS4 A;  2AHJ B;  1G3T A;  3NPF A;  4EMG A;  1I8F A;  4EON B;  1BI1 A;  1BIB A;  3CCM A;  2KRN A;  2VUB A;  1VQP T;  2A08 A;  2B86 A;  2PK9 B;  2GGR A;  1T3S A;  1KQS P;  5LJ5 h;  3HZJ A;  3OBY A;  5GAO q;  3G1J A;  1VQ4 A;  2CP3 A;  4XAX B;  5IDN B;  2CCH B;  1DJ7 B;  2EYX A;  3CCM Q;  5GAM f;  2LT4 A;  3BDL A;  3I5R A;  2A0F B;  2KMG A;  5J3B A;  4EPC A;  1Q86 U;  1VQ4 Q;  2ZPB B;  5HNB B;  1WJR A;  2QA4 A;  1URC B;  1UEC A;  1KQS S;  4MFD A;  4D8D A;  1OI9 B;  1I5L A;  2K2M A;  2EUF A;  2YRV A;  4BI3 A;  2FYK A;  4BDY A;  5IAY A;  4VUB A;  4ELZ C;  4M75 G;  1BYM A;  1B34 B;  3MP6 A;  3M56 A;  2QA4 Q;  4JRP A;  4ZTJ A;  1GBR A;  3EG1 A;  2JUF A;  3ZBD A;  1X01 A;  1VQO T;  1RUW A;  3RIR A;  2MWO A;  4CC2 A;  3OYI A;  4HNT A;  3REA B;  1BI0 A;  3J80 E;  2MYS A;  2HDA A;  3DLL A;  1YJW T;  1H1P B;  5LJ3 f;  1H26 B;  3B57 A;  3SWN A;  3TQ7 P;  5IHK A;  1OUL A;  3OQ5 A;  5CVI A;  5IHN A;  4Q5W A;  2PNI A;  3EAE A;  4HT8 A;  2XU8 A;  3G33 B;  4OMO A;  2E5Q A;  5I2S A;  1OZ3 A;  1GCQ C;  3MP1 A;  4DOV A;  3CCU T;  2O9S A;  2WMA B;  4C92 D;  3OS0 A;  3CPW P;  4BXX X;  2QEX A;  1CKB A;  1E7O A;  3VS2 A;  2DK3 A;  3RES A;  1K8A U;  4AFS C;  3QDR B;  3RER A;  2PTK A;  4BCK B;  2E41 A;  1GY3 B;  1HJD A;  3QXE B;  4M75 A;  2O4X B;  1RL2 A;  1KK7 A;  2LC4 A;  4F7U E;  2PK2 A;  2QEX Q;  1JJ2 A;  4J8O A;  3PNW C;  2CP6 A;  4PK4 A;  4M7A G;  1H92 A;  1VQM T;  3OA6 A;  4RCB A;  4J5Y A;  3CPW S;  4RMO A;  2W2H A;  4EDU A;  5GAN j;  1OYX A;  4E7L A;  3N5B B;  2EBP A;  2C0I A;  1Y71 A;  2L5Q A;  3M0P A;  4F70 B;  1VQP A;  4XQ3 A;  4J6X A;  2RJF A;  3EGD A;  4FL6 A;  4K11 A;  1O9K B;  4KT0 E;  4OB2 B;  1KC8 C;  3HO8 A;  2UZB B;  4C5I A;  5CAI A;  1VQP Q;  1W4S A;  3C12 A;  5IDP B;  1Q81 U;  3UA7 A;  3VYG A;  1YIT T;  2CP0 A;  1X6O A;  1UGP B;  1TU0 B;  3EFO A;  3CQT A;  4OMQ A;  2FL7 A;  4C5E A;  4M7A A;  2EJF A;  3FLG A;  1K73 R;  4BCH B;  4AKH A;  1QCN A;  1IHW A;  4PJM A;  4FT4 A;  2CDT A;  1VQO A;  4BCI B;  4CFM B;  4JLI A;  2RQV A;  1Q95 G;  1FX7 A;  1BCO A;  1AD6 A;  4LDV A;  5GAN 5;  5GAN 7;  1YJW A;  1C9B A;  1V76 A;  4DBH A;  3JAM E;  1F5Q B;  2WFY B;  5DLQ E;  2KR6 A;  4QT7 A;  1OL1 B;  2J7I A;  2QK0 A;  1WGS A;  5A0G A;  3CBP A;  2KBT A;  3CCU A;  4PJO C;  1YJW Q;  4JJN K;  1GL5 A;  3P8H A;  3CC7 Q;  1H1Q B;  3ULR B;  2VVK A;  1AVZ C;  1WLP B;  5DM7 R;  3K7A M;  2KXC A;  3V8K A;  1W70 A;  1W2B A;  2XD0 A;  2K3X A;  3SHW A;  4FYW B;  1WPY A;  3CCU Q;  3M54 A;  4ELL A;  2DXB A;  1IHV A;  2DD5 A;  2RMO A;  1U5S A;  1VQM A;  1B07 A;  1QVP A;  4KRC B;  1WNL A;  1IXD A;  3CME Q;  1IB8 A;  1GUX A;  3JCM g;  1JBM A;  4J9D A;  4KUL A;  4OGE A;  2DXU A;  2LCL A;  2AZV A;  5KYN A;  4HCZ A;  4JS5 A;  1U8R A;  1EZZ B;  1QVF A;  2CT4 A;  2PVG B;  3M03 A;  2FO0 A;  2RJC A;  3PVQ A;  1RAA B;  3V7R A;  2D8H A;  3EGX A;  3OSS C;  2GTJ A;  5GAM j;  2PMI B;  4A4H A;  4MFE A;  2WPA B;  3URG A;  1YIT A;  2G77 A;  1PNJ A;  1WHK A;  2M02 A;  4EOP B;  2LMJ A;  5IXF A;  5LJ5 f;  3CCJ T;  1KFZ A;  2QTX A;  1K4U S;  2IN3 A;  4IUP A;  3EJ1 B;  4J9H A;  2RB6 A;  2EQK A;  3GLX A;  3JCM h;  5HQ0 B;  1YIT Q;  1A0N B;  2DJQ A;  5GAN h;  3NTH A;  1YCS B;  1YNZ A;  