1H27B

Cdk2/cyclina in complex with an 11-residue recruitment peptide from p27
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Specificity Determinants of Recruitment Peptides Bound to Phospho-Cdk2/Cyclin A
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h27B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h27B02
3EJ1B 4CFMB 4EOKB 1VINA 4YOOA 4CFVB 1TFBA 1E9HB 5IDNB 4BCQD 5I5ZB 2CCHB 2W9FA 4EOMB 1JSUB 2JGZB 4EC8B 4RODA 1H28B 4BCMB 2W99A 3TN8B 1OI9B 4KRCB 2CJMB 4YC3B 3BHVB 4KRDB 3DDPB 1H1SB 2WIPB 3EIDB 1H1QB 2UZLB 1VYWB 1H25B 3TNHB 4CXAB 4F7SB 5HBEB 2WMAB 3BLRB 1XO2A 5HBJB 1JKWA 4BCPB 1JSTB 2PK9B 2C4GB 1KXUA 4EC9B 3DOGB 3F5XB 4BCND 2WEVB 3BHTB 4FX3B 2IW8B 2UZDB 3TNIB 4CFXB 4TTHA 2V22B 3MY1B 5HQ0B 4F7NB 3H4CA 1H24B 1QMZB 2WPAB 5CYIB 1OGUB 4EOOB 4CFUD 5LQFB 2I53A 3G33B 1OL2B 1UNLD 1N4MA 4ROCA 4Y72B 1GUXA 3MY5B 2IVXA 5EFQB 5BNJB 1FVVB 2F2CA 3O0GD 1GH6B 4CRLB 2BKZB 2X1NB 3K7AM 2G9XB 4BCQB 5LMKB 1VOLA 1G3NC 2C5XB 2W96A 4EOQB 4F70B 4F7LB 2WFYB 4OR5B 3M03A 4OGRB 2QDJA 4G6LB 1D3UB 2UZBB 2IW6B 2WIHB 3RGFB 5L2WB 4EOLB 1GY3B 1PKDB 2CCIB 3DDQB 1P5EB 1W98B 2BPMB 4EOPB 1OKVB 4ELLA 1C9BA 3MI9B 4YOZA 4EOSB 1F5QB 1H1RB 1O9KB 1H1PB 1ZP2A 3MIAB 1H26B 3BHUB 4EOIB 4I3ZB 4F6UB 2IW9B 4NSTB 2PK2A 5HNBB 2B9RA 4BCNB 1UNGD 1H27B 3BLQB 5IDPB 3BLHB 5IF1B 2C5NB 1AISB 4BCJB 4BCIB 5ICPB 4F7JB 2C5OB 4YOSA 2C5VB 1URCB 2WHBB 4BCMD 4IMYB 4CFUB 4BCFB 5FGKB 4EORB 4F6SB 1BU2A 2PMIB 4CFNB 4BCOB 2PHGA 2WMBB 4ELJA 1O9KA 4CFWB 3EOCB 2UUEB 4F6WB 1UNHD 4ROEA 2EUFA 1AD6A 1OL1B 2W9ZA 1OKWB 4II5B 5CEIB 3LQ5B 1OIYB 2C6TB 4UN0A 2WXVB 4BCGB 4EOJB 1OIUB 3QHWB 4BCKB 1FINB 3TNWB 1GUXB 4BCHB 3POMA 5ACBA 5HBHB 3QHRB 2UZEB 2W2HA 2R7GA 4EONB 1H4LD 2I40B 1JOWA 5HVYB
chains in the Genus database with same CATH superfamily
2DD4B 1VINA 1TFBA 1UGSB 5IDNB 2W9FA 2JGZB 4EC8B 2ZPBB 3HZJA 3TNHB 4CXAB 4F7SB 3BLRB 2WJ9A 3DL1A 1XO2A 1JSTB 1UGPB 2DD5B 1KXUA 3F5XB 4BCND 4HLQA 4FX3B 2IW8B 3TNIB 4CFXB 4TTHA 4MIMA 3MY1B 5HQ0B 4ROCA 4Y72B 1GUXA 3MY5B 2IVXA 2F2CA 3A8HB 5LMKB 4BCQB 4JX5A 1G3NC 2W96A 2QGSA 4OGRB 1GY3B 1PKDB 1P5EB 1C9BA 4MFEA 1ZP2A 4F6UB 2PK2A 1H27B 3BLQB 2C5NB 1AISB 4BCIB 4YOSA 4AKGA 2C5VB 