3HZJA

Crystal structure of the rabgap domain of the rabgap1l protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
YSWGELLGKWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDRYRILITKDSAQESVITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYDYGLRDLYRNNFEDLHCKFYQLERLMQEQLPDLHSHFSDLNLEAHMYASQWFLTLFTAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIKVPTKKLKKYEKEYQTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase activator
molecule keywords RAB GTPase-activating protein 1-like
publication title Crystal structure of the RabGAP domain of the RABGAP1L protein
rcsb
source organism Homo sapiens
total genus 97
structure length 287
sequence length 287
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3hzjA02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 3hzjA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hzjA03
4Z6YA 5EJCA 4NC6A 4P17A 3HZJA 3QYBA 2G77A 2QFZA 3QYEA 4HLQA 2QQ8A 3QWLA 1FKMA 4HL4A
chains in the Genus database with same CATH superfamily
3M0EA 1QHHD 2JUCA 3C2HA 4LLLA 4ENKA 4OB0B 2VI6A 3WTVC 2KIFA 3VYRB 1YX5A 3WE3A 1XMQM 4L9VA 4OWRB 3NWSA 1YQAA 4L0ZB 1QZMA 2B0LA 2R4EA 3QU3A 3TKYA 3IRRA 2PX9A 3V7RA 4Q47A 1VFCA 4BQQA 3AJIB 1V29B 3I4VA 2K5CA 1I5ZA 3BC8A 3TW7A 3ZN0A 2DT5A 1FINB 3BOSA 2YPRA 3HUGB 4RS8A 3ZOBA 4XN3A 4D1QA 3SHGB 2BJVA 2XAGA 3O8HA 1T56A 3SZPA 5JFRA 3MMPA 4KHPM 2QWWA 4N9HA 3W2WA 3A45A 1FP2A 3AV0A 4M74A 2A6EF 3G6EI 3ZMVA 4IHTA 3EUKL 4G4QA 3S3OA 2XFSA 1LEAA 1MDMB 1VQ5I 3RKYA 3OS0A 4X65M 3NAUA 4CHTB 2V26A 1POGA 3GLFA 3E97A 4HDUA 2O25A 2IRFG 3ZH9B 1MSFC 2CJMB 4RAZA 5DYMA 1R6BX 5C3EJ 1HXDA 3RE8A 4ZYHA 5DQWA 2B9SA 3S3NA 4II2A 4EJUA 4YHHM 2CQ7A 2V79A 4L6V6 4V2GA 2CUZA 3GXOA 4Y15A 1YE9A 2CZ7B 4RGRA 5D5XB 2P4WA 1Z21A 1PJIA 2ZAMA 4E70A 1IBLM 5C1BA 2B9RA 3C1DA 4BCQD 2JZ0A 4KJZA 1P4AA 4GC5A 4HNUA 2HQ5A 1OFCX 4P9UA 4IZZA 2XAQA 1Z77A 2YX7A 2UXDM 2OAZA 1PVEA 2GQQA 3LOCA 1IY0A 2XFTA 2X48A 1XGMA 1QPIA 2A05A 1WJCA 2XROA 4BH9A 4ZTFA 1QAOA 3KOWE 2CUEA 2X49A 4KUMA 3X25B 1U5TB 4DIQA 4BACA 3K1NA 3KOZE 3RIRA 3FXMA 3VFDA 3WU2C 3JRBA 4BCJB 4GEWA 4DUYM 2V4JC 4GO1A 3M8EA 3BPXA 3K10A 3KX2A 2KFDA 1UNHD 2D1VA 4G6TB 3VYGB 1OGUB 3WU1B 1ZHFA 2DA6A 2F2CA 2QGSA 2OOBA 3OL3A 5BMZA 2CHVA 2PI0A 1LEBA 2DU9A 2VKDA 4FE4A 2FBHA 5EG0A 1BR2A 3WHCA 1RIOH 1BW5A 1LFPA 4LIVA 1ETQA 1IBKM 1USTA 2RKHA 2CWBA 4BJ5C 2VQEM 4F6WB 1DO2A 3U6LA 3HEFA 1IN8A 2DZLA 1MJBA 4LJ8A 2XAUA 1YW9A 4FTHA 1JT0A 2WAQN 1ZREA 2H1RA 4NXNM 2ZMEC 5ACBA 1OYYA 1O3SA 2JY6B 4DR1M 3K6GA 1DUXC 1ENWA 2IGNA 1JE8A 3E21A 3B7QA 3HXLA 1TR8A 4AYBN 1JR3D 3OYHA 3CO7C 3BOQA 3JTHA 3OL4A 1DU0A 5M5XJ 2HWVA 4CSWA 3ZMZA 1BU2A 3WE2A 3VDUA 4LG0A 2WIHB 2MBFA 2UU9M 2LVSA 1VINA 2DDBA 2G9WA 4M6XA 3KLOA 2HZTA 3JAMK 3KPHA 2DWZB 1GVJA 4NQWB 2JA6J 3Q0WA 3ABKH 2KXEA 7CATA 2BHYA 2R5ZB 4Y72B 1Z5BA 1B72B 2MC3A 3LL7A 3SBJA 2MC4A 4I99C 4WW0A 3U60B 2E1MB 3CO6C 4QWQA 5BPIA 5KNLA 3VK7A 1IY1A 1DPRA 1IZ1A 1BL0A 4B09A 2J5OA 4EJWA 3S2WA 2MD0A 4LZZA 5LEJA 4X0GA 1HNXM 1FJGM 5IY5H 2ZCFB 1RR7A 5EZHA 3H9JA 3F8BA 2L6OA 4HV6A 1W7PA 1FBSA 3EIHA 3E4RA 1QVUA 2F5OA 4P55A 2RKOA 2K40A 4IJAA 4DV1M 4UUSA 1VQPI 1R49A 4ZH4F 1H1PB 3DL1A 2ZXIA 5F0FA 3I3LA 2WAFA 2R92J 2ZJPF 4A3JJ 2BXZA 1HBXG 1XB2B 1ZG3A 1QUTA 2L4FA 2DA7A 2NS8A 4BU2A 3D0SA 1Z59A 3B89A 3QQAA 3F5XB 3OYBA 1ZGWA 4PDKA 2FMLA 2Y21A 1RR8C 4ENJA 2CV0A 3K4MA 5FFZA 2XUBA 5FO5A 4CGZA 5FLXK 3ERMA 4F2LA 3GO5A 4EC8B 1VOLA 4II7A 3LW5F 4BL0B 3GLHE 2HKXA 2CFXA 2EFNA 3LA2A 2FQ4A 5FTLA 2HS5A 2Y75A 3AKZA 4JX6A 4WXCA 4Y28F 2JGZB 4LOCA 1T33A 5FTJA 3W0LB 2OQGA 3E5UA 3IH3A 4RB2C 3HOZJ 3K2LA 2XRNA 3FKEA 1V4RA 4M3FA 4C2MJ 2W7NA 1KU7A 3ZQFA 2E2IJ 4KMFA 2Y0TA 3FRHA 4ABZA 3J7YJ 2ZJRF 4A3FJ 9ANTA 3MK6A 3UJNA 1HNZM 1U9OA 4OAZA 4FE7A 1G71A 2PG4A 2FS1A 3A0BC 2CYZB 2DMPA 2K9LA 2STTA 4Y7NJ 2K47A 4I5SA 3FISA 3OSGA 1IQPA 2QEXI 1ZAOA 1H4LD 2HKOA 5K5RA 1FWZA 2RGOA 1XSVA 3JRHA 3DCFA 5M3FJ 3KZIC 3OYNA 5GTHC 1F36A 3GF2A 3GLXA 2XAHA 3HPHA 2GNOA 4KRCB 4QPOA 3WHKA 1E9HB 3FXQA 2UUBM 2KRUA 1D0XA 4LFBM 1XNQM 1JUMA 2ME6A 3KETA 4FW9A 2R5YA 4B3TM 5L3CA 3L2RA 1REPC 1OCPA 2QCUA 3OYJA 1QBJA 2R6FA 1TWAJ 2EJRA 2IA2A 3HRUA 3T0YA 2GA1A 3DTKA 5LFAA 3B74A 3UNGC 5D5WB 1ETXA 3BR3A 2UXCM 3ABLH 1HNWM 4XNFA 1WFXA 3H9GA 4IPAA 5FGMA 3CCEI 5DQVA 2DHYA 2OF7A 4S12A 4BDYA 4A3IJ 2KIQA 3RZDJ 5B3SH 1KQ8A 1IM2A 3HKZA 4G6DA 4I0BA 5J1RA 2CV2A 4KT6A 1QRYA 2DPPB 4ZGJB 1X1AA 2LW4A 4F7LB 2ZSHB 4KRDB 2C99A 1UG2A 4BCND 2X1CA 1A5TA 4LJAA 2W9ZA 1G4DA 1Q3CA 2JY8A 5DV5A 2ZB9A 1D5VA 1V5EA 3HGGA 5HBEB 3IECA 3QOPA 3VK8A 1UGSB 1X1PA 4EONB 4NC6A 1WH5A 4RB3C 1EH8A 3V8JA 2G3QA 3BBZA 4ELJA 2R7XA 5M3MJ 4QSHA 2P6TA 3HOXJ 2FJ1A 2JA5J 3M9AA 4BXXJ 2ELJA 1K4SA 1O7FA 3K1MA 5FKNA 1ON1A 2ZMEA 2DPUA 1S3JA 4BCOB 3C9PA 3HU3A 5FTNA 1GY3B 4YOOA 1ZP2A 1IUYA 2D45A 1NNUC 3OIOA 2NVQJ 3FXKA 2CP8A 4NRWA 5TJJA 4RAGA 3FUTA 4D5FA 4YFNF 1CF7B 2BEOA 1HDDC 3K1PA 1Z91A 4RM3A 4YIRX 3DDQB 2RN7A 2HYGD 2JRMA 3SMSA 4ITQA 4EM2A 5J47A 4JP0A 3BG5A 4L15A 2OPTA 1OIUB 1TDHA 5BR8M 3HHWA 1EFUB 2EA4A 2OBPA 4MFEA 5IYCJ 2EKFA 2LNHC 1TDZA 3WHLA 2XF5A 1H1SB 1AKHA 5A2QS 2LY1A 3TGNA 1W0UA 4HX7A 1MMSA 2R0IA 4IQJA 2L5QA 3E5XA 2F5VA 2KNZA 1FSHA 3ZQIA 3ZC7B 4BCFB 3KS4A 1BI3A 4RMNA 4I7HA 5J3LA 3CMEI 2K9NA 2KQRA 1ORYB 1ZELA 1H9GA 2K4JA 1ZH5A 1ZLKA 1BJZA 4DZPA 3CDIA 4KNYA 3FTEA 4OX9M 3OMYA 3RSNA 1G41A 2XKPA 2XPVA 2BKZB 4HW0A 3LA7A 4M3EA 2BJWA 2XPWA 3IAS2 3V8KA 5FKOA 1K61A 2PJRB 4QHSA 3TW6A 2C5XB 1VQ7I 2M3AA 2I10A 4RKUF 5JHUA 4PSWA 1K3WA 2UV1A 2UZBB 5LMUM 5KPTA 2F5PA 3GLIB 3B6AA 3L2UA 2DTRA 1DQUA 4A3KJ 2VOPA 2PK2A 1MNDA 4O6JA 1ODDA 3O2PE 1XWIA 3KIOA 2QPAA 2EH3A 2UXXA 4IHVA 2WZJA 3CUQA 4OIRF 1WJEA 1ORKA 1HW5A 1PP8F 4KDPA 3ULQB 1EV7A 4LF8M 3VSLA 1SXJC 4I0AA 5HNBB 1FZPB 2BHZA 4B3SM 2Z99A 2VBZA 1OIZA 4JI0M 1MJ9A 2ZJ2A 4G94A 4BYYA 3IV5A 3CCMI 4FCWA 2A61A 4OU0A 3GCMA 3SJMA 3KFWX 4ESFA 4I98B 5K5QA 1NV9A 2LOOA 1XGSA 1E3HA 4L18B 4LJ9A 3F8FA 1Z5AA 2RRUA 1FEXA 3DWLE 2UUEB 4PCZA 1AA7A 2DHRA 4MO7A 5KAFC 4YOZA 4BE0A 3WTTC 1JR3A 5E3OA 2PN6A 3ONQA 4RB0A 2KRKA 4UV8A 4ETSA 2DENA 4YG2F 3MVPA 5HOOA 1ZTRA 3RCOA 3HM5A 3ZN1A 3LVWA 3A46A 1JGGA 5CKTA 4KIGA 3OYMA 2IJLA 1FSEA 4DYCA 2KLOA 1IREB 1TTYA 1WJ7A 1PJJA 3DV8A 2WMBB 4EJTA 1ZRFA 4MEYF 4A69C 1ZYRF 1MKMA 2KL4A 4BQNA 5FD6A 2BVLA 4N4OB 3MZ8A 1D3UB 2ELKA 3GRUA 2FA5A 2K3FA 4BE1A 2ISZA 3OYAA 2K9SA 1GUXB 3X20B 4G6ZA 5EDNA 4JI6M 4M3BA 3MKYB 1LNWA 3IG8A 2Y0MA 1OKSA 5F08A 5L3BA 3PO2J 4PDGA 1WGNA 2PJQA 3WVEB 3H9QA 1AHDP 2AHJB 4CCKA 1NTCA 2CMPA 5ICFA 1NSFA 2VONA 4GHAA 1VEKA 1MIJA 1KQ0A 2MFZA 2QZ4A 5LGUA 3TO7A 2F4IA 2QF7A 1BJAA 4IVNA 3H1CA 4ESJA 3R8FA 2EFQA 3FE3A 3V7SA 4M6YA 1EJ9A 4F6UB 1R2YA 2BY0A 2F4OB 3HU2A 4BQOA 3E3VA 2BY2A 3IKVA 1HKQA 4FASD 2DAMA 3H5RA 1AIPC 2DMUA 1OCTC 4KYWA 3RGSA 1R5ID 2XSZD 3V42A 1QYRA 2PBIA 3FHNA 1KXUA 2IT0A 2NOGA 4E6KG 4IMYB 4YFKF 3ZQGA 3H35A 4CFUB 2UXNA 3E1SA 1GJSA 3H4JA 5C44J 1BIAA 2KHMA 4D7MA 5LHGA 1KA8A 3I4MJ 3I53A 1LE8B 1YOVB 3IWZA 4JI5M 1H24B 1ETVA 3M1EA 1SEUA 4ZJZA 4CFUD 2YR2A 1K7AA 2OTLI 1BI0A 4KN7X 3EYIA 3S2HJ 1IDZA 3DXJF 1J5YA 1DGFA 4CFWB 1QZZA 3B7NA 3F0CA 2JT1A 2ZTDA 1E0EA 3KCCA 2K6BA 2HPIA 3TNWB 3PO3J 2EUCA 3M6AA 3BZKA 3DBLB 2B7EA 1R4GA 3WHBA 1I27A 3BLQB 3MKLA 3OSFA 2LC2A 1H28B 4AC0A 3QAUA 2XSJC 1P3QQ 1ETOA 2DAIA 2QLZA 2CQNA 5HS9A 2NRAC 4HF1A 2LVAA 1A35A 3BY6A 3GLFB 2FE8A 2Y0SA 2LH9A 1DGHA 3REOA 1U78A 1X2NA 2BGCA 4BCMB 1Q39A 2J7OA 2LY2A 1GKIA 3RKXA 3M7GA 1XNRM 3OIQA 3KP5A 1BOBA 4A5NA 4EV0A 1AHJB 1OCZH 3S1QJ 3RGFB 1IAWA 1NVMA 5HVQC 4OVZA 4WP2A 1Y56A 1H89C 3PO3S 3BTJA 2L0KA 2IP2A 2XIGA 3OYKA 2C98A 5ERIA 4JI3M 5DS9A 4RF0A 3SMPA 2OU2A 4DYQA 2R65A 1GV5A 2DODA 1V55H 2QKLB 4BXFA 5L3EA 2W24A 1K82A 1Y8RB 5BNGA 1EA3A 2IXSA 3I4PA 3MQ0A 3BQYA 4ANRA 2H8RA 5ICCA 1YX3A 5JR3A 2L7KA 3R61A 1TFBA 4X66M 5F6FA 1Q02A 4LF5M 2NOJB 5TISC 2CSOA 1UMQA 3C7JA 1X4OA 1V92A 1OLTA 3GTJJ 3P7NA 4J01A 1IGNA 1WWXA 1URCB 1XSXA 3JR4A 2X6YA 3DKXA 2ESNA 3GLLA 1QGPA 3DOGB 4I01A 1ENHA 3JR5A 1JB0F 4XLAA 5EP1A 3N97A 1IO2A 2E1CA 2HCBA 1KONA 3SEQA 1L1ZA 2DPDA 4EOQB 2YUSA 4JV5M 2DT7B 4DR6M 4MNUA 3K9OA 3MHVC 2Y20A 4ZDOA 4A6DA 3KEOA 5EG0B 4FVMA 3VDPA 3ZQ7A 3K4JA 2DAEA 3CLOA 5EGOA 4EM0B 4M73A 4Y3OA 1WHUA 3DBHB 2VB6A 5EP3A 1FBUA 5LRSA 1WJBA 4IBGA 4CGYB 2TCTA 1R1TA 3W67A 1R5HA 2L2OA 3C2BA 1E17A 3FTFA 1EKEA 2QM3A 4DV7M 2KZGA 1N77A 1KFVA 2R0QC 5H37D 3RJPA 4CO8A 4W1UA 4BXUA 1QZEA 4N9IA 3TMOA 1UFMA 5HLTA 2HOEA 5CEIB 3X2QH 2AS5F 1K83J 1HR0M 1K78A 2JUGA 1VQKI 1IV8A 2JTVA 4WURA 3X26B 1QPMA 4RM2A 5J6XA 3RGPA 1VQMI 4IBKA 3E5QA 1FVVB 2ZPHB 4AVPA 1OCCH 2XSDC 2DFHA 2JMWA 2RQQA 3NWLA 4ZPXA 5CPRB 3HDDA 1WKMA 4D81A 3FIWA 3CF6E 2WSEF 5E8GA 4A3DJ 3M4OJ 2JN6A 2QUFA 2M8EA 3BROA 4FWGA 1HSJA 3BG7A 1A6QA 4A12A 5E1XA 2OJED 1Z9CA 3SYTA 2E2JJ 2BS2A 4EOKB 2M8GX 2QQBA 3G3ZA 3G4SI 2ZNZA 3PNTA 2C6TB 4LK0F 2O03A 3CMAI 4PJ0C 1T08B 3D1NI 3R60A 3VB2A 2PJPA 2I40B 1TH4A 1MNEA 5E3MA 2BNKA 1LJ9A 