3HZJA

Crystal structure of the rabgap domain of the rabgap1l protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
YSWGELLGKWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDRYRILITKDSAQESVITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYDYGLRDLYRNNFEDLHCKFYQLERLMQEQLPDLHSHFSDLNLEAHMYASQWFLTLFTAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIKVPTKKLKKYEKEYQTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RabGAP domain of the RABGAP1L protein
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords RAB GTPase-activating protein 1-like
total genus 97
structure length 287
sequence length 287
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3hzjA02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 3hzjA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hzjA03
2QFZA 3HZJA 2G77A 4NC6A 4Z6YA 3QYBA 1FKMA 5EJCA 3QYEA 3QWLA 4P17A 4HL4A 2QQ8A 4HLQA
chains in the Genus database with same CATH superfamily
2XUBA 3K4BA 3RJPA 2XSZA 1BIAA 3BHTB 3DWLE 5ICEA 1SFUA 1QZYA 2ZANA 2TCTA 4J00A 1PVEA 2EFPA 2WB1N 4RMNA 4E70A 2Z16A 5DCMB 2I7PA 1FX7A 5DUKA 5BS6A 3MZYA 1EV7A 2WMAB 4CFWB 4U88A 4AZFA 1SMYF 4BCGB 2FBKA 4W5WA 3MKZA 3HU2A 2DA1A 3SXYA 2ZJRF 4KA4A 4F7NB 2LVNC 1DPUA 1W5SA 2LHGA 5LLQA 5EF6A 4CO8A 2CQ7A 5FD5A 2E60A 4RB3C 2YQZA 3HWSA 2V26A 4OWRB 3A42A 4LGWA 4WXHA 4RLFA 5F08A 1VQMI 4I0BA 1QAOA 3W3CA 4IBBA 4AG6A 3CCLI 5GP9A 3CCJI 1MSEC 3H9JA 3BOQA 2A5YB 4LFAM 2KA6B 4PT5A 4LG2A 2XZFA 1FIAA 2UV1A 4CCOA 1OR7A 5KPTA 1W7PB 1E17A 3PQKA 2XHKA 1VQ8I 4S12A 1VZ0A 5KK1A 2FFJA 4I81A 3HJ8A 5CQGA 5EDNA 3GTQJ 1H1RB 3WHKA 1TWAJ 2MBFA 4HZFA 1UHMA 3BR2A 4KODA 1ULYA 3MZHA 2K6BA 3FXJA 3L7WA 1R9TJ 3H1CA 1WKMA 2F5OA 2Q8KA 2V7FA 2ZB9A 3IH2A 1YG2A 4Q5SF 4M9SA 2MSYA 3J81Z 1XSDA 3GQ5A 1LKXA 3BROA 3I0TA 5BR8M 2UUZA 4LJ6A 2IN3A 4NOOB 1IJWC 2J5YA 4EOOB 2DOEA 2CUJA 2LVAA 5C1BA 3K2AA 3U61A 4L0YB 4IJEA 3LQ5B 2LRDA 2RGOA 5BPIA 5EYRA 1WJ7A 3E4RA 2DFIA 3GUDA 2ZPGB 4B7HA 2LVSA 2M60A 3ZMDA 4CHUA 1M1EB 1MMSA 2ZBKA 3T15A 3GLLA 2QKLB 2JP7A 1W0TA 4XN0A 2HDDA 3WTVC 2Y21A 1XHBA 1MH4A 3VFDA 1QRYA 2HQAA 3FKEA 1F9NA 4HQMA 3VYSB 5FSWA 1JR3E 2JY7A 3L29A 2KIUA 1T8IA 3TN8B 2LF8A 3RPQA 4BAYA 5JI3E 3J7AY 3S1NJ 3SZTA 1LDJA 2XROA 1FP1D 2Y48A 3ZQGA 5EEAA 3GLGE 1UFMA 2H1LA 1IY2A 3KP3A 2R7VA 1IO2A 4L78A 4DV0M 3KP1E 3S3MA 2DFEA 3PNVA 1I94M 4QOSA 1G3WA 2RNJA 3G4SI 3K2LA 1OCCH 4EEFG 1O3RA 3JAMS 2X1EA 5AIPA 4K0KM 1WIVA 1ZTRA 5LEKA 1RR8C 2UXXA 2F2EA 3VDPA 4JQFA 3BJOA 3CC4I 4IHXA 2XLJA 4HA8A 1W1WE 3TNIB 4KHPM 2C98A 1IN6A 2IJLA 2DXBB 2CRUA 4REZA 2DOFA 3FF5A 4E6KG 4AWXB 3DCFA 2PJPA 1VI0A 1MU5A 1SXJA 4Z2YA 4C2UA 2ZPFB 2O3FA 2EV6A 2F5QA 4FISA 1D0LA 4BCNB 1BOAA 2DPPB 1MNDA 2FD5A 2CJMB 2C99A 2IT0A 4C2MJ 5J3LA 2LF7A 2CHQA 2A6HF 2Y0SA 3UGJA 3LA2A 1S72I 1V54H 1V3FA 3JRCA 1BN5A 1TLHB 2PI0A 3H3VK 1U9OA 3AOEA 5HDGA 3F22A 3DLAA 1LEBA 2L7MP 3FBNB 1BI1A 2MGQA 2R7RA 1YTYA 2K0BX 4TV7A 3CJNA 4PFOA 2LKXA 1I5ZA 2ECCA 3FE3A 2EV5A 5ACBA 3DA1A 3WE3A 2W4SA 1V33A 4L15A 3DKWA 3MJ5A 4EJVA 4A3GJ 2NNNA 2L4MA 4F55A 2HAKA 3KZZA 3NWTA 2ZCFB 3WU1B 3L00A 1XD7A 1XMOM 4LK1F 4XK4A 4BY7J 2I5UA 3JR9A 4TUWA 5EP4A 4CUGA 1N4MA 2Z5UA 5HDNA 1MBGA 2EV0A 1WSUA 2CCIB 2EZHA 3HPHA 1MMAA 1PUEE 5KNLA 1W5TA 3W6VA 4OIPF 2W99A 4M74A 5IT3A 4XLFA 3SAUA 3TP0A 4ZYHA 3ROUA 2IBDA 5D5XB 2M5ZA 2CQNA 2ZMEA 4DYCA 2KXEA 3ERED 2WJ9A 4PDIA 3CLOA 2CMPA 4QHSA 1H26B 3GPXA 1RETA 5TGTA 2UZBB 1NG6A 1GVNA 4N0BA 1E9HB 3RGSA 2EFQA 4HX8A 1VQOI 5F1RA 4IBKA 2XVCA 4DV3M 4XLEA 2LDUA 3GLIA 2ID3A 1NNUC 2CU7A 4L5IA 5H2FC 1G3SA 2O0YA 4Y13A 5E3OA 1DQUA 3ZGKA 2BV6A 2JZYA 2ZFWA 2R7GA 3SFIA 4A3KJ 1JSTB 3V76A 5L3CA 2LREA 5LEJA 2MYSA 1YSYA 3OYIA 2X8AA 1MZBA 4BJTA 5FKNA 4YG2F 4IHWA 2G3QA 4ZYDA 1YI2I 4PZJA 1VQ7I 3MZ8A 1UGQB 3REOA 3RZOJ 2Q2EB 3JRFA 1U8RA 4XKWA 3CC2I 1IUYA 2L0KA 4CCNA 5DQWA 4DGWB 2DZLA 3TNWB 3FXOA 3MKYB 3FTEA 3BR6A 1PUFA 2JUCA 1B4AA 2R7SA 3FYDA 4ANRA 3NRVA 2IS1A 4YOZA 2VI6A 1R22A 5CVJA 2R93J 1I4WA 1BR4A 2ZMEC 3VWBA 3SFZA 1XMXA 5KVRA 2CYYA 3FHNA 3I04M 1G41A 2R4JA 2CP8A 2F5SA 2HKXA 3AG4H 3BQYA 2H5XA 3DPUA 4EOLB 4Q4ZF 2NAZA 4YIRX 2LXEA 2O8XA 3OYFA 4LF7M 1VQKI 3U6EA 5D8LB 4N4NB 1EH6A 4BQNA 4ELJA 3DZDA 4DV6M 3BG5A 5EFQB 2VBZA 2VKDA 4X1EA 5B66C 4RM3A 2JVHA 4BDZA 5IDPB 2QVOA 3K8ZA 1WJEA 5FTMA 4XNFA 2NS7A 4YIFA 3TOBA 3NBIA 4Y28F 3OWTA 1R49A 1FTZA 1WGNA 1N78A 1XGMA 2N35A 5E79C 1GHCA 4L9NA 3MI9B 4L5JA 2PEXA 3W67A 2NOGA 4GYGA 3OS0A 2XF7A 2OA4A 3OOPA 1JT6A 2KZGA 1KQ9A 3WHLA 2HXIA 3EPZA 4A3EJ 4WP2A 1G8PA 3RKYA 4ENKA 4HRIA 3M7GA 2WC2A 3SATA 4UN2B 1NO1A 4LF8M 1JGSA 2CW0F 2M7AA 4XRFA 2DD4B 3KEQA 3ZQ7A 2I53A 3E9SA 3OOUA 1LDKB 4A3IJ 1IQPA 1QANA 5DS9A 2LBFB 4BNCA 3JRAA 4NC7A 4II3A 2MROB 3S1RJ 5B1AH 2QGSA 1TNSA 1K4SA 1HNZM 4AQYM 4UB6C 4AIDA 2XF3A 2APLA 3DKXA 4DIQA 2AQFA 2G7UA 3A0BC 4DQ2A 2L7IA 4I01A 4NSRA 1IZ1A 3WTZA 4X65M 2QKMB 2W1OA 1ZKGA 2W9ZA 3DTKA 3ERMA 3ZXSA 2GXAA 3E5XA 2XV4S 3A2KA 3CCSI 1NG7A 1NV9A 2EILH 2KPMA 2BS2A 4U7BA 4QNRA 2DAKA 1P4XA 1GL7A 1IDYA 3ASNH 3K70D 3ABTA 4CFVB 5LHGA 5D5WB 1P9QC 2C5NB 3HU3A 4AU7A 2DDBA 2DPUA 4MGZE 2JRMA 3EUHC 2L5QA 4IVNA 1PJQA 4A2UA 4BYYA 4BBSJ 3U5ZA 3BG6A 2VT3A 2F5VA 2ZAOA 4BB9A 5L3GA 2VF8A 2D7GA 3VSKA 1YOVB 3EUKL 2GXGA 3M0EA 4M0WA 3LSMA 1X1PA 4IBIA 2GA2A 2VF7A 1JR3A 2NXNB 5HLHA 3JREA 4UUVA 3TL4X 5HQ0B 3FM5A 1XDUA 2DT7B 3PNTA 1UGRB 2X51A 3L27A 3T0YA 1IFYA 2F5CA 4XOTA 1FKMA 5HS8A 1H4LD 3GRYA 4MM3B 2MC3A 3TDZC 4GC5A 2CJJA 2MH8A 3G2BA 4QPOA 1DGGA 3CF6E 1FT9A 1HW2A 3RQIA 1ZYRF 4HSTA 5H6RA 3JR4A 4CCKA 2JA5J 2A6TA 1OFIA 1N25A 4BQAA 1L2CA 1HR0M 1FP2A 3GLHE 1JR3D 2JWTA 2X9DA 2E5ZA 5HOOA 4FWGA 4R3DA 4KYWA 3I4YA 4LF6M 2WB1A 4RBOA 2XSDC 3OS2A 3KXEC 2NVTJ 3P9KA 2WBMA 3BP8A 2UZEB 2Z8YM 3DOGB 1MGTA 3GRVA 4E4HA 4EGYA 3IKVA 1XTAA 1XC5A 2DFHA 2R4GA 4G6TB 3GTPJ 4V2GA 3PFIA 1OR7C 4V2FA 4DBRA 3A8LB 4PGGA 3BOSA 1S9HA 1B72B 3QPSA 4CDGA 5D6FA 2P6SA 4F6UB 3RKWA 4OGRB 2VXDA 3HGGA 3JRDA 3GO5A 3HOXJ 3F8CA 5H37D 3K0LA 3GLXA 5FKLA 1SD6A 2GIZA 4CYCB 4DYRA 3E6CC 2PJRA 2KDOA 3E6MA 3A0HC 4ENJA 2MLGA 1F1ZA 3H0DA 5IP7J 1FOYA 1MJ9A 1FOXA 4B3RM 2K9QA 1L8QA 3HRMA 3AV0A 1V55H 5LQFB 2BGCA 2JA8J 2CG4A 4RAYA 1U6GA 2Z99A 2XAGA 2X6XA 3GWZA 2GAUA 4PJLA 3FMQA 1LPQA 4Z6YA 1X1DA 3M1EA 3ML6A 4HEA2 2DODA 3LSTA 3KS4A 4D80A 4WK8F 4G7HF 1C9BA 1TW3A 3O0GD 4D5CA 4XGIA 2HQ5A 1FMVA 1USTA 1FNNA 1NY5A 2GOMA 1B8IA 2J5PA 1P3QQ 3C58A 1J5YA 2E2JJ 3C3EA 3A01B 2K9MA 2Z4RA 4DV4M 4S05A 1NH3A 5IYCJ 4LLGF 2C5VB 5JHFA 3RPUD 1E9RA 2IW5A 3GLIE 5LMNM 4RM2A 4LFCM 3CMEI 5LD2C 1YYVA 1Y56A 2RGVA 4WURA 2LVPC 1QGPA 2ELHA 1HKTA 1X3UA 1B9NA 2ZXIA 3TQSA 4IJFA 4OW0A 1WI9A 4FTHA 3A8MB 2EUCA 1ORKA 4LMYA 3H36A 1TWHJ 2GOXB 2EFNA 3CMAI 1IXSA 1ZRDA 5DEQA 4DZPA 5E26A 3U2RA 3U5ZB 1MMDA 3A4CA 4F7SB 1RU3A 3GPPA 3HOZJ 1PJTA 4QPQA 4BHPA 1YLFA 2IGMA 4I98B 3SYTA 3FHZA 4AUXA 2HU9A 1F4KA 2WFYB 4EOPB 5DNYA 2QQAA 4YIIA 3MCZA 2A6EF 5KCMA 2DMUA 1MX0A 3C3DA 2R5YA 3HHXA 2XPVA 2CRGA 3K9PA 4ZZDA 5FD6A 4GDFA 4OB3B 5ILVA 4EV0A 2Y0MA 5TJJA 3U21A 1CF7B 1AD6A 4RGRA 4L9VA 3E5QA 4EATA 4EOQB 1ORYB 3AFHA 2DTZA 2O03A 1TTYA 3OTOM 3ABUA 3DF8A 4IPAA 4HX7A 1VQ5I 4AM3A 3HRUA 2AHJB 4XORA 2OPFA 2JA6J 4FM4B 3C3WA 2XKOA 1TW2A 3AOGA 3EIEA 4ON0A 4IQ4A 3LSPA 3HJEA 1F36A 4GHLA 2DO7A 4XL9A 5GTHC 4KT5C 2WY8Q 2KFDA 3R8FA 2UXBM 3BTJA 5ICGA 5EEGA 1RNLA 1SXJE 2DMTA 5CYIB 2BEOA 1RPWA 3ZQHA 4KRDB 3QQAA 1IGNA 1X1AA 1UNLD 4MEYF 3QU3A 3BTLA 3CCVI 2E71A 3Q0WA 4GIPA 1MIJA 2ZXWH 1H9TA 1ZRFA 1OYIA 2L7ZA 2WTEA 5ED4A 2X4HA 1JT0A 2LC2A 1P5EB 1X3WB 3U6PA 4PJJA 1SD4A 4JYAM 2DJIA 2BJVA 3JRIA 1HW5A 2CWBA 2P6TA 1BC7C 1R36A 3SMSA 1QYRA 1TFBA 2E2HJ 3J2PB 4K2EA 1UHSA 4BGDA 1REPC 1GVJA 1E3OC 1ZGWA 3Q9VA 2BS3A 4BACA 2EJRA 3P5JA 1XSVA 3CP2A 2UUEB 2ZZDB 3EOCB 3BR0A 3JCUC 3F72A 4GITA 4IL6C 2IAIA 2HKOA 1G8XA 3GLFA 3WG7H 3LA3A 2QEXI 1AOYA 3WG9A 1ETQA 2VQLA 4XLAA 3ZQCA 3K4CA 4ZPXA 3RTRA 2FF4A 3KOYE 4HX4A 4EC8B 3W68A 1JKRC 1BU2A 3VK7A 3H0GJ 2E5LM 3CQZJ 1I3QJ 4LY6A 5E20A 1NK3P 2QSFX 3A01A 3HUGB 4IKFA 1JKPC 1MJGM 2JSPA 3I4VA 3UJNA 1R5GA 4PDKA 2HR3A 4ZDLA 1QBJA 2DENA 3LW5F 1ZV1A 4F2LA 4BUPA 2A68F 1HDDC 1T6OA 2C9OA 3FTCA 1PGYA 2QHOB 3K7AJ 1H89C 4HF2A 4QNMA 4JYKA 3RCOA 2R7OA 1WJBA 2F48A 5FGMA 1YX5A 2KDLA 2QBYA 3OYHA 5ITXE 5FJ8J 4WXDA 2G0EA 3MKWB 1W7PD 3ZP5A 4ROCA 3F6OA 3M9AA 4A3FJ 1RUNA 1J59A 2CZ7B 3HOYJ 3DDPB 2UZLB 1SMTA 1U3EM 1RKWA 3QYFA 2VOOA 1YE9A 3SDBA 9ANTA 2IW6B 2Z7JA 5KO3A 3DBRB 2RNGA 4BCOB 4AIKA 3IECA 1KU9A 1J0RA 1MBHA 2WV0A 2CHGA 1EA3A 3GLHA 1QAMA 2LTUA 3EETA 1AWCA 1ZELA 4JI8M 3B57A 4ROEA 1OKRA 2HPMA 2EA2A 2EA0A 3BZ6A 2R5ZA 