4CFUB 3QZ9B 4CFNB 2ZPEB 4II5B 3A8MB 3LQ5B 1OIYB 4BY7X 2WXVB 3BG5A 2CZ0B 3POMA 5ACBA 5HBHB 3QHRB 2UZEB 2W2HA 2R7GA 1H4LD 1JOWA 5HVYB 3EJ1B 4CFMB 4YOOA 3X25B 4CFVB 1E9HB 4FM4B 4BCQD 2CCHB 1V29B 4RODA 2W99A 3TN8B 2CJMB 5DQVA 4KRDB 1H1QB 3KHIA 5HBEB 3HBLA 3NDQA 4BCPB 3VYHB 2PK9B 4OB0B 4AKHA 4M6VA 1QLBA 2UZDB 2ZPHB 2WPAB 5CYIB 1OGUB 4CFUD 2I53A 3G33B 1OL2B 1UNLD 2LW4A 4JX4A 2D0QB 3QYHB 3HB9A 1FVVB 3O0GD 2C5XB 4EOQB 4F7LB 3VKGA 4G6LB 4ZGDB 2UZBB 2WIHB 4EOLB 3DTOA 4HNTA 3A8LB 3GTMS 2BS3A 4ELLA 2IN3A 5IHYA 3MI9B 4EOSB 1UGQB 3MIAB 5HNBB 2B9RA 3TW7A 4HNVA 2WHBB 3QYEA 2WMBB 4BBSM 2UUEB 4ROEA 1AD6A 2CYZB 3X28B 5CEIB 4UN0A 1UGRB 2BS4A 4BCKB 1FINB 4HNUA 1ENWA 2ZPGB 5I5ZB 1JSUB 3WVEB 4BCMB 1OI9B 4KRCB 3BHVB 3DDPB 1H1SB 2WIPB 2UZLB 1VYWB 1H25B 3B57A 2CZ1B 4BXXX 2QF7A 2WMAB 3A8GB 1JKWA 2C4GB 4EC9B 3DOGB 2WEVB 3BHTB 4OB1B 2ZCFB 2V22B 2QDYB 4LOCA 4F7NB 3H4CA 4EOOB 5LQFB 1N4MA 5EFQB 1GH6B 4CRLB 2BKZB 2X1NB 1VOLA 2QFZA 4F70B 3HHTB 3M03A 1D3UB 5L2WB 2CCIB 3DDQB 2BPMB 4EOPB 1OKVB 3A8OB 4YOZA 1F5QB 1O9KB 3PO3S 1H1PB 4ZGEB 2DMEA 4QSHA 4NSTB 5IDPB 3BLHB 3X24B 4BCJB 4BY1X 2C5OB 3BG9A 4BCMD 3DJBA 2ZZDB 4EORB 2DXBB 1BU2A 2PHGA 1O9KA 3EOCB 2EUFA 2G77A 2W9ZA 1OKWB 4EOJB 1TD6A 1OIUB 3QYBA 3TW6A 3QHWB 1GUXB 4BCHB 4HL4A 3QWLA 4EONB 4Z6YA 1AHJB 4EOKB 2AHJB 3HO8A 4EOMB 1H28B 4YC3B 1E7PA 3EIDB 2PJQA 5HBJB 2KMGA 2ZPIB 3X20B 1H24B 1QMZB 2KR6A 4ZGJB 2QQ8A 5BNJB 5DQWA 4AI6A 3X26B 3VYGB 3QXEB 3K7AM 2G9XB 2CZ6B 3QZ5B 1IREB 2WFYB 4OR5B 2DXCB 2QDJA 4OB2B 2IW6B 3RGFB 3WVDB 1W98B 4JX6A 4EOIB 1H1RB 1H26B 3BHUB 4I3ZB 3QYGB 2IW9B 3VKHA 4OB3B 4BCNB 1UNGD 5IF1B 1FKMA 5ICPB 2ZPFB 4F7JB 1URCB 4IMYB 4BCFB 5FGKB 4F6SB 3BG3A 2PMIB 2DPPB 4BCOB 4ELJA 4CFWB 4F6WB 1UNHD 4NC6A 1OL1B 2C6TB 2CZ7B 4BCGB 3TNWB 4BBRM 4MFDA 2I40B 5EJCA 2BS2A 4AKIA
chains in the Genus database with same CATH topology