3BLR B;  1G3Y A;  2RK2 A;  3GF5 A;  3ZFJ A;  3MEW A;  1YBY A;  4FYV B;  4LD6 A;  3SWN C;  4ME7 A;  2HQX A;  1NJI U;  4KH0 B;  4OMP A;  4B6M A;  1V29 B;  2I40 B;  1M3C A;  5CKF A;  2NUP B;  1E6G A;  4CC3 A;  2ED0 A;  2F5K A;  4FSS A;  3CXC P;  1PSF A;  3BFM A;  3M9Q A;  2W9Z A;  2DEU A;  4BY1 X;  3CBO A;  3OW2 A;  4M77 D;  2HEQ A;  4NC6 A;  3H0H A;  3QWX X;  4M75 C;  4O5V A;  3VS1 A;  2W10 A;  1QP3 A;  4C0Z A;  3EG9 A;  1FMK A;  3T9N A;  3JCM e;  1OL2 B;  2YLC A;  1UB4 A;  2XG8 D;  3VS4 A;  3CXC S;  5I2M A;  2ZPI B;  3DL1 A;  2RHU A;  5GAN e;  5I11 A;  2LZ6 B;  4A54 A;  1YWP A;  2JJ9 A;  2X4W A;  3M4Y A;  4C8Q F;  4FU6 A;  1K76 A;  3R6O A;  1AEY A;  1Q86 R;  3JCM J;  2C06 A;  4ZTF A;  4L59 A;  4M7D F;  2CSQ A;  2MI6 A;  3MEV A;  2H3J A;  4XK8 E;  2BZ8 A;  2J6K A;  1E6H A;  4BY7 X;  1WX6 A;  2Y90 A;  4J9F A;  3QII A;  4F6U B;  2DFU A;  2J6O A;  4D6W A;  5GAM g;  3LGF A;  2FZG B;  3QWY A;  3I56 A;  2PZ1 A;  3QJ6 A;  4AKI A;  1VYU A;  1UJ0 A;  3CCJ A;  4M7A C;  1AWJ A;  6AT1 B;  5HY6 A;  3CC4 T;  2W96 A;  3G71 T;  1NG2 A;  4IUQ A;  4HNV A;  2DBM A;  3I56 Q;  2EQJ A;  2DJZ A;  4BCQ D;  4XTV A;  4CRI A;  1FXX A;  1JRI A;  3CCJ Q;  5HCK A;  3MCA B;  1TS9 A;  2LNH B;  4JJD A;  2X9H A;  2R7G A;  3NTK A;  5CQY A;  1H4L D;  4QQD A;  1Y96 A;  2BE7 D;  4IIO A;  4Z6Y A;  1FIN B;  2PU9 B;  4KGZ B;  4LXC A;  5KYW B;  2DEQ A;  3WVE B;  2L0A A;  3TCJ A;  5GAM h;  4E7J A;  2D9T A;  4HVW A;  1T3L A;  4BCF B;  4JZ4 A;  1VQK T;  4F7U B;  1NYF A;  2MF2 A;  3LW5 E;  2DIQ A;  1JB0 E;  1D3B A;  1Q7Y C;  1X2Q A;  5EC7 A;  3CPF A;  2DXC B;  1MMA A;  4E7K A;  5HK0 A;  5IT9 E;  1RLP C;  2YT6 A;  1PC0 A;  2RI5 A;  3BLH B;  4PJL A;  1GFD A;  2L2P A;  2DXT A;  4A4K A;  2GQV A;  2SRC A;  4YTL A;  4Z02 A;  1QWF A;  2CUB A;  4N4G A;  2RQU A;  3DOG B;  5HBJ B;  4FYY B;  2LNV A;  2X3W D;  1XQH A;  5KCO A;  4N4H A;  1SHF A;  2LTO A;  5GJV B;  3M0T A;  1N9R A;  2HKN A;  2XHC A;  5GAM e;  4XU2 A;  3UT1 A;  2FZC B;  3TSZ A;  3I5S A;  3JCM Q;  2QQB A;  3NHN A;  3CCQ T;  1KC8 U;  2CP2 A;  4C0D C;  4C0F A;  3OYC A;  3O8V A;  1M2V B;  4LD9 K;  4FCY A;  3BG9 A;  5GAN 2;  1RI0 A;  2EJG A;  5KYU A;  1QMZ B;  2L3R A;  3CC4 A;  1M8M A;  2X4Y A;  3G71 A;  3EID B;  3PT9 A;  2HSP A;  1ZHI A;  3U23 A;  4B9X A;  1UEB A;  1FMW A;  1I1J A;  1M3B A;  2D0Q B;  2E5K A;  5LJ3 e;  2R57 A;  1JO8 A;  3RDV A;  3CC4 Q;  3QSU A;  4M75 E;  4ZGD B;  2BTT A;  3G71 Q;  2LQ8 A;  1Y57 A;  2CRE A;  3MPU B;  2DZ9 A;  4X9C A;  4QW2 A;  4C8Q B;  2KEA A;  2L3Q A;  2DYI A;  3LGL A;  3MIA B;  2JM9 A;  2KY9 A;  2XDD A;  4C92 E;  3EHR A;  1VQK A;  3OYM A;  3M0S A;  1MMN A;  4M7D B;  3QYE A;  2D0N A;  5GAN 4;  3JCM V;  4J9I A;  2Y4Y A;  1LVK A;  3E9F A;  4ZNX A;  4EOQ B;  2EPD A;  4OMN A;  1VQK Q;  3JCM d;  1M1G A;  5ECA A;  3QYB A;  2O31 A;  1MV0 B;  4P5N A;  2KAF A;  5D6Y A;  4JLG A;  2C0T A;  5GAN d;  4QSH A;  4PFO A;  3FIF A;  3JB9 F;  4QKU A;  2RHX A;  5BNJ B;  5GMK e;  2M1H A;  1M2O A;  3D7S B;  4XTZ A;  3UWN A;  1KIK A;  5LQF B;  3BY7 A;  3RMQ A;  2BUD A;  1M90 C;  4M7A E;  3CCL T;  2MIO A;  4GY5 A;  3QUI A;  4PJO D;  2XMF A;  2MCN A;  4JRI A;  3A8L B;  2EJ9 A;  1SPK A;  1JOW A;  4F7S B;  2CZ7 B;  2XIC