3GP1A 1W7PA 4M72A 1OIUB 2AQEA 3GFIA 1SD5A 5M5XJ 2KKOA 4A3LJ 1PDNC 3E3VA 3K92A 2HL7A 3MD2A 1HF0A 1UFZA 5IT9Z 3FDYA 1Q1VA 1UMQA 5D5VB 3F0CA 3LL7A 5IPAA 3PSIA 1MN3A 4KT6A 3N4MA 3J7ZI 1OQYA 2BE5F 1CQTA 4ANJA 3BJ6A 1ERDA 3BLHB 1VQNI 3CDIA 2XASA 5HBJB 4LD5A 4WWCA 1DGRM 4IOCF 1N33M 4EM2A 3CJTB 4KT0F 4PSWA 3H4JA 4X66M 3TOAA 4II2A 4FQGA 1DP3A 1PKDB 3G3ZA 4AKIA 2Z3XA 4CGZA 2E7WA 4M3EA 3S93A 2IEKA 2W84A 4A12A 1HBXG 3S2WA 4OB0B 1VTNC 4XKCA 4BHBA 3PVSA 4ELLA 3CDLA 3MMYB 2QCOA 1U9NA 4QOZC 1Y1VJ 2K02A 2Y0SN 2RREA 1JXSA 2WIPB 2FA5A 3KETA 3VFZA 1ETVA 2KIMA 2QPAA 1OIZA 3QHWB 4IHVA 2PMZA 4X64M 1G3TA 2H6CA 2MD5A 2OBPA 2XGDA 3DQVC 2W24A 1I1GA 4IRGA 3OYEA 1FOKA 3RE8A 5D4SA 2KEBA 3J7AS 4AI6A 5F3WA 3BG7A 2BWBA 4IHSA 4QWQA 2R5YB 2QM3A 1I1SA 1X58A 1JJ6C 2QCUA 1A6QA 4UUSB 2BXYA 5L3EA 5IT9S 2WSEF 4GGGA 1CF7A 1ITYA 4FCTA 4ESBA 4WXCA 3SHGB 1SC7A 2C6TB 1BBYA 2E1MC 2PMUA 3I71A 4FWHA 4LJ9A 2D45A 1OKWB 3H4CA 3PL8A 4PFPA 5C4XJ 1BM9A 3U9GA 4F93B 1D5YA 3K2ZA 1DGHA 2JRTA 3QP5A 1IBMM 4LF5M 2VQCA 4XLPF 2CYZB 3ZRGA 3KCCA 1ZG5A 2P5KA 1W98B 3UMMA 5ICFA 2KNZA 5DD4A 2ZSIB 3EUAA 3BR5A 3PM1A 4YFNF 3JAMZ 5LHIA 4R79A 2C4GB 4RLQA 4XSXF 2DA4A 3CCQI 4E7KA 2NOJB 4DBGB 4NB5A 2VODA 3RFWA 2VJIA 5FRMA 1E0EA 1VYWB 2LYCA 5H6QA 2H1KA 1MSFC 3HKPA 3SAWA 3TEDA 1UELB 2EZKA 3IWZA 2DA5A 3DTOA 1G6NA 1GVDA 3V8KA 4LRTA 3QRFF 4BCJB 2BHYA 3NEUA 5FO5A 1TBXA 2L09A 3I64A 3MHVC 4M3DA 2UWMA 2LMDA 2FUG2 3PUBA 1DGBA 2QSHX 3BTCA 1WJ5A 3GFJA 1H25B 1HDPA 2NRAC 1TR8A 3PFYA 3SARA 5IWAM 1R4NB 1AUAA 1I27A 4MH0E 2EZIA 3KS8A 3OIQA 4MGYE 5E3NA 3OYMA 4A3MJ 1B8IB 5K5RA 1IN8A 2MA3A 2NNYA 2YR0A 2Z2SB 3BPXA 4NXMM 2PQ8A 3IWFA 4M9ZA 3DTEA 3WU2C 4P55A 4YRVA 1SD7A 1VFCA 1V29B 3KYDB 3LA7A 4LK0F 4I99C 3X26B 1JGGA 5ITTA 1OCTC 2M9HA 3S17J 2V22B 2Y9YA 2R6FA 2GM4A 3S2HJ 4G6DA 3WODF 2XRLA 2IW8B 2DMQA 1KFVA 1E94E 2YSRA 1ETOA 1TGUA 4F7ZA 3E5UA 4Q7JA 3E21A 3BHUB 3HOTA 2L2OA 2HNHA 1WRJA 2CSOA 4RGSA 4I5SA 5F0CA 2DAMA 2CV1A 2HTJA 2VJ4A 3KLNA 4FX4A 1G59A 3A1YA 3RI4A 1K79A 2KZSA 3KEYA 4Y17A 4OB2B 1DGFA 3FTDA 4KNYA 4MFEA 5ICPB 1VQ1A 5C4JJ 2QBYB 2X48A 1WGLA 4GH9A 2D5VA 3VOEA 3A8OB 1BJAA 3TWMA 3OSGA 1WJCA 1ETKA 1WPKA 4JI1M 1RKTA 3FM3A 1Z5BA 4EVIA 4YFXF 4JXJA 5FKOA 1JSUB 5L2WB 1LNWA 1A6IA 2ISYA 1ZG3A 4RGUA 3AAFA 1Q02A 1Y8GA 4A0XA 1WH5A 5HNHA 4ZJZA 1SVOA 1KU7A 3G1MA 2V79A 1F5TA 4I2OA 4ZGDB 2EPFA 5HNFA 5J4YA 1J09A 3J81S 2ME0A 3OYNA 2X49A 3TPZA 2QWWA 4UV8A 1J7KA 2DAOA 3HUGA 1JE8A 4GFBA 1ZGAA 5B3SH 1UNHD 2M8GX 1GH6B 2LW4A 3GTGJ 3NQOA 1J2XA 4FCVA 4HQEA 5CPRB 2CQKA 5DYGA 4UUSA 4PSXA 2F5DA 3N05A 4HV5A 4CZCA 1HNXM 3H3UA 1WCMJ 3KZIC 3SQNA 4BEHA 4J19A 4FT8A 1XG1A 2MD0A 5E17F 1VEGA 4FE7A 3KP2A 1C7YA 2VPLA 5FTKA 4BCQD 2R7XA 1Z05A 3JAMK 5D4RA 2LY2A 4NSTB 4F7JB 1A35A 2R62A 3BLYA 3OL4A 4G4NA 4PCQA 3CCRI 1G2HA 3HOVJ 4EOMB 1ON2A 5FTLA 1LE8B 1YW9A 3RGFB 3B73A 3QAHA 1OGUB 2FMYA 4JI7M 1Z3XA 2Y69H 5EP1A 1IRFA 2UXDM 4W97A 2DXCB 4CISA 3QYEA 3BDDA 3DL1A 4D0PA 1JUPA 5KPZA 4BCKB 3ISPA 4IRIA 1KQ8A 4OMZA 2K7LA 2VE8A 1QO0D 2DWZB 3VODA 4D81A 4EORB 1D0MA 1XB4A 3IC7A 4OAYA 1T56A 2XSJC 1SVLA 3R6SA 1X19A 4EOSB 2OJED 2YUSA 5F0HA 3DBHB 2XRNA 3WTWC 3DJBA 3I9V2 3B9PA 1U2WA 5HNBB 2PHGA 2OD5A 4II7A 4PGHA 4YY3M 1IRGA 1IW7F 1NNJA 2E1NA 5ITYA 3DEUA 1OIPA 4MGKE 1XO2A 3K1PA 2O8KA 2BW3B 4A3VB 3O8HA 4HNTA 2C5XB 1QHGA 2VC0A 3FKJA 2FQ4A 1EKEA 2FSWA 3I56I 3QXEB 4HNVA 1NHGC 2NVQJ 1ONVA 1JKOC 2Q1ZB 2HWVA 1IG7A 3QAUA 3RZDJ 1NJGA 3UKGA 3DFZA 2L4EA 3KPHA 3Q9SA 2FEZA 1UG0A 4L9TA 3HJQA 3LVWA 4AYBA 3GTLJ 1FC3A 2EO2A 3B74A 4BHCA 2VQFM 2FOIC 2PK9B 4LJ8A 5BOXA 3S14J 1S7EA 4LJ4A 4Y72B 1R1VA 3LSGA 4UHTA 4NRVA 3S3OA 2OO9A 4EC9B 1L1ZA 3CP8A 1D2NA 3RQ4A 2DTRA 3QYBA 2LVOC 2QYOA 2Y31A 3OMYA 3PIPF 2R7UA 1ENWA 1TWFJ 3A45A 1VQ9I 1R2YA 4XN3A 2HDWA 3O6BB 3CCEI 3DKYA 2K4JA 1YIJI 1Z3YA 2HOTA 4BXXJ 4LGMA 2DZNB 4IBEA 1A36A 4BBAA 3D5LA 4WW0A 2DA6A 1RIOH 2P8TA 1R2ZA 1Z91A 1UCRA 2ZKZA 2IGNA 5F04A 2M4GA 1Z77A 5A2QZ 5GAHJ 3F92A 3QHRB 3MVPA 1SXJD 2CV0A 4R8HA 3GTMS 2IGKA 2DAGA 3I4NJ 5HBEB 3FKIJ 3CUQA 2V1UA 2GA1A 4GKJM 4B09A 1YRNB 2H8WA 2D0QB 2Z1DA 2YU3A 3G1LA 1XN7A 1LDDA 3HRTA 4W1UA 5FLXS 4BL0B 4DJAA 5K7HA 4L9JA 1XXHE 2LTPA 3HL2A 1H8AC 3KSJA 2JQ7A 1ACIA 4F91B 2HWJA 2GBYA 3H9GA 1IN4A 4XR6A 3VSLA 5TRDA 5KPRA 4A69C 5EP2A 1YS6A 2DOAA 2ZJPF 3E6DA 4RF1A 2W7NA 3CF5F 1QA6A 1GXQA 2HCBA 2EIJH 3CCYA 4DR1M 2VXZA 3K69A 1ETWA 5HVQC 4RB1A 2LOOA 5FTJA 4BCMD 3VLFB 4ZH4F 1NVMA 3A98B 3D0SA 4NC8A 1WGXA 4IQJA 3BZCA 3S32A 2ZMEB 3EQLF 2XFSA 2P5LC 2MLKA 3G73A 3WTTC 2HI3A 3CTAA 2GLOA 5D6EA 2WPAB 3E1SA 1IRXA 2CO5A 1VDLA 1FYKA 1QUTA 2V1DA 4JP0A 3V7SA 1R6BX 4EGZA 4M6VA 3ZMSA 3HSFA 3LVVA 4D7NA 4HF0A 5IHYA 1APLC 1TZLA 2LVQD 5E18F 3S15J 4V19K 1ZAOA 5B5EC 3R4KA 3IRRA 2NVYJ 2CS3A 2C6YA 2G9XB 1S5LC 1TDHA 2L9RA 3HHTB 3B7ZA 3IP4B 1LVKA 3QYHB 1NK2P 2FNPA 3CMMA 3IRQA 3HB9A 3QP6A 3BJAA 2ISZA 2FJ1A 2NS8A 4CJ6A 4HDVA 1D1CA 2QZ4A 2D7HA 1LJ9A 1OFHA 4JI5M 2BZTA 4CFXB 2KRFA 1DO0A 1W36D 1XGNA 3F3XA 2L02A 2KHHA 4BEHB 2KR6A 4EONB 2UUAM 4PK4A 2OZ6A 1SXJC 1UGSB 5EXPA 3POMA 1IUFA 5HVYB 2XAJA 1UGPB 1WVRA 2V9KA 5DQVA 3U1DA 3J80S 3NDQA 1R1UA 3Q8GA 1TT0A 2M4KA 2B63J 1EF4A 1FTTA 1Q3CA 3HYIA 1P6RA 1Y8QB 3K6GA 2QQBA 2V9VA 3TW7A 4PJNA 4S0HB 2HQNA 3KLOA 4M3BA 4KMUX 4M71A 4UV9A 1K6OA 2LKSA 3K4KA 3ZQLA 1H0MA 1KYZA 4H0EA 1AU7A 2HDCA 2PG4A 1GV2A 3OIOA 4RB2C 3CDHA 2A07F 4NDLA 3IH4A 2MFZA 2LNBA 4B3TM 2ESNA 5CKTA 2QSGX 2M3AA 4LFUA 1Z7LA 1MNEA 3LSIA 4HNUA 5CLSA 2XAQA 1BW5A 3DLLF 2JPBA 5F27A 2LD5A 3QZ9B 2OCEA 1X2MA 2UU9M 2QDYB 3C1DA 2HOEA 3LNQA 4R71A 3GPYA 3ASOH 1G4AE 3BR3A 3CUOA 3E7LA 3GW2A 5AIQA 2X6YA 1BL0A 5GAGJ 4KITB 1OIYB 2PJRB 1KGSA 3QZ5B 2F5PA 2RQQA 2WEVB 4OU7A 4XRMA 2IRFG 3ELKA 4PUSA 2XGXA 3FBIB 2VBXA 2F5NA 4I6ZA 3M4OJ 3B7QA 1D0YA 3GZ5A 2CQXA 2HFHA 4FX3B 1Z0XA 3CLQA 2R18A 4IO9F 3ECHA 1IY1A 4PCZA 3QWLA 1V4RA 2FBHA 1OL1B 1K78B 1MMNA 3J7AO 1DU6A 3I54A 3X24B 5DYIA 2XF5A 4HYEA 3DOAA 1LV7A 1WJDA 3VDXA 5F6FA 4ESFA 3HOSA 5ITXA 4GYIA 4ASNA 3U6DA 2X1CA 3DEWA 3CCUI 3CJRB 3DBLB 5DM7F 2KRHA 2E36A 4P9FA 3BBZA 1P4WA 3BR1A 4ITVA 1R4MB 1OAIA 5FFXA 2X6OA 4P17A 4XLHA 5E1WA 2R4EA 4IBCA 3RYRA 2ZNZA 3W6KB 2VL8A 4A93J 3E0JB 3OYCA 2IS4A 3I53A 3LWFA 2MW8A 1BW6A 3ZMUA 2H27A 1E7PA 1ZLJA 3O3KA 3ZN0A 1KU3A 2VASA 4EQQA 3HPGA 1KZHA 1O3SA 4XBFA 1GDTA 3F8BA 2R7DA 6PAXA 1OJLA 5GPCA 3OR2C 1DDNA 4BJ5C 3WVEB 3M8FA 2CW7A 3J81K 1D0XA 3IH3A 4LJ7A 1TC3C 4CZZA 2OPTA 2DQLA 3TP3A 4MTDA 5DDGA 1TQIA 4LF9M 2ZFUA 3K1NA 2KISA 2DXIA 1WJAA 1H1SB 1D1AA 4OU0A 1MD0A 4EOKB 1R6RA 3M3YJ 5M3MJ 4NL4H 4LF4M 1TD6A 4CFUB 2PN6A 2VN2A 2DA7A 3TWLA 3SASA 3B6CA 2ACJA 1MDMB 1YRNA 1ZH5A 2BKZB 3L26A 4ENMA 3K4MA 5ITRA 4C3JJ 3U6LA 1Y6IA 4GC9A 1V5EA 2L9VA 2XIGA 5ILUA 5L8RF 4F52A 1H27B 1HW1A 4JI0M 3CESA 2KW0A 2D7EA 2WA0A 2DNAA 4BQQA 1JOWA 3ABMH 4B7FA 2BHZA 2EKFA 2DMEA 5KAIC 4G6ZA 2UZDB 1IM2A 2PMHA 2XAUA 4ZYEA 5J40A 1AHDP 2KIFA 2OAZA 4LJ5A 2VIIA 2H94A 5DTDA 2NVXJ 3S1QJ 5IOZA 3AOEC 2LLKA 4M3GA 1T38A 4IBJA 2Y20A 4XSZF 5IP6A 2DD5B 3KHIA 3GLIB 3AG2H 2KZVA 2YPRA 3GX4X 3GLHB 3AJIB 2P81A 4BLCA 5IOYA 3KX2A 1G3YA 2Y2ZA 2HGCA 2G7HA 3GTOJ 3FK7A 4X6AJ 1B72A 1XMAA 4KJZA 4MGRA 2WY7Q 2NVUB 5LMUM 3IHPA 3ZMVA 4A3BJ 3HEFA 1JJ8C 2QP9X 1F43A 3WHCA 2UXNA 2WIHB 5FLVA 2WMBB 4BH9A 1ZGJA 4UXNA 3OSFA 5DYMA 3SMPA 1V34A 1QUSA 1JHFA 1YX3A 2OUMA 3IUOA 1YIOA 2A3SA 4LG0A 3V8LA 1VEKA 3L28A 2F4VM 5EP3A 1KSFX 1LFBA 4R1HA 4B3XA 2EIMH 2I7NA 2DWNA 2XB0X 5LRRA 1JB0F 2QUFA 4IF4A 4CFMB 2H1RA 2V6ZM 1QAQA 4U87A 1QVRA 4QHTA 4ZYGA 4OB1B 1QHHD 2VDBB 4ITQA 1R23A 1QLBA 1RRJA 1UZCA 3ABLH 5M5YJ 4DR5M 3ZQJA 4CCJA 2W85A 4MQVA 5ILSA 2XH9A 3I55I 2ZJQF 1FBQA 1FEXA 1Y0NA 1V5GA 2Y75A 1ZR4A 2BS4A 1T98A 1O4XA 4M73A 2R44A 3QU6A 1IDZA 3L2CA 2ETHA 2X6WA 1QNTA 3FUXA 2STWA 1IY0A 1VINA 3QPHA 4G4RA 3S16J 5K5OA 4BBSM 5CVRA 4WCGA 3SC3A 2O61A 3I4PA 3EIDB 2DYRH 4E7SA 1R4GA 2XF6A 2R0QC 1HC8A 1GUXB 4AG5A 1H24B 3FXKA 1W0UA 2XZUA 3VYTB 4PDGA 2J5OA 4OVZA 3FD9A 2NQ8C 1RUOA 2XPUA 1NV8A 3V42A 4DOZA 4FWDA 1EJ9A 3UZUA 2VT2A 2DCEA 3U6SA 5LHHA 3FUWA 2CWEA 1O7LA 3W2VA 1SXJB 3N97A 1D8JA 4LFBM 4P1WA 3W0FA 1FZPB 2BPMB 5E3MA 2M30A 4MNUA 1CGPA 4X62M 2B0LA 3MAJA 3TO7A 3HY5A 4I4LA 1YQAA 2R7FA 4KISA 3KW6A 4KN7X 1NJFA 4OMYA 4ENNA 4LJAA 8CATA 3R9XB 4A0ZA 3GPUA 4BE0A 1GY3B 1H88C 1P92A 4FCYA 3J7YJ 3CGWA 2KIQA 3I5UA 4R7GA 2G8LA 3THGA 3I51A 2M5WA 3NARA 3Q0VA 4KUMA 5ERIA 2PJQA 1QDRA 2ZO4A 1J9IA 3L2VA 1MW7A 3H4MA 1LUJB 3T8RA 5ICCA 3VDUA 4YEJA 4RNAA 1X1BA 1PJRA 4QLCU 2OOAA 5IY5H 1K61A 1MMGA 1E2XA 4KO8A 2LY9A 3OL3A 4CGYB 1ETYA 4L16A 4FCWA 3FWEA 1K78A 2KZUA 3H3ZA 2PK2A 1Y39A 1JHHA 1HKSA 