3EJ1B 4CFMB 4EOKB 1VINA 4YOOA 4CFVB 1TFBA 1E9HB 5IDNB 4BCQD 5I5ZB 2CCHB 2W9FA 4EOMB 1JSUB 2JGZB 4EC8B 4RODA 1H28B 4BCMB 2W99A 3TN8B 1OI9B 4KRCB 2CJMB 4YC3B 3BHVB 4KRDB 3DDPB 1H1SB 2WIPB 3EIDB 1H1QB 2UZLB 1VYWB 1H25B 3TNHB 4CXAB 4F7SB 5HBEB 2WMAB 3BLRB 1XO2A 5HBJB 1JKWA 4BCPB 1JSTB 2PK9B 2C4GB 1KXUA 4EC9B 3DOGB 3F5XB 4BCND 2WEVB 3BHTB 4FX3B 2IW8B 2UZDB 3TNIB 4CFXB 4TTHA 2V22B 3MY1B 5HQ0B 4F7NB 3H4CA 1H24B 1QMZB 2WPAB 5CYIB 1OGUB 4EOOB 4CFUD 5LQFB 2I53A 3G33B 1OL2B 1UNLD 1N4MA 4ROCA 4Y72B 1GUXA 3MY5B 2IVXA 5EFQB 5BNJB 1FVVB 2F2CA 3O0GD 1GH6B 4CRLB 2BKZB 2X1NB 3K7AM 2G9XB 4BCQB 5LMKB 1VOLA 1G3NC 2C5XB 2W96A 4EOQB 4F70B 4F7LB 2WFYB 4OR5B 3M03A 4OGRB 2QDJA 4G6LB 1D3UB 2UZBB 2IW6B 2WIHB 3RGFB 5L2WB 4EOLB 1GY3B 1PKDB 2CCIB 3DDQB 1P5EB 1W98B 2BPMB 4EOPB 1OKVB 4ELLA 1C9BA 3MI9B 4YOZA 4EOSB 1F5QB 1H1RB 1O9KB 1H1PB 1ZP2A 3MIAB 1H26B 3BHUB 4EOIB 4I3ZB 4F6UB 2IW9B 4NSTB 2PK2A 5HNBB 2B9RA 4BCNB 1UNGD 1H27B 3BLQB 5IDPB 3BLHB 5IF1B 2C5NB 1AISB 4BCJB 4BCIB 5ICPB 4F7JB 2C5OB 4YOSA 2C5VB 1URCB 2WHBB 4BCMD 4IMYB 4CFUB 4BCFB 5FGKB 4EORB 4F6SB 1BU2A 2PMIB 4CFNB 4BCOB 2PHGA 2WMBB 4ELJA 1O9KA 4CFWB 3EOCB 2UUEB 4F6WB 1UNHD 4ROEA 2EUFA 1AD6A 1OL1B 2W9ZA 1OKWB 4II5B 5CEIB 3LQ5B 1OIYB 2C6TB 4UN0A 2WXVB 4BCGB 4EOJB 1OIUB 3QHWB 4BCKB 1FINB 3TNWB 1GUXB 4BCHB 3POMA 5ACBA 5HBHB 3QHRB 2UZEB 2W2HA 2R7GA 4EONB 1H4LD 2I40B 1JOWA 5HVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJ1 B;  4CFM B;  4EOK B;  1VIN A;  4YOO A;  4CFV B;  1TFB A;  1E9H B;  5IDN B;  4BCQ D;  5I5Z B;  2CCH B;  2W9F A;  4EOM B;  1JSU B;  2JGZ B;  4EC8 B;  4ROD A;  1H28 B;  4BCM B;  2W99 A;  3TN8 B;  1OI9 B;  4KRC B;  2CJM B;  4YC3 B;  3BHV B;  4KRD B;  3DDP B;  1H1S B;  2WIP B;  3EID B;  1H1Q B;  2UZL B;  1VYW B;  1H25 B;  3TNH B;  4CXA B;  4F7S B;  5HBE B;  2WMA B;  3BLR B;  1XO2 A;  5HBJ B;  1JKW A;  4BCP B;  1JST B;  2PK9 B;  2C4G B;  1KXU A;  4EC9 B;  3DOG B;  3F5X B;  4BCN D;  2WEV B;  3BHT B;  4FX3 B;  2IW8 B;  2UZD B;  3TNI B;  4CFX B;  4TTH A;  2V22 B;  3MY1 B;  5HQ0 B;  4F7N B;  3H4C A;  1H24 B;  1QMZ B;  2WPA B;  5CYI B;  1OGU B;  4EOO B;  4CFU D;  5LQF B;  2I53 A;  3G33 B;  1OL2 B;  1UNL D;  1N4M A;  4ROC A;  4Y72 B;  1GUX A;  3MY5 B;  2IVX A;  5EFQ B;  5BNJ B;  1FVV B;  2F2C A;  3O0G D;  1GH6 B;  4CRL B;  2BKZ B;  2X1N B;  3K7A M;  2G9X B;  4BCQ B;  5LMK B;  1VOL A;  1G3N C;  2C5X B;  2W96 A;  4EOQ B;  4F70 B;  4F7L B;  2WFY B;  4OR5 B;  3M03 A;  4OGR B;  2QDJ A;  4G6L B;  1D3U B;  2UZB B;  