3HZJA

Crystal structure of the rabgap domain of the rabgap1l protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
YSWGELLGKWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDRYRILITKDSAQESVITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYDYGLRDLYRNNFEDLHCKFYQLERLMQEQLPDLHSHFSDLNLEAHMYASQWFLTLFTAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIKVPTKKLKKYEKEYQTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RabGAP domain of the RABGAP1L protein
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords RAB GTPase-activating protein 1-like
total genus 97
structure length 287
sequence length 287
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3hzjA02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 3hzjA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hzjA03
4HLQA 2QQ8A 2G77A 1FKMA 3QWLA 3HZJA 4NC6A 4Z6YA 3QYEA 5EJCA 2QFZA 4P17A 3QYBA 4HL4A
chains in the Genus database with same CATH superfamily
2V9PA 2CV0A 3F8BA 3ASNH 3FXOA 1OKRA 3HOVJ 4OU7A 3WU1B 3FYDA 1V55H 1D0ZA 1MZBA 3E6MA 3FBIB 3LFKA 1KZHA 4EORB 1B59A 1LNWA 2DA3A 3W6JB 3V7SA 1XWIA 4IJAA 1EV7A 3IG5A 1QRYA 3H9QA 3QAHA 4B7GA 2MW8A 2Y0SA 2K9NA 4U0WA 3LQQA 1BI1A 4EOLB 3QAUA 1V5FA 4YG2F 4MIMA 3GTKJ 3OYBA 2VT3A 5DD8A 1X1PA 4ETSA 2R93J 4R7GA 4R1HA 1TQMA 2JVGA 2HTJA 1R5HA 4I01A 5H2FC 1GUXA 1H1SB 1D1AA 1S72I 1W7PB 4HF0A 4BE2A 3SAWA 4EATA 3X25B 1ZARA 4IO9F 2A07F 1F4IA 4HNTA 4BY7J 4EJOA 2A3SA 2H09A 2MG4A 4OB0B 1LFBA 1N25A 1H1RB 3ZPLA 1IBKM 1VINA 3S2DJ 4DV3M 2Y9YA 3BOSA 3H1CA 4XORA 3RQIA 3GX4X 3I4PA 3O6BB 1P4XA 3E6DA 3HU2A 2O03A 3F8CA 4A5MA 3BG6A 1Q3BA 4L8RC 2R4JA 3WTZA 3F9KA 5IYDJ 1IUYA 4LFUA 4Y52J 3J80Z 1E0EA 1TNTA 4M3BA 1DGGA 1T38A 2D45A 1CQTA 3JAMS 2TDXA 3QRFF 4Y7NJ 2GA2A 1KU3A 1UAAA 4X64M 1VQOI 1S3SA 4BCOB 1TH4A 5FKNA 3BT9A 3PNTA 4ESFA 2KZSA 3KZYA 5LEJA 3T1HM 4TTHA 3K70D 4EOIB 1TTEA 3X20B 5HBEB 1W0UA 2F4MB 2VL8A 2HYFA 4UUTA 1I1SA 4IRHA 3LA2A 2PMUA 3HRTA 2GQQA 3VEPA 1YO5C 1D8JA 3E97A 4BU2A 1K78A 2IAIA 1IN8A 4L78A 4KIFA 5GAEJ 5IOZA 1Z5CA 2DAMA 3WGHA 2GA1A 2QEXI 1QAMA 5EXXA 3SBJA 1QVUA 2WSFF 2HAKA 1Z67A 5A2QZ 1WSUA 5E8GA 2R3SA 2K3PA 4EOJB 1ZQ9A 1E9HB 4FT8A 3FBNB 2CYYA 1IN5A 3DQVC 1UB9A 2KHMA 2A5YB 5ICGA 2UZDB 3IH3A 2OBPA 2HOEA 3S17J 3K4BA 4KNYA 2HKOA 5F0HA 3O2PE 1ZRFA 2XSZA 5KVRA 3LAPA 1Z77A 1MIJA 3IWZA 2OPTA 1D5VA 2M7BA 3KYCB 3BP8A 4HZFA 2K02A 3PJRA 1ETOA 4N4NB 1FSHA 2DA1A 4LFCM 4JK1X 1TWAJ 4H0EA 2HOAA 4E7KA 2DK8A 2DXCB 3J81K 5EJCA 3HYIA 3VB2A 3ZQQA 1RUNA 4LJAA 3HXLA 2OF7A 3TWKA 2GZWA 1WCMJ 4HLYA 3A98B 3M8FA 4L4UA 2VBYA 1K3XA 2NNYA 3W0FA 2LNBA 2BS4A 4HDUA 4XR6A 2LG4A 3OYDA 3BWGA 2CHQA 3GYHX 2PMHA 2RGOA 2ZSHB 4KLNA 4ESJA 3KOZE 3KX2A 3RI4A 1K4SA 1L1TA 2ETHA 2ZCWA 2C5XB 3K9PA 2QGUA 2ZXIA 2XAQA 5F27A 3LQ5B 1JR3D 2VOPA 5K5QA 2P5VA 1H8AC 4BXXX 3OSGA 4BE0A 5IDPB 4XLAA 2ESHA 3I51A 3IECA 2XASA 4L5JA 3TQSA 4PK4A 5LD2C 4CJ6A 4P1WA 2IT0A 4A3BJ 1NV9A 2WXVB 3FRIA 2LBFB 1H1QB 5JI3E 3UMMA 4V2GA 4KMFA 4IVNA 2EZLA 2KNZA 2KRUA 3LW5F 1PJIA 2FUG2 4X65M 2HOSA 4GO1A 3IHUA 2MABA 4EJTA 2RAEA 2E5LM 3OYEA 4S12A 2FF4A 2DT5A 4OAYA 4HW0A 2CUJA 4LJ4A 1AHDP 1ON1A 2CZ0B 4X62M 4EQQA 3OYFA 4ANJA 4BBSM 5JHUA 1UNHD 3VLFB 4GITA 2DOAA 4CHUA 4EOPB 3SC3A 3F92A 3DPTA 5L3GA 2LVQD 1NV8A 1EH8A 1FEXA 4A3LJ 5DQVA 1YIOA 2DDAA 3CCRI 2JUJA 2KA6B 4BBRJ 4LIVA 1ITYA 3HHXA 3GLHA 2LFBA 4NDLA 3IH2A 5AIPA 2WZJA 3BTCA 4X0GA 2FQ4A 2R7VA 2JUGA 3FYCA 4G94A 3TBIA 4AM3A 2FNPA 1XC8A 3A42A 4JN6A 5LMUM 2BS2A 4IMYB 3BHTB 5CYIB 1T08B 1NVMA 4YFNF 1NNUC 2WHBB 4XLEA 4ABZA 4M6XA 2CSOA 1VQ8I 5IREB 3O3KA 2R7XA 3KPHA 5K7FA 4AG5A 3IH4A 3L00A 1R00A 1J59A 1IG7A 2HXIA 2ME0A 3KP1E 3FUWA 1BJZA 3MWMA 2OD5A 4RB1A 4CCLA 1BJAA 4OX9M 2CHVA 4BXXJ 4OVZA 1KU9A 2VLAA 3VDUA 5E26A 4L9NA 4UVAA 4LG0B 4ZYGA 4NRWA 2OQ4A 4BJ6C 4WWCA 2EWNA 4LCBA 4IHSA 2DPDA 2OU2A 4HX7A 2BXZA 3OMYA 2FOKA 4G9YA 3CLOA 1QLBA 2QFZA 1ZMUA 4QHSA 4ZYEA 4L15A 4OINF 4EM2A 5L3EA 3LQRA 4KJZA 4KIGA 4XK4A 1HQYE 3QYFA 1FZPB 4G4OA 4RNAA 4LF9M 1JR3A 4MGKE 2CMPA 1DGHB 5B1AH 1MJGM 3S2HJ 3UZUA 3PM1A 2EINH 1IAWA 1OFCX 1HNXM 2OV7A 1HC8A 1X4PA 3KE2A 1UHSA 2Y0MA 3FM3A 3RCOA 2DMEA 1ZG1A 4ZH4F 4FX4A 1QA6A 4DV5M 3SYTA 2LNHC 3BR0A 2Y31A 3R60A 4D80A 1VYWB 1IN7A 4LFBM 1R1VA 3ZQ7A 2CQXA 4E7HA 4UB6C 2VDBB 3KVWA 4DOZA 3OS2A 4I3ZB 2JTVA 4Y72B 4MQ9F 3PQKA 4F70B 3BZ6A 3BCAA 2R4EA 2HVRA 1QPIA 4YEJA 4P9UA 2DMUA 1IGNA 3IKTA 3G1MA 2NXNB 2NNNA 1MSEC 3GQ3A 2WV1A 2DXBB 1DUXC 3AL0C 4NSOB 2H8RA 2HKJA 3JAMZ 3WHLA 3DEEA 4ENMA 1D0XA 2B63J 1JHHA 1GXPA 4IBCA 1ZHFA 1XMAA 4N9HA 1TFBA 4MGIE 4A2UA 1BU2A 2KR6A 3FMQA 5HBHB 2KDOA 3P5JA 4DGWB 4RAGA 1IM2A 1JTYA 1XPXA 3ZR8X 4OB1B 2W48A 2IBDA 3T8TA 3BLQB 1P7IA 2IPQX 5J4YA 1H4LD 3HTUA 2Y69H 3A02A 2JXNA 3GRYA 5KNLA 5M3MJ 4F6SB 4IBGA 1FY7A 4M3GA 5HLGA 4WX9A 3ZMVA 3FKJA 2ZO4A 2DKLA 4XK8F 3HOZJ 2DCEA 3CO6C 4EVIA 1RR8C 2K5CA 4FETA 4XRSG 5F6FA 1FTZA 1NY6A 2LY2A 4MB7A 4L0ZB 1P6RA 1X58A 4AIJA 3WVDB 3SFZA 3GXOA 1U0JA 2EFQA 3F6VA 3G3ZA 5BOXA 3L2UA 1XGSA 3EIEA 5EEGA 5FKOA 1TL8A 5IY5H 1Z1DA 4E7SA 4LJZF 3MK6A 2FQ3A 4MGRA 1DGWY 2X1NB 2X6XA 4B3SM 2DAOA 3KEOA 2IGMA 3RGFB 3DBHB 2WJ9A 2QQAA 4JV5M 1DU6A 4D82A 4IQ4A 5LEKA 3F72A 4W1UA 4PZJA 1JOWA 3HB9A 2QZ4A 3D0SA 2QCUA 5IDNB 3ZMDA 2BVLA 2BJWA 2H5XA 2DNAA 4FWGA 1JSTB 4ENJA 3W2WA 5CPRB 3BBZA 3AJIB 3KFUG 2WIHB 1XXHB 2ELJA 2E2IJ 1FKMA 3KW6A 1MNEA 3S93A 3K4JA 2COMA 3JTHA 2HDCA 4IIWA 2RGVA 4XOPA 3PSFA 4CFXB 3DWLE 3I3LA 2GQFA 2A61A 3GTMJ 4PCZA 4LG0A 2OCCH 3I01M 2VN2A 5TISC 3L7WA 1TWCJ 2DI0A 2UXBM 3X2QH 5C4XJ 4ENNA 4BBAA 2Y75A 4QPOA 3GLIA 4RGXA 2D1HA 5E3MA 3HSRA 3HOYJ 2M7AA 1QVTA 1S7EA 3SHGB 1HDPA 3DF8A 2KP6A 2V1UA 2VOOA 3U6CA 5FLXK 3GCMA 4D9JA 1UGRB 2NS0A 2M9HA 4S04A 3FUVA 4CFUD 3V7RA 4X66M 4UB8C 3GFIA 1MMNA 2AQFA 3U6OA 4QWQA 4OIPF 1VQ6I 2E35A 1OYYA 4A3KJ 5A2QS 3HU1A 1MJAA 1RKTA 2R65A 2X85A 1G71A 4NQWB 2XSJC 3KP5A 1DQUA 2R7GA 3A8OB 3DP7A 2BBYA 1LVAA 4M3EA 4DR7M 5GADJ 5AONA 1H0MA 3KLNA 4Q4ZF 1IRZA 5CJ9A 2EKKA 2I5UA 5FKLA 1DP3A 1PJTA 4NXNM 4RA2A 5ERIA 1LUJB 3WHCA 1C7YA 4XKWA 4RB2C 4CXAB 1NG6A 4BY1J 4CH7A 2FOWA 2O25A 3KSJA 3LL7A 3GP1A 2XSDC 5E8IA 1J0RA 1LJ9A 2XKPA 4QOZC 2GOXB 2A5WA 3TO9A 2R7WA 1ETVA 2D0QB 5KPTA 4II2A 1Z5AA 5M5XJ 1Y1WJ 3QOPA 3L26A 2DVWB 2XB0X 3E4RA 4EOQB 2IRFG 5LRRA 4A6EA 3V8JA 2AO9A 2XGDA 4ZYHA 5H37D 1XMKA 1OKVB 4DBGB 2E2JJ 3KEQA 1ZMWA 4FE7A 4R71A 1DDNA 3I4MJ 1B1BA 2CV1A 3SYLA 1VF9A 3ABKH 1HA8A 1QZEA 1ODDA 2JA5J 1ZGJA 2X1DA 3ZRGA 1Z3YA 4MEXF 3U5ZA 1WIVA 2LH9A 3KXEC 1A5JA 1YUBA 3KP4A 1HDDC 1TD6A 1E3PA 1OAOC 1S29A 2DMQA 5DV5A 1OPCA 2FEZA 2H1LA 5HS9A 2Y9ZA 2M2EA 1ETWA 2YUSA 4OR5B 1WVRA 5H20A 1KXUA 2R7DA 1VFCA 4G6TB 5BPVA 3MHVC 2XZUA 3BG5A 3FM5A 3PIPF 2RKOA 2I10A 2RREA 4AIKA 1HW2A 2OA4A 4A3DJ 2JZ0A 1WH7A 3ILKA 3OWTA 1FWZA 2O7OA 4NC7A 3AAFA 3L1PA 2DHRA 1GDTA 5EZHA 3FD9A 1S6LA 2R5ZA 1QMZB 2PJRA 4CGYB 2IVMA 3L2WA 4HQMA 5B5EC 3AV0A 2DBBA 2P4WA 3BR5A 1YRNB 2QP9X 1KYWA 4MHGA 3PSIA 3MY1B 2E1MC 4IZZA 1Q02A 4Y3OA 4EGYA 5HNFA 3VK7A 4JOMA 1SEUA 1GL6A 1TNSA 2E5NA 2CV2A 1KQ0A 2JY8A 1C1KA 2ZJ2A 1BR4A 3E3VA 1W36C 4FQGA 2CFOA 4L9TA 3F8MA 2F4IA 1TBXA 3THGA 1SFUA 1J75A 4D5CA 2CQNA 3A01A 1F5QB 3ML6A 2IS1A 2L01A 3K69A 3VWBA 1ZRDA 2W4SA 1W1WE 2L3DA 4EC8B 4RODA 4Q5SF 2DPUA 2VI6A 2NVUB 2VKVA 3M3YJ 3R0JA 1XSXA 3QP5A 1QU3A 1ZV1A 3JSOA 4RGUA 4IHVA 1Z05A 2I8DA 1XSVA 2BE5F 1WWXA 2WY7Q 1VQ7I 3CCYA 1H1PB 2LTUA 3T6PA 2LYCA 3U2RA 1SAUA 2IA0A 3ESWB 2KNVA 3SHFA 1IXSA 1ZR2A 3GTLJ 4NQWA 2L5QA 3SZPA 1Z6TA 5FD5A 3LNQA 4R8HA 1E32A 1IDYA 3C3DA 1EH7A 2VQLA 5FROA 4E4HA 2F5DA 2BY0A 1TP4A 1VOLA 4PCQA 5B3SH 5EP4A 1EFUB 2V6CA 4BXFA 3NRVA 5LRSA 1ZH5A 3GW2A 2FE3A 2VQGA 1QANA 3DDQB 5J6XA 3J7YJ 3ZXSA 2E1OA 1PKDB 4LG2A 3CCLI 1Y8QB 2ZB9A 4AVZA 4GGGA 4GXOA 3AG1H 4BCJB 1Y8GA 4JI8M 3RZOJ 3PFIA 2V7FA 4YIIA 3T0YA 1W7PA 1G3SA 3JRBA 2JQ7A 3Q3SA 1I4WA 3FF5A 3IP4B 4ITVA 1O4XA 4YRVA 1I6HJ 2OO9A 2DJNA 2LKSA 4F6WB 4B3TM 2C98A 5DCFA 2WSEF 4IHTA 4BCGB 1XD7A 5KQDA 1XTAA 5D6FA 4WXHA 3LCUA 1FBSA 2A6TA 1WPKA 2E71A 2P6SA 3F6OA 1SFOJ 3ULQB 2M87A 2E1MB 1T0FA 1MX0A 1Z59A 3PUBA 3CUQB 4IBEA 3JRGA 3BR1A 3I71A 3QPLA 2VUMJ 5JHFA 3A46A 1OFHA 2R62A 2MJ5B 2LD5A 2E1CA 3HJSA 1SFKA 2LY1A 1FT9A 1S8NA 1HBXG 1N32M 3S8PA 3ROUA 3J7AY 2IA2A 3HO8A 2UZLB 3GPYA 3BPVA 3HM5A 5DD4A 1WJEA 2IW5A 4G6DA 3LMMA 1QUTA 4CA0A 3A45A 4LGMA 3NEUA 1UGPB 2E1NA 4LJ7A 3J81S 2KIQA 4EV0A 1NY5A 2CO5A 5BNJB 2CZ6B 2DU9A 3B57A 4G6LB 3LSGA 2STWA 1IXSB 1FINB 2ZTCA 5ITTA 4DR4M 2JY5A 2C6YA 5ITXE 4EJWA 2X49A 2Z8YM 4FWDA 4G7OF 2LWXA 1YRNA 1UMQA 4AG6A 1NTCA 2EA2A 1YLAA 3CCEI 3GZ6A 3QHRB 2G8LA 3QXEB 3TW6A 2MC4A 1N4MA 3FRHA 4A5NA 1IRGA 3H3ZA 4JX4A 4KT0F 2MYSA 3LVWA 3I0TA 1ZGAA 4GC5A 4DQ2A 3S1NJ 4DBRA 3OYCA 2UZEB 4LG3A 5BR8M 1OCCH 3WE2A 2F5PA 4LK1F 2O6GE 4P16A 4OB2B 3REOA 3OS0A 2IW6B 1XNRM 4CIZA 2KIUA 4Y4RA 3K70C 1VQMI 4YIFA 2E2HJ 2Z1DA 1VQ5I 1R4NB 2VXZA 2W24A 3ZMSA 4AKHA 1MMGA 3RPQA 2G7HA 2BJVA 2OQRA 1OMIA 4II3A 1YJNI 