4OB3B

Crystal structure of nitrile hydratase from pseudonocardia thermophila : a reference structure to boronic acid inhibition of nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
229
structure length
229
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 66
structure length 229
sequence length 229
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob3B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob3B02
2PUOB 2DXCB 4OB3B 3X28B 3VYHB 2ZZDB 5L8RE 4ZGDB 2ZCFB 4ZGEB 4RKUE 1UGPB 2PVOB 2O01E 2WSEE 4L6V5 2ZPHB 2DD5A 2DXBA 4ZGJB 1DJ7B 4KT0E 2CYZB 2PVDB 3A8HB 1UGSB 3WVEB 1IREB 2WSCE 1QP3A 2PUKB 1PSFA 2ZPGB 1JB0E 3X24B 2DPPB 3WVDB 3QYHB 2QDYB 1QP2A 3X20B 2WSFE 2DXCA 2DD4A 2DXBB 3LW5E 2ZPIB 4Y28E 2ZPBB 3VYGA 3X26B 3X25B 2D0QB 4XK8E 2CZ1B 3A8MB 4OB2B 3A8GB 2AHJB 1UGRB 4OB0B 1PSEA 3QZ9B 3QZ5B 2ZZDA 2DD5B 2CZ6B 2ZPFB 2DD4B 3HHTB 1AHJB 3QXEB 3A8OB 2CZ0B 2CZ7B 3VYGB 4FM4B 2ZPEB 3QYGB 4OB1B 1UGQB 1GXIE 2PVGB 2PU9B 3A8LB 1V29B
chains in the Genus database with same CATH superfamily
1WXBA 1W2BP 4HXJA 2YLBA 3LGFA 2L3QA 2LP5A 3V7RA 4OB3B 4RTVA 5IXFA 5LJ5e 2Z0WA 5L8RE 1VQ5A 2K5IA 2ZCFB 3BHVB 4IIMA 1Q82U 3RR6A 3LYIA 3NDQA 3JB9H 2PK9B 5I21A 2JTMA 1WHHA 1JO8A 1ARKA 1Q86U 2ABLA 3A1PA 1YCYA 3BLQB 1JXMA 4LUEA 4BCPB 3BLHB 4CRIA 1SEMA 4UN0A 5CEIB 4L59A 3REAB 2CS7A 2WEVB 4HNUA 2KRNA 2EGCA 1JB0E 3RDVA 4DQ2A 1RAEB 3OYMA 5KYUA 3BG5A 2WIPB 2DERA 3MP8A 2GCXA 2GGRA 2EIFA 5IDPB 4QVZA 1XO2A 4BCQD 2EQKA 4J9HA 2VYTA 4E6RA 2E6ZA 1VA7A 1WJRA 4EMGA 1KD1U 2LC4A 1ZBJA 3L42A 3MEAA 3EG9A 2ESWA 2ZPIB 2RPNA 3H9NA 4CRLB 2I2LA 5CAIA 1OPLA 1X2QA 1Q95G 1TOVA 2VKNA 5IH2A 1OV3A 4XK8E 3CC7A 5IHNA 1KQSS 3BFMA 3A8GB 2NUZA 3L2RA 1FMWA 2K6DA 2EYQA 3EGUA 4M7AD 2CUDA 2M51A 4PLIA 2FZKB 3CMEQ 3OW2A 2NUPB 4CFXB 3RBBB 4M7DD 4QKUA 1H1SB 2DFUA 1VQNQ 3LWIA 5DQVA 2CH4A 3URGA 4C8QA 1M5Q1 5GAN5 1ZA2B 3OB9A 2WHBB 1M1KC 4BY7X 4OP0A 1UDLA 3C12A 1G8XA 1VQOA 2AKKA 4OGRB 1WFWA 2RHZA 4P5NA 2RMOA 1YP5A 1QCOA 1M2VA 4PFZA 4IMYB 3BHUB 2P4RA 1V1CA 4OMOA 1BIAA 4I3ZB 1PG5B 1I8FA 4KRTA 4M78D 3CCSQ 1N5ZA 1A0NB 5KYWA 4A4FA 2DIGA 1C0MA 2E41A 3BG3A 2EFIA 4C92A 1BCMA 4E7KA 1NM7A 1H4LD 3M0TA 1PM3A 1WHLA 5IN1A 3THKA 3QO3A 2QDJA 3HO8A 3CMAQ 4XTXA 4M7DG 3L1AA 4QW2A 1TUDA 1JOWA 3PIOA 1J3TA 2RA2A 4KT0E 2EPDA 1OPKA 1QVGA 3WXMB 1PCXA 4F16A 3QHWB 4JX5A 4ANJA 2A37A 1LCKA 1FXXA 1C6VX 3SHWA 4M77D 1Q7YC 2L3RA 4F04B 1ZQ1A 3JB9I 3GNFB 3SFMA 5CKEA 4Y72B 3BDUA 2J6KA 4CFVB 4AG2C 5HBJB 1M30A 4JJDA 2JOYA 4GY5A 3HRTA 4EOLB 2GFUA 2YT6A 5GAOm 1ZUKA 4JLIA 3CC4A 4II1A 4AFZC 1PKTA 5FWCA 4YC3B 4M78G 2DTOA 1OZ2A 4FSXA 5I2SA 5M9OA 4M7DB 4MMLA 4Y28E 3M5AA 4PJOC 3JB9J 4CC2A 5IT9E 5GANj 2I40B 3I5RA 3V7SA 5CKBA 1RABB 2QTVA 2UZLB 3EHQA 1FX7A 3VS5A 4BCMD 4BCIB 1H1RB 1NEGA 1KJWA 4RMOA 5KYXA 2BIVA 7AT1B 1YITT 1UHFA 4OB0B 4JUVA 4BUGA 1KHIA 4QSHA 3NPFA 3QZ5B 2DMEA 2W99A 1D09B 4J9EA 2CZ6B 5FU6B 2HQEA 3GBQA 2FRYA 1VQKT 2A0FB 4C0FA 5IHIA 4M78B 3TN8B 1B34A 4LN2A 1OI9B 2F2CA 4GLMA 4V2SA 4FSSA 5CVIA 1M1KR 3OA6A 4BD3A 3VYGB 1Y96A 3M0PA 5LJ3g 3OYNA 3JCMe 2FL7A 3H6ZA 1K9MC 1Q7YU 1YN8A 4LDXA 1E6GA 4EMKA 4O6JA 5GAOq 1YWPA 4KGZB 1NYGA 4DBRA 4M77B 3RKWA 1YI2A 2W9FA 3L2ZA 2M0YA 4M7AE 4ZGDB 1WHGA 3PT9A 4MFEA 3H0IA 4J9DA 1HXDA 4BCND 1TUCA 4JDSA 5BNJB 1EZZB 3G7ZA 2D6FA 1VQ5T 4MDWA 2DXBA 4FT4A 1O9KA 3CCLQ 4FYXB 2G9XB 2YRDA 1VQMT 2E65A 5GJVB 2WIHB 1TH7A 4DBFA 2MK5A 3E9FA 3GP8A 2UZDB 2GBQA 1XTDA 5GMKe 3I9QA 3X24B 4RTZA 2P0QA 5FW9A 1JRIA 3QYHB 4JRIA 1D1CA 2MCNA 2LJ0A 2CKKA 2BS4A 4BXXX 1IXDA 2W10A 2NLUA 1RACB 3M55A 3CMEA 1VQPT 1K9MU 3F70A 3EJ1B 1KC8R 2DLPA 3LH0A 2O9SA 2QQBA 2KT8A 5FLXE 4J8OA 4F17A 1QLBA 2C5VB 2RQUA 5KYWB 1VQ8A 4EOMB 2AHJB 4X9DA 2EYZA 5C0MA 4M77E 2X4XA 1BBZA 1B7TA 2KE9A 4IUVA 9ATCB 5KCHA 3JCMX 1JJ2A 4OMLA 3CC7T 5D6XA 1RI9A 3P8DA 2LVMA 1OL2B 1M1GA 2ZPFB 2IW6B 5A2QE 2C0OA 1MMNA 5DLOA 1D3BB 3LWHA 1C1AA 4EOOB 1BKBA 3H0HA 1Y7XA 2F2VA 2RF0A 1WJQA 1UTIA 2PVGB 3FRNA 3TU4K 4HNTA 2OTJA 2UZBB 2EQUA 2PU9B 1OIUB 4PNOA 2F5KA 5LJ3d 4EMHA 4PJOD 1OZ3A 2K9GA 2Y4YA 3CCVA 4FU6A 4IUUA 4PJLA 1R77A 3OYYA 4A53A 2RQRA 1YITQ 1TG0A 3RUXA 1OEBA 3M59A 3UWNA 2LJ3A 2E70A 3O0GD 2QA4A 5CKFA 4EOKB 3CC2T 2L89A 3UATA 1WHJA 2WXVB 1D0ZA 4RTYA 1Y57A 2DE0X 2E3HA 2HAXA 2RO0A 2MIOA 4NL3A 1KIKA 2K2VA 3DB4A 4AKGA 5GMKi 2K5FA 1YJNT 1B34B 3OYBA 2E6NA 1XOVA 3HZJA 1TS9A 1K4US 1VQ6T 4M7AF 5LJ3f 3R6NA 2ROTA 4M75C 5ACBA 4BCKB 3QWLA 4EMKB 2X4JA 4YOSA 1FMVA 1Y71A 2YLCA 4JJNK 1VQ5Q 4Y92A 4BDYA 1VQ9T 3M58A 5GAN7 2EYYA 4HCKA 2M1HA 4MDXA 2DJZA 2LX9A 4CFUB 2YRVA 8AT1B 2RHXA 4PLLA 2D9TA 5EFQB 2D1XA 3PGGA 1YIJA 2EGEA 1HYOA 1M8MA 4XU2A 1KG1A 2QGGA 3ME9A 3OYKA 2PJQA 4R0KA 1FINB 4RTWA 3QSUA 4F7UB 5LJ5h 1C9BA 4DEXA 4GBQA 1UGVA 3VRYA 2JXBA 3OS1A 2PUOB 3QDRB 1K73C 4OVAA 1E7OA 4B9WA 5HBHB 4JX6A 2R57A 2VXEA 4M77F 3G71A 3TVTA 4E7SA 3CC7Q 2IW8B 4EDUA 2RJDA 4AI6A 1OOTA 1U06A 5GAMe 1JU5C 5LQFB 4EOQB 2WSEE 1URCB 2K4YA 1YFNA 3CCMA 4N0AA 4IIOA 1PKSA 3POMA 1WXTA 3ER0A 2HBPA 3HTRA 2KQWA 2X1NB 1HJDA 2JMAA 2NWMA 3VUBA 1VQOQ 4PJOE 3OBYA 3TNHB 4ZN1A 2FG0A 1JSTB 2KGTA 2NUPA 2QDYB 2L2PA 5I11A 2EJ9A 3CBPA 3OW2P 1H24B 3H8ZA 3HRSA 1D0YA 1GY3B 1G2BA 4AFUC 2KROA 4EIKA 4BDZA 5FRNA 5DY9A 4F7UE 4MZMA 1QKWA 2BPMB 4O5VA 3CMET 4BI8B 3EGDA 4EOIB 2BTTA 2LX7A 2RJCA 1OQKA 2FPEA 2NYSA 3G4SA 2FZCB 1VQNT 3MP6A 3HSBA 3M9QA 4JRQA 4E7HA 1SKUB 1NJIC 1ZSZC 3QZ9B 1WX6A 3OYGA 4KH0B 1Q82C 4HA8A 4F7LB 2DTIA 1FVVB 3S3OA 5IDNB 5CQYA 1BI2A 2BS3A 3G6EA 1X43A 4LE9A 4FM4B 1IHVA 1YBYA 4M75D 3CC4Q 1I1JA 1RAIB 3KXTA 3CCST 3OQ5A 2DEUA 5HBEB 2FVUA 4QVDA 2WMAB 2LW4A 1QVGP 5GAN6 2DF6A 3BY7A 2IPOB 2OTJT 1W98B 1K73R 3MY1B 2KNBB 3X28B 4BE0A 4C0DC 2M16A 2AIRB 2F1LA 4HT8A 4ZGEB 3OSVA 1WA7A 2DL7A 2R7GA 4B6MA 4M7AA 1E7PA 4EC9B 4XU3A 4Q5WA 1KD1C 1MUZA 2I0NA 2QTXA 2K3YA 1NYFA 3OYIA 3PE0A 3SB2A 4M7DA 5GAOl 3JCMd 1H3ZA 4BCFB 3BW1A 3OMGA 4XAXB 4NOYA 1UGSB 3QWYA 1D1AA 1IREB 3RMQA 3N5BB 2D0NA 1NJIU 3TW6A 1VQ7A 1O9SA 4OR5B 1WDXA 1K1ZA 1P5EB 2BS2A 5CO7A 4C5GA 5LJ3j 1KHCA 2KRMA 4J6YA 2L3PA 1QWFA 2HL5C 3V8LA 4M78A 1G3WA 3LW5E 2VGMA 2RHIA 4MFDA 1YI2Q 2ZPBB 2Y4XA 4DBHA 3VYGA 3ASKA 2PNIA 3M54A 1FWZA 1VQLA 2CZ1B 1Q81C 1QMZB 4A4GA 1YHQA 1M90C 1UGRB 1U1TA 4CI0C 1TD6A 1NG2A 3VS2A 2JM8A 4M77A 4PJOF 2YSQA 1M3BA 1AT1B 2DIQA 2DL4A 2GQIA 2JVVA 1Q82R 3QBYA 1AISB 1Z9ZA 4OMNA 3EHRA 3JCMh 2DEQA 4IURA 2JN0A 1AWJA 1BK2A 1IZ6A 2W2HA 4CFMB 1Q86R 1TU0B 3KFVA 2MI6A 4BCOB 2QXFA 2G6FX 3PVLA 2VGNA 4RCCA 4F7UF 5GAN8 1V29B 3DOGB 3VS4A 1FMKA 2RI3A 4PL6A 2OAUA 2E1HA 5LMKB 2P0PA 1MV3A 3KHIA 3LGLA 3OS2A 3CCLT 3CCUA 5EC7A 1VQ8Q 1G3YA 1IRXA 1JXOA 1T3LA 3G71T 1H641 3Q1JA 4L6V5 1KD1R 1RL2A 5IHYA 2DD5A 4WF2A 2B9RA 1S1NA 3UPUA 5HK0A 4LDVA 3EGDB 4DEYA 3EAEA 1Q81U 3RNJA 4AKHA 1MGQA 5DM7R 1FKMA 5GMKh 2P4TA 2GF7A 4LDUA 2X51A 1UECA 1M90U 4OMMA 2K3BA 4M75E 4TTHA 2HBWA 2XMFA 5GAMg 5FGKB 4FL6A 2BZ8A 4M7AG 1M8VA 2JMCA 2DPPB 1U1SA 5HKCA 2OTJQ 1U3OA 1JJ2P 3L2UA 2WSFE 3RERA 2QASA 3P8BB 1VYWB 5A0LA 3CCVQ 4BCQB 1YCSB 4BE1A 1AOJA 4DOVA 3GNGA 1D3BA 3LH5A 4PFPA 5GANe 3MEWA 1N6AA 3JCMV 4F7SB 3E9GA 1JSUB 4KRDB 4YOOA 4J9CA 4JJCA 