2IW6 B;  2WIH B;  3RGF B;  5L2W B;  4EOL B;  1GY3 B;  1PKD B;  2CCI B;  3DDQ B;  1P5E B;  1W98 B;  2BPM B;  4EOP B;  1OKV B;  4ELL A;  1C9B A;  3MI9 B;  4YOZ A;  4EOS B;  1F5Q B;  1H1R B;  1O9K B;  1H1P B;  1ZP2 A;  3MIA B;  1H26 B;  3BHU B;  4EOI B;  4I3Z B;  4F6U B;  2IW9 B;  4NST B;  2PK2 A;  5HNB B;  2B9R A;  4BCN B;  1UNG D;  1H27 B;  3BLQ B;  5IDP B;  3BLH B;  5IF1 B;  2C5N B;  1AIS B;  4BCJ B;  4BCI B;  5ICP B;  4F7J B;  2C5O B;  4YOS A;  2C5V B;  1URC B;  2WHB B;  4BCM D;  4IMY B;  4CFU B;  4BCF B;  5FGK B;  4EOR B;  4F6S B;  1BU2 A;  2PMI B;  4CFN B;  4BCO B;  2PHG A;  2WMB B;  4ELJ A;  1O9K A;  4CFW B;  3EOC B;  2UUE B;  4F6W B;  1UNH D;  4ROE A;  2EUF A;  1AD6 A;  1OL1 B;  2W9Z A;  1OKW B;  4II5 B;  5CEI B;  3LQ5 B;  1OIY B;  2C6T B;  4UN0 A;  2WXV B;  4BCG B;  4EOJ B;  1OIU B;  3QHW B;  4BCK B;  1FIN B;  3TNW B;  1GUX B;  4BCH B;  3POM A;  5ACB A;  5HBH B;  3QHR B;  2UZE B;  2W2H A;  2R7G A;  4EON B;  1H4L D;  2I40 B;  1JOW A;  5HVY B; 
#chains in the Genus database with same CATH topology
 2DD4 B;  1VIN A;  1TFB A;  1UGS B;  5IDN B;  2W9F A;  2JGZ B;  4EC8 B;  2ZPB B;  3HZJ A;  3TNH B;  4CXA B;  4F7S B;  3BLR B;  2WJ9 A;  3DL1 A;  1XO2 A;  1JST B;  1UGP B;  2DD5 B;  1KXU A;  3F5X B;  4BCN D;  4HLQ A;  4FX3 B;  2IW8 B;  3TNI B;  4CFX B;  4TTH A;  4MIM A;  3MY1 B;  5HQ0 B;  4ROC A;  4Y72 B;  1GUX A;  3MY5 B;  2IVX A;  2F2C A;  3A8H B;  5LMK B;  4BCQ B;  4JX5 A;  1G3N C;  2W96 A;  2QGS A;  4OGR B;  1GY3 B;  1PKD B;  1P5E B;  1C9B A;  4MFE A;  1ZP2 A;  4F6U B;  2PK2 A;  1H27 B;  3BLQ B;  2C5N B;  1AIS B;  4BCI B;  4YOS A;  4AKG A;  2C5V B;  4CFU B;  3QZ9 B;  4CFN B;  2ZPE B;  4II5 B;  3A8M B;  3LQ5 B;  1OIY B;  4BY7 X;  2WXV B;  3BG5 A;  2CZ0 B;  3POM A;  5ACB A;  5HBH B;  3QHR B;  2UZE B;  2W2H A;  2R7G A;  1H4L D;  1JOW A;  5HVY B;  3EJ1 B;  4CFM B;  4YOO A;  3X25 B;  4CFV B;  1E9H B;  4FM4 B;  4BCQ D;  2CCH B;  1V29 B;  4ROD A;  2W99 A;  3TN8 B;  2CJM B;  5DQV A;  4KRD B;  1H1Q B;  3KHI A;  5HBE B;  3HBL A;  3NDQ A;  4BCP B;  3VYH B;  2PK9 B;  4OB0 B;  4AKH A;  4M6V A;  1QLB A;  2UZD B;  2ZPH B;  2WPA B;  5CYI B;  1OGU B;  4CFU