1YG2A 2JZ1A 4AI6A 1R6RA 3S14J 3ZMZA 3CJRB 3F8FA 2XFTA 3D5LA 2VODA 1STZA 3SEZA 3L2CA 3HGYA 1MBJA 2ZFUA 3SAVA 1I3AA 1AISB 1OL2B 4PJLA 2B0LA 3NWLA 2Q8KA 2J5OA 4BQQA 1VQ4I 4CCKA 3GTQJ 1XX5A 4BCIB 2XHKA 5FKKA 4NB5A 2ADUA 3ZQLA 2RVCA 1MMDA 1V4RA 3J7AO 1JHFA 1SFEA 3CUQC 3EYYA 4IBKA 5IT9S 6PAXA 2TRTA 1MMSA 4LF8M 2CQ7A 1FJLA 3U1KA 3HGIA 1U8BA 2B9RA 3J27B 4E7ZA 2KIMA 1JKPC 1JGSA 5DYGA 4XRSA 3LSPA 3BR2A 1IY2A 3B6AA 1VEGA 3OYMA 3GQ4A 4BY1X 2ZFWA 1R22A 3DEWA 3GLXA 2EUFA 2KNAA 3WHKA 3OYLA 3K2ZA 3H9JA 2LKXA 3RPUA 2PG4A 5IYCJ 3TGNA 2FXAA 4ZYDA 1OCRH 5FRMA 3CCVI 2WWYA 1B4AA 3GLHB 3FMRA 5IP7J 4CXFA 4CHTB 2FBKA 4A69C 4II5B 3EYIA 5EDNA 2E36A 3HSFA 3BROA 4KA4A 1NO1A 4HF1A 5JVGF 3CDLA 3K2AA 5E1WA 1MD0A 1X1DA 4BJ5C 4KT5C 2KDZA 1JR3E 1PP8F 2ZAMA 2M8GX 2KDLA 3FTCA 2PMIB 4G3OA 2F5EA 3AG3H 1VQNI 3SASA 1IRFA 3HRMA 3MZYA 3W0LB 1LQ1A 2BZTA 3AG4H 5ACBA 2UXCM 3OIOA 4LGYA 4M73A 1X1BA 2XPWA 1AWCA 5E3NA 3EJ1B 2WAFA 1PJSA 1WGXA 2HI3A 2PN6A 3GBGA 3RGPA 2W9ZA 4YHHM 4AD9A 3DU5A 1LFPA 5FFZA 1WXQA 4NRVA 2HZDA 5EG0B 2HVSA 3CZ6A 2BHYA 3CF6E 3OL4A 1YOVB 3SEQA 2XSZD 1XGOA 1FP2A 3I64A 4MFEA 3FHZA 5HDKA 2QDYB 1C9BA 2LBCA 2K7LA 3HEFA 5BMZA 3ISPA 2QSFX 3QPTA 1LEBA 4DV0M 1TQIA 1HSJA 4EC9B 1MGTA 2DFFA 1GLNA 1VEKA 4XICA 3C3WA 4XMYA 5J47A 4Y15A 2Y48A 3OR1C 4DIQA 1SG9A 1I94M 5KAIC 1ONVA 3W68A 2EJRA 1ZKGA 3BG7A 1M1EB 2K4BA 2P7CB 2VASA 3GZ5A 3GPXA 2XGCA 4HG2A 5DCMB 2ZPHB 1QAOA 3KOWE 4F7LB 2F48A 2V26A 1SMYF 3BR3A 4AC0A 3VPRA 3HHHA 2P0WA 2WMAB 1HT1E 2STTA 1X2MA 3KP7A 1NK2P 5F0CA 4F2LA 1R1UA 3QP6A 3LAJA 5CEIB 2HDWA 5DUIA 2HFHA 3TN8B 4UY8I 4K2EA 2ZC2A 5HNHA 4IJEA 2L9RA 4I09A 3CMYA 2DA2A 2JT1A 1OISA 1ERDA 3BJ6A 4B09A 4BY7X 4JI7M 4BDZA 3U21A 3W2AA 3DEUA 1XXHA 3WTVC 1D0KA 1YX3A 2Y0SN 3M9AA 5K7HA 3FXRA 1SXJD 1Y56A 3MKZA 4EEFG 2JRTA 3ABLH 2QLZA 3L09A 4CCNA 4XRMA 4B3MM 1IRXA 5HODA 3CJQB 3QPHA 2Y21A 1MBHA 4OMYA 4TV7A 4A93J 4FX3B 4L5EA 3S1MJ 3HRSA 4F52A 4B3RM 4PSWA 1B8IB 1R5LA 4F7JB 1FYMA 4G4NA 2R92J 1N34M 4W5WA 4JI1M 5KCMA 5L3FA 1I50J 2MC3A 5FTMA 3K4LA 3ECHA 4DR1M 2MA3A 1ZR4A 3G71I 1HQCA 3ASOH 3HKZN 3FISA 3ABUA 1WFXA 2DA6A 4GKJM 4AU7A 3DPLC 2ZXJA 3WHBA 1YTYA 5CLSA 4IOAF 2APLA 3VYTB 2YFQA 1IBLM 4D5FA 3CESA 2VONA 3MFKA 1W0TA 3HDDA 3RKQA 1CGPA 4YFXF 1HR0M 2FA5A 2R7ZJ 1NJFA 4BCKB 1A5TA 1PDNC 3S15J 4LF4M 5IPAA 4XKBA 4A3GJ 5HVYB 2ME6A 2VQCA 5EFQB 4JI6M 1JKRC 2QBYB 5D4RA 2FRHA 1HW1A 4AVPA 3HOXJ 2UUEB 1D0MA 4MGZE 3EIDB 3SXYA 1R4GA 4PDIA 2XGXA 5F04A 1B8IA 4BEHB 3A03A 4MFDA 3PVSA 2KRHA 5FLXZ 1SXJE 3JREA 2ZJPF 1FLIA 2BWBA 2AXLA 3CJTB 4NBQA 1GVJA 1VEJA 1XC5A 3CUQA 4OAZA 4U0VA 5JFRA 1K79A 1O9KB 3CDHA 4B44A 3RE8A 1PRBA 4UUSA 1VQKI 4MGHA 5L8RF 3TNWB 3UJNA 2EJSA 1YYVA 2KRFA 1V3FA 2EV0A 5DFLA 1X2NA 1WHUA 4E6KG 1J5EM 3M07A 3L2AA 4FD2A 4CYCB 4OVZB 2IA1A 4LJ6A 4PJ0C 4UXNA 1JE8A 2K9MA 4A0ZA 1BVSA 2HEOA 1N36M 1WI9A 1O3RA 4BKXA 1TLHB 2RQPA 3WU2C 3TP3A 3BJAA 2ZCFB 1CF7B 2P81A 3A0BC 3FK6A 3I56I 4ZGDB 1Y6IA 2XRNA 4DZJA 4Z6YA 3B7NA 2V6EA 3CC7I 5F64A 5EYRA 2EFNA 4RB3C 2XROA 4PGHA 4I5SA 2FBIA 2GBYA 4P96A 5M5WJ 1S3JA 2L9NA 2G5GX 3KYDB 3KDSE 1V5EA 3S3OA 5K5RA 2HXOA 1QZZA 1ETXA 3I53A 4CCOA 4IHYA 2ZPFB 3TE6A 4IPAA 2R7UA 1JI8A 1G41A 2DAKA 3H5RA 1FMWA 1JUSA 1WJCA 2K9SA 2VBWA 2EA0A 5ILSA 4EOOB 1DO0A 3U61B 1YJWI 1G3IA 4M9ZA 3HOTA 2HS5A 3S3MA 1SVOA 5D8KB 3FE3A 4MTEA 1KU7A 4RLQA 2R7QA 2K47A 3FXQA 1GXQA 1RR7A 2EPFA 2EZIA 1R71A 2C5NB 1QAQA 1XN7A 1XO2A 1P7JA 5BPDA 2YS9A 2Z5UA 1ETYA 2KT0A 3GFJA 4YELA 3ZQGA 1BIBA 1KGSA 4S05A 1Z21A 2XH9A 3BY6A 2FSWA 4M72A 4HNVA 2WY8Q 2J7OA 1WGNA 3G73A 3QWLA 4HNUA 1LE8B 4GYGA 1OCOH 4H4KC 2LVNC 4KN7X 1IZ1A 4PD2A 2XAHA 4FCWA 5LBQA 3TWLA 3GUDA 2F2EA 4HV5A 3W6KB 2G77A 3LWFA 2HYGD 2WAQN 2Z16A 4G4RA 1XGMA 3KLOA 3TDUC 1JJ6C 4BBRM 1BI0A 1PUFB 1KFVA 1R23A 4YOZA 4LITA 1K3WA 2GXBA 4I7HA 2ZJRF 3VYHB 3MMYB 3EUAA 4F3QA 1Q39A 1R1TA 2IJLA 3NARA 1Y0UA 3SZGA 1QNTA 4PJMA 4IF4A 1OGUB 2G7UA 4FTHA 3WG7H 1TW2A 2UUAM 4A12A 1NJGA 3GTPJ 4BCMD 2PQ8A 4IJFA 4C3IJ 3KETA 4IBBA 3UGJA 5DYIA 3BTJA 1VTNC 4BCQB 3SDBA 2J5PA 3ABTA 4FWHA 2W96A 3GLGB 2EZKA 3CQZJ 3CCUI 1ACIA 5BNGA 1H9GA 4RBOA 2PEXA 4XIDA 2JA2A 2RDPA 2LH0A 4BUPA 2F5VA 3HJQA 1U2WA 4B08A 5EF6A 3I04M 3CUOA 1UNLD 5FGKB 1X3WB 5FTNA 3LSJA 4QSHA 1PGYA 4NSRA 1I3QJ 3B7QA 3H3VK 3IG8A 3K1JA 3ZC7B 8CATA 3F8NA 5D5XB 1RETA 4AWXB 3G4SI 2YU9J 2KHHA 3A8GB 2A6EF 3H4MA 4WURA 1Z9CA 2ZNZA 3U1DA 3GRVA 4KRCB 2BNKA 2DWNA 1WJFA 3LSTA 1G3YA 3NAUA 3RKXA 4NXMM 1IQPA 4DR6M 2EIKH 2W7NA 1VDDA 2BKZB 3FTFA 4BCPB 1NSFA 2XPUA 1RRJA 3DV8A 5DM6F 3E5QA 1R6BX 2Q1ZB 4XONA 3SFIA 2VBXA 2ZXHA 1ZMVA 1O3SA 2CE7A 2CQKA 2BOLA 2HGCA 3B02A 4HX4A 2DOEA 2QQ8A 2KMGA 2CP8A 2W00A 4JX6A 1L3LA 2X4HA 4NUBA 2G9WA 1MNDA 3L28A 2KMUA 3P7NA 2KJBA 3VK8A 1USTA 4CO8A 1FYKA 2FU4A 3LCVB 2O0YA 3RGSA 2E7XA 1SXJC 4XNFA 1B72B 2V1DA 1BC8C 5IT9K 3I55I 4KISA 3U6SA 2F5CA 2QGSA 3RYPA 3GLHE 4WP2A 3KS8A 2DAIA 2R5YA 5IT9Z 3V76A 5CQGA 1W5TA 2E60A 3LA7A 5E6JA 1FP1D 5E3LA 1FYLA 1IUFA 1JQJC 1BOBA 2XF5A 3KP3A 1D0LA 2C5VB 1OR7C 1KU2A 4JP0A 3E6CC 4E7IA 3F5XB 2M34A 1YIJI 1CF7A 3M6AA 4LRSA 2VC1A 2W57A 4CUGA 2I40B 3BJOA 1FC3A 2R0QC 1NK3P 4ZGJB 4EONB 2EK5A 4XLHA 3I4YA 1QO0D 1YSYA 1UHMA 1N75A 2BXYA 2WBMA 4MEYF 2YPRA 1AIPC 3CCSI 4ENKA 1TW3A 2XAJA 1YW7A 3K2LA 4G8XA 3HZJA 2VKHA 3M1EA 2X6OA 2PMZA 1D3YA 1TTYA 1O7FA 2AQEA 3HIFA 2CRGA 7CATA 1MH4A 4XGIA 1EA3A 2QYOA 1T8IA 1JT0A 5M3FJ 5F08A 3DJBA 2DJIA 3JCUC 3B74A 3EUKL 5FLMJ 4IBDA 1IY1A 3ONQA 4DV4M 2HWJA 2CW8A 4BEHA 5EP1A 4ASNA 2HDDA 3TNIB 4JI2M 2LKPA 2L4MA 3PFYA 2XEPA 2RNJA 3RTRA 2A68F 4KN4X 1ENWA 1L1ZA 1VNDA 1H25B 4Q47A 1FOYA 4RDUA 4G7ZF 4NC6A 3PUFA 5D5VB 2R5YB 1KYIA 3T15A 2OJED 4I4LA 1WR1B 4A3JJ 2W1OA 5D6EA 4M0DA 3MD2A 2L6OA 1HF0A 2B7EA 1B72A 1LVKA 1O3TA 3GTGJ 3RZDJ 4CFMB 1EH6A 1OTRA 1Z5BA 3SAUA 1YX5A 2DFHA 5CVRA 2CZ7B 2LRDA 1Y1VJ 3VFDA 2Y0QA 1YITI 4JYKA 3KSXA 3F3XA 3HRUA 4RM3A 2Z4RA 1EKEA 2G0EA 2M1BA 4EIWA 5JR3A 3S1RJ 2CU7A 3BTIA 2ZJQF 1EJ9A 1P9QC 2F5QA 3QYGB 1ZGWA 3GO8A 2GM4A 4CFWB 4XQFA 4F93B 3FUTA 1T33A 2ELHA 2LSOA 3RKYA 1HKQA 2FH0A 2H94A 2VPRA 4JQFA 4FM4B 2M3AA 3MMPA 1V33A 2NS7A 4RAFA 1W98B 3E46A 3E5XA 2ECBA 3D8LA 4DV1M 3WG9A 5J40A 2ZMEC 3I58A 3A8HB 4UVBA 4RKUF 1MSFC 4GCVA 1D8KA 2MLGA 2DD5B 2G9XB 4NHJA 1UCRA 1E94E 5CVIA 3HU3A 1RKWA 1SD7A 5J8CA 2WTEA 4XM3A 2RRUA 4LZJA 2HU9A 3BTLA 1CUKA 4GIPA 4HA8A 3WU0A 5HS8A 3CCMI 3OYIA 4C9YA 1YS7A 1N78A 2DYRH 5EGOA 2I7NA 3A4CA 1Q1HA 3L2RA 4ZZLA 4JX5A 3CTAA 1P4WA 1L2DA 4PSXA 5HOOA 4HRIA 1MBFA 3GTMS 1OIZA 2VQEM 2VBZA 3JR5A 3M03A 4I0AA 1RI7A 1UFMA 2R7FA 4RGRA 1FPQA 3WTSC 1ZQ3P 3KZZA 3K4KA 1G4AE 2D7GA 4HAMA 2QSHX 2OTJI 2KPMA 1IN4A 1HT2E 3GFMA 4A0XA 3AOEA 3KCCA 1UFZA 2OZ6A 4ZZDA 1SVLA 3OYGA 4NOOB 3U60A 3SMSA 2W82A 4I76A 4AZFA 3HUGB 4BH9A 3DOAA 1YFHA 2WAQA 3GO5A 3I9V2 1OR7A 4I99C 2ZMEB 3FXMA 1JB0F 3IL2A 4DBQA 5LHGA 2R44A 2BV6A 4DV2M 2CUFA 1K78B 2DWLA 3LVVA 5EXTA 2BGCA 2Y0TA 2HL7A 2UV1A 1S7OA 1BL0A 1XB2B 1XMQM 1B9MA 4GC9A 4IRGA 4D0PA 1YJ9I 5BPIA 2CJMB 3VYSB 1QPMA 2RNGA 3I59A 4AIHA 1SVMA 2YSRA 4MM3B 4Y33A 4GH9A 5IF1B 3K9TA 5D5UB 3A2KA 2EIMH 2DAEA 2L4EA 1QZYA 2BPMB 5ICCA 2MD0A 3KOXE 2KRCA 1I5ZA 4IEJA 3FHNA 2LLKA 5E1ZB 1PUEE 2JWTA 2CH0A 2DO7A 3W67A 2JK3A 3H0GJ 3FMSA 5DDGA 3HOWJ 3Q0UA 2C99A 3JRFA 4UNOA 3HJ8A 2XFSA 3TOAA 4CFVB 3FXLA 4RAYA 9ANTA 1WJDA 3BPXA 3OV8A 1D5YA 3EUHC 3BHVB 4F91B 1TH2A 1UNGD 2DN0A 3E1SA 2EQRA 3GF2A 2V4JC 2OQGA 3NBXX 3OR2C 1WQ2A 2V9KA 3LSMA 1OJLA 1RNLA 2IGKA 4D81A 2HHHM 3FKIJ 5L3CA 1UG2A 4R3DA 4P5OA 4L9JA 5GAHJ 3CTWB 3ABMH 2JPCA 2MSYA 2FFJA 1D2NA 1RZ4A 3M4OJ 1TC3C 1JUPA 3WTXC 5LLQA 2XPVA 1GO5A 1XXHE 1YE9A 1K83J 3Q0WA 1OI9B 1QDRA 2HKXA 3PXGA 2BEOA 4P9FA 1GH6B 2XLJA 2KL4A 4WF2A 3HY5A 2K40A 5DYMA 1BA5A 3BLHB 2YU3A 1G3TA 1RESA 3QU3A 2F4VM 4BQNA 2KRKA 4NNJA 4MO7A 4I8OA 3OIQA 4LD5A 3HC7A 2DD4B 4CSWA 2CWBA 3ERMA 3QZ9B 3RIRA 1KQ8A 1OCTC 1A35A 3B6CA 5F1JA 3TNHB 2EH3A 3HKZA 1E2XA 4YIRX 1DPRA 1HJPA 4B7HA 4IRIA 1KA8A 4XLPF 3W2VA 4FE4A 5EGOB 3TEDA 1AKHA 2JY7A 4BL0B 2XC7A 1LE8A 2DTZA 3H4CA 4ZC3A 4JBAA 4M0WA 2BY3A 1ZYRF 1FIAA 1X1AA 3QPSA 5H6RA 4B1RA 4M6YA 2QSGX 1O9KA 5IP9J 3J81Z 3DA1A 5DNYA 3GRUA 4WXDA 2R7RA 1J09A 3H4JA 4FCYA 2YX4A 1F5TA 1P5EB 5ICPB 2KZUA 5EZGA 1ZTRA 2Z3XA 3K4NA 5HVQC 3CCQI 1A6IA 1TT0A 2BYVE 4A3IJ 3A8LB 3H0DA 1FIPA 3DPUA 1QVRA 2M0CA 3C2BA 1FMVA 3U60B 1V5GA 3OTOM 3L2VA 1LPQA 2P7VB 2WMBB 4UN0A 5DQWA 2BS3A 1GJTA 4F6UB 1PM5A 4CCJA 3FTDA 3I54A 2L7MP 3MQ0A 1U8RA 2IS4A 2XVCA 3U6MA 3OYJA 1EF4A 3AOGA 3MIAB 1XCBA 3FXJA 3HJEA 5FTLA 2KJCA 3HL2A 2CJJA 1H27B 4ZDPA 2DI3A 3IUOA 2ZM6M 1OCZH 2DPPB 3E7LA 4AUXA 2L02A 1SC7A 2JWSA 3H5NA 1VQPI 5EG0A 3WTUC 1Z0XA 3I5UA 3R0AA 2N35A 3U6DA 4II7A 4XSXF 3TW7A 3S1QJ 2PFBA 4CRLB 4KODA 2PJPA 5LFAA 5KPRA 1ZAOA 2M4KA 3V8KA 3GVAA 2NVYJ 4C2TA 3OL3A 2MH9A 2V22B 4DUYM 1IFYA 5D4SA 1XHBA 4AYBN 5IOYA 4QPQA 5JI2E 2IVXA 3ELKA 4E7LA 4HX8A 3QQAA 1MN3A 3BQZA 3ZN1A 4BCFB 2HYJA 5LGNA 1O3QA 4GHLA 2JGZB 3HHGA 3W6VA 2IEKA 