1W7PB 2QSFX 4X1EA 4UUSB 1V54H 1R6RA 2MLKA 5IPAA 1W5SA 3L2AA 1TL8A 2AQEA 3S15J 5BPVA 2A5WA 2G7UA 2MG4A 4PZJA 4XSXF 1PKDB 1R9TJ 2V9PA 1K4TA 2E34A 1E32A 4B3RM 3L1PA 3K70C 2CQXA 1GLNA 4WCGA 1N75A 1OYIA 3HL2A 1D1CA 3V76A 3ZMTA 3UKGA 3HTUA 1LFUP 4S04A 2IW5A 2E71A 3OR1C 1ITYA 5E20A 1H8AC 1PM5A 1XO2A 3AOEC 5LHIA 2W9FA 2V6ZM 1YJ9I 2DO7A 2CRGA 4LGWA 1XMKA 4XORA 5HLHA 5HODA 3BP8A 1VNDA 3A42A 4MFDA 2QGUA 2PMZN 2VKHA 1BOAA 1M1EB 3A03A 4B3XA 4JI2M 3J7BA 1XGOA 2HDCA 2ZZDB 1ACIA 3Q0VA 1KSFX 2X4AA 1W36C 1N25A 1IN7A 2AHQA 4KT0F 2E1OA 3J81K 2LKXA 4OB3B 4B7GA 3EQLF 1PJSA 5EJCA 1LKXA 1QQIA 5ITRA 1TBXA 2XZUA 4HLQA 4FHTA 1G8XA 3ZPLA 3PUBA 3RFWA 2NS7A 4LB5A 3QYFA 2CS3A 3FF5A 4GITA 1SXJE 1ON2A 4EOIB 4YRVA 1E94E 2Y0SN 3A98B 2VIIA 4ZYDA 2D7HA 2JRTA 4NSRA 3U5ZA 5EYRA 4EATA 1KYWA 5JI6A 2ZPIB 1I1SA 5DCMA 2R5YB 1W0TA 1G3YA 2HGCA 1P2FA 4KICA 1WCMJ 2P81A 3DOAA 1P9QC 2C9OA 2ID3A 2UUCM 4XLCA 2WSFF 1J5EM 2CW7A 3QAHA 4KN4X 3B02A 2KPMA 3TN8B 4GKJM 1YJWI 4L16A 3E46A 3JRDA 1D5YA 3I58A 2WHBB 2QQ8A 2XSZA 1BI1A 1Y6IA 2COMA 2L9SA 2WA0A 5CJ9A 4PCQA 1IXZA 1JGSA 4LJ7A 1OISA 5CVVA 3DFZA 1IG7A 3C3EA 2B3TA 2BW3A 4HF0A 3OOUA 1JKRC 2R7VA 1JTYA 1F1ZA 3VFZA 5CYIB 3VEPA 5IREB 4IRHA 4DBRA 3OV8A 2O6GE 4LJ4A 2L3DA 4CXAB 2ZBKA 1YIJI 2R7QA 2F4MB 2C5VB 1PUFA 3JTGA 1B9NA 2DKLA 1S8NA 3L25A 1GXQA 2EA0A 2DXCB 1XMXA 3EIEA 5FKMA 2L9VA 4OAYA 5JVGF 2PMIB 4CHUA 1OFHA 4I3ZB 2ERCA 1O57A 4PDIA 4A3MJ 3AL0C 3I9V2 4HA8A 1HT2E 3TNHB 1G3SA 3RPUD 2ZMEB 3ZMDA 2JP7A 4RF1A 1U9NA 1MZBA 2O01F 1LQ1A 2VQGA 4NNJA 4XLFA 1HLVA 3CC2I 3S1MJ 4DV3M 1GO5A 2LVPC 3NBXX 3FXLA 1U8BA 2KZVA 1GUUA 2CZ6B 1D0KA 1MJGM 2QBYA 1MSEC 1Q1HA 1W5TA 2IGOA 1Z67A 5F0CA 4PFOA 4ON0A 3K0LA 1JI8A 4CRLB 3EIDB 3ISPA 3HJEA 3LSJA 4LRSA 5HS7A 2KRFA 1FOXA 2Y9ZA 3A8MB 2V6EA 4IEJA 2WAEA 1I4WA 2CYYA 1T0FC 2XGCA 2YSRA 4MEXF 2R46A 5CYVA 4EOPB 3FYCA 2OZUA 1WI9A 1AKHB 5LMNM 3K2ZA 3MN2A 4OR5B 4C3HJ 1ZG1A 1WQ2A 2VQHA 3KP2A 2BY1A 4BCQB 5IP6A 3J80K 3DPLC 3IL2A 2M9HA 5ITUA 2DYRH 1H27B 2MH2A 2VKEA 3K69A 4JI1M 3CTAA 1J09A 1XMAA 1L1TA 4QOSA 3GLHA 3CCLI 1G6NA 2J5YA 1I94M 4FWDA 3CF0A 4J00A 2LVQD 2IN3A 3LSKA 1PDNC 2GAUA 1OL1B 1VQ6I 1K3XA 2XH9A 2DJNA 3DEUA 1USSA 4R1HA 3TP0A 1FYLA 3SYLA 3BJAA 3GUDA 1YI2I 1V33A 1P7JA 1MU5A 1BI2A 5TGTA 4EOSB 4IBBA 5H6RA 3GTMJ 1O9KA 4I2OA 4A3LJ 3PXGA 4HNTA 4D82A 1TNSA 1G8PA 3DPUA 4G12A 4W97A 3GLGE 1E2XA 2E7XA 4R79A 1NY5A 3SASA 1BN5A 1KQ9A 3BPVA 4EGYA 3CUQB 2XHKA 1HA8A 4GGGA 2O0YA 5KVRA 4V2FA 4ZDLA 4BCIB 2FFJA 2VXZA 4WXHA 3KP4A 1WJAA 1QO0D 4KIFA 1KU9A 3AOEA 3GZ6A 3HO8A 1OIPA 2KIUA 4RAYA 3U6QA 1KU2A 3FUXA 2BYVE 2Z9OA 3U21A 4I02A 4NSOB 2LG4A 4RGUA 1FJLA 3S2DJ 1G59A 1S29A 4HRIA 2I7NA 2XEPA 4UB8C 4F91B 1F5QB 3GTMS 2Q0OA 1OR7C 5FLMJ 1MMAA 3RDIA 5J4VA 5D8KB 1X3UA 1BW6A 3WG9A 1APLC 1D0YA 3TNIB 3IWFA 3ML6A 3BR0A 5E8IA 3I55I 5BQTA 1R23A 4O3MA 3E7LA 4XIDA 5B1BH 2FOKA 3WODF 4LMYA 2JVGA 3G33B 3H3UA 4L9NA 3PFYA 1FX7A 1WPKA 2HDWA 2K27A 2DA1A 2Y9YA 1ZMUA 2L09A 2A07F 2WB1A 2VDBB 3F8NA 2CZ0B 3MWMA 1ZGAA 3WG7H 1FYMA 4NOOB 4E7SA 3HOSA 4E7JA 1PP7U 3MY1B 2GQFA 3A8HB 2VF8A 5E26A 2O5RA 4BHCA 4C2UA 4UN0A 4BCHB 2ZPFB 2JPBA 3HOWJ 2EILH 3OYFA 4U7DA 2HU9A 3PIOF 3JRCA 4R8HA 2UUZA 1SD4A 4HX8A 2F6CA 1N34M 1MD0A 1E9SA 3R6SA 2DMEA 2FXAA 2HTSA 2F5EA 1QDRA 1IRFA 4NRVA 1SAUA 2FRHA 3I59B 1S7EA 2W25A 4B43A 2A68F 3LAJA 3IKTA 5L8RF 4HNVA 4G7OF 1CGPA 1OIYB 2DFIA 2V1DA 1E9RA 3BJ6A 2F5QA 4AI6A 3ESWB 4A6EA 5L3GA 4OB1B 4HPQA 2WV0A 4G4OA 4LCBA 4AIJA 5GAEJ 1EH7A 3KDSE 1YG2A 2EBIA 3LQ5B 3CJTB 3NDQA 3DTEA 2EZIA 3JREA 3PSIA 3GTQJ 3PJRA 4IBCA 3WTUC 4D5CA 1P6RA 1AOYA 1FMVA 3GRVA 1MMDA 4LJZF 3HOUJ 3FYDA 3L2VA 5H2FC 4ZTJA 5ITTA 4GKKM 2DOEA 1MBJA 2LMDA 2RNJA 3HRSA 4G9YA 2IVXA 2DI3A 2XB0X 1YLAA 2JPCA 1HKSA 1F43A 3HU1A 4BUPA 5L2WB 3A2KA 3U6PA 4RB1A 1IXSA 3J7AO 1TC3C 3HRMA 4RLFA 3HHZA 2NYXA 3AG4H 3EUAA 2WY8Q 3F6VA 4L9TA 2L02A 1GXPA 1Z6TA 2LH0A 2I8DA 4J19A 2K85A 4XLNF 4XBFA 4G8XA 2M5WA 3ZR8X 3K8ZA 1U5TC 5ITXA 2VBYA 3CCYA 4DW6A 3HOTA 4UY8I 2X8AA 2NQ8C 3GTLJ 2OUMA 3J80Z 5BOXA 1O7LA 1Y0NA 4ZC3A 1FLIA 5ITYA 2MH9A 2M4KA 4G4NA 2VBWA 2W84A 3JSPA 4IRGA 1QMZB 2WTEA 1YIOA 3Q8XA 2W57A 4BY1J 1FY7A 2W85A 3ECHA 2UZKA 4OVZB 3CCUI 2FBKA 3DTOA 1TH3A 2GM4A 2OCEA 4BEHA 5B5EC 2HOSA 1SD6A 3G2BA 2PEXA 1BVSA 3FMQA 4F93B 2CW0F 3D5SC 3L00A 3QZ9B 4ENMA 5IYDJ 3HRTA 4HOBA 2H6CA 1GV2A 3HJQA 2EK5A 1FOWA 4L5EA 3A01A 1GABA 4BCNB 4LLNA 2QSHX 5D6FA 5ED4A 2EINH 5EEAA 5C18A 2VQFM 3A8GB 3FUUA 3OS1A 5E3NA 3E9SA 4PSXA 2KHHA 3I04M 2M45A 1FKMA 4Y4RA 3WTXC 1I39A 2ACJA 2L9RA 2HEOA 2XGEA 3CDHA 4I09A 3C58A 3LQQA 3PVSA 3IRQA 3DPTA 3EPZA 2ECBA 5IOYA 3FHZA 4MH0E 1X1BA 1H88C 2W2HA 2EV0A 3NWTA 3PL8A 3AG1H 4XKVA 3BWGA 3CUOA 3OS2A 2JZ1A 3RPUA 4IL6C 2OD5A 3I51A 1LVAA 5EGOB 2PQ8A 1SXJD 3U6DA 2X4HA 4P16A 4E4HA 2E1MC 5CVUA 1SFXA 1XDUA 1UNGD 4HSTA 1AD6A 2EO2A 4C3JJ 4MGIE 2QA4I 3NBIA 3W6KB 4UVAA 5D6EA 2JY5A 4I8OA 4KT5C 5HNFA 2M87A 1K78B 3LQRA 1WXQA 1D1BA 2RNGA 3CGWA 1A5JA 3RI4A 4RGXA 4HBLA 3KYLA 5LGNA 4AM3A 4YY3M 3I4NJ 2C5NB 4ITVA 5BNJB 1VZ0A 3JAMZ 4MQVA 1I3QJ 4F7ZA 5DM7F 1O3TA 2QP9X 4GCVA 4Q7JA 2WB1N 4UUTA 5DTDA 1ZRDA 4ZGEB 2DZNB 5DUKA 1MBGA 5KHDA 3BR5A 2ZXWH 4PJMA 3E6DA 2C5OB 2LREA 2VIXA 2Z2SB 5LMKB 1RKWA 5K7HA 3HB9A 3ECOA 2H6BA 2JWTA 3QU6A 5M5WJ 4LZJA 4AW4A 3A0HC 3CCJI 4CFVB 4LF7M 2IGKA 2M4GA 2R4GA 5CVRA 3Q3SA 4FX3B 4AIHA 1UFZA 2E19A 3MEXA 4ROEA 4JI8M 2K9QA 4CFNB 3SAWA 3CCSI 2JJ7A 2OV7A 3LFKA 3ELKA 2OQ4A 5J1YA 1RUOA 4IKFA 3PM1A 1RUNA 1QLBA 1AWCA 3MD2A 5D4RA 4IRIA 4FT8A 5ITXE 3OYLA 2VL8A 4XKCA 3TO6A 5F27A 4LG3A 5FLXZ 1YJNI 4PJJA 2KZUA 3QYEA 2CQQA 1R36A 5GTIC 3T1HM 4M6VA 4XN0A 3J7AS 5C4XJ 5D5UB 5HBJB 2DD4B 4BGDA 4XICA 3GP1A 3BQZA 1B6AA 2X6OA 2Z4RA 3QP6A 1MH4A 2VT2A 2QHOB 3ABMH 2R7RA 1TD6A 1VF9A 1DP7P 2KIMA 5D5VB 4DUZM 4ZYAA 2DAGA 3A8LB 1I1GA 3FKJA 1JUSA 4FCYA 3IG5A 3J7AY 1SVMA 2X6XA 4AG6A 2KJBA 4E7IA 1SD5A 4LJ5A 1ZR2A 4UUVA 3BHTB 2K0BX 2DZOB 2R93J 1U5TA 5D4SA 4DV5M 3QHWB 1MNMC 1HT1E 1XXHE 3FTCA 4FCVA 2HI3A 3CQZJ 2E60A 3HJ8A 4PUSA 3FM3A 4RAFA 4PJNA 3EUHC 4CDGA 1YTYA 1QANA 3PNYA 3GFIA 3FX3A 4DYRA 1S72I 2R4JA 1QAQA 2YX4A 4IJEA 4Y17A 4HG2A 2W00A 2WFYB 5GP9A 3AG3H 3HOVJ 3S8PA 3U5ZB 2AXLA 2A5YB 1PJTA 2EFOA 3SXYA 5DCMB 1QVRA 3QPLA 3POMA 2ZPGB 1VEJA 3U2RA 2X85A 1IUFA 2R45A 4RLQA 1JSUB 4XGIA 2DD5B 2KEBA 2L7FP 3N05A 2EIJH 3KP6A 4AIDA 3M8JA 2DA5A 3QWLA 5E1ZB 4TTHA 2AO9A 3K7AJ 2GXBA 4OB2B 3CCVI 1ERDA 4XLPF 1E7PA 1UHMA 4A93J 1L8QA 1WRJA 5DDGA 1T38A 1F5TA 5EXTA 3F92A 1RPWA 2OA4A 2X51A 5F0HA 1BR4A 1JKQC 3BG3A 2HAKA 3H4MA 3OYIA 2M30A 2DN0A 2XVCA 4EM1A 2R7GA 4H4KC 2EFWA 2DWMA 3W0FA 1WI3A 2BW3B 2DAOA 2LFBA 3VYUB 3RYRA 5FRNA 2NVTJ 2CGPA 2CCIB 3HKZN 3FRIA 5K5OA 3G71I 3FK7A 1OAOC 2M60A 3L2CA 3VKHA 2QVOA 4BY7X 1J59A 2QENA 2ZBKB 2GXAA 5FTKA 3KZZA 2D1HA 2J5PA 2H09A 2CQKA 2JNHA 1LUJB 5B66C 5GAHJ 1PUFB 5IT9K 4FWHA 4XK4A 5FKKA 4LLGF 3WU0A 1A31A 4UVBA 1G3NC 2PK9B 2IS4A 1WGLA 4EORB 2CWEA 5AONA 2QDYB 5LLQA 2IW6B 1JSTB 1DGBA 4DQ2A 2MA3A 3WGGA 3S1NJ 4LJ6A 3HHYA 3HG9A 4UXNA 1Z6RA 1Y1WJ 2UZDB 4CYCA 5EP2A 2C96A 3U6CA 3OYEA 4XL9A 4G6LB 1LVKA 4B1RA 4IJFA 1T39A 2QNJA 3ZMUA 2QBYB 2XF7A 5B1AH 3DU5A 4X62M 1V5GA 3U6MA 2EIKH 5IP7J 4A3GJ 1J2XA 2XV4S 1XX5A 3JRIA 2G0EA 2HOAA 3C2GA 3S1RJ 3W68A 3ZMSA 3BLHB 3I4YA 1JOWA 3ABUA 4UN2B 1WHCA 2IPQX 3BT9A 4HQEA 2W96A 4E7KA 1TWFJ 4XK8F 1K79A 5F64A 2P7CB 1B59A 4M0WA 4M9XA 1I50J 3O6BB 5F04A 4FM4B 4QNMA 4EOJB 4CA0A 3CF2A 1HJPA 3CJQB 2V22B 2HYJA 3T8RA 2Z3YA 1WZ2A 2XAJA 2JSCA 1EH6A 3QODA 3CCRI 2Z4SA 2DXBB 3F72A 3WVDB 4A0YA 5EZGA 4OMYA 2LWXA 3A4CA 4MB7A 3JCUC 4CCLA 4CFMB 3W3CA 4NDLA 4N0BA 1F4KA 5AIQA 4B4CA 5A2QK 2L7IA 2YNMD 4EOOB 4L4UA 3GLHB 2LKPA 1L2BA 4IBIA 2CH0A 2Q2EA 3RZOJ 4IBJA 3LCUA 4CIZA 3HIFA 1J9IA 1NY6A 1LDKB 1T2KA 2VQCA 4OINF 3E6MA 4A0XA 1DGGA 1ZG5A 2E5NA 4P17A 4MGZE 3A1YA 3LSGA 4KA4A 2W48A 4B3AA 4Q5SF 2LSOA 2HL7A 5AIPA 1G3TA 1SC7A 3CMMA 3H3ZA 4U87A 3V4GA 1H1QB 4RGSA 1O9KB 2DXIA 2PFBA 2K9MA 1LDDA 3PNVA 1TNTA 2MYSA 5HDKA 3UR3C 1O4XA 2HTJA 4L78A 2VPRA 2WWYA 2AQFA 3KVWA 5JVTA 3F23A 1HC8A 3DDPB 3U1KA 4AKGA 3IC7A 3BG9A 3SHFA 1DGRM 2HYFA 2HNHA 1Y8QB 4LD5A 1W1WE 5ICGA 1JTXA 3MKWB 1C7YA 1SXJA 1DP3A 2B63J 3EJ1B 2NVUB 1P92A 4MTEA 2ECCA 2X1DA 1QDTA 3HPGA 4EIWA 3K70D 2IS6A 3PUFA 5E1WA 3T38A 1YO5C 2VASA 3OTOM 2LNBA 1TWCJ 2ISYA 2V9KA 3FM5A 5HDNA 5E18F 3CCQI 1IC8A 3R4KA 3MIAB 1FYKA 4BCGB 5F1JA 2Y31A 3Q9VA 2XZFA 3I0TA 1VQ4I 2R7FA 1DU6A 3U61A 2E36A 4AWXB 4M0DA 1BM9A 4A0ZA 1FOKA 4M9SA 2DQRA 2KKOA 3A02A 3KFUG 3TO9A 3E6CC 1TLHB 3FUWA 2L7MP 1SVOA 4JQFA 3TOAA 1LFBA 4DV6M 5FD5A 4LF9M 1TT0A 1W36D 2EZKA 3MMYB 2A69F 3CP8A 4TV7A 2P6SA 3HSEA 2ZJQF 3BXWA 1D8KA 4CICA 3B57A 1H1RB 3HHGA 4F3QA 4LK1F 3GMEA 4LG0B 3KP1E 5DNYA 5BS6A 4EGZA 2LK2A 3IHUA 2GIZA 3LSHA 3RPQA 1XSDA 3WTZA 1LB2A 1TGUA 2JVHA 5KCMA 1X3WB 3I64A 3FK6A 2CUJA 2DW4A 4XLEA 3RKWA 2BWBA 1YW8A 2ICWG 2A6HF 4BJ6C 3T5XA 2VF7A 5FFXA 2CV1A 2LLKA 3T1BA 4B7FA 3JSOA 1NK3P 3H4CA 3TOBA 3QPSA 2MROB 