1H27B

Cdk2/cyclina in complex with an 11-residue recruitment peptide from p27
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Specificity Determinants of Recruitment Peptides Bound to Phospho-Cdk2/Cyclin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h27B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h27B02
4EOJB 2IW9B 1UNHD 1XO2A 1H25B 1FVVB 2I40B 5IDNB 5LQFB 4YOSA 2IW6B 1D3UB 1UNGD 1PKDB 4OR5B 4BCQD 4BCHB 1O9KB 4F7SB 5IF1B 2C5XB 4EOPB 4EORB 1C9BA 1OI9B 1VINA 3M03A 1OIUB 5FGKB 4BCMB 4F7LB 3BHTB 5L2WB 2UZBB 4BCND 3F5XB 1OL1B 5ICPB 1F5QB 5I5ZB 1H1QB 4EOOB 2UZLB 1KXUA 3MY1B 3TN8B 4EOQB 1AISB 4I3ZB 2PK2A 3G33B 1ZP2A 4ROCA 2WEVB 4UN0A 5CEIB 2WIPB 2V22B 2W99A 2C5NB 2W2HA 2IW8B 4CFNB 2QDJA 1E9HB 4ROEA 1O9KA 2WIHB 4CRLB 4CFUB 2WMAB 3TNHB 4BCPB 2C5VB 1G3NC 5EFQB 5ACBA 3O0GD 1OL2B 4EOMB 1H1RB 1OGUB 1TFBA 3MI9B 2W96A 1QMZB 2PHGA 4Y72B 4BCOB 3BLQB 4IMYB 4EOLB 1VOLA 4CFVB 4CFWB 1JKWA 4BCQB 4CXAB 1H28B 4BCMD 4F6WB 4F7NB 2F2CA 3MIAB 3MY5B 4F70B 4EC9B 4EOKB 4CFXB 1H26B 1AD6A 1OKVB 5HNBB 4BCFB 4EC8B 4YC3B 4EOSB 3DDPB 2W9FA 2PK9B 2B9RA 1H24B 4BCJB 1URCB 1JSTB 3EJ1B 2UZEB 2C4GB 4NSTB 4EOIB 4ELJA 1OKWB 4F7JB 2CCHB 3EOCB 3DOGB 5HBHB 3H4CA 5HVYB 4F6SB 2WXVB 4CFUD 4YOZA 4CFMB 2BKZB 1GUXB 2WFYB 1W98B 2WHBB 1P5EB 2EUFA 1VYWB 2WPAB 4TTHA 5HQ0B 4II5B 4G6LB 1JOWA 1GY3B 5LMKB 4EONB 5BNJB 1BU2A 2WMBB 1H27B 2CCIB 1FINB 4BCNB 3LQ5B 3POMA 3TNIB 3BHUB 4BCKB 2JGZB 2W9ZA 3QHWB 4BCIB 4ELLA 5IDPB 4YOOA 2I53A 1JSUB 2CJMB 2BPMB 3QHRB 2C6TB 1N4MA 2UUEB 3EIDB 4OGRB 3BLRB 5HBEB 1OIYB 2R7GA 3DDQB 1H1PB 1H4LD 1GUXA 1UNLD 3RGFB 3BHVB 2G9XB 3TNWB 3BLHB 4KRDB 2PMIB 4F6UB 1GH6B 2C5OB 4RODA 2UZDB 5HBJB 4BCGB 5CYIB 2IVXA 4FX3B 1H1SB 2X1NB 4KRCB 3K7AM
chains in the Genus database with same CATH superfamily
3X28B 2IW9B 5EJCA 1H25B 3A8OB 2DD5B 4F7SB 2C5XB 4BY1X 2ZPBB 4BCMB 2ZPEB 2ZPHB 1OL1B 2QF7A 5ICPB 2CZ0B 3HZJA 1KXUA 4OB3B 1AISB 2PK2A 4MIMA 2W99A 3QZ9B 2W2HA 1UGSB 4CFNB 3X26B 2WIHB 2WMAB 4EOMB 1OGUB 2ZPGB 1H28B 4BCMD 4F6WB 4AKGA 4F7NB 1IREB 2DXBB 2QDYB 1AD6A 1OKVB 4BCFB 1V29B 3WVDB 4YC3B 3DDPB 4AKIA 4M6VA 2B9RA 4BCJB 1URCB 2ZPFB 3KHIA 3BG9A 2CCHB 2CZ6B 2KMGA 3QXEB 5IHYA 