A;  4M4Z A;  3CCQ A;  2CH4 A;  3EFS A;  3TSW A;  5CCA A;  2MWP A;  2LVM A;  4E7H A;  4UC4 A;  2WAC A;  5FLX E;  4DA4 A;  1S1N A;  2MOX A;  3V7C A;  2HCK A;  3GPL A;  1G2B A;  3G4S T;  1SEM A;  2LT1 A;  3CCQ Q;  1IO6 A;  2PQW A;  4ZN1 A;  2CKK A;  4NL2 A;  1W6X A;  1MV3 A;  1B34 A;  4E2F B;  1AWW A;  2RNA A;  1R8O B;  5IXB A;  2EYY A;  4RTY A;  2AK5 A;  2V8J A;  5IN1 A;  3OS2 A;  4KGV B;  3JB9 G;  3GIB A;  1Q82 C;  4CRL B;  1M1K C;  2HQE A;  2KMT A;  4ORZ A;  1H24 B;  4IMY B;  1WQW A;  3G6E T;  1UTI A;  2DPP B;  4KBM B;  1S72 Q;  3MET A;  2M9U A;  2DL4 A;  4ELY C;  3VRZ A;  3L1A A;  2BKZ B;  1EIF A;  2PUO B;  1QVG A;  2EQM A;  5CKD A;  3L2Z A;  4OGC A;  4HCC A;  3J81 E;  3JSC A;  1NM7 A;  2RJD A;  3M53 A;  2QQ8 A;  1JXO A;  2KXD A;  3AHU A;  1RAC B;  1MNE A;  4N4I A;  1JU5 C;  3H8Z A;  5IHI A;  4BI8 B;  1LOJ A;  4HNU A;  1GCP A;  2YHT A;  2O4X A;  4JJC A;  4IUT A;  4OMM A;  1CKA A;  1MMG A;  3HTR A;  4DBF A;  1ACM B;  4C5H A;  3BLQ B;  4MMK A;  2DER A;  4YOZ A;  2FRY A;  3RMS A;  2DNU A;  1NLP C;  3CCS T;  4YOO A;  3OMC A;  9ATC B;  5FGK B;  5GAN 3;  1OGU B;  1BU1 A;  1PSE A;  2V8I A;  4PFP A;  3CCL A;  2DD4 B;  4DOW A;  3REB B;  2ZPF B;  4OR5 B;  1PKT A;  3HL8 A;  5GAM d;  3SD4 A;  1O9K A;  4GLM A;  1D3U B;  4V2S A;  2F2V A;  1KQS A;  3CCL Q;  1B7T A;  4PJJ A;  4MZM A;  4F17 A;  2OTJ T;  2JS2 A;  2K5L A;  4M75 D;  2E6Z A;  4QVC A;  5LJ5 e;  2LP5 A;  4II1 A;  4M78 B;  3OYF A;  2R5M A;  1F1B B;  3X24 B;  2RA2 A;  3NFC A;  1ZX6 A;  4KGX B;  3BW1 A;  4FT2 A;  1JKW A;  3VS3 A;  3CC2 T;  4F16 A;  5GMK i;  2ROT A;  1QW1 A;  3G4S A;  4BCJ B;  2C6T B;  4BD3 A;  1K0S A;  2DTH A;  4R56 A;  2WSC E;  2HNI A;  2EKH A;  1OU8 A;  4OMF B;  2KR3 A;  1XOV A;  2RH2 A;  1UDL A;  2RHY A;  2YUO A;  4ANJ A;  4C0G A;  5LJ3 d;  2OX7 A;  2D8J A;  2LJ1 A;  4J9C A;  3NMZ C;  4AFU C;  3ER0 A;  4BCN D;  2QDY B;  3G6E A;  2QQA A;  5D6X A;  2DO3 A;  3JB9 H;  3JV3 A;  3EH1 A;  4MML A;  3VS6 A;  1BCM A;  2O2O A;  4ZGE B;  2JMC A;  3G6E Q;  2YSQ A;  2KNB B;  2X4X A;  2V8K A;  4BCM D;  4M7A D;  1GXI E;  4M77 E;  1NYG A;  1KG1 A;  1SRM A;  1ZSZ A;  5DY9 A;  3VKI A;  1YJ9 T;  2QQS A;  3A1P A;  3CPW A;  1UFF A;  1WHM A;  5IHY A;  1Q7Y U;  2WXV B;  4CFU D;  2X4J A;  2RPN A;  3C0C A;  1VIE A;  5GAO r;  4X1V A;  5ACB A;  3A8O B;  2VC8 A;  3OYK A;  2L3P A;  1BB9 A;  1PD0 A;  4KRT A;  4JJB A;  1WHL A;  3GOX A;  5KE2 A;  1KC8 R;  4BY6 B;  2K57 A;  1X75 C;  3RNJ A;  3PIP A;  2LRQ A;  3INZ A;  4QVD A;  2OTJ A;  3VUZ A;  3QYG B;  4BCG B;  4HCB A;  3DDP B;  2H3E B;  2AIR B;  1SKU B;  4J6Y A;  4A63 B;  1VQO Q;  1VQ8 T;  1YN8 A;  3HFN A;  4R55 A;  1WDX A;  3CC2 A;  2OTJ Q;  2NLU A;  1ZP2 A;  2EVR A;  1P92 A;  3QDF A;  3R6N A;  1ZSZ B;  3NDQ A;  4A4E A;  3F70 A;  4KUI A;  2DX1 A;  3ASK A;  1WXT A;  1K1Z A;  4ATO A;  4OB0 B;  1QP2 A;  2HZY A;  4C92 B;  2XKO C;  3FDR A;  2HBW A;  4CC4 B;  2DZC A;  1ZUK A;  2KRM A;  1PCX A;  5HBE B;  3H41 A;  1YHQ T;  1VQ5 T;  1VQ6 T;  3S3M A;  1QWE A;  3L42 A;  4BCP B;  2E1H A;  2NUP A;  2V22 B;  2IPO B;  1ZA2 B;  3PFS A;  5FU7 B;  1VQM Q;  3TNW B;  1I07 A;  4BB7 A;  4ROD A;  3UA6 A;  4F7U F;  2YRD A;  1G8X A;  4JDS A;  1YJ9 A;  1BI3 A;  1RLQ C;  3HP9 A;  2GNC A;  1IGQ A;  4WCI A;  2EGA A;  1KXU A;  2F2C A;  3ME9 A;  4HT9 A;  2QAS A;  1ENW A;  5LL6 S;  3M0R A;  1YJ9 Q;  4Z8A A;  1U3O A;  2HL3 A;  2KYB A;  2BZY A;  3UDC A;  1RAH B;  2DAQ A;  3HB9 A;  4Z89 A;  4BE2 A;  1TSF A;  2W99 A;  2JW4 A;  3SFM A;  4D8K A;  3OYG A;  2G3R A;  2XK0 A;  2EYZ A;  2IVW A;  1M90 U;  1H3H A;  4EOK B;  1NZ9 A;  4XU3 A;  1NEB A;  4EMK B;  5IH2 A;  5LJ5 d;  2OJ2 A;  2ZPH B;  5GJW B;  4JPB W;  5FRO A;  1G83 A;  2JM8 A;  4F7U G;  2VGN A;  2NUZ A;  1U1T A;  4Y92 A;  3PE0 A;  1VQ8 A;  3BG3 A;  3C95 A;  1RAI B;  2C0O A;  1LCK A;  2PVO B;  4AG1 C;  3QZ5 B;  2ENM A;  2VYT A;  3AT1 B;  4CFX B;  2C4G B;  3JRZ A;  3OY9 A;  5FU6 B;  3OW2 S;  4EOL B;  3BG5 A;  1VQ8 Q;  1X6G A;  3LLR A;  5FW9 A;  4AKG A;  5D7U A;  2CZ6 B;  5CEI B;  2VAS A;  3IQL A;  3VS0 A;  4JZ3 A;  2M0Y A;  2QG9 B;  5KYY B;  4OB3 B;  2ZGW A;  1Q82 U;  2E12 A;  1M1K U;  1G5V A;  3KXT A;  1YHQ A;  2J06 A;  1NEG A;  1VQ5 A;  1D1C A;  5KYW A;  2FZK B;  1VQ6 A;  2A36 A;  3MJX A;  4Z88 A;  2I2L A;  1Z9Q A;  3EOC B;  4HCK A;  4F7U A;  2LX7 A;  1ZSZ C;  1N8R C;  2VXF A;  1M8V A;  1YHQ Q;  1VQ5 Q;  3CXC A;  1VQ6 Q;  4ZN3 A;  2DL5 A;  2DXC A;  1VQ7 T;  1X2K A;  1TUD A;  2P4R A;  2KRS A;  2P84 A;  1ARK A;  2QQ9 A;  5CR2 A;  2C5V B;  1BIA A;  2LQW A;  3OYY A;  1WYX A;  4KH1 B;  3O0G D;  3TNI B;  3VS7 A;  1AZE A;  2AT1 B;  1PD1 A;  2UZL B;  1N8R R;  1AHJ B;  4OB1 B;  1YCY A;  2E65 A;  5CIU A;  2QGS A;  4EOI B;  1OIY B;  2RHZ A;  4O6J A;  3HSB A;  2Y4X A;  4PJO E;  1H28 B;  4XTU A;  3PVL A;  1FKM A;  1T0J A;  4C8Q G;  1NPR A;  1VOL A;  3QYH B;  3LQ5 B;  1QLB A;  1VYW B;  4B9W A;  2FEI A;  1M2V A;  4M7D G;  5CKH A;  3KFV A;  1YIJ T;  2JTF A;  1MGQ A;  1H1R B;  1QLY A;  1D1B A;  4E7I A;  4F14 A;  4IUU A;  2R58 A;  4RTV A;  1V1C A;  3JCM c;  1QKX A;  1O75 A;  4JX4 A;  4EOS B;  4ZGJ B;  1VYV A;  2DRM A;  2IW6 B;  2ABL A;  3E2U A;  2QQR A;  5D6W A;  5I21 A;  2ZPE B;  5CKB A;  3VJP A;  3OYD A;  2IVX A;  2C5O B;  2BPM B;  2F2X A;  3FJP A;  1LPL A;  3RBB B;  3TW6 A;  4EIK A;  4M77 B;  3QPH A;  4WTO B;  1WJS A;  2JNG A;  4C8Q A;  2A37 A;  3OMG A;  4BAC A;  3DKM A;  1UG1 A;  3L2Q A;  3M58 A;  1Q81 C;  1Q7Y R;  2JZ2 A;  1CSK A;  1D0X A;  1R77 A;  4JX6 A;  1IRE B;  1TWB A;  2DL7 A;  3RUX A;  2CZ1 B;  1GFC A;  4M7D A;  2MMP A;  5GAN 8;  3RGF B;  3HRS A;  1VQ7 A;  2A7Y A;  2C5N B;  2DVE A;  2E3I A;  1YI2 T;  3HPW A;  1MND A;  2IIM A;  1QCO A;  1R0C B;  2P4T A;  3WVD B;  1HK9 A;  1VQ7 Q;  3EHQ A;  2HMA A;  3DTO A;  3X20 B;  5C6S A;  1X6B A;  1WA7 A;  2E6N A;  2CZ0 B;  4XTY A;  1JQQ A;  3JCM W;  4RKU E;  5I22 A;  4J7F A;  2MK5 A;  2F1L A;  1M3A A;  1KD1 C;  1GBQ A;  1JSU B;  1UNG D;  2EIF A;  3KHI A;  2BZX A;  4BCQ B;  1EX4 A;  2SEM A;  1I5O B;  3L2W A;  2EFI A;  3QBY A;  2GCX A;  4M78 F;  3H0F A;  3OYL A;  2DM1 A;  4RTZ A;  3X28 B;  2K3Y A;  1YIJ A;  3S3O A;  2DMO A;  3MI9 B;  5DQW A;  2GTO A;  4LE9 A;  1MHN A;  1UGR B;  2GQI A;  1PRM C;  4QQG A;  1RAF B;  2AKK A;  3VKH A;  4PLL A;  2ZPG B;  2L3S A;  1TXQ A;  1TG0 A;  4M6V A;  2JT4 A;  2CYZ B;  4BCO B;  1YIJ Q;  4C5G A;  4LDU A;  1RAG B;  2O9V A;  5FRN A;  3UPU A;  1UHF A;  3BHV B;  4LUE A;  4CXA B;  1TUC