4E47A 5J3BA 2CSQA 2HMAA 1WNLA 2VVKA 1ZSGA 4OGEA 2K3XA 4WTOB 5CYIB 4OB2B 1AZEA 2A36A 2QA4Q 3FIFA 3RIRA 4LD9K 4RODA 4II5B 5I2MA 5CQXA 4YOZA 1AZGB 4M7AB 4ATOA 1PD1A 1W70A 4LD6A 1GL5A 1B07A 2HSEB 1AHJB 3QXEB 2XK0A 5A0DA 1RI0A 3TSWA 2DBMA 2COWA 4LUDA 2H3EB 5IHKA 4ELLA 2MF2A 2IW9B 1ZSZB 1GXIE 2YUNA 4XTVA 4PJNA 3EH2A 3G6ET 2AZVA 3UA7A 4M77G 2CGHA 1SSFA 3CCEA 4CXAB 1WHMA 2WJ9A 2ZZDB 2H8HA 3DLMA 5EJCA 2MPXC 3GPLA 3PFSA 4C8QD 4E7IA 1UGPB 2W96A 4BACA 2HKNA 4CC4B 4ELZC 2EYXA 3OSSC 2C0IA 1VINA 5CIUA 4JS5A 5AT1B 4JPBW 1YIJQ 5FWBA 4LNPA 1WYXA 3I56Q 3OYAA 1HSQA 2V8KA 4F14A 4BBRM 1G3NC 3JCMW 5DQWA 4IUPA 1VOMA 4C92D 4BI3A 3CCQA 2JGZB 2DILA 1S72A 3CBMA 4KGXB 2X3WD 2HDAA 2GNCA 1VQ7T 1GCQC 4PJOA 4F7JB 1JKWA 2VXFA 1NLPC 1I5OB 5GAMd 1CKAA 1RUWA 1JBMA 4JX4A 2VASA 1K9AA 5LJ5g 3G71Q 1QQJA 1NPPA 3MIAB 3OW2S 1Q7YR 4CFWB 3MO8A 3PNWC 1G3SA 3OYDA 3CCJQ 2P0KA 4F7UA 2DKGA 1VIFA 3CCRQ 5IAYA 3OYLA 4BCMB 4M75F 3CCMQ 5KYYB 2L0AA 6AT1B 3VS6A 2QQ8A 5GAN3 2KAFA 2RQWA 4Z02A 3M4GA 2DD5B 4AFQC 4WCIA 4XTUA 1X27A 2RN8A 4OMFB 1X6BA 2DD4B 3HHTB 1GBQA 2LCLA 4CC7A 2PMIB 3EG1A 4IUQA 4AKIA 3NTHA 3CQTA 2JW4A 1K8AC 3DDPB 1WQ7A 1N9RA 3S3MA 3REBB 3EGXB 2XKOC 1RAFB 4Z88A 3FJPA 4C5HA 1MHNA 2FHDA 2EQMA 3HFNA 1YJ9A 1PHTA 2DA9A 1IGUA 5GAMh 2LZ6B 4PKCC 1QVGS 2DETA 4XTZA 1D1BA 4JS4A 2XG8D 4RKUE 4BCNB 2EUFA 2RH2A 4FCYA 3IQLA 3G4SQ 1QCFA 4OMPA 1K9MR 3G33B 1W4SA 2HQXA 2LJ1A 3FEOA 1BI3A 4ZGJB 2JS2A 2R58A 5EG2A 2X3XD 1H26B 1VQOT 3JCMQ 1M1FA 3M0RA 2VB6A 3FJ5A 4X9CA 3M56A 3OS0A 4Z89A 3G6EQ 2VWFA 4KRCB 2EW3A 2V22B 4E7ZA 1RAHB 1E9HB 4KBMB 2QEXA 1GH6B 3C95A 2HL3A 2WMBB 2BKDN 1K8AU 2DL5A 4C8QE 5J26A 4JJBA 2KMGA 1N8RC 3RKYA 3V7CA 3JCMP 3CD6A 2QI2A 3M0QA 1VUBA 1WI7A 2OTLA 2D0QB 2F2WA 4HVWA 3JAME 1UNGD 2DYIA 5LJ5d 2RQVA 1ABOA 2FYKA 4HLQA 3NTIA 4PJOG 3C0CA 4C92E 4BB7A 3JCMJ 3OYHA 4VUBA 2XICA 1NE8A 3MY5B 3CC4T 1VQ7Q 2UUEB 4J6XA 5DLQE 2MWOA 2QK0A 4F7UG 2AK5A 1MMDA 2QDLA 8ATCB 2CUBA 2KDSA 1WLPB 4HL4A 1M9SA 3A98A 2M02A 1NLOC 3SWNC 4PJOB 1KSWA 1ZLMA 2HEQA 2IVXA 1QVPA 3HL8A 1OIYB 3I56A 1VQLQ 1HK9A 3EG3A 3I35A 5LJ5f 2KR3A 1N8RU 1MMAA 3JB9D 2XDBA 1YHQQ 3GF5A 4JRKA 3VKIA 3UF4A 5KE2A 1JQQA 4YTLA 1UNLD 4OF1A 3VS0A 3QG1A 4JLGA 1CSKA 1T3SA 2BZYA 2XHCA 4PFOA 1SG5A 4E7JA 2PVDB 3ZBDA 3EFSA 3SDZA 3OYEA 3A8HB 2QQRA 3MHXA 5KE3A 2JT4A 3DL1A 3ZFJA 2EJGA 2QQAA 2JTFA 4M75A 4ZN3A 3JCMg 2DJQA 3WVDB 1I81A 3CCJA 1YI2T 1VYUA 4HCBA 2GQVA 1OU9A 3CCRA 3X20B 4CFNB 1M27C 3VV0A 3L2WA 2BKZB 3CCQT 4KUIA 1JJ2S 1IO6A 3FDRA 3VRZA 3CCUQ 1TXQA 4M4ZA 1X69A 1Z9QA 1BYMA 3PMIA 1WXUA 3QUIA 3KBGA 1R8OB 4XU0A 2DZ9A 4XTWA 2J06A 2PTKA 3PO3S 1TFBA 5I22A 2B86A 3RKXA 2O31A 1OYXA 3TW7A 2FZGB 4R55A 1ABQA 3M0SA 5CK9A 2DK3A 1U8RA 2J6FA 1NPRA 1BI1A 3TREA 4C8QF 2CP6A 2KMTA 2VC8A 4F6SB 1VOLA 2LCCA 3S3NA 5GAMj 1H25B 2X4WA 1UUEA 3F5XB 2PHGA 1QCNA 1TSFA 4HKEA 2A3LA 2ED0A 2JM9A 1VQ8T 4A4KA 3JV3A 4D8DA 1OX9A 2RI5A 3CPWA 2OJ2A 2JZ2A 2XDPA 2YWWA 4A54A 3A5ZB 1YJ9T 3EFRA 4AFSC 5L2WB 3QYEA 2PVOB 4C92F 2EAYA 2W0ZA 4HCCA 2O01E 3INZA 2J6OA 2R5AA 3EFOB 1H1QB 2RM4A 4Z8AA 2BUDA 4J7FA 1VYTA 5D7UA 4LDWA 3META 3QIIA 5C6SA 3EH1A 2WFYB 2XU8A 3WVEB 3QHSA 3VU3C 3JCMb 2OAWA 4EONB 1PSFA 1ZX6A 2K2MA 2O88A 3CCVT 3BDLA 2LDMA 5LJ3e 2QGFB 4RTTA 1KK7A 1OU8A 5GANh 2H3JA 1WPYA 5HQ0B 1N27A 1PNJA 2DVEA 1QVFA 3CCEQ 2ECZA 5GMKm 2QA4T 1WJSA 3BG9A 1H92A 4Y91A 3KUFA 1ZP2A 3MEUA 1RLPC 2C5NB 1ZSZA 2HD0A 2LTOA 1E6HA 4M75G 4BY6C 5A0GA 4IUTA 2CP7A 3DKMA 2O9VA 4FYWB 3VJPA 4M6VA 3HPWA 1M2OA 2OTLT 3HKSA 3HFOA 2P84A 1D0XA 2CT4A 2O2OA 4FX3B 1PRLC 2ZZDA 1ZUUA 4J9GA 1EFNA 2ZGWA 2AZSA 4FYYB 2QFZA 1NZ9A 3LLRA 1LOJA 1VQMA 2IIMA 3CCQQ 1LPLA 1S72Q 2DRMA 4N4GA 2BE7D 2DYBA 4EOPB 1UFFA 4M75B 4C8QC 4AG1C 2NUTB 3JCMf 4XTYA 1NJIR 2RK2A 3UA6A 3GIBA 2CCIB 2EQIA 5HNBB 1UE9A 5HVYB 2JNGA 4DOWA 3DJBA 3HBLA 1Y07A 2F2XA 4F6UB 1UJ0A 2O4XB 3OYFA 4MMKA 5LJ5j 4ME7A 2YXYA 1I4K1 1MNDA 3V8JA 1YIJT 3NGPA 1BCOA 1AD5A 2DAQA 1CKBA 3I56T 4X34A 1VQPA 3R6OA 3SWNB 3O8VA 4NL2A 1DJ7B 4KGVB 4C92C 3L2VA 3H4CA 2F69A 4J9IA 4ORZA 2CCHB 3RESA 3BLRB 2QQSA 2YUOA 1AD6A 3MPUB 3GTMS 5D6YA 1RAAB 4Z6YA 3VS1A 2COZA 4EORB 2PUKB 3K7AM 2FPDA 3J7AF 4ZNXA 3JRZA 2LNHB 3NTKA 4XU1A 3FB9A 3E2UA 5KYYA 2E3IA 2ENMA 2VV5A 1G5VA 2SEMA 2M0OA 3MEVA 1LJOA 2JTEA 2DXCA 1YJ9Q 2DD4A 2K7AA 3CXCA 3NFCA 4KH1B 2EYWA 3CCJT 1UJYA 3CCRT 2GTOA 1G83A 3CCMT 3EGXA 2KI7A 1PKDB 2LQ8A 1VYVA 4J5YA 3CPWS 2K57A 4J9BA 3J81E 4NSTB 1WGSA 2VUBA 5FRMA 1UHCA 2KY9A 2LQWA 1OL1B 2C4GB 1YJWQ 1VQ4Q 2X35A 3G1JA 2GTJA 3I55A 3TQ7P 2MAMA 3FLGA 1M3AA 3MCAB 2YHTA 3NMZC 2FB7A 3AHUA 4JRPA 1G3TA 4ZTFA 5D6WA 3CC2A 1PWTA 1U5SA 3PMTA 2DTHA 4RG8A 1Q81R 3QYGB 2DXUA 2QEXQ 2QAZA 3JB9F 2DL3A 2DVJA 2LT4A 4G6LB 3QJYA 2X4YA 4R56A 1M90R 4FYVB 3BE3A 4FW2A 3QJ6A 2PZ1A 1YJNA 2YDLA 4EPCA 3EG0A 1F5QB 5L23A 3CD6Q 3G4ST 1KFZA 1QVFS 4EOJB 2E4HA 2RD1A 2OTLQ 1VQ6A 5CCAA 4EMKC 3H0FA 3JSCA 3VUZA 2XI9A 4GLKA 3OS5A 4ESRA 2G77A 4CC3A 4J6WA 4BI4A 1M1KU 1VQ9A 1IGQA 1W2BA 1LVKA 4IKFA 5GAOr 2CREA 4K11A 5I5ZB 3TEEA 1KC8C 3OYJA 3JCMc 4PJJA 2WSCE 2E64A 4MIMA 2KRSA 3NHNA 4A63B 2V1RA 3MP1A 2JUFA 4D8KA 1H27B 2PQWA 4BCGB 1K76A 3V8KA 1QW1A 3MJXA 4B9XA 3QHRB 4C0DB 1H1PB 1PC0A 1F1BB 4RCBA 4PK4A 1K0XA 1OX8A 2RJEA 4QVCA 2E10A 3X25B 1B3QA 1LNXA 1SHFA 2ATCB 3MKDA 5CR2A 3SEMA 2ROLA 1GUXA 1GCPA 2M9UA 5GAOn 2DL8A 4N4IA 4ELYC 2BZXA 4J9FA 5ICPB 4OMQA 5KYUB 1SF9A 2K5LA 1ENWA 4EC8B 1SRMA 4C8QG 4BY6B 1UG1A 2CJMB 2KEAA 3EG9B 2A28A 4FIBA 1GFCA 3GOXA 2QQ9A 1ZUYA 1X6OA 4M7DE 2FRWA 3DB3A 1KC8U 5ECAA 2J05A 2V1QA 4HT9A 2RHYA 4DBQA 3P8HA 1VQLT 1ZBXA 2KYBA 4C5EA 1T0JA 1BU2A 4AT1B 5GAN4 1TWBA 1YHQT 3ZEHA 2DXCB 2KT1A 2C5OB 5FU7C 3CXCS 2QYZA 4BY1X 2RB6A 2AT1B 4C92G 3U23A 1SSHA 1H28B 2LNVA 1WIEA 4NC6A 1M4ZA 2OI3A 2V26A 1AEYA 4C8QB 2EBPA 4C5IA 1N9SA 1SRLA 3D7SB 4M78E 4PJMA 4HNVA 5GAMf 2LQNA 2AKLA 1X6GA 1O75A 3LX7A 3S6WA 2CYZB 1X01A 2KK4A 5CKHA 1W1FA 1M2VB 2DBKA 1KQ1A 1BIBA 2A7YA 3C4SA 1GCQA 1VQNA 4BCJB 1QP3A 4UC4A 1BU1A 2Y90A 1SHGA 1R0CB 2ZPGB 4HCZA 1IB8A 4C92B 3J80E 4A4EA 4ROEA 5GMKj 4L5GA 2DNUA 1YWOA 2DX1A 3CCUT 2I53A 1VQ4A 2K79A 1YJWA 2QG9B 4RTXA 1TTHB 2IG0A 2ED1A 2XD0A 1SPKA 1KQSP 2L8DA 1BB9A 2HSPA 3X26B 3CCSA 1RAGB 2EJFA 2KVQG 3E19A 3C94A 2RI2A 1OULA 1ZA1B 2J7IA 3HB9A 5HK3A 3OY9A 4CFUD 3CMAA 3E1SA 1T0HA 2CP3A 2V8IA 2ZAEA 1D3UB 4ROCA 2LQKA 4N4HA 3TNWB 3M03A 3I55T 2EKOA 3CPWP 2C06A 1W2BS 2RJFA 1PRMC 2DXTA 2CSIA 2LMJA 2C6TB 3QPHA 1OKVB 2CZ7B 2GFAA 3EFOA 4TVRA 5AYFA 1WZOA 1QMCA 4OB1B 1VQKQ 3VS7A 3M0UA 1UGQB 4C0GA 4X1VA 4LOCA 5KCOA 3VS3A 2YUQA 1EX4A 1BI0A 2RK1A 1I5LA 5KYXB 2C5XB 2OX7A 4AMCA 5GANg 2RHUA 2KSSA 1OI1A 2FEIA 2F5TX 1OGUB 1UNHD 2QF7A 2PK2A 2CH4W 5KYNA 1EIFA 1UEBA 5CKDA 3UDCA 1K8AR 3TNIB 2X9HA 4KULA 3TSZA 1GRIA 2DM1A 1RLQC 2ZPHB 2XIDA 1Y96B 1QLYA 1PD0A 1GUXB 3RGFB 4ELJA 1MNEA 3TCJA 3PIPA 4LDYA 1QVFP 4KUDK 4F7NB 4M7DF 5GMKl 5IF1B 2CDTA 5LJ3h 4MZPA 2C0TA 1VQMQ 4HVVA 3CEYA 1X75C 4N0AC 2BE9B 3CCET 1QWEA 3PTAA 1I07A 2HQHA 2YRCA 2WPAB 2CP2A 1KQ2A 1ZHIA 4J7IA 1AWOA 3B57A 3QYBA 1R0BG 2DXBB 1P92A 2EVRA 4J83A 5GJWB 1O9KB 2LCSA 2KXDA 5HCKA 2RQTA 2DO3A 4M78F 3M57A 5J39A 5KH6A 