3H4CA 5HVYB 4QSHA 3X25B 1W98B 2WHBB 3QZ5B 2WPAB 4TTHA 4II5B 1E7PA 1GY3B 2BS2A 5BNJB 4OB1B 3LQ5B 3A8GB 2JGZB 3QHWB 2I53A 2BPMB 2C6TB 1N4MA 2UUEB 3BLRB 3DDQB 1GUXA 3BHVB 4RODA 4BCGB 3HO8A 1FKMA 4ELJA 2BS3A 1UNHD 1XO2A 1UNGD 1PKDB 4JX6A 4OR5B 3B57A 4BCHB 1O9KB 5IF1B 4EORB 3M03A 1OIUB 3WVEB 4F7LB 1F5QB 4EOOB 3MY1B 3G33B 3QYBA 4ROCA 1UGQB 2WEVB 5CEIB 2V22B 2C5NB 2CZ7B 3NDQA 4CRLB 3TNHB 2C5VB 4AI6A 1OL2B 4HL4A 3DTOA 2PHGA 2IN3A 4BCOB 1QLBA 4CFVB 1JKWA 4BCQB 4CXAB 2F2CA 3MY5B 4F70B 4EOKB 4CFXB 1H26B 4EOSB 4ZGJB 3EJ1B 3QYHB 4HNVA 5DQVA 2WXVB 4YOZA 2ZZDB 4OB2B 4AKHA 3X20B 5LMKB 4FM4B 4EONB 2CCIB 4BCNB 4HNTA 1UGPB 3TNIB 4ZGEB 4BCKB 3HB9A 1JSUB 3QHRB 3HHTB 3A8MB 1OIYB 2G9XB 4KRDB 2DD4B 2ZPIB 1GH6B 2C5OB 2IVXA 1H1SB 2X1NB 3K7AM 1TD6A 2I40B 1FVVB 5LQFB 5IDNB 3BG5A 4YOSA 3TW6A 1C9BA 1OI9B 1VINA 5FGKB 5L2WB 2UZBB 3A8HB 3F5XB 4BCND 4LOCA 5I5ZB 1H1QB 3PO3S 4EOQB 4I3ZB 4JX5A 2DPPB 2ZCFB 3VKGA 2WIPB 2QDJA 3QWLA 1O9KA 4JX4A 5ACBA 1H1RB 1TFBA 3DL1A 3MI9B 2W96A 4Y72B 3BLQB 4IMYB 4BXXX 3VYGB 4CFWB 3MIAB 1H24B 3QYGB 2C4GB 4NSTB 4EOIB 3EOCB 4F6SB 2BKZB 1P5EB 4ZGDB 1VYWB 5HQ0B 4BBRM 4G6LB 1JOWA 2WMBB 1H27B 3BG3A 1FINB 2WJ9A 2W9ZA 2LW4A 3EIDB 4MFDA 1H1PB 1H4LD 1UNLD 3TNWB 2PMIB 4FX3B 3DOGB 4KRCB 4EOJB 3TW7A 2IW6B 1D3UB 2QQ8A 1AHJB 4BCQD 3X24B 4EOPB 4Z6YA 1UGRB 3HBLA 3BHTB 2AHJB 2UZLB 3TN8B 2KR6A 1ENWA 1ZP2A 2BS4A 4UN0A 2IW8B 1E9HB 4ROEA 3VYHB 3GTMS 4CFUB 4BCPB 5EFQB 1G3NC 3O0GD 2DMEA 2CZ1B 4HNUA 1QMZB 4BBSM 4EOLB 4NC6A 1VOLA 4HLQA 4OB0B 3VKHA 4EC9B 2G77A 4EC8B 5HNBB 4BY7X 2W9FA 2DXCB 2PK9B 1JSTB 2UZEB 3A8LB 1OKWB 4F7JB 5HBHB 4CFUD 4CFMB 1GUXB 2WFYB 2EUFA 2QGSA 1BU2A 3QYEA 2PJQA 3POMA 3BHUB 4ELLA 3DJBA 5DQWA 4BCIB 5IDPB 4YOOA 2CJMB 4OGRB 5HBEB 2R7GA 2CYZB 2QFZA 3RGFB 3BLHB 4F6UB 2UZDB 5HBJB 5CYIB 2D0QB 4MFEA
chains in the Genus database with same CATH topology
4EOJB 2IW9B 1UNHD 1XO2A 1H25B 1FVVB 2I40B 5IDNB 5LQFB 4YOSA 2IW6B 1D3UB 1UNGD 1PKDB 4OR5B 4BCQD 4BCHB 1O9KB 4F7SB 5IF1B 2C5XB 4EOPB 4EORB 1C9BA 1OI9B 1VINA 3M03A 1OIUB 5FGKB 4BCMB 4F7LB 3BHTB 5L2WB 2UZBB 4BCND 3F5XB 1OL1B 5ICPB 1F5QB 5I5ZB 1H1QB 4EOOB 2UZLB 1KXUA 3MY1B 3TN8B 4EOQB 1AISB 4I3ZB 2PK2A 3G33B 1ZP2A 