1D0MA 2LF7A 4WK8F 3FTDA 1T8IA 2WV1A 3SEZA 3LNQA 1YRNA 2L7ZA 1VEGA 2WSCF 4DV0M 1MMGA 1X1DA 2F5DA 1DGWY 2COBA 5IT9Z 2P7VB 3J80S 4JK1X 5JI2E 2DFEA 3TP3A 1OKRA 4CCOA 3GYHX 1XMOM 3KEQA 3SYKA 4F1IA 1U3EM 3TQSA 4JI4M 2JSPA 3B6CA 1X1CA 4NC7A 4NB5A 1N32M 3OYGA 1HQYE 2KNAA 2G77A 1ONVA 5L3FA 2ZTCA 5K1YA 5E79C 2ZPBB 4EOMB 2R7OA 2LD5A 1VQLI 2LBCA 1WJDA 3F8CA 1MW7A 2C9CA 4A3BJ 2FH0A 4GIPA 1FBQA 3KLNA 4MGRA 3QHRB 1B1BA 2XGNA 2OC6A 2UWMA 2NXNB 1YS6A 3GBGA 3M07A 3O3KA 5D8LB 3F8MA 1A36A 3OIPA 4PGHA 1T43A 5EEGA 1IXSB 3U1DA 2XC7A 2CHGA 2ZXHA 4FX0A 1K6YA 1G3IA 2W4SA 4C30A 3LCVB 1FP1D 1T6SA 1IBMM 1GL7A 1RESA 1Z1DA 3LFUA 1B8IA 4GDFA 4UNOA 2MJ5B 4UVCA 3HHTB 2RVCA 4FCTA 1QUSA 4DR2M 3K1JA 4OMZA 4BKXA 2ZANA 3TWKA 2K02A 2ELHA 3SARA 1UJ8A 4XBOA 2NAZA 5J8FA 1BIBA 4IBFA 4DV2M 5CQEA 5IHYA 3ZQQA 1HKTA 4B7HA 4GRIA 5KO3A 3F21A 1UZCA 2DYSH 3DZDA 2HVRA 3S14J 4Z6YA 4ZYEA 1H26B 4U88A 1ZQ3P 2FUG2 1UG0A 2DMNA 4M9ZA 3AG2H 3GLGA 2RAEA 4CCNA 1CQTA 4U7BA 2TDXA 5HBHB 3DTIA 4DR4M 4XMYA 3JRAA 3HSRA 2PLYA 2DJIA 2OO9A 2DA2A 4G7ZF 1Y8GA 1KZHA 4BEHB 4JYKA 3QYHB 2DK8A 2F5FA 4WXDA 4KISA 1UGRB 4NC8A 4YOSA 4QIWN 3MZYA 2BY3A 1AUAA 4IIWA 1N36M 2O9LA 2CU7A 4KIBA 1VYWB 5DYIA 2RV8A 2QQAA 4A3VB 2D7EA 2VQLA 2FOWA 3A01B 3HKPA 3BR6A 2Q1ZB 4M3GA 4JN6A 2JA2A 4AYBA 1JUPA 1O3QA 5FGKB 2VJJA 1SANA 2D7GA 5HLGA 2H8WA 2O8KA 2R7DA 5IDNB 5JLXA 2PMHA 1SAXA 3JAMS 1D3YA 1X2MA 2HR3A 1BC8C 1YSYA 3MY5B 3QYBA 1UCRA 3BLYA 4I4LA 3VPRA 4BHPA 2NNNA 1HF0A 2HQAA 3HY5A 3PFIA 3L9FA 4B48A 2V7FA 2F5SA 3RQ4A 1VQ1A 2Z33A 3S32A 4GXOA 1U0JA 3SFIA 2DNAA 3DKYA 3LSPA 3GTKJ 2APLA 1J0RA 3TQNA 5DD4A 3JR9A 4NSTB 2KRHA 2VKVA 3J2PB 3KSXA 1XB4A 3LSRA 1Y0UA 2JA8J 1FIPA 1YLFA 2DTZA 4MLOA 3K4CA 4L9JA 2LY9A 4M72A 2FQ3A 2WPAB 2P0WA 1I3AA 1NK2P 2R7UA 3SAUA 5LQFB 3HJSA 3LWFA 4R3DA 4F7JB 5TRDA 1QQWA 2ZCWA 2IW8B 2GA2A 5FLXS 3RTRA 5GADJ 5IYBJ 1MBFA 1D1AA 2X0LA 1IY2A 3QYGB 1DDNA 1R5LA 1R1VA 2ZC2A 2C5RA 3M8FA 3CESA 4GC9A 4K2EA 3MZHA 2RC4A 4X6AJ 2HKJA 4LGYA 4B44A 1D0LA 1LE8A 4O5VA 4NUBA 3GZ5A 4IHSA 1TTEA 1KYZA 2VUMJ 4A3EJ 5ICPB 2E1NA 4QPQA 4B8XA 4IOAF 3DF8A 1IXRC 2BS4A 3P9KA 1SFKA 2CG4A 4AZFA 2OOAA 3SATA 2LRDA 2D0QB 2F48A 2HXIA 4A2UA 2K86A 3X28B 2X1NB 2RREA 3C18A 4EJOA 2DVWB 1ZKGA 4F92B 1TWHJ 3H5AA 1G3WA 3W2AA 3HZJA 2ZSIB 4IHYA 3GLIE 3B73A 4BXXX 4Z2YA 4M71A 2OZ6A 2VE9A 4B47A 1KGSA 3MKZA 3AAFA 4QOZC 2L4MA 1YHQI 1RKTA 1ULYA 1OL2B 1W4MA 4GH9A 4DBGB 2DA4A 5LHHA 3KP3A 4LGMA 4LFUA 1OFIA 5EXSA 3K4NA 4W5WA 1TW2A 2DQLA 4II5B 3TWMA 4FISA 4IQ4A 3S93A 3V8LA 1R71A 3CJNA 3VKGA 3F6OA 2YQZA 4YC3B 5I5ZB 1H6UA 2HOTA 1MGTA 3GQ4A 1WIVA 3CMYA 1R22A 2D2WA 3VOEA 3MCZA 3FUVA 2BBYA 3FZVA 2F5NA 5F3WA 1E3PA 3LSTA 1IF1A 5JHFA 3CD6I 2F4VM 1TQMA 5IOZA 3L7WA 1GDTA 3J81Z 2X9DA 4GHLA 1W98B 1IRGA 1R1UA 1UAAA 1ETKA 4PJLA 2ETHA 4TUWA 2L9NA 3H36A 3KW6A 1XC8A 1ZARA 1LTMA 4A5MA 2JUJA 3TDZC 2VN2A 2KDOA 5ILSA 5IWAM 4LITA 3DQVC 5CVJA 4MGKE 1R58A 2EZHA 2RQPA 3BCAA 1ETWA 2PMUA 1ZMWA 3F9KA 1IN6A 1NG7A 2TRTA 4L5IA 3D8BA 2XDVA 3UZUA 3CC4I 4OGRB 3PSFA 2XAFA 4DJAA 3DBRB 3K4KA 5HVYB 2M0MA 3QPTA 1WGXA 2ZPEB 4Q4ZF 2MH8A 3B9PA 3CZ6A 4UHTA 2CFOA 2DBBA 5K7FA 3WTWC 5FJ8J 5DUIA 3UK6A 2CE7A 3LMMA 3GVAA 2MSYA 2OQRA 4EMSA 5GPCA 3ERED 2NNYA 1JJ6C 5HQ0B 4CCJA 1SFOJ 5CLSA 2WEVB 2UUAM 3L28A 2DDAA 2KW0A 2LBFA 4C3IJ 2MGQA 2IGMA 2DI0A 3MJ5A 1UGPB 2K7LA 1Y39A 4PT5A 5K7ZA 4U0WA 1JKWA 3QOEA 2WIPB 2MW8A 3G1LA 1A04A 3MAJA 2FNPA 4Z8XA 4FX4A 1D8JA 4E7ZA 4CH7A 3SDGA 1RRJA 1SVLA 2JZYA 2D5VA 1LDJA 4BQAA 1JHHA 2WMAB 1PUEE 4RODA 3T8TA 4F6SB 1T95A 2EPFA 4XM3A 4KODA 1WVRA 2R7ZJ 2Y69H 1U8RA 3HYIA 1ZN2A 3Q9SA 3P9CA 2E7WA 3QXEB 2GXGA 2OPFA 1Z5CA 2DT6A 2KZSA 4QHTA 2FSWA 2JQ7A 1BR1A 3L27A 3ZQLA 1STZA 1R5GA 2CRUA 1OCOH 2H27A 4BBSJ 3SDBA 1FIAA 2I5UA 1OMIA 2DFFA 5IT3A 1N33M 1FTZA 2Q8KA 3WGHA 2LKSA 1IRXA 3D5LA 1WR1B 4OOIA 1QZYA 2O8XA 4AVZA 2Z16A 1OKWB 5EFQB 3H0DA 2P5VA 2WJ9A 1XGNA 4CYCB 1X19A 2DOFA 8CATA 3KXEC 2KRCA 4UV9A 1ZRCA 4L0YB 5IF1B 4HYEA 2KJCA 4MQ9F 4ROCA 4Y52J 1OQYA 3FBNB 4HDVA 2P5LC 2GOMA 1IXCA 2HHHM 1T3TA 3BR2A 5LRRA 1YITI 3BHVB 3WTSC 4ESBA 1Q1VA 2K4BA 3O0GD 2KNVA 3ABTA 2ZFWA 4X64M 2KT0A 1K6OA 5DM6F 1XDSA 3GLFE 2FD5A 3BTLA 3KOXE 1T0FA 4HQMA 2G5GX 1HOMA 1UNLD 1LPQA 4I76A 3UGJA 4DR3M 4RBOA 1IDYA 3OYCA 4XRMA 4M3DA 2ME0A 3CUQC 4DNCA 1DGHB 1PRBA 3ASNH 3GTPJ 3KS8A 1MJAA 2IAIA 3QP5A 2I53A 3H92A 2EZLA 4XKBA 2EV5A 3W6JB 4CUGA 3DJBA 1Z7LA 4IBDA 3C3DA 4Y33A 4BJTA 1L0OC 1MBKA 2O7OA 1PGYA 2YFQA 2BZTA 1ETYA 2Q2EB 4EOLB 1AISB 5DCFA 1JXSA 4F70B 2ADUA 3EOCB 3OR2C 1IJWC 3R0JA 1ZQ9A 3TE6A 5J8CA 3BR1A 2HXOA 5FSWA 2P5KA 1QHGA 4PGGA 3JRFA 3K9PA 1TP4A 2RDPA 2YU3A 4BB9A 3FMSA 3TBIA 1OPCA 1ZLJA 3CTWB 5FLVA 2MLGA 3ASOH 1ZMVA 3HHXA 4D7NA 2BV6A 5DFLA 4XKWA 4ELLA 1ZV1A 5ILUA 1JHFA 2G8LA 3EYYA 2VJIA 3NARA 1SD7A 4FQGA 3U6EA 3V7CA 4LRTA 3GTGJ 1P4XA 1XXHA 4IBEA 3I01M 3OOPA 1VQOI 4XRFA 1V5FA 4BCPB 1SMTA 1L2DA 1XD7A 4GFBA 1XCBA 2CZ1B 1SXJB 1X4PA 4HZFA 4JX5A 4EQQA 3SQNA 5FB2A 2R18A 4LFAM 2KDZA 1GT0C 1QA6A 4NHJA 2C4GB 3DEWA 2NVXJ 3BLRB 3QRFF 3GPPA 3DFGA 2GWRA 3ZCBB 4BLCA 1FNNA 3FMRA 4EEFG 2DK5A 4BBSM 2BOLA 3W6VA 4BHBA 4CISA 5EP4A 2LF8A 4JX4A 3X24B 2L7HA 2YR0A 3U61B 1OR7A 3BHUB 3CLQA 2E5ZA 2M2EA 1WSUA 2FEZA 3P9IA 4II3A 1OKVB 1T98A 1U2WA 4CZZA 2FOIC 2XPUA 4HV5A 5IT9S 4S0HB 2NVYJ 4LY6A 1L3LA 2IW9B 2JA7J 2LVOC 5EXXA 2DWLA 3EETA 2RGVA 1R7JA 3L26A 3M03A 2QCOA 2GLOA 4XOTA 4GMQA 3ZP5A 1SFEA 3VODA 4HLYA 2VXDA 5E3LA 3KEYA 3HBLA 3HTSB 1QU3A 1U6GA 2JXNA 3FWEA 4XONA 1CUKA 2EB7A 4REZA 3VLFB 2KP6A 3J7ZI 1NHGC 1B4AA 2A6TA 4BNCA 2F5CA 1OCRH 2O3FA 1T6OA 5HDGA 2KDLA 3I71A 1TZLA 5FTMA 2R7TA 5DYGA 2GBYA 3HUGA 5HNHA 3TL4X 3JW4A 1J75A 3CC7I 1NHAA 2O61A 2WBMA 5EF6A 2QDJA 3KSJA 5M5YJ 1OI9B 1C9BA 1Z05A 1YRNB 2MD5A 5LBQA 3I56I 3AOGA 2KR6A 1Z3XA 1C1KA 2Z7JA 3GQ5A 3D5RC 4ZZLA 3HOYJ 2IVMA 4C9YA 2M7AA 1MDMA 5GKNA 2VJ4A 3VYTB 2PHGA 4JXJA 2L01A 5FRMA 2LVNC 2XLJA 3QPHA 1I6HJ 3C3WA 3VYSB 2Y0QA 2V1NA 2WADA 4WX9A 1RU3A 4P96A 3A8OB 3GFJA 4ZZDA 3H0GJ 5EQTA 4CYDA 1YS7A 3K9TA 4RDUA 1FTTA 2IS2A 1QVTA 2STWA 3KYDB 5JI3E 4L5JA 3DLAA 3NRVA 2HQNA 4GYIA 3S17J 4G4RA 4I81A 2CO5A 4PD2A 4P9FA 4HSRA 3SFZA 3DU6A 2CCHB 4KMUX 4K0KM 3ILKA 3OYDA 3S3MA 1B8IB 1DO0A 5EXPA 3CJRB 2UXBM 1TWGJ 1ZAEA 1JQJC 3GPYA 3FKIJ 5FKLA 2HVQA 4LB6B 3PQKA 4ZYGA 4BE2A 2C6YA 3FBIB 1D2NA 1NHWC 1KYIA 1P7IA 2R62A 4OU7A 3IUOA 4OIQF 1E3OC 5E17F 3IHPA 1XHBA 2BE5F 2G9XB 2EWNA 4AU7A 2R7SA 3GZNB 4BDZA 2EQRA 2DWNA 3LAPA 3E0JB 5ILVA 1YUBA 3MFKA 3ZQCA 1NO1A 5KPRA 1Y1VJ 2GIVA 4B08A 2LYCA 1VTNC 3GLGB 1ZGJA 2VBXA 4WF2A 2HPMA 3K4LA 3M1CA 5ITQA 1HSTA 5IP9J 3T15A 2JK3A 4AKHA 5BPDA 3IAM2 3VSKA 4CXFA 3GPXA 4C2TA 4JI7M 2KMGA 3GQ3A 2AXTC 1VQ8I 1IRZA 3F22A 1V3FA 3SZTA 2R44A 4JYAM 2W1OA 3OY9A 4HAMA 5LD2C 4OIPF 2HDDA 2UZEB 5IDPB 2HWJA 4LF4M 2QFZA 3I5UA 3VYHB 4D80A 4IO9F 2ZFUA 4EVIA 1F9NA 4U0YA 3L2QA 4DOZA 1Z0XA 1G2HA 1RI7A 2IS1A 4G7HF 1SG9A 4IOCF 3CP2A 3RQIA 1X37A 1TQPA 2NS0A 1SMYF 2GZWA 2M1BA 2IEKA 5KAIC 3RKQA 1YYVA 2N35A 2CUFA 4ANJA 4DV4M 3GO8A 2Z1DA 2KMUA 2CW8A 2LHCA 4I6ZA 5KQDA 3M3YJ 4MHGA 3HX3A 3KE2A 2K9DA 1GJTA 4BBAA 2FX0A 2K3PA 2EUFA 4MGYE 4NQWA 1P5EB 2W82A 2DLLA 1NH3A 2R5ZA 4NBQA 3G73A 2E35A 2VC0A 3SC3A 1B72A 4AG5A 3SZGA 3U60A 1HDPA 4R71A 2KA6B 4S05A 3K4BA 4XRSA 1N78A 3GEZA 2FU4A 1VQ9I 4R7GA 5KK1A 3BZCA 3SAVA 4G3OA 2HFHA 3H5NA 4DR7M 3I59A 3Q8GA 3KP7A 4LIUA 2QYOA 4PK4A 2P5TA 3TPZA 1DPUA 1MN3A 3BZ6A 3DEEA 3WTYC 2EFPA 1GHCA 3O8GA 3LSIA 1R7RA 1S7OA 3K2AA 1IW7F 4YFXF 4BCKB 2WXVB 3BJOA 2H1KA 3T6PA 3E6BA 1JT6A 3LA3A 4NXMM 1NJGA 2LDUA 3BDDA 2HQRA 1X58A 3ZQJA 4XR6A 1MBHA 1RETA 4L8RC 1NJFA 1VDDA 1V34A 2LHGA 5GPAA 4E7LA 4KLNA 1FOYA 1XTAA 1NNJA 4Y13A 3H3VK 3TWLA 2LP0A 4WWCA 1ZR4A 2V1XA 2M5ZA 4OIOF 1VQNI 2ZKZA 2PMZA 3VDXA 4QNRA 5ICEA 3KOYE 3TDUC 5LEKA 5C4JJ 3JRGA 3N4MA 1HCRA 3J81S 1IFYA 2DOAA 2MABA 2BVMA 3FXJA 1XS9A 3T1YM 3R9XB 3Q0UA 1SFUA 1QAMA 3HGYA 1FC3A 2I7PA 1XG1A 2M34A 1IN5A 1GVNA 3IH4A 1S7AA 4AKIA 5H20A 1EE8A 3GPUA 2EA2A 5J4YA 1RZ4A 1MH3A 1UM8A 1MBEA 4H0EA 3K7AM 1TQIA 3OWTA 1O3RA 4KO8A 4LF6M 2H1LA 1GL6A 2ZXJA 3DKWA 5GAGJ 2Y30A 3HHHA 1XPXA 2UZLB 5L3DA 1UELB 2VT3A 6PAXA 2ZO4A 4XQFA 4AD9A 5KPZA 2BXYA 3KYCB 5DEQA 5IZ7D 2IA0A 5CVIA 4BBRJ 2L54A 4KITB 2XB5A 3PIPF 1H0MA 5HS8A 2DAKA 1LV7A 2DMTA 2V1CA 2L2DA 1R4MB 3Q5FA 3L29A 5J1UA 1W5CC 3CF5F 4V19K 3LSMA 2V9VA 1C0WA 1NV8A 5E6JA 2R7WA 4BCMD 2VC1A 1JKOC 4G6QA 3BG6A 4ENNA 3BTIA 2FBIA 4P1WA 4AIKA 1UHSA 2Z8YM 2CEAA 3GX4X 2ZAOA 1R4NB 1DV0A 1UHWA 2LXEA 1UB9A 1JR3E 2X6WA 1TF0B 3BTCA 2L4EA 3B7ZA 1S3SA 2L4AA 3GTOJ 2KISA 4U0VA 2QQ9A 5CQGA 4XLHA 2HZDA 3GRYA 4B3MM 3KHIA 3K92A 1P4WA 1FPQA 5FROA 3GWZA 1HW2A 3NEUA 3S16J 3EUHA 2Z3XA 3G1OA 2VOOA 2VPLA 2JY7A 4FETA 1VDLA 2EJSA 4CZCA 2IA1A 2QKMB 1J7KA 1OJLA 2FMYA 4FD2A 2IBDA 4NL4H 2XKOA 3IP4B 4YIIA 2FNAA 1MMNA 2ZM6M 1HW1A 1OYWA 4D0PA 2BPMB 4QLCU 3ZGKA 1BA5A 2BS3A 2FE3A 3EDPA 3FDYA 5F1RA 4E7HA 4A3CJ 4HX4A 2F2EA 4AUXA 4F55A 5HLIA 1F4IA 3DA1A 4OW0A 2H94A 