4BE2A 2JJ9A 4MZTA 4QQ6A 4EOSB 3ULRB 4BCHB 1WQWA 3L2QA 2NUTA 1VQPQ 1H3HA 2QGSA 2MOXA 1TUGB 3FC3A 2EKHA 1PSEA 2E5KA 3CCLA 2RNAA 1AWWA 2KYMA 2O4XA 1ACMB 3OYCA 4D6WA 2R5MA 1S72T 1N8RR 3ZL7C 3MI9B 5GAN2 3CPFA 4F6WB 3M4YA 3A8OB 3JB9G 4OGCA 1H8KA 2DRKA 2MYSA 5FROA 3RMSA 4FW1A 2LRQA 4C0ZA 2B8AA 3SWNA 4E2FB 2A08A 5HY6A 2MMPA 3QWXX 3H41A 3I5SA 3OMCA 3A8LB 1GBRA 3DDQB 4QQDA 1MV0B 1NBEB 2KXCA 4ZTJA 3VYHB 1AVZC 1KQSA 2HZYA 4FT2A 2HNIA 4HVUA 1XNIA 4A4HA 2E12A 2HCKA 1IHWA 1KXUA 1AWXA 4RTUA 5GANd 1Y0MA 2WACA 3UT1A 3I55Q 4LXCA 4DA4A 3AT1B 3EIDB 1XQHA 2MWPA 3PVQA 5FU7B 4JZ3A 1GFDA 3GLXA 2FPFA 4E7LA 1HD3A 3CXCP 3O5ZA 2W9ZA 4M7AC 2KR6A 1M3CA 3QKJA 2DZCA 3SD4A 2G3RA 3CC2Q 4M7DC 2CT3A 1NEBA 1K73U 3DLLA 3VKHA 1QKXA 2JS0A 1FYNA 3QDFA 1QP2A 2LT1A 1V76A 4F70B 1K0SA 1YJNQ 2UZEB 2CP5A 1VIEA 2L3SA 1X2KA 1WHKA 2XDDA 1N4MA 1VQ6Q 1VQ4T 1YJWT 2EGAA 5FU6C 3BHTB 3OBWA 4XQ3A 1Q86C 1YITA 5GANf 3CBOA 4M78C 5IXBA 3A8MB 1I0CA 2COYA 1OKWB 2V8JA 2IN3A 1JEGA 2CP0A 1VQ9Q 1VQKA 4RG2A 2YUPA 2KBTA 2L5QA 1XJWB 3EG2A 4BBSM 3M53A 3VKGA 2EQJA 3T9NA 2QEXT 2E5QA 2FO0A 4QQGA 3CMAT 3DTOA 2D8HA 2CZ0B 1UB4A 2EWNA 5GAOp 3LQ5B 5LL6S 4QT7A 2HKQB 1MMGA 3EOCB 1YNZA 4M77C 4NS5A 4RUGA 3HRUA 2ZPEB 2DMOA 2IVWA 2D8JA 3CD6T 3HP9A 1W6XA 1RADB 4JZ4A 2SRCA
chains in the Genus database with same CATH topology
1YJ9A 3OS1A 1YJNA 2PUOB 2YLBA 3QDRB 3LGFA 4EPCA 5GAMh 3V7RA 4OVAA 4PKCC 4B9WA 3G4ST 4OB3B 5LJ5e 1K73C 3CC2A 4JX6A 2R57A 2RD1A 5L8RE 2VXEA 4M77F 3G71A 1QVGS 1VQ5A 4XTZA 1VQ6A 5CCAA 4EMKC 2K5IA 2ZCFB 4JS4A 4EDUA 2RJDA 2XG8D 3JSCA 4RKUE 4AI6A 1Q82U 3LYIA 5GAMe 3VUZA 3JB9H 2RH2A 2XI9A 4GLKA 3OS5A 2WSEE 5I21A 2G77A 2K4YA 2JTMA 1W4SA 4J6WA 4BI4A 2HQXA 1M1KU 3FEOA 1VQ9A 1BI3A 3CCMA 4ZGJB 1Q86U 4N0AA 1W2BA 2R58A 5EG2A 4IKFA 5GAOr 1YCYA 1VQOT 3ER0A 2HBPA 3JCMQ 1M1FA 3TEEA 2KQWA 1KC8C 4CRIA 3OYJA 3JCMc 4X9CA 3M56A 3OS0A 2WSCE 2E64A 4L59A 4MIMA 2CS7A 4HNUA 3VUBA 4PJOE 3OBYA 1JB0E 4ZN1A 3MP1A 4DQ2A 2JUFA 4KBMB 3OYMA 2QEXA 3BG5A 3MP8A 2GCXA 3C95A 2QDYB 2EIFA 2PQWA 2BKDN 4QVZA 1K8AU 4C8QE 2EQKA 5J26A 2EJ9A 3CBPA 3V8KA 2VYTA 1QW1A 2KMGA 1WJRA 2E6ZA 3H8ZA 3RKYA 4EMGA 2LC4A 1N8RC 4B9XA 3HRSA 3L42A 3MEAA 4C0DB 2ZPIB 3V7CA 4RCBA 3JCMP 4BDZA 5FRNA 3CD6A 2I2LA 2QI2A 5DY9A 5CAIA 4F7UE 2RJEA 4MZMA 1VUBA 2E10A 4O5VA 3X25B 4QVCA 1LNXA 2D0QB 2OTLA 1QVFS 4XK8E 3CC7A 4HCCA 3JAME 5CR2A 3CMET 4BI8B 1KQSS 3BFMA 5LJ5d 2M9UA 3A8GB 2RJCA 5GAOn 3L2RA 2FYKA 3G4SA 4HLQA 3NTIA 2EYQA 4PJOG 1VQNT 4N4IA 3MP6A 3HSBA 4M7AD 3M9QA 4JRQA 4E7HA 4ELYC 1NJIC 4PLIA 3QZ9B 3OW2A 3OYGA 4C92E 2K5LA 4BB7A 4M7DD 1Q82C 4HA8A 3JCMJ 2DTIA 3OYHA 4VUBA 4C8QG 2XICA 4BY6B 3LWIA 1NE8A 3URGA 3CC4T 4C8QA 3S3OA 1M5Q1 5GAN5 3OB9A 4J6XA 1M1KC 5CQYA 5DLQE 2MWOA 1BI2A 2BS3A 4FIBA 3G6EA 3GOXA 2QQ9A 4OP0A 1X6OA 4M7DE 3C12A 4F7UG 4FM4B 1VQOA 1YBYA 3DB3A 1KC8U 2KDSA 4M75D 2RHZA 4P5NA 3KXTA 3CCST 3OQ5A 4HT9A 2RHYA 4HL4A 2FVUA 1M9SA 3P8HA 1VQLT 1ZBXA 4QVDA 4C5EA 5GAN6 4PJOB 3BY7A 3SWNC 5GAN4 1BIAA 1YHQT 2OTJT 3ZEHA 2DXCB 1I8FA 3X28B 5FU7C 4M78D 3CXCS 4BE0A 1QVPA 3HL8A 2RB6A 4A4FA 4C92G 2DIGA 2E41A 5GMKh 3BG3A 2EFIA 2LNVA 2M16A 4C0DC 4C92A 4NC6A 1HK9A 1M4ZA 4ZGEB 3OSVA 4E7KA 4HT8A 5LJ5f 4C8QB 1N8RU 5IN1A 4C5IA 4M7AA 1E7PA 1N9SA 4XU3A 3JB9D 3QO3A 2XDBA 4Q5WA 3GF5A 4JRKA 2QDJA 3VKIA 1KD1C 4M78E 3HO8A 2QTXA 5KE2A 4YTLA 2K3YA 4OF1A 4HNVA 3OYIA 4XTXA 3SB2A 5GAMf 4M7DG 3QG1A 4JLGA 3L1AA 4QW2A 4M7DA 3PIOA 1O75A 3LX7A 3S6WA 5GAOl 2RA2A 2XHCA 4KT0E 3JCMd 1QVGA 1H3ZA 3BW1A 2CYZB 3OMGA 4XAXB 2PVDB 3WXMB 1X01A 2KK4A 3ZBDA 3EFSA 5CKHA 3SDZA 3OYEA 4JX5A 4NOYA 3A8HB 1UGSB 1KQ1A 1BIBA 1FXXA 2A7YA 2QQRA 3C4SA 4M77D 1IREB 1Q7YC 3MHXA 2L3RA 3RMQA 1VQNA 1QP3A 1ZQ1A 3N5BB 5KE3A 3TW6A 3JB9I 1NJIU 3DL1A 1O9SA 4UC4A 2Y90A 2EJGA 3GNFB 2QQAA 3SFMA 3ZFJA 5CKEA 2JTFA 4M75A 2ZPGB 4HCZA 3BDUA 4ZN3A 3JCMg 2BS2A 4C92B 2JOYA 3J80E 4A4EA 3WVDB 1I81A 5CO7A 4C5GA 4GY5A 5GMKj 3HRTA 3CCJA 1YI2T 2GFUA 4L5GA 4HCBA 2GQVA 5LJ3j 1KHCA 4JLIA 5GAOm 3CCRA 3CC4A 4II1A 3X20B 3CCUT 1VQ4A 1YJWA 4J6YA 4M78G 3VV0A 3L2WA 2DTOA 3V8LA 4M78A 3CCQT 1OZ2A 4KUIA 4FSXA 1G3WA 3LW5E 2VGMA 5I2SA 5M9OA 1JJ2S 4M7DB 2RHIA 4MFDA 2IG0A 4MMLA 4Y28E 3M5AA 2XD0A 3FDRA 2ZPBB 2Y4XA 2L8DA 4PJOC 3VYGA 3JB9J 3X26B 3CCSA 2EJFA 5IT9E 5GANj 3ASKA 2KVQG 3V7SA 3E19A 3C94A 5CKBA 3M54A 1FWZA 1VQLA 1BYMA 2CZ1B 2RI2A 1Q81C 3PMIA 5HK3A 3HB9A 1FX7A 3QUIA 3KBGA 3OY9A 1R8OB 4A4GA 1YHQA 1M90C 4RMOA 1UGRB 1U1TA 4CI0C 4XU0A 2BIVA 2DZ9A 4XTWA 1YITT 3CMAA 3E1SA 4OB0B 4JUVA 2V8IA 4BUGA 1KHIA 4QSHA 4M77A 3QZ5B 5FU6B 4PJOF 3RKXA 2CZ6B 2LQKA 1OYXA 4N4HA 2HQEA 3TW7A 2DIQA 2JVVA 1VQKT 3QBYA 4R55A 2EKOA 4C0FA 3I55T 4M78B 3JCMh 1W2BS 1B34A 2DEQA 2RJFA 4IURA 2C06A 2JN0A 5CK9A 2DK3A 2DXTA 1U8RA 4V2SA 3QPHA 5CVIA 1IZ6A 1NPRA 1BI1A 4BD3A 3TREA 4C8QF 3OA6A 2CZ7B 2GFAA 2KMTA 3VYGB 1Y96A 2VC8A 4TVRA 5AYFA 2LCCA 5LJ3g 3S3NA 3OYNA 4OB1B 2FL7A 3H6ZA 3JCMe 2MI6A 5GAMj 1UGQB 1K9MC 2QXFA 4C0GA 2X4WA 1Q7YU 4LDXA 4LOCA 5KCOA 4EMKA 2VGNA 4HKEA 4RCCA 2A3LA 4F7UF 5GAN8 1BI0A 1V29B 2RI3A 4O6JA 2RK1A 4PL6A 1I5LA 1VQ8T 4A4KA 2OAUA 2E1HA 5GAOq 2RI5A 3CPWA 5GANg 2P0PA 2RHUA 2KSSA 4M77B 3RKWA 1YI2A 3KHIA 2JZ2A 3LGLA 1OI1A 3L2ZA 2XDPA 3OS2A 4M7AE 4A54A 4ZGDB 2F5TX 3CCLT 3A5ZB 2QF7A 3PT9A 4MFEA 3CCUA 1YJ9T 3EFRA 1HXDA 1EIFA 1UEBA 5CKDA 4JDSA 1G3YA 3UDCA 4KULA 3QYEA 2PVOB 4C92F 2EAYA 3G7ZA 2D6FA 3G71T 1H641 2O01E 3INZA 3Q1JA 4L6V5 1VQ5T 2ZPHB 2XIDA 1RL2A 2R5AA 4MDWA 2DD5A 2DXBA 1Y96B 4FT4A 4WF2A 5HK0A 4LDVA 3UPUA 2RM4A 4ELJA 2BUDA 1VQMT 4J7FA 3EAEA 3TCJA 3PIPA 4LDYA 1Q81U 4KUDK 4AKHA 1MGQA 4LDWA 5DM7R 4M7DF 2E65A 1FKMA 3META 3QIIA 2P4TA 5C6SA 2GF7A 2XU8A 3WVEB 3QHSA 4LDUA 5GMKl 1M90U 1TH7A 4M75E 5LJ3h 3VU3C 3JCMb 3E9FA 4MZPA 3GP8A 1VQ7A 3CEYA 1X75C 4N0AC 5GAMg 1PSFA 1XTDA 4FL6A 5GMKe 3CCVT 3BDLA 3CCET 4M7AG 2LDMA 3X24B 3PTAA 2P0QA 1M8VA 2DPPB 1JRIA 1U1SA 5HKCA 5LJ3e 3QYHB 4JRIA 5GANe 1KQ2A 5GANh 2H3JA 1WPYA 1ZHIA 2WSFE 4J7IA 3P8BB 1N27A 3L2UA 3RERA 2DVEA 1QVFA 2CKKA 2BS4A 3QYBA 5A0LA 2DXBB 1P92A 4J83A 4BE1A 4DOVA 2NLUA 5GMKm 3GNGA 3M55A 1D3BA 3CMEA 1VQPT 3F70A 2QA4T 1K9MU 1WJSA 3BG9A 1N6AA 2DO3A 3MEWA 3E9GA 3M57A 4M78F 3JCMV 4E47A 5J39A 5KH6A 4LD9K 3LH0A 5J3BA 4Y91A 4BE2A 3KUFA 4MZTA 1WNLA 3MEUA 2QQBA 4OGEA 2HD0A 5FLXE 4QQ6A 4J8OA 2K3XA 2LTOA 4M75G 1WQWA 1QLBA 4BY6C 3L2QA 4OB2B 5A0GA 4IUTA 3DKMA 1VQ8A 3FIFA 2AHJB 4M6VA 4X9DA 3RIRA 3VJPA 3HPWA 5C0MA 4M77E 2X4XA 3JCMX 1JJ2A 4IUVA 5I2MA 5KCHA 2OTLT 5CQXA 3FC3A 4M7AB 3CC7T 3HKSA 5D6XA 4ATOA 3HFOA 1PSEA 3CCLA 3P8DA 2LVMA 2O4XA 2ZZDA 4LD6A 2ZGWA 1M1GA 2R5MA 2ZPFB 4D6WA 3OYCA 1S72T 5A2QE 5GAN2 1AHJB 3QXEB 2XK0A 3CPFA 2QFZA 3A8OB 3M4YA 5A0DA 1NZ9A 3LLRA 1RI0A 1D3BB 4OGCA 5DLOA 3LWHA 3JB9G 5FROA 1LOJA 3RMSA 1VQMA 2LRQA 4C0ZA 1BKBA 2B8AA 3SWNA 1Y7XA 2MF2A 5HY6A 1WJQA 4N4GA 2MMPA 2PVGB 1GXIE 3FRNA 3TU4K 4HNTA 4M75B 4XTVA 4C8QC 2OTJA 3OMCA 2EQUA 2PU9B 3G6ET 3A8LB 3JCMf 4XTYA 2RK2A 4M77G 4PNOA 2F5KA 4QQDA 5LJ3d 4EMHA 3GIBA 2CGHA 4PJOD 1OZ3A 1SSFA 2Y4YA 3CCEA 3CCVA 2JNGA 4FU6A 4IUUA 4DOWA 3HBLA 1Y07A 3OYYA 2O4XB 2WJ9A 3VYHB 4A53A 2ZZDB 3OYFA 4ZTJA 