A;  2YUQ A;  3JB9 J;  1OPL A;  2RO0 A;  5J26 A;  1X69 A;  1LJO A;  4R0K A;  4G6L B;  3OYA A;  2X35 A;  4HA8 A;  1K9M C;  3BHT B;  1XJW B;  5HBH B;  1UGV A;  2EYQ A;  4J9B A;  2JS0 A;  1ZLM A;  2BS2 A;  1ZSG A;  4HLQ A;  4JRQ A;  5C0M A;  1H25 B;  4M78 G;  2LCC A;  1AWO A;  2P0K A;  3E9G A;  2CUD A;  2NUT B;  4XTX A;  5GAO n;  1YI2 A;  5L8R E;  3ZEH A;  4DEY A;  2DTO A;  1SF9 A;  1BBZ A;  2VWF A;  4CI0 C;  4BE0 A;  1N27 A;  4E6R A;  2DYB A;  2RHI A;  2WMB B;  2BIV A;  3TRE A;  1M90 R;  4CFV B;  1SSH A;  2FPF A;  2OTL T;  1FMV A;  1YI2 Q;  4EOR B;  3GP8 A;  3O5Z A;  5FRM A;  5KYX B;  3LWI A;  2K79 A;  3G7Z A;  3OYB A;  2DD4 A;  4RTX A;  2JTM A;  4F6W B;  2L8D A;  2O88 A;  3TU4 K;  1H3Z A;  2K7A A;  2QAZ A;  1OX9 A;  2YDL A;  1D0Y A;  2ATC B;  4MIM A;  4ROC A;  2KT1 A;  3PGG A;  2CH4 W;  1YWO A;  3GNG A;  2KI7 A;  2LW4 A;  1UGQ B;  2XDP A;  1C0M A;  4M78 A;  4A53 A;  4BBR M;  2CT3 A;  1KHC A;  2KE9 A;  3JB9 D;  2RF0 A;  2KQW A;  5L23 A;  2K5I A;  3HRT A;  2DBK A;  1X27 A;  3A98 A;  2DF6 A;  2KSS A;  2QGG A;  3H9N A;  3THK A;  1Q82 R;  1PG5 B;  1M1K R;  4QQ6 A;  4QVZ A;  4YOS A;  4ELJ A;  2D1X A;  4N0A A;  3EFR A;  1H8K A;  3A8G B;  3P8B B;  2RI3 A;  5GAN 6;  1UE9 A;  2BKD N;  2JMA A;  1PKD B;  3NGP A;  2E3H A;  4C92 F;  4C8Q C;  3S3N A;  3X26 B;  3HBL A;  1Y07 A;  2JGZ B;  2DIL A;  1PWT A;  3OB9 A;  2ECZ A;  1VQ9 T;  2EW3 A;  2GF7 A;  1D0Z A;  1UHC A;  4LDX A;  3M5A A;  4M7D C;  4L6V 5;  1WQ7 A;  3X25 B;  4LDY A;  2C5X B;  3KUF A;  4HVV A;  1ZBJ A;  1ZUY A;  4IKF A;  1TOV A;  1N8R U;  3KBG A;  4NS5 A;  2D6F A;  3CEY A;  3I35 A;  1ABO A;  4PJO B;  4EOJ B;  1NLO C;  4M7A F;  4XTW A;  5EJC A;  2OTL A;  2JVV A;  2ROL A;  2IG0 A;  2MPX C;  4RG2 A;  5KCH A;  1JJ2 P;  1PKS A;  1K9A A;  1VQL T;  2X1N B;  1OIU B;  2VB6 A;  1WIE A;  2EWN A;  1OKW B;  2FPD A;  2ZZD B; 
#chains in the Genus database with same CATH homology
 4XTV A;  4CRI A;  1FXX A;  2QDJ A;  1JRI A;  4BB7 A;  4F7U F;  3MCA B;  5EG2 A;  3VV0 A;  3FEO A;  4MDX A;  4C92 G;  3L2V A;  1G3S A;  3NTK A;  2EKO A;  4JDS A;  1YJ9 A;  5CQY A;  4FIB A;  3RKW A;  4QQD A;  4X34 A;  1BI3 A;  1Y96 A;  5DLO A;  5GAO p;  3CC7 T;  3HP9 A;  3OYH A;  3S6W A;  4Z6Y A;  1TH7 A;  4JX5 A;  1VQN A;  4PJO G;  2CGH A;  3ME9 A;  4HT9 A;  2QA4 T;  1JJ2 S;  2XI9 A;  2PU9 B;  3TEE A;  1KHI A;  2RJE A;  2E70 A;  5LL6 S;  1LNX A;  2DEQ A;  3WVE B;  5HKC A;  3TCJ A;  5GAM h;  4PNO A;  4HKE A;  3PIO A;  2D9T A;  4M77 C;  3BDU A;  3UDC A;  2EAY A;  1SSF A;  4E7J A;  2QXF A;  3VKG A;  3RKY A;  1VQK T;  4F7U B;  2CS7 A;  2DAQ A;  1FWZ A;  2MF2 A;  3HRU A;  3LW5 E;  4M78 D;  1OZ2 A;  3HB9 A;  3CME T;  2DIQ A;  1JB0 E;  4BE2 A;  2WJ9 A;  1D3B A;  1Q7Y C;  2QF7 A;  3SFM A;  4LOC A;  5GMK m;  3A8H B;  1H64 1;  2DXC B;  3CPF A;  1NJI C;  2P0P A;  4Y91 A;  1NE8 A;  3MO8 A;  3OYG A;  2G3R A;  4FM4 B;  2XK0 A;  2IVW A;  1M90 U;  4E7K A;  5HK0 A;  2BS3 A;  2ZCF B;  4OVA A;  5IT9 E;  1NZ9 A;  1YJN A;  2RI5 A;  4XU3 A;  3A8M B;  4EMK B;  2QI2 A;  5LJ5 d;  2XID A;  4A4F A;  4C92 A;  2ZPH B;  5FRO A;  3NTI A;  2DXT A;  3SDZ A;  4A4K A;  4F7U G;  2B8A A;  2VGN A;  1U1T A;  1VQ8 A;  2GQV A;  3BG3 A;  4JRK A;  4YTL A;  3C95 