1EIJA 2A3SA 4IF4A 2QSGX 2GOXB 2LBFB 3ROUA 1RC9A 4DGWB 4MGHA 4HF2A 1ZK8A 3PQJA 4P5OA 2P8TA 2XF6A 3F3XA 4ASNA 4ZDPA 1Q3BA 4UB6C 4F7NB 2LTUA 4YIFA 3GRRA 2LTPA 3ZRGA 5JLWA 1S9HA 2XASA 1CF7A 3DP7A 3VWBA 3KP0E 3BCBA 1BC7C 1XN7A 3UMMA 2EV6A 2M0CA 4XRSG 2VODA 3MI9B 2EKKA 4LFCM 2DA3A 3TEDA 1GH6B 2Y2ZA 1L2CA 1A6IA 1FMWA 2V6CA 2DCEA 1R00A 2ZNYA 2X1EA 4DZJA 2Y48A 4EJVA 3L2WA 2J7NA 2VE8A 3HSFA 1PJQA 4BBRM 4PFPA 2CHQA 4EC9B 1KU3A 4XSZF 3RYPA 2E2HJ 1BBYA 3AL0B 1YFHA 1AU7A 4LG2A 2OTJI 3L09A 1G4AE 4KFCA 1B9MA 4BAYA 1JJ8C 4RA2A 2VLAA 1N4MA 2LR8A 2HVSA 2XRLA 1X3ZB 4JBAA 2M7BA 3ZXSA 1EF4A 2PJRA 1TT5B 1VI0A 3G1MA 4AQYM 1UGQB 3WGIA 3COAC 4CJ6A 2XF3A 4MIMA 4YELA 1W7PD 2EIMH 3GLIA 1OTRA 1GVDA 3HGIA 3DLLF 3THGA 3R0AA 3FXOA 3J27B 2VJ5A 1I6XA 5A2QZ 1HQCA 3W2VA 4HL4A 2R3SA 3FXUA 4HEOA 4CCMA 4F52A 1MX0A 3HC7A 1H9TA 4IHXA 5LGTA 4DR5M 2RGHA 2YS9A 3GFLA 4QTRA 2G7HA 4XOPA 3HWSA 2MR9A 3LVVA 3U6SA 1VG5A 2XGDA 2ESHA 4YEJA 2H5XA 2CJJA 4ZGDB 4MTDA 1H25B 2WAQA 4IHWA 2E5LM 1NG6A 4IXAA 2OCCH 4GYGA 5J40A 1XC5A 1WJFA 4BY7J 3CDLA 1IV6A 1IN4A 1WJ5A 1TW3A 4DBQA 5DD8A 1YW7A 4D9JA 4BS9A 3FXRA 2AHMA 4Q48A 1XXHB 2BWEA 4CFXB 4IX7A 2N8GA 4N4NB 3U6OA 1TH2A 3GW2A 1FT9A 1PJRA 1S6LA 4HLXA 3FD9A 1GUXA 5H6QA 1R2ZA 3QZ5B 2FF4A 3GFMA 2YU9J 2JWSA 3P5JA 3ZCOA 3KZYA 4RNAA 1S5LC 1OAIA 4HEA2 2V1UA 4JOMA 2ID6A 3NQOA 3U9GA 2QZ8A 1Z7UA 2DMQA 2MGWA 1Z3YA 1XCVA 4MM3B 1D0ZA 1PYVA 4BY1X 5KQ8A 2W99A 1RNLA 3AFHA 3D8LA 3IH2A 1QNTA 1JKPC 2WC2A 5EEHA 1WH7A 2Z5UA 3I54A 3ZQHA 2XGXA 2WY7Q 4F7SB
chains in the Genus database with same CATH topology
3X28B 2QDJA 3HO8A 2ZPIB 3X20B 4OB0B 4ZGEB 3HHTB 1UGSB 2KR6A 3A8LB 4NC6A 3QZ9B 4P17A 3HZJA 3WVEB 2AHJB 4ELJA 4QSHA 4BBRM 2QQ8A 1V29B 3A8OB 2QF7A 4Z6YA 3A8GB 3TW7A 1FKMA 4AKGA 3VKGA 3BG9A 2ZCFB 3X26B 4AKIA 2CZ0B 1UGRB 2ZPGB 2ZPHB 3QYHB 3DL1A 3BG5A 2DD5B 3A8HB 1UGQB 3QWLA 4MFEA 2ZPFB 4OB2B 4MIMA 2DXCB 1E7PA 2BS2A 3BG3A 4HL4A 2CZ7B 2CZ6B 2CZ1B 4JX6A 3QYBA 4JX5A 4LOCA 4HNVA 2ZPEB 4AKHA 3VKHA 4AI6A 4OB1B 4HNUA 2KMGA 3A8MB 4ZGDB 4BBSM 3TW6A 2WJ9A 4JX4A 3X24B 2CYZB 2QFZA 2QDYB 3X25B 3VYHB 3KHIA 1UGPB 3HB9A 3H4CA 1AHJB 3VYGB 4MFDA 3QZ5B 2BS3A 3QXEB 1QLBA 2ZZDB 3QYGB 3HBLA 4OB3B 5EJCA 2G77A 4FM4B 4HLQA 3QYEA 4HNTA 2ZPBB 4M6VA 2BS4A 2DXBB 2DD4B 3WVDB 2D0QB 4ZGJB 2DPPB 1IREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6Y A;  5EJC A;  4NC6 A;  4P17 A;  3HZJ A;  3QYB A;  2G77 A;  2QFZ A;  3QYE A;  4HLQ A;  2QQ8 A;  3QWL A;  1FKM A;  4HL4 A; 
#chains in the Genus database with same CATH topology
 3M0E A;  1QHH D;  2JUC A;  3C2H A;  4LLL A;  4ENK A;  4OB0 B;  2VI6 A;  3WTV C;  2KIF A;  3VYR B;  1YX5 A;  3WE3 A;  1XMQ M;  4L9V A;  4OWR B;  3NWS A;  1YQA A;  4L0Z B;  1QZM A;  2B0L A;  2R4E A;  3QU3 A;  3TKY A;  3IRR A;  2PX9 A;  3V7R A;  4Q47 A;  1VFC A;  4BQQ A;  3AJI B;  1V29 B;  3I4V A;  2K5C A;  1I5Z A;  3BC8 A;  3TW7 A;  3ZN0 A;  2DT5 A;  1FIN B;  3BOS A;  2YPR A;  3HUG B;  4RS8 A;  3ZOB A;  4XN3 A;  4D1Q A;  3SHG B;  2BJV A;  2XAG A;  3O8H A;  1T56 A;  3SZP A;  5JFR A;  3MMP A;  4KHP M;  2QWW A;  4N9H A;  3W2W A;  3A45 A;  1FP2 A;  3AV0 A;  4M74 A;  2A6E F;  3G6E I;  3ZMV A;  4IHT A;  3EUK L;  4G4Q A;  3S3O A;  2XFS A;  1LEA A;  1MDM B;  1VQ5 I;  3RKY A;  3OS0 A;  4X65 M;  3NAU A;  4CHT B;  2V26 A;  1POG A;  3GLF A;  3E97 A;  4HDU A;  2O25 A;  2IRF G;  3ZH9 B;  1MSF C;  2CJM B;  4RAZ A;  5DYM A;  1R6B X;  5C3E J;  1HXD A;  3RE8 A;  4ZYH A;  5DQW A;  2B9S A;  3S3N A;  4II2 A;  4EJU A;  4YHH M;  2CQ7 A;  2V79 A;  4L6V 6;  4V2G A;  2CUZ A;  3GXO A;  4Y15 A;  1YE9 A;  2CZ7 B;  4RGR A;  5D5X B;  2P4W A;  1Z21 A;  1PJI A;  2ZAM A;  4E70 A;  1IBL M;  5C1B A;  2B9R A;  3C1D A;  4BCQ D;  2JZ0 A;  4KJZ A;  1P4A A;  4GC5 A;  4HNU A;  2HQ5 A;  1OFC X;  4P9U A;  4IZZ A;  2XAQ A;  1Z77 A;  2YX7 A;  2UXD M;  2OAZ A;  1PVE A;  2GQQ A;  3LOC A;  1IY0 A;  2XFT A;  2X48 A;  1XGM A;  1QPI A;  2A05 A;  1WJC A;  2XRO A;  4BH9 A;  4ZTF A;  1QAO A;  3KOW E;  2CUE A;  2X49 A;  4KUM A;  3X25 B;  1U5T B;  4DIQ A;  4BAC A;  3K1N A;  3KOZ E;  3RIR A;  3FXM A;  3VFD A;  3WU2 C;  3JRB A;  4BCJ B;  4GEW A;  4DUY M;  2V4J C;  4GO1 A;  3M8E A;  3BPX A;  3K10 A;  3KX2 A;  2KFD A;  1UNH D;  2D1V A;  4G6T B;  3VYG B;  1OGU B;  3WU1 B;  1ZHF A;  2DA6 A;  2F2C A;  2QGS A;  2OOB A;  3OL3 A;  5BMZ A;  2CHV A;  2PI0 A;  1LEB A;  2DU9 A;  2VKD A;  4FE4 A;  2FBH A;  5EG0 A;  1BR2 A;  3WHC A;  1RIO H;  1BW5 A;  1LFP A;  4LIV A;  1ETQ A;  1IBK M;  1UST A;  2RKH A;  2CWB A;  4BJ5 C;  2VQE M;  4F6W B;  1DO2 A;  3U6L A;  3HEF A;  1IN8 A;  2DZL A;  1MJB A;  4LJ8 A;  2XAU A;  1YW9 A;  4FTH A;  1JT0 A;  2WAQ N;  1ZRE A;  2H1R A;  4NXN M;  2ZME C;  5ACB A;  1OYY A;  1O3S A;  2JY6 B;  4DR1 M;  3K6G A;  1DUX C;  1ENW A;  2IGN A;  1JE8 A;  3E21 A;  3B7Q A;  3HXL A;  1TR8 A;  4AYB N;  1JR3 D;  3OYH A;  3CO7 C;  3BOQ A;  3JTH A;  3OL4 A;  1DU0 A;  5M5X J;  2HWV A;  4CSW A;  3ZMZ A;  1BU2 A;  3WE2 A;  3VDU A;  4LG0 A;  2WIH B;  2MBF A;  2UU9 M;  2LVS A;  1VIN A;  2DDB A;  2G9W A;  4M6X A;  3KLO A;  2HZT A;  3JAM K;  3KPH A;  2DWZ B;  1GVJ A;  4NQW B;  2JA6 J;  3Q0W A;  3ABK H;  2KXE A;  7CAT A;  2BHY A;  2R5Z B;  4Y72 B;  1Z5B A;  1B72 B;  2MC3 A;  3LL7 A;  3SBJ A;  2MC4 A;  4I99 C;  4WW0 A;  3U60 B;  2E1M B;  3CO6 C;  4QWQ A;  5BPI A;  5KNL A;  3VK7 A;  1IY1 A;  1DPR A;  1IZ1 A;  1BL0 A;  4B09 A;  2J5O A;  4EJW A;  3S2W A;  2MD0 A;  4LZZ A;  5LEJ A;  4X0G A;  1HNX M;  1FJG M;  5IY5 H;  2ZCF B;  1RR7 A;  5EZH A;  3H9J A;  3F8B A;  2L6O A;  4HV6 A;  1W7P A;  1FBS A;  3EIH A;  3E4R A;  1QVU A;  2F5O A;  4P55 A;  2RKO A;  2K40 A;  4IJA A;  4DV1 M;  4UUS A;  1VQP I;  1R49 A;  4ZH4 F;  1H1P B;  3DL1 A;  2ZXI A;  5F0F A;  3I3L A;  2WAF A;  2R92 J;  2ZJP F;  4A3J J;  2BXZ A;  1HBX G;  1XB2 B;  1ZG3 A;  1QUT A;  2L4F A;  2DA7 A;  2NS8 A;  4BU2 A;  3D0S A;  1Z59 A;  3B89 A;  3QQA A;  3F5X B;  3OYB A;  1ZGW A;  4PDK A;  2FML A;  2Y21 A;  1RR8 C;  4ENJ A;  2CV0 A;  3K4M A;  5FFZ A;  2XUB A;  5FO5 A;  4CGZ A;  5FLX K;  3ERM A;  4F2L A;  3GO5 A;  4EC8 B;  1VOL A;  4II7 A;  3LW5 F;  4BL0 B;  3GLH E;  2HKX A;  2CFX A;  2EFN A;  3LA2 A;  2FQ4 A;  5FTL A;  2HS5 A;  2Y75 A;  3AKZ A;  4JX6 A;  4WXC A;  4Y28 F;  2JGZ B;  4LOC A;  1T33 A;  5FTJ A;  3W0L B;  2OQG A;  3E5U A;  3IH3 A;  4RB2 C;  3HOZ J;  3K2L A;  2XRN A;  3FKE A;  1V4R A;  4M3F A;  4C2M J;  2W7N A;  1KU7 A;  3ZQF A;  2E2I J;  4KMF A;  2Y0T A;  3FRH A;  4ABZ A;  3J7Y J;  2ZJR F;  4A3F J;  9ANT A;  3MK6 A;  3UJN A;  1HNZ M;  1U9O A;  4OAZ A;  4FE7 A;  1G71 A;  2PG4 A;  2FS1 A;  3A0B C;  2CYZ B;  2DMP A;  2K9L A;  2STT A;  4Y7N J;  2K47 A;  4I5S A;  3FIS A;  3OSG A;  1IQP A;  2QEX I;  1ZAO A;  1H4L D;  2HKO A;  5K5R A;  1FWZ A;  2RGO A;  1XSV A;  3JRH A;  3DCF A;  5M3F J;  3KZI C;  3OYN A;  5GTH C;  1F36 A;  3GF2 A;  3GLX A;  2XAH A;  3HPH A;  2GNO A;  4KRC B;  4QPO A;  3WHK A;  1E9H B;  3FXQ A;  2UUB M;  2KRU A;  1D0X A;  4LFB M;  1XNQ M;  1JUM A;  2ME6 A;  3KET A;  4FW9 A;  2R5Y A;  4B3T M;  5L3C A;  3L2R A;  1REP C;  1OCP A;  2QCU A;  3OYJ A;  1QBJ A;  2R6F A;  1TWA J;  2EJR A;  2IA2 A;  3HRU A;  3T0Y A;  2GA1 A;  3DTK A;  5LFA A;  3B74 A;  3UNG C;  5D5W B;  1ETX A;  3BR3 A;  2UXC M;  3ABL H;  1HNW M;  4XNF A;  1WFX A;  3H9G A;  4IPA A;  5FGM A;  3CCE I;  5DQV A;  2DHY A;  2OF7 A;  4S12 A;  4BDY A;  4A3I J;  2KIQ A;  3RZD J;  5B3S H;  1KQ8 A;  1IM2 A;  3HKZ A;  4G6D A;  4I0B A;  5J1R A;  2CV2 A;  4KT6 A;  1QRY A;  2DPP B;  4ZGJ B;  1X1A A;  2LW4 A;  4F7L B;  2ZSH B;  4KRD B;  2C99 A;  1UG2 A;  4BCN D;  2X1C A;  1A5T A;  4LJA A;  2W9Z A;  1G4D A;  1Q3C A;  2JY8 A;  5DV5 A;  2ZB9 A;  1D5V A;  1V5E A;  3HGG A;  5HBE B;  3IEC A;  3QOP A;  3VK8 A;  1UGS B;  1X1P A;  4EON B;  4NC6 A;  1WH5 A;  4RB3 C;  1EH8 A;  3V8J A;  2G3Q A;  3BBZ A;  4ELJ A;  2R7X A;  5M3M J;  4QSH A;  2P6T A;  3HOX J;  2FJ1 A;  2JA5 J;  3M9A A;  4BXX J;  2ELJ A;  1K4S A;  1O7F A;  3K1M A;  5FKN A;  1ON1 A;  2ZME A;  2DPU A;  1S3J A;  4BCO B;  3C9P A;  3HU3 A;  5FTN A;  1GY3 B;  4YOO A;  1ZP2 A;  1IUY A;  2D45 A;  1NNU C;  3OIO A;  2NVQ J;  3FXK A;  2CP8 A;  4NRW A;  5TJJ A;  4RAG A;  3FUT A;  4D5F A;  4YFN F;  1CF7 B;  2BEO A;  1HDD C;  3K1P A;  1Z91 A;  4RM3 A;  4YIR X;  3DDQ B;  2RN7 A;  2HYG D;  2JRM A;  3SMS A;  4ITQ A;  4EM2 A;  5J47 A;  4JP0 A;  3BG5 A;  4L15 A;  2OPT A;  1OIU B;  1TDH A;  5BR8 M;  3HHW A;  1EFU B;  2EA4 A;  2OBP A;  4MFE A;  5IYC J;  2EKF A;  2LNH C;  1TDZ A;  3WHL A;  2XF5 A;  1H1S B;  1AKH A;  5A2Q S;  2LY1 A;  3TGN A;  1W0U A;  4HX7 A;  1MMS A;  2R0I A;  4IQJ A;  2L5Q A;  3E5X A;  2F5V A;  2KNZ A;  1FSH A;  3ZQI A;  3ZC7 B;  4BCF B;  3KS4 A;  1BI3 A;  4RMN A;  4I7H A;  5J3L A;  3CME I;  2K9N A;  2KQR A;  1ORY B;  1ZEL A;  1H9G A;  2K4J A;  1ZH5 A;  1ZLK