3HJSA 2IGOA 1FBSA 3HKZN 4HAMA 2FBIA 3SYKA 2M2EA 3W0LB 4NRWA 2QNJA 3WHBA 4A6EA 1XXHB 3U61B 2A05A 2H6BA 2L7FP 2JGZB 2P7VB 2AS5F 1O7FA 1Q1HA 2K9DA 1P7JA 2DU9A 3V8JA 5BPVA 4UNOA 3S8PA 2COBA 2EFOA 4IX7A 1VNDA 2L7HA 4B1RA 3O8GA 3OY9A 1A5TA 2W82A 2B7EA 1QZEA 4BXFA 4G4OA 1BC8C 3B7NA 1T3TA 1HT2E 2WAQA 3CF0A 1OFCX 4Q48A 1Z6RA 3PIOF 1QPIA 2C5OB 4IMYB 5IYDJ 1TT5B 1B9MA 2XSZD 2PMZN 4LIVA 3T8TA 3CO6C 4DBQA 2Y30A 2EUFA 1G3NC 1P7IA 1U5TC 4UN0A 2L54A 4ETSA 5CEIB 5HLIA 3KIOA 4WX9A 1Z5CA 2EJSA 3HXLA 1OKVB 1N34M 3F8NA 1I3AA 2GZWA 2HS5A 1R5LA 3DU5A 4D1QA 5LMKB 2M87A 1HA8A 1SFKA 5JHUA 4YOOA 2KDZA 4G7OF 5K1YA 2XC7A 3GO8A 2QLZA 2LH9A 5F1JA 3BTIA 1L1TA 5DM6F 1PJSA 4CFNB 4BY1X 2BVLA 3P9CA 3MIAB 3AL0B 5K7FA 1WH7A 3OR1C 1KYIA 2JZ0A 2Q2EA 1GXPA 1B6AA 3V7CA 2O6GE 2M0CA 5LRSA 3T1BA 1IXCA 3NWLA 3KP7A 3NWSA 2MH2A 4BXXX 3HG9A 4RF0A 1IV8A 2K86A 4WF2A 1GLNA 1UJ8A 2QGUA 2DWMA 3HTSB 3FXRA 1ENHA 4GHAA 2FX0A 4EJTA 4JBAA 2L9NA 3M8EA 5L3FA 4C3HJ 3R61A 3ZQIA 2UUCM 1MH3A 3FTFA 1BJZA 5EGOA 1LQ1A 3SYLA 2HZTA 1CUKA 2BY0A 1A31A 5FROA 1WHCA 3FUVA 3KOWE 2CV2A 2Q0OA 1NHWC 2IA2A 1NSFA 3EYYA 4O6JA 1MDMA 1VDDA 1C0WA 1V92A 2KNVA 1WI3A 3DDQB 3OYJA 3OYLA 5LGTA 4UVAA 3HGYA 2FU4A 3G33B 3A03A 1TH3A 5LGUA 3KFUG 1A5JA 2PMIB 4L8RC 5M3FJ 1C1KA 1QQWA 5DUIA 1U8BA 4UY8I 5HDKA 1TNTA 2GXBA 4NHJA 1FMWA 1H1PB 3GQ4A 4E7ZA 2HKJA 1G71A 2UUBM 4XKBA 3K10A 2VE9A 4CXAB 3ZN1A 2RV8A 4RGXA 2F6CA 3FRHA 2KP6A 3SBJA 1P4AA 4F92B 3LAJA 2LSOA 5AONA 4ZC3A 4Z8XA 4Y4RA 5IP9J 2FE3A 4BBRM 5LFAA 4CXFA 1MBEA 2DA2A 3TO9A 2ERCA 1QMZB 2IXSA 5C44J 2VKEA 1GKIA 2VONA 1YITI 1BI2A 4G8XA 1DO2A 5K7ZA 3H5AA 3MY5B 1RESA 3MWMA 1TL8A 1IBLM 2MABA 3DU6A 1U5TB 1L2BA 1IN7A 4I8OA 3A02A 4LG0B 1Z5AA 1FLIA 1XX5A 5EZGA 4C9YA 3JSPA 2CEAA 4NC6A 2DMPA 2VB6A 2W57A 1JTYA 3KP0E 2JVGA 2V9PA 4P16A 5IYBJ 4NQWB 1HSTA 3MY1B 3HHZA 1S7AA 1PJJA 2E1CA 5E8GA 1X37A 2O9LA 1PM5A 1VG5A 1D1BA 5M5WJ 3MKLA 2NS0A 2DN0A 2W2HA 4LITA 4GXOA 4BDYA 1GJSA 2X4AA 1T43A 2YU9J 1MKMA 1LE8A 3H9QA 3IAM2 1AIPC 1L2DA 4B8XA 1PRBA 2LHCA 4XLNF 1OLTA 4HPQA 2E5NA 2V1CA 3U60A 2BY1A 3KOZE 2E34A 3TE6A 3TW6A 2DA3A 2FOKA 3W2WA 2JA2A 4IOAF 1T6SA 4IRHA 3GXOA 4RKUF 4AD9A 5HLGA 2Y0TA 4LCBA 2JNHA 2EK5A 2X85A 4OIRF 4IIWA 5EG0A 1OISA 2BXZA 2KT0A 3SZGA 5TISC 1STZA 2ICWG 2CFOA 1ZHFA 3OYGA 4E7JA 1SFEA 3OIPA 4HBLA 1SFOJ 3KP4A 3PQJA 1JUMA 2IVXA 3LCVB 1POGA 3F9KA 4MTEA 5BNGA 3DP7A 3FYCA 2K3PA 1XXHA 3M8JA 3F8MA 1J5EM 1BA5A 2EA4A 4PJ0C 4X0GA 5E8IA 3BLRB 2LP0A 2RKHA 2BW3A 3EDPA 1XSXA 5HBHB 1DV0A 4XKVA 1IBKM 1HXDA 2I10A 3L2AA 4EMSA 2WHBB 1XCBA 4G12A 5KAFC 1IXSB 3QODA 1O57A 4CICA 3VYGB 1WXQA 4N4OB 1KONA 3TWKA 1MJAA 2JA7J 4RODA 5E1ZB 3U6OA 1FBUA 1L0OC 4GEWA 1K3WA 1HQCA 3T38A 2HVQA 3JRBA 3IAS2 5F0FA 3LOCA 2DKLA 4FD2A 4ZYAA 1WFXA 4MLOA 3RYPA 2A61A 3ILKA 3HIFA 3OYKA 2WXVB 2ZPIB 2ESHA 1SANA 4BKXA 3X28B 2K40A 5KHDA 4I02A 4BCPB 5DD8A 2VC1A 4KMFA 3BLQB 4N9HA 3E6BA 2VQHA 3LSHA 1XC8A 5EEHA 5JLWA 3KFWX 1UM8A 3AKZA 5EXSA 1Y8RB 3JW4A 2K47A 4OX9M 5FLXZ 5CQEA 1ZMUA 2R3SA 4GCVA 4BCQB 3C18A 3ULQB 4CCLA 2OF7A 1TTEA 2AHQA 1Z9CA 4EOIB 3I59A 1IAWA 3KEOA 3COAC 3PO2J 3RPUA 2XGEA 3WE2A 5H20A 1WR1B 3ZMTA 3CD6I 3T6PA 1OI9B 3I58A 1Z21A 3IL2A 3AG1H 1ZAEA 4RS8A 3CUQB 3X2QH 4A0YA 4B44A 1ZR2A 1RR7A 2C5RA 3X20B 2F2CA 2HOSA 2Y0QA 2VQEM 1LFUP 3VKGA 3IG5A 1XCVA 2XGNA 5JLXA 3L09A 4HF1A 3WTXC 1Z7UA 2V4JC 3GRUA 4ZGJB 2DMNA 4LJZF 3KE2A 2DQRA 4IHYA 1ZK8A 2ZC2A 3H5RA 2AXLA 3GFMA 4KFCA 1XWIA 2VJ5A 3Q5FA 2O7OA 4F6WB 4ZDPA 4OIQF 4YC3B 2XDVA 3I4MJ 4AIJA 1BOBA 2D2WA 1E32A 1I50J 5EZHA 4ZDOA 2ZNYA 5IT9K 3JR5A 3VKHA 1DGWY 1X4OA 4I76A 2W96A 3KOXE 3JRHA 1OPCA 5EGOB 3BHVB 1OCRH 1XGOA 2R5ZB 1R00A 3EUHA 1QVUA 2EB7A 1Z6TA 1MBJA 4F6SB 2AHMA 2P5VA 5D8KB 2LFBA 1FIPA 4C3IJ 3B6AA 3DEEA 2V6CA 3FZVA 4IEJA 4AVZA 1Z67A 5BPDA 1QZMA 3CZ6A 4UVBA 3VYHB 2CE7A 2KQRA 1BR1A 3IG8A 4XM3A 2XKPA 4XIDA 3QOPA 2BOLA 3FUUA 4P5OA 1JQJC 5EG0B 1AISB 3NBXX 4ZZLA 3U6MA 3T1HM 2RKOA 1FWZA 3BWGA 3K9TA 2Z3YA 3M03A 1EFUB 1E3PA 3OYDA 2HEOA 2FNAA 1YO5C 4DUZM 3RKXA 4G9YA 4DNCA 4BY1J 4BS9A 2JJ7A 3M1CA 2H09A 2LWXA 3CO7C 2IA0A 4LZZA 4RA2A 1SFXA 1ZRCA 4L18B 4EJWA 2CQQA 2K9LA 2R45A 3GF2A 2LH0A 3BY6A 1GABA 1U78A 1WQ2A 3DPTA 3KZYA 3VPRA 4B47A 4D82A 3LMMA 1T0FC 2PFBA 2ZPEB 3ZC7B 5K5QA 3M6AA 3MN2A 4HL4A 3KYCB 3MEXA 1TH2A 3LSJA 4MEXF 4MGHA 2WSCF 3W6JB 1WJFA 2DAIA 3F21A 1PYVA 4G7ZF 4CYDA 1DGHB 3HRSA 4JX6A 2RRUA 1KQ0A 4B43A 1R5ID 4NQWA 4LOCA 1G4DA 4M0DA 5HODA 3K4JA 2QF7A 4AIHA 1NY6A 4UB8C 2ME6A 3H5NA 2ADUA 2VJJA 4HW0A 1PP8F 2HHHM 2HVRA 5EXTA 3WGHA 3L2QA 4A3CJ 4JK1X 4CFUD 4YOSA 4DV5M 1MBKA 3HKZA 1HCRA 1N36M 3BG3A 3CMYA 4PD2A 5A2QS 3A8GB 4MO7A 5C3EJ 4M3FA 1YW8A 5GKNA 4J01A 2JPCA 5F64A 1MBFA 1W36C 3BT9A 2PLYA 2DYSH 4TTHA 2BYVE 3DTIA 1N75A 3F23A 4EOJB 2IS6A 4XLCA 4QSHA 2MR9A 3TQNA 4C2TA 1UNGD 3M07A 3K9OA 1Y1WJ 2IVMA 4XK8F 4DV2M 4AKHA 4Y52J 2CUZA 3FXLA 2HTSA 1KXUA 4JI4M 3HX3A 4Y33A 2XB5A 3ZPLA 1NTCA 1P2FA 2M45A 3F8FA 2KRUA 5JFRA 4B3SM 3CTWB 4BCND 5C18A 2ZSHB 3WTYC 2XPWA 1VQPI 3R60A 1BI0A 4BY7X 4LG3A 5LGNA 4BU2A 4Q47A 3I01M 1IC8A 3RSNA 2VOPA 1OMIA 1ZP2A 3UR3C 1S3SA 3K4NA 4HLQA 1N77A 2DLLA 1ON1A 1USSA 5J4VA 4MGIE 4JX5A 2STTA 2DK5A 4I0AA 1WWXA 2ZTCA 2N8GA 3P7NA 4CCMA 3GMEA 2WWYA 2B9RA 2ZBKB 3C2HA 3TNHB 2DW4A 2HYJA 3KYLA 4RAFA 4OAZA 5J6XA 1JUSA 4Y3OA 4KIBA 1QU3A 1ZLKA 1BVSA 2WZJA 1LFPA 5CVUA 4EM0B 5CJ9A 4ZGEB 1H1QB 3FX3A 5FKKA 2C96A 3DPLC 3S3NA 4LB5A 1ZMVA 2EKKA 4FETA 4L5EA 1YS7A 2L9SA 2EFWA 4XRSA 4CSWA 3BC8A 2X0LA 1TF0B 1DUXC 1DU0A 1FVVB 4BCFB 2UXCM 4U0VA 1RC9A 3RGPA 2MC4A 5J1RA 3KP5A 4M9XA 3D8BA 3QOEA 1IREB 3AG3H 4IBDA 1OYYA 5HS7A 3E97A 4IZZA 3X25B 4QIWN 4P96A 2EZLA 2M0MA 2ZM6M 2DI3A 2K5CA 1K83J 2RVCA 3GCMA 2CZ6B 4CRLB 1FY7A 2QENA 1VEJA 1H9GA 2RAEA 3PXGA 2LBFA 3MQ0A 1KU2A 3U1KA 1X1CA 1FYLA 3RDIA 2TDXA 1YJWI 3VK8A 5GTIC 3LSRA 4IBGA 4CA0A 2F5EA 2F4OB 3HTUA 3EIHA 3ZQFA 4ESJA 1HJPA 4HDUA 2LG4A 4BCMB 2BBYA 3ABKH 4IXAA 1D5VA 4RDUA 2MGWA 1S7OA 4XRSG 3SAVA 2VBYA 1TDZA 2RC4A 1R58A 2OQGA 4CIZA 3BPVA 3OYBA 1EH7A 1Z1DA 2V1NA 4OIOF 2CH0A 1Z59A 4XICA 1ZN2A 5FLMJ 2IS2A 3V7RA 2G5GX 2JK3A 4L6V6 1ETXA 2P0WA 1F4IA 1S3JA 2IP2A 5CYVA 2DAEA 2M7BA 2Y9ZA 4YFKF 4XQFA 5E1XA 1VF9A 2YX7A 3FXUA 4DUYM 3ZCOA 4A3JJ 3L9FA 2FXAA 1QDTA 4KIFA 3A8HB 3HHHA 3HSEA 3C9PA 5DFLA 4ABZA 5GAEJ 2QA4I 3CF2A 4B08A 3A46A 1TP4A 4JI6M 4DR7M 4RAZA 5JR3A 1YFHA 3MMPA 2FOWA 3ECOA 2JY6B 5DCMA 2EINH 4ZTFA 4EJOA 2R46A 2M34A 3SZPA 1SG9A 1OCOH 2V6EA 1GJTA 4F70B 2JT1A 4KLNA 3BCAA 2NYXA 4S04A 4FW9A 1RI7A 2K27A 2JY8A 2I40B 3GTMJ 1PUFB 2W00A 1U0JA 2XAFA 1X3ZB 3FRIA 2I8DA 3C2BA 4MFDA 4NUBA 4OVZB 4OINF 3R0JA 1U5TA 2HYGD 2O25A 3FXQA 1QQIA 4U7DA 1SAXA 4G6LB 2XAHA 2KJBA 1XGSA 4F3QA 2CUEA 3HHGA 3MFKA 1GV5A 1OCZH 5GADJ 2UZKA 1XS9A 1K4TA 2E1OA 2CZ1B 2P5TA 3D5SC 4BE1A 2ELKA 4M6XA 1I39A 2X1DA 4LRSA 2EBIA 1IN5A 1T0FA 3CUQC 5FLXK 1VQ6I 2HYFA 1GL6A 7CATA 3C7JA 2H8RA 1S8NA 2QQ9A 4NBQA 2HVSA 3OYAA 2R65A 2EIKH 1SAUA 1EH8A 1SVMA 2HPIA 4A5MA 5L3BA 1S29A 3SJMA 1FYMA 4I3ZB 1T95A 3J27B 2ECBA 2KMUA 2DHRA 3BG9A 5BQTA 1UG2A 3PSFA 1WHUA 2G9WA 1O9KA 2XFTA 3IKTA 2LNHC 4JV5M 4DV1M 3HDDA 5ITQA 4Y7NJ 1OTRA 1FINB 5FKMA 1XNRM 4E7IA 2ZPBB 3WTUC 5IF1B 2OOBA 2HZDA 3G6EI 1TQPA 2E35A 2IA1A 2K9NA 3BCBA 3D5RC 1GUXA 1HSJA 1ZQ9A 1VQ4I 1W5CC 4AKGA 2OTJI 5FGKB 4DYQA 1L3LA 3FIWA 1FJGM 4I7HA 1Q39A 2L2DA 2ZAMA 3JRGA 2DWLA 2RN7A 2DI0A 4HOBA 2QFZA 4U0WA 1QVTA 5KQDA 2FRHA 1OCPA 4QTRA 4P9UA 1R7JA 4GKKM 1G3IA 2F4IA 2JMWA 2A5WA 1IRZA 2G77A 1IF1A 3GLFE 4I09A 3R0AA 3SEZA 1KYWA 5JVTA 2CHVA 1HNWM 2KHMA 1D3UB 1K3XA 1FPQA 5CVIA 2ELJA 2DDAA 3QPTA 3L2WA 1D8KA 1R5HA 2J7OA 2R0IA 3IHUA 5DCFA 1TWGJ 4OOIA 2YR2A 3ZOBA 1HOMA 2KL4A 5A2QK 5HS9A 2BVMA 4H4KC 2FQ3A 3TDUC 5HLTA 2JSCA 1R71A 2CGPA 5BNJB 2KNAA 5ITUA 3U6QA 2GIVA 4MB7A 3GBGA 3FXMA 2WAEA 2DPDA 3WGIA 1AKHA 1MJBA 4BXUA 4HG2A 3UK6A 3QPLA 1XB2B 5E6JA 2Z4SA 4F1IA 2OQ4A 4B7GA 3ZCBB 2HXOA 3TKYA 5J8FA 1GT0C 1AHJB 2QQ8A 2R7WA 2A69F 2F4MB 2LKPA 2OQRA 3H92A 2BWEA 4LZJA 4KRCB 2YNMD 1UAAA 1TWCJ 2DFFA 2HOAA 3V4GA 3GTKJ 5J1UA 5D5UB 4JI3M 3FUTA 3SHFA 2OC6A 3GLGB 1YUBA 3C2GA 2D1HA 3HSRA 4AC0A 5EJCA 4RB0A 2VKVA 3Q0UA 1K7AA 4IBFA 1I6HJ 1ODDA 2EQRA 3I59B 3WTSC 4FE4A 2PX9A 3VYUB 3OS1A 4G3OA 4JI2M 1YLAA 2CW8A 4B3MM 2KJCA 1EE8A 3WU0A 1JI8A 2X1NB 1QPMA 4MQ9F 4CYCA 1XDSA 4LLLA 2L4FA 1A04A 3DFGA 4KDPA 4G4QA 1HQYE 3J7BA 2EH3A 2MJ5B 1O3TA 2P4WA 4NNJA 3VB2A 1JKWA 4JN6A 4DW6A 3CJQB 1R1TA 2HQRA 4EIWA 1ZG1A 2R7TA 5IZ7D 3RKQA 1UB9A 3K4LA 3EYIA 1T08B 2GQQA 5FB2A 4MHGA 1EIJA 2PBIA 1LB2A 3JSOA 1H28B 1OAOC 2JWSA 1BI3A 1JTXA 3O2PE 1NHAA 3Q8XA 4FASD 1ZREA 2B3TA 2D1VA 3HU1A 2W48A 5FFZA 4B48A 4DZJA 5FRNA 3ZR8X 2VBWA 2K85A 5EXXA 5J47A 1Q3BA 3TBIA 2DBBA 4EJUA 3T1YM 3J80Z 4II5B 4LGYA 4D9JA 4O3MA 4BE2A 5JVGF 1N32M 2YS9A 1OKSA 1E9SA 4F7LB 3MK6A 2VLAA 3DXJF 4BJ6C 1LTMA 1KA8A 4GMQA 1IXRC 1V5FA 3PNYA 4G6QA 4DR3M 3HC7A 3P9IA 4O5VA 4AVPA 4BBRJ 3DV8A 2C9CA 4DV7M 4XONA 2IPQX 1E3HA 2OTLI 1QZZA 1HT1E 2RGHA 3OV8A 2DJNA 1VQLI 4Y15A 4L0ZB 2DHYA 4IJAA 1XMKA 3TO6A 3LQQA 3T5XA 2MH9A 4KIGA 3ZMZA 5FTNA 3HOWJ 1B1BA 3ESWB 2P7CB 3QYGB 3G71I 2W25A 1I6XA 3RIRA 2E2IJ 3WVDB 2KRCA 5E3LA 2BJWA 2ZCWA 4L4UA 4PJMA 2RQPA 3SEQA 3U6CA 4XMYA 4A5NA 4EM1A 3D1NI 3HO8A 4HV6A 1XMQM 4BCIB 2COMA 2F5FA 2WV1A 3F5XB 3D8LA 2E1MB 3W2AA 2YFQA 2DK8A 1OYWA 2VPRA 2K9SA 2M8EA 3K7AM 4NSOB 4BQOA 1RZ4A 4HLYA 1OL2B 2ID6A 2VQGA 5GPAA 5L3DA 2TRTA 4G94A 3GFLA 1BIBA 5DV5A 1T2KA 3IV5A 2J7NA 1PJIA 2R92J 2CCHB 3JTGA 1ZMWA 3FK6A 2FMLA 3HHYA 4CH7A 1FJLA 2L4AA 2L3DA 3L2RA 1HLVA 4FX0A 1JKQC 4BCHB 1MNMC 1ZQ3P 2JUJA 1WZ2A 1XPXA 4MIMA 1IV6A 5JI6A 4E7LA 4GRIA 4XBOA 2JUGA 3HGIA 2LBCA 2O5RA 3L25A 3GRRA 1F5QB 3K70C 1TQMA 2XEPA 4DR2M 4AYBN 4U0YA 2R7ZJ 4XOPA 1S6LA 2RDPA 1X2NA 3AL0C 4JX4A 4OR5B 4LLNA 1VOLA 3BQZA 4YELA 1DPRA 2LY1A 3UNGC 3L1PA 1O9KB 3K1JA 1SEUA 5J1YA 5EQTA 2JTVA 2KRKA 3LFKA 3HM5A 3G1OA 3PO3S 2FH0A 4KICA 4FHTA 1YHQI 1H6UA 3S1MJ 2JZ1A 2CUFA 2WAQN 2DT6A 3LSKA 5I5ZB 1YW7A 3PUFA 4UUTA 2KMGA 2OU2A 1FOWA 4RAGA 2VKHA 4C30A 1T33A 1R7RA 3Q3SA 4UVCA 2CFXA 5CVVA 2L6OA 2QDJA 3EJ1B 3JTHA 2GNOA 3CC7I 1IXZA 1O3QA 2GQFA 2JY5A 1J75A 4LB6B 2LR8A 3VEPA 4D7MA 1YJNI 4D5FA 2JXNA 3KVWA 3U60B 3FISA 4GO1A 3B89A 4LIUA 2E19A 4HSRA 3VYRB 3J80K 2MG4A 4KN4X 3E46A 3GZ6A 3GTJJ 1K82A 3LAPA 1PP7U 3GVAA 3K1MA 1LVAA 3ZH9B 3B02A 5JI2E 3GEZA 2QZ8A 4HLXA 2AO9A 2FS1A 5IREB 2L7KA 1DP7P 2K3FA 2O01F 3HBLA 2XGCA 1BR2A 2GWRA 2ZJ2A 2VIXA 2BY3A 3KP6A 4A6DA 1GUUA 4ZTJA 2WAFA 1HKQA 2L01A 4NXNM 2EWNA 2JN6A 3S2DJ 1URCB 2ZXJA 5B1BH 3KSXA 3BXWA 4N9IA 1GO5A 1D0KA 4CHTB 2ZTDA 1B59A 1D3YA 2BY2A 3CCMI 2DVWB 2OZUA 3TMOA 3HOUJ 3SDGA 3GYHX 4E7HA 1AA7A 2AXTC 2W9FA 4DR6M 2M1BA 2K4BA 1XNQM 3HHWA 3HZJA 4HEOA 2CZ0B 3FMSA 3I3LA 2YX4A 2ZPHB 5BMZA 2DZOB 1Y0UA 2ZXHA 4JOMA 4DR4M 1W4MA 2Z9OA 2OV7A 3GLGA 2DT5A 2WADA 1LEAA 4IHTA 4A3DJ 1X4PA 3GQ3A 1FSHA 2V1XA 1K6YA 2IW9B 1AKHB 3WGGA 5LBQA 3PJRA 2FE8A 3LCUA 1T39A 2B9SA 3KDSE 3H35A 2Z33A 1YJ9I 1FSEA 2E7XA 3BZKA 4YHHM 2R7QA 3ZQQA 4B4CA 2OCCH 3L2UA 3LFUA 4M6YA 2KLOA 5IDNB 5J8CA 1TH4A 3ONQA 3PO3J 1D0ZA 3LQRA 2WSFF 1UHWA 3GLFB 3FMRA 3GZNB 3NAUA 4FVMA 5KQ8A 3F6VA 2VUMJ 4B3AA 2BNKA 4AW4A 3TGNA 1ZARA 2LK2A
chains in the Genus database with same CATH topology
4AI6A 2ZPFB 2DPPB 2BS4A 2BS3A 3QWLA 4JX4A 3A8HB 3X24B 2ZZDB 2ZPEB 1AHJB 4HL4A 2QQ8A 4BBSM 3H4CA 4Z6YA 2DD4B 3VYGB 2CYZB 4JX6A 4LOCA 5EJCA 2KMGA 2QF7A 2QDJA 4P17A 2ZCFB 2DXCB 3QYEA 3DL1A 4M6VA 2ZPIB 1E7PA 3X28B 3BG3A 3A8GB 2BS2A 3A8MB 3HHTB 3WVEB 3QYHB 4MFDA 3HB9A 2WJ9A 4QSHA 2CZ7B 2CZ1B 4AKHA 3HBLA 3X20B 4BBRM 4HNTA 2KR6A 1UGSB 3VKGA 1V29B 3QXEB 3X26B 1UGPB 4ZGJB 3BG9A 4OB3B 4HLQA 1UGRB 4NC6A 4JX5A 2ZPGB 3TW7A 1FKMA 2ZPBB 3HZJA 2CZ0B 3QYGB 2AHJB 2DD5B 3KHIA 4HNVA 3WVDB 2ZPHB 4FM4B 4ZGEB 4AKGA 1UGQB 3VKHA 3HO8A 3QYBA 4HNUA 4OB2B 4MFEA 2QFZA 4AKIA 3TW6A 3QZ9B 3A8OB 2QDYB 1IREB 3VYHB 4OB0B 2G77A 3X25B 3QZ5B 2CZ6B 2DXBB 4ELJA 4ZGDB 3BG5A 4OB1B 3A8LB 2D0QB 1QLBA 4MIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFZ A;  3HZJ A;  2G77 A;  4NC6 A;  4Z6Y A;  3QYB A;  1FKM A;  5EJC A;  3QYE A;  3QWL A;  4P17 A;  4HL4 A;  2QQ8 A;  4HLQ A; 
#chains in the Genus database with same CATH topology
 2XUB A;  3K4B A;  3RJP A;  2XSZ A;  1BIA A;  3BHT B;  3DWL E;  5ICE A;  1SFU A;  1QZY A;  2ZAN A;  2TCT A;  4J00 A;  1PVE A;  2EFP A;  2WB1 N;  4RMN A;  4E70 A;  2Z16 A;  5DCM B;  2I7P A;  1FX7 A;  5DUK A;  5BS6 A;  3MZY A;  1EV7 A;  2WMA B;  4CFW B;  4U88 A;  4AZF A;  1SMY F;  4BCG B;  2FBK A;  4W5W A;  3MKZ A;  3HU2 A;  2DA1 A;  3SXY A;  2ZJR F;  4KA4 A;  4F7N B;  2LVN C;  1DPU A;  1W5S A;  2LHG A;  5LLQ A;  5EF6 A;  4CO8 A;  2CQ7 A;  5FD5 A;  2E60 A;  4RB3 C;  2YQZ A;  3HWS A;  2V26 A;  4OWR B;  3A42 A;  4LGW A;  4WXH A;  4RLF A;  5F08 A;  1VQM I;  4I0B A;  1QAO A;  3W3C A;  4IBB A;  4AG6 A;  3CCL I;  5GP9 A;  3CCJ I;  1MSE C;  3H9J A;  3BOQ A;  2A5Y B;  4LFA M;  2KA6 B;  4PT5 A;  4LG2 A;  2XZF A;  1FIA A;  2UV1 A;  4CCO A;  1OR7 A;  5KPT A;  1W7P B;  1E17 A;  3PQK A;  2XHK A;  1VQ8 I;  4S12 A;  1VZ0 A;  5KK1 A;  2FFJ A;  4I81 A;  3HJ8 A;  5CQG A;  5EDN A;  3GTQ J;  1H1R B;  3WHK A;  1TWA J;  2MBF A;  4HZF A;  1UHM A;  3BR2 A;  4KOD A;  1ULY A;  3MZH A;  2K6B A;  3FXJ A;  3L7W A;  1R9T J;  3H1C A;  1WKM A;  2F5O A;  2Q8K A;  2V7F A;  2ZB9 A;  3IH2 A;  1YG2 A;  4Q5S F;  4M9S A;  2MSY A;  3J81 Z;  1XSD A;  3GQ5 A;  1LKX A;  3BRO A;  3I0T A;  5BR8 M;  2UUZ A;  4LJ6 A;  2IN3 A;  4NOO B;  1IJW C;  2J5Y A;  4EOO B;  2DOE A;  2CUJ A;  2LVA A;  5C1B A;  3K2A A;  3U61 A;  4L0Y B;  4IJE A;  3LQ5 B;  2LRD A;  2RGO A;  5BPI A;  5EYR A;  1WJ7 A;  3E4R A;  2DFI A;  3GUD A;  2ZPG B;  4B7H A;  2LVS A;  2M60 A;  3ZMD A;  4CHU A;  1M1E B;  1MMS A;  2ZBK A;  3T15 A;  3GLL A;  2QKL B;  2JP7 A;  1W0T A;  4XN0 A;  2HDD A;  3WTV C;  2Y21 A;  1XHB A;  1MH4 A;  3VFD A;  1QRY A;  2HQA A;  3FKE A;  1F9N A;  4HQM A;  3VYS B;  5FSW A;  1JR3 E;  2JY7 A;  3L29 A;  2KIU A;  1T8I A;  3TN8 B;  2LF8 A;  3RPQ A;  4BAY A;  5JI3 E;  3J7A Y;  3S1N J;  3SZT A;  1LDJ A;  2XRO A;  1FP1 D;  2Y48 A;  3ZQG A;  5EEA A;  3GLG E;  1UFM A;  2H1L A;  1IY2 A;  3KP3 A;  2R7V A;  1IO2 A;  4L78 A;  4DV0 M;  3KP1 E;  3S3M A;  2DFE A;  3PNV A;  1I94 M;  4QOS A;  1G3W A;  2RNJ A;  3G4S I;  3K2L A;  1OCC H;  4EEF G;  1O3R A;  3JAM S;  2X1E A;  5AIP A;  4K0K M;  1WIV A;  1ZTR A;  5LEK A;  1RR8 C;  2UXX A;  2F2E A;  3VDP A;  4JQF A;  3BJO A;  3CC4 I;  4IHX A;  2XLJ A;  4HA8 A;  1W1W E;  3TNI B;  4KHP M;  2C98 A;  1IN6 A;  2IJL A;  2DXB B;  2CRU A;  4REZ A;  2DOF A;  3FF5 A;  4E6K G;  4AWX B;  3DCF A;  2PJP A;  1VI0 A;  1MU5 A;  1SXJ A;  4Z2Y A;  4C2U A;  2ZPF B;  2O3F A;  2EV6 A;  2F5Q A;  4FIS A;  1D0L A;  4BCN B;  1BOA A;  2DPP B;  1MND A;  2FD5 A;  2CJM B;  2C99 A;  2IT0 A;  4C2M J;  5J3L A;  2LF7 A;  2CHQ A;  2A6H F;  2Y0S A;  3UGJ A;  3LA2 A;  1S72 I;  1V54 H;  1V3F A;  3JRC A;  1BN5 A;  1TLH B;  2PI0 A;  3H3V K;  1U9O A;  3AOE A;  5HDG A;  3F22 A;  3DLA A;  1LEB A;  2L7M P;  3FBN B;  1BI1 A;  2MGQ A;  2R7R A;  1YTY A;  2K0B X;  4TV7 A;  3CJN A;  4PFO A;  2LKX A;  1I5Z A;  2ECC A;  3FE3 A;  2EV5 A;  5ACB A;  3DA1 A;  3WE3 A;  2W4S A;  1V33 A;  4L15 A;  3DKW A;  3MJ5 A;  4EJV A;  4A3G J;  2NNN A;  2L4M A;  4F55 A;  2HAK A;  3KZZ A;  3NWT A;  2ZCF B;  3WU1 B;  3L00 A;  1XD7 A;  1XMO M;  4LK1 F;  4XK4 A;  4BY7 J;  2I5U A;  3JR9 A;  4TUW A;  5EP4 A;  4CUG A;  1N4M A;  2Z5U A;  5HDN A;  1MBG A;  2EV0 A;  1WSU A;  2CCI B;  2EZH A;  3HPH A;  1MMA A;  1PUE E;  5KNL A;  1W5T A;  3W6V A;  4OIP F;  2W99 A;  4M74 A;  5IT3 A;  4XLF A;  3SAU A;  3TP0 A;  4ZYH A;  3ROU A;  2IBD A;  5D5X B;  2M5Z A;  2CQN A;  2ZME A;  4DYC A;  2KXE A;  3ERE D;  2WJ9 A;  4PDI A;  3CLO A;  2CMP A;  4QHS A;  1H26 B;  3GPX A;  1RET A;  5TGT A;  2UZB B;  1NG6 A;  1GVN A;  4N0B A;  1E9H B;  3RGS A;  2EFQ A;  4HX8 A;  1VQO I;  5F1R A;  4IBK A;  2XVC A;  4DV3 M;  4XLE A;  2LDU A;  3GLI A;  2ID3 A;  1NNU C;  2CU7 A;  4L5I A;  5H2F C;  1G3S A;  2O0Y A;  4Y13 A;  5E3O A;  1DQU A;  3ZGK A;  2BV6 A;  2JZY A;  2ZFW A;  2R7G A;  3SFI A;  4A3K J;  1JST B;  3V76 A;  5L3C A;  2LRE A;  5LEJ A;  2MYS A;  1YSY A;  3OYI A;  2X8A A;  1MZB A;  4BJT A;  5FKN A;  4YG2 F;  4IHW A;  2G3Q A;  4ZYD A;  1YI2 I;  4PZJ A;  1VQ7 I;  3MZ8 A;  1UGQ B;  3REO A;  3RZO J;  2Q2E B;  3JRF A;  1U8R A;  4XKW A;  3CC2 I;  1IUY A;  2L0K A;  4CCN A;  5DQW A;  4DGW B;  2DZL A;  3TNW B;  3FXO A;  3MKY B;  3FTE A;  3BR6 A;  1PUF A;  2JUC A;  1B4A A;  2R7S A;  3FYD A;  4ANR A;  3NRV A;  2IS1 A;  4YOZ A;  2VI6 A;  1R22 A;  5CVJ A;  2R93 J;  1I4W A;  1BR4 A;  2ZME C;  3VWB A;  3SFZ A;  1XMX A;  5KVR A;  2CYY A;  3FHN A;  3I04 M;  1G41 A;  2R4J A;  2CP8 A;  2F5S A;  2HKX A;  3AG4 H;  3BQY A;  2H5X A;  3DPU A;  4EOL B;  4Q4Z F;  2NAZ A;  4YIR X;  2LXE A;  2O8X A;  3OYF A;  4LF7 M;  1VQK I;  3U6E A;  5D8L B;  4N4N B;  1EH6 A;  4BQN A;  4ELJ A;  3DZD A;  4DV6 M;  3BG5 A;  5EFQ B;  2VBZ A;  2VKD A;  4X1E A;  5B66 C;  4RM3 A;  2JVH A;  4BDZ A;  5IDP B;  2QVO A;  3K8Z A;  1WJE A;  5FTM A;  4XNF A;  2NS7 A;  4YIF A;  3TOB