1KQSA 4MMKA 1KD1U 3DLMA 5EJCA 5LJ5j 4FT2A 2HNIA 4ME7A 3RUXA 3GPLA 3PFSA 1I4K1 4C8QD 4E7IA 1UGPB 1XNIA 4A4HA 2E12A 3M59A 3UWNA 3V8JA 5GANd 1YIJT 4BACA 2DAQA 2E70A 2WACA 3I56T 3UT1A 4X34A 2QA4A 1VQPA 5CKFA 4DA4A 4ELZC 3R6OA 3SWNB 1XQHA 3CC2T 2L89A 3O8VA 4NL2A 2MWPA 3OSSC 1DJ7B 5CIUA 4C92C 3L2VA 5FU7B 4JS5A 3H4CA 2F69A 3GLXA 3RESA 4E7LA 2QQSA 4M7AC 2KR6A 3QKJA 5D6YA 3OYAA 2DZCA 3SD4A 2G3RA 2HAXA 4Z6YA 2V8KA 2PUKB 2RO0A 4NL3A 4M7DC 4BBRM 2K2VA 3DB4A 3J7AF 4AKGA 3JCMW 5GMKi 2K5FA 3JRZA 4IUPA 3NTKA 4XU1A 1YJNT 1B34B 3OYBA 3FB9A 2E6NA 4C92D 4BI3A 1K73U 2VV5A 3VKHA 1XOVA 3DLLA 3HZJA 3CCQA 1G5VA 1S72A 3CBMA 1VQ7T 1VQ6T 4PJOA 2M0OA 2VXFA 4M7AF 3MEVA 1QP2A 1LJOA 5GAMd 2LT1A 2DXCA 5LJ3f 2DD4A 3CXCA 4M75C 3NFCA 1JBMA 3CCJT 3QWLA 4JX4A 1VIEA 2X4JA 4EMKB 5LJ5g 1Y71A 2YLCA 2XDDA 3CCRT 4JJNK 1NPPA 1VQ4T 4BDYA 1YJWT 3OW2S 5FU6C 3CCMT 1VQ9T 3M58A 3OBWA 4XQ3A 2LQ8A 4J5YA 5GAN7 3CPWS 2K57A 3MO8A 1Q86C 1YITA 5GANf 3J81E 1WGSA 3CBOA 2VUBA 3PNWC 4M78C 1G3SA 3A8MB 3OYDA 5FRMA 2P0KA 4F7UA 2KY9A 2M1HA 3I56A 2DJZA 2DKGA 1VIFA 4MDXA 2V8JA 5IAYA 3OYLA 2LX9A 2X35A 2YRVA 2RHXA 4M75F 4PLLA 1VQKA 3I55A 4RG2A 2D9TA 2MAMA 3FLGA 2L5QA 2QQ8A 5GAN3 3MCAB 2KAFA 2YHTA 4BBSM 4Z02A 3M4GA 3M53A 2DD5B 4E7JA 3PGGA 3VKGA 2EQJA 2FB7A 4OMFB 4XTUA 3T9NA 4JRPA 1G3TA 2QEXT 1YIJA 3AHUA 2DD4B 3HHTB 2E5QA 2LCLA 4QQGA 3CMAT 2CZ0B 1UB4A 2EWNA 4IUQA 4XU2A 5D6WA 5LL6S 5GAOp 4ZTFA 4AKIA 3NTHA 3PMTA 1KG1A 1K8AC 3ME9A 1WQ7A 3OYKA 1N9RA 3S3MA 4M77C 4NS5A 3HRUA 2XKOC 2DTHA 4RG8A 2ZPEB 3QYGB 2DXUA 3JB9F 2LT4A 2IVWA 3QJYA 3CD6T 3QSUA 3HP9A 2X4YA 4R56A 4F7UB 5LJ5h 3FJPA 4C5HA 3QJ6A 1MHNA 2FHDA 2EQMA 3HFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUO B;  2DXC B;  4OB3 B;  3X28 B;  3VYH B;  2ZZD B;  5L8R E;  4ZGD B;  2ZCF B;  4ZGE B;  4RKU E;  1UGP B;  2PVO B;  2O01 E;  2WSE E;  4L6V 5;  2ZPH B;  2DD5 A;  2DXB A;  4ZGJ B;  1DJ7 B;  4KT0 E;  2CYZ B;  2PVD B;  3A8H B;  1UGS B;  3WVE B;  1IRE B;  2WSC E;  1QP3 A;  2PUK B;  1PSF A;  2ZPG B;  1JB0 E;  3X24 B;  2DPP B;  3WVD B;  3QYH B;  2QDY B;  1QP2 A;  3X20 B;  2WSF E;  2DXC A;  2DD4 A;  2DXB B;  3LW5 E;  2ZPI B;  4Y28 E;  2ZPB B;  3VYG A;  3X26 B;  3X25 B;  2D0Q B;  4XK8 E;  2CZ1 B;  3A8M B;  4OB2 B;  3A8G B;  2AHJ B;  1UGR B;  4OB0 B;  1PSE A;  3QZ9 B;  3QZ5 B;  2ZZD A;  2DD5 B;  2CZ6 B;  2ZPF B;  2DD4 B;  3HHT B;  1AHJ B;  3QXE B;  3A8O B;  2CZ0 B;  2CZ7 B;  3VYG B;  4FM4 B;  2ZPE B;  3QYG B;  4OB1 B;  1UGQ B;  1GXI E;  2PVG B;  2PU9 B;  3A8L B;  1V29 B; 
#chains in the Genus database with same CATH topology
 1WXB A;  1W2B P;  4HXJ A;  2YLB A;  3LGF A;  2L3Q A;  2LP5 A;  3V7R A;  4OB3 B;  4RTV A;  5IXF A;  5LJ5 e;  2Z0W A;  5L8R E;  1VQ5 A;  2K5I A;  2ZCF B;  3BHV B;  4IIM A;  1Q82 U;  3RR6 A;  3LYI A;  3NDQ A;  3JB9 H;  2PK9 B;  5I21 A;  2JTM A;  1WHH A;  1JO8 A;  1ARK A;  1Q86 U;  2ABL A;  3A1P A;  1YCY A;  3BLQ B;  1JXM A;  4LUE A;  4BCP B;  3BLH B;  4CRI A;  1SEM A;  4UN0 A;  5CEI B;  4L59 A;  3REA B;  2CS7 A;  2WEV B;  4HNU A;  2KRN A;  2EGC A;  1JB0 E;  3RDV A;  4DQ2 A;  1RAE B;  3OYM A;  5KYU A;  3BG5 A;  2WIP B;  2DER A;  3MP8 A;  2GCX A;  2GGR A;  2EIF A;  5IDP B;  4QVZ A;  1XO2 A;  4BCQ D;  2EQK A;  4J9H A;  2VYT A;  4E6R A;  2E6Z A;  1VA7 A;  1WJR A;  4EMG A;  1KD1 U;  2LC4 A;  1ZBJ A;  3L42 A;  3MEA A;  3EG9 A;  2ESW A;  2ZPI B;  2RPN A;  3H9N A;  4CRL B;  2I2L A;  5CAI A;  1OPL A;  1X2Q A;  1Q95 G;  1TOV A;  2VKN A;  5IH2 A;  1OV3 A;  4XK8 E;  3CC7 A;  5IHN A;  1KQS S;  3BFM A;  3A8G B;  2NUZ A;  3L2R A;  1FMW A;  2K6D A;  2EYQ A;  3EGU A;  4M7A D;  2CUD A;  2M51 A;  4PLI A;  2FZK B;  3CME Q;  3OW2 A;  2NUP B;  4CFX B;  3RBB B;  4M7D D;  4QKU A;  1H1S B;  2DFU A;  1VQN Q;  3LWI A;  5DQV A;  2CH4 A;  3URG A;  4C8Q A;  1M5Q 1;  5GAN 5;  1ZA2 B;  3OB9 A;  2WHB B;  1M1K C;  4BY7 X;  4OP0 A;  1UDL A;  3C12 A;  1G8X A;  1VQO A;  2AKK A;  4OGR B;  1WFW A;  2RHZ A;  4P5N A;  2RMO A;  1YP5 A;  1QCO A;  1M2V A;  4PFZ A;  4IMY B;  3BHU B;  2P4R A;  1V1C A;  4OMO A;  1BIA A;  4I3Z B;  1PG5 B;  1I8F A;  4KRT A;  4M78 D;  3CCS Q;  1N5Z A;  1A0N B;  5KYW A;  4A4F A;  2DIG A;  1C0M A;  2E41 A;  3BG3 A;  2EFI A;  4C92 A;  1BCM A;  4E7K A;  1NM7 A;  1H4L D;  3M0T A;  1PM3 A;  1WHL A;  5IN1 A;  3THK A;  3QO3 A;  2QDJ A;  3HO8 A;  3CMA Q;  4XTX A;  4M7D G;  3L1A A;  4QW2 A;  1TUD A;  1JOW A;  3PIO A;  1J3T A;  2RA2 A;  4KT0 E;  2EPD A;  1OPK A;  1QVG A;  3WXM B;  1PCX A;  4F16 A;  3QHW B;  4JX5 A;  4ANJ A;  2A37 A;  1LCK A;  1FXX A;  1C6V X;  3SHW A;  4M77 D;  1Q7Y C;  2L3R A;  4F04 B;  1ZQ1 A;  3JB9 I;  3GNF B;  3SFM A;  5CKE A;  4Y72 B;  3BDU A;  2J6K A;  4CFV B;  4AG2 C;  5HBJ B;  1M30 A;  4JJD A;  2JOY A;  4GY5 A;  3HRT A;  4EOL B;  2GFU A;  2YT6 A;  5GAO m;  1ZUK A;  4JLI A;  3CC4 A;  4II1 A;  4AFZ C;  1PKT A;  5FWC A;  4YC3 B;  4M78 G;  2DTO A;  1OZ2 A;  4FSX A;  5I2S A;  5M9O A;  4M7D B;  4MML A;  4Y28 E;  3M5A A;  4PJO C;  3JB9 J;  4CC2 A;  5IT9 E;  5GAN j;  2I40 B;  3I5R A;  3V7S A;  5CKB A;  1RAB B;  2QTV A;  2UZL B;  3EHQ A;  1FX7 A;  3VS5 A;  4BCM D;  4BCI B;  1H1R B;  1NEG A;  1KJW A;  4RMO A;  5KYX A;  2BIV A;  7AT1 B;  1YIT T;  1UHF A;  4OB0 B;  4JUV A;  4BUG A;  1KHI A;  4QSH A;  3NPF A;  3QZ5 B;  2DME A;  2W99 A;  1D09 B;  4J9E A;  2CZ6 B;  5FU6 B;  2HQE A;  3GBQ A;  2FRY A;  1VQK T;  2A0F B;  4C0F A;  5IHI A;  4M78 B;  3TN8 B;  1B34 A;  4LN2 A;  1OI9 B;  2F2C A;  4GLM A;  4V2S A;  4FSS A;  5CVI A;  1M1K R;  3OA6 A;  4BD3 A;  3VYG B;  1Y96 A;  3M0P A;  5LJ3 g;  3OYN A;  3JCM e;  2FL7 A;  3H6Z A;  1K9M C;  1Q7Y U;  1YN8 A;  4LDX A;  1E6G A;  4EMK A;  4O6J A;  5GAO q;  1YWP A;  4KGZ B;  1NYG A;  4DBR A;  4M77 B;  3RKW A;  1YI2 A;  2W9F A;  3L2Z A;  2M0Y A;  4M7A E;  4ZGD B;  1WHG A;  3PT9 A;  4MFE A;  3H0I A;  4J9D A;  1HXD A;  4BCN D;  1TUC A;  4JDS A;  5BNJ B;  1EZZ B;  3G7Z A;  2D6F A;  1VQ5 T;  4MDW A;  2DXB A;  4FT4 A;  1O9K A;  3CCL Q;  4FYX B;  2G9X B;  2YRD A;  1VQM T;  2E65 A;  5GJV B;  2WIH B;  1TH7 A;  4DBF A;  2MK5 A;  3E9F A;  3GP8 A;  2UZD B;  2GBQ A;  1XTD A;  5GMK e;  3I9Q A;  3X24 B;  4RTZ A;  2P0Q A;  5FW9 A;  1JRI A;  3QYH B;  4JRI A;  1D1C A;  2MCN A;  2LJ0 A;  2CKK A;  2BS4 A;  4BXX X;  1IXD A;  2W10 A;  2NLU A;  1RAC B;  3M55 A;  3CME A;  1VQP T;  1K9M U;  3F70 A;  3EJ1 B;  1KC8 R;  2DLP A;  3LH0 A;  2O9S A;  2QQB A;  2KT8 A;  5FLX E;  4J8O A;  4F17 A;  1QLB A;  2C5V B;  2RQU A;  5KYW B;  1VQ8 A;  4EOM B;  2AHJ B;  4X9D A;  2EYZ A;  5C0M A;  4M77 E;  2X4X A;  1BBZ A;  1B7T A;  2KE9 A;  4IUV A;  9ATC B;  5KCH A;  3JCM X;  1JJ2 A;  4OML A;  3CC7 T;  5D6X A;  1RI9 A;  3P8D A;  2LVM A;  1OL2 B;  1M1G A;  2ZPF B;  2IW6 B;  5A2Q E;  2C0O A;  1MMN A;  5DLO A;  1D3B B;  3LWH A;  1C1A A;  4EOO B;  1BKB A;  3H0H A;  1Y7X A;  2F2V A;  2RF0 A;  1WJQ A;  1UTI A;  2PVG B;  3FRN A;  3TU4 K;  4HNT A;  2OTJ A;  2UZB B;  2EQU A;  2PU9 B;  1OIU B;  4PNO A;  2F5K A;  5LJ3 d;  4EMH A;  4PJO D;  1OZ3 A;  2K9G A;  2Y4Y