4HBLA 1TGUA 3BOQA 3DKYA 3V7CA 1E7PA 2X48A 4A3CJ 1BN5A 2ZMEA 1GT0C 4ROEA 3I59B 1A31A 3IHPA 5D5WB 2DMPA 2VIXA 1VI0A 4BHCA 1LDKB 2G3QA 1MKMA 4BQAA 1T6SA 3RQ4A 1IN6A 3B73A 4RGSA 5J1UA 1P3QQ 5J8FA 1LKXA 3GLLA 3C9PA 4I98B 1BOAA 4M6VA 2K4JA 1J7KA 4BNCA 3HOUJ 3KYLA 5C3EJ 4LMYA 5IT3A 1TQPA 3BC8A 3HHZA 3BQYA 3FXUA 3VDXA 1JKOC 4KRDB 1WJ5A 3HPHA 1X3ZB 4I0BA 3C2GA 4GEWA 2ISYA 5FGMA 1HNZM 3S2WA 3VFZA 3ZMTA 3JSPA 4E7JA 1QGPA 4XRFA 2HNHA 3F0CA 2WC2A 2X8AA 3SJMA 1FNNA 4NL4H 3V8LA 3BDDA 3CMAI 1DO2A 2CUEA 1JJ8C 1UGSB 1IXZA 2R6FA 2HQ5A 3BR6A 1OAIA 2EV5A 2NOJB 5BQTA 5EXPA 4HDVA 2JA8J 1R5ID 1N77A 4BCMB 2CCIB 2L4AA 2DLLA 2AS5F 2LTPA 2WB1N 2JVHA 2PX9A 3O8HA 2OUMA 4IKFA 1IREB 2ZXWH 2L54A 2XF3A 1HXDA 4LZZA 1LEAA 2MBFA 2GNOA 1Z3XA 5E1XA 1A36A 3F21A 3M7GA 2UWMA 1WH5A 3IAM2 5B66C 1OFIA 5HBJB 3GLFE 1SD5A 1MDMA 4HPQA 1K7AA 4LF5M 3JRIA 3WVEB 1OKWB 2ZSIB 2DK5A 2KFDA 3K0LA 4DV7M 5E3OA 2FNAA 4LY6A 3E9SA 5IYBJ 3NDQA 1PJJA 4EM0B 1G6NA 4DR3M 4D7NA 2PHGA 4HSRA 1SXJB 5ITYA 3H92A 4LB5A 4DJAA 5LHIA 2CZ1B 4BLCA 4ROCA 2O01F 1OCPA 1A6QA 2IS6A 4PGGA 2XAUA 2WEVB 2LK2A 1P4AA 2LR8A 3A1YA 1VQLI 3GMEA 1X3UA 2VPLA 2ECCA 2VF7A 3CO7C 1V54H 2CWEA 3CMMA 1C0WA 3DFGA 2KKOA 4N0BA 2XF7A 2PLYA 3EOCB 2JZYA 2XGNA 1EIJA 3M1CA 2AHMA 3D5RC 4YC3B 2RQQA 2EBIA 1JXSA 2DMTA 3JRDA 4IQJA 2M0MA 2VC0A 2MD5A 1R5GA 2XGEA 2JSCA 3J2PB 3CP2A 2K86A 4LFAM 4LIUA 1K61A 1E9RA 2ZNYA 1V29B 3FTEA 3E6BA 2QCOA 4MLOA 3FKEA 4ZJZA 2EFWA 5IZ7D 5IP6A 1MJ9A 3PNYA 5TRDA 3P9KA 3EUHA 2W85A 2L7FP 4GKKM 3GWZA 1IF1A 2QQBA 2ISZA 4C2MJ 2IW8B 4DUZM 3C3EA 2YR0A 1T0FC 3V4GA 4DYQA 3PNVA 2KEBA 5DTDA 4BCNB 1H88C 3DTKA 1PYVA 1MDMB 2GLOA 2L7KA 1H6UA 2Z7JA 4LLNA 3OOUA 5K7ZA 1F36A 1POGA 5F0FA 5HLIA 5C4JJ 1ORYB 4JI0M 3MJ5A 4V2FA 1ZG3A 2K6BA 3FXKA 2MLKA 2NS8A 2L2DA 2R5ZB 1SANA 1LFUP 5E79C 2H1RA 4J01A 1LB2A 1D0YA 3GPUA 1G8PA 3MKWB 1KQ9A 2MGQA 1YQAA 4KUMA 1G8XA 4XOTA 1Q1VA 3UKGA 1W4MA 1LDDA 3OSFA 2XRLA 4EJVA 1F4KA 3VOEA 2F2CA 4L9VA 1GV2A 1LDJA 5DCMA 1MW7A 3QYEA 4S0HB 4X6AJ 1QQWA 1XGNA 4RS8A 5KQ8A 3TP0A 3LSRA 3CDIA 3M8EA 2L9SA 4ELJA 2R7OA 2XKOA 3VSLA 1P2FA 4C30A 2EIJH 3SQNA 1JKWA 3H5AA 4XLCA 2DZOB 3WE3A 5TJJA 1D1CA 2RC4A 2ZTDA 3AOEC 3HTSB 3CGWA 5KO3A 3DOGB 4GDFA 2C9OA 1YW9A 4RB0A 3DLLF 4A3FJ 2ESNA 2KLOA 2CW0F 2DHYA 3EQLF 4RMNA 2HQAA 4AKGA 3FUXA 1GUUA 1U5TA 4PT5A 2VT2A 3W3CA 4KITB 4YY3M 1J5YA 2DT7B 3U6EA 1K6OA 5J1YA 1BBYA 2DXIA 3DCFA 3RPUD 2DODA 4UHTA 1H28B 3HG9A 1XB4A 3LA3A 2IN3A 4CYDA 4XLNF 1T56A 4BAYA 2UXXA 2YX7A 4C2UA 3SZTA 2I7PA 3K4MA 4L18B 5EXSA 2DWMA 4UUVA 2XIGA 3V42A 2VF8A 5LHHA 3U61A 1I6XA 2H27A 1G3WA 2GWRA 1GY3B 4Y28F 3U9GA 1IDZA 4M9SA 2F6CA 1ZG5A 1W5CC 2DA5A 2ACJA 1X4OA 1NHWC 2VQHA 3EETA 3BLYA 1AOYA 1UM8A 3HSEA 1ZRCA 3JRHA 2Z9OA 1U5TB 3BXWA 5ITXA 3OS1A 4D1QA 1QHGA 2VXDA 3GLFA 3G1LA 2ZANA 4QIWN 4EJUA 2Q2EA 2PBIA 5CVVA 2KISA 2R46A 3NQOA 5DEQA 1HLVA 1JTXA 2J7NA 2UZKA 1MBEA 2WPAB 4ZGEB 3T1BA 1UZCA 2GOMA 1UG0A 3GLGA 2LW4A 1SMTA 2R0IA 1UJ8A 5GKNA 1GKIA 1NNJA 2JRMA 1KONA 1BI3A 2EB7A 1PVEA 4M3FA 2C5OB 2JNHA 1AA7A 1HW5A 2HCBA 1LV7A 4WK8F 2EA4A 1TF0B 1X37A 4I81A 2EZHA 2F5SA 4FCVA 3OYNA 1PUFA 4UN2B 4O5VA 4OMZA 3KOYE 1F9NA 3J7AS 2V79A 2QHOB 3PO3S 1AUAA 1R2YA 2X9DA 1TT5B 2L4FA 3T38A 3KZIC 2CHGA 1V92A 1S7AA 1G59A 3ZP5A 1FOKA 5L3BA 3IWFA 3R6SA 1MJBA 1R2ZA 4F7ZA 1MBGA 5JVTA 1L2CA 3CP8A 2IGNA 2LF8A 3DKXA 1YHQI 4LB6B 1MBKA 4V19K 3K6GA 1GHCA 3VODA 4IXAA 1A04A 3VKGA 1OL1B 1BW6A 4LGWA 5FB2A 2L7HA 5L2WB 1KSFX 3AG2H 1B9NA 2XUBA 3OYKA 2CCHB 1I27A 2QBYA 3K7AJ 3MVPA 5DUKA 2MR9A 2NQ8C 4JI4M 2JMWA 4J00A 3JAMK 2WADA 1XMOM 2O8KA 2XZFA 3KEYA 3RKWA 2ZPEB 1XMXA 3U6LA 3VYGB 2DMNA 2QQ9A 3QU6A 2VJ5A 4G7HF 3E21A 3GTOJ 3GQ5A 3P9IA 4PDKA 2JA6J 5FSWA 4B7FA 3M8JA 2UUCM 2J5YA 3GFLA 1NG7A 2HVQA 2ZAOA 4BB9A 2OOBA 3RSNA 1VG5A 3B9PA 1Z7LA 2WAEA 3S16J 4MGYE 1IC8A 4BDYA 4LLLA 1QBJA 1RC9A 3D8BA 4OIOF 4BGDA 4DV6M 5LMKB 2IXSA 5FLXS 1KYZA 2LOOA 4HLQA 1H24B 2M4GA 4E70A 1IO2A 2C6TB 2CQQA 3MCZA 3GLIE 2V9VA 2VKEA 2D2WA 4BCND 3JRCA 4X1EA 3GLGE 1T95A 2KQRA 3QHWB 1K4TA 3A8MB 1QHHD 3NBIA 2K9DA 3U5ZB 5HLHA 5ICEA 4XN3A 3X28B 4A6DA 2P5TA 2BHZA 2XAFA 5B1BH 4HF2A 3T1YM 1K6YA 5CQEA 5LQFB 2V1CA 1F43A 2A6HF 5CVUA 1QQIA 3DL1A 2VJIA 1T6OA 2CS3A 4Y17A 4U7DA 1TH3A 2N8GA 1USSA 1FJGM 2VKDA 2D5VA 2EILH 4P17A 2QF7A 4GYIA 4N4OB 4FVMA 4ZTFA 4OB3B 1GABA 2Z99A 4CGZA 4LRTA 2R7SA 3CD6I 4EOSB 3IAS2 2VJ4A 2MGWA 4UV9A 3ZGKA 2KXEA 5E17F 3TMOA 2Y30A 3JTGA 1DPUA 1DGRM 2LHCA 1S5LC 5H6QA 2ZPBB 4OGRB 4XBOA 1I39A 4ZYAA 2CG4A 3FZVA 4LF7M 4B8XA 3N97A 4BE1A 2OAZA 1QDTA 3M0EA 1RPWA 3NWSA 4MH0E 2OOAA 3L27A 3WGGA 2M5WA 4C3HJ 3HOSA 3HUGA 2E7WA 4F1IA 3K7AM 1T3TA 2QKMB 1XG1A 3PQJA 1IXRC 5F3WA 4QLCU 3ZQFA 4M9XA 1T39A 4ON0A 4U7BA 3G6EI 3DZDA 4Q48A 2IP2A 3IKVA 3OIPA 3ZOBA 1FOXA 4NC8A 3Q5FA 4L5IA 3ZQHA 1ZP2A 5JI6A 3JR4A 2BY2A 2P6TA 2O61A 4FW9A 2PJRB 3MAJA 1G3NC 5ITUA 2M60A 2VQFM 2JP7A 1K82A 2NRAC 1WJ7A 2R45A 1WKMA 2KZGA 3G1OA 4AIDA 3COAC 2X51A 1HNWM 2W2HA 2VB6A 2UUBM 5L3DA 3LSIA 2WIPB 3GZNB 5C18A 4ESBA 1ZLJA 3E0JB 4FHTA 4F55A 3EPZA 1XCVA 1WHCA 3CF5F 1BC7C 3PL8A 2ID3A 2QWWA 1E17A 4ANRA 5LMNM 2UU9M 2MROB 3DU6A 1F1ZA 4F7SB 4ELLA 3HKPA 3ZCBB 2ZZDB 4RF1A 2GXGA 4LJ9A 4WW0A 1SFXA 1DGFA 3IRQA 4FASD 5FJ8J 2M45A 2H8WA 5BS6A 1ZELA 2RN7A 1YS6A 2OZUA 2PK9B 4PFPA 5GTHC 2K3FA 4L6V6 3IRRA 2WB1A 4HOBA 1OIPA 2OCEA 4BS9A 3CF2A 3LSKA 2X0LA 5DM7F 2QPAA 4REZA 3H3UA 3MKLA 4LOCA 2A69F 4I6ZA 2DENA 2KIFA 4XSZF 1APLC 4JI3M 2EFPA 4M3DA 3L9FA 3ZCOA 1FVVB 3Q9VA 2ZBKB 2DT6A 4DW6A 5ED4A 3SYKA 2F5OA 1U9OA 2K85A 4K0KM 4BXUA 2F5FA 4HSTA 1E3OC 2X6YA 2JN6A 1OIYB 4I2OA 1ON2A 1AU7A 2UZBB 2X4AA 4KHPM 4PJJA 5K1YA 5FTJA 3H35A 1IJWC 3DBRB 5KK1A 4XLFA 4B48A 4JXJA 2ID6A 3K1MA 3RYRA 3G33B 1L0OC 1O57A 3C2HA 3IC7A 2Z33A 2GXAA 5GTIC 5ITQA 1JSUB 2LMDA 5J1RA 2LVSA 1NH3A 1DGHA 2UUZA 1U5TC 2COBA 5D8LB 2L9VA 1DGBA 2HTSA 3H9GA 4XN0A 3HX3A 1QUSA 1HKSA 3GLFB 4LLGF 4A3MJ 1R4MB 2FMYA 2ZBKA 2D1VA 1R7RA 2QENA 3AKZA 2LDUA 3POMA 5EQTA 4JI5M 3ZQJA 2FD5A 2K27A 2WV0A 3BZCA 5C44J 4HQEA 2Z4SA 1AKHB 1U9NA 2HPMA 3B89A 2DFIA 1QYRA 3VSKA 1AHJB 2C9CA 5E18F 1VQ9I 1ULYA 3KP6A 4RLFA 1UGQB 2KZVA 3TOBA 1RUOA 4OWRB 3P9CA 4OIRF 3F23A 2KW0A 2ICWG 1AD6A 4G6ZA 4EMSA 3OY9A 2HWVA 2VJJA 4OOIA 2IS2A 3PO2J 2Y2ZA 1TDZA 1Z91A 1TWGJ 3N05A 2OTLI 2W99A 3SDGA 4CZCA 3WGIA 2OPFA 1BR1A 3BG3A 4DYRA 2W25A 4OW0A 4AW4A 1B6AA 5ITRA 3J80S 3C7JA 3L29A 1DV0A 5HDNA 2UXDM 2IW9B 1LTMA 1FX7A 4IOCF 3E5UA 3J7ZI 3ZH9B 3ZQIA 5FLVA 4B3AA 3K9OA 2Y20A 1ORKA 4EM1A 2K9QA 3I4VA 1FOWA 1BW5A 4KICA 4CDGA 3MKYB 4IBIA 2DZLA 3WODF 1IXCA 2V6ZM 3FWEA 3N4MA 3HHTB 1GV5A 3EIHA 4B4CA 1Y39A 2V1XA 4KT6A 1MU5A 5IHYA 1XDUA 5HS7A 2L2OA 2H1KA 1IV8A 3ZMUA 1NHGC 3CF0A 3B7ZA 1BIAA 4ZDLA 3F22A 4KDPA 2RKHA 3DTEA 1DU0A 4CYCA 1HKTA 2W9FA 3CMEI 1R49A 3PO3J 2CEAA 2FS1A 3UNGC 3K8ZA 2ELKA 2VIIA 5EEHA 3LOCA 1GUXB 2O8XA 2H6CA 1R9TJ 2WA0A 4LK0F 1H89C 5ICFA 2EV6A 2VE8A 2WFYB 1WJAA 3VKHA 3DDPB 1R58A 3HBLA 1WI3A 3ZQCA 4PDGA 1SD6A 3DXJF 3TDZC 3CJNA 4AQYM 3WTYC 4U88A 1OIUB 1X19A 2QVOA 5HNBB 4NSTB 4DZPA 1U6GA 2XDVA 3AL0B 3S3NA 3QYBA 5ILVA 5F1RA 5C1BA 3TWMA 3K4CA 5TGTA 3KP2A 5FFXA 4KO8A 4C3JJ 4DYCA 3IV5A 2OC6A 3DFZA 1E3HA 1R7JA 1GVDA 2XAGA 4KMUX 4XKVA 5A2QK 2HOTA 2CRUA 5CYVA 4WCGA 3OYAA 3LFUA 3A01B 3HWSA 3UK6A 4BHBA 1NHAA 1VZ0A 2B9SA 3GRRA 1Z7UA 2FOIC 1IY0A 4HV6A 2C5RA 3MEXA 5J3LA 1RIOH 2PI0A 2M30A 2WSCF 3VDPA 3MY5B 3ERED 3C58A 3GTJJ 2JUCA 2F5NA 2JY6B 4XKCA 3JR9A 4F92B 2DQLA 2O9LA 3K1PA 5KHDA 1TWHJ 3EDPA 2CFXA 2P5LC 3X24B 3TL4X 1I1GA 3SMPA 2HPIA 4PFOA 2Q0OA 4GHAA 1MMAA 1BR2A 2LXEA 1XS9A 1O7LA 2FBHA 1QZMA 2H6BA 2Z3YA 3O0GD 3MN2A 1X1CA 3WTWC 1URCB 2DQRA 2M5ZA 4PJNA 1ZAEA 2AHQA 3RDIA 2C4GB 2CUZA 5KAFC 2LREA 4BYYA 4J19A 3LSHA 4IBFA 1Q3CA 4MNUA 1FTTA 2DA4A 2E5ZA 4Q7JA 3H36A 2QDJA 5JLXA 3KP0E 2JPBA 2E34A 4BQOA 2X6WA 5GPCA 1OKSA 4A0YA 1YI2I 2YQZA 4ZTJA 3RJPA 3K92A 4AKIA 2D7EA 1V34A 2LVAA 2O5RA 1FBQA 2MH8A 4QHTA 4YOOA 3WTTC 2IGOA 1VDLA 4CFUB 3A0HC 4B3XA 5GP9A 4G4QA 3T5XA 1IV6A 2YR2A 1G4DA 3QYHB 4DR5M 4CISA 2PJQA 1JKQC 3KS4A 2I53A 2BW3A 3K10A 2VE9A 1EE8A 3RFWA 2A05A 3DLAA 1S9HA 2XF6A 2XB5A 1YLFA 1FSEA 3MI9B 4KFCA 1G2HA 2AXTC 3U6PA 2LY9A 2PK2A 1T43A 1WZ2A 3OOPA 3GEZA 4PUSA 1Y0NA 2L09A 3R8FA 4YOSA 3BCBA 2F4OB 4CICA 4QNMA 1ETKA 2B3TA 3D1NI 5CVJA 5HDGA 4IHXA 3R9XB 2ZPIB 3TQNA 1BI2A 4R79A 4QNRA 3KHIA 1SXJA 1HOMA 5ILUA 3J80K 4JYAM 2AHJB 2RGHA 4D7MA 2Z2SB 2X1EA 4QTRA 1VQ1A 4UV8A 1HCRA 4WXCA 2EFOA 3TPZA 4LF6M 5FKMA 5AIQA 1OLTA 2Q2EB 3ECOA 3AFHA 1D3UB 3JRAA 1XSDA 1GVNA 3DTIA 2EO2A 3FK7A 2JJ7A 2YNMD 3VYRB 2XV4S 2DYSH 4BJTA 1JGGA 2NYXA 1WRJA 1YW8A 3SARA 1ZK8A 1WJBA 4Z2YA 4ZDOA 4HL4A 1D1BA 3X26B 2NAZA 2QKLB 5JLWA 1T2KA 1H26B 1OQYA 1UHWA 3Q0VA 3CLQA 2GIVA 2TCTA 3BG9A 4L0YB 1WGLA 2CGPA 2D7HA 2UXNA 2BWEA 4G6QA 4IX7A 5LGUA 3BLRB 3I4NJ 3QOEA 2EUCA 4XL9A 2LVPC 3R4KA 4GMQA 4A3VB 3SATA 2X1CA 1L2BA 2MH2A 5FO5A 4BHPA 5KPZA 5DS9A 2P5KA 1Y8RB 2FMLA 3FX3A 3CC2I 2NVTJ 4XBFA 2BY1A 