D;  2I53 A;  3G33 B;  1OL2 B;  1UNL D;  2LW4 A;  4JX4 A;  2D0Q B;  3QYH B;  3HB9 A;  1FVV B;  3O0G D;  2C5X B;  4EOQ B;  4F7L B;  3VKG A;  4G6L B;  4ZGD B;  2UZB B;  2WIH B;  4EOL B;  3DTO A;  4HNT A;  3A8L B;  3GTM S;  2BS3 A;  4ELL A;  2IN3 A;  5IHY A;  3MI9 B;  4EOS B;  1UGQ B;  3MIA B;  5HNB B;  2B9R A;  3TW7 A;  4HNV A;  2WHB B;  3QYE A;  2WMB B;  4BBS M;  2UUE B;  4ROE A;  1AD6 A;  2CYZ B;  3X28 B;  5CEI B;  4UN0 A;  1UGR B;  2BS4 A;  4BCK B;  1FIN B;  4HNU A;  1ENW A;  2ZPG B;  5I5Z B;  1JSU B;  3WVE B;  4BCM B;  1OI9 B;  4KRC B;  3BHV B;  3DDP B;  1H1S B;  2WIP B;  2UZL B;  1VYW B;  1H25 B;  3B57 A;  2CZ1 B;  4BXX X;  2QF7 A;  2WMA B;  3A8G B;  1JKW A;  2C4G B;  4EC9 B;  3DOG B;  2WEV B;  3BHT B;  4OB1 B;  2ZCF B;  2V22 B;  2QDY B;  4LOC A;  4F7N B;  3H4C A;  4EOO B;  5LQF B;  1N4M A;  5EFQ B;  1GH6 B;  4CRL B;  2BKZ B;  2X1N B;  1VOL A;  2QFZ A;  4F70 B;  3HHT B;  3M03 A;  1D3U B;  5L2W B;  2CCI B;  3DDQ B;  2BPM B;  4EOP B;  1OKV B;  3A8O B;  4YOZ A;  1F5Q B;  1O9K B;  3PO3 S;  1H1P B;  4ZGE B;  2DME A;  4QSH A;  4NST B;  5IDP B;  3BLH B;  3X24 B;  4BCJ B;  4BY1 X;  2C5O B;  3BG9 A;  4BCM D;  3DJB A;  2ZZD B;  4EOR B;  2DXB B;  1BU2 A;  2PHG A;  1O9K A;  3EOC B;  2EUF A;  2G77 A;  2W9Z A;  1OKW B;  4EOJ B;  1TD6 A;  1OIU B;  3QYB A;  3TW6 A;  3QHW B;  1GUX B;  4BCH B;  4HL4 A;  3QWL A;  4EON B;  4Z6Y A;  1AHJ B;  4EOK B;  2AHJ B;  3HO8 A;  4EOM B;  1H28 B;  4YC3 B;  1E7P A;  3EID B;  2PJQ A;  5HBJ B;  2KMG A;  2ZPI B;  3X20 B;  1H24 B;  1QMZ B;  2KR6 A;  4ZGJ B;  2QQ8 A;  5BNJ B;  5DQW A;  4AI6 A;  3X26 B;  3VYG B;  3QXE B;  3K7A M;  2G9X B;  2CZ6 B;  3QZ5 B;  1IRE B;  2WFY B;  4OR5 B;  2DXC B;  2QDJ A;  4OB2 B;  2IW6 B;  3RGF B;  3WVD B;  1W98 B;  4JX6 A;  4EOI B;  1H1R B;  1H26 B;  3BHU B;  4I3Z B;  3QYG B;  2IW9 B;  3VKH A;  4OB3 B;  4BCN B;  1UNG D;  5IF1 B;  1FKM A;  5ICP B;  2ZPF B;  4F7J B;  1URC B;  4IMY B;  4BCF B;  5FGK B;  4F6S B;  3BG3 A;  2PMI B;  2DPP B;  4BCO B;  4ELJ A;  4CFW B;  4F6W B;  1UNH D;  4NC6 A;  1OL1 B;  2C6T B;  2CZ7 B;  4BCG B;  3TNW B;  4BBR M;  4MFD A;  2I40 B;  5EJC A;  2BS2 A;  4AKI A; 