A;  1BJZ A;  4DZP A;  3CDI A;  4KNY A;  3FTE A;  4OX9 M;  3OMY A;  3RSN A;  1G41 A;  2XKP A;  2XPV A;  2BKZ B;  4HW0 A;  3LA7 A;  4M3E A;  2BJW A;  2XPW A;  3IAS 2;  3V8K A;  5FKO A;  1K61 A;  2PJR B;  4QHS A;  3TW6 A;  2C5X B;  1VQ7 I;  2M3A A;  2I10 A;  4RKU F;  5JHU A;  4PSW A;  1K3W A;  2UV1 A;  2UZB B;  5LMU M;  5KPT A;  2F5P A;  3GLI B;  3B6A A;  3L2U A;  2DTR A;  1DQU A;  4A3K J;  2VOP A;  2PK2 A;  1MND A;  4O6J A;  1ODD A;  3O2P E;  1XWI A;  3KIO A;  2QPA A;  2EH3 A;  2UXX A;  4IHV A;  2WZJ A;  3CUQ A;  4OIR F;  1WJE A;  1ORK A;  1HW5 A;  1PP8 F;  4KDP A;  3ULQ B;  1EV7 A;  4LF8 M;  3VSL A;  1SXJ C;  4I0A A;  5HNB B;  1FZP B;  2BHZ A;  4B3S M;  2Z99 A;  2VBZ A;  1OIZ A;  4JI0 M;  1MJ9 A;  2ZJ2 A;  4G94 A;  4BYY A;  3IV5 A;  3CCM I;  4FCW A;  2A61 A;  4OU0 A;  3GCM A;  3SJM A;  3KFW X;  4ESF A;  4I98 B;  5K5Q A;  1NV9 A;  2LOO A;  1XGS A;  1E3H A;  4L18 B;  4LJ9 A;  3F8F A;  1Z5A A;  2RRU A;  1FEX A;  3DWL E;  2UUE B;  4PCZ A;  1AA7 A;  2DHR A;  4MO7 A;  5KAF C;  4YOZ A;  4BE0 A;  3WTT C;  1JR3 A;  5E3O A;  2PN6 A;  3ONQ A;  4RB0 A;  2KRK A;  4UV8 A;  4ETS A;  2DEN A;  4YG2 F;  3MVP A;  5HOO A;  1ZTR A;  3RCO A;  3HM5 A;  3ZN1 A;  3LVW A;  3A46 A;  1JGG A;  5CKT A;  4KIG A;  3OYM A;  2IJL A;  1FSE A;  4DYC A;  2KLO A;  1IRE B;  1TTY A;  1WJ7 A;  1PJJ A;  3DV8 A;  2WMB B;  4EJT A;  1ZRF A;  4MEY F;  4A69 C;  1ZYR F;  1MKM A;  2KL4 A;  4BQN A;  5FD6 A;  2BVL A;  4N4O B;  3MZ8 A;  1D3U B;  2ELK A;  3GRU A;  2FA5 A;  2K3F A;  4BE1 A;  2ISZ A;  3OYA A;  2K9S A;  1GUX B;  3X20 B;  4G6Z A;  5EDN A;  4JI6 M;  4M3B A;  3MKY B;  1LNW A;  3IG8 A;  2Y0M A;  1OKS A;  5F08 A;  5L3B A;  3PO2 J;  4PDG A;  1WGN A;  2PJQ A;  3WVE B;  3H9Q A;  1AHD P;  2AHJ B;  4CCK A;  1NTC A;  2CMP A;  5ICF A;  1NSF A;  2VON A;  4GHA A;  1VEK A;  1MIJ A;  1KQ0 A;  2MFZ A;  2QZ4 A;  5LGU A;  3TO7 A;  2F4I A;  2QF7 A;  1BJA A;  4IVN A;  3H1C A;  4ESJ A;  3R8F A;  2EFQ A;  3FE3 A;  3V7S A;  4M6Y A;  1EJ9 A;  4F6U B;  1R2Y A;  2BY0 A;  2F4O B;  3HU2 A;  4BQO A;  3E3V A;  2BY2 A;  3IKV A;  1HKQ A;  4FAS D;  2DAM A;  3H5R A;  1AIP C;  2DMU A;  1OCT C;  4KYW A;  3RGS A;  1R5I D;  2XSZ D;  3V42 A;  1QYR A;  2PBI A;  3FHN A;  1KXU A;  2IT0 A;  2NOG A;  4E6K G;  4IMY B;  4YFK F;  3ZQG A;  3H35 A;  4CFU B;  2UXN A;  3E1S A;  1GJS A;  3H4J A;  5C44 J;  1BIA A;  2KHM A;  4D7M A;  5LHG A;  1KA8 A;  3I4M J;  3I53 A;  1LE8 B;  1YOV B;  3IWZ A;  4JI5 M;  1H24 B;  1ETV A;  3M1E A;  1SEU A;  4ZJZ A;  4CFU D;  2YR2 A;  1K7A A;  2OTL I;  1BI0 A;  4KN7 X;  3EYI A;  3S2H J;  1IDZ A;  3DXJ F;  1J5Y A;  1DGF A;  4CFW B;  1QZZ A;  3B7N A;  3F0C A;  2JT1 A;  2ZTD A;  1E0E A;  3KCC A;  2K6B A;  2HPI A;  3TNW B;  3PO3 J;  2EUC A;  3M6A A;  3BZK A;  3DBL B;  2B7E A;  1R4G A;  3WHB A;  1I27 A;  3BLQ B;  3MKL A;  3OSF A;  2LC2 A;  1H28 B;  4AC0 A;  3QAU A;  2XSJ C;  1P3Q Q;  1ETO A;  2DAI A;  2QLZ A;  2CQN A;  5HS9 A;  2NRA C;  4HF1 A;  2LVA A;  1A35 A;  3BY6 A;  3GLF B;  2FE8 A;  2Y0S A;  2LH9 A;  1DGH A;  3REO A;  1U78 A;  1X2N A;  2BGC A;  4BCM B;  1Q39 A;  2J7O A;  2LY2 A;  1GKI A;  3RKX A;  3M7G A;  1XNR M;  3OIQ A;  3KP5 A;  1BOB A;  4A5N A;  4EV0 A;  1AHJ B;  1OCZ H;  3S1Q J;  3RGF B;  1IAW A;  1NVM A;  5HVQ C;  4OVZ A;  4WP2 A;  1Y56 A;  1H89 C;  3PO3 S;  3BTJ A;  2L0K A;  2IP2 A;  2XIG A;  3OYK A;  2C98 A;  5ERI A;  4JI3 M;  5DS9 A;  4RF0 A;  3SMP A;  2OU2 A;  4DYQ A;  2R65 A;  1GV5 A;  2DOD A;  1V55 H;  2QKL B;  4BXF A;  5L3E A;  2W24 A;  1K82 A;  1Y8R B;  5BNG A;  1EA3 A;  2IXS A;  3I4P A;  3MQ0 A;  3BQY A;  4ANR A;  2H8R A;  5ICC A;  1YX3 A;  5JR3 A;  2L7K A;  3R61 A;  1TFB A;  4X66 M;  5F6F A;  1Q02 A;  4LF5 M;  2NOJ B;  5TIS C;  2CSO A;  1UMQ A;  3C7J A;  1X4O A;  1V92 A;  1OLT A;  3GTJ J;  3P7N A;  4J01 A;  1IGN A;  1WWX A;  1URC B;  1XSX A;  3JR4 A;  2X6Y A;  3DKX A;  2ESN A;  3GLL A;  1QGP A;  3DOG B;  4I01 A;  1ENH A;  3JR5 A;  1JB0 F;  4XLA A;  5EP1 A;  3N97 A;  1IO2 A;  2E1C A;  2HCB A;  1KON A;  3SEQ A;  1L1Z A;  2DPD A;  4EOQ B;  2YUS A;  4JV5 M;  2DT7 B;  4DR6 M;  4MNU A;  3K9O A;  3MHV C;  2Y20 A;  4ZDO A;  4A6D A;  3KEO A;  5EG0 B;  4FVM A;  3VDP A;  3ZQ7 A;  3K4J A;  2DAE A;  3CLO A;  5EGO A;  4EM0 B;  4M73 A;  4Y3O A;  1WHU A;  3DBH B;  2VB6 A;  5EP3 A;  1FBU A;  5LRS A;  1WJB A;  4IBG A;  4CGY B;  2TCT A;  1R1T A;  3W67 A;  1R5H A;  2L2O A;  3C2B A;  1E17 A;  3FTF A;  1EKE A;  2QM3 A;  4DV7 M;  2KZG A;  1N77 A;  1KFV A;  2R0Q C;  5H37 D;  3RJP A;  4CO8 A;  4W1U A;  4BXU A;  1QZE A;  4N9I A;  3TMO A;  1UFM A;  5HLT A;  2HOE A;  5CEI B;  3X2Q H;  2AS5 F;  1K83 J;  1HR0 M;  1K78 A;  2JUG A;  1VQK I;  1IV8 A;  2JTV A;  4WUR A;  3X26 B;  1QPM A;  4RM2 A;  5J6X A;  3RGP A;  1VQM I;  4IBK A;  3E5Q A;  1FVV B;  2ZPH B;  4AVP A;  1OCC H;  2XSD C;  2DFH A;  2JMW A;  2RQQ A;  3NWL A;  4ZPX A;  5CPR B;  3HDD A;  1WKM A;  4D81 A;  3FIW A;  3CF6 E;  2WSE F;  5E8G A;  4A3D J;  3M4O J;  2JN6 A;  2QUF A;  2M8E A;  3BRO A;  4FWG A;  1HSJ A;  3BG7 A;  1A6Q A;  4A12 A;  5E1X A;  2OJE D;  1Z9C A;  3SYT A;  2E2J J;  2BS2 A;  4EOK B;  2M8G X;  2QQB A;  3G3Z A;  3G4S I;  2ZNZ A;  3PNT A;  2C6T B;  4LK0 F;  2O03 A;  3CMA I;  4PJ0 C;  1T08 B;  3D1N I;  3R60 A;  3VB2 A;  2PJP A;  2I40 B;  1TH4 A;  1MNE A;  5E3M A;  2BNK A;  1LJ9 A;  1W7P B;  2QSF X;  4X1E A;  4UUS B;  1V54 H;  1R6R A;  2MLK A;  5IPA A;  1W5S A;  3L2A A;  1TL8 A;  2AQE A;  3S15 J;  5BPV A;  2A5W A;  2G7U A;  2MG4 A;  4PZJ A;  4XSX F;  1PKD B;  1R9T J;  2V9P A;  1K4T A;  2E34 A;  1E32 A;  4B3R M;  3L1P A;  3K70 C;  2CQX A;  1GLN A;  4WCG A;  1N75 A;  1OYI A;  3HL2 A;  1D1C A;  3V76 A;  3ZMT A;  3UKG A;  3HTU A;  1LFU P;  4S04 A;  2IW5 A;  2E71 A;  3OR1 C;  1ITY A;  5E20 A;  1H8A C;  1PM5 A;  1XO2 A;  3AOE C;  5LHI A;  2W9F A;  2V6Z M;  1YJ9 I;  2DO7 A;  2CRG A;  4LGW A;  1XMK A;  4XOR A;  5HLH A;  5HOD A;  3BP8 A;  1VND A;  3A42 A;  4MFD A;  2QGU A;  2PMZ N;  2VKH A;  1BOA A;  1M1E B;  3A03 A;  4B3X A;  4JI2 M;  3J7B A;  1XGO A;  2HDC A;  2ZZD B;  1ACI A;  3Q0V A;  1KSF X;  2X4A A;  1W36 C;  1N25 A;  1IN7 A;  2AHQ A;  4KT0 F;  2E1O A;  3J81 K;  2LKX A;  4OB3 B;  4B7G A;  3EQL F;  1PJS A;  5EJC A;  1LKX A;  1QQI A;  5ITR A;  1TBX A;  2XZU A;  4HLQ A;  4FHT A;  1G8X A;  3ZPL A;  3PUB A;  3RFW A;  2NS7 A;  4LB5 A;  3QYF A;  2CS3 A;  3FF5 A;  4GIT A;  1SXJ E;  1ON2 A;  4EOI B;  4YRV A;  1E94 E;  2Y0S N;  3A98 B;  2VII A;  4ZYD A;  2D7H A;  2JRT A;  4NSR A;  3U5Z A;  5EYR A;  4EAT A;  1KYW A;  5JI6 A;  2ZPI B;  1I1S A;  5DCM A;  2R5Y B;  1W0T A;  1G3Y A;  2HGC A;  1P2F A;  4KIC A;  1WCM J;  2P81 A;  3DOA A;  1P9Q C;  2C9O A;  2ID3 A;  2UUC M;  4XLC A;  2WSF F;  1J5E M;  2CW7 A;  3QAH A;  4KN4 X;  3B02 A;  2KPM A;  3TN8 B;  4GKJ M;  1YJW I;  4L16 A;  3E46 A;  3JRD A;  1D5Y A;  3I58 A;  2WHB B;  2QQ8 A;  2XSZ A;  1BI1 A;  1Y6I A;  2COM A;  2L9S A;  2WA0 A;  5CJ9 A;  4PCQ A;  1IXZ A;  1JGS A;  4LJ7 A;  1OIS A;  5CVV A;  3DFZ A;  1IG7 A;  3C3E A;  2B3T A;  2BW3 A;  4HF0 A;  3OOU A;  1JKR C;  2R7V A;  1JTY A;  1F1Z A;  3VFZ A;  5CYI B;  3VEP A;  5IRE B;  4IRH A;  4DBR A;  3OV8 A;  2O6G E;  4LJ4 A;  2L3D A;  4CXA B;  2ZBK A;  1YIJ I;  2R7Q A;  2F4M B;  2C5V B;  1PUF A;  3JTG A;  1B9N A;  2DKL A;  1S8N A;  3L25 A;  1GXQ A;  2EA0 A;  2DXC B;  1XMX A;  3EIE A;  5FKM A;  2L9V A;  4OAY A;  5JVG F;  2PMI B;  4CHU A;  1OFH A;  4I3Z B;  2ERC A;  1O57 A;  4PDI A;  4A3M J;  3AL0 C;  3I9V 2;  4HA8 A;  1HT2 E;  3TNH B;  1G3S A;  3RPU D;  2ZME B;  3ZMD A;  2JP7 A;  4RF1 A;  1U9N A;  1MZB A;  2O01 F;  1LQ1 A;  2VQG A;  4NNJ A;  4XLF A;  1HLV A;  3CC2 I;  3S1M J;  4DV3 M;  1GO5 A;  2LVP C;  3NBX X;  3FXL A;  1U8B A;  2KZV A;  1GUU A;  2CZ6 B;  1D0K A;  1MJG M;  2QBY A;  1MSE C;  1Q1H A;  1W5T A;  2IGO A;  1Z67 A;  5F0C A;  4PFO A;  4ON0 A;  3K0L A;  1JI8 A;  4CRL B;  3EID B;  3ISP A;  3HJE A;  3LSJ A;  4LRS A;  5HS7 A;  2KRF A;  1FOX A;  2Y9Z A;  3A8M B;  2V6E A;  4IEJ A;  2WAE A;  1I4W A;  2CYY A;  1T0F C;  2XGC A;  2YSR A;  4MEX F;  2R46 A;  5CYV A;  4EOP B;  3FYC A;  2OZU A;  1WI9 A;  1AKH B;  5LMN M;  3K2Z A;  3MN2 A;  4OR5 B;  4C3H J;  1ZG1 A;  1WQ2 A;  2VQH A;  3KP2 A;  2BY1 A;  4BCQ B;  5IP6 A;  3J80 K;  3DPL C;  3IL2 A;  2M9H A;  5ITU A;  2DYR H;  1H27 B;  2MH2 A;  2VKE A;  3K69 A;  4JI1 M;  3CTA A;  1J09 A;  1XMA A;  1L1T A;  4QOS A;  3GLH A;  3CCL I;  1G6N A;  2J5Y A;  1I94 M;  4FWD A;  3CF0 A;  4J00 A;  2LVQ D;  2IN3 A;  3LSK A;  1PDN C;  2GAU A;  1OL1 B;  1VQ6 I;  1K3X A;  2XH9 A;  2DJN A;  3DEU A;  1USS A;  4R1H A;  3TP0 A;  1FYL A;  3SYL A;  3BJA A;  3GUD A;  1YI2 I;  1V33 A;  1P7J A;  1MU5 A;  1BI2 A;  5TGT A;  4EOS B;  4IBB A;  5H6R A;  3GTM J;  1O9K A;  4I2O A;  4A3L J;  3PXG A;  4HNT