A;  3NBI A;  4Y28 F;  3OWT A;  1R49 A;  1FTZ A;  1WGN A;  1N78 A;  1XGM A;  2N35 A;  5E79 C;  1GHC A;  4L9N A;  3MI9 B;  4L5J A;  2PEX A;  3W67 A;  2NOG A;  4GYG A;  3OS0 A;  2XF7 A;  2OA4 A;  3OOP A;  1JT6 A;  2KZG A;  1KQ9 A;  3WHL A;  2HXI A;  3EPZ A;  4A3E J;  4WP2 A;  1G8P A;  3RKY A;  4ENK A;  4HRI A;  3M7G A;  2WC2 A;  3SAT A;  4UN2 B;  1NO1 A;  4LF8 M;  1JGS A;  2CW0 F;  2M7A A;  4XRF A;  2DD4 B;  3KEQ A;  3ZQ7 A;  2I53 A;  3E9S A;  3OOU A;  1LDK B;  4A3I J;  1IQP A;  1QAN A;  5DS9 A;  2LBF B;  4BNC A;  3JRA A;  4NC7 A;  4II3 A;  2MRO B;  3S1R J;  5B1A H;  2QGS A;  1TNS A;  1K4S A;  1HNZ M;  4AQY M;  4UB6 C;  4AID A;  2XF3 A;  2APL A;  3DKX A;  4DIQ A;  2AQF A;  2G7U A;  3A0B C;  4DQ2 A;  2L7I A;  4I01 A;  4NSR A;  1IZ1 A;  3WTZ A;  4X65 M;  2QKM B;  2W1O A;  1ZKG A;  2W9Z A;  3DTK A;  3ERM A;  3ZXS A;  2GXA A;  3E5X A;  2XV4 S;  3A2K A;  3CCS I;  1NG7 A;  1NV9 A;  2EIL H;  2KPM A;  2BS2 A;  4U7B A;  4QNR A;  2DAK A;  1P4X A;  1GL7 A;  1IDY A;  3ASN H;  3K70 D;  3ABT A;  4CFV B;  5LHG A;  5D5W B;  1P9Q C;  2C5N B;  3HU3 A;  4AU7 A;  2DDB A;  2DPU A;  4MGZ E;  2JRM A;  3EUH C;  2L5Q A;  4IVN A;  1PJQ A;  4A2U A;  4BYY A;  4BBS J;  3U5Z A;  3BG6 A;  2VT3 A;  2F5V A;  2ZAO A;  4BB9 A;  5L3G A;  2VF8 A;  2D7G A;  3VSK A;  1YOV B;  3EUK L;  2GXG A;  3M0E A;  4M0W A;  3LSM A;  1X1P A;  4IBI A;  2GA2 A;  2VF7 A;  1JR3 A;  2NXN B;  5HLH A;  3JRE A;  4UUV A;  3TL4 X;  5HQ0 B;  3FM5 A;  1XDU A;  2DT7 B;  3PNT A;  1UGR B;  2X51 A;  3L27 A;  3T0Y A;  1IFY A;  2F5C A;  4XOT A;  1FKM A;  5HS8 A;  1H4L D;  3GRY A;  4MM3 B;  2MC3 A;  3TDZ C;  4GC5 A;  2CJJ A;  2MH8 A;  3G2B A;  4QPO A;  1DGG A;  3CF6 E;  1FT9 A;  1HW2 A;  3RQI A;  1ZYR F;  4HST A;  5H6R A;  3JR4 A;  4CCK A;  2JA5 J;  2A6T A;  1OFI A;  1N25 A;  4BQA A;  1L2C A;  1HR0 M;  1FP2 A;  3GLH E;  1JR3 D;  2JWT A;  2X9D A;  2E5Z A;  5HOO A;  4FWG A;  4R3D A;  4KYW A;  3I4Y A;  4LF6 M;  2WB1 A;  4RBO A;  2XSD C;  3OS2 A;  3KXE C;  2NVT J;  3P9K A;  2WBM A;  3BP8 A;  2UZE B;  2Z8Y M;  3DOG B;  1MGT A;  3GRV A;  4E4H A;  4EGY A;  3IKV A;  1XTA A;  1XC5 A;  2DFH A;  2R4G A;  4G6T B;  3GTP J;  4V2G A;  3PFI A;  1OR7 C;  4V2F A;  4DBR A;  3A8L B;  4PGG A;  3BOS A;  1S9H A;  1B72 B;  3QPS A;  4CDG A;  5D6F A;  2P6S A;  4F6U B;  3RKW A;  4OGR B;  2VXD A;  3HGG A;  3JRD A;  3GO5 A;  3HOX J;  3F8C A;  5H37 D;  3K0L A;  3GLX A;  5FKL A;  1SD6 A;  2GIZ A;  4CYC B;  4DYR A;  3E6C C;  2PJR A;  2KDO A;  3E6M A;  3A0H C;  4ENJ A;  2MLG A;  1F1Z A;  3H0D A;  5IP7 J;  1FOY A;  1MJ9 A;  1FOX A;  4B3R M;  2K9Q A;  1L8Q A;  3HRM A;  3AV0 A;  1V55 H;  5LQF B;  2BGC A;  2JA8 J;  2CG4 A;  4RAY A;  1U6G A;  2Z99 A;  2XAG A;  2X6X A;  3GWZ A;  2GAU A;  4PJL A;  3FMQ A;  1LPQ A;  4Z6Y A;  1X1D A;  3M1E A;  3ML6 A;  4HEA 2;  2DOD A;  3LST A;  3KS4 A;  4D80 A;  4WK8 F;  4G7H F;  1C9B A;  1TW3 A;  3O0G D;  4D5C A;  4XGI A;  2HQ5 A;  1FMV A;  1UST A;  1FNN A;  1NY5 A;  2GOM A;  1B8I A;  2J5P A;  1P3Q Q;  3C58 A;  1J5Y A;  2E2J J;  3C3E A;  3A01 B;  2K9M A;  2Z4R A;  4DV4 M;  4S05 A;  1NH3 A;  5IYC J;  4LLG F;  2C5V B;  5JHF A;  3RPU D;  1E9R A;  2IW5 A;  3GLI E;  5LMN M;  4RM2 A;  4LFC M;  3CME I;  5LD2 C;  1YYV A;  1Y56 A;  2RGV A;  4WUR A;  2LVP C;  1QGP A;  2ELH A;  1HKT A;  1X3U A;  1B9N A;  2ZXI A;  3TQS A;  4IJF A;  4OW0 A;  1WI9 A;  4FTH A;  3A8M B;  2EUC A;  1ORK A;  4LMY A;  3H36 A;  1TWH J;  2GOX B;  2EFN A;  3CMA I;  1IXS A;  1ZRD A;  5DEQ A;  4DZP A;  5E26 A;  3U2R A;  3U5Z B;  1MMD A;  3A4C A;  4F7S B;  1RU3 A;  3GPP A;  3HOZ J;  1PJT A;  4QPQ A;  4BHP A;  1YLF A;  2IGM A;  4I98 B;  3SYT A;  3FHZ A;  4AUX A;  2HU9 A;  1F4K A;  2WFY B;  4EOP B;  5DNY A;  2QQA A;  4YII A;  3MCZ A;  2A6E F;  5KCM A;  2DMU A;  1MX0 A;  3C3D A;  2R5Y A;  3HHX A;  2XPV A;  2CRG A;  3K9P A;  4ZZD A;  5FD6 A;  4GDF A;  4OB3 B;  5ILV A;  4EV0 A;  2Y0M A;  5TJJ A;  3U21 A;  1CF7 B;  1AD6 A;  4RGR A;  4L9V A;  3E5Q A;  4EAT A;  4EOQ B;  1ORY B;  3AFH A;  2DTZ A;  2O03 A;  1TTY A;  3OTO M;  3ABU A;  3DF8 A;  4IPA A;  4HX7 A;  1VQ5 I;  4AM3 A;  3HRU A;  2AHJ B;  4XOR A;  2OPF A;  2JA6 J;  4FM4 B;  3C3W A;  2XKO A;  1TW2 A;  3AOG A;  3EIE A;  4ON0 A;  4IQ4 A;  3LSP A;  3HJE A;  1F36 A;  4GHL A;  2DO7 A;  4XL9 A;  5GTH C;  4KT5 C;  2WY8 Q;  2KFD A;  3R8F A;  2UXB M;  3BTJ A;  5ICG A;  5EEG A;  1RNL A;  1SXJ E;  2DMT A;  5CYI B;  2BEO A;  1RPW A;  3ZQH A;  4KRD B;  3QQA A;  1IGN A;  1X1A A;  1UNL D;  4MEY F;  3QU3 A;  3BTL A;  3CCV I;  2E71 A;  3Q0W A;  4GIP A;  1MIJ A;  2ZXW H;  1H9T A;  1ZRF A;  1OYI A;  2L7Z A;  2WTE A;  5ED4 A;  2X4H A;  1JT0 A;  2LC2 A;  1P5E B;  1X3W B;  3U6P A;  4PJJ A;  1SD4 A;  4JYA M;  2DJI A;  2BJV A;  3JRI A;  1HW5 A;  2CWB A;  2P6T A;  1BC7 C;  1R36 A;  3SMS A;  1QYR A;  1TFB A;  2E2H J;  3J2P B;  4K2E A;  1UHS A;  4BGD A;  1REP C;  1GVJ A;  1E3O C;  1ZGW A;  3Q9V A;  2BS3 A;  4BAC A;  2EJR A;  3P5J A;  1XSV A;  3CP2 A;  2UUE B;  2ZZD B;  3EOC B;  3BR0 A;  3JCU C;  3F72 A;  4GIT A;  4IL6 C;  2IAI A;  2HKO A;  1G8X A;  3GLF A;  3WG7 H;  3LA3 A;  2QEX I;  1AOY A;  3WG9 A;  1ETQ A;  2VQL A;  4XLA A;  3ZQC A;  3K4C A;  4ZPX A;  3RTR A;  2FF4 A;  3KOY E;  4HX4 A;  4EC8 B;  3W68 A;  1JKR C;  1BU2 A;  3VK7 A;  3H0G J;  2E5L M;  3CQZ J;  1I3Q J;  4LY6 A;  5E20 A;  1NK3 P;  2QSF X;  3A01 A;  3HUG B;  4IKF A;  1JKP C;  1MJG M;  2JSP A;  3I4V A;  3UJN A;  1R5G A;  4PDK A;  2HR3 A;  4ZDL A;  1QBJ A;  2DEN A;  3LW5 F;  1ZV1 A;  4F2L A;  4BUP A;  2A68 F;  1HDD C;  1T6O A;  2C9O A;  3FTC A;  1PGY A;  2QHO B;  3K7A J;  1H89 C;  4HF2 A;  4QNM A;  4JYK A;  3RCO A;  2R7O A;  1WJB A;  2F48 A;  5FGM A;  1YX5 A;  2KDL A;  2QBY A;  3OYH A;  5ITX E;  5FJ8 J;  4WXD A;  2G0E A;  3MKW B;  1W7P D;  3ZP5 A;  4ROC A;  3F6O A;  3M9A A;  4A3F J;  1RUN A;  1J59 A;  2CZ7 B;  3HOY J;  3DDP B;  2UZL B;  1SMT A;  1U3E M;  1RKW A;  3QYF A;  2VOO A;  1YE9 A;  3SDB A;  9ANT A;  2IW6 B;  2Z7J A;  5KO3 A;  3DBR B;  2RNG A;  4BCO B;  4AIK A;  3IEC A;  1KU9 A;  1J0R A;  1MBH A;  2WV0 A;  2CHG A;  1EA3 A;  3GLH A;  1QAM A;  2LTU A;  3EET A;  1AWC A;  1ZEL A;  4JI8 M;  3B57 A;  4ROE A;  1OKR A;  2HPM A;  2EA2 A;  2EA0 A;  3BZ6 A;  2R5Z A;  3GP1 A;  1W7P A;  4M72 A;  1OIU B;  2AQE A;  3GFI A;  1SD5 A;  5M5X J;  2KKO A;  4A3L J;  1PDN C;  3E3V A;  3K92 A;  2HL7 A;  3MD2 A;  1HF0 A;  1UFZ A;  5IT9 Z;  3FDY A;  1Q1V A;  1UMQ A;  5D5V B;  3F0C A;  3LL7 A;  5IPA A;  3PSI A;  1MN3 A;  4KT6 A;  3N4M A;  3J7Z I;  1OQY A;  2BE5 F;  1CQT A;  4ANJ A;  3BJ6 A;  1ERD A;  3BLH B;  1VQN I;  3CDI A;  2XAS A;  5HBJ B;  4LD5 A;  4WWC A;  1DGR M;  4IOC F;  1N33 M;  4EM2 A;  3CJT B;  4KT0 F;  4PSW A;  3H4J A;  4X66 M;  3TOA A;  4II2 A;  4FQG A;  1DP3 A;  1PKD B;  3G3Z A;  4AKI A;  2Z3X A;  4CGZ A;  2E7W A;  4M3E A;  3S93 A;  2IEK A;  2W84 A;  4A12 A;  1HBX G;  3S2W A;  4OB0 B;  1VTN C;  4XKC A;  4BHB A;  3PVS A;  4ELL A;  3CDL A;  3MMY B;  2QCO A;  1U9N A;  4QOZ C;  1Y1V J;  2K02 A;  2Y0S N;  2RRE A;  1JXS A;  2WIP B;  2FA5 A;  3KET A;  3VFZ A;  1ETV A;  2KIM A;  2QPA A;  1OIZ A;  3QHW B;  4IHV A;  2PMZ A;  4X64 M;  1G3T A;  2H6C A;  2MD5 A;  2OBP A;  2XGD A;  3DQV C;  2W24 A;  1I1G A;  4IRG A;  3OYE A;  1FOK A;  3RE8 A;  5D4S A;  2KEB A;  3J7A S;  4AI6 A;  5F3W A;  3BG7 A;  2BWB A;  4IHS A;  4QWQ A;  2R5Y B;  2QM3 A;  1I1S A;  1X58 A;  1JJ6 C;  2QCU A;  1A6Q A;  4UUS B;  2BXY A;  5L3E A;  5IT9 S;  2WSE F;  4GGG A;  1CF7 A;  1ITY A;  4FCT A;  4ESB A;  4WXC A;  3SHG B;  1SC7 A;  2C6T B;  1BBY A;  2E1M C;  2PMU A;  3I71 A;  4FWH A;  4LJ9 A;  2D45 A;  1OKW B;  3H4C A;  3PL8 A;  4PFP A;  5C4X J;  1BM9 A;  3U9G A;  4F93 B;  1D5Y A;  3K2Z A;  1DGH A;  2JRT A;  3QP5 A;  1IBM M;  4LF5 M;  2VQC A;  4XLP F;  2CYZ B;  3ZRG A;  3KCC A;  1ZG5 A;  2P5K A;  1W98 B;  3UMM A;  5ICF A;  2KNZ A;  5DD4 A;  2ZSI B;  3EUA A;  3BR5 A;  3PM1 A;  4YFN F;  3JAM Z;  5LHI A;  4R79 A;  2C4G B;  4RLQ A;  4XSX F;  2DA4 A;  3CCQ I;  4E7K A;  2NOJ B;  4DBG B;  4NB5 A;  2VOD A;  3RFW A;  2VJI A;  5FRM A;  1E0E A;  1VYW B;  2LYC A;  5H6Q A;  2H1K A;  1MSF C;  3HKP A;  3SAW A;  3TED A;  1UEL B;  2EZK A;  3IWZ A;  2DA5 A;  3DTO A;  1G6N A;  1GVD A;  3V8K A;  4LRT A;  3QRF F;  4BCJ B;  2BHY A;  3NEU A;  5FO5 A;  1TBX A;  2L09 A;  3I64 A;  3MHV C;  4M3D A;  2UWM A;  2LMD A;  2FUG 2;  3PUB A;  1DGB A;  2QSH X;  3BTC A;  1WJ5 A;  3GFJ A;  