A;  3CCV A;  4FU6 A;  4IUU A;  4PJL A;  1R77 A;  3OYY A;  4A53 A;  2RQR A;  1YIT Q;  1TG0 A;  3RUX A;  1OEB A;  3M59 A;  3UWN A;  2LJ3 A;  2E70 A;  3O0G D;  2QA4 A;  5CKF A;  4EOK B;  3CC2 T;  2L89 A;  3UAT A;  1WHJ A;  2WXV B;  1D0Z A;  4RTY A;  1Y57 A;  2DE0 X;  2E3H A;  2HAX A;  2RO0 A;  2MIO A;  4NL3 A;  1KIK A;  2K2V A;  3DB4 A;  4AKG A;  5GMK i;  2K5F A;  1YJN T;  1B34 B;  3OYB A;  2E6N A;  1XOV A;  3HZJ A;  1TS9 A;  1K4U S;  1VQ6 T;  4M7A F;  5LJ3 f;  3R6N A;  2ROT A;  4M75 C;  5ACB A;  4BCK B;  3QWL A;  4EMK B;  2X4J A;  4YOS A;  1FMV A;  1Y71 A;  2YLC A;  4JJN K;  1VQ5 Q;  4Y92 A;  4BDY A;  1VQ9 T;  3M58 A;  5GAN 7;  2EYY A;  4HCK A;  2M1H A;  4MDX A;  2DJZ A;  2LX9 A;  4CFU B;  2YRV A;  8AT1 B;  2RHX A;  4PLL A;  2D9T A;  5EFQ B;  2D1X A;  3PGG A;  1YIJ A;  2EGE A;  1HYO A;  1M8M A;  4XU2 A;  1KG1 A;  2QGG A;  3ME9 A;  3OYK A;  2PJQ A;  4R0K A;  1FIN B;  4RTW A;  3QSU A;  4F7U B;  5LJ5 h;  1C9B A;  4DEX A;  4GBQ A;  1UGV A;  3VRY A;  2JXB A;  3OS1 A;  2PUO B;  3QDR B;  1K73 C;  4OVA A;  1E7O A;  4B9W A;  5HBH B;  4JX6 A;  2R57 A;  2VXE A;  4M77 F;  3G71 A;  3TVT A;  4E7S A;  3CC7 Q;  2IW8 B;  4EDU A;  2RJD A;  4AI6 A;  1OOT A;  1U06 A;  5GAM e;  1JU5 C;  5LQF B;  4EOQ B;  2WSE E;  1URC B;  2K4Y A;  1YFN A;  3CCM A;  4N0A A;  4IIO A;  1PKS A;  3POM A;  1WXT A;  3ER0 A;  2HBP A;  3HTR A;  2KQW A;  2X1N B;  1HJD A;  2JMA A;  2NWM A;  3VUB A;  1VQO Q;  4PJO E;  3OBY A;  3TNH B;  4ZN1 A;  2FG0 A;  1JST B;  2KGT A;  2NUP A;  2QDY B;  2L2P A;  5I11 A;  2EJ9 A;  3CBP A;  3OW2 P;  1H24 B;  3H8Z A;  3HRS A;  1D0Y A;  1GY3 B;  1G2B A;  4AFU C;  2KRO A;  4EIK A;  4BDZ A;  5FRN A;  5DY9 A;  4F7U E;  4MZM A;  1QKW A;  2BPM B;  4O5V A;  3CME T;  4BI8 B;  3EGD A;  4EOI B;  2BTT A;  2LX7 A;  2RJC A;  1OQK A;  2FPE A;  2NYS A;  3G4S A;  2FZC B;  1VQN T;  3MP6 A;  3HSB A;  3M9Q A;  4JRQ A;  4E7H A;  1SKU B;  1NJI C;  1ZSZ C;  3QZ9 B;  1WX6 A;  3OYG A;  4KH0 B;  1Q82 C;  4HA8 A;  4F7L B;  2DTI A;  1FVV B;  3S3O A;  5IDN B;  5CQY A;  1BI2 A;  2BS3 A;  3G6E A;  1X43 A;  4LE9 A;  4FM4 B;  1IHV A;  1YBY A;  4M75 D;  3CC4 Q;  1I1J A;  1RAI B;  3KXT A;  3CCS T;  3OQ5 A;  2DEU A;  5HBE B;  2FVU A;  4QVD A;  2WMA B;  2LW4 A;  1QVG P;  5GAN 6;  2DF6 A;  3BY7 A;  2IPO B;  2OTJ T;  1W98 B;  1K73 R;  3MY1 B;  2KNB B;  3X28 B;  4BE0 A;  4C0D C;  2M16 A;  2AIR B;  2F1L A;  4HT8 A;  4ZGE B;  3OSV A;  1WA7 A;  2DL7 A;  2R7G A;  4B6M A;  4M7A A;  1E7P A;  4EC9 B;  4XU3 A;  4Q5W A;  1KD1 C;  1MUZ A;  2I0N A;  2QTX A;  2K3Y A;  1NYF A;  3OYI A;  3PE0 A;  3SB2 A;  4M7D A;  5GAO l;  3JCM d;  1H3Z A;  4BCF B;  3BW1 A;  3OMG A;  4XAX B;  4NOY A;  1UGS B;  3QWY A;  1D1A A;  1IRE B;  3RMQ A;  3N5B B;  2D0N A;  1NJI U;  3TW6 A;  1VQ7 A;  1O9S A;  4OR5 B;  1WDX A;  1K1Z A;  1P5E B;  2BS2 A;  5CO7 A;  4C5G A;  5LJ3 j;  1KHC A;  2KRM A;  4J6Y A;  2L3P A;  1QWF A;  2HL5 C;  3V8L A;  4M78 A;  1G3W A;  3LW5 E;  2VGM A;  2RHI A;  4MFD A;  1YI2 Q;  2ZPB B;  2Y4X A;  4DBH A;  3VYG A;  3ASK A;  2PNI A;  3M54 A;  1FWZ A;  1VQL A;  2CZ1 B;  1Q81 C;  1QMZ B;  4A4G A;  1YHQ A;  1M90 C;  1UGR B;  1U1T A;  4CI0 C;  1TD6 A;  1NG2 A;  3VS2 A;  2JM8 A;  4M77 A;  4PJO F;  2YSQ A;  1M3B A;  1AT1 B;  2DIQ A;  2DL4 A;  2GQI A;  2JVV A;  1Q82 R;  3QBY A;  1AIS B;  1Z9Z A;  4OMN A;  3EHR A;  3JCM h;  2DEQ A;  4IUR A;  2JN0 A;  1AWJ A;  1BK2 A;  1IZ6 A;  2W2H A;  4CFM B;  1Q86 R;  1TU0 B;  3KFV A;  2MI6 A;  4BCO B;  2QXF A;  2G6F X;  3PVL A;  2VGN A;  4RCC A;  4F7U F;  5GAN 8;  1V29 B;  3DOG B;  3VS4 A;  1FMK A;  2RI3 A;  4PL6 A;  2OAU A;  2E1H A;  5LMK B;  2P0P A;  1MV3 A;  3KHI A;  3LGL A;  3OS2 A;  3CCL T;  3CCU A;  5EC7 A;  1VQ8 Q;  1G3Y A;  1IRX A;  1JXO A;  1T3L A;  3G71 T;  1H64 1;  3Q1J A;  4L6V 5;  1KD1 R;  1RL2 A;  5IHY A;  2DD5 A;  4WF2 A;  2B9R A;  1S1N A;  3UPU A;  5HK0 A;  4LDV A;  3EGD B;  4DEY A;  3EAE A;  1Q81 U;  3RNJ A;  4AKH A;  1MGQ A;  5DM7 R;  1FKM A;  5GMK h;  2P4T A;  2GF7 A;  4LDU A;  2X51 A;  1UEC A;  1M90 U;  4OMM A;  2K3B A;  4M75 E;  4TTH A;  2HBW A;  2XMF A;  5GAM g;  5FGK B;  4FL6 A;  2BZ8 A;  4M7A G;  1M8V A;  2JMC A;  2DPP B;  1U1S A;  5HKC A;  2OTJ Q;  1U3O A;  1JJ2 P;  3L2U A;  2WSF E;  3RER A;  2QAS A;  3P8B B;  1VYW B;  5A0L A;  3CCV Q;  4BCQ B;  1YCS B;  4BE1 A;  1AOJ A;  4DOV A;  3GNG A;  1D3B A;  3LH5 A;  4PFP A;  5GAN e;  3MEW A;  1N6A A;  3JCM V;  4F7S B;  3E9G A;  1JSU B;  4KRD B;  4YOO A;  4J9C A;  4JJC A;  4E47 A;  5J3B A;  2CSQ A;  2HMA A;  1WNL A;  2VVK A;  1ZSG A;  4OGE A;  2K3X A;  4WTO B;  5CYI B;  4OB2 B;  1AZE A;  2A36 A;  2QA4 Q;  3FIF A;  3RIR A;  4LD9 K;  4ROD A;  4II5 B;  5I2M A;  5CQX A;  4YOZ A;  1AZG B;  4M7A B;  4ATO A;  1PD1 A;  1W70 A;  4LD6 A;  1GL5 A;  1B07 A;  2HSE B;  1AHJ B;  3QXE B;  2XK0 A;  5A0D A;  1RI0 A;  3TSW A;  2DBM A;  2COW A;  4LUD A;  2H3E B;  5IHK A;  4ELL A;  2MF2 A;  2IW9 B;  1ZSZ B;  1GXI E;  2YUN A;  4XTV A;  4PJN A;  3EH2 A;  3G6E T;  2AZV A;  3UA7 A;  4M77 G;  2CGH A;  1SSF A;  3CCE A;  4CXA B;  1WHM A;  2WJ9 A;  2ZZD B;  2H8H A;  3DLM A;  5EJC A;  2MPX C;  3GPL A;  3PFS A;  4C8Q D;  4E7I A;  1UGP B;  2W96 A;  4BAC A;  2HKN A;  4CC4 B;  4ELZ C;  2EYX A;  3OSS C;  2C0I A;  1VIN A;  5CIU A;  4JS5 A;  5AT1 B;  4JPB W;  1YIJ Q;  5FWB A;  4LNP A;  1WYX A;  3I56 Q;  3OYA A;  1HSQ A;  2V8K A;  4F14 A;  4BBR M;  1G3N C;  3JCM W;  5DQW A;  4IUP A;  1VOM A;  4C92 D;  4BI3 A;  3CCQ A;  2JGZ B;  2DIL A;  1S72 A;  3CBM A;  4KGX B;  2X3W D;  2HDA A;  2GNC A;  1VQ7 T;  1GCQ C;  4PJO A;  4F7J B;  1JKW A;  2VXF A;  1NLP C;  1I5O B;  5GAM d;  1CKA A;  1RUW A;  1JBM A;  4JX4 A;  2VAS A;  1K9A A;  5LJ5 g;  3G71 Q;  1QQJ A;  1NPP A;  3MIA B;  3OW2 S;  1Q7Y R;  4CFW B;  3MO8 A;  3PNW C;  1G3S A;  3OYD A;  3CCJ Q;  2P0K A;  4F7U A;  2DKG A;  1VIF A;  3CCR Q;  5IAY A;  3OYL A;  4BCM B;  4M75 F;  3CCM Q;  5KYY B;  2L0A A;  6AT1 B;  3VS6 A;  2QQ8 A;  5GAN 3;  2KAF A;  2RQW A;  4Z02 A;  3M4G A;  2DD5 B;  4AFQ C;  4WCI A;  4XTU A;  1X27 A;  2RN8 A;  4OMF B;  1X6B A;  2DD4 B;  3HHT B;  1GBQ A;  2LCL A;  4CC7 A;  2PMI B;  3EG1 A;  4IUQ A;  4AKI A;  3NTH A;  3CQT A;  2JW4 A;  1K8A C;  3DDP B;  1WQ7 A;  1N9R A;  3S3M A;  3REB B;  3EGX B;  2XKO C;  1RAF B;  4Z88 A;  3FJP A;  4C5H A;  1MHN A;  2FHD A;  2EQM A;  3HFN A;  1YJ9 A;  1PHT A;  2DA9 A;  1IGU A;  5GAM h;  2LZ6 B;  4PKC C;  1QVG S;  2DET A;  4XTZ A;  1D1B A;  4JS4 A;  2XG8 D;  4RKU E;  4BCN B;  2EUF A;  2RH2 A;  4FCY A;  3IQL A;  3G4S Q;  1QCF A;  4OMP A;  1K9M R;  3G33 B;  1W4S A;  2HQX A;  2LJ1 A;  3FEO A;  1BI3 A;  4ZGJ B;  2JS2 A;  2R58 A;  5EG2 A;  2X3X D;  1H26 B;  1VQO T;  3JCM Q;  1M1F A;  3M0R A;  2VB6 A;  3FJ5 A;  4X9C A;  3M56 A;  3OS0 A;  4Z89 A;  3G6E Q;  2VWF A;  4KRC B;  2EW3 A;  2V22 B;  4E7Z A;  1RAH B;  1E9H B;  4KBM B;  2QEX A;  1GH6 B;  3C95 A;  2HL3 A;  2WMB B;  2BKD N;  1K8A U;  2DL5 A;  4C8Q E;  5J26 A;  4JJB A;  2KMG A;  1N8R C;  3RKY A;  3V7C