A;  4D82 A;  1TNS A;  1G8P A;  3DPU A;  4G12 A;  4W97 A;  3GLG E;  1E2X A;  2E7X A;  4R79 A;  1NY5 A;  3SAS A;  1BN5 A;  1KQ9 A;  3BPV A;  4EGY A;  3CUQ B;  2XHK A;  1HA8 A;  4GGG A;  2O0Y A;  5KVR A;  4V2F A;  4ZDL A;  4BCI B;  2FFJ A;  2VXZ A;  4WXH A;  3KP4 A;  1WJA A;  1QO0 D;  4KIF A;  1KU9 A;  3AOE A;  3GZ6 A;  3HO8 A;  1OIP A;  2KIU A;  4RAY A;  3U6Q A;  1KU2 A;  3FUX A;  2BYV E;  2Z9O A;  3U21 A;  4I02 A;  4NSO B;  2LG4 A;  4RGU A;  1FJL A;  3S2D J;  1G59 A;  1S29 A;  4HRI A;  2I7N A;  2XEP A;  4UB8 C;  4F91 B;  1F5Q B;  3GTM S;  2Q0O A;  1OR7 C;  5FLM J;  1MMA A;  3RDI A;  5J4V A;  5D8K B;  1X3U A;  1BW6 A;  3WG9 A;  1APL C;  1D0Y A;  3TNI B;  3IWF A;  3ML6 A;  3BR0 A;  5E8I A;  3I55 I;  5BQT A;  1R23 A;  4O3M A;  3E7L A;  4XID A;  5B1B H;  2FOK A;  3WOD F;  4LMY A;  2JVG A;  3G33 B;  3H3U A;  4L9N A;  3PFY A;  1FX7 A;  1WPK A;  2HDW A;  2K27 A;  2DA1 A;  2Y9Y A;  1ZMU A;  2L09 A;  2A07 F;  2WB1 A;  2VDB B;  3F8N A;  2CZ0 B;  3MWM A;  1ZGA A;  3WG7 H;  1FYM A;  4NOO B;  4E7S A;  3HOS A;  4E7J A;  1PP7 U;  3MY1 B;  2GQF A;  3A8H B;  2VF8 A;  5E26 A;  2O5R A;  4BHC A;  4C2U A;  4UN0 A;  4BCH B;  2ZPF B;  2JPB A;  3HOW J;  2EIL H;  3OYF A;  4U7D A;  2HU9 A;  3PIO F;  3JRC A;  4R8H A;  2UUZ A;  1SD4 A;  4HX8 A;  2F6C A;  1N34 M;  1MD0 A;  1E9S A;  3R6S A;  2DME A;  2FXA A;  2HTS A;  2F5E A;  1QDR A;  1IRF A;  4NRV A;  1SAU A;  2FRH A;  3I59 B;  1S7E A;  2W25 A;  4B43 A;  2A68 F;  3LAJ A;  3IKT A;  5L8R F;  4HNV A;  4G7O F;  1CGP A;  1OIY B;  2DFI A;  2V1D A;  1E9R A;  3BJ6 A;  2F5Q A;  4AI6 A;  3ESW B;  4A6E A;  5L3G A;  4OB1 B;  4HPQ A;  2WV0 A;  4G4O A;  4LCB A;  4AIJ A;  5GAE J;  1EH7 A;  3KDS E;  1YG2 A;  2EBI A;  3LQ5 B;  3CJT B;  3NDQ A;  3DTE A;  2EZI A;  3JRE A;  3PSI A;  3GTQ J;  3PJR A;  4IBC A;  3WTU C;  4D5C A;  1P6R A;  1AOY A;  1FMV A;  3GRV A;  1MMD A;  4LJZ F;  3HOU J;  3FYD A;  3L2V A;  5H2F C;  4ZTJ A;  5ITT A;  4GKK M;  2DOE A;  1MBJ A;  2LMD A;  2RNJ A;  3HRS A;  4G9Y A;  2IVX A;  2DI3 A;  2XB0 X;  1YLA A;  2JPC A;  1HKS A;  1F43 A;  3HU1 A;  4BUP A;  5L2W B;  3A2K A;  3U6P A;  4RB1 A;  1IXS A;  3J7A O;  1TC3 C;  3HRM A;  4RLF A;  3HHZ A;  2NYX A;  3AG4 H;  3EUA A;  2WY8 Q;  3F6V A;  4L9T A;  2L02 A;  1GXP A;  1Z6T A;  2LH0 A;  2I8D A;  4J19 A;  2K85 A;  4XLN F;  4XBF A;  4G8X A;  2M5W A;  3ZR8 X;  3K8Z A;  1U5T C;  5ITX A;  2VBY A;  3CCY A;  4DW6 A;  3HOT A;  4UY8 I;  2X8A A;  2NQ8 C;  3GTL J;  2OUM A;  3J80 Z;  5BOX A;  1O7L A;  1Y0N A;  4ZC3 A;  1FLI A;  5ITY A;  2MH9 A;  2M4K A;  4G4N A;  2VBW A;  2W84 A;  3JSP A;  4IRG A;  1QMZ B;  2WTE A;  1YIO A;  3Q8X A;  2W57 A;  4BY1 J;  1FY7 A;  2W85 A;  3ECH A;  2UZK A;  4OVZ B;  3CCU I;  2FBK A;  3DTO A;  1TH3 A;  2GM4 A;  2OCE A;  4BEH A;  5B5E C;  2HOS A;  1SD6 A;  3G2B A;  2PEX A;  1BVS A;  3FMQ A;  4F93 B;  2CW0 F;  3D5S C;  3L00 A;  3QZ9 B;  4ENM A;  5IYD J;  3HRT A;  4HOB A;  2H6C A;  1GV2 A;  3HJQ A;  2EK5 A;  1FOW A;  4L5E A;  3A01 A;  1GAB A;  4BCN B;  4LLN A;  2QSH X;  5D6F A;  5ED4 A;  2EIN H;  5EEA A;  5C18 A;  2VQF M;  3A8G B;  3FUU A;  3OS1 A;  5E3N A;  3E9S A;  4PSX A;  2KHH A;  3I04 M;  2M45 A;  1FKM A;  4Y4R A;  3WTX C;  1I39 A;  2ACJ A;  2L9R A;  2HEO A;  2XGE A;  3CDH A;  4I09 A;  3C58 A;  3LQQ A;  3PVS A;  3IRQ A;  3DPT A;  3EPZ A;  2ECB A;  5IOY A;  3FHZ A;  4MH0 E;  1X1B A;  1H88 C;  2W2H A;  2EV0 A;  3NWT A;  3PL8 A;  3AG1 H;  4XKV A;  3BWG A;  3CUO A;  3OS2 A;  2JZ1 A;  3RPU A;  4IL6 C;  2OD5 A;  3I51 A;  1LVA A;  5EGO B;  2PQ8 A;  1SXJ D;  3U6D A;  2X4H A;  4P16 A;  4E4H A;  2E1M C;  5CVU A;  1SFX A;  1XDU A;  1UNG D;  4HST A;  1AD6 A;  2EO2 A;  4C3J J;  4MGI E;  2QA4 I;  3NBI A;  3W6K B;  4UVA A;  5D6E A;  2JY5 A;  4I8O A;  4KT5 C;  5HNF A;  2M87 A;  1K78 B;  3LQR A;  1WXQ A;  1D1B A;  2RNG A;  3CGW A;  1A5J A;  3RI4 A;  4RGX A;  4HBL A;  3KYL A;  5LGN A;  4AM3 A;  4YY3 M;  3I4N J;  2C5N B;  4ITV A;  5BNJ B;  1VZ0 A;  3JAM Z;  4MQV A;  1I3Q J;  4F7Z A;  5DM7 F;  1O3T A;  2QP9 X;  4GCV A;  4Q7J A;  2WB1 N;  4UUT A;  5DTD A;  1ZRD A;  4ZGE B;  2DZN B;  5DUK A;  1MBG A;  5KHD A;  3BR5 A;  2ZXW H;  4PJM A;  3E6D A;  2C5O B;  2LRE A;  2VIX A;  2Z2S B;  5LMK B;  1RKW A;  5K7H A;  3HB9 A;  3ECO A;  2H6B A;  2JWT A;  3QU6 A;  5M5W J;  4LZJ A;  4AW4 A;  3A0H C;  3CCJ I;  4CFV B;  4LF7 M;  2IGK A;  2M4G A;  2R4G A;  5CVR A;  3Q3S A;  4FX3 B;  4AIH A;  1UFZ A;  2E19 A;  3MEX A;  4ROE A;  4JI8 M;  2K9Q A;  4CFN B;  3SAW A;  3CCS I;  2JJ7 A;  2OV7 A;  3LFK A;  3ELK A;  2OQ4 A;  5J1Y A;  1RUO A;  4IKF A;  3PM1 A;  1RUN A;  1QLB A;  1AWC A;  3MD2 A;  5D4R A;  4IRI A;  4FT8 A;  5ITX E;  3OYL A;  2VL8 A;  4XKC A;  3TO6 A;  5F27 A;  4LG3 A;  5FLX Z;  1YJN I;  4PJJ A;  2KZU A;  3QYE A;  2CQQ A;  1R36 A;  5GTI C;  3T1H M;  4M6V A;  4XN0 A;  3J7A S;  5C4X J;  5D5U B;  5HBJ B;  2DD4 B;  4BGD A;  4XIC A;  3GP1 A;  3BQZ A;  1B6A A;  2X6O A;  2Z4R A;  3QP6 A;  1MH4 A;  2VT2 A;  2QHO B;  3ABM H;  2R7R A;  1TD6 A;  1VF9 A;  1DP7 P;  2KIM A;  5D5V B;  4DUZ M;  4ZYA A;  2DAG A;  3A8L B;  1I1G A;  3FKJ A;  1JUS A;  4FCY A;  3IG5 A;  3J7A Y;  1SVM A;  2X6X A;  4AG6 A;  2KJB A;  4E7I A;  1SD5 A;  4LJ5 A;  1ZR2 A;  4UUV A;  3BHT B;  2K0B X;  2DZO B;  2R93 J;  1U5T A;  5D4S A;  4DV5 M;  3QHW B;  1MNM C;  1HT1 E;  1XXH E;  3FTC A;  4FCV A;  2HI3 A;  3CQZ J;  2E60 A;  3HJ8 A;  4PUS A;  3FM3 A;  4RAF A;  4PJN A;  3EUH C;  4CDG A;  1YTY A;  1QAN A;  3PNY A;  3GFI A;  3FX3 A;  4DYR A;  1S72 I;  2R4J A;  1QAQ A;  2YX4 A;  4IJE A;  4Y17 A;  4HG2 A;  2W00 A;  2WFY B;  5GP9 A;  3AG3 H;  3HOV J;  3S8P A;  3U5Z B;  2AXL A;  2A5Y B;  1PJT A;  2EFO A;  3SXY A;  5DCM B;  1QVR A;  3QPL A;  3POM A;  2ZPG B;  1VEJ A;  3U2R A;  2X85 A;  1IUF A;  2R45 A;  4RLQ A;  1JSU B;  4XGI A;  2DD5 B;  2KEB A;  2L7F P;  3N05 A;  2EIJ H;  3KP6 A;  4AID A;  3M8J A;  2DA5 A;  3QWL A;  5E1Z B;  4TTH A;  2AO9 A;  3K7A J;  2GXB A;  4OB2 B;  3CCV I;  1ERD A;  4XLP F;  1E7P A;  1UHM A;  4A93 J;  1L8Q A;  1WRJ A;  5DDG A;  1T38 A;  1F5T A;  5EXT A;  3F92 A;  1RPW A;  2OA4 A;  2X51 A;  5F0H A;  1BR4 A;  1JKQ C;  3BG3 A;  2HAK A;  3H4M A;  3OYI A;  2M30 A;  2DN0 A;  2XVC A;  4EM1 A;  2R7G A;  4H4K C;  2EFW A;  2DWM A;  3W0F A;  1WI3 A;  2BW3 B;  2DAO A;  2LFB A;  3VYU B;  3RYR A;  5FRN A;  2NVT J;  2CGP A;  2CCI B;  3HKZ N;  3FRI A;  5K5O A;  3G71 I;  3FK7 A;  1OAO C;  2M60 A;  3L2C A;  3VKH A;  2QVO A;  4BY7 X;  1J59 A;  2QEN A;  2ZBK B;  2GXA A;  5FTK A;  3KZZ A;  2D1H A;  2J5P A;  2H09 A;  2CQK A;  2JNH A;  1LUJ B;  5B66 C;  5GAH J;  1PUF B;  5IT9 K;  4FWH A;  4XK4 A;  5FKK A;  4LLG F;  3WU0 A;  1A31 A;  4UVB A;  1G3N C;  2PK9 B;  2IS4 A;  1WGL A;  4EOR B;  2CWE A;  5AON A;  2QDY B;  5LLQ A;  2IW6 B;  1JST B;  1DGB A;  4DQ2 A;  2MA3 A;  3WGG A;  3S1N J;  4LJ6 A;  3HHY A;  3HG9 A;  4UXN A;  1Z6R A;  1Y1W J;  2UZD B;  4CYC A;  5EP2 A;  2C96 A;  3U6C A;  3OYE A;  4XL9 A;  4G6L B;  1LVK A;  4B1R A;  4IJF A;  1T39 A;  2QNJ A;  3ZMU A;  2QBY B;  2XF7 A;  5B1A H;  3DU5 A;  4X62 M;  1V5G A;  3U6M A;  2EIK H;  5IP7 J;  4A3G J;  1J2X A;  2XV4 S;  1XX5 A;  3JRI A;  2G0E A;  2HOA A;  3C2G A;  3S1R J;  3W68 A;  3ZMS A;  3BLH B;  3I4Y A;  1JOW A;  3ABU A;  4UN2 B;  1WHC A;  2IPQ X;  3BT9 A;  4HQE A;  2W96 A;  4E7K A;  1TWF J;  4XK8 F;  1K79 A;  5F64 A;  2P7C B;  1B59 A;  4M0W A;  4M9X A;  1I50 J;  3O6B B;  5F04 A;  4FM4 B;  4QNM A;  4EOJ B;  4CA0 A;  3CF2 A;  1HJP A;  3CJQ B;  2V22 B;  2HYJ A;  3T8R A;  2Z3Y A;  1WZ2 A;  2XAJ A;  2JSC A;  1EH6 A;  3QOD A;  3CCR I;  2Z4S A;  2DXB B;  3F72 A;  3WVD B;  4A0Y A;  5EZG A;  4OMY A;  2LWX A;  3A4C A;  4MB7 A;  3JCU C;  4CCL A;  4CFM B;  3W3C A;  4NDL A;  4N0B A;  1F4K A;  5AIQ A;  4B4C A;  5A2Q K;  2L7I A;  2YNM D;  4EOO B;  4L4U A;  3GLH B;  2LKP A;  1L2B A;  4IBI A;  2CH0 A;  2Q2E A;  3RZO J;  4IBJ A;  3LCU A;  4CIZ A;  3HIF A;  1J9I A;  1NY6 A;  1LDK B;  1T2K A;  2VQC A;  4OIN F;  3E6M A;  4A0X A;  1DGG A;  1ZG5 A;  2E5N A;  4P17 A;  4MGZ E;  3A1Y A;  3LSG A;  4KA4 A;  2W48 A;  4B3A A;  4Q5S F;  2LSO A;  2HL7 A;  5AIP A;  1G3T A;  1SC7 A;  3CMM A;  3H3Z A;  4U87 A;  3V4G A;  1H1Q B;  4RGS A;  1O9K B;  2DXI A;  2PFB A;  2K9M A;  1LDD A;  3PNV A;  1TNT A;  2MYS A;  5HDK A;  3UR3 C;  1O4X A;  2HTJ A;  4L78 A;  2VPR A;  2WWY A;  2AQF A;  3KVW A;  5JVT A;  3F23 A;  1HC8 A;  3DDP B;  3U1K A;  4AKG A;  3IC7 A;  3BG9 A;  3SHF A;  1DGR M;  2HYF A;  2HNH A;  1Y8Q B;  4LD5 A;  1W1W E;  5ICG A;  1JTX A;  3MKW B;  1C7Y A;  1SXJ A;  1DP3 A;  2B63 J;  3EJ1 B;  2NVU B;  1P92 A;  4MTE A;  2ECC A;  2X1D A;  1QDT A;  3HPG A;  4EIW A;  3K70 D;  2IS6 A;  3PUF A;  5E1W A;  3T38 A;  1YO5 C;  2VAS A;  3OTO M;  2LNB A;  1TWC J;  2ISY A;  2V9K A;  3FM5 A;  