A;  4Z02 A;  5LJ5 g;  3QKJ A;  2K2V A;  2PUK B;  4N4G A;  3H6Z A;  1M5Q 1;  4PJO A;  2QEX T;  5CK9 A;  1S72 A;  3CCS A;  2XDB A;  2M16 A;  2HD0 A;  2PVO B;  5KCO A;  3LH0 A;  2LNV A;  1VQ9 A;  3QZ5 B;  1U1S A;  1XQH A;  4N4H A;  1QVG S;  1K73 C;  2A3L A;  2VYT A;  2LTO A;  4PLI A;  1N9R A;  3JRZ A;  3OY9 A;  5FU6 B;  3OS1 A;  2XHC A;  3DLM A;  3OW2 S;  3BG5 A;  2HBP A;  5GAM e;  2ZZD A;  4XU2 A;  3PMT A;  2FB7 A;  2M0O A;  3OYE A;  2F5T X;  3UT1 A;  2P0Q A;  4Y28 E;  2GFA A;  3LLR A;  3J7A F;  4M75 F;  3SWN B;  4AKG A;  2CZ6 B;  2EQU A;  2PVD B;  4IUV A;  3JCM Q;  2QQB A;  3CCQ T;  4L5G A;  4J6W A;  3QJY A;  4C0D C;  1KC8 U;  3M57 A;  4C0F A;  3OYC A;  2RI2 A;  3O8V A;  4J7I A;  4OB3 B;  1E7P A;  2ZGW A;  3VUB A;  4LD9 K;  4JS4 A;  5CQX A;  2AHJ B;  1Q82 U;  2E12 A;  3BG9 A;  1M1K U;  1G3T A;  4EMG A;  5GAN 2;  1I8F A;  1G5V A;  3KXT A;  1YHQ A;  1VQ5 A;  1BI1 A;  1RI0 A;  1BIB A;  3CCM A;  1VQ6 A;  2EJG A;  2VUB A;  1VQP T;  1NPP A;  4KUD K;  2L3R A;  2LX9 A;  1VQL A;  3CC4 A;  2I2L A;  2X4Y A;  5LJ5 h;  3G71 A;  3HZJ A;  3OBY A;  5GAO q;  1VQ4 A;  4F7U A;  3PT9 A;  4XAX B;  4M75 B;  1ZHI A;  1N8R C;  2VXF A;  1M8V A;  1DJ7 B;  4B9X A;  1UEB A;  3E19 A;  3CXC A;  3V7S A;  4ZN3 A;  5GAM f;  2DXC A;  1VQ7 T;  2LT4 A;  2D0Q B;  3A5Z B;  4E47 A;  3BDL A;  5LJ3 e;  3SB2 A;  2R57 A;  2KMG A;  5J3B A;  2QQ9 A;  5CR2 A;  3CC7 A;  4M75 E;  4EPC A;  4ZGD B;  3QSU A;  1Q86 U;  1BIA A;  2LQ8 A;  1ZBX A;  2ZPB B;  2F69 A;  3OYY A;  4MDW A;  1WJR A;  2DZ9 A;  2QA4 A;  1UGS B;  2WSF E;  3FC3 A;  1KQS S;  4X9C A;  4QW2 A;  4C8Q B;  4MFD A;  4EMK A;  4M78 C;  3V8L A;  1I5L A;  3LGL A;  1KD1 U;  4BI3 A;  2KY9 A;  2YRV A;  2FYK A;  3JCM X;  4PL6 A;  4BDY A;  5IAY A;  2XDD A;  2KDS A;  4VUB A;  4C92 E;  4IUR A;  4ELZ C;  4M75 G;  1BYM A;  1VQK A;  1B34 B;  1AHJ B;  4OB1 B;  1YCY A;  2E65 A;  5CIU A;  4C8Q E;  3OYM A;  3MP6 A;  3M56 A;  4PKC C;  4M7D B;  3CME A;  3QYE A;  4JRP A;  4ZTJ A;  2RHZ A;  2JUF A;  4O6J A;  5GAN 4;  2Y4X A;  1X01 A;  3ZBD A;  3C94 A;  1VQO T;  4HL4 A;  3HSB A;  4PJO E;  3JCM V;  1QVF S;  2Y4Y A;  3E9F A;  3RIR A;  2MWO A;  4XTU A;  3OYI A;  5FU7 B;  3VYG B;  4HNT A;  1BI0 A;  3J80 E;  4M7D E;  4N0A C;  1FKM A;  3JCM d;  1M1G A;  3DLL A;  2L89 A;  1YJW T;  4C8Q G;  3QYB A;  1NPR A;  5LJ3 f;  3MHX A;  4P5N A;  2KAF A;  3DB4 A;  3QZ9 B;  5D6Y A;  3SWN A;  4JLG A;  3OQ5 A;  5CVI A;  4Q5W A;  5GAN d;  4QSH A;  3EAE A;  4HT8 A;  3QYH B;  4J83 A;  2XU8 A;  4M7A B;  3FIF A;  1QLB A;  3JB9 F;  2RHX A;  4B9W A;  5GMK e;  2K5F A;  2E5Q A;  2M1H A;  1OZ3 A;  4XTZ A;  3UWN A;  3MP1 A;  4DOV A;  5CKH A;  1I4K 1;  5I2S A;  3CCU T;  4M7D G;  1YI2 A;  5GAN g;  4C92 D;  3BY7 A;  1YIJ T;  2JTF A;  1MGQ A;  3OS0 A;  4M77 F;  2BUD A;  3RMQ A;  2QEX A;  4IUU A;  3CCL T;  2R58 A;  4E7I A;  1M90 C;  2DK3 A;  2RK1 A;  4M7A E;  4GY5 A;  3RES A;  3JCM c;  3JB9 I;  3CMA T;  2DIG A;  1K8A U;  1O75 A;  4MZT A;  4JX4 A;  3QDR B;  3RER A;  4ZGJ B;  3QUI A;  4PJO D;  2E41 A;  5M9O A;  4JRI A;  3QXE B;  4M75 A;  2O4X B;  4DQ2 A;  1RL2 A;  3I55 T;  1K9M U;  3A8L B;  2LC4 A;  2QQR A;  3HKS A;  2EJ9 A;  5D6W A;  4F7U E;  5I21 A;  2ZPE B;  5KE3 A;  5CKB