1H25 B;  1HDP A;  2NRA C;  1TR8 A;  3PFY A;  3SAR A;  5IWA M;  1R4N B;  1AUA A;  1I27 A;  4MH0 E;  2EZI A;  3KS8 A;  3OIQ A;  4MGY E;  5E3N A;  3OYM A;  4A3M J;  1B8I B;  5K5R A;  1IN8 A;  2MA3 A;  2NNY A;  2YR0 A;  2Z2S B;  3BPX A;  4NXM M;  2PQ8 A;  3IWF A;  4M9Z A;  3DTE A;  3WU2 C;  4P55 A;  4YRV A;  1SD7 A;  1VFC A;  1V29 B;  3KYD B;  3LA7 A;  4LK0 F;  4I99 C;  3X26 B;  1JGG A;  5ITT A;  1OCT C;  2M9H A;  3S17 J;  2V22 B;  2Y9Y A;  2R6F A;  2GM4 A;  3S2H J;  4G6D A;  3WOD F;  2XRL A;  2IW8 B;  2DMQ A;  1KFV A;  1E94 E;  2YSR A;  1ETO A;  1TGU A;  4F7Z A;  3E5U A;  4Q7J A;  3E21 A;  3BHU B;  3HOT A;  2L2O A;  2HNH A;  1WRJ A;  2CSO A;  4RGS A;  4I5S A;  5F0C A;  2DAM A;  2CV1 A;  2HTJ A;  2VJ4 A;  3KLN A;  4FX4 A;  1G59 A;  3A1Y A;  3RI4 A;  1K79 A;  2KZS A;  3KEY A;  4Y17 A;  4OB2 B;  1DGF A;  3FTD A;  4KNY A;  4MFE A;  5ICP B;  1VQ1 A;  5C4J J;  2QBY B;  2X48 A;  1WGL A;  4GH9 A;  2D5V A;  3VOE A;  3A8O B;  1BJA A;  3TWM A;  3OSG A;  1WJC A;  1ETK A;  1WPK A;  4JI1 M;  1RKT A;  3FM3 A;  1Z5B A;  4EVI A;  4YFX F;  4JXJ A;  5FKO A;  1JSU B;  5L2W B;  1LNW A;  1A6I A;  2ISY A;  1ZG3 A;  4RGU A;  3AAF A;  1Q02 A;  1Y8G A;  4A0X A;  1WH5 A;  5HNH A;  4ZJZ A;  1SVO A;  1KU7 A;  3G1M A;  2V79 A;  1F5T A;  4I2O A;  4ZGD B;  2EPF A;  5HNF A;  5J4Y A;  1J09 A;  3J81 S;  2ME0 A;  3OYN A;  2X49 A;  3TPZ A;  2QWW A;  4UV8 A;  1J7K A;  2DAO A;  3HUG A;  1JE8 A;  4GFB A;  1ZGA A;  5B3S H;  1UNH D;  2M8G X;  1GH6 B;  2LW4 A;  3GTG J;  3NQO A;  1J2X A;  4FCV A;  4HQE A;  5CPR B;  2CQK A;  5DYG A;  4UUS A;  4PSX A;  2F5D A;  3N05 A;  4HV5 A;  4CZC A;  1HNX M;  3H3U A;  1WCM J;  3KZI C;  3SQN A;  4BEH A;  4J19 A;  4FT8 A;  1XG1 A;  2MD0 A;  5E17 F;  1VEG A;  4FE7 A;  3KP2 A;  1C7Y A;  2VPL A;  5FTK A;  4BCQ D;  2R7X A;  1Z05 A;  3JAM K;  5D4R A;  2LY2 A;  4NST B;  4F7J B;  1A35 A;  2R62 A;  3BLY A;  3OL4 A;  4G4N A;  4PCQ A;  3CCR I;  1G2H A;  3HOV J;  4EOM B;  1ON2 A;  5FTL A;  1LE8 B;  1YW9 A;  3RGF B;  3B73 A;  3QAH A;  1OGU B;  2FMY A;  4JI7 M;  1Z3X A;  2Y69 H;  5EP1 A;  1IRF A;  2UXD M;  4W97 A;  2DXC B;  4CIS A;  3QYE A;  3BDD A;  3DL1 A;  4D0P A;  1JUP A;  5KPZ A;  4BCK B;  3ISP A;  4IRI A;  1KQ8 A;  4OMZ A;  2K7L A;  2VE8 A;  1QO0 D;  2DWZ B;  3VOD A;  4D81 A;  4EOR B;  1D0M A;  1XB4 A;  3IC7 A;  4OAY A;  1T56 A;  2XSJ C;  1SVL A;  3R6S A;  1X19 A;  4EOS B;  2OJE D;  2YUS A;  5F0H A;  3DBH B;  2XRN A;  3WTW C;  3DJB A;  3I9V 2;  3B9P A;  1U2W A;  5HNB B;  2PHG A;  2OD5 A;  4II7 A;  4PGH A;  4YY3 M;  1IRG A;  1IW7 F;  1NNJ A;  2E1N A;  5ITY A;  3DEU A;  1OIP A;  4MGK E;  1XO2 A;  3K1P A;  2O8K A;  2BW3 B;  4A3V B;  3O8H A;  4HNT A;  2C5X B;  1QHG A;  2VC0 A;  3FKJ A;  2FQ4 A;  1EKE A;  2FSW A;  3I56 I;  3QXE B;  4HNV A;  1NHG C;  2NVQ J;  1ONV A;  1JKO C;  2Q1Z B;  2HWV A;  1IG7 A;  3QAU A;  3RZD J;  1NJG A;  3UKG A;  3DFZ A;  2L4E A;  3KPH A;  3Q9S A;  2FEZ A;  1UG0 A;  4L9T A;  3HJQ A;  3LVW A;  4AYB A;  3GTL J;  1FC3 A;  2EO2 A;  3B74 A;  4BHC A;  2VQF M;  2FOI C;  2PK9 B;  4LJ8 A;  5BOX A;  3S14 J;  1S7E A;  4LJ4 A;  4Y72 B;  1R1V A;  3LSG A;  4UHT A;  4NRV A;  3S3O A;  2OO9 A;  4EC9 B;  1L1Z A;  3CP8 A;  1D2N A;  3RQ4 A;  2DTR A;  3QYB A;  2LVO C;  2QYO A;  2Y31 A;  3OMY A;  3PIP F;  2R7U A;  1ENW A;  1TWF J;  3A45 A;  1VQ9 I;  1R2Y A;  4XN3 A;  2HDW A;  3O6B B;  3CCE I;  3DKY A;  2K4J A;  1YIJ I;  1Z3Y A;  2HOT A;  4BXX J;  4LGM A;  2DZN B;  4IBE A;  1A36 A;  4BBA A;  3D5L A;  4WW0 A;  2DA6 A;  1RIO H;  2P8T A;  1R2Z A;  1Z91 A;  1UCR A;  2ZKZ A;  2IGN A;  5F04 A;  2M4G A;  1Z77 A;  5A2Q Z;  5GAH J;  3F92 A;  3QHR B;  3MVP A;  1SXJ D;  2CV0 A;  4R8H A;  3GTM S;  2IGK A;  2DAG A;  3I4N J;  5HBE B;  3FKI J;  3CUQ A;  2V1U A;  2GA1 A;  4GKJ M;  4B09 A;  1YRN B;  2H8W A;  2D0Q B;  2Z1D A;  2YU3 A;  3G1L A;  1XN7 A;  1LDD A;  3HRT A;  4W1U A;  5FLX S;  4BL0 B;  4DJA A;  5K7H A;  4L9J A;  1XXH E;  2LTP A;  3HL2 A;  1H8A C;  3KSJ A;  2JQ7 A;  1ACI A;  4F91 B;  2HWJ A;  2GBY A;  3H9G A;  1IN4 A;  4XR6 A;  3VSL A;  5TRD A;  5KPR A;  4A69 C;  5EP2 A;  1YS6 A;  2DOA A;  2ZJP F;  3E6D A;  4RF1 A;  2W7N A;  3CF5 F;  1QA6 A;  1GXQ A;  2HCB A;  2EIJ H;  3CCY A;  4DR1 M;  2VXZ A;  3K69 A;  1ETW A;  5HVQ C;  4RB1 A;  2LOO A;  5FTJ A;  4BCM D;  3VLF B;  4ZH4 F;  1NVM A;  3A98 B;  3D0S A;  4NC8 A;  1WGX A;  4IQJ A;  3BZC A;  3S32 A;  2ZME B;  3EQL F;  2XFS A;  2P5L C;  2MLK A;  3G73 A;  3WTT C;  2HI3 A;  3CTA A;  2GLO A;  5D6E A;  2WPA B;  3E1S A;  1IRX A;  2CO5 A;  1VDL A;  1FYK A;  1QUT A;  2V1D A;  4JP0 A;  3V7S A;  1R6B X;  4EGZ A;  4M6V A;  3ZMS A;  3HSF A;  3LVV A;  4D7N A;  4HF0 A;  5IHY A;  1APL C;  1TZL A;  2LVQ D;  5E18 F;  3S15 J;  4V19 K;  1ZAO A;  5B5E C;  3R4K A;  3IRR A;  2NVY J;  2CS3 A;  2C6Y A;  2G9X B;  1S5L C;  1TDH A;  2L9R A;  3HHT B;  3B7Z A;  3IP4 B;  1LVK A;  3QYH B;  1NK2 P;  2FNP A;  3CMM A;  3IRQ A;  3HB9 A;  3QP6 A;  3BJA A;  2ISZ A;  2FJ1 A;  2NS8 A;  4CJ6 A;  4HDV A;  1D1C A;  2QZ4 A;  2D7H A;  1LJ9 A;  1OFH A;  4JI5 M;  2BZT A;  4CFX B;  2KRF A;  1DO0 A;  1W36 D;  1XGN A;  3F3X A;  2L02 A;  2KHH A;  4BEH B;  2KR6 A;  4EON B;  2UUA M;  4PK4 A;  2OZ6 A;  1SXJ C;  1UGS B;  5EXP A;  3POM A;  1IUF A;  5HVY B;  2XAJ A;  1UGP B;  1WVR A;  2V9K A;  5DQV A;  3U1D A;  3J80 S;  3NDQ A;  1R1U A;  3Q8G A;  1TT0 A;  2M4K A;  2B63 J;  1EF4 A;  1FTT A;  1Q3C A;  3HYI A;  1P6R A;  1Y8Q B;  3K6G A;  2QQB A;  2V9V A;  3TW7 A;  4PJN A;  4S0H B;  2HQN A;  3KLO A;  4M3B A;  4KMU X;  4M71 A;  4UV9 A;  1K6O A;  2LKS A;  3K4K A;  3ZQL A;  1H0M A;  1KYZ A;  4H0E A;  1AU7 A;  2HDC A;  2PG4 A;  1GV2 A;  3OIO A;  4RB2 C;  3CDH A;  2A07 F;  4NDL A;  3IH4 A;  2MFZ A;  2LNB A;  4B3T M;  2ESN A;  5CKT A;  2QSG X;  2M3A A;  4LFU A;  1Z7L A;  1MNE A;  3LSI A;  4HNU A;  5CLS A;  2XAQ A;  1BW5 A;  3DLL F;  2JPB A;  5F27 A;  2LD5 A;  3QZ9 B;  2OCE A;  1X2M A;  2UU9 M;  2QDY B;  3C1D A;  2HOE A;  3LNQ A;  4R71 A;  3GPY A;  3ASO H;  1G4A E;  3BR3 A;  3CUO A;  3E7L A;  3GW2 A;  5AIQ A;  2X6Y A;  1BL0 A;  5GAG J;  4KIT B;  1OIY B;  2PJR B;  1KGS A;  3QZ5 B;  2F5P A;  2RQQ A;  2WEV B;  4OU7 A;  4XRM A;  2IRF G;  3ELK A;  4PUS A;  2XGX A;  3FBI B;  2VBX A;  2F5N A;  4I6Z A;  3M4O J;  3B7Q A;  1D0Y A;  3GZ5 A;  2CQX A;  2HFH A;  4FX3 B;  1Z0X A;  3CLQ A;  2R18 A;  4IO9 F;  3ECH A;  1IY1 A;  4PCZ A;  3QWL A;  1V4R A;  2FBH A;  1OL1 B;  1K78 B;  1MMN A;  3J7A O;  1DU6 A;  3I54 A;  3X24 B;  5DYI A;  2XF5 A;  4HYE A;  3DOA A;  1LV7 A;  1WJD A;  3VDX A;  5F6F A;  4ESF A;  3HOS A;  5ITX A;  4GYI A;  4ASN A;  3U6D A;  2X1C A;  3DEW A;  3CCU I;  3CJR B;  3DBL B;  5DM7 F;  2KRH A;  2E36 A;  4P9F A;  3BBZ A;  1P4W A;  3BR1 A;  4ITV A;  1R4M B;  1OAI A;  5FFX A;  2X6O A;  4P17 A;  4XLH A;  5E1W A;  2R4E A;  4IBC A;  3RYR A;  2ZNZ A;  3W6K B;  2VL8 A;  4A93 J;  3E0J B;  3OYC A;  2IS4 A;  3I53 A;  3LWF A;  2MW8 A;  1BW6 A;  3ZMU A;  2H27 A;  1E7P A;  1ZLJ A;  3O3K A;  3ZN0 A;  1KU3 A;  2VAS A;  4EQQ A;  3HPG A;  1KZH A;  1O3S A;  4XBF A;  1GDT A;  3F8B A;  2R7D A;  6PAX A;  1OJL A;  5GPC A;  3OR2 C;  1DDN A;  4BJ5 C;  3WVE B;  3M8F A;  2CW7 A;  3J81 K;  1D0X A;  3IH3 A;  4LJ7 A;  1TC3 C;  4CZZ A;  2OPT A;  2DQL A;  3TP3 A;  4MTD A;  5DDG A;  1TQI A;  4LF9 M;  2ZFU A;  3K1N A;  2KIS A;  2DXI A;  1WJA A;  1H1S B;  1D1A A;  4OU0 A;  1MD0 A;  4EOK B;  1R6R A;  3M3Y J;  5M3M J;  4NL4 H;  4LF4 M;  1TD6 A;  4CFU B;  2PN6 A;  2VN2 A;  2DA7 A;  3TWL A;  3SAS A;  3B6C A;  2ACJ A;  1MDM B;  1YRN A;  1ZH5 A;  2BKZ B;  3L26 A;  4ENM A;  3K4M A;  5ITR A;  4C3J J;  3U6L A;  1Y6I A;  4GC9 A;  1V5E A;  2L9V A;  2XIG A;  5ILU A;  5L8R F;  4F52 A;  1H27 B;  1HW1 A;  4JI0 M;  3CES A;  2KW0 A;  2D7E A;  2WA0 A;  2DNA A;  4BQQ A;  1JOW A;  3ABM H;  4B7F A;  2BHZ A;  2EKF A;  2DME A;  5KAI C;  4G6Z A;  2UZD B;  1IM2 A;  2PMH A;  2XAU A;  4ZYE A;  5J40 A;  1AHD P;  2KIF A;  2OAZ A;  4LJ5 A;  2VII A;  2H94 A;  5DTD A;  2NVX J;  3S1Q J;  5IOZ A;  3AOE C;  2LLK A;  4M3G A;  1T38 A;  4IBJ A;  2Y20 A;  4XSZ F;  5IP6 A;  2DD5 B;  3KHI A;  3GLI B;  3AG2 H;  2KZV A;  2YPR A;  3GX4 X;  3GLH B;  3AJI B;  2P81 A;  4BLC A;  5IOY A;  3KX2 A;  1G3Y A;  2Y2Z A;  2HGC A;  2G7H A;  3GTO J;  3FK7 A;  4X6A J;  1B72 A;  1XMA A;  4KJZ A;  4MGR A;  2WY7 Q;  2NVU B;  5LMU M;  3IHP A;  3ZMV A;  4A3B J;  3HEF A;  1JJ8 C;  2QP9 X;  1F43 A;  3WHC A;  2UXN A;  2WIH B;  5FLV A;  2WMB B;  4BH9 A;  1ZGJ A;  4UXN A;  3OSF A;  5DYM A;  3SMP A;  1V34 A;  1QUS A;  1JHF A;  1YX3 A;  2OUM A;  3IUO A;  1YIO A;  2A3S A;  4LG0 A;  3V8L A;  1VEK A;  3L28 A;  2F4V M;  5EP3 A;  1KSF X;  1LFB A;  4R1H A;  4B3X A;  2EIM H;  2I7N A;  2DWN A;  2XB0 X;  5LRR A;  1JB0 F;  2QUF A;  4IF4 A;  4CFM B;  2H1R A;  2V6Z M;  1QAQ A;  4U87 A;  1QVR A;  4QHT A;  4ZYG A;  4OB1 B;  1QHH D;  2VDB B;  4ITQ A;  1R23 A;  1QLB A;  1RRJ A;  1UZC A;  3ABL H;  5M5Y J;  4DR5 M;  3ZQJ A;  4CCJ A;  2W85 A;  4MQV A;  5ILS A;  2XH9 A;  3I55 I;  2ZJQ F;  1FBQ A;  1FEX A;  1Y0N A;  1V5G A;  2Y75 A;  1ZR4 A;  2BS4 A;  1T98 A;  1O4X A;  4M73 A;  2R44 A;  3QU6 A;  1IDZ A;  3L2C A;  2ETH A;  2X6W A;  1QNT A;  3FUX A;  2STW A;  1IY0 A;  1VIN A;  3QPH A;  4G4R A;  3S16 J;  5K5O A;  4BBS M;  5CVR A;  4WCG A;  3SC3 A;  2O61 A;  3I4P A;  3EID B;  2DYR H;  4E7S A;  1R4G A;  2XF6 A;  2R0Q C;  1HC8 A;  1GUX B;  4AG5 A;  1H24 B;  3FXK A;  1W0U A;  2XZU A;  3VYT B;  4PDG A;  2J5O A;  4OVZ A;  3FD9 A;  2NQ8 C;  1RUO A;  2XPU A;  1NV8 A;  3V42 A;  4DOZ A;  4FWD A;  1EJ9 A;  3UZU A;  2VT2 A;  2DCE A;  3U6S A;  5LHH A;  3FUW A;  2CWE A;  1O7L A;  3W2V A;  1SXJ B;  3N97 A;  1D8J A;  4LFB M;  4P1W A;  3W0F A;  1FZP B;  2BPM B;  5E3M A;  2M30 A;  4MNU A;  1CGP A;  4X62 M;  2B0L A;  3MAJ A;  3TO7 A;  3HY5 A;  4I4L A;  1YQA A;  2R7F A;  4KIS A;  3KW6 A;  4KN7 X;  1NJF A;  4OMY A;  4ENN A;  4LJA A;  8CAT A;  3R9X B;  4A0Z A;  3GPU A;  4BE0 A;  1GY3 B;  1H88 C;  1P92 A;  4FCY A;  3J7Y J;  3CGW A;  2KIQ A;  3I5U A;  4R7G A;  2G8L A;  3THG A;  3I51 A;  2M5W A;  3NAR A;  3Q0V A;  4KUM A;  5ERI A;  2PJQ A;  1QDR A;  2ZO4 A;  1J9I A;  3L2V A;  1MW7 A;  3H4M A;  1LUJ B;  3T8R A;  5ICC A;  3VDU A;  4YEJ A;  4RNA A;  1X1B A;  1PJR A;  4QLC U;  2OOA A;  5IY5 H;  1K61 A;  1MMG A;  1E2X A;  4KO8 A;  2LY9 A;  3OL3 A;  4CGY B;  1ETY A;  4L16 A;  4FCW A;  3FWE A;  1K78 A;  2KZU A;  3H3Z A;  2PK2 A;  1Y39 A;  1JHH A;  1HKS A;  3HJS A;  2IGO A;  1FBS A;  3HKZ N;  4HAM A;  2FBI A;  3SYK A;  2M2E A;  3W0L B;  4NRW A;  2QNJ A;  3WHB A;  4A6E A;  1XXH B;  3U61 B;  2A05 A;  2H6B A;  2L7F P;  2JGZ B;  2P7V B;  2AS5 F;  1O7F A;  1Q1H A;  2K9D A;  1P7J A;  2DU9 A;  3V8J A;  5BPV A;  4UNO A;  3S8P A;  2COB A;  2EFO A;  4IX7 A;  1VND A;  2L7H A;  4B1R A;  3O8G A;  3OY9 A;  1A5T A;  2W82 A;  2B7E A;  1QZE A;  4BXF A;  4G4O A;  1BC8 C;  3B7N A;  1T3T A;  1HT2 E;  2WAQ A;  3CF0 A;  1OFC X;  4Q48 A;  1Z6R A;  3PIO F;  1QPI A;  2C5O B;  4IMY B;  5IYD J;  1TT5 B;  1B9M A;  2XSZ D;  2PMZ N;  4LIV A;  3T8T A;  3CO6 C;  4DBQ A;  2Y30 A;  2EUF A;  1G3N C;  1P7I A;  1U5T C;  4UN0 A;  2L54 A;  4ETS A;  5CEI B;  5HLI A;  3KIO A;  4WX9 A;  1Z5C A;  2EJS A;  3HXL A;  1OKV B;  1N34 M;  3F8N A;  1I3A A;  2GZW A;  2HS5 A;  1R5L A;  3DU5 A;  4D1Q A;  5LMK B;  2M87 A;  1HA8 A;  1SFK A;  5JHU A;  4YOO A;  2KDZ A;  4G7O F;  5K1Y A;  2XC7 A;  3GO8 A;  2QLZ A;  2LH9 A;  5F1J A;  3BTI A;  1L1T A;  5DM6 F;  1PJS A;  4CFN B;  4BY1 X;  2BVL A;  3P9C A;  3MIA B;  3AL0 B;  5K7F A;  1WH7 A;  3OR1 C;  1KYI A;  2JZ0 A;  2Q2E A;  1GXP A;  1B6A A;  3V7C A;  2O6G E;  2M0C A;  5LRS A;  3T1B A;  1IXC A;  3NWL A;  3KP7 A;  3NWS A;  2MH2 A;  4BXX X;  3HG9 A;  4RF0 A;  1IV8 A;  2K86 A;  4WF2 A;  1GLN A;  1UJ8 A;  2QGU A;  2DWM A;  3HTS B;  3FXR A;  1ENH A;  4GHA A;  2FX0 A;  4EJT A;  4JBA A;  2L9N A;  3M8E A;  5L3F A;  4C3H J;  3R61 A;  3ZQI A;  2UUC M;  1MH3 A;  3FTF A;  1BJZ A;  5EGO A;  1LQ1 A;  3SYL A;  2HZT A;  1CUK A;  2BY0 A;  1A31 A;  5FRO A;  1WHC A;  3FUV A;  3KOW E;  2CV2 A;  2Q0O A;  1NHW C;  2IA2 A;  1NSF A;  3EYY A;  4O6J A;  1MDM A;  1VDD A;  1C0W A;  1V92 A;  2KNV A;  1WI3 A;  3DDQ B;  3OYJ A;  3OYL A;  5LGT A;  4UVA A;  3HGY A;  2FU4 A;  3G33 B;  3A03 A;  1TH3 A;  5LGU A;  3KFU G;  1A5J A;  2PMI B;  4L8R C;  5M3F J;  1C1K A;  1QQW A;  5DUI A;  1U8B A;  4UY8 I;  5HDK A;  1TNT A;  2GXB A;  4NHJ A;  1FMW A;  1H1P B;  3GQ4 A;  4E7Z A;  2HKJ A;  1G71 A;  2UUB M;  4XKB A;  3K10 A;  2VE9 A;  4CXA B;  3ZN1 A;  2RV8 A;  4RGX A;  2F6C A;  3FRH A;  2KP6 A;  3SBJ A;  1P4A A;  4F92 B;  3LAJ A;  2LSO A;  5AON A;  4ZC3 A;  4Z8X A;  4Y4R A;  5IP9 J;  2FE3 A;  4BBR M;  5LFA A;  4CXF A;  1MBE A;  2DA2 A;  3TO9 A;  2ERC A;  1QMZ B;  2IXS A;  5C44 J;  2VKE A;  1GKI A;  2VON A;  1YIT I;  1BI2 A;  4G8X A;  1DO2 A;  5K7Z A;  3H5A A;  3MY5 B;  1RES A;  3MWM A;  1TL8 A;  1IBL M;  2MAB A;  3DU6 A;  1U5T B;  1L2B A;  1IN7 A;  4I8O A;  3A02 A;  4LG0 B;  1Z5A A;  1FLI A;  1XX5 A;  5EZG A;  4C9Y A;  3JSP A;  2CEA A;  4NC6 A;  2DMP A;  2VB6 A;  2W57 A;  1JTY A;  3KP0 E;  2JVG A;  2V9P A;  4P16 A;  5IYB J;  4NQW B;  1HST A;  3MY1 B;  3HHZ A;  1S7A A;  1PJJ A;  2E1C A;  5E8G A;  1X37 A;  2O9L A;  1PM5 A;  1VG5 A;  1D1B A;  5M5W J;  3MKL A;  2NS0 A;  2DN0 A;  2W2H A;  4LIT A;  4GXO A;  4BDY A;  1GJS A;  2X4A A;  1T43 A;  2YU9 J;  1MKM A;  1LE8 A;  3H9Q A;  3IAM 2;  1AIP C;  1L2D A;  4B8X A;  1PRB A;  2LHC A;  4XLN F;  1OLT A;  4HPQ A;  2E5N A;  2V1C A;  3U60 A;  2BY1 A;  3KOZ E;  2E34 A;  3TE6 A;  3TW6 A;  2DA3 A;  2FOK A;  3W2W A;  2JA2 A;  4IOA F;  1T6S A;  4IRH A;  3GXO A;  4RKU F;  4AD9 A;  5HLG A;  2Y0T A;  4LCB A;  2JNH A;  2EK5 A;  2X85 A;  4OIR F;  4IIW A;  5EG0 A;  1OIS A;  2BXZ A;  2KT0 A;  3SZG A;  5TIS C;  1STZ A;  2ICW G;  2CFO A;  1ZHF A;  3OYG A;  4E7J A;  1SFE A;  3OIP A;  4HBL A;  1SFO J;  3KP4 A;  3PQJ A;  1JUM A;  2IVX A;  3LCV B;  1POG A;  3F9K A;  4MTE A;  5BNG A;  3DP7 A;  3FYC A;  2K3P A;  1XXH A;  3M8J A;  3F8M A;  1J5E M;  1BA5 A;  2EA4 A;  4PJ0 C;  4X0G A;  5E8I A;  3BLR B;  2LP0 A;  2RKH A;  2BW3 A;  3EDP A;  1XSX A;  5HBH B;  1DV0 A;  4XKV A;  1IBK M;  1HXD A;  2I10 A;  3L2A A;  4EMS A;  2WHB B;  1XCB A;  4G12 A;  5KAF C;  1IXS B;  3QOD A;  1O57 A;  4CIC A;  3VYG B;  1WXQ A;  4N4O B;  1KON A;  3TWK A;  1MJA A;  2JA7 J;  4ROD A;  5E1Z B;  3U6O A;  1FBU A;  1L0O C;  4GEW A;  1K3W A;  1HQC A;  3T38 A;  2HVQ A;  3JRB A;  3IAS 2;  5F0F A;  3LOC A;  2DKL A;  4FD2 A;  4ZYA A;  1WFX A;  4MLO A;  3RYP A;  2A61 A;  3ILK A;  3HIF A;  3OYK A;  2WXV B;  2ZPI B;  2ESH A;  1SAN A;  4BKX A;  3X28 B;  2K40 A;  5KHD A;  4I02 A;  4BCP B;  5DD8 A;  2VC1 A;  4KMF A;  3BLQ B;  4N9H A;  3E6B A;  2VQH A;  3LSH A;  1XC8 A;  5EEH A;  5JLW A;  3KFW X;  1UM8 A;  3AKZ A;  5EXS A;  1Y8R B;  3JW4 A;  2K47 A;  4OX9 M;  5FLX Z;  5CQE A;  1ZMU A;  2R3S A;  4GCV A;  4BCQ B;  3C18 A;  3ULQ B;  4CCL A;  2OF7 A;  1TTE A;  2AHQ A;  1Z9C A;  4EOI B;  3I59 A;  1IAW A;  3KEO A;  3COA C;  3PO2 J;  3RPU A;  2XGE A;  3WE2 A;  5H20 A;  1WR1 B;  3ZMT A;  3CD6 I;  3T6P A;  1OI9 B;  3I58 A;  1Z21 A;  3IL2 A;  3AG1 H;  1ZAE A;  4RS8 A;  3CUQ B;  3X2Q H;  4A0Y A;  4B44 A;  1ZR2 A;  1RR7 A;  2C5R A;  3X20 B;  2F2C A;  2HOS A;  2Y0Q A;  2VQE M;  1LFU P;  3VKG A;  3IG5 A;  1XCV A;  2XGN A;  5JLX A;  3L09 A;  4HF1 A;  3WTX C;  1Z7U A;  2V4J C;  3GRU A;  4ZGJ B;  2DMN A;  4LJZ F;  3KE2 A;  2DQR A;  4IHY A;  1ZK8 A;  2ZC2 A;  3H5R A;  2AXL A;  3GFM A;  4KFC A;  1XWI A;  2VJ5 A;  3Q5F A;  2O7O A;  4F6W B;  4ZDP A;  4OIQ F;  4YC3 B;  2XDV A;  3I4M J;  4AIJ A;  1BOB A;  2D2W A;  1E32 A;  1I50 J;  5EZH A;  4ZDO A;  2ZNY A;  5IT9 K;  3JR5 A;  3VKH A;  1DGW Y;  1X4O A;  4I76 A;  2W96 A;  3KOX E;  3JRH A;  1OPC A;  5EGO B;  3BHV B;  1OCR H;  1XGO A;  2R5Z B;  1R00 A;  3EUH A;  1QVU A;  2EB7 A;  1Z6T A;  1MBJ A;  4F6S B;  2AHM A;  2P5V A;  5D8K B;  2LFB A;  1FIP A;  4C3I J;  3B6A A;  3DEE A;  2V6C A;  3FZV A;  4IEJ A;  4AVZ A;  1Z67 A;  5BPD A;  1QZM A;  3CZ6 A;  4UVB A;  3VYH B;  2CE7 A;  2KQR A;  1BR1 A;  3IG8 A;  4XM3 A;  2XKP A;  4XID A;  3QOP A;  2BOL A;  3FUU A;  4P5O A;  1JQJ C;  5EG0 B;  1AIS B;  3NBX X;  4ZZL A;  3U6M A;  3T1H M;  2RKO A;  1FWZ A;  3BWG A;  3K9T A;  2Z3Y A;  3M03 A;  1EFU B;  1E3P A;  3OYD A;  2HEO A;  2FNA A;  1YO5 C;  4DUZ M;  3RKX A;  4G9Y A;  4DNC A;  4BY1 J;  4BS9 A;  2JJ7 A;  3M1C A;  2H09 A;  2LWX A;  3CO7 C;  2IA0 A;  4LZZ A;  4RA2 A;  1SFX A;  1ZRC A;  4L18 B;  4EJW A;  2CQQ A;  2K9L A;  2R45 A;  3GF2 A;  2LH0 A;  3BY6 A;  1GAB A;  1U78 A;  1WQ2 A;  3DPT A;  3KZY A;  3VPR A;  4B47 A;  4D82 A;  3LMM A;  1T0F C;  2PFB A;  2ZPE B;  3ZC7 B;  5K5Q A;  3M6A A;  3MN2 A;  4HL4 A;  3KYC B;  3MEX A;  1TH2 A;  3LSJ A;  4MEX F;  4MGH A;  2WSC F;  3W6J B;  1WJF A;  2DAI A;  3F21 