4ROCA 2WEVB 4UN0A 5CEIB 2WIPB 2V22B 2W99A 2C5NB 2W2HA 2IW8B 4CFNB 2QDJA 1E9HB 4ROEA 1O9KA 2WIHB 4CRLB 4CFUB 2WMAB 3TNHB 4BCPB 2C5VB 1G3NC 5EFQB 5ACBA 3O0GD 1OL2B 4EOMB 1H1RB 1OGUB 1TFBA 3MI9B 2W96A 1QMZB 2PHGA 4Y72B 4BCOB 3BLQB 4IMYB 4EOLB 1VOLA 4CFVB 4CFWB 1JKWA 4BCQB 4CXAB 1H28B 4BCMD 4F6WB 4F7NB 2F2CA 3MIAB 3MY5B 4F70B 4EC9B 4EOKB 4CFXB 1H26B 1AD6A 1OKVB 5HNBB 4BCFB 4EC8B 4YC3B 4EOSB 3DDPB 2W9FA 2PK9B 2B9RA 1H24B 4BCJB 1URCB 1JSTB 3EJ1B 2UZEB 2C4GB 4NSTB 4EOIB 4ELJA 1OKWB 4F7JB 2CCHB 3EOCB 3DOGB 5HBHB 3H4CA 5HVYB 4F6SB 2WXVB 4CFUD 4YOZA 4CFMB 2BKZB 1GUXB 2WFYB 1W98B 2WHBB 1P5EB 2EUFA 1VYWB 2WPAB 4TTHA 5HQ0B 4II5B 4G6LB 1JOWA 1GY3B 5LMKB 4EONB 5BNJB 1BU2A 2WMBB 1H27B 2CCIB 1FINB 4BCNB 3LQ5B 3POMA 3TNIB 3BHUB 4BCKB 2JGZB 2W9ZA 3QHWB 4BCIB 4ELLA 5IDPB 4YOOA 2I53A 1JSUB 2CJMB 2BPMB 3QHRB 2C6TB 1N4MA 2UUEB 3EIDB 4OGRB 3BLRB 5HBEB 1OIYB 2R7GA 3DDQB 1H1PB 1H4LD 1GUXA 1UNLD 3RGFB 3BHVB 2G9XB 3TNWB 3BLHB 4KRDB 2PMIB 4F6UB 1GH6B 2C5OB 4RODA 2UZDB 5HBJB 4BCGB 5CYIB 2IVXA 4FX3B 1H1SB 2X1NB 4KRCB 3K7AM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EOJ B;  2IW9 B;  1UNH D;  1XO2 A;  1H25 B;  1FVV B;  2I40 B;  5IDN B;  5LQF B;  4YOS A;  2IW6 B;  1D3U B;  1UNG D;  1PKD B;  4OR5 B;  4BCQ D;  4BCH B;  1O9K B;  4F7S B;  5IF1 B;  2C5X B;  4EOP B;  4EOR B;  1C9B A;  1OI9 B;  1VIN A;  3M03 A;  1OIU B;  5FGK B;  4BCM B;  4F7L B;  3BHT B;  5L2W B;  2UZB B;  4BCN D;  3F5X B;  1OL1 B;  5ICP B;  1F5Q B;  5I5Z B;  1H1Q B;  4EOO B;  2UZL B;  1KXU A;  3MY1 B;  3TN8 B;  4EOQ B;  1AIS B;  4I3Z B;  2PK2 A;  3G33 B;  1ZP2 A;  4ROC A;  2WEV B;  4UN0 A;  5CEI B;  2WIP B;  2V22 B;  2W99 A;  2C5N B;  2W2H A;  2IW8 B;  4CFN B;  2QDJ A;  1E9H B;  4ROE A;  1O9K A;  2WIH B;  4CRL B;  4CFU B;  2WMA B;  3TNH B;  4BCP B;  2C5V B;  1G3N C;  5EFQ B;  5ACB A;  3O0G D;  1OL2 B;  4EOM B;  1H1R B;  1OGU B;  1TFB A;  3MI9 B;  2W96 A;  1QMZ B;  2PHG A;  4Y72 B;  4BCO B;  3BLQ B;  4IMY B;  4EOL B;  1VOL A;  4CFV B;  4CFW B;  1JKW A;  4BCQ B;  4CXA B;  1H28 B;  4BCM D;  4F6W B;  4F7N B;  2F2C A;  3MIA B;  3MY5 B;  4F70 B;  4EC9 B;  4EOK B;  4CFX B;  1H26 B;  1AD6 A;  1OKV B;  5HNB B;  