5HDN A;  5E18 F;  3CCQ I;  1IC8 A;  3R4K A;  3MIA B;  1FYK A;  4BCG B;  5F1J A;  2Y31 A;  3Q9V A;  2XZF A;  3I0T A;  1VQ4 I;  2R7F A;  1DU6 A;  3U61 A;  2E36 A;  4AWX B;  4M0D A;  1BM9 A;  4A0Z A;  1FOK A;  4M9S A;  2DQR A;  2KKO A;  3A02 A;  3KFU G;  3TO9 A;  3E6C C;  1TLH B;  3FUW A;  2L7M P;  1SVO A;  4JQF A;  3TOA A;  1LFB A;  4DV6 M;  5FD5 A;  4LF9 M;  1TT0 A;  1W36 D;  2EZK A;  3MMY B;  2A69 F;  3CP8 A;  4TV7 A;  2P6S A;  3HSE A;  2ZJQ F;  3BXW A;  1D8K A;  4CIC A;  3B57 A;  1H1R B;  3HHG A;  4F3Q A;  4LK1 F;  3GME A;  4LG0 B;  3KP1 E;  5DNY A;  5BS6 A;  4EGZ A;  2LK2 A;  3IHU A;  2GIZ A;  3LSH A;  3RPQ A;  1XSD A;  3WTZ A;  1LB2 A;  1TGU A;  2JVH A;  5KCM A;  1X3W B;  3I64 A;  3FK6 A;  2CUJ A;  2DW4 A;  4XLE A;  3RKW A;  2BWB A;  1YW8 A;  2ICW G;  2A6H F;  4BJ6 C;  3T5X A;  2VF7 A;  5FFX A;  2CV1 A;  2LLK A;  3T1B A;  4B7F A;  3JSO A;  1NK3 P;  3H4C A;  3TOB A;  3QPS A;  2MRO B;  1D0M A;  2LF7 A;  4WK8 F;  3FTD A;  1T8I A;  2WV1 A;  3SEZ A;  3LNQ A;  1YRN A;  2L7Z A;  1VEG A;  2WSC F;  4DV0 M;  1MMG A;  1X1D A;  2F5D A;  1DGW Y;  2COB A;  5IT9 Z;  2P7V B;  3J80 S;  4JK1 X;  5JI2 E;  2DFE A;  3TP3 A;  1OKR A;  4CCO A;  3GYH X;  1XMO M;  3KEQ A;  3SYK A;  4F1I A;  1U3E M;  3TQS A;  4JI4 M;  2JSP A;  3B6C A;  1X1C A;  4NC7 A;  4NB5 A;  1N32 M;  3OYG A;  1HQY E;  2KNA A;  2G77 A;  1ONV A;  5L3F A;  2ZTC A;  5K1Y A;  5E79 C;  2ZPB B;  4EOM B;  2R7O A;  2LD5 A;  1VQL I;  2LBC A;  1WJD A;  3F8C A;  1MW7 A;  2C9C A;  4A3B J;  2FH0 A;  4GIP A;  1FBQ A;  3KLN A;  4MGR A;  3QHR B;  1B1B A;  2XGN A;  2OC6 A;  2UWM A;  2NXN B;  1YS6 A;  3GBG A;  3M07 A;  3O3K A;  5D8L B;  3F8M A;  1A36 A;  3OIP A;  4PGH A;  1T43 A;  5EEG A;  1IXS B;  3U1D A;  2XC7 A;  2CHG A;  2ZXH A;  4FX0 A;  1K6Y A;  1G3I A;  2W4S A;  4C30 A;  3LCV B;  1FP1 D;  1T6S A;  1IBM M;  1GL7 A;  1RES A;  1Z1D A;  3LFU A;  1B8I A;  4GDF A;  4UNO A;  2MJ5 B;  4UVC A;  3HHT B;  2RVC A;  4FCT A;  1QUS A;  4DR2 M;  3K1J A;  4OMZ A;  4BKX A;  2ZAN A;  3TWK A;  2K02 A;  2ELH A;  3SAR A;  1UJ8 A;  4XBO A;  2NAZ A;  5J8F A;  1BIB A;  4IBF A;  4DV2 M;  5CQE A;  5IHY A;  3ZQQ A;  1HKT A;  4B7H A;  4GRI A;  5KO3 A;  3F21 A;  1UZC A;  2DYS H;  3DZD A;  2HVR A;  3S14 J;  4Z6Y A;  4ZYE A;  1H26 B;  4U88 A;  1ZQ3 P;  2FUG 2;  1UG0 A;  2DMN A;  4M9Z A;  3AG2 H;  3GLG A;  2RAE A;  4CCN A;  1CQT A;  4U7B A;  2TDX A;  5HBH B;  3DTI A;  4DR4 M;  4XMY A;  3JRA A;  3HSR A;  2PLY A;  2DJI A;  2OO9 A;  2DA2 A;  4G7Z F;  1Y8G A;  1KZH A;  4BEH B;  4JYK A;  3QYH B;  2DK8 A;  2F5F A;  4WXD A;  4KIS A;  1UGR B;  4NC8 A;  4YOS A;  4QIW N;  3MZY A;  2BY3 A;  1AUA A;  4IIW A;  1N36 M;  2O9L A;  2CU7 A;  4KIB A;  1VYW B;  5DYI A;  2RV8 A;  2QQA A;  4A3V B;  2D7E A;  2VQL A;  2FOW A;  3A01 B;  3HKP A;  3BR6 A;  2Q1Z B;  4M3G A;  4JN6 A;  2JA2 A;  4AYB A;  1JUP A;  1O3Q A;  5FGK B;  2VJJ A;  1SAN A;  2D7G A;  5HLG A;  2H8W A;  2O8K A;  2R7D A;  5IDN B;  5JLX A;  2PMH A;  1SAX A;  3JAM S;  1D3Y A;  1X2M A;  2HR3 A;  1BC8 C;  1YSY A;  3MY5 B;  3QYB A;  1UCR A;  3BLY A;  4I4L A;  3VPR A;  4BHP A;  2NNN A;  1HF0 A;  2HQA A;  3HY5 A;  3PFI A;  3L9F A;  4B48 A;  2V7F A;  2F5S A;  3RQ4 A;  1VQ1 A;  2Z33 A;  3S32 A;  4GXO A;  1U0J A;  3SFI A;  2DNA A;  3DKY A;  3LSP A;  3GTK J;  2APL A;  1J0R A;  3TQN A;  5DD4 A;  3JR9 A;  4NST B;  2KRH A;  2VKV A;  3J2P B;  3KSX A;  1XB4 A;  3LSR A;  1Y0U A;  2JA8 J;  1FIP A;  1YLF A;  2DTZ A;  4MLO A;  3K4C A;  4L9J A;  2LY9 A;  4M72 A;  2FQ3 A;  2WPA B;  2P0W A;  1I3A A;  1NK2 P;  2R7U A;  3SAU A;  5LQF B;  3HJS A;  3LWF A;  4R3D A;  4F7J B;  5TRD A;  1QQW A;  2ZCW A;  2IW8 B;  2GA2 A;  5FLX S;  3RTR A;  5GAD J;  5IYB J;  1MBF A;  1D1A A;  2X0L A;  1IY2 A;  3QYG B;  1DDN A;  1R5L A;  1R1V A;  2ZC2 A;  2C5R A;  3M8F A;  3CES A;  4GC9 A;  4K2E A;  3MZH A;  2RC4 A;  4X6A J;  2HKJ A;  4LGY A;  4B44 A;  1D0L A;  1LE8 A;  4O5V A;  4NUB A;  3GZ5 A;  4IHS A;  1TTE A;  1KYZ A;  2VUM J;  4A3E J;  5ICP B;  2E1N A;  4QPQ A;  4B8X A;  4IOA F;  3DF8 A;  1IXR C;  2BS4 A;  3P9K A;  1SFK A;  2CG4 A;  4AZF A;  2OOA A;  3SAT A;  2LRD A;  2D0Q B;  2F48 A;  2HXI A;  4A2U A;  2K86 A;  3X28 B;  2X1N B;  2RRE A;  3C18 A;  4EJO A;  2DVW B;  1ZKG A;  4F92 B;  1TWH J;  3H5A A;  1G3W A;  3W2A A;  3HZJ A;  2ZSI B;  4IHY A;  3GLI E;  3B73 A;  4BXX X;  4Z2Y A;  4M71 A;  2OZ6 A;  2VE9 A;  4B47 A;  1KGS A;  3MKZ A;  3AAF A;  4QOZ C;  2L4M A;  1YHQ I;  1RKT A;  1ULY A;  1OL2 B;  1W4M A;  4GH9 A;  4DBG B;  2DA4 A;  5LHH A;  3KP3 A;  4LGM A;  4LFU A;  1OFI A;  5EXS A;  3K4N A;  4W5W A;  1TW2 A;  2DQL A;  4II5 B;  3TWM A;  4FIS A;  4IQ4 A;  3S93 A;  3V8L A;  1R71 A;  3CJN A;  3VKG A;  3F6O A;  2YQZ A;  4YC3 B;  5I5Z B;  1H6U A;  2HOT A;  1MGT A;  3GQ4 A;  1WIV A;  3CMY A;  1R22 A;  2D2W A;  3VOE A;  3MCZ A;  3FUV A;  2BBY A;  3FZV A;  2F5N A;  5F3W A;  1E3P A;  3LST A;  1IF1 A;  5JHF A;  3CD6 I;  2F4V M;  1TQM A;  5IOZ A;  3L7W A;  1GDT A;  3J81 Z;  2X9D A;  4GHL A;  1W98 B;  1IRG A;  1R1U A;  1UAA A;  1ETK A;  4PJL A;  2ETH A;  4TUW A;  2L9N A;  3H36 A;  3KW6 A;  1XC8 A;  1ZAR A;  1LTM A;  4A5M A;  2JUJ A;  3TDZ C;  2VN2 A;  2KDO A;  5ILS A;  5IWA M;  4LIT A;  3DQV C;  5CVJ A;  4MGK E;  1R58 A;  2EZH A;  2RQP A;  3BCA A;  1ETW A;  2PMU A;  1ZMW A;  3F9K A;  1IN6 A;  1NG7 A;  2TRT A;  4L5I A;  3D8B A;  2XDV A;  3UZU A;  3CC4 I;  4OGR B;  3PSF A;  2XAF A;  4DJA A;  3DBR B;  3K4K A;  5HVY B;  2M0M A;  3QPT A;  1WGX A;  2ZPE B;  4Q4Z F;  2MH8 A;  3B9P A;  3CZ6 A;  4UHT A;  2CFO A;  2DBB A;  5K7F A;  3WTW C;  5FJ8 J;  5DUI A;  3UK6 A;  2CE7 A;  3LMM A;  3GVA A;  2MSY A;  2OQR A;  4EMS A;  5GPC A;  3ERE D;  2NNY A;  1JJ6 C;  5HQ0 B;  4CCJ A;  1SFO J;  5CLS A;  2WEV B;  2UUA M;  3L28 A;  2DDA A;  2KW0 A;  2LBF A;  4C3I J;  2MGQ A;  2IGM A;  2DI0 A;  3MJ5 A;  1UGP B;  2K7L A;  1Y39 A;  4PT5 A;  5K7Z A;  4U0W A;  1JKW A;  3QOE A;  2WIP B;  2MW8 A;  3G1L A;  1A04 A;  3MAJ A;  2FNP A;  4Z8X A;  4FX4 A;  1D8J A;  4E7Z A;  4CH7 A;  3SDG A;  1RRJ A;  1SVL A;  2JZY A;  2D5V A;  1LDJ A;  4BQA A;  1JHH A;  2WMA B;  1PUE E;  4ROD A;  3T8T A;  4F6S B;  1T95 A;  2EPF A;  4XM3 A;  4KOD A;  1WVR A;  2R7Z J;  2Y69 H;  1U8R A;  3HYI A;  1ZN2 A;  3Q9S A;  3P9C A;  2E7W A;  3QXE B;  2GXG A;  2OPF A;  1Z5C A;  2DT6 A;  2KZS A;  4QHT A;  2FSW A;  2JQ7 A;  1BR1 A;  3L27 A;  3ZQL A;  1STZ A;  1R5G A;  2CRU A;  1OCO H;  2H27 A;  4BBS J;  3SDB A;  1FIA A;  2I5U A;  1OMI A;  2DFF A;  5IT3 A;  1N33 M;  1FTZ A;  2Q8K A;  3WGH A;  2LKS A;  1IRX A;  3D5L A;  1WR1 B;  4OOI A;  1QZY A;  2O8X A;  4AVZ A;  2Z16 A;  1OKW B;  5EFQ B;  3H0D A;  2P5V A;  2WJ9 A;  1XGN A;  4CYC B;  1X19 A;  2DOF A;  8CAT A;  3KXE C;  2KRC A;  4UV9 A;  1ZRC A;  4L0Y B;  5IF1 B;  4HYE A;  2KJC A;  4MQ9 F;  4ROC A;  4Y52 J;  1OQY A;  3FBN B;  4HDV A;  2P5L C;  2GOM A;  1IXC A;  2HHH M;  1T3T A;  3BR2 A;  5LRR A;  1YIT I;  3BHV B;  3WTS C;  4ESB A;  1Q1V A;  2K4B A;  3O0G D;  2KNV A;  3ABT A;  2ZFW A;  4X64 M;  2KT0 A;  1K6O A;  5DM6 F;  1XDS A;  3GLF E;  2FD5 A;  3BTL A;  3KOX E;  1T0F A;  4HQM A;  2G5G X;  1HOM A;  1UNL D;  1LPQ A;  4I76 A;  3UGJ A;  4DR3 M;  4RBO A;  1IDY A;  3OYC A;  4XRM A;  4M3D A;  2ME0 A;  3CUQ C;  4DNC A;  1DGH B;  1PRB A;  3ASN H;  3GTP J;  3KS8 A;  1MJA A;  2IAI A;  3QP5 A;  2I53 A;  3H92 A;  2EZL A;  4XKB A;  2EV5 A;  3W6J B;  4CUG A;  3DJB A;  1Z7L A;  4IBD A;  3C3D A;  4Y33 A;  4BJT A;  1L0O C;  1MBK A;  2O7O A;  1PGY A;  2YFQ A;  2BZT A;  1ETY A;  2Q2E B;  4EOL B;  1AIS B;  5DCF A;  1JXS A;  4F70 B;  2ADU A;  3EOC B;  3OR2 C;  1IJW C;  3R0J A;  1ZQ9 A;  3TE6 A;  5J8C A;  3BR1 A;  2HXO A;  5FSW A;  2P5K A;  1QHG A;  4PGG A;  3JRF A;  3K9P A;  1TP4 A;  2RDP A;  2YU3 A;  4BB9 A;  3FMS A;  3TBI A;  1OPC A;  1ZLJ A;  3CTW B;  5FLV A;  2MLG A;  3ASO H;  1ZMV A;  3HHX A;  4D7N A;  2BV6 A;  5DFL A;  4XKW A;  4ELL A;  1ZV1 A;  5ILU A;  1JHF A;  2G8L A;  3EYY A;  2VJI A;  3NAR A;  1SD7 A;  4FQG A;  3U6E A;  3V7C A;  4LRT A;  3GTG J;  1P4X A;  1XXH A;  4IBE A;  3I01 M;  3OOP A;  1VQO I;  4XRF A;  1V5F A;  4BCP B;  1SMT A;  1L2D A;  1XD7 A;  4GFB A;  1XCB A;  2CZ1 B;  1SXJ B;  1X4P A;  4HZF A;  4JX5 A;  4EQQ A;  3SQN A;  5FB2 A;  2R18 A;  4LFA M;  2KDZ A;  1GT0 C;  1QA6 A;  4NHJ A;  2C4G B;  3DEW A;  2NVX J;  3BLR B;  3QRF F;  3GPP A;  3DFG A;  2GWR A;  3ZCB B;  4BLC A;  1FNN A;  3FMR A;  4EEF G;  2DK5 A;  4BBS M;  2BOL A;  3W6V A;  4BHB A;  4CIS A;  5EP4 A;  2LF8 A;  4JX4 A;  3X24 B;  2L7H A;  2YR0 A;  3U61 B;  1OR7 A;  3BHU B;  3CLQ A;  2E5Z A;  2M2E A;  1WSU A;  2FEZ A;  3P9I A;  4II3 A;  1OKV B;  1T98 A;  1U2W A;  4CZZ A;  2FOI C;  2XPU A;  4HV5 A;  5IT9 S;  4S0H B;  2NVY J;  4LY6 A;  1L3L A;  2IW9 B;  2JA7 J;  2LVO