A;  1PYV A;  4G7Z F;  4CYD A;  1DGH B;  3HRS A;  4JX6 A;  2RRU A;  1KQ0 A;  4B43 A;  1R5I D;  4NQW A;  4LOC A;  1G4D A;  4M0D A;  5HOD A;  3K4J A;  2QF7 A;  4AIH A;  1NY6 A;  4UB8 C;  2ME6 A;  3H5N A;  2ADU A;  2VJJ A;  4HW0 A;  1PP8 F;  2HHH M;  2HVR A;  5EXT A;  3WGH A;  3L2Q A;  4A3C J;  4JK1 X;  4CFU D;  4YOS A;  4DV5 M;  1MBK A;  3HKZ A;  1HCR A;  1N36 M;  3BG3 A;  3CMY A;  4PD2 A;  5A2Q S;  3A8G B;  4MO7 A;  5C3E J;  4M3F A;  1YW8 A;  5GKN A;  4J01 A;  2JPC A;  5F64 A;  1MBF A;  1W36 C;  3BT9 A;  2PLY A;  2DYS H;  4TTH A;  2BYV E;  3DTI A;  1N75 A;  3F23 A;  4EOJ B;  2IS6 A;  4XLC A;  4QSH A;  2MR9 A;  3TQN A;  4C2T A;  1UNG D;  3M07 A;  3K9O A;  1Y1W J;  2IVM A;  4XK8 F;  4DV2 M;  4AKH A;  4Y52 J;  2CUZ A;  3FXL A;  2HTS A;  1KXU A;  4JI4 M;  3HX3 A;  4Y33 A;  2XB5 A;  3ZPL A;  1NTC A;  1P2F A;  2M45 A;  3F8F A;  2KRU A;  5JFR A;  4B3S M;  3CTW B;  4BCN D;  5C18 A;  2ZSH B;  3WTY C;  2XPW A;  1VQP I;  3R60 A;  1BI0 A;  4BY7 X;  4LG3 A;  5LGN A;  4BU2 A;  4Q47 A;  3I01 M;  1IC8 A;  3RSN A;  2VOP A;  1OMI A;  1ZP2 A;  3UR3 C;  1S3S A;  3K4N A;  4HLQ A;  1N77 A;  2DLL A;  1ON1 A;  1USS A;  5J4V A;  4MGI E;  4JX5 A;  2STT A;  2DK5 A;  4I0A A;  1WWX A;  2ZTC A;  2N8G A;  3P7N A;  4CCM A;  3GME A;  2WWY A;  2B9R A;  2ZBK B;  3C2H A;  3TNH B;  2DW4 A;  2HYJ A;  3KYL A;  4RAF A;  4OAZ A;  5J6X A;  1JUS A;  4Y3O A;  4KIB A;  1QU3 A;  1ZLK A;  1BVS A;  2WZJ A;  1LFP A;  5CVU A;  4EM0 B;  5CJ9 A;  4ZGE B;  1H1Q B;  3FX3 A;  5FKK A;  2C96 A;  3DPL C;  3S3N A;  4LB5 A;  1ZMV A;  2EKK A;  4FET A;  4L5E A;  1YS7 A;  2L9S A;  2EFW A;  4XRS A;  4CSW A;  3BC8 A;  2X0L A;  1TF0 B;  1DUX C;  1DU0 A;  1FVV B;  4BCF B;  2UXC M;  4U0V A;  1RC9 A;  3RGP A;  2MC4 A;  5J1R A;  3KP5 A;  4M9X A;  3D8B A;  3QOE A;  1IRE B;  3AG3 H;  4IBD A;  1OYY A;  5HS7 A;  3E97 A;  4IZZ A;  3X25 B;  4QIW N;  4P96 A;  2EZL A;  2M0M A;  2ZM6 M;  2DI3 A;  2K5C A;  1K83 J;  2RVC A;  3GCM A;  2CZ6 B;  4CRL B;  1FY7 A;  2QEN A;  1VEJ A;  1H9G A;  2RAE A;  3PXG A;  2LBF A;  3MQ0 A;  1KU2 A;  3U1K A;  1X1C A;  1FYL A;  3RDI A;  2TDX A;  1YJW I;  3VK8 A;  5GTI C;  3LSR A;  4IBG A;  4CA0 A;  2F5E A;  2F4O B;  3HTU A;  3EIH A;  3ZQF A;  4ESJ A;  1HJP A;  4HDU A;  2LG4 A;  4BCM B;  2BBY A;  3ABK H;  4IXA A;  1D5V A;  4RDU A;  2MGW A;  1S7O A;  4XRS G;  3SAV A;  2VBY A;  1TDZ A;  2RC4 A;  1R58 A;  2OQG A;  4CIZ A;  3BPV A;  3OYB A;  1EH7 A;  1Z1D A;  2V1N A;  4OIO F;  2CH0 A;  1Z59 A;  4XIC A;  1ZN2 A;  5FLM J;  2IS2 A;  3V7R A;  2G5G X;  2JK3 A;  4L6V 6;  1ETX A;  2P0W A;  1F4I A;  1S3J A;  2IP2 A;  5CYV A;  2DAE A;  2M7B A;  2Y9Z A;  4YFK F;  4XQF A;  5E1X A;  1VF9 A;  2YX7 A;  3FXU A;  4DUY M;  3ZCO A;  4A3J J;  3L9F A;  2FXA A;  1QDT A;  4KIF A;  3A8H B;  3HHH A;  3HSE A;  3C9P A;  5DFL A;  4ABZ A;  5GAE J;  2QA4 I;  3CF2 A;  4B08 A;  3A46 A;  1TP4 A;  4JI6 M;  4DR7 M;  4RAZ A;  5JR3 A;  1YFH A;  3MMP A;  2FOW A;  3ECO A;  2JY6 B;  5DCM A;  2EIN H;  4ZTF A;  4EJO A;  2R46 A;  2M34 A;  3SZP A;  1SG9 A;  1OCO H;  2V6E A;  1GJT A;  4F70 B;  2JT1 A;  4KLN A;  3BCA A;  2NYX A;  4S04 A;  4FW9 A;  1RI7 A;  2K27 A;  2JY8 A;  2I40 B;  3GTM J;  1PUF B;  2W00 A;  1U0J A;  2XAF A;  1X3Z B;  3FRI A;  2I8D A;  3C2B A;  4MFD A;  4NUB A;  4OVZ B;  4OIN F;  3R0J A;  1U5T A;  2HYG D;  2O25 A;  3FXQ A;  1QQI A;  4U7D A;  1SAX A;  4G6L B;  2XAH A;  2KJB A;  1XGS A;  4F3Q A;  2CUE A;  3HHG A;  3MFK A;  1GV5 A;  1OCZ H;  5GAD J;  2UZK A;  1XS9 A;  1K4T A;  2E1O A;  2CZ1 B;  2P5T A;  3D5S C;  4BE1 A;  2ELK A;  4M6X A;  1I39 A;  2X1D A;  4LRS A;  2EBI A;  1IN5 A;  1T0F A;  3CUQ C;  5FLX K;  1VQ6 I;  2HYF A;  1GL6 A;  7CAT A;  3C7J A;  2H8R A;  1S8N A;  2QQ9 A;  4NBQ A;  2HVS A;  3OYA A;  2R65 A;  2EIK H;  1SAU A;  1EH8 A;  1SVM A;  2HPI A;  4A5M A;  5L3B A;  1S29 A;  3SJM A;  1FYM A;  4I3Z B;  1T95 A;  3J27 B;  2ECB A;  2KMU A;  2DHR A;  3BG9 A;  5BQT A;  1UG2 A;  3PSF A;  1WHU A;  2G9W A;  1O9K A;  2XFT A;  3IKT A;  2LNH C;  4JV5 M;  4DV1 M;  3HDD A;  5ITQ A;  4Y7N J;  1OTR A;  1FIN B;  5FKM A;  1XNR M;  4E7I A;  2ZPB B;  3WTU C;  5IF1 B;  2OOB A;  2HZD A;  3G6E I;  1TQP A;  2E35 A;  2IA1 A;  2K9N A;  3BCB A;  3D5R C;  1GUX A;  1HSJ A;  1ZQ9 A;  1VQ4 I;  1W5C C;  4AKG A;  2OTJ I;  5FGK B;  4DYQ A;  1L3L A;  3FIW A;  1FJG M;  4I7H A;  1Q39 A;  2L2D A;  2ZAM A;  3JRG A;  2DWL A;  2RN7 A;  2DI0 A;  4HOB A;  2QFZ A;  4U0W A;  1QVT A;  5KQD A;  2FRH A;  1OCP A;  4QTR A;  4P9U A;  1R7J A;  4GKK M;  1G3I A;  2F4I A;  2JMW A;  2A5W A;  1IRZ A;  2G77 A;  1IF1 A;  3GLF E;  4I09 A;  3R0A A;  3SEZ A;  1KYW A;  5JVT A;  2CHV A;  1HNW M;  2KHM A;  1D3U B;  1K3X A;  1FPQ A;  5CVI A;  2ELJ A;  2DDA A;  3QPT A;  3L2W A;  1D8K A;  1R5H A;  2J7O A;  2R0I A;  3IHU A;  5DCF A;  1TWG J;  4OOI A;  2YR2 A;  3ZOB A;  1HOM A;  2KL4 A;  5A2Q K;  5HS9 A;  2BVM A;  4H4K C;  2FQ3 A;  3TDU C;  5HLT A;  2JSC A;  1R71 A;  2CGP A;  5BNJ B;  2KNA A;  5ITU A;  3U6Q A;  2GIV A;  4MB7 A;  3GBG A;  3FXM A;  2WAE A;  2DPD A;  3WGI A;  1AKH A;  1MJB A;  4BXU A;  4HG2 A;  3UK6 A;  3QPL A;  1XB2 B;  5E6J A;  2Z4S A;  4F1I A;  2OQ4 A;  4B7G A;  3ZCB B;  2HXO A;  3TKY A;  5J8F A;  1GT0 C;  1AHJ B;  2QQ8 A;  2R7W A;  2A69 F;  2F4M B;  2LKP A;  2OQR A;  3H92 A;  2BWE A;  4LZJ A;  4KRC B;  2YNM D;  1UAA A;  1TWC J;  2DFF A;  2HOA A;  3V4G A;  3GTK J;  5J1U A;  5D5U B;  4JI3 M;  3FUT A;  3SHF A;  2OC6 A;  3GLG B;  1YUB A;  3C2G A;  2D1H A;  3HSR A;  4AC0 A;  5EJC A;  4RB0 A;  2VKV A;  3Q0U A;  1K7A A;  4IBF A;  1I6H J;  1ODD A;  2EQR A;  3I59 B;  3WTS C;  4FE4 A;  2PX9 A;  3VYU B;  3OS1 A;  4G3O A;  4JI2 M;  1YLA A;  2CW8 A;  4B3M M;  2KJC A;  1EE8 A;  3WU0 A;  1JI8 A;  2X1N B;  1QPM A;  4MQ9 F;  4CYC A;  1XDS A;  4LLL A;  2L4F A;  1A04 A;  3DFG A;  4KDP A;  4G4Q A;  1HQY E;  3J7B A;  2EH3 A;  2MJ5 B;  1O3T A;  2P4W A;  4NNJ A;  3VB2 A;  1JKW A;  4JN6 A;  4DW6 A;  3CJQ B;  1R1T A;  2HQR A;  4EIW A;  1ZG1 A;  2R7T A;  5IZ7 D;  3RKQ A;  1UB9 A;  3K4L A;  3EYI A;  1T08 B;  2GQQ A;  5FB2 A;  4MHG A;  1EIJ A;  2PBI A;  1LB2 A;  3JSO A;  1H28 B;  1OAO C;  2JWS A;  1BI3 A;  1JTX A;  3O2P E;  1NHA A;  3Q8X A;  4FAS D;  1ZRE A;  2B3T A;  2D1V A;  3HU1 A;  2W48 A;  5FFZ A;  4B48 A;  4DZJ A;  5FRN A;  3ZR8 X;  2VBW A;  2K85 A;  5EXX A;  5J47 A;  1Q3B A;  3TBI A;  2DBB A;  4EJU A;  3T1Y M;  3J80 Z;  4II5 B;  4LGY A;  4D9J A;  4O3M A;  4BE2 A;  5JVG F;  1N32 M;  2YS9 A;  1OKS A;  1E9S A;  4F7L B;  3MK6 A;  2VLA A;  3DXJ F;  4BJ6 C;  1LTM A;  1KA8 A;  4GMQ A;  1IXR C;  1V5F A;  3PNY A;  4G6Q A;  4DR3 M;  3HC7 A;  3P9I A;  4O5V A;  4AVP A;  4BBR J;  3DV8 A;  2C9C A;  4DV7 M;  4XON A;  2IPQ X;  1E3H A;  2OTL I;  1QZZ A;  1HT1 E;  2RGH A;  3OV8 A;  2DJN A;  1VQL I;  4Y15 A;  4L0Z B;  2DHY A;  4IJA A;  1XMK A;  3TO6 A;  3LQQ A;  3T5X A;  2MH9 A;  4KIG A;  3ZMZ A;  5FTN A;  3HOW J;  1B1B A;  3ESW B;  2P7C B;  3QYG B;  3G71 I;  2W25 A;  1I6X A;  3RIR A;  2E2I J;  3WVD B;  2KRC A;  5E3L A;  2BJW A;  2ZCW A;  4L4U A;  4PJM A;  2RQP A;  3SEQ A;  3U6C A;  4XMY A;  4A5N A;  4EM1 A;  3D1N I;  3HO8 A;  4HV6 A;  1XMQ M;  4BCI B;  2COM A;  2F5F A;  2WV1 A;  3F5X B;  3D8L A;  2E1M B;  3W2A A;  2YFQ A;  2DK8 A;  1OYW A;  2VPR A;  2K9S A;  2M8E A;  3K7A M;  4NSO B;  4BQO A;  1RZ4 A;  4HLY A;  1OL2 B;  2ID6 A;  2VQG A;  5GPA A;  5L3D A;  2TRT A;  4G94 A;  3GFL A;  1BIB A;  5DV5 A;  1T2K A;  3IV5 A;  2J7N A;  1PJI A;  2R92 J;  2CCH B;  3JTG A;  1ZMW A;  3FK6 A;  2FML A;  3HHY A;  4CH7 A;  1FJL A;  2L4A A;  2L3D A;  3L2R A;  1HLV A;  4FX0 A;  1JKQ C;  4BCH B;  1MNM C;  1ZQ3 P;  2JUJ A;  1WZ2 A;  1XPX A;  4MIM A;  1IV6 A;  5JI6 A;  4E7L A;  4GRI A;  4XBO A;  2JUG A;  3HGI A;  2LBC A;  2O5R A;  3L25 A;  3GRR A;  1F5Q B;  3K70 C;  1TQM A;  2XEP A;  4DR2 M;  4AYB N;  4U0Y A;  2R7Z J;  4XOP A;  1S6L A;  2RDP A;  1X2N A;  3AL0 C;  4JX4 A;  4OR5 B;  4LLN A;  1VOL A;  3BQZ A;  4YEL A;  1DPR A;  2LY1 A;  3UNG C;  3L1P A;  1O9K B;  3K1J A;  1SEU A;  5J1Y A;  5EQT A;  2JTV A;  2KRK A;  3LFK A;  3HM5 A;  3G1O A;  3PO3 S;  2FH0 A;  4KIC A;  4FHT A;  1YHQ I;  1H6U A;  3S1M J;  2JZ1 A;  2CUF A;  2WAQ N;  2DT6 A;  3LSK A;  5I5Z B;  1YW7 A;  3PUF A;  4UUT A;  2KMG A;  2OU2 A;  1FOW A;  4RAG A;  2VKH A;  4C30 A;  1T33 A;  1R7R A;  3Q3S A;  4UVC A;  2CFX A;  5CVV A;  2L6O A;  2QDJ A;  3EJ1 B;  3JTH A;  2GNO A;  3CC7 I;  1IXZ A;