A;  3VJP A;  3OYD A;  3M4G A;  1JJ2 A;  4J8O A;  3PNW C;  4M7A G;  2CZ7 B;  2WSE E;  2XIC A;  3I56 T;  3CCQ A;  1VQM T;  3OA6 A;  4RCB A;  1I81 A;  3EFS A;  4J5Y A;  3FJP A;  2MWP A;  5CCA A;  4RMO A;  3CPW S;  2LVM A;  4E7H A;  4EDU A;  4UC4 A;  2WAC A;  5A0D A;  5FLX E;  1OYX A;  3FRN A;  5GAN j;  4DA4 A;  4E7L A;  3TW6 A;  4M77 B;  3QPH A;  3N5B B;  4BE1 A;  3GIB A;  1WJS A;  2JNG A;  1Y71 A;  3V7C A;  4C8Q A;  3PMI A;  2KK4 A;  3OMG A;  3GPL A;  4BAC A;  3DKM A;  3G4S T;  2L5Q A;  1VQP A;  2LT1 A;  4X9D A;  3L2Q A;  3M58 A;  4XQ3 A;  2PQW A;  4ZN1 A;  1Q81 C;  2JZ2 A;  2CKK A;  4NL2 A;  4J6X A;  2RJF A;  4FL6 A;  1B34 A;  4JX6 A;  1IRE B;  3RUX A;  4KT0 E;  4XU1 A;  1R8O B;  2CZ1 B;  4OB2 B;  1VIF A;  4LDW A;  4M7D A;  1KC8 C;  3HO8 A;  4BY6 C;  2MMP A;  2DXB B;  1XNI A;  2V8J A;  3HRS A;  5IN1 A;  4C5I A;  5CAI A;  5LJ3 j;  5GAN 8;  3OS2 A;  2DD5 B;  3CCV T;  1VQ7 A;  1Q82 C;  1M1K C;  2A7Y A;  2HQE A;  1W4S A;  2QFZ A;  2KMT A;  3C12 A;  3CMA A;  1WQW A;  1Q81 U;  3VYG A;  3G6E T;  2DPP B;  4KBM B;  3OSV A;  2DVE A;  4M77 G;  1YIT T;  3MET A;  1YI2 T;  4OP0 A;  3HPW A;  1OI1 A;  2M9U A;  4ELY C;  1X6O A;  1UGP B;  3L1A A;  2P4T A;  3WVD B;  1HK9 A;  1EIF A;  3CCR T;  2PUO B;  3WXM B;  2FL7 A;  2EQM A;  2FVU A;  4C5E A;  1QVG A;  4M7A A;  2EJF A;  5CKD A;  3MEA A;  3L2Z A;  3FLG A;  4OGC A;  4HCC A;  3J81 E;  3JSC A;  3M53 A;  2RJD A;  3X20 B;  5C6S A;  2E6N A;  3TW7 A;  4AKH A;  2CZ0 B;  1IZ6 A;  4XTY A;  3JCM W;  2QQ8 A;  1Q86 C;  3AHU A;  4RKU E;  4FT4 A;  1VQO A;  4N4I A;  4JLI A;  4J7F A;  1FX7 A;  3P8D A;  3H8Z A;  4BI8 B;  1LOJ A;  4HNU A;  4LDV A;  2VXE A;  2YHT A;  2O4X A;  5GAN 7;  4IUT A;  5GAN 5;  3JAM E;  1YJW A;  1KD1 C;  3V8J A;  4C0D B;  2LDM A;  4C92 C;  4C5H A;  4MMK A;  5DLQ E;  2EIF A;  2RD1 A;  3KHI A;  2RM4 A;  5GMK j;  2KR6 A;  2JN0 A;  1VUB A;  1WGS A;  3RMS A;  5A0G A;  3L2W A;  3CBP A;  2EFI A;  3QBY A;  5A0L A;  3QWL A;  2GCX A;  3CCS T;  3CCU A;  4PJO C;  4M77 A;  4M78 F;  3OMC A;  4JJN K;  3OYL A;  3OYJ A;  3X28 B;  2K3Y A;  2R5A A;  3P8H A;  4GLK A;  3S3O A;  5GAN 3;  1YIJ A;  1PSE A;  2V8I A;  5DM7 R;  3CCL A;  2DD4 B;  4DOW A;  1MHN A;  1UGR B;  2LQK A;  3RKX A;  3V8K A;  3E1S A;  2ZPF B;  4QQG A;  5FU7 C;  1W2B A;  3VKH A;  2K3X A;  4PLL A;  2XD0 A;  4OF1 A;  3HL8 A;  2ZPG B;  5GAM d;  3SD4 A;  1BKB A;  1WPY A;  4M6V A;  4AI6 A;  2CYZ B;  3I55 A;  3M54 A;  4V2S A;  2DXB A;  3CD6 T;  4C5G A;  1KQS A;  4LDU A;  3LX7 A;  2DD5 A;  4BDZ A;  4MZM A;  3HHT B;  5FRN A;  2OTJ T;  1VQM A;  3UPU A;  1QVP A;  2K5L A;  1WNL A;  2E6Z A;  4M75 D;  3HFO A;  4RG8 A;  4QVC A;  5LJ5 e;  4II1 A;  4M78 B;  3GNF B;  3OYF A;  2R5M A;  3X24 B;  2RA2 A;  3L2R A;  4BI4 A;  3NFC A;  3JB9 J;  4XU0 A;  1K8A C;  1Y7X A;  2RO0 A;  5J26 A;  3JCM g;  1JBM A;  3BW1 A;  4KUL A;  4FT2 A;  1N6A A;  2DXU A;  2GFU A;  1LJO A;  4OGE A;  4NOY A;  1O9S A;  2LCL A;  3CC2 T;  5GAO r;  4M78 E;  5GAO l;  5GMK i;  2X35 A;  1QW1 A;  4HA8 A;  4HCZ A;  3OYA A;  3G4S A;  1K9M C;  4JS5 A;  1U8R A;  2EYQ A;  3CCE T;  4BD3 A;  3JB9 G;  1QVF A;  2DTH A;  2PVG B;  2HAX A;  4R56 A;  2BS2 A;  2WSC E;  4C8Q D;  2HNI A;  2RJC A;  3OYN A;  3V7R