C;  5EXX A;  2DWL A;  3EET A;  2RGV A;  1R7J A;  3L26 A;  3M03 A;  2QCO A;  2GLO A;  4XOT A;  4GMQ A;  3ZP5 A;  1SFE A;  3VOD A;  4HLY A;  2VXD A;  5E3L A;  3KEY A;  3HBL A;  3HTS B;  1QU3 A;  1U6G A;  2JXN A;  3FWE A;  4XON A;  1CUK A;  2EB7 A;  4REZ A;  3VLF B;  2KP6 A;  3J7Z I;  1NHG C;  1B4A A;  2A6T A;  4BNC A;  2F5C A;  1OCR H;  2O3F A;  1T6O A;  5HDG A;  2KDL A;  3I71 A;  1TZL A;  5FTM A;  2R7T A;  5DYG A;  2GBY A;  3HUG A;  5HNH A;  3TL4 X;  3JW4 A;  1J75 A;  3CC7 I;  1NHA A;  2O61 A;  2WBM A;  5EF6 A;  2QDJ A;  3KSJ A;  5M5Y J;  1OI9 B;  1C9B A;  1Z05 A;  1YRN B;  2MD5 A;  5LBQ A;  3I56 I;  3AOG A;  2KR6 A;  1Z3X A;  1C1K A;  2Z7J A;  3GQ5 A;  3D5R C;  4ZZL A;  3HOY J;  2IVM A;  4C9Y A;  2M7A A;  1MDM A;  5GKN A;  2VJ4 A;  3VYT B;  2PHG A;  4JXJ A;  2L01 A;  5FRM A;  2LVN C;  2XLJ A;  3QPH A;  1I6H J;  3C3W A;  3VYS B;  2Y0Q A;  2V1N A;  2WAD A;  4WX9 A;  1RU3 A;  4P96 A;  3A8O B;  3GFJ A;  4ZZD A;  3H0G J;  5EQT A;  4CYD A;  1YS7 A;  3K9T A;  4RDU A;  1FTT A;  2IS2 A;  1QVT A;  2STW A;  3KYD B;  5JI3 E;  4L5J A;  3DLA A;  3NRV A;  2HQN A;  4GYI A;  3S17 J;  4G4R A;  4I81 A;  2CO5 A;  4PD2 A;  4P9F A;  4HSR A;  3SFZ A;  3DU6 A;  2CCH B;  4KMU X;  4K0K M;  3ILK A;  3OYD A;  3S3M A;  1B8I B;  1DO0 A;  5EXP A;  3CJR B;  2UXB M;  1TWG J;  1ZAE A;  1JQJ C;  3GPY A;  3FKI J;  5FKL A;  2HVQ A;  4LB6 B;  3PQK A;  4ZYG A;  4BE2 A;  2C6Y A;  3FBI B;  1D2N A;  1NHW C;  1KYI A;  1P7I A;  2R62 A;  4OU7 A;  3IUO A;  4OIQ F;  1E3O C;  5E17 F;  3IHP A;  1XHB A;  2BE5 F;  2G9X B;  2EWN A;  4AU7 A;  2R7S A;  3GZN B;  4BDZ A;  2EQR A;  2DWN A;  3LAP A;  3E0J B;  5ILV A;  1YUB A;  3MFK A;  3ZQC A;  1NO1 A;  5KPR A;  1Y1V J;  2GIV A;  4B08 A;  2LYC A;  1VTN C;  3GLG B;  1ZGJ A;  2VBX A;  4WF2 A;  2HPM A;  3K4L A;  3M1C A;  5ITQ A;  1HST A;  5IP9 J;  3T15 A;  2JK3 A;  4AKH A;  5BPD A;  3IAM 2;  3VSK A;  4CXF A;  3GPX A;  4C2T A;  4JI7 M;  2KMG A;  3GQ3 A;  2AXT C;  1VQ8 I;  1IRZ A;  3F22 A;  1V3F A;  3SZT A;  2R44 A;  4JYA M;  2W1O A;  3OY9 A;  4HAM A;  5LD2 C;  4OIP F;  2HDD A;  2UZE B;  5IDP B;  2HWJ A;  4LF4 M;  2QFZ A;  3I5U A;  3VYH B;  4D80 A;  4IO9 F;  2ZFU A;  4EVI A;  1F9N A;  4U0Y A;  3L2Q A;  4DOZ A;  1Z0X A;  1G2H A;  1RI7 A;  2IS1 A;  4G7H F;  1SG9 A;  4IOC F;  3CP2 A;  3RQI A;  1X37 A;  1TQP A;  2NS0 A;  1SMY F;  2GZW A;  2M1B A;  2IEK A;  5KAI C;  3RKQ A;  1YYV A;  2N35 A;  2CUF A;  4ANJ A;  4DV4 M;  3GO8 A;  2Z1D A;  2KMU A;  2CW8 A;  2LHC A;  4I6Z A;  5KQD A;  3M3Y J;  4MHG A;  3HX3 A;  3KE2 A;  2K9D A;  1GJT A;  4BBA A;  2FX0 A;  2K3P A;  2EUF A;  4MGY E;  4NQW A;  1P5E B;  2W82 A;  2DLL A;  1NH3 A;  2R5Z A;  4NBQ A;  3G73 A;  2E35 A;  2VC0 A;  3SC3 A;  1B72 A;  4AG5 A;  3SZG A;  3U60 A;  1HDP A;  4R71 A;  2KA6 B;  4S05 A;  3K4B A;  4XRS A;  1N78 A;  3GEZ A;  2FU4 A;  1VQ9 I;  4R7G A;  5KK1 A;  3BZC A;  3SAV A;  4G3O A;  2HFH A;  3H5N A;  4DR7 M;  3I59 A;  3Q8G A;  3KP7 A;  4LIU A;  2QYO A;  4PK4 A;  2P5T A;  3TPZ A;  1DPU A;  1MN3 A;  3BZ6 A;  3DEE A;  3WTY C;  2EFP A;  1GHC A;  3O8G A;  3LSI A;  1R7R A;  1S7O A;  3K2A A;  1IW7 F;  4YFX F;  4BCK B;  2WXV B;  3BJO A;  2H1K A;  3T6P A;  3E6B A;  1JT6 A;  3LA3 A;  4NXM M;  1NJG A;  2LDU A;  3BDD A;  2HQR A;  1X58 A;  3ZQJ A;  4XR6 A;  1MBH A;  1RET A;  4L8R C;  1NJF A;  1VDD A;  1V34 A;  2LHG A;  5GPA A;  4E7L A;  4KLN A;  1FOY A;  1XTA A;  1NNJ A;  4Y13 A;  3H3V K;  3TWL A;  2LP0 A;  4WWC A;  1ZR4 A;  2V1X A;  2M5Z A;  4OIO F;  1VQN I;  2ZKZ A;  2PMZ A;  3VDX A;  4QNR A;  5ICE A;  3KOY E;  3TDU C;  5LEK A;  5C4J J;  3JRG A;  3N4M A;  1HCR A;  3J81 S;  1IFY A;  2DOA A;  2MAB A;  2BVM A;  3FXJ A;  1XS9 A;  3T1Y M;  3R9X B;  3Q0U A;  1SFU A;  1QAM A;  3HGY A;  1FC3 A;  2I7P A;  1XG1 A;  2M34 A;  1IN5 A;  1GVN A;  3IH4 A;  1S7A A;  4AKI A;  5H20 A;  1EE8 A;  3GPU A;  2EA2 A;  5J4Y A;  1RZ4 A;  1MH3 A;  1UM8 A;  1MBE A;  4H0E A;  3K7A M;  1TQI A;  3OWT A;  1O3R A;  4KO8 A;  4LF6 M;  2H1L A;  1GL6 A;  2ZXJ A;  3DKW A;  5GAG J;  2Y30 A;  3HHH A;  1XPX A;  2UZL B;  5L3D A;  1UEL B;  2VT3 A;  6PAX A;  2ZO4 A;  4XQF A;  4AD9 A;  5KPZ A;  2BXY A;  3KYC B;  5DEQ A;  5IZ7 D;  2IA0 A;  5CVI A;  4BBR J;  2L54 A;  4KIT B;  2XB5 A;  3PIP F;  1H0M A;  5HS8 A;  2DAK A;  1LV7 A;  2DMT A;  2V1C A;  2L2D A;  1R4M B;  3Q5F A;  3L29 A;  5J1U A;  1W5C C;  3CF5 F;  4V19 K;  3LSM A;  2V9V A;  1C0W A;  1NV8 A;  5E6J A;  2R7W A;  4BCM D;  2VC1 A;  1JKO C;  4G6Q A;  3BG6 A;  4ENN A;  3BTI A;  2FBI A;  4P1W A;  4AIK A;  1UHS A;  2Z8Y M;  2CEA A;  3GX4 X;  2ZAO A;  1R4N B;  1DV0 A;  1UHW A;  2LXE A;  1UB9 A;  1JR3 E;  2X6W A;  1TF0 B;  3BTC A;  2L4E A;  3B7Z A;  1S3S A;  2L4A A;  3GTO J;  2KIS A;  4U0V A;  2QQ9 A;  5CQG A;  4XLH A;  2HZD A;  3GRY A;  4B3M M;  3KHI A;  3K92 A;  1P4W A;  1FPQ A;  5FRO A;  3GWZ A;  1HW2 A;  3NEU A;  3S16 J;  3EUH A;  2Z3X A;  3G1O A;  2VOO A;  2VPL A;  2JY7 A;  4FET A;  1VDL A;  2EJS A;  4CZC A;  2IA1 A;  2QKM B;  1J7K A;  1OJL A;  2FMY A;  4FD2 A;  2IBD A;  4NL4 H;  2XKO A;  3IP4 B;  4YII A;  2FNA A;  1MMN A;  2ZM6 M;  1HW1 A;  1OYW A;  4D0P A;  2BPM B;  4QLC U;  3ZGK A;  1BA5 A;  2BS3 A;  2FE3 A;  3EDP A;  3FDY A;  5F1R A;  4E7H A;  4A3C J;  4HX4 A;  2F2E A;  4AUX A;  4F55 A;  5HLI A;  1F4I A;  3DA1 A;  4OW0 A;  2H94 A;  1EIJ A;  2A3S A;  4IF4 A;  2QSG X;  2GOX B;  2LBF B;  3ROU A;  1RC9 A;  4DGW B;  4MGH A;  4HF2 A;  1ZK8 A;  3PQJ A;  4P5O A;  2P8T A;  2XF6 A;  3F3X A;  4ASN A;  4ZDP A;  1Q3B A;  4UB6 C;  4F7N B;  2LTU A;  4YIF A;  3GRR A;  2LTP A;  3ZRG A;  5JLW A;  1S9H A;  2XAS A;  1CF7 A;  3DP7 A;  3VWB A;  3KP0 E;  3BCB A;  1BC7 C;  1XN7 A;  3UMM A;  2EV6 A;  2M0C A;  4XRS G;  2VOD A;  3MI9 B;  2EKK A;  4LFC M;  2DA3 A;  3TED A;  1GH6 B;  2Y2Z A;  1L2C A;  1A6I A;  1FMW A;  2V6C A;  2DCE A;  1R00 A;  2ZNY A;  2X1E A;  4DZJ A;  2Y48 A;  4EJV A;  3L2W A;  2J7N A;  2VE8 A;  3HSF A;  1PJQ A;  4BBR M;  4PFP A;  2CHQ A;  4EC9 B;  1KU3 A;  4XSZ F;  3RYP A;  2E2H J;  1BBY A;  3AL0 B;  1YFH A;  1AU7 A;  4LG2 A;  2OTJ I;  3L09 A;  1G4A E;  4KFC A;  1B9M A;  4BAY A;  1JJ8 C;  4RA2 A;  2VLA A;  1N4M A;  2LR8 A;  2HVS A;  2XRL A;  1X3Z B;  4JBA A;  2M7B A;  3ZXS A;  1EF4 A;  2PJR A;  1TT5 B;  1VI0 A;  3G1M A;  4AQY M;  1UGQ B;  3WGI A;  3COA C;  4CJ6 A;  2XF3 A;  4MIM A;  4YEL A;  1W7P D;  2EIM H;  3GLI A;  1OTR A;  1GVD A;  3HGI A;  3DLL F;  3THG A;  3R0A A;  3FXO A;  3J27 B;  2VJ5 A;  1I6X A;  5A2Q Z;  1HQC A;  3W2V A;  4HL4 A;  2R3S A;  3FXU A;  4HEO A;  4CCM A;  4F52 A;  1MX0 A;  3HC7 A;  1H9T A;  4IHX A;  5LGT A;  4DR5 M;  2RGH A;  2YS9 A;  3GFL A;  4QTR A;  2G7H A;  4XOP A;  3HWS A;  2MR9 A;  3LVV A;  3U6S A;  1VG5 A;  2XGD A;  2ESH A;  4YEJ A;  2H5X A;  2CJJ A;  4ZGD B;  4MTD A;  1H25 B;  2WAQ A;  4IHW A;  2E5L M;  1NG6 A;  4IXA A;  2OCC H;  4GYG A;  5J40 A;  1XC5 A;  1WJF A;  4BY7 J;  3CDL A;  1IV6 A;  1IN4 A;  1WJ5 A;  1TW3 A;  4DBQ A;  5DD8 A;  1YW7 A;  4D9J A;  4BS9 A;  3FXR A;  2AHM A;  4Q48 A;  1XXH B;  2BWE A;  4CFX B;  4IX7 A;  2N8G A;  4N4N B;  3U6O A;  1TH2 A;  3GW2 A;  1FT9 A;  1PJR A;  1S6L A;  4HLX A;  3FD9 A;  1GUX A;  5H6Q A;  1R2Z A;  3QZ5 B;  2FF4 A;  3GFM A;  2YU9 J;  2JWS A;  3P5J A;  3ZCO A;  3KZY A;  4RNA A;  1S5L C;  1OAI A;  4HEA 2;  2V1U A;  4JOM A;  2ID6 A;  3NQO A;  3U9G A;  2QZ8 A;  1Z7U A;  2DMQ A;  2MGW A;  1Z3Y A;  1XCV A;  4MM3 B;  1D0Z A;  1PYV A;  4BY1 X;  5KQ8 A;  2W99 A;  1RNL A;  3AFH A;  3D8L A;  3IH2 A;  1QNT A;  1JKP C;  2WC2 A;  5EEH A;  1WH7 A;  2Z5U A;  3I54 A;  3ZQH A;  2XGX A;  2WY7 Q;  4F7S B; 
#chains in the Genus database with same CATH homology
 3X28 B;  2QDJ A;  3HO8 A;  2ZPI B;  3X20 B;  4OB0 B;  4ZGE B;  3HHT B;  1UGS B;  2KR6 A;  3A8L B;  4NC6 A;  3QZ9 B;  4P17 A;  3HZJ A;  3WVE B;  2AHJ B;  4ELJ A;  4QSH A;  4BBR M;  2QQ8 A;  1V29 B;  3A8O B;  2QF7 A;  4Z6Y A;  3A8G B;  3TW7 A;  1FKM A;  4AKG A;  3VKG A;  3BG9 A;  2ZCF B;  3X26 B;  4AKI A;  2CZ0 B;  1UGR B;  2ZPG B;  2ZPH B;  3QYH B;  3DL1 A;  3BG5 A;  2DD5 B;  3A8H B;  1UGQ B;  3QWL A;  4MFE A;  2ZPF B;  4OB2 B;  4MIM A;  2DXC B;  1E7P A;  2BS2 A;  3BG3 A;  4HL4 A;  2CZ7 B;  2CZ6 B;  2CZ1 B;  4JX6 A;  3QYB A;  4JX5 A;  4LOC A;  4HNV A;  2ZPE B;  4AKH A;  3VKH A;  4AI6 A;  4OB1 B;  4HNU A;  2KMG A;  3A8M B;  4ZGD B;  4BBS M;  3TW6 A;  2WJ9 A;  4JX4 A;  3X24 B;  2CYZ B;  2QFZ A;  2QDY B;  3X25 B;  3VYH B;  3KHI A;  1UGP B;  3HB9 A;  3H4C A;  1AHJ B;  3VYG B;  4MFD A;  3QZ5 B;  2BS3 A;  3QXE B;  1QLB A;  2ZZD B;  3QYG B;  3HBL A;  4OB3 B;  5EJC A;  2G77 A;  4FM4 B;  4HLQ A;  3QYE A;  4HNT A;  2ZPB B;  4M6V A;  2BS4 A;  2DXB B;  2DD4 B;  3WVD B;  2D0Q B;  4ZGJ B;  2DPP B;  1IRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...