#chains in the Genus database with same CATH homology
 3EJ1 B;  4CFM B;  4EOK B;  1VIN A;  4YOO A;  4CFV B;  1TFB A;  1E9H B;  5IDN B;  4BCQ D;  5I5Z B;  2CCH B;  2W9F A;  4EOM B;  1JSU B;  2JGZ B;  4EC8 B;  4ROD A;  1H28 B;  4BCM B;  2W99 A;  3TN8 B;  1OI9 B;  4KRC B;  2CJM B;  4YC3 B;  3BHV B;  4KRD B;  3DDP B;  1H1S B;  2WIP B;  3EID B;  1H1Q B;  2UZL B;  1VYW B;  1H25 B;  3TNH B;  4CXA B;  4F7S B;  5HBE B;  2WMA B;  3BLR B;  1XO2 A;  5HBJ B;  1JKW A;  4BCP B;  1JST B;  2PK9 B;  2C4G B;  1KXU A;  4EC9 B;  3DOG B;  3F5X B;  4BCN D;  2WEV B;  3BHT B;  4FX3 B;  2IW8 B;  2UZD B;  3TNI B;  4CFX B;  4TTH A;  2V22 B;  3MY1 B;  5HQ0 B;  4F7N B;  3H4C A;  1H24 B;  1QMZ B;  2WPA B;  5CYI B;  1OGU B;  4EOO B;  4CFU D;  5LQF B;  2I53 A;  3G33 B;  1OL2 B;  1UNL D;  1N4M A;  4ROC A;  4Y72 B;  1GUX A;  3MY5 B;  2IVX A;  5EFQ B;  5BNJ B;  1FVV B;  2F2C A;  3O0G D;  1GH6 B;  4CRL B;  2BKZ B;  2X1N B;  3K7A M;  2G9X B;  4BCQ B;  5LMK B;  1VOL A;  1G3N C;  2C5X B;  2W96 A;  4EOQ B;  4F70 B;  4F7L B;  2WFY B;  4OR5 B;  3M03 A;  4OGR B;  2QDJ A;  4G6L B;  1D3U B;  2UZB B;  2IW6 B;  2WIH B;  3RGF B;  5L2W B;  4EOL B;  1GY3 B;  1PKD B;  2CCI B;  3DDQ B;  1P5E B;  1W98 B;  2BPM B;  4EOP B;  1OKV B;  4ELL A;  1C9B A;  3MI9 B;  4YOZ A;  4EOS B;  1F5Q B;  1H1R B;  1O9K B;  1H1P B;  1ZP2 A;  3MIA B;  1H26 B;  3BHU B;  4EOI B;  4I3Z B;  4F6U B;  2IW9 B;  4NST B;  2PK2 A;  5HNB B;  2B9R A;  4BCN B;  1UNG D;  1H27 B;  3BLQ B;  5IDP B;  3BLH B;  5IF1 B;  2C5N B;  1AIS B;  4BCJ B;  4BCI B;  5ICP B;  4F7J B;  2C5O B;  4YOS A;  2C5V B;  1URC B;  2WHB B;  4BCM D;  4IMY B;  4CFU B;  4BCF B;  5FGK B;  4EOR B;  4F6S B;  1BU2 A;  2PMI B;  4CFN B;  4BCO B;  2PHG A;  2WMB B;  4ELJ A;  1O9K A;  4CFW B;  3EOC B;  2UUE B;  4F6W B;  1UNH D;  4ROE A;  2EUF A;  1AD6 A;  1OL1 B;  2W9Z A;  1OKW B;  4II5 B;  5CEI B;  3LQ5 B;  1OIY B;  2C6T B;  4UN0 A;  2WXV B;  4BCG B;  4EOJ B;  1OIU B;  3QHW B;  4BCK B;  1FIN B;  3TNW B;  1GUX B;  4BCH B;  3POM A;  5ACB A;  5HBH B;  3QHR B;  2UZE B;  2W2H A;  2R7G A;  4EON B;  1H4L D;  2I40 B;  1JOW A;  5HVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...