A;  3JCM P;  3CD6 A;  2QI2 A;  3M0Q A;  1VUB A;  1WI7 A;  2OTL A;  2D0Q B;  2F2W A;  4HVW A;  3JAM E;  1UNG D;  2DYI A;  5LJ5 d;  2RQV A;  1ABO A;  2FYK A;  4HLQ A;  3NTI A;  4PJO G;  3C0C A;  4C92 E;  4BB7 A;  3JCM J;  3OYH A;  4VUB A;  2XIC A;  1NE8 A;  3MY5 B;  3CC4 T;  1VQ7 Q;  2UUE B;  4J6X A;  5DLQ E;  2MWO A;  2QK0 A;  4F7U G;  2AK5 A;  1MMD A;  2QDL A;  8ATC B;  2CUB A;  2KDS A;  1WLP B;  4HL4 A;  1M9S A;  3A98 A;  2M02 A;  1NLO C;  3SWN C;  4PJO B;  1KSW A;  1ZLM A;  2HEQ A;  2IVX A;  1QVP A;  3HL8 A;  1OIY B;  3I56 A;  1VQL Q;  1HK9 A;  3EG3 A;  3I35 A;  5LJ5 f;  2KR3 A;  1N8R U;  1MMA A;  3JB9 D;  2XDB A;  1YHQ Q;  3GF5 A;  4JRK A;  3VKI A;  3UF4 A;  5KE2 A;  1JQQ A;  4YTL A;  1UNL D;  4OF1 A;  3VS0 A;  3QG1 A;  4JLG A;  1CSK A;  1T3S A;  2BZY A;  2XHC A;  4PFO A;  1SG5 A;  4E7J A;  2PVD B;  3ZBD A;  3EFS A;  3SDZ A;  3OYE A;  3A8H B;  2QQR A;  3MHX A;  5KE3 A;  2JT4 A;  3DL1 A;  3ZFJ A;  2EJG A;  2QQA A;  2JTF A;  4M75 A;  4ZN3 A;  3JCM g;  2DJQ A;  3WVD B;  1I81 A;  3CCJ A;  1YI2 T;  1VYU A;  4HCB A;  2GQV A;  1OU9 A;  3CCR A;  3X20 B;  4CFN B;  1M27 C;  3VV0 A;  3L2W A;  2BKZ B;  3CCQ T;  4KUI A;  1JJ2 S;  1IO6 A;  3FDR A;  3VRZ A;  3CCU Q;  1TXQ A;  4M4Z A;  1X69 A;  1Z9Q A;  1BYM A;  3PMI A;  1WXU A;  3QUI A;  3KBG A;  1R8O B;  4XU0 A;  2DZ9 A;  4XTW A;  2J06 A;  2PTK A;  3PO3 S;  1TFB A;  5I22 A;  2B86 A;  3RKX A;  2O31 A;  1OYX A;  3TW7 A;  2FZG B;  4R55 A;  1ABQ A;  3M0S A;  5CK9 A;  2DK3 A;  1U8R A;  2J6F A;  1NPR A;  1BI1 A;  3TRE A;  4C8Q F;  2CP6 A;  2KMT A;  2VC8 A;  4F6S B;  1VOL A;  2LCC A;  3S3N A;  5GAM j;  1H25 B;  2X4W A;  1UUE A;  3F5X B;  2PHG A;  1QCN A;  1TSF A;  4HKE A;  2A3L A;  2ED0 A;  2JM9 A;  1VQ8 T;  4A4K A;  3JV3 A;  4D8D A;  1OX9 A;  2RI5 A;  3CPW A;  2OJ2 A;  2JZ2 A;  2XDP A;  2YWW A;  4A54 A;  3A5Z B;  1YJ9 T;  3EFR A;  4AFS C;  5L2W B;  3QYE A;  2PVO B;  4C92 F;  2EAY A;  2W0Z A;  4HCC A;  2O01 E;  3INZ A;  2J6O A;  2R5A A;  3EFO B;  1H1Q B;  2RM4 A;  4Z8A A;  2BUD A;  4J7F A;  1VYT A;  5D7U A;  4LDW A;  3MET A;  3QII A;  5C6S A;  3EH1 A;  2WFY B;  2XU8 A;  3WVE B;  3QHS A;  3VU3 C;  3JCM b;  2OAW A;  4EON B;  1PSF A;  1ZX6 A;  2K2M A;  2O88 A;  3CCV T;  3BDL A;  2LDM A;  5LJ3 e;  2QGF B;  4RTT A;  1KK7 A;  1OU8 A;  5GAN h;  2H3J A;  1WPY A;  5HQ0 B;  1N27 A;  1PNJ A;  2DVE A;  1QVF A;  3CCE Q;  2ECZ A;  5GMK m;  2QA4 T;  1WJS A;  3BG9 A;  1H92 A;  4Y91 A;  3KUF A;  1ZP2 A;  3MEU A;  1RLP C;  2C5N B;  1ZSZ A;  2HD0 A;  2LTO A;  1E6H A;  4M75 G;  4BY6 C;  5A0G A;  4IUT A;  2CP7 A;  3DKM A;  2O9V A;  4FYW B;  3VJP A;  4M6V A;  3HPW A;  1M2O A;  2OTL T;  3HKS A;  3HFO A;  2P84 A;  1D0X A;  2CT4 A;  2O2O A;  4FX3 B;  1PRL C;  2ZZD A;  1ZUU A;  4J9G A;  1EFN A;  2ZGW A;  2AZS A;  4FYY B;  2QFZ A;  1NZ9 A;  3LLR A;  1LOJ A;  1VQM A;  2IIM A;  3CCQ Q;  1LPL A;  1S72 Q;  2DRM A;  4N4G A;  2BE7 D;  2DYB A;  4EOP B;  1UFF A;  4M75 B;  4C8Q C;  4AG1 C;  2NUT B;  3JCM f;  4XTY A;  1NJI R;  2RK2 A;  3UA6 A;  3GIB A;  2CCI B;  2EQI A;  5HNB B;  1UE9 A;  5HVY B;  2JNG A;  4DOW A;  3DJB A;  3HBL A;  1Y07 A;  2F2X A;  4F6U B;  1UJ0 A;  2O4X B;  3OYF A;  4MMK A;  5LJ5 j;  4ME7 A;  2YXY A;  1I4K 1;  1MND A;  3V8J A;  1YIJ T;  3NGP A;  1BCO A;  1AD5 A;  2DAQ A;  1CKB A;  3I56 T;  4X34 A;  1VQP A;  3R6O A;  3SWN B;  3O8V A;  4NL2 A;  1DJ7 B;  4KGV B;  4C92 C;  3L2V A;  3H4C A;  2F69 A;  4J9I A;  4ORZ A;  2CCH B;  3RES A;  3BLR B;  2QQS A;  2YUO A;  1AD6 A;  3MPU B;  3GTM S;  5D6Y A;  1RAA B;  4Z6Y A;  3VS1 A;  2COZ A;  4EOR B;  2PUK B;  3K7A M;  2FPD A;  3J7A F;  4ZNX A;  3JRZ A;  2LNH B;  3NTK A;  4XU1 A;  3FB9 A;  3E2U A;  5KYY A;  2E3I A;  2ENM A;  2VV5 A;  1G5V A;  2SEM A;  2M0O A;  3MEV A;  1LJO A;  2JTE A;  2DXC A;  1YJ9 Q;  2DD4 A;  2K7A A;  3CXC A;  3NFC A;  4KH1 B;  2EYW A;  3CCJ T;  1UJY A;  3CCR T;  2GTO A;  1G83 A;  3CCM T;  3EGX A;  2KI7 A;  1PKD B;  2LQ8 A;  1VYV A;  4J5Y A;  3CPW S;  2K57 A;  4J9B A;  3J81 E;  4NST B;  1WGS A;  2VUB A;  5FRM A;  1UHC A;  2KY9 A;  2LQW A;  1OL1 B;  2C4G B;  1YJW Q;  1VQ4 Q;  2X35 A;  3G1J A;  2GTJ A;  3I55 A;  3TQ7 P;  2MAM A;  3FLG A;  1M3A A;  3MCA B;  2YHT A;  3NMZ C;  2FB7 A;  3AHU A;  4JRP A;  1G3T A;  4ZTF A;  5D6W A;  3CC2 A;  1PWT A;  1U5S A;  3PMT A;  2DTH A;  4RG8 A;  1Q81 R;  3QYG B;  2DXU A;  2QEX Q;  2QAZ A;  3JB9 F;  2DL3 A;  2DVJ A;  2LT4 A;  4G6L B;  3QJY A;  2X4Y A;  4R56 A;  1M90 R;  4FYV B;  3BE3 A;  4FW2 A;  3QJ6 A;  2PZ1 A;  1YJN A;  2YDL A;  4EPC A;  3EG0 A;  1F5Q B;  5L23 A;  3CD6 Q;  3G4S T;  1KFZ A;  1QVF S;  4EOJ B;  2E4H A;  2RD1 A;  2OTL Q;  1VQ6 A;  5CCA A;  4EMK C;  3H0F A;  3JSC A;  3VUZ A;  2XI9 A;  4GLK A;  3OS5 A;  4ESR A;  2G77 A;  4CC3 A;  4J6W A;  4BI4 A;  1M1K U;  1VQ9 A;  1IGQ A;  1W2B A;  1LVK A;  4IKF A;  5GAO r;  2CRE A;  4K11 A;  5I5Z B;  3TEE A;  1KC8 C;  3OYJ A;  3JCM c;  4PJJ A;  2WSC E;  2E64 A;  4MIM A;  2KRS A;  3NHN A;  4A63 B;  2V1R A;  3MP1 A;  2JUF A;  4D8K A;  1H27 B;  2PQW A;  4BCG B;  1K76 A;  3V8K A;  1QW1 A;  3MJX A;  4B9X A;  3QHR B;  4C0D B;  1H1P B;  1PC0 A;  1F1B B;  4RCB A;  4PK4 A;  1K0X A;  1OX8 A;  2RJE A;  4QVC A;  2E10 A;  3X25 B;  1B3Q A;  1LNX A;  1SHF A;  2ATC B;  3MKD A;  5CR2 A;  3SEM A;  2ROL A;  1GUX A;  1GCP A;  2M9U A;  5GAO n;  2DL8 A;  4N4I A;  4ELY C;  2BZX A;  4J9F A;  5ICP B;  4OMQ A;  5KYU B;  1SF9 A;  2K5L A;  1ENW A;  4EC8 B;  1SRM A;  4C8Q G;  4BY6 B;  1UG1 A;  2CJM B;  2KEA A;  3EG9 B;  2A28 A;  4FIB A;  1GFC A;  3GOX A;  2QQ9 A;  1ZUY A;  1X6O A;  4M7D E;  2FRW A;  3DB3 A;  1KC8 U;  5ECA A;  2J05 A;  2V1Q A;  4HT9 A;  2RHY A;  4DBQ A;  3P8H A;  1VQL T;  1ZBX A;  2KYB A;  4C5E A;  1T0J A;  1BU2 A;  4AT1 B;  5GAN 4;  1TWB A;  1YHQ T;  3ZEH A;  2DXC B;  2KT1 A;  2C5O B;  5FU7 C;  3CXC S;  2QYZ A;  4BY1 X;  2RB6 A;  2AT1 B;  4C92 G;  3U23 A;  1SSH A;  1H28 B;  2LNV A;  1WIE A;  4NC6 A;  1M4Z A;  2OI3 A;  2V26 A;  1AEY A;  4C8Q B;  2EBP A;  4C5I A;  1N9S A;  1SRL A;  3D7S B;  4M78 E;  4PJM A;  4HNV A;  5GAM f;  2LQN A;  2AKL A;  1X6G A;  1O75 A;  3LX7 A;  3S6W A;  2CYZ B;  1X01 A;  2KK4 A;  5CKH A;  1W1F A;  1M2V B;  2DBK A;  1KQ1 A;  1BIB A;  2A7Y A;  3C4S A;  1GCQ A;  1VQN A;  4BCJ B;  1QP3 A;  4UC4 A;  1BU1 A;  2Y90 A;  1SHG A;  1R0C B;  2ZPG B;  4HCZ A;  1IB8 A;  4C92 B;  3J80 E;  4A4E A;  4ROE A;  5GMK j;  4L5G A;  2DNU A;  1YWO A;  2DX1 A;  3CCU T;  2I53 A;  1VQ4 A;  2K79 A;  1YJW A;  2QG9 B;  4RTX A;  1TTH B;  2IG0 A;  2ED1 A;  2XD0 A;  1SPK A;  1KQS P;  2L8D A;  1BB9 A;  2HSP A;  3X26 B;  3CCS A;  1RAG B;  2EJF A;  2KVQ G;  3E19 A;  3C94 A;  2RI2 A;  1OUL A;  1ZA1 B;  2J7I A;  3HB9 A;  5HK3 A;  3OY9 A;  4CFU D;  3CMA A;  3E1S A;  1T0H A;  2CP3 A;  2V8I A;  2ZAE A;  1D3U B;  4ROC A;  2LQK A;  4N4H A;  3TNW B;  3M03 A;  3I55 T;  2EKO A;  3CPW P;  2C06 A;  1W2B S;  2RJF A;  1PRM C;  2DXT A;  2CSI A;  2LMJ A;  2C6T B;  3QPH A;  1OKV B;  2CZ7 B;  2GFA A;  3EFO