4BCF B;  4EC8 B;  4YC3 B;  4EOS B;  3DDP B;  2W9F A;  2PK9 B;  2B9R A;  1H24 B;  4BCJ B;  1URC B;  1JST B;  3EJ1 B;  2UZE B;  2C4G B;  4NST B;  4EOI B;  4ELJ A;  1OKW B;  4F7J B;  2CCH B;  3EOC B;  3DOG B;  5HBH B;  3H4C A;  5HVY B;  4F6S B;  2WXV B;  4CFU D;  4YOZ A;  4CFM B;  2BKZ B;  1GUX B;  2WFY B;  1W98 B;  2WHB B;  1P5E B;  2EUF A;  1VYW B;  2WPA B;  4TTH A;  5HQ0 B;  4II5 B;  4G6L B;  1JOW A;  1GY3 B;  5LMK B;  4EON B;  5BNJ B;  1BU2 A;  2WMB B;  1H27 B;  2CCI B;  1FIN B;  4BCN B;  3LQ5 B;  3POM A;  3TNI B;  3BHU B;  4BCK B;  2JGZ B;  2W9Z A;  3QHW B;  4BCI B;  4ELL A;  5IDP B;  4YOO A;  2I53 A;  1JSU B;  2CJM B;  2BPM B;  3QHR B;  2C6T B;  1N4M A;  2UUE B;  3EID B;  4OGR B;  3BLR B;  5HBE B;  1OIY B;  2R7G A;  3DDQ B;  1H1P B;  1H4L D;  1GUX A;  1UNL D;  3RGF B;  3BHV B;  2G9X B;  3TNW B;  3BLH B;  4KRD B;  2PMI B;  4F6U B;  1GH6 B;  2C5O B;  4ROD A;  2UZD B;  5HBJ B;  4BCG B;  5CYI B;  2IVX A;  4FX3 B;  1H1S B;  2X1N B;  4KRC B;  3K7A M; 
#chains in the Genus database with same CATH topology
 3X28 B;  2IW9 B;  5EJC A;  1H25 B;  3A8O B;  2DD5 B;  4F7S B;  2C5X B;  4BY1 X;  2ZPB B;  4BCM B;  2ZPE B;  2ZPH B;  1OL1 B;  2QF7 A;  5ICP B;  2CZ0 B;  3HZJ A;  1KXU A;  4OB3 B;  1AIS B;  2PK2 A;  4MIM A;  2W99 A;  3QZ9 B;  2W2H A;  1UGS B;  4CFN B;  3X26 B;  2WIH B;  2WMA B;  4EOM B;  1OGU B;  2ZPG B;  1H28 B;  4BCM D;  4F6W B;  4AKG A;  4F7N B;  1IRE B;  2DXB B;  2QDY B;  1AD6 A;  1OKV B;  4BCF B;  1V29 B;  3WVD B;  4YC3 B;  3DDP B;  4AKI A;  4M6V A;  2B9R A;  4BCJ B;  1URC B;  2ZPF B;  3KHI A;  3BG9 A;  2CCH B;  2CZ6 B;  2KMG A;  3QXE B;  5IHY A;  3H4C A;  5HVY B;  4QSH A;  3X25 B;  1W98 B;  2WHB B;  3QZ5 B;  2WPA B;  4TTH A;  4II5 B;  1E7P A;  1GY3 B;  2BS2 A;  5BNJ B;  4OB1 B;  3LQ5 B;  3A8G B;  2JGZ B;  3QHW B;  2I53 A;  2BPM B;  2C6T B;  1N4M A;  2UUE B;  3BLR B;  3DDQ B;  1GUX A;  3BHV B;  4ROD A;  4BCG B;  3HO8 A;  1FKM A;  4ELJ A;  2BS3 A;  1UNH D;  1XO2 A;  1UNG D;  1PKD B;  4JX6 A;  4OR5 B;  3B57 A;  4BCH B;  1O9K B;  5IF1 B;  4EOR B;  3M03 A;  1OIU B;  3WVE B;  4F7L B;  1F5Q B;  4EOO B;  3MY1 B;  3G33 B;  3QYB A;  4ROC A;  1UGQ B;  2WEV B;  5CEI B;  2V22 B;  2C5N B;  2CZ7 B;  3NDQ A;  4CRL B;  3TNH B;  2C5V B;  4AI6 A;  1OL2 B;  4HL4 A;  3DTO A;  2PHG A;  2IN3 A;  4BCO B;  1QLB A;  4CFV B;  1JKW A;  4BCQ B;  4CXA B;  2F2C A;  3MY5 B;  4F70 B;  4EOK B;  4CFX B;  1H26 B;  4EOS B;  4ZGJ B;  3EJ1 B;  3QYH B;  4HNV A;  5DQV A;  2WXV B;  4YOZ A;  2ZZD B;  4OB2 B;  4AKH A;  3X20 B;  5LMK B;  4FM4 B;  4EON B;  2CCI B;  4BCN B;  4HNT A;  1UGP B;  3TNI B;  4ZGE B;  4BCK B;  3HB9 A;  1JSU B;  3QHR B;  3HHT B;  3A8M B;  1OIY B;  2G9X B;  4KRD B;  2DD4 B;  2ZPI B;  1GH6 B;  2C5O B;  2IVX A;  1H1S B;  2X1N B;  3K7A M;  1TD6 A;  2I40 B;  1FVV B;  5LQF B;  5IDN B;  3BG5 A;  4YOS A;  3TW6 A;  1C9B A;  1OI9 B;  1VIN A;  5FGK B;  5L2W B;  2UZB B;  3A8H B;  3F5X B;  4BCN D;  4LOC A;  5I5Z B;  1H1Q B;  3PO3 S;  4EOQ B;  4I3Z B;  4JX5 A;  2DPP B;  2ZCF B;  3VKG A;  2WIP B;  2QDJ A;  3QWL A;  1O9K A;  4JX4 A;  5ACB A;  1H1R B;  1TFB A;  3DL1 A;  3MI9 B;  2W96 A;  4Y72 B;  3BLQ B;  4IMY B;  4BXX X;  3VYG B;  4CFW B;  3MIA B;  1H24 B;  3QYG B;  2C4G B;  4NST B;  4EOI B;  3EOC B;  4F6S B;  2BKZ B;  1P5E B;  4ZGD B;  1VYW B;  5HQ0 B;  4BBR M;  4G6L B;  1JOW A;  2WMB B;  1H27 B;  3BG3 A;  1FIN B;  2WJ9 A;  2W9Z A;  2LW4 A;  3EID B;  4MFD A;  1H1P B;  1H4L D;  1UNL D;  3TNW B;  2PMI B;  4FX3 B;  3DOG B;  4KRC B;  4EOJ B;  3TW7 A;  2IW6 B;  1D3U B;  2QQ8 A;  1AHJ B;  4BCQ D;  3X24 B;  4EOP B;  4Z6Y A;  1UGR B;  3HBL A;  3BHT B;  2AHJ B;  2UZL B;  3TN8 B;  2KR6 A;  1ENW A;  1ZP2 A;  2BS4 A;  4UN0 A;  2IW8 B;  1E9H B;  4ROE A;  3VYH B;  3GTM S;  4CFU B;  4BCP B;  5EFQ B;  1G3N C;  3O0G D;  2DME A;  2CZ1 B;  4HNU A;  1QMZ B;  4BBS M;  4EOL B;  4NC6 A;  1VOL A;  4HLQ A;  4OB0 B;  3VKH A;  4EC9 B;  2G77 A;  4EC8 B;  5HNB B;  4BY7 X;  2W9F A;  2DXC B;  2PK9 B;  1JST B;  2UZE B;  3A8L B;  1OKW B;  4F7J B;  5HBH B;  4CFU D;  4CFM B;  1GUX B;  2WFY B;  2EUF A;  2QGS A;  1BU2 A;  3QYE A;  2PJQ A;  3POM A;  3BHU B;  4ELL A;  3DJB A;  5DQW A;  4BCI B;  5IDP B;  4YOO A;  2CJM B;  4OGR B;  5HBE B;  2R7G A;  2CYZ B;  2QFZ A;  3RGF B;  3BLH B;  4F6U B;  2UZD B;  5HBJ B;  5CYI B;  2D0Q B;  4MFE A; 