3HHWA 5EP2A 3D5SC 2NOGA 4RAZA 5LGTA 2L7ZA 5I5ZB 1SD4A 2ZPGB 3GPPA 2ERCA 3FUUA 3HHYA 3MZHA 4O6JA 2C96A 4LJ8A 2V1NA 3G2BA 5CKTA 4P55A 2FX0A 4O3MA 2FE8A 3CC4I 4CFNB 1TZLA 1H9TA 3J7BA 3Q8GA 5J4VA 2P8TA 1MNMC 1N33M 1TR8A 1PP7U 1REPC 2R18A 4ITQA 2K0BX 2O3FA 2PMZN 3T8RA 2JA7J 4EOMB 4RF0A 1BM9A 1FBUA 4HLXA 2LC2A 5GPAA 4B43A 3BHUB 4FISA 2DA7A 4N9IA 5IWAM 2L0KA 4U87A 1PJRA 2HZTA 3MZ8A 3R61A 3S32A 3CCJI 4BBSJ 5K5OA 3UR3C 4IL6C 2CW7A 1HSTA 1PJQA 1SAXA 4HYEA 3OYHA 1TDHA 3JW4A 4Y13A 1W36D 2EKFA 3TKYA 4B47A 1XNQM 3DBLB 3HPGA 1U78A 4UVCA 3QZ5B 2DAGA 2DDBA 1OYIA 4BCQD 2GIZA 2LBFA 4DR2M 3PIOF 1TWFJ 4HEA2 3ZN0A 4GFBA 4L16A 2ZKZA 3HGGA 1ETQA 4BCHB 4GRIA 4G12A 3GLIB 1IW7F 3L25A 2DTRA 1IBMM 4RM2A 1W7PD 2R4GA 2L7IA 1OYWA 4FX0A 4FCTA 5M5YJ 4I02A 3C1DA 4HEOA 4M71A 3L2QA 4EOKB 1ENHA 1ZN2A 2DFEA 2MFZA 5FRNA 4A3EJ 3Q9SA 4MQVA 5FD6A 1XDSA 2LHGA 3FDYA 4UUSB 2M8EA 3K1NA 5HQ0B 1P92A 2QNJA 2DW4A 1RU3A 2HQNA 2RV8A 3NWTA 5GAGJ 2QZ8A 3VYUB 5EEAA 4F7NB 4W97A 3DTOA 2W84A 2BW3B 2QM3A 3BZKA 3TO7A 2HQRA 1UELB 3TO6A 1U3EM 2DZNB 1JUMA 2JSPA 1JT6A 1ZREA 5E20A 2HR3A 3Q8XA 1E9SA 1ZLKA 2R7TA 4M74A 2LF7A 4KYWA 5FTKA 1Z6RA 5HLTA 4ZPXA 3U6QA 1T98A 3QODA 2LVOC 4AYBA 4OIQF 2BVMA 4KIBA 4CCMA 2K9LA 4IHWA 2DWZB 3C18A 4U0YA 4OU0A 4BACA 4Z8XA 2FJ1A 4MTDA 3O8GA 2CYZB 4LJ5A 1GL7A 1MH3A 1R36A 3KIOA 1W5SA 2QUFA 3FIWA 1GJSA 2E19A 4DNCA 4EGZA 3DKWA 2LP0A 4YFKF 4IBJA 2GAUA 3KFWX 2NVXJ 2NVQJ 5EP3A 2DOFA 1J9IA 4CZZA 2QA4I 4TUWA 1L8QA 1DP7P 4QOSA 1J2XA
chains in the Genus database with same CATH topology
2ZZDB 2G77A 4BBRM 3A8OB 2BS4A 4HL4A 3X26B 3VKGA 3VKHA 3VYHB 1E7PA 3HBLA 3BG9A 4LOCA 4NC6A 2DXBB 2ZPEB 3QYBA 3VYGB 4MIMA 4M6VA 3QYEA 2KR6A 2CZ7B 2D0QB 4MFDA 4ELJA 3X25B 4OB1B 2ZPGB 4HNTA 4HLQA 3QYGB 4OB0B 1UGSB 4QSHA 2CZ0B 4FM4B 4BBSM 3X24B 4AKGA 3A8MB 3A8GB 2DD4B 3WVDB 3QZ9B 3A8HB 3HO8A 1IREB 3X28B 4MFEA 2DD5B 2QDYB 1UGPB 3DL1A 2CZ6B 3H4CA 3WVEB 2QDJA 3BG5A 2WJ9A 3QZ5B 4P17A 2QF7A 2ZCFB 1AHJB 4OB3B 2BS2A 1UGQB 3X20B 3HB9A 2QQ8A 4JX5A 4ZGDB 2KMGA 4Z6YA 4JX6A 2CZ1B 4AKIA 2ZPBB 1FKMA 2ZPHB 3A8LB 3QXEB 3QYHB 3TW6A 4JX4A 3BG3A 2ZPFB 2BS3A 4OB2B 4ZGEB 4AKHA 4ZGJB 2DPPB 1QLBA 2QFZA 4AI6A 1V29B 2CYZB 2ZPIB 3HHTB 3KHIA 2AHJB 3HZJA 3TW7A 1UGRB 4HNVA 3QWLA 4HNUA 2DXCB 5EJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLQ A;  2QQ8 A;  2G77 A;  1FKM A;  3QWL A;  3HZJ A;  4NC6 A;  4Z6Y A;  3QYE A;  5EJC A;  2QFZ A;  4P17 A;  3QYB A;  4HL4 A; 
#chains in the Genus database with same CATH topology
 2V9P A;  2CV0 A;  3F8B A;  3ASN H;  3FXO A;  1OKR A;  3HOV J;  4OU7 A;  3WU1 B;  3FYD A;  1V55 H;  1D0Z A;  1MZB A;  3E6M A;  3FBI B;  3LFK A;  1KZH A;  4EOR B;  1B59 A;  1LNW A;  2DA3 A;  3W6J B;  3V7S A;  1XWI A;  4IJA A;  1EV7 A;  3IG5 A;  1QRY A;  3H9Q A;  3QAH A;  4B7G A;  2MW8 A;  2Y0S A;  2K9N A;  4U0W A;  3LQQ A;  1BI1 A;  4EOL B;  3QAU A;  1V5F A;  4YG2 F;  4MIM A;  3GTK J;  3OYB A;  2VT3 A;  5DD8 A;  1X1P A;  4ETS A;  2R93 J;  4R7G A;  4R1H A;  1TQM A;  2JVG A;  2HTJ A;  1R5H A;  4I01 A;  5H2F C;  1GUX A;  1H1S B;  1D1A A;  1S72 I;  1W7P B;  4HF0 A;  4BE2 A;  3SAW A;  4EAT A;  3X25 B;  1ZAR A;  4IO9 F;  2A07 F;  1F4I A;  4HNT A;  4BY7 J;  4EJO A;  2A3S A;  2H09 A;  2MG4 A;  4OB0 B;  1LFB A;  1N25 A;  1H1R B;  3ZPL A;  1IBK M;  1VIN A;  3S2D J;  4DV3 M;  2Y9Y A;  3BOS A;  3H1C A;  4XOR A;  3RQI A;  3GX4 X;  3I4P A;  3O6B B;  1P4X A;  3E6D A;  3HU2 A;  2O03 A;  3F8C A;  4A5M A;  3BG6 A;  1Q3B A;  4L8R C;  2R4J A;  3WTZ A;  3F9K A;  5IYD J;  1IUY A;  4LFU A;  4Y52 J;  3J80 Z;  1E0E A;  1TNT A;  4M3B A;  1DGG A;  1T38 A;  2D45 A;  1CQT A;  3JAM S;  2TDX A;  3QRF F;  4Y7N J;  2GA2 A;  1KU3 A;  1UAA A;  4X64 M;  1VQO I;  1S3S A;  4BCO B;  1TH4 A;  5FKN A;  3BT9 A;  3PNT A;  4ESF A;  2KZS A;  3KZY A;  5LEJ A;  3T1H M;  4TTH A;  3K70 D;  4EOI B;  1TTE A;  3X20 B;  5HBE B;  1W0U A;  2F4M B;  2VL8 A;  2HYF A;  4UUT A;  1I1S A;  4IRH A;  3LA2 A;  2PMU A;  3HRT A;  2GQQ A;  3VEP A;  1YO5 C;  1D8J A;  3E97 A;  4BU2 A;  1K78 A;  2IAI A;  1IN8 A;  4L78 A;  4KIF A;  5GAE J;  5IOZ A;  1Z5C A;  2DAM A;  3WGH A;  2GA1 A;  2QEX I;  1QAM A;  5EXX A;  3SBJ A;  1QVU A;  2WSF F;  2HAK A;  1Z67 A;  5A2Q Z;  1WSU A;  5E8G A;  2R3S A;  2K3P A;  4EOJ B;  1ZQ9 A;  1E9H B;  4FT8 A;  3FBN B;  2CYY A;  1IN5 A;  3DQV C;  1UB9 A;  2KHM A;  2A5Y B;  5ICG A;  2UZD B;  3IH3 A;  2OBP A;  2HOE A;  3S17 J;  3K4B A;  4KNY A;  2HKO A;  5F0H A;  3O2P E;  1ZRF A;  2XSZ A;  5KVR A;  3LAP A;  1Z77 A;  1MIJ A;  3IWZ A;  2OPT A;  1D5V A;  2M7B A;  3KYC B;  3BP8 A;  4HZF A;  2K02 A;  3PJR A;  1ETO A;  4N4N B;  1FSH A;  2DA1 A;  4LFC M;  4JK1 X;  1TWA J;  4H0E A;  2HOA A;  4E7K A;  2DK8 A;  2DXC B;  3J81 K;  5EJC A;  3HYI A;  3VB2 A;  3ZQQ A;  1RUN A;  4LJA A;  3HXL A;  2OF7 A;  3TWK A;  2GZW A;  1WCM J;  4HLY A;  3A98 B;  3M8F A;  4L4U A;  2VBY A;  1K3X A;  2NNY A;  3W0F A;  2LNB A;  2BS4 A;  4HDU A;  4XR6 A;  2LG4 A;  3OYD A;  3BWG A;  2CHQ A;  3GYH X;  2PMH A;  2RGO A;  2ZSH B;  4KLN A;  4ESJ A;  3KOZ E;  3KX2 A;  3RI4 A;  1K4S A;  1L1T A;  2ETH A;  2ZCW A;  2C5X B;  3K9P A;  2QGU A;  2ZXI A;  2XAQ A;  5F27 A;  3LQ5 B;  1JR3 D;  2VOP A;  5K5Q A;  2P5V A;  1H8A C;  4BXX X;  3OSG A;  4BE0 A;  5IDP B;  4XLA A;  2ESH A;  3I51 A;  3IEC A;  2XAS A;  4L5J A;  3TQS A;  4PK4 A;  5LD2 C;  4CJ6 A;  4P1W A;  2IT0 A;  4A3B J;  1NV9 A;  2WXV B;  3FRI A;  2LBF B;  1H1Q B;  5JI3 E;  3UMM A;  4V2G A;  4KMF A;  4IVN A;  2EZL A;  2KNZ A;  2KRU A;  3LW5 F;  1PJI A;  2FUG 2;  4X65 M;  2HOS A;  4GO1 A;  3IHU A;  2MAB A;  4EJT A;  2RAE A;  2E5L M;  3OYE A;  4S12 A;  2FF4 A;  2DT5 A;  4OAY A;  4HW0 A;  2CUJ A;  4LJ4 A;  1AHD P;  1ON1 A;  2CZ0 B;  4X62 M;  4EQQ A;  3OYF A;  4ANJ A;  4BBS M;  5JHU A;  1UNH D;  3VLF B;  4GIT A;  2DOA A;  4CHU A;  4EOP B;  3SC3 A;  3F92 A;  3DPT A;  5L3G A;  2LVQ D;  1NV8 A;  1EH8 A;  1FEX A;  4A3L J;  5DQV A;  1YIO A;  2DDA A;  3CCR I;  2JUJ A;  2KA6 B;  4BBR J;  4LIV A;  1ITY A;  3HHX A;  3GLH A;  2LFB A;  4NDL A;  3IH2 A;  5AIP A;  2WZJ A;  3BTC A;  4X0G A;  2FQ4 A;  2R7V A;  2JUG A;  3FYC A;  4G94 A;  3TBI A;  4AM3 A;  2FNP A;  1XC8 A;  3A42 A;  4JN6 A;  5LMU M;  2BS2 A;  4IMY B;  3BHT B;  5CYI B;  1T08 B;  1NVM A;  4YFN F;  1NNU C;  2WHB B;  4XLE A;  4ABZ A;  4M6X A;  2CSO A;  1VQ8 I;  5IRE B;  3O3K A;  2R7X A;  3KPH A;  5K7F A;  4AG5 A;  3IH4 A;  3L00 A;  1R00 A;  1J59 A;  1IG7 A;  2HXI A;  2ME0 A;  3KP1 E;  3FUW A;  1BJZ A;  3MWM A;  2OD5 A;  4RB1 A;  4CCL A;  1BJA A;  4OX9 M;  2CHV A;  4BXX J;  4OVZ A;  1KU9 A;  2VLA A;  3VDU A;  5E26 A;  4L9N A;  4UVA A;  4LG0 B;  4ZYG A;  4NRW A;  2OQ4 A;  4BJ6 C;  4WWC A;  2EWN A;  4LCB A;  4IHS A;  2DPD A;  2OU2 A;  4HX7 A;  2BXZ A;  3OMY A;  2FOK A;  4G9Y A;  3CLO A;  1QLB A;  2QFZ A;  1ZMU A;  4QHS A;  4ZYE A;  4L15 A;  4OIN F;  4EM2 A;  5L3E A;  3LQR A;  4KJZ A;  4KIG A;  4XK4 A;  1HQY E;  3QYF A;  1FZP B;  4G4O A;  4RNA A;  4LF9 M;  1JR3 A;  4MGK E;  2CMP A;  1DGH B;  5B1A H;  1MJG M;  3S2H J;  3UZU A;  3PM1 A;  2EIN H;  1IAW A;  1OFC X;  1HNX M;  2OV7 A;  1HC8 A;  1X4P A;  3KE2 A;  1UHS A;  2Y0M A;  3FM3 A;  3RCO A;  2DME A;  1ZG1 A;  4ZH4 F;  4FX4 A;  1QA6 A;  4DV5 M;  3SYT A;  2LNH C;  3BR0 A;  2Y31 A;  3R60 A;  4D80 A;  1VYW B;  1IN7 A;  4LFB M;  1R1V A;  3ZQ7 A;  2CQX A;  4E7H A;  4UB6 C;  2VDB B;  3KVW A;  4DOZ A;  3OS2 A;  4I3Z B;  2JTV A;  4Y72 B;  4MQ9 F;  3PQK A;  4F70 B;  3BZ6 A;  3BCA A;  2R4E A;  2HVR A;  1QPI A;  4YEJ A;  4P9U A;  2DMU A;  1IGN A;  3IKT A;  3G1M A;  2NXN B;  2NNN A;  1MSE C;  3GQ3 A;  2WV1 A;  2DXB B;  1DUX C;  3AL0 C;  4NSO B;  2H8R A;  2HKJ A;  3JAM Z;  3WHL A;  3DEE A;  4ENM A;  1D0X A;  2B63 J;  1JHH A;  1GXP A;  4IBC A;  1ZHF A;  1XMA A;  4N9H A;  1TFB A;  4MGI E;  4A2U A;  1BU2 A;  2KR6 A;  3FMQ A;  5HBH B;  2KDO A;  3P5J A;  4DGW B;  4RAG A;  1IM2 A;  1JTY A;  1XPX A;  3ZR8 X;  4OB1 B;  2W48 A;  2IBD A;  3T8T A;  3BLQ B;  1P7I A;  2IPQ X;  5J4Y A;  1H4L D;  3HTU A;  2Y69 H;  3A02 A;  2JXN A;  3GRY A;  5KNL A;  5M3M J;  4F6S B;  4IBG A;  1FY7 A;  4M3G A;  5HLG A;  4WX9 A;  3ZMV A;  3FKJ A;  2ZO4 A;  2DKL A;  4XK8 F;  3HOZ J;  2DCE A;  3CO6 C;  4EVI A;  1RR8 C;  2K5C A;  4FET A;  4XRS G;  5F6F A;  1FTZ A;  1NY6 A;  2LY2 A;  4MB7 A;  4L0Z B;  1P6R A;  1X58 A;  4AIJ A;  3WVD B;  3SFZ A;  3GXO A;  1U0J A;  2EFQ A;  3F6V A;  3G3Z A;  5BOX A;  3L2U A;  1XGS A;  3EIE A;  5EEG A;  5FKO A;  1TL8 A;  5IY5 H;  1Z1D A;  4E7S A;  4LJZ F;  3MK6 A;  2FQ3 A;  4MGR A;  1DGW Y;  2X1N B;  2X6X A;  4B3S M;  2DAO A;  3KEO A;  2IGM A;  3RGF B;  3DBH B;  2WJ9 A;  2QQA A;  4JV5 M;  1DU6 A;  4D82 A;  4IQ4 A;  5LEK A;  3F72 A;  4W1U A;  4PZJ A;  1JOW A;  3HB9 A;  2QZ4 A;  3D0S A;  2QCU A;  5IDN B;  3ZMD A;  2BVL A;  2BJW A;  2H5X A;  