A;  4TVR A;  5AYF A;  1WZO A;  1QMC A;  4OB1 B;  1VQK Q;  3VS7 A;  3M0U A;  1UGQ B;  4C0G A;  4X1V A;  4LOC A;  5KCO A;  3VS3 A;  2YUQ A;  1EX4 A;  1BI0 A;  2RK1 A;  1I5L A;  5KYX B;  2C5X B;  2OX7 A;  4AMC A;  5GAN g;  2RHU A;  2KSS A;  1OI1 A;  2FEI A;  2F5T X;  1OGU B;  1UNH D;  2QF7 A;  2PK2 A;  2CH4 W;  5KYN A;  1EIF A;  1UEB A;  5CKD A;  3UDC A;  1K8A R;  3TNI B;  2X9H A;  4KUL A;  3TSZ A;  1GRI A;  2DM1 A;  1RLQ C;  2ZPH B;  2XID A;  1Y96 B;  1QLY A;  1PD0 A;  1GUX B;  3RGF B;  4ELJ A;  1MNE A;  3TCJ A;  3PIP A;  4LDY A;  1QVF P;  4KUD K;  4F7N B;  4M7D F;  5GMK l;  5IF1 B;  2CDT A;  5LJ3 h;  4MZP A;  2C0T A;  1VQM Q;  4HVV A;  3CEY A;  1X75 C;  4N0A C;  2BE9 B;  3CCE T;  1QWE A;  3PTA A;  1I07 A;  2HQH A;  2YRC A;  2WPA B;  2CP2 A;  1KQ2 A;  1ZHI A;  4J7I A;  1AWO A;  3B57 A;  3QYB A;  1R0B G;  2DXB B;  1P92 A;  2EVR A;  4J83 A;  5GJW B;  1O9K B;  2LCS A;  2KXD A;  5HCK A;  2RQT A;  2DO3 A;  4M78 F;  3M57 A;  5J39 A;  5KH6 A;  4BE2 A;  2JJ9 A;  4MZT A;  4QQ6 A;  4EOS B;  3ULR B;  4BCH B;  1WQW A;  3L2Q A;  2NUT A;  1VQP Q;  1H3H A;  2QGS A;  2MOX A;  1TUG B;  3FC3 A;  2EKH A;  1PSE A;  2E5K A;  3CCL A;  2RNA A;  1AWW A;  2KYM A;  2O4X A;  1ACM B;  3OYC A;  4D6W A;  2R5M A;  1S72 T;  1N8R R;  3ZL7 C;  3MI9 B;  5GAN 2;  3CPF A;  4F6W B;  3M4Y A;  3A8O B;  3JB9 G;  4OGC A;  1H8K A;  2DRK A;  2MYS A;  5FRO A;  3RMS A;  4FW1 A;  2LRQ A;  4C0Z A;  2B8A A;  3SWN A;  4E2F B;  2A08 A;  5HY6 A;  2MMP A;  3QWX X;  3H41 A;  3I5S A;  3OMC A;  3A8L B;  1GBR A;  3DDQ B;  4QQD A;  1MV0 B;  1NBE B;  2KXC A;  4ZTJ A;  3VYH B;  1AVZ C;  1KQS A;  2HZY A;  4FT2 A;  2HNI A;  4HVU A;  1XNI A;  4A4H A;  2E12 A;  2HCK A;  1IHW A;  1KXU A;  1AWX A;  4RTU A;  5GAN d;  1Y0M A;  2WAC A;  3UT1 A;  3I55 Q;  4LXC A;  4DA4 A;  3AT1 B;  3EID B;  1XQH A;  2MWP A;  3PVQ A;  5FU7 B;  4JZ3 A;  1GFD A;  3GLX A;  2FPF A;  4E7L A;  1HD3 A;  3CXC P;  3O5Z A;  2W9Z A;  4M7A C;  2KR6 A;  1M3C A;  3QKJ A;  2DZC A;  3SD4 A;  2G3R A;  3CC2 Q;  4M7D C;  2CT3 A;  1NEB A;  1K73 U;  3DLL A;  3VKH A;  1QKX A;  2JS0 A;  1FYN A;  3QDF A;  1QP2 A;  2LT1 A;  1V76 A;  4F70 B;  1K0S A;  1YJN Q;  2UZE B;  2CP5 A;  1VIE A;  2L3S A;  1X2K A;  1WHK A;  2XDD A;  1N4M A;  1VQ6 Q;  1VQ4 T;  1YJW T;  2EGA A;  5FU6 C;  3BHT B;  3OBW A;  4XQ3 A;  1Q86 C;  1YIT A;  5GAN f;  3CBO A;  4M78 C;  5IXB A;  3A8M B;  1I0C A;  2COY A;  1OKW B;  2V8J A;  2IN3 A;  1JEG A;  2CP0 A;  1VQ9 Q;  1VQK A;  4RG2 A;  2YUP A;  2KBT A;  2L5Q A;  1XJW B;  3EG2 A;  4BBS M;  3M53 A;  3VKG A;  2EQJ A;  3T9N A;  2QEX T;  2E5Q A;  2FO0 A;  4QQG A;  3CMA T;  3DTO A;  2D8H A;  2CZ0 B;  1UB4 A;  2EWN A;  5GAO p;  3LQ5 B;  5LL6 S;  4QT7 A;  2HKQ B;  1MMG A;  3EOC B;  1YNZ A;  4M77 C;  4NS5 A;  4RUG A;  3HRU A;  2ZPE B;  2DMO A;  2IVW A;  2D8J A;  3CD6 T;  3HP9 A;  1W6X A;  1RAD B;  4JZ4 A;  2SRC A; 
#chains in the Genus database with same CATH homology
 1YJ9 A;  3OS1 A;  1YJN A;  2PUO B;  2YLB A;  3QDR B;  3LGF A;  4EPC A;  5GAM h;  3V7R A;  4OVA A;  4PKC C;  4B9W A;  3G4S T;  4OB3 B;  5LJ5 e;  1K73 C;  3CC2 A;  4JX6 A;  2R57 A;  2RD1 A;  5L8R E;  2VXE A;  4M77 F;  3G71 A;  1QVG S;  1VQ5 A;  4XTZ A;  1VQ6 A;  5CCA A;  4EMK C;  2K5I A;  2ZCF B;  4JS4 A;  4EDU A;  2RJD A;  2XG8 D;  3JSC A;  4RKU E;  4AI6 A;  1Q82 U;  3LYI A;  5GAM e;  3VUZ A;  3JB9 H;  2RH2 A;  2XI9 A;  4GLK A;  3OS5 A;  2WSE E;  5I21 A;  2G77 A;  2K4Y A;  2JTM A;  1W4S A;  4J6W A;  4BI4 A;  2HQX A;  1M1K U;  3FEO A;  1VQ9 A;  1BI3 A;  3CCM A;  4ZGJ B;  1Q86 U;  4N0A A;  1W2B A;  2R58 A;  5EG2 A;  4IKF A;  5GAO r;  1YCY A;  1VQO T;  3ER0 A;  2HBP A;  3JCM Q;  1M1F A;  3TEE A;  2KQW A;  1KC8 C;  4CRI A;  3OYJ A;  3JCM c;  4X9C A;  3M56 A;  3OS0 A;  2WSC E;  2E64 A;  4L59 A;  4MIM A;  2CS7 A;  4HNU A;  3VUB A;  4PJO E;  3OBY A;  1JB0 E;  4ZN1 A;  3MP1 A;  4DQ2 A;  2JUF A;  4KBM B;  3OYM A;  2QEX A;  3BG5 A;  3MP8 A;  2GCX A;  3C95 A;  2QDY B;  2EIF A;  2PQW A;  2BKD N;  4QVZ A;  1K8A U;  4C8Q E;  2EQK A;  5J26 A;  2EJ9 A;  3CBP A;  3V8K A;  2VYT A;  1QW1 A;  2KMG A;  1WJR A;  2E6Z A;  3H8Z A;  3RKY A;  4EMG A;  2LC4 A;  1N8R C;  4B9X A;  3HRS A;  3L42 A;  3MEA A;  4C0D B;  2ZPI B;  3V7C A;  4RCB A;  3JCM P;  4BDZ A;  5FRN A;  3CD6 A;  2I2L A;  2QI2 A;  5DY9 A;  5CAI A;  4F7U E;  2RJE A;  4MZM A;  1VUB A;  2E10 A;  4O5V A;  3X25 B;  4QVC A;  1LNX A;  2D0Q B;  2OTL A;  1QVF S;  4XK8 E;  3CC7 A;  4HCC A;  3JAM E;  5CR2 A;  3CME T;  4BI8 B;  1KQS S;  3BFM A;  5LJ5 d;  2M9U A;  3A8G B;  2RJC A;  5GAO n;  3L2R A;  2FYK A;  3G4S A;  4HLQ A;  3NTI A;  2EYQ A;  4PJO G;  1VQN T;  4N4I A;  3MP6 A;  3HSB A;  4M7A D;  3M9Q A;  4JRQ A;  4E7H A;  4ELY C;  1NJI C;  4PLI A;  3QZ9 B;  3OW2 A;  3OYG A;  4C92 E;  2K5L A;  4BB7 A;  4M7D D;  1Q82 C;  4HA8 A;  3JCM J;  2DTI A;  3OYH A;  4VUB A;  4C8Q G;  2XIC A;  4BY6 B;  3LWI A;  1NE8 A;  3URG A;  3CC4 T;  4C8Q A;  3S3O A;  1M5Q 1;  5GAN 5;  3OB9 A;  4J6X A;  1M1K C;  5CQY A;  5DLQ E;  2MWO A;  1BI2 A;  2BS3 A;  4FIB A;  3G6E A;  3GOX A;  2QQ9 A;  4OP0 A;  1X6O A;  4M7D E;  3C12 A;  4F7U G;  4FM4 B;  1VQO A;  1YBY A;  3DB3 A;  1KC8 U;  2KDS A;  4M75 D;  2RHZ A;  4P5N A;  3KXT A;  3CCS T;  3OQ5 A;  4HT9 A;  2RHY A;  4HL4 A;  2FVU A;  1M9S A;  3P8H A;  1VQL T;  1ZBX A;  4QVD A;  4C5E A;  5GAN 6;  4PJO B;  3BY7 A;  3SWN C;  5GAN 4;  1BIA A;  1YHQ T;  2OTJ T;  3ZEH A;  2DXC B;  1I8F A;  3X28 B;  5FU7 C;  4M78 D;  3CXC S;  4BE0 A;  1QVP A;  3HL8 A;  2RB6 A;  4A4F A;  4C92 G;  2DIG A;  2E41 A;  5GMK h;  3BG3 A;  2EFI A;  2LNV A;  2M16 A;  4C0D C;  4C92 A;  4NC6 A;  1HK9 A;  1M4Z A;  4ZGE B;  3OSV A;  4E7K A;  4HT8 A;  5LJ5 f;  4C8Q B;  1N8R U;  5IN1 A;  4C5I A;  4M7A A;  1E7P A;  1N9S A;  4XU3 A;  3JB9 D;  3QO3 A;  2XDB A;  4Q5W A;  3GF5 A;  4JRK A;  2QDJ A;  3VKI A;  1KD1 C;  4M78 E;  3HO8 A;  2QTX A;  5KE2 A;  4YTL A;  2K3Y A;  4OF1 A;  4HNV A;  3OYI A;  4XTX A;  3SB2 A;  5GAM f;  4M7D G;  3QG1 A;  4JLG A;  3L1A A;  4QW2 A;  4M7D A;  3PIO A;  1O75 A;  3LX7 A;  3S6W A;  5GAO l;  2RA2 A;  2XHC A;  4KT0 E;  3JCM d;  1QVG A;  1H3Z A;  3BW1 A;  2CYZ B;  3OMG A;  4XAX B;  2PVD B;  3WXM B;  1X01 A;  2KK4 A;  3ZBD A;  3EFS A;  5CKH A;  3SDZ A;  3OYE A;  4JX5 A;  4NOY A;  3A8H B;  1UGS B;  1KQ1 A;  1BIB A;  1FXX A;  2A7Y A;  2QQR A;  3C4S A;  4M77 D;  1IRE B;  1Q7Y C;  3MHX A;  2L3R A;  3RMQ A;  1VQN A;  1QP3 A;  1ZQ1 A;  3N5B B;  5KE3 A;  3TW6 A;  3JB9 I;  1NJI U;  3DL1 A;  1O9S A;  4UC4 A;  2Y90 A;  2EJG A;  3GNF B;  2QQA A;  3SFM A;  3ZFJ A;  5CKE A;  2JTF A;  4M75 A;  2ZPG B;  4HCZ A;  3BDU A;  4ZN3 A;  3JCM g;  2BS2 A;  4C92 B;  2JOY A;  3J80 E;  4A4E A;  3WVD B;  1I81 A;  5CO7 A;  4C5G A;  4GY5 A;  5GMK j;  3HRT A;  3CCJ A;  1YI2 T;  2GFU A;  4L5G A;  4HCB A;  2GQV A;  5LJ3 j;  1KHC A;  4JLI A;  5GAO m;  3CCR A;  3CC4 A;  4II1 A;  3X20 B;  3CCU T;  1VQ4 A;  1YJW A;  4J6Y A;  4M78 G;  3VV0 A;  3L2W A;  2DTO A;  3V8L A;  4M78 