A;  4OMF B;  4HLQ A;  1XOV A;  2RH2 A;  2RHY A;  3OSS C;  5GAM j;  4JRQ A;  5C0M A;  4C0G A;  4A4H A;  4MFE A;  2DKG A;  4BUG A;  3CCV A;  5LJ3 d;  4M78 G;  2LCC A;  3ER0 A;  4M7D D;  2P0K A;  3E9G A;  2QDY B;  3URG A;  3G6E A;  4XTX A;  5GAO n;  1YIT A;  2G77 A;  2E10 A;  2QQA A;  5L8R E;  1ZQ1 A;  2DTO A;  5D6X A;  2DO3 A;  3ZEH A;  4EMK C;  5LJ3 g;  3JCM P;  3JB9 H;  4CI0 C;  4EMH A;  4BE0 A;  1N27 A;  5LJ5 f;  5GMK l;  2BS4 A;  2RHI A;  1KQ1 A;  4MML A;  3CCJ T;  1N9S A;  2QTX A;  3L2U A;  3CCR A;  2BIV A;  4IUP A;  3TRE A;  2YLB A;  2K4Y A;  1M4Z A;  4ZGE B;  2OTL T;  2RB6 A;  2EQK A;  3GLX A;  3JCM h;  2MAM A;  1W2B S;  2X4X A;  3Q1J A;  3GP8 A;  2V8K A;  3QO3 A;  4M7A D;  1GXI E;  4M77 E;  5FRM A;  3JCM b;  3LWI A;  3G7Z A;  3OYB A;  5GAN h;  2DD4 A;  1KG1 A;  3NTH A;  5DY9 A;  5FU6 C;  3VKI A;  1G3Y A;  3PTA A;  1YJ9 T;  2RK2 A;  3GF5 A;  4WF2 A;  2JTM A;  5HK3 A;  2QQS A;  3ZFJ A;  2L8D A;  3CPW A;  4RCC A;  1M9S A;  3MEW A;  1YBY A;  4A4G A;  4LD6 A;  3TU4 K;  3SWN C;  1Q7Y U;  4ME7 A;  1H3Z A;  1VQN T;  2VV5 A;  1HXD A;  2HQX A;  1NJI U;  1XTD A;  2X4J A;  4MIM A;  1V29 B;  3PGG A;  5CKE A;  3GNG A;  4MZP A;  1VIE A;  1G3W A;  1UGQ B;  3VYH B;  2XDP A;  3QHS A;  4M78 A;  3M59 A;  5CKF A;  3A8O B;  5LJ3 h;  4A53 A;  2VC8 A;  3OYK A;  4BBR M;  2F5K A;  3QG1 A;  1KHC A;  1PSF A;  3BFM A;  3JB9 D;  3M9Q A;  2KQW A;  2K5I A;  3HRT A;  3GOX A;  3H4C A;  3CBO A;  5KE2 A;  3OW2 A;  4M77 D;  4BY6 B;  2K57 A;  1X75 C;  4NC6 A;  2KSS A;  3OS5 A;  3PIP A;  1Y96 B;  2JOY A;  4M75 C;  1WJQ A;  4O5V A;  1BI2 A;  1QP3 A;  4BBS M;  4QQ6 A;  2LRQ A;  3CBM A;  4C0Z A;  4QVZ A;  4ELJ A;  1K73 U;  2O01 E;  3CD6 A;  4N0A A;  3T9N A;  3JCM e;  1YJN T;  5AYF A;  2YLC A;  3EFR A;  3INZ A;  1UB4 A;  2XG8 D;  3A8G B;  4QVD A;  5LJ5 j;  3P8B B;  3CXC S;  5I2M A;  2ZPI B;  2RI3 A;  3VUZ A;  5GAN 6;  2OTJ A;  3DL1 A;  2BKD N;  3QYG B;  2VGM A;  3LYI A;  2RHU A;  4HCB A;  3FB9 A;  5GAN e;  4J6Y A;  4A54 A;  4C92 F;  3M55 A;  4C8Q C;  2DTI A;  2X4W A;  3M4Y A;  3S3N A;  1VQ8 T;  3X26 B;  4C8Q F;  3HBL A;  1Y07 A;  3HFN A;  4R55 A;  4FU6 A;  5KH6 A;  3OB9 A;  3CC2 A;  1S72 T;  3R6O A;  2NLU A;  3MEU A;  1D3B B;  1VQ9 T;  2GF7 A;  2C06 A;  3JCM J;  4PJO F;  2FHD A;  3CCE A;  4ZTF A;  2KVQ G;  1P92 A;  4JUV A;  3C4S A;  4LDX A;  3M5A A;  4L59 A;  4M7D C;  3LWH A;  3VU3 C;  4M7D F;  4L6V 5;  2MI6 A;  3MEV A;  5GMK h;  1WQ7 A;  3X25 B;  4A4E A;  1KQ2 A;  2H3J A;  2E64 A;  4XK8 E;  5A2Q E;  4LDY A;  3F70 A;  2OAU A;  4KUI A;  5GAO m;  3ASK A;  3KUF A;  4ATO A;  4OB0 B;  1QP2 A;  2Y90 A;  4IKF A;  4C92 B;  2XKO C;  3DB3 A;  3QII A;  3JCM f;  3FDR A;  1N8R U;  3KBG A;  4NS5 A;  5J39 A;  3MP8 A;  2DZC A;  4D6W A;  5GAM g;  3LGF A;  2D6F A;  3I56 A;  3QJ6 A;  3CEY A;  5GAN f;  4AKI A;  3OBW A;  1YHQ T;  4TVR A;  3CCJ A;  1VQ5 T;  4M7A C;  4PJO B;  3CCM T;  4M7A F;  1VQ6 T;  3S3M A;  4XTW A;  5EJC A;  2OTL A;  3L42 A;  5HY6 A;  2E1H A;  1M1F A;  2JVV A;  2IG0 A;  5CO7 A;  4RG2 A;  5KCH A;  3CC4 T;  1VQL T;  3PFS A;  3G71 T;  4IUQ A;  4HNV A;  2EWN A;  4NL3 A;  1VQ4 T;  2EQJ A;  2DJZ A;  4FSX A;  2ZZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...