2DNA A;  4FWG A;  1JST B;  4ENJ A;  3W2W A;  5CPR B;  3BBZ A;  3AJI B;  3KFU G;  2WIH B;  1XXH B;  2ELJ A;  2E2I J;  1FKM A;  3KW6 A;  1MNE A;  3S93 A;  3K4J A;  2COM A;  3JTH A;  2HDC A;  4IIW A;  2RGV A;  4XOP A;  3PSF A;  4CFX B;  3DWL E;  3I3L A;  2GQF A;  2A61 A;  3GTM J;  4PCZ A;  4LG0 A;  2OCC H;  3I01 M;  2VN2 A;  5TIS C;  3L7W A;  1TWC J;  2DI0 A;  2UXB M;  3X2Q H;  5C4X J;  4ENN A;  4BBA A;  2Y75 A;  4QPO A;  3GLI A;  4RGX A;  2D1H A;  5E3M A;  3HSR A;  3HOY J;  2M7A A;  1QVT A;  1S7E A;  3SHG B;  1HDP A;  3DF8 A;  2KP6 A;  2V1U A;  2VOO A;  3U6C A;  5FLX K;  3GCM A;  4D9J A;  1UGR B;  2NS0 A;  2M9H A;  4S04 A;  3FUV A;  4CFU D;  3V7R A;  4X66 M;  4UB8 C;  3GFI A;  1MMN A;  2AQF A;  3U6O A;  4QWQ A;  4OIP F;  1VQ6 I;  2E35 A;  1OYY A;  4A3K J;  5A2Q S;  3HU1 A;  1MJA A;  1RKT A;  2R65 A;  2X85 A;  1G71 A;  4NQW B;  2XSJ C;  3KP5 A;  1DQU A;  2R7G A;  3A8O B;  3DP7 A;  2BBY A;  1LVA A;  4M3E A;  4DR7 M;  5GAD J;  5AON A;  1H0M A;  3KLN A;  4Q4Z F;  1IRZ A;  5CJ9 A;  2EKK A;  2I5U A;  5FKL A;  1DP3 A;  1PJT A;  4NXN M;  4RA2 A;  5ERI A;  1LUJ B;  3WHC A;  1C7Y A;  4XKW A;  4RB2 C;  4CXA B;  1NG6 A;  4BY1 J;  4CH7 A;  2FOW A;  2O25 A;  3KSJ A;  3LL7 A;  3GP1 A;  2XSD C;  5E8I A;  1J0R A;  1LJ9 A;  2XKP A;  4QOZ C;  2GOX B;  2A5W A;  3TO9 A;  2R7W A;  1ETV A;  2D0Q B;  5KPT A;  4II2 A;  1Z5A A;  5M5X J;  1Y1W J;  3QOP A;  3L26 A;  2DVW B;  2XB0 X;  3E4R A;  4EOQ B;  2IRF G;  5LRR A;  4A6E A;  3V8J A;  2AO9 A;  2XGD A;  4ZYH A;  5H37 D;  1XMK A;  1OKV B;  4DBG B;  2E2J J;  3KEQ A;  1ZMW A;  4FE7 A;  4R71 A;  1DDN A;  3I4M J;  1B1B A;  2CV1 A;  3SYL A;  1VF9 A;  3ABK H;  1HA8 A;  1QZE A;  1ODD A;  2JA5 J;  1ZGJ A;  2X1D A;  3ZRG A;  1Z3Y A;  4MEX F;  3U5Z A;  1WIV A;  2LH9 A;  3KXE C;  1A5J A;  1YUB A;  3KP4 A;  1HDD C;  1TD6 A;  1E3P A;  1OAO C;  1S29 A;  2DMQ A;  5DV5 A;  1OPC A;  2FEZ A;  2H1L A;  5HS9 A;  2Y9Z A;  2M2E A;  1ETW A;  2YUS A;  4OR5 B;  1WVR A;  5H20 A;  1KXU A;  2R7D A;  1VFC A;  4G6T B;  5BPV A;  3MHV C;  2XZU A;  3BG5 A;  3FM5 A;  3PIP F;  2RKO A;  2I10 A;  2RRE A;  4AIK A;  1HW2 A;  2OA4 A;  4A3D J;  2JZ0 A;  1WH7 A;  3ILK A;  3OWT A;  1FWZ A;  2O7O A;  4NC7 A;  3AAF A;  3L1P A;  2DHR A;  1GDT A;  5EZH A;  3FD9 A;  1S6L A;  2R5Z A;  1QMZ B;  2PJR A;  4CGY B;  2IVM A;  3L2W A;  4HQM A;  5B5E C;  3AV0 A;  2DBB A;  2P4W A;  3BR5 A;  1YRN B;  2QP9 X;  1KYW A;  4MHG A;  3PSI A;  3MY1 B;  2E1M C;  4IZZ A;  1Q02 A;  4Y3O A;  4EGY A;  5HNF A;  3VK7 A;  4JOM A;  1SEU A;  1GL6 A;  1TNS A;  2E5N A;  2CV2 A;  1KQ0 A;  2JY8 A;  1C1K A;  2ZJ2 A;  1BR4 A;  3E3V A;  1W36 C;  4FQG A;  2CFO A;  4L9T A;  3F8M A;  2F4I A;  1TBX A;  3THG A;  1SFU A;  1J75 A;  4D5C A;  2CQN A;  3A01 A;  1F5Q B;  3ML6 A;  2IS1 A;  2L01 A;  3K69 A;  3VWB A;  1ZRD A;  2W4S A;  1W1W E;  2L3D A;  4EC8 B;  4ROD A;  4Q5S F;  2DPU A;  2VI6 A;  2NVU B;  2VKV A;  3M3Y J;  3R0J A;  1XSX A;  3QP5 A;  1QU3 A;  1ZV1 A;  3JSO A;  4RGU A;  4IHV A;  1Z05 A;  2I8D A;  1XSV A;  2BE5 F;  1WWX A;  2WY7 Q;  1VQ7 I;  3CCY A;  1H1P B;  2LTU A;  3T6P A;  2LYC A;  3U2R A;  1SAU A;  2IA0 A;  3ESW B;  2KNV A;  3SHF A;  1IXS A;  1ZR2 A;  3GTL J;  4NQW A;  2L5Q A;  3SZP A;  1Z6T A;  5FD5 A;  3LNQ A;  4R8H A;  1E32 A;  1IDY A;  3C3D A;  1EH7 A;  2VQL A;  5FRO A;  4E4H A;  2F5D A;  2BY0 A;  1TP4 A;  1VOL A;  4PCQ A;  5B3S H;  5EP4 A;  1EFU B;  2V6C A;  4BXF A;  3NRV A;  5LRS A;  1ZH5 A;  3GW2 A;  2FE3 A;  2VQG A;  1QAN A;  3DDQ B;  5J6X A;  3J7Y J;  3ZXS A;  2E1O A;  1PKD B;  4LG2 A;  3CCL I;  1Y8Q B;  2ZB9 A;  4AVZ A;  4GGG A;  4GXO A;  3AG1 H;  4BCJ B;  1Y8G A;  4JI8 M;  3RZO J;  3PFI A;  2V7F A;  4YII A;  3T0Y A;  1W7P A;  1G3S A;  3JRB A;  2JQ7 A;  3Q3S A;  1I4W A;  3FF5 A;  3IP4 B;  4ITV A;  1O4X A;  4YRV A;  1I6H J;  2OO9 A;  2DJN A;  2LKS A;  4F6W B;  4B3T M;  2C98 A;  5DCF A;  2WSE F;  4IHT A;  4BCG B;  1XD7 A;  5KQD A;  1XTA A;  5D6F A;  4WXH A;  3LCU A;  1FBS A;  2A6T A;  1WPK A;  2E71 A;  2P6S A;  3F6O A;  1SFO J;  3ULQ B;  2M87 A;  2E1M B;  1T0F A;  1MX0 A;  1Z59 A;  3PUB A;  3CUQ B;  4IBE A;  3JRG A;  3BR1 A;  3I71 A;  3QPL A;  2VUM J;  5JHF A;  3A46 A;  1OFH A;  2R62 A;  2MJ5 B;  2LD5 A;  2E1C A;  3HJS A;  1SFK A;  2LY1 A;  1FT9 A;  1S8N A;  1HBX G;  1N32 M;  3S8P A;  3ROU A;  3J7A Y;  2IA2 A;  3HO8 A;  2UZL B;  3GPY A;  3BPV A;  3HM5 A;  5DD4 A;  1WJE A;  2IW5 A;  4G6D A;  3LMM A;  1QUT A;  4CA0 A;  3A45 A;  4LGM A;  3NEU A;  1UGP B;  2E1N A;  4LJ7 A;  3J81 S;  2KIQ A;  4EV0 A;  1NY5 A;  2CO5 A;  5BNJ B;  2CZ6 B;  2DU9 A;  3B57 A;  4G6L B;  3LSG A;  2STW A;  1IXS B;  1FIN B;  2ZTC A;  5ITT A;  4DR4 M;  2JY5 A;  2C6Y A;  5ITX E;  4EJW A;  2X49 A;  2Z8Y M;  4FWD A;  4G7O F;  2LWX A;  1YRN A;  1UMQ A;  4AG6 A;  1NTC A;  2EA2 A;  1YLA A;  3CCE I;  3GZ6 A;  3QHR B;  2G8L A;  3QXE B;  3TW6 A;  2MC4 A;  1N4M A;  3FRH A;  4A5N A;  1IRG A;  3H3Z A;  4JX4 A;  4KT0 F;  2MYS A;  3LVW A;  3I0T A;  1ZGA A;  4GC5 A;  4DQ2 A;  3S1N J;  4DBR A;  3OYC A;  2UZE B;  4LG3 A;  5BR8 M;  1OCC H;  3WE2 A;  2F5P A;  4LK1 F;  2O6G E;  4P16 A;  4OB2 B;  3REO A;  3OS0 A;  2IW6 B;  1XNR M;  4CIZ A;  2KIU A;  4Y4R A;  3K70 C;  1VQM I;  4YIF A;  2E2H J;  2Z1D A;  1VQ5 I;  1R4N B;  2VXZ A;  2W24 A;  3ZMS A;  4AKH A;  1MMG A;  3RPQ A;  2G7H A;  2BJV A;  2OQR A;  1OMI A;  4II3 A;  1YJN I;  1YG2 A;  2JZ1 A;  4AI6 A;  1R6R A;  3S14 J;  3ZMZ A;  3CJR B;  3F8F A;  2XFT A;  3D5L A;  2VOD A;  1STZ A;  3SEZ A;  3L2C A;  3HGY A;  1MBJ A;  2ZFU A;  3SAV A;  1I3A A;  1AIS B;  1OL2 B;  4PJL A;  2B0L A;  3NWL A;  2Q8K A;  2J5O A;  4BQQ A;  1VQ4 I;  4CCK A;  3GTQ J;  1XX5 A;  4BCI B;  2XHK A;  5FKK A;  4NB5 A;  2ADU A;  3ZQL A;  2RVC A;  1MMD A;  1V4R A;  3J7A O;  1JHF A;  1SFE A;  3CUQ C;  3EYY A;  4IBK A;  5IT9 S;  6PAX A;  2TRT A;  1MMS A;  4LF8 M;  2CQ7 A;  1FJL A;  3U1K A;  3HGI A;  1U8B A;  2B9R A;  3J27 B;  4E7Z A;  2KIM A;  1JKP C;  1JGS A;  5DYG A;  4XRS A;  3LSP A;  3BR2 A;  1IY2 A;  3B6A A;  1VEG A;  3OYM A;  3GQ4 A;  4BY1 X;  2ZFW A;  1R22 A;  3DEW A;  3GLX A;  2EUF A;  2KNA A;  3WHK A;  3OYL A;  3K2Z A;  3H9J A;  2LKX A;  3RPU A;  2PG4 A;  5IYC J;  3TGN A;  2FXA A;  4ZYD A;  1OCR H;  5FRM A;  3CCV I;  2WWY A;  1B4A A;  3GLH B;  3FMR A;  5IP7 J;  4CXF A;  4CHT B;  2FBK A;  4A69 C;  4II5 B;  3EYI A;  5EDN A;  2E36 A;  3HSF A;  3BRO A;  4KA4 A;  1NO1 A;  4HF1 A;  5JVG F;  3CDL A;  3K2A A;  5E1W A;  1MD0 A;  1X1D A;  4BJ5 C;  4KT5 C;  2KDZ A;  1JR3 E;  1PP8 F;  2ZAM A;  2M8G X;  2KDL A;  3FTC A;  2PMI B;  4G3O A;  2F5E A;  3AG3 H;  1VQN I;  3SAS A;  1IRF A;  3HRM A;  3MZY A;  3W0L B;  1LQ1 A;  2BZT A;  3AG4 H;  5ACB A;  2UXC M;  3OIO A;  4LGY A;  4M73 A;  1X1B A;  2XPW A;  1AWC A;  5E3N A;  3EJ1 B;  2WAF A;  1PJS A;  1WGX A;  2HI3 A;  2PN6 A;  3GBG A;  3RGP A;  2W9Z A;  4YHH M;  4AD9 A;  3DU5 A;  1LFP A;  5FFZ A;  1WXQ A;  4NRV A;  2HZD A;  5EG0 B;  2HVS A;  3CZ6 A;  2BHY A;  3CF6 E;  3OL4 A;  1YOV B;  3SEQ A;  2XSZ D;  1XGO A;  1FP2 A;  3I64 A;  4MFE A;  3FHZ A;  5HDK A;  2QDY B;  1C9B A;  2LBC A;  2K7L A;  3HEF A;  5BMZ A;  3ISP A;  2QSF X;  3QPT A;  1LEB A;  4DV0 M;  1TQI A;  1HSJ A;  4EC9 B;  1MGT A;  2DFF A;  1GLN A;  1VEK A;  4XIC A;  3C3W A;  4XMY A;  5J47 A;  4Y15 A;  2Y48 A;  3OR1 C;  4DIQ A;  1SG9 A;  1I94 M;  5KAI C;  1ONV A;  3W68 A;  2EJR A;  1ZKG A;  3BG7 A;  1M1E B;  2K4B A;  2P7C B;  2VAS A;  3GZ5 A;  3GPX A;  2XGC A;  4HG2 A;  5DCM B;  2ZPH B;  1QAO A;  3KOW E;  4F7L B;  2F48 A;  2V26 A;  1SMY F;  3BR3 A;  4AC0 A;  3VPR A;  3HHH A;  2P0W A;  2WMA B;  1HT1 E;  2STT A;  1X2M A;  3KP7 A;  1NK2 P;  5F0C A;  4F2L A;  1R1U A;  3QP6 A;  3LAJ A;  5CEI B;  2HDW A;  5DUI A;  2HFH A;  3TN8 B;  4UY8 I;  4K2E A;  2ZC2 A;  5HNH A;  4IJE A;  2L9R A;  4I09 A;  3CMY A;  2DA2 A;  2JT1 A;  1OIS A;  1ERD A;  3BJ6 A;  4B09 A;  4BY7 X;  4JI7 M;  4BDZ A;  3U21 A;  3W2A A;  3DEU A;  1XXH A;  3WTV C;  1D0K A;  1YX3 A;  2Y0S N;  3M9A A;  5K7H A;  3FXR A;  1SXJ D;  1Y56 A;  3MKZ A;  4EEF G;  2JRT A;  3ABL H;  2QLZ A;  3L09 A;  4CCN A;  4XRM A;  4B3M M;  1IRX A;  5HOD A;  3CJQ B;  3QPH A;  2Y21 A;  1MBH A;  4OMY A;  4TV7 A;  4A93 J;  4FX3 B;  4L5E A;  3S1M J;  3HRS A;  4F52 A;  4B3R M;  4PSW A;  1B8I B;  1R5L A;  4F7J B;  1FYM A;  4G4N A;  2R92 J;  1N34 M;  4W5W A;  4JI1 M;  5KCM A;  5L3F A;  1I50 J;  2MC3 A;  5FTM A;  3K4L A;  3ECH A;  4DR1 M;  2MA3 A;  1ZR4 A;  3G71 I;  1HQC A;  3ASO H;  3HKZ N;  3FIS A;  3ABU A;  1WFX A;  2DA6 A;  4GKJ M;  4AU7 A;  3DPL C;  2ZXJ A;  3WHB A;  1YTY A;  5CLS A;  4IOA F;  2APL A;  3VYT B;  2YFQ A;  1IBL M;  4D5F A;  3CES A;  2VON A;  3MFK A;  1W0T A;  3HDD A;  3RKQ A;  1CGP A;  4YFX F;  1HR0 M;  2FA5 A;  2R7Z J;  1NJF A;  4BCK B;  