A;  3CCQ T;  1OZ2 A;  4KUI A;  4FSX A;  1G3W A;  3LW5 E;  2VGM A;  5I2S A;  5M9O A;  1JJ2 S;  4M7D B;  2RHI A;  4MFD A;  2IG0 A;  4MML A;  4Y28 E;  3M5A A;  2XD0 A;  3FDR A;  2ZPB B;  2Y4X A;  2L8D A;  4PJO C;  3VYG A;  3JB9 J;  3X26 B;  3CCS A;  2EJF A;  5IT9 E;  5GAN j;  3ASK A;  2KVQ G;  3V7S A;  3E19 A;  3C94 A;  5CKB A;  3M54 A;  1FWZ A;  1VQL A;  1BYM A;  2CZ1 B;  2RI2 A;  1Q81 C;  3PMI A;  5HK3 A;  3HB9 A;  1FX7 A;  3QUI A;  3KBG A;  3OY9 A;  1R8O B;  4A4G A;  1YHQ A;  1M90 C;  4RMO A;  1UGR B;  1U1T A;  4CI0 C;  4XU0 A;  2BIV A;  2DZ9 A;  4XTW A;  1YIT T;  3CMA A;  3E1S A;  4OB0 B;  4JUV A;  2V8I A;  4BUG A;  1KHI A;  4QSH A;  4M77 A;  3QZ5 B;  5FU6 B;  4PJO F;  3RKX A;  2CZ6 B;  2LQK A;  1OYX A;  4N4H A;  2HQE A;  3TW7 A;  2DIQ A;  2JVV A;  1VQK T;  3QBY A;  4R55 A;  2EKO A;  4C0F A;  3I55 T;  4M78 B;  3JCM h;  1W2B S;  1B34 A;  2DEQ A;  2RJF A;  4IUR A;  2C06 A;  2JN0 A;  5CK9 A;  2DK3 A;  2DXT A;  1U8R A;  4V2S A;  3QPH A;  5CVI A;  1IZ6 A;  1NPR A;  1BI1 A;  4BD3 A;  3TRE A;  4C8Q F;  3OA6 A;  2CZ7 B;  2GFA A;  2KMT A;  3VYG B;  1Y96 A;  2VC8 A;  4TVR A;  5AYF A;  2LCC A;  5LJ3 g;  3S3N A;  3OYN A;  4OB1 B;  2FL7 A;  3H6Z A;  3JCM e;  2MI6 A;  5GAM j;  1UGQ B;  1K9M C;  2QXF A;  4C0G A;  2X4W A;  1Q7Y U;  4LDX A;  4LOC A;  5KCO A;  4EMK A;  2VGN A;  4HKE A;  4RCC A;  2A3L A;  4F7U F;  5GAN 8;  1BI0 A;  1V29 B;  2RI3 A;  4O6J A;  2RK1 A;  4PL6 A;  1I5L A;  1VQ8 T;  4A4K A;  2OAU A;  2E1H A;  5GAO q;  2RI5 A;  3CPW A;  5GAN g;  2P0P A;  2RHU A;  2KSS A;  4M77 B;  3RKW A;  1YI2 A;  3KHI A;  2JZ2 A;  3LGL A;  1OI1 A;  3L2Z A;  2XDP A;  3OS2 A;  4M7A E;  4A54 A;  4ZGD B;  2F5T X;  3CCL T;  3A5Z B;  2QF7 A;  3PT9 A;  4MFE A;  3CCU A;  1YJ9 T;  3EFR A;  1HXD A;  1EIF A;  1UEB A;  5CKD A;  4JDS A;  1G3Y A;  3UDC A;  4KUL A;  3QYE A;  2PVO B;  4C92 F;  2EAY A;  3G7Z A;  2D6F A;  3G71 T;  1H64 1;  2O01 E;  3INZ A;  3Q1J A;  4L6V 5;  1VQ5 T;  2ZPH B;  2XID A;  1RL2 A;  2R5A A;  4MDW A;  2DD5 A;  2DXB A;  1Y96 B;  4FT4 A;  4WF2 A;  5HK0 A;  4LDV A;  3UPU A;  2RM4 A;  4ELJ A;  2BUD A;  1VQM T;  4J7F A;  3EAE A;  3TCJ A;  3PIP A;  4LDY A;  1Q81 U;  4KUD K;  4AKH A;  1MGQ A;  4LDW A;  5DM7 R;  4M7D F;  2E65 A;  1FKM A;  3MET A;  3QII A;  2P4T A;  5C6S A;  2GF7 A;  2XU8 A;  3WVE B;  3QHS A;  4LDU A;  5GMK l;  1M90 U;  1TH7 A;  4M75 E;  5LJ3 h;  3VU3 C;  3JCM b;  3E9F A;  4MZP A;  3GP8 A;  1VQ7 A;  3CEY A;  1X75 C;  4N0A C;  5GAM g;  1PSF A;  1XTD A;  4FL6 A;  5GMK e;  3CCV T;  3BDL A;  3CCE T;  4M7A G;  2LDM A;  3X24 B;  3PTA A;  2P0Q A;  1M8V A;  2DPP B;  1JRI A;  1U1S A;  5HKC A;  5LJ3 e;  3QYH B;  4JRI A;  5GAN e;  1KQ2 A;  5GAN h;  2H3J A;  1WPY A;  1ZHI A;  2WSF E;  4J7I A;  3P8B B;  1N27 A;  3L2U A;  3RER A;  2DVE A;  1QVF A;  2CKK A;  2BS4 A;  3QYB A;  5A0L A;  2DXB B;  1P92 A;  4J83 A;  4BE1 A;  4DOV A;  2NLU A;  5GMK m;  3GNG A;  3M55 A;  1D3B A;  3CME A;  1VQP T;  3F70 A;  2QA4 T;  1K9M U;  1WJS A;  3BG9 A;  1N6A A;  2DO3 A;  3MEW A;  3E9G A;  3M57 A;  4M78 F;  3JCM V;  4E47 A;  5J39 A;  5KH6 A;  4LD9 K;  3LH0 A;  5J3B A;  4Y91 A;  4BE2 A;  3KUF A;  4MZT A;  1WNL A;  3MEU A;  2QQB A;  4OGE A;  2HD0 A;  5FLX E;  4QQ6 A;  4J8O A;  2K3X A;  2LTO A;  4M75 G;  1WQW A;  1QLB A;  4BY6 C;  3L2Q A;  4OB2 B;  5A0G A;  4IUT A;  3DKM A;  1VQ8 A;  3FIF A;  2AHJ B;  4M6V A;  4X9D A;  3RIR A;  3VJP A;  3HPW A;  5C0M A;  4M77 E;  2X4X A;  3JCM X;  1JJ2 A;  4IUV A;  5I2M A;  5KCH A;  2OTL T;  5CQX A;  3FC3 A;  4M7A B;  3CC7 T;  3HKS A;  5D6X A;  4ATO A;  3HFO A;  1PSE A;  3CCL A;  3P8D A;  2LVM A;  2O4X A;  2ZZD A;  4LD6 A;  2ZGW A;  1M1G A;  2R5M A;  2ZPF B;  4D6W A;  3OYC A;  1S72 T;  5A2Q E;  5GAN 2;  1AHJ B;  3QXE B;  2XK0 A;  3CPF A;  2QFZ A;  3A8O B;  3M4Y A;  5A0D A;  1NZ9 A;  3LLR A;  1RI0 A;  1D3B B;  4OGC A;  5DLO A;  3LWH A;  3JB9 G;  5FRO A;  1LOJ A;  3RMS A;  1VQM A;  2LRQ A;  4C0Z A;  1BKB A;  2B8A A;  3SWN A;  1Y7X A;  2MF2 A;  5HY6 A;  1WJQ A;  4N4G A;  2MMP A;  2PVG B;  1GXI E;  3FRN A;  3TU4 K;  4HNT A;  4M75 B;  4XTV A;  4C8Q C;  2OTJ A;  3OMC A;  2EQU A;  2PU9 B;  3G6E T;  3A8L B;  3JCM f;  4XTY A;  2RK2 A;  4M77 G;  4PNO A;  2F5K A;  4QQD A;  5LJ3 d;  4EMH A;  3GIB A;  2CGH A;  4PJO D;  1OZ3 A;  1SSF A;  2Y4Y A;  3CCE A;  3CCV A;  2JNG A;  4FU6 A;  4IUU A;  4DOW A;  3HBL A;  1Y07 A;  3OYY A;  2O4X B;  2WJ9 A;  3VYH B;  4A53 A;  2ZZD B;  3OYF A;  4ZTJ A;  1KQS A;  4MMK A;  1KD1 U;  3DLM A;  5EJC A;  5LJ5 j;  4FT2 A;  2HNI A;  4ME7 A;  3RUX A;  3GPL A;  3PFS A;  1I4K 1;  4C8Q D;  4E7I A;  1UGP B;  1XNI A;  4A4H A;  2E12 A;  3M59 A;  3UWN A;  3V8J A;  5GAN d;  1YIJ T;  4BAC A;  2DAQ A;  2E70 A;  2WAC A;  3I56 T;  3UT1 A;  4X34 A;  2QA4 A;  1VQP A;  5CKF A;  4DA4 A;  4ELZ C;  3R6O A;  3SWN B;  1XQH A;  3CC2 T;  2L89 A;  3O8V A;  4NL2 A;  2MWP A;  3OSS C;  1DJ7 B;  5CIU A;  4C92 C;  3L2V A;  5FU7 B;  4JS5 A;  3H4C A;  2F69 A;  3GLX A;  3RES A;  4E7L A;  2QQS A;  4M7A C;  2KR6 A;  3QKJ A;  5D6Y A;  3OYA A;  2DZC A;  3SD4 A;  2G3R A;  2HAX A;  4Z6Y A;  2V8K A;  2PUK B;  2RO0 A;  4NL3 A;  4M7D C;  4BBR M;  2K2V A;  3DB4 A;  3J7A F;  4AKG A;  3JCM W;  5GMK i;  2K5F A;  3JRZ A;  4IUP A;  3NTK A;  4XU1 A;  1YJN T;  1B34 B;  3OYB A;  3FB9 A;  2E6N A;  4C92 D;  4BI3 A;  1K73 U;  2VV5 A;  3VKH A;  1XOV A;  3DLL A;  3HZJ A;  3CCQ A;  1G5V A;  1S72 A;  3CBM A;  1VQ7 T;  1VQ6 T;  4PJO A;  2M0O A;  2VXF A;  4M7A F;  3MEV A;  1QP2 A;  1LJO A;  5GAM d;  2LT1 A;  2DXC A;  5LJ3 f;  2DD4 A;  3CXC A;  4M75 C;  3NFC A;  1JBM A;  3CCJ T;  3QWL A;  4JX4 A;  1VIE A;  2X4J A;  4EMK B;  5LJ5 g;  1Y71 A;  2YLC A;  2XDD A;  3CCR T;  4JJN K;  1NPP A;  1VQ4 T;  4BDY A;  1YJW T;  3OW2 S;  5FU6 C;  3CCM T;  1VQ9 T;  3M58 A;  3OBW A;  4XQ3 A;  2LQ8 A;  4J5Y A;  5GAN 7;  3CPW S;  2K57 A;  3MO8 A;  1Q86 C;  1YIT A;  5GAN f;  3J81 E;  1WGS A;  3CBO A;  2VUB A;  3PNW C;  4M78 C;  1G3S A;  3A8M B;  3OYD A;  5FRM A;  2P0K A;  4F7U A;  2KY9 A;  2M1H A;  3I56 A;  2DJZ A;  2DKG A;  1VIF A;  4MDX A;  2V8J A;  5IAY A;  3OYL A;  2LX9 A;  2X35 A;  2YRV A;  2RHX A;  4M75 F;  4PLL A;  1VQK A;  3I55 A;  4RG2 A;  2D9T A;  2MAM A;  3FLG A;  2L5Q A;  2QQ8 A;  5GAN 3;  3MCA B;  2KAF A;  2YHT A;  4BBS M;  4Z02 A;  3M4G A;  3M53 A;  2DD5 B;  4E7J A;  3PGG A;  3VKG A;  2EQJ A;  2FB7 A;  4OMF B;  4XTU A;  3T9N A;  4JRP A;  1G3T A;  2QEX T;  1YIJ A;  3AHU A;  2DD4 B;  3HHT B;  2E5Q A;  2LCL A;  4QQG A;  3CMA T;  2CZ0 B;  1UB4 A;  2EWN A;  4IUQ A;  4XU2 A;  5D6W A;  5LL6 S;  5GAO p;  4ZTF A;  4AKI A;  3NTH A;  3PMT A;  1KG1 A;  1K8A C;  3ME9 A;  1WQ7 A;  3OYK A;  1N9R A;  3S3M A;  4M77 C;  4NS5 A;  3HRU A;  2XKO C;  2DTH A;  4RG8 A;  2ZPE B;  3QYG B;  2DXU A;  3JB9 F;  2LT4 A;  2IVW A;  3QJY A;  3CD6 T;  3QSU A;  3HP9 A;  2X4Y A;  4R56 A;  4F7U B;  5LJ5 h;  3FJP A;  4C5H A;  3QJ6 A;  1MHN A;  2FHD A;  2EQM A;  3HFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...