#chains in the Genus database with same CATH homology
 4EOJ B;  2IW9 B;  1UNH D;  1XO2 A;  1H25 B;  1FVV B;  2I40 B;  5IDN B;  5LQF B;  4YOS A;  2IW6 B;  1D3U B;  1UNG D;  1PKD B;  4OR5 B;  4BCQ D;  4BCH B;  1O9K B;  4F7S B;  5IF1 B;  2C5X B;  4EOP B;  4EOR B;  1C9B A;  1OI9 B;  1VIN A;  3M03 A;  1OIU B;  5FGK B;  4BCM B;  4F7L B;  3BHT B;  5L2W B;  2UZB B;  4BCN D;  3F5X B;  1OL1 B;  5ICP B;  1F5Q B;  5I5Z B;  1H1Q B;  4EOO B;  2UZL B;  1KXU A;  3MY1 B;  3TN8 B;  4EOQ B;  1AIS B;  4I3Z B;  2PK2 A;  3G33 B;  1ZP2 A;  4ROC A;  2WEV B;  4UN0 A;  5CEI B;  2WIP B;  2V22 B;  2W99 A;  2C5N B;  2W2H A;  2IW8 B;  4CFN B;  2QDJ A;  1E9H B;  4ROE A;  1O9K A;  2WIH B;  4CRL B;  4CFU B;  2WMA B;  3TNH B;  4BCP B;  2C5V B;  1G3N C;  5EFQ B;  5ACB A;  3O0G D;  1OL2 B;  4EOM B;  1H1R B;  1OGU B;  1TFB A;  3MI9 B;  2W96 A;  1QMZ B;  2PHG A;  4Y72 B;  4BCO B;  3BLQ B;  4IMY B;  4EOL B;  1VOL A;  4CFV B;  4CFW B;  1JKW A;  4BCQ B;  4CXA B;  1H28 B;  4BCM D;  4F6W B;  4F7N B;  2F2C A;  3MIA B;  3MY5 B;  4F70 B;  4EC9 B;  4EOK B;  4CFX B;  1H26 B;  1AD6 A;  1OKV B;  5HNB B;  4BCF B;  4EC8 B;  4YC3 B;  4EOS B;  3DDP B;  2W9F A;  2PK9 B;  2B9R A;  1H24 B;  4BCJ B;  1URC B;  1JST B;  3EJ1 B;  2UZE B;  2C4G B;  4NST B;  4EOI B;  4ELJ A;  1OKW B;  4F7J B;  2CCH B;  3EOC B;  3DOG B;  5HBH B;  3H4C A;  5HVY B;  4F6S B;  2WXV B;  4CFU D;  4YOZ A;  4CFM B;  2BKZ B;  1GUX B;  2WFY B;  1W98 B;  2WHB B;  1P5E B;  2EUF A;  1VYW B;  2WPA B;  4TTH A;  5HQ0 B;  4II5 B;  4G6L B;  1JOW A;  1GY3 B;  5LMK B;  4EON B;  5BNJ B;  1BU2 A;  2WMB B;  1H27 B;  2CCI B;  1FIN B;  4BCN B;  3LQ5 B;  3POM A;  3TNI B;  3BHU B;  4BCK B;  2JGZ B;  2W9Z A;  3QHW B;  4BCI B;  4ELL A;  5IDP B;  4YOO A;  2I53 A;  1JSU B;  2CJM B;  2BPM B;  3QHR B;  2C6T B;  1N4M A;  2UUE B;  3EID B;  4OGR B;  3BLR B;  5HBE B;  1OIY B;  2R7G A;  3DDQ B;  1H1P B;  1H4L D;  1GUX A;  1UNL D;  3RGF B;  3BHV B;  2G9X B;  3TNW B;  3BLH B;  4KRD B;  2PMI B;  4F6U B;  1GH6 B;  2C5O B;  4ROD A;  2UZD B;  5HBJ B;  4BCG B;  5CYI B;  2IVX A;  4FX3 B;  1H1S B;  2X1N B;  4KRC B;  3K7A M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...