1A5T A;  1PDN C;  3S15 J;  4LF4 M;  5IPA A;  4XKB A;  4A3G J;  5HVY B;  2ME6 A;  2VQC A;  5EFQ B;  4JI6 M;  1JKR C;  2QBY B;  5D4R A;  2FRH A;  1HW1 A;  4AVP A;  3HOX J;  2UUE B;  1D0M A;  4MGZ E;  3EID B;  3SXY A;  1R4G A;  4PDI A;  2XGX A;  5F04 A;  1B8I A;  4BEH B;  3A03 A;  4MFD A;  3PVS A;  2KRH A;  5FLX Z;  1SXJ E;  3JRE A;  2ZJP F;  1FLI A;  2BWB A;  2AXL A;  3CJT B;  4NBQ A;  1GVJ A;  1VEJ A;  1XC5 A;  3CUQ A;  4OAZ A;  4U0V A;  5JFR A;  1K79 A;  1O9K B;  3CDH A;  4B44 A;  3RE8 A;  1PRB A;  4UUS A;  1VQK I;  4MGH A;  5L8R F;  3TNW B;  3UJN A;  2EJS A;  1YYV A;  2KRF A;  1V3F A;  2EV0 A;  5DFL A;  1X2N A;  1WHU A;  4E6K G;  1J5E M;  3M07 A;  3L2A A;  4FD2 A;  4CYC B;  4OVZ B;  2IA1 A;  4LJ6 A;  4PJ0 C;  4UXN A;  1JE8 A;  2K9M A;  4A0Z A;  1BVS A;  2HEO A;  1N36 M;  1WI9 A;  1O3R A;  4BKX A;  1TLH B;  2RQP A;  3WU2 C;  3TP3 A;  3BJA A;  2ZCF B;  1CF7 B;  2P81 A;  3A0B C;  3FK6 A;  3I56 I;  4ZGD B;  1Y6I A;  2XRN A;  4DZJ A;  4Z6Y A;  3B7N A;  2V6E A;  3CC7 I;  5F64 A;  5EYR A;  2EFN A;  4RB3 C;  2XRO A;  4PGH A;  4I5S A;  2FBI A;  2GBY A;  4P96 A;  5M5W J;  1S3J A;  2L9N A;  2G5G X;  3KYD B;  3KDS E;  1V5E A;  3S3O A;  5K5R A;  2HXO A;  1QZZ A;  1ETX A;  3I53 A;  4CCO A;  4IHY A;  2ZPF B;  3TE6 A;  4IPA A;  2R7U A;  1JI8 A;  1G41 A;  2DAK A;  3H5R A;  1FMW A;  1JUS A;  1WJC A;  2K9S A;  2VBW A;  2EA0 A;  5ILS A;  4EOO B;  1DO0 A;  3U61 B;  1YJW I;  1G3I A;  4M9Z A;  3HOT A;  2HS5 A;  3S3M A;  1SVO A;  5D8K B;  3FE3 A;  4MTE A;  1KU7 A;  4RLQ A;  2R7Q A;  2K47 A;  3FXQ A;  1GXQ A;  1RR7 A;  2EPF A;  2EZI A;  1R71 A;  2C5N B;  1QAQ A;  1XN7 A;  1XO2 A;  1P7J A;  5BPD A;  2YS9 A;  2Z5U A;  1ETY A;  2KT0 A;  3GFJ A;  4YEL A;  3ZQG A;  1BIB A;  1KGS A;  4S05 A;  1Z21 A;  2XH9 A;  3BY6 A;  2FSW A;  4M72 A;  4HNV A;  2WY8 Q;  2J7O A;  1WGN A;  3G73 A;  3QWL A;  4HNU A;  1LE8 B;  4GYG A;  1OCO H;  4H4K C;  2LVN C;  4KN7 X;  1IZ1 A;  4PD2 A;  2XAH A;  4FCW A;  5LBQ A;  3TWL A;  3GUD A;  2F2E A;  4HV5 A;  3W6K B;  2G77 A;  3LWF A;  2HYG D;  2WAQ N;  2Z16 A;  4G4R A;  1XGM A;  3KLO A;  3TDU C;  1JJ6 C;  4BBR M;  1BI0 A;  1PUF B;  1KFV A;  1R23 A;  4YOZ A;  4LIT A;  1K3W A;  2GXB A;  4I7H A;  2ZJR F;  3VYH B;  3MMY B;  3EUA A;  4F3Q A;  1Q39 A;  1R1T A;  2IJL A;  3NAR A;  1Y0U A;  3SZG A;  1QNT A;  4PJM A;  4IF4 A;  1OGU B;  2G7U A;  4FTH A;  3WG7 H;  1TW2 A;  2UUA M;  4A12 A;  1NJG A;  3GTP J;  4BCM D;  2PQ8 A;  4IJF A;  4C3I J;  3KET A;  4IBB A;  3UGJ A;  5DYI A;  3BTJ A;  1VTN C;  4BCQ B;  3SDB A;  2J5P A;  3ABT A;  4FWH A;  2W96 A;  3GLG B;  2EZK A;  3CQZ J;  3CCU I;  1ACI A;  5BNG A;  1H9G A;  4RBO A;  2PEX A;  4XID A;  2JA2 A;  2RDP A;  2LH0 A;  4BUP A;  2F5V A;  3HJQ A;  1U2W A;  4B08 A;  5EF6 A;  3I04 M;  3CUO A;  1UNL D;  5FGK B;  1X3W B;  5FTN A;  3LSJ A;  4QSH A;  1PGY A;  4NSR A;  1I3Q J;  3B7Q A;  3H3V K;  3IG8 A;  3K1J A;  3ZC7 B;  8CAT A;  3F8N A;  5D5X B;  1RET A;  4AWX B;  3G4S I;  2YU9 J;  2KHH A;  3A8G B;  2A6E F;  3H4M A;  4WUR A;  1Z9C A;  2ZNZ A;  3U1D A;  3GRV A;  4KRC B;  2BNK A;  2DWN A;  1WJF A;  3LST A;  1G3Y A;  3NAU A;  3RKX A;  4NXM M;  1IQP A;  4DR6 M;  2EIK H;  2W7N A;  1VDD A;  2BKZ B;  3FTF A;  4BCP B;  1NSF A;  2XPU A;  1RRJ A;  3DV8 A;  5DM6 F;  3E5Q A;  1R6B X;  2Q1Z B;  4XON A;  3SFI A;  2VBX A;  2ZXH A;  1ZMV A;  1O3S A;  2CE7 A;  2CQK A;  2BOL A;  2HGC A;  3B02 A;  4HX4 A;  2DOE A;  2QQ8 A;  2KMG A;  2CP8 A;  2W00 A;  4JX6 A;  1L3L A;  2X4H A;  4NUB A;  2G9W A;  1MND A;  3L28 A;  2KMU A;  3P7N A;  2KJB A;  3VK8 A;  1UST A;  4CO8 A;  1FYK A;  2FU4 A;  3LCV B;  2O0Y A;  3RGS A;  2E7X A;  1SXJ C;  4XNF A;  1B72 B;  2V1D A;  1BC8 C;  5IT9 K;  3I55 I;  4KIS A;  3U6S A;  2F5C A;  2QGS A;  3RYP A;  3GLH E;  4WP2 A;  3KS8 A;  2DAI A;  2R5Y A;  5IT9 Z;  3V76 A;  5CQG A;  1W5T A;  2E60 A;  3LA7 A;  5E6J A;  1FP1 D;  5E3L A;  1FYL A;  1IUF A;  1JQJ C;  1BOB A;  2XF5 A;  3KP3 A;  1D0L A;  2C5V B;  1OR7 C;  1KU2 A;  4JP0 A;  3E6C C;  4E7I A;  3F5X B;  2M34 A;  1YIJ I;  1CF7 A;  3M6A A;  4LRS A;  2VC1 A;  2W57 A;  4CUG A;  2I40 B;  3BJO A;  1FC3 A;  2R0Q C;  1NK3 P;  4ZGJ B;  4EON B;  2EK5 A;  4XLH A;  3I4Y A;  1QO0 D;  1YSY A;  1UHM A;  1N75 A;  2BXY A;  2WBM A;  4MEY F;  2YPR A;  1AIP C;  3CCS I;  4ENK A;  1TW3 A;  2XAJ A;  1YW7 A;  3K2L A;  4G8X A;  3HZJ A;  2VKH A;  3M1E A;  2X6O A;  2PMZ A;  1D3Y A;  1TTY A;  1O7F A;  2AQE A;  3HIF A;  2CRG A;  7CAT A;  1MH4 A;  4XGI A;  1EA3 A;  2QYO A;  1T8I A;  1JT0 A;  5M3F J;  5F08 A;  3DJB A;  2DJI A;  3JCU C;  3B74 A;  3EUK L;  5FLM J;  4IBD A;  1IY1 A;  3ONQ A;  4DV4 M;  2HWJ A;  2CW8 A;  4BEH A;  5EP1 A;  4ASN A;  2HDD A;  3TNI B;  4JI2 M;  2LKP A;  2L4M A;  3PFY A;  2XEP A;  2RNJ A;  3RTR A;  2A68 F;  4KN4 X;  1ENW A;  1L1Z A;  1VND A;  1H25 B;  4Q47 A;  1FOY A;  4RDU A;  4G7Z F;  4NC6 A;  3PUF A;  5D5V B;  2R5Y B;  1KYI A;  3T15 A;  2OJE D;  4I4L A;  1WR1 B;  4A3J J;  2W1O A;  5D6E A;  4M0D A;  3MD2 A;  2L6O A;  1HF0 A;  2B7E A;  1B72 A;  1LVK A;  1O3T A;  3GTG J;  3RZD J;  4CFM B;  1EH6 A;  1OTR A;  1Z5B A;  3SAU A;  1YX5 A;  2DFH A;  5CVR A;  2CZ7 B;  2LRD A;  1Y1V J;  3VFD A;  2Y0Q A;  1YIT I;  4JYK A;  3KSX A;  3F3X A;  3HRU A;  4RM3 A;  2Z4R A;  1EKE A;  2G0E A;  2M1B A;  4EIW A;  5JR3 A;  3S1R J;  2CU7 A;  3BTI A;  2ZJQ F;  1EJ9 A;  1P9Q C;  2F5Q A;  3QYG B;  1ZGW A;  3GO8 A;  2GM4 A;  4CFW B;  4XQF A;  4F93 B;  3FUT A;  1T33 A;  2ELH A;  2LSO A;  3RKY A;  1HKQ A;  2FH0 A;  2H94 A;  2VPR A;  4JQF A;  4FM4 B;  2M3A A;  3MMP A;  1V33 A;  2NS7 A;  4RAF A;  1W98 B;  3E46 A;  3E5X A;  2ECB A;  3D8L A;  4DV1 M;  3WG9 A;  5J40 A;  2ZME C;  3I58 A;  3A8H B;  4UVB A;  4RKU F;  1MSF C;  4GCV A;  1D8K A;  2MLG A;  2DD5 B;  2G9X B;  4NHJ A;  1UCR A;  1E94 E;  5CVI A;  3HU3 A;  1RKW A;  1SD7 A;  5J8C A;  2WTE A;  4XM3 A;  2RRU A;  4LZJ A;  2HU9 A;  3BTL A;  1CUK A;  4GIP A;  4HA8 A;  3WU0 A;  5HS8 A;  3CCM I;  3OYI A;  4C9Y A;  1YS7 A;  1N78 A;  2DYR H;  5EGO A;  2I7N A;  3A4C A;  1Q1H A;  3L2R A;  4ZZL A;  4JX5 A;  3CTA A;  1P4W A;  1L2D A;  4PSX A;  5HOO A;  4HRI A;  1MBF A;  3GTM S;  1OIZ A;  2VQE M;  2VBZ A;  3JR5 A;  3M03 A;  4I0A A;  1RI7 A;  1UFM A;  2R7F A;  4RGR A;  1FPQ A;  3WTS C;  1ZQ3 P;  3KZZ A;  3K4K A;  1G4A E;  2D7G A;  4HAM A;  2QSH X;  2OTJ I;  2KPM A;  1IN4 A;  1HT2 E;  3GFM A;  4A0X A;  3AOE A;  3KCC A;  1UFZ A;  2OZ6 A;  4ZZD A;  1SVL A;  3OYG A;  4NOO B;  3U60 A;  3SMS A;  2W82 A;  4I76 A;  4AZF A;  3HUG B;  4BH9 A;  3DOA A;  1YFH A;  2WAQ A;  3GO5 A;  3I9V 2;  1OR7 A;  4I99 C;  2ZME B;  3FXM A;  1JB0 F;  3IL2 A;  4DBQ A;  5LHG A;  2R44 A;  2BV6 A;  4DV2 M;  2CUF A;  1K78 B;  2DWL A;  3LVV A;  5EXT A;  2BGC A;  2Y0T A;  2HL7 A;  2UV1 A;  1S7O A;  1BL0 A;  1XB2 B;  1XMQ M;  1B9M A;  4GC9 A;  4IRG A;  4D0P A;  1YJ9 I;  5BPI A;  2CJM B;  3VYS B;  1QPM A;  2RNG A;  3I59 A;  4AIH A;  1SVM A;  2YSR A;  4MM3 B;  4Y33 A;  4GH9 A;  5IF1 B;  3K9T A;  5D5U B;  3A2K A;  2EIM H;  2DAE A;  2L4E A;  1QZY A;  2BPM B;  5ICC A;  2MD0 A;  3KOX E;  2KRC A;  1I5Z A;  4IEJ A;  3FHN A;  2LLK A;  5E1Z B;  1PUE E;  2JWT A;  2CH0 A;  2DO7 A;  3W67 A;  2JK3 A;  3H0G J;  3FMS A;  5DDG A;  3HOW J;  3Q0U A;  2C99 A;  3JRF A;  4UNO A;  3HJ8 A;  2XFS A;  3TOA A;  4CFV B;  3FXL A;  4RAY A;  9ANT A;  1WJD A;  3BPX A;  3OV8 A;  1D5Y A;  3EUH C;  3BHV B;  4F91 B;  1TH2 A;  1UNG D;  2DN0 A;  3E1S A;  2EQR A;  3GF2 A;  2V4J C;  2OQG A;  3NBX X;  3OR2 C;  1WQ2 A;  2V9K A;  3LSM A;  1OJL A;  1RNL A;  2IGK A;  4D81 A;  2HHH M;  3FKI J;  5L3C A;  1UG2 A;  4R3D A;  4P5O A;  4L9J A;  5GAH J;  3CTW B;  3ABM H;  2JPC A;  2MSY A;  2FFJ A;  1D2N A;  1RZ4 A;  3M4O J;  1TC3 C;  1JUP A;  3WTX C;  5LLQ A;  2XPV A;  1GO5 A;  1XXH E;  1YE9 A;  1K83 J;  3Q0W A;  1OI9 B;  1QDR A;  2HKX A;  3PXG A;  2BEO A;  4P9F A;  1GH6 B;  2XLJ A;  2KL4 A;  4WF2 A;  3HY5 A;  2K40 A;  5DYM A;  1BA5 A;  3BLH B;  2YU3 A;  1G3T A;  1RES A;  3QU3 A;  2F4V M;  4BQN A;  2KRK A;  4NNJ A;  4MO7 A;  4I8O A;  3OIQ A;  4LD5 A;  3HC7 A;  2DD4 B;  4CSW A;  2CWB A;  3ERM A;  3QZ9 B;  3RIR A;  1KQ8 A;  1OCT C;  1A35 A;  3B6C A;  5F1J A;  3TNH B;  2EH3 A;  3HKZ A;  1E2X A;  4YIR X;  1DPR A;  1HJP A;  4B7H A;  4IRI A;  1KA8 A;  4XLP F;  3W2V A;  4FE4 A;  5EGO B;  3TED A;  1AKH A;  2JY7 A;  4BL0 B;  2XC7 A;  1LE8 A;  2DTZ A;  3H4C A;  4ZC3 A;  4JBA A;  4M0W A;  2BY3 A;  1ZYR F;  1FIA A;  1X1A A;  3QPS A;  5H6R A;  4B1R A;  4M6Y A;  2QSG X;  1O9K A;  5IP9 J;  3J81 Z;  3DA1 A;  5DNY A;  3GRU A;  4WXD A;  2R7R A;  1J09 A;  3H4J A;  4FCY A;  2YX4 A;  1F5T A;  1P5E B;  5ICP B;  2KZU A;  5EZG A;  1ZTR A;  2Z3X A;  3K4N A;  5HVQ C;  3CCQ I;  1A6I A;  1TT0 A;  2BYV E;  4A3I J;  3A8L B;  3H0D A;  1FIP A;  3DPU A;  1QVR A;  2M0C A;  3C2B A;  1FMV A;  3U60 B;  1V5G A;  3OTO M;  3L2V A;  1LPQ A;  2P7V B;  2WMB B;  4UN0 A;  5DQW A;  2BS3 A;  1GJT A;  4F6U B;  1PM5 A;  4CCJ A;  3FTD A;  3I54 A;  2L7M P;  3MQ0 A;  1U8R A;  2IS4 A;  2XVC A;  3U6M A;  3OYJ A;  1EF4 A;  3AOG A;  3MIA B;  1XCB A;  3FXJ A;  3HJE A;  5FTL A;  2KJC A;  3HL2 A;  2CJJ A;  1H27 B;  4ZDP A;  2DI3 A;  3IUO A;  2ZM6 M;  1OCZ H;  2DPP B;  3E7L A;  4AUX A;  2L02 A;  1SC7 A;  2JWS A;  3H5N A;  1VQP I;  5EG0 A;  3WTU C;  1Z0X A;  3I5U A;  3R0A A;  2N35 A;  3U6D A;  4II7 A;  4XSX F;  3TW7 A;  3S1Q J;  2PFB A;  4CRL B;  4KOD A;  2PJP A;  5LFA A;  5KPR A;  1ZAO A;  2M4K A;  3V8K A;  3GVA A;  2NVY J;  4C2T A;  3OL3 A;  2MH9 A;  2V22 B;  4DUY M;  1IFY A;  5D4S A;  1XHB A;  4AYB N;  5IOY A;  4QPQ A;  5JI2 E;  2IVX A;  3ELK A;  4E7L A;  4HX8 A;  3QQA A;  1MN3 A;  3BQZ A;  3ZN1 A;  4BCF B;  2HYJ A;  5LGN A;  1O3Q A;  4GHL A;  2JGZ B;  3HHG A;  3W6V A;  2IEK A;  4HBL A;  1TGU A;  3BOQ A;  3DKY A;  3V7C A;  1E7P A;  2X48 A;  4A3C J;  1BN5 A;  2ZME A;  1GT0 C;  4ROE A;  3I59 B;  1A31 A;  3IHP A;  5D5W B;  2DMP A;  2VIX A;  1VI0 A;  4BHC A;  1LDK B;  2G3Q A;  1MKM A;  4BQA A;  1T6S A;  3RQ4 A;  1IN6 A;  3B73 A;  4RGS A;  5J1U A;  1P3Q Q;  5J8F A;  1LKX A;  3GLL A;  3C9P A;  4I98 B;  1BOA A;  4M6V A;  2K4J A;  1J7K A;  4BNC A;  3HOU J;  3KYL A;  5C3E J;  4LMY A;  5IT3 A;  1TQP A;  3BC8 A;  3HHZ A;  3BQY A;  3FXU A;  3VDX A;  1JKO C;  4KRD B;  1WJ5 A;  3HPH A;  1X3Z B;  4I0B A;  3C2G A;  4GEW A;  2ISY A;  5FGM A;  1HNZ M;  3S2W A;  3VFZ A;  3ZMT A;  3JSP A;  4E7J A;  1QGP A;  4XRF A;  2HNH A;  3F0C A;  2WC2 A;  2X8A A;  3SJM A;  1FNN A;  4NL4 H;  3V8L A;  3BDD A;  3CMA I;  1DO2 A;  2CUE A;  1JJ8 C;  1UGS B;  1IXZ A;  2R6F A;  2HQ5 A;  3BR6 A;  1OAI A;  2EV5 A;  2NOJ B;  5BQT A;  5EXP A;  4HDV A;  2JA8 J;  1R5I D;  1N77 A;  4BCM B;  2CCI B;  2L4A A;  2DLL A;  2AS5 F;  2LTP A;  2WB1 N;  2JVH A;  2PX9 A;  3O8H A;  2OUM A;  4IKF A;  1IRE B;  2ZXW H;  2L54 A;  2XF3 A;  1HXD A;  4LZZ A;  1LEA A;  2MBF A;  2GNO A;  1Z3X A;  5E1X A;  1A36 A;  3F21 A;  3M7G A;  2UWM A;  1WH5 A;  3IAM 2;  5B66 C;  1OFI A;  5HBJ B;  3GLF E;  1SD5 A;  1MDM A;  4HPQ A;  1K7A A;  4LF5 M;  3JRI A;  3WVE B;  1OKW B;  2ZSI B;  2DK5 A;  2KFD A;  3K0L A;  4DV7 M;  5E3O A;  2FNA A;  4LY6 A;  3E9S A;  5IYB J;  3NDQ A;  1PJJ A;  4EM0 B;  1G6N A;  4DR3 M;  4D7N A;  2PHG A;  4HSR A;  1SXJ B;  5ITY A;  3H92 A;  4LB5 A;  4DJA A;  5LHI A;  2CZ1 B;  4BLC A;  4ROC A;  2O01 F;  1OCP A;  1A6Q A;  2IS6 A;  4PGG A;  2XAU A;  2WEV B;  2LK2 A;  1P4A A;  2LR8 A;  3A1Y A;  1VQL I;  3GME A;  1X3U A;  2VPL A;  2ECC A;  2VF7 A;  3CO7 C;  1V54 H;  2CWE A;  3CMM A;  1C0W A;  3DFG A;  2KKO A;  4N0B A;  2XF7 A;  2PLY A;  3EOC B;  2JZY A;  2XGN A;  1EIJ A;  3M1C A;  2AHM A;  3D5R C;  4YC3 B;  2RQQ A;  2EBI A;  1JXS A;  2DMT A;  3JRD A;  4IQJ A;  2M0M A;  2VC0 A;  2MD5 A;  1R5G A;  2XGE A;  2JSC A;  3J2P B;  3CP2 A;  2K86 A;  4LFA M;  4LIU A;  1K61 A;  1E9R A;  2ZNY A;  1V29 B;  3FTE A;  3E6B A;  2QCO A;  4MLO A;  3FKE A;  4ZJZ A;  2EFW A;  5IZ7 D;  5IP6 A;  1MJ9 A;  3PNY A;  5TRD A;  3P9K A;  3EUH A;  2W85 A;  2L7F P;  4GKK M;  3GWZ A;  1IF1 A;  2QQB A;  2ISZ A;  4C2M J;  2IW8 B;  4DUZ M;  3C3E A;  2YR0 A;  1T0F C;  3V4G A;  4DYQ A;  3PNV A;  2KEB A;  5DTD A;  4BCN B;  1H88 C;  3DTK A;  1PYV A;  1MDM B;  2GLO A;  2L7K A;  1H6U A;  2Z7J A;  4LLN A;  3OOU A;  5K7Z A;  1F36 A;  1POG A;  5F0F A;  5HLI A;  5C4J J;  1ORY B;  4JI0 M;  3MJ5 A;  4V2F A;  1ZG3 A;  2K6B A;  3FXK A;  2MLK A;  2NS8 A;  2L2D A;  2R5Z B;  1SAN A;  1LFU P;  5E79 C;  2H1R A;  4J01 A;  1LB2 A;  1D0Y A;  3GPU A;  1G8P A;  3MKW B;  1KQ9 A;  2MGQ A;  1YQA A;  4KUM A;  1G8X A;  4XOT A;  1Q1V A;  3UKG A;  1W4M A;  1LDD A;  3OSF A;  2XRL A;  4EJV A;  1F4K A;  3VOE A;  2F2C A;  4L9V A;  1GV2 A;  1LDJ A;  5DCM A;  1MW7 A;  3QYE A;  4S0H B;  4X6A J;  1QQW A;  1XGN A;  4RS8 A;  5KQ8 A;  3TP0 A;  3LSR A;  3CDI A;  3M8E A;  2L9S A;  4ELJ A;  2R7O A;  2XKO A;  3VSL A;  1P2F A;  4C30 A;  2EIJ H;  3SQN A;  1JKW A;  3H5A A;  4XLC A;  2DZO B;  3WE3 A;  5TJJ A;  1D1C A;  2RC4 A;  2ZTD A;  3AOE C;  3HTS B;  3CGW A;  5KO3 A;  3DOG B;  4GDF A;  2C9O A;  1YW9 A;  4RB0 A;  3DLL F;  4A3F J;  2ESN A;  2KLO A;  2CW0 F;  2DHY A;  3EQL F;  4RMN A;  2HQA A;  4AKG A;  3FUX A;  1GUU A;  1U5T A;  4PT5 A;  2VT2 A;  3W3C A;  4KIT B;  4YY3 M;  1J5Y A;  2DT7 B;  3U6E A;  1K6O A;  5J1Y A;  1BBY A;  2DXI A;  3DCF A;  3RPU D;  2DOD A;  4UHT A;  1H28 B;  3HG9 A;  1XB4 A;  3LA3 A;  2IN3 A;  4CYD A;  4XLN F;  1T56 A;  4BAY A;  2UXX A;  2YX7 A;  4C2U A;  3SZT A;  2I7P A;  3K4M A;  4L18 B;  5EXS A;  2DWM A;  4UUV A;  2XIG A;  3V42 A;  2VF8 A;  5LHH A;  3U61 A;  1I6X A;  2H27 A;  1G3W A;  2GWR A;  1GY3 B;  4Y28 F;  3U9G A;  1IDZ A;  4M9S A;  2F6C A;  1ZG5 A;  1W5C C;  2DA5 A;  2ACJ A;  1X4O A;  1NHW C;  2VQH A;  3EET A;  3BLY A;  1AOY A;  1UM8 A;  3HSE A;  1ZRC A;  3JRH A;  2Z9O A;  1U5T B;  3BXW A;  5ITX A;  3OS1 A;  4D1Q A;  1QHG A;  2VXD A;  3GLF A;  3G1L A;  2ZAN A;  4QIW N;  4EJU A;  2Q2E A;  2PBI A;  5CVV A;  2KIS A;  2R46 A;  3NQO A;  5DEQ A;  1HLV A;  1JTX A;  2J7N A;  2UZK A;  1MBE A;  2WPA B;  4ZGE B;  3T1B A;  1UZC A;  2GOM A;  1UG0 A;  3GLG A;  2LW4 A;  1SMT A;  2R0I A;  1UJ8 A;  5GKN A;  1GKI A;  1NNJ A;  2JRM A;  1KON A;  1BI3 A;  2EB7 A;  1PVE A;  4M3F A;  2C5O B;  2JNH A;  1AA7 A;  1HW5 A;  2HCB A;  1LV7 A;  4WK8 F;  2EA4 A;  1TF0 B;  1X37 A;  4I81 A;  2EZH A;  2F5S A;  4FCV A;  3OYN A;  1PUF A;  4UN2 B;  4O5V A;  4OMZ A;  3KOY E;  1F9N A;  3J7A S;  2V79 A;  2QHO B;  3PO3 S;  1AUA A;  1R2Y A;  2X9D A;  1TT5 B;  2L4F A;  3T38 A;  3KZI C;  2CHG A;  1V92 A;  1S7A A;  1G59 A;  3ZP5 A;  1FOK A;  5L3B A;  3IWF A;  3R6S A;  1MJB A;  1R2Z A;  4F7Z A;  1MBG A;  5JVT A;  1L2C A;  3CP8 A;  2IGN A;  2LF8 A;  3DKX A;  1YHQ I;  4LB6 B;  1MBK A;  4V19 K;  3K6G A;  1GHC A;  3VOD A;  4IXA A;  1A04 A;  3VKG A;  1OL1 B;  1BW6 A;  4LGW A;  5FB2 A;  2L7H A;  5L2W B;  1KSF X;  3AG2 H;  1B9N A;  2XUB A;  3OYK A;  2CCH B;  1I27 A;  2QBY A;  3K7A J;  3MVP A;  5DUK A;  2MR9 A;  2NQ8 C;  4JI4 M;  2JMW A;  4J00 A;  3JAM K;  2WAD A;  1XMO M;  2O8K A;  2XZF A;  3KEY A;  3RKW A;  2ZPE B;  1XMX A;  3U6L A;  3VYG B;  2DMN A;  2QQ9 A;  3QU6 A;  2VJ5 A;  4G7H F;  3E21 A;  3GTO J;  3GQ5 A;  3P9I A;  4PDK A;  2JA6 J;  5FSW A;  4B7F A;  3M8J A;  2UUC M;  2J5Y A;  3GFL A;  1NG7 A;  2HVQ A;  2ZAO A;  4BB9 A;  2OOB A;  3RSN A;  1VG5 A;  3B9P A;  1Z7L A;  2WAE A;  3S16 J;  4MGY E;  1IC8 A;  4BDY A;  4LLL A;  1QBJ A;  1RC9 A;  3D8B A;  4OIO F;  4BGD A;  4DV6 M;  5LMK B;  2IXS A;  5FLX S;  1KYZ A;  2LOO A;  4HLQ A;  1H24 B;  2M4G A;  4E70 A;  1IO2 A;  2C6T B;  2CQQ A;  3MCZ A;  3GLI E;  2V9V A;  2VKE A;  2D2W A;  4BCN D;  3JRC A;  4X1E A;  3GLG E;  1T95 A;  2KQR A;  3QHW B;  1K4T A;  3A8M B;  1QHH D;  3NBI A;  2K9D A;  3U5Z B;  5HLH A;  5ICE A;  4XN3 A;  3X28 B;  4A6D A;  2P5T A;  2BHZ A;  2XAF A;  5B1B H;  4HF2 A;  3T1Y M;  1K6Y A;  5CQE A;  5LQF B;  2V1C A;  1F43 A;  2A6H F;  5CVU A;  1QQI A;  3DL1 A;  2VJI A;  1T6O A;  2CS3 A;  4Y17 A;  4U7D A;  1TH3 A;  2N8G A;  1USS A;  1FJG M;  2VKD A;  2D5V A;  2EIL H;  4P17 A;  2QF7 A;  4GYI A;  4N4O B;  4FVM A;  4ZTF A;  4OB3 B;  1GAB A;  2Z99 A;  4CGZ A;  4LRT A;  2R7S A;  3CD6 I;  4EOS B;  3IAS 2;  2VJ4 A;  2MGW A;  4UV9 A;  3ZGK A;  2KXE A;  5E17 F;  3TMO A;  2Y30 A;  3JTG A;  1DPU A;  1DGR M;  2LHC A;  1S5L C;  5H6Q A;  2ZPB B;  4OGR B;  4XBO A;  1I39 A;  4ZYA A;  2CG4 A;  3FZV A;  4LF7 M;  4B8X A;  3N97 A;  4BE1 A;  2OAZ A;  1QDT A;  3M0E A;  1RPW A;  3NWS A;  4MH0 E;  2OOA A;  3L27 A;  3WGG A;  2M5W A;  4C3H J;  3HOS A;  3HUG A;  2E7W A;  4F1I A;  3K7A M;  1T3T A;  2QKM B;  1XG1 A;  3PQJ A;  1IXR C;  5F3W A;  4QLC U;  3ZQF A;  4M9X A;  1T39 A;  4ON0 A;  4U7B A;  3G6E I;  3DZD A;  4Q48 A;  2IP2 A;  3IKV A;  3OIP A;  3ZOB A;  1FOX A;  4NC8 A;  3Q5F A;  4L5I A;  3ZQH A;  1ZP2 A;  5JI6 A;  3JR4 A;  2BY2 A;  2P6T A;  2O61 A;  4FW9 A;  2PJR B;  3MAJ A;  1G3N C;  5ITU A;  2M60 A;  2VQF M;  2JP7 A;  1K82 A;  2NRA C;  1WJ7 A;  2R45 A;  1WKM A;  2KZG A;  3G1O A;  4AID A;  3COA C;  2X51 A;  1HNW M;  2W2H A;  2VB6 A;  2UUB M;  5L3D A;  3LSI A;  2WIP B;  3GZN B;  5C18 A;  4ESB A;  1ZLJ A;  3E0J B;  4FHT A;  4F55 A;  3EPZ A;  1XCV A;  1WHC A;  3CF5 F;  1BC7 C;  3PL8 A;  2ID3 A;  2QWW A;  1E17 A;  4ANR A;  5LMN M;  2UU9 M;  2MRO B;  3DU6 A;  1F1Z A;  4F7S B;  4ELL A;  3HKP A;  3ZCB B;  2ZZD B;  4RF1 A;  2GXG A;  4LJ9 A;  4WW0 A;  1SFX A;  1DGF A;  3IRQ A;  4FAS D;  5FJ8 J;  2M45 A;  2H8W A;  5BS6 A;  1ZEL A;  2RN7 A;  1YS6 A;  2OZU A;  2PK9 B;  4PFP A;  5GTH C;  2K3F A;  4L6V 6;  3IRR A;  2WB1 A;  4HOB A;  1OIP A;  2OCE A;  4BS9 A;  3CF2 A;  3LSK A;  2X0L A;  5DM7 F;  2QPA A;  4REZ A;  3H3U A;  3MKL A;  4LOC A;  2A69 F;  4I6Z A;  2DEN A;  2KIF A;  4XSZ F;  1APL C;  4JI3 M;  2EFP A;  4M3D A;  3L9F A;  3ZCO A;  1FVV B;  3Q9V A;  2ZBK B;  2DT6 A;  4DW6 A;  5ED4 A;  3SYK A;  2F5O A;  1U9O A;  2K85 A;  4K0K M;  4BXU A;  2F5F A;  4HST A;  1E3O C;  2X6Y A;  2JN6 A;  1OIY B;  4I2O A;  1ON2 A;  1AU7 A;  2UZB B;  2X4A A;  4KHP M;  4PJJ A;  5K1Y A;  5FTJ A;  3H35 A;  1IJW C;  3DBR B;  5KK1 A;  4XLF A;  4B48 A;  4JXJ A;  2ID6 A;  3K1M A;  3RYR A;  3G33 B;  1L0O C;  1O57 A;  3C2H A;  3IC7 A;  2Z33 A;  2GXA A;  5GTI C;  5ITQ A;  1JSU B;  2LMD A;  5J1R A;  2LVS A;  1NH3 A;  1DGH A;  2UUZ A;  1U5T C;  2COB A;  5D8L B;  2L9V A;  1DGB A;  2HTS A;  3H9G A;  4XN0 A;  3HX3 A;  1QUS A;  1HKS A;  3GLF B;  4LLG F;  4A3M J;  1R4M B;  2FMY A;  2ZBK A;  2D1V A;  1R7R A;  2QEN A;  3AKZ A;  2LDU A;  3POM A;  5EQT A;  4JI5 M;  3ZQJ A;  2FD5 A;  2K27 A;  2WV0 A;  3BZC A;  5C44 J;  4HQE A;  2Z4S A;  1AKH B;  1U9N A;  2HPM A;  3B89 A;  2DFI A;  1QYR A;  3VSK A;  1AHJ B;  2C9C A;  5E18 F;  1VQ9 I;  1ULY A;  3KP6 A;  4RLF A;  1UGQ B;  2KZV A;  3TOB A;  1RUO A;  4OWR B;  3P9C A;  4OIR F;  3F23 A;  2KW0 A;  2ICW G;  1AD6 A;  4G6Z A;  4EMS A;  3OY9 A;  2HWV A;  2VJJ A;  4OOI A;  2IS2 A;  3PO2 J;  2Y2Z A;  1TDZ A;  1Z91 A;  1TWG J;  3N05 A;  2OTL I;  2W99 A;  3SDG A;  4CZC A;  3WGI A;  2OPF A;  1BR1 A;  3BG3 A;  4DYR A;  2W25 A;  4OW0 A;  4AW4 A;  1B6A A;  5ITR A;  3J80 S;  3C7J A;  3L29 A;  1DV0 A;  5HDN A;  2UXD M;  2IW9 B;  1LTM A;  1FX7 A;  4IOC F;  3E5U A;  3J7Z I;  3ZH9 B;  3ZQI A;  5FLV A;  4B3A A;  3K9O A;  2Y20 A;  1ORK A;  4EM1 A;  2K9Q A;  3I4V A;  1FOW A;  1BW5 A;  4KIC A;  4CDG A;  3MKY B;  4IBI A;  2DZL A;  3WOD F;  1IXC A;  2V6Z M;  3FWE A;  3N4M A;  3HHT B;  1GV5 A;  3EIH A;  4B4C A;  1Y39 A;  2V1X A;  4KT6 A;  1MU5 A;  5IHY A;  1XDU A;  5HS7 A;  2L2O A;  2H1K A;  1IV8 A;  3ZMU A;  1NHG C;  3CF0 A;  3B7Z A;  1BIA A;  4ZDL A;  3F22 A;  4KDP A;  2RKH A;  3DTE A;  1DU0 A;  4CYC A;  1HKT A;  2W9F A;  3CME I;  1R49 A;  3PO3 J;  2CEA A;  2FS1 A;  3UNG C;  3K8Z A;  2ELK A;  2VII A;  5EEH A;  3LOC A;  1GUX B;  2O8X A;  2H6C A;  1R9T J;  2WA0 A;  4LK0 F;  1H89 C;  5ICF A;  2EV6 A;  2VE8 A;  2WFY B;  1WJA A;  3VKH A;  3DDP B;  1R58 A;  3HBL A;  1WI3 A;  3ZQC A;  4PDG A;  1SD6 A;  3DXJ F;  3TDZ C;  3CJN A;  4AQY M;  3WTY C;  4U88 A;  1OIU B;  1X19 A;  2QVO A;  5HNB B;  4NST B;  4DZP A;  1U6G A;  2XDV A;  3AL0 B;  3S3N A;  3QYB A;  5ILV A;  5F1R A;  5C1B A;  3TWM A;  3K4C A;  5TGT A;  3KP2 A;  5FFX A;  4KO8 A;  4C3J J;  4DYC A;  3IV5 A;  2OC6 A;  3DFZ A;  1E3H A;  1R7J A;  1GVD A;  2XAG A;  4KMU X;  4XKV A;  5A2Q K;  2HOT A;  2CRU A;  5CYV A;  4WCG A;  3OYA A;  3LFU A;  3A01 B;  3HWS A;  3UK6 A;  4BHB A;  1NHA A;  1VZ0 A;  2B9S A;  3GRR A;  1Z7U A;  2FOI C;  1IY0 A;  4HV6 A;  2C5R A;  3MEX A;  5J3L A;  1RIO H;  2PI0 A;  2M30 A;  2WSC F;  3VDP A;  3MY5 B;  3ERE D;  3C58 A;  3GTJ J;  2JUC A;  2F5N A;  2JY6 B;  4XKC A;  3JR9 A;  4F92 B;  2DQL A;  2O9L A;  3K1P A;  5KHD A;  1TWH J;  3EDP A;  2CFX A;  2P5L C;  3X24 B;  3TL4 X;  1I1G A;  3SMP A;  2HPI A;  4PFO A;  2Q0O A;  4GHA A;  1MMA A;  1BR2 A;  2LXE A;  1XS9 A;  1O7L A;  2FBH A;  1QZM A;  2H6B A;  2Z3Y A;  3O0G D;  3MN2 A;  1X1C A;  3WTW C;  1URC B;  2DQR A;  2M5Z A;  4PJN A;  1ZAE A;  2AHQ A;  3RDI A;  2C4G B;  2CUZ A;  5KAF C;  2LRE A;  4BYY A;  4J19 A;  3LSH A;  4IBF A;  1Q3C A;  4MNU A;  1FTT A;  2DA4 A;  2E5Z A;  4Q7J A;  3H36 A;  2QDJ A;  5JLX A;  3KP0 E;  2JPB A;  2E34 A;  4BQO A;  2X6W A;  5GPC A;  1OKS A;  4A0Y A;  1YI2 I;  2YQZ A;  4ZTJ A;  3RJP A;  3K92 A;  4AKI A;  2D7E A;  1V34 A;  2LVA A;  2O5R A;  1FBQ A;  2MH8 A;  4QHT A;  4YOO A;  3WTT C;  2IGO A;  1VDL A;  4CFU B;  3A0H C;  4B3X A;  5GP9 A;  4G4Q A;  3T5X A;  1IV6 A;  2YR2 A;  1G4D A;  3QYH B;  4DR5 M;  4CIS A;  2PJQ A;  1JKQ C;  3KS4 A;  2I53 A;  2BW3 A;  3K10 A;  2VE9 A;  1EE8 A;  3RFW A;  2A05 A;  3DLA A;  1S9H A;  2XF6 A;  2XB5 A;  1YLF A;  1FSE A;  3MI9 B;  4KFC A;  1G2H A;  2AXT C;  3U6P A;  2LY9 A;  2PK2 A;  1T43 A;  1WZ2 A;  3OOP A;  3GEZ A;  4PUS A;  1Y0N A;  2L09 A;  3R8F A;  4YOS A;  3BCB A;  2F4O B;  4CIC A;  4QNM A;  1ETK A;  2B3T A;  3D1N I;  5CVJ A;  5HDG A;  4IHX A;  3R9X B;  2ZPI B;  3TQN A;  1BI2 A;  4R79 A;  4QNR A;  3KHI A;  1SXJ A;  1HOM A;  5ILU A;  3J80 K;  4JYA M;  2AHJ B;  2RGH A;  4D7M A;  2Z2S B;  2X1E A;  4QTR A;  1VQ1 A;  4UV8 A;  1HCR A;  4WXC A;  2EFO A;  3TPZ A;  4LF6 M;  5FKM A;  5AIQ A;  1OLT A;  2Q2E B;  3ECO A;  3AFH A;  1D3U B;  3JRA A;  1XSD A;  1GVN A;  3DTI A;  2EO2 A;  3FK7 A;  2JJ7 A;  2YNM D;  3VYR B;  2XV4 S;  2DYS H;  4BJT A;  1JGG A;  2NYX A;  1WRJ A;  1YW8 A;  3SAR A;  1ZK8 A;  1WJB A;  4Z2Y A;  4ZDO A;  4HL4 A;  1D1B A;  3X26 B;  2NAZ A;  2QKL B;  5JLW A;  1T2K A;  1H26 B;  1OQY A;  1UHW A;  3Q0V A;  3CLQ A;  2GIV A;  2TCT A;  3BG9 A;  4L0Y B;  1WGL A;  2CGP A;  2D7H A;  2UXN A;  2BWE A;  4G6Q A;  4IX7 A;  5LGU A;  3BLR B;  3I4N J;  3QOE A;  2EUC A;  4XL9 A;  2LVP C;  3R4K A;  4GMQ A;  4A3V B;  3SAT A;  2X1C A;  1L2B A;  2MH2 A;  5FO5 A;  4BHP A;  5KPZ A;  5DS9 A;  2P5K A;  1Y8R B;  2FML A;  3FX3 A;  3CC2 I;  2NVT J;  4XBF A;  2BY1 A;  3HHW A;  5EP2 A;  3D5S C;  2NOG A;  4RAZ A;  5LGT A;  2L7Z A;  5I5Z B;  1SD4 A;  2ZPG B;  3GPP A;  2ERC A;  3FUU A;  3HHY A;  3MZH A;  4O6J A;  2C96 A;  4LJ8 A;  2V1N A;  3G2B A;  5CKT A;  4P55 A;  2FX0 A;  4O3M A;  2FE8 A;  3CC4 I;  4CFN B;  1TZL A;  1H9T A;  3J7B A;  3Q8G A;  5J4V A;  2P8T A;  1MNM C;  1N33 M;  1TR8 A;  1PP7 U;  1REP C;  2R18 A;  4ITQ A;  2K0B X;  2O3F A;  2PMZ N;  3T8R A;  2JA7 J;  4EOM B;  4RF0 A;  1BM9 A;  1FBU A;  4HLX A;  2LC2 A;  5GPA A;  4B43 A;  3BHU B;  4FIS A;  2DA7 A;  4N9I A;  5IWA M;  2L0K A;  4U87 A;  1PJR A;  2HZT A;  3MZ8 A;  3R61 A;  3S32 A;  3CCJ I;  4BBS J;  5K5O A;  3UR3 C;  4IL6 C;  2CW7 A;  1HST A;  1PJQ A;  1SAX A;  4HYE A;  3OYH A;  1TDH A;  3JW4 A;  4Y13 A;  1W36 D;  2EKF A;  3TKY A;  4B47 A;  1XNQ M;  3DBL B;  3HPG A;  1U78 A;  4UVC A;  3QZ5 B;  2DAG A;  2DDB A;  1OYI A;  4BCQ D;  2GIZ A;  2LBF A;  4DR2 M;  3PIO F;  1TWF J;  4HEA 2;  3ZN0 A;  4GFB A;  4L16 A;  2ZKZ A;  3HGG A;  1ETQ A;  4BCH B;  4GRI A;  4G12 A;  3GLI B;  1IW7 F;  3L25 A;  2DTR A;  1IBM M;  4RM2 A;  1W7P D;  2R4G A;  2L7I A;  1OYW A;  4FX0 A;  4FCT A;  5M5Y J;  4I02 A;  3C1D A;  4HEO A;  4M71 A;  3L2Q A;  4EOK B;  1ENH A;  1ZN2 A;  2DFE A;  2MFZ A;  5FRN A;  4A3E J;  3Q9S A;  4MQV A;  5FD6 A;  1XDS A;  2LHG A;  3FDY A;  4UUS B;  2M8E A;  3K1N A;  5HQ0 B;  1P92 A;  2QNJ A;  2DW4 A;  1RU3 A;  2HQN A;  2RV8 A;  3NWT A;  5GAG J;  2QZ8 A;  3VYU B;  5EEA A;  4F7N B;  4W97 A;  3DTO A;  2W84 A;  2BW3 B;  2QM3 A;  3BZK A;  3TO7 A;  2HQR A;  1UEL B;  3TO6 A;  1U3E M;  2DZN B;  1JUM A;  2JSP A;  1JT6 A;  1ZRE A;  5E20 A;  2HR3 A;  3Q8X A;  1E9S A;  1ZLK A;  2R7T A;  4M74 A;  2LF7 A;  4KYW A;  5FTK A;  1Z6R A;  5HLT A;  4ZPX A;  3U6Q A;  1T98 A;  3QOD A;  2LVO C;  4AYB A;  4OIQ F;  2BVM A;  4KIB A;  4CCM A;  2K9L A;  4IHW A;  2DWZ B;  3C18 A;  4U0Y A;  4OU0 A;  4BAC A;  4Z8X A;  2FJ1 A;  4MTD A;  3O8G A;  2CYZ B;  4LJ5 A;  1GL7 A;  1MH3 A;  1R36 A;  3KIO A;  1W5S A;  2QUF A;  3FIW A;  1GJS A;  2E19 A;  4DNC A;  4EGZ A;  3DKW A;  2LP0 A;  4YFK F;  4IBJ A;  2GAU A;  3KFW X;  2NVX J;  2NVQ J;  5EP3 A;  2DOF A;  1J9I A;  4CZZ A;  2QA4 I;  4TUW A;  1L8Q A;  1DP7 P;  4QOS A;  1J2X A; 
#chains in the Genus database with same CATH homology
 2ZZD B;  2G77 A;  4BBR M;  3A8O B;  2BS4 A;  4HL4 A;  3X26 B;  3VKG A;  3VKH A;  3VYH B;  1E7P A;  3HBL A;  3BG9 A;  4LOC A;  4NC6 A;  2DXB B;  2ZPE B;  3QYB A;  3VYG B;  4MIM A;  4M6V A;  3QYE A;  2KR6 A;  2CZ7 B;  2D0Q B;  4MFD A;  4ELJ A;  3X25 B;  4OB1 B;  2ZPG B;  4HNT A;  4HLQ A;  3QYG B;  4OB0 B;  1UGS B;  4QSH A;  2CZ0 B;  4FM4 B;  4BBS M;  3X24 B;  4AKG A;  3A8M B;  3A8G B;  2DD4 B;  3WVD B;  3QZ9 B;  3A8H B;  3HO8 A;  1IRE B;  3X28 B;  4MFE A;  2DD5 B;  2QDY B;  1UGP B;  3DL1 A;  2CZ6 B;  3H4C A;  3WVE B;  2QDJ A;  3BG5 A;  2WJ9 A;  3QZ5 B;  4P17 A;  2QF7 A;  2ZCF B;  1AHJ B;  4OB3 B;  2BS2 A;  1UGQ B;  3X20 B;  3HB9 A;  2QQ8 A;  4JX5 A;  4ZGD B;  2KMG A;  4Z6Y A;  4JX6 A;  2CZ1 B;  4AKI A;  2ZPB B;  1FKM A;  2ZPH B;  3A8L B;  3QXE B;  3QYH B;  3TW6 A;  4JX4 A;  3BG3 A;  2ZPF B;  2BS3 A;  4OB2 B;  4ZGE B;  4AKH A;  4ZGJ B;  2DPP B;  1QLB A;  2QFZ A;  4AI6 A;  1V29 B;  2CYZ B;  2ZPI B;  3HHT B;  3KHI A;  2AHJ B;  3HZJ A;  3TW7 A;  1UGR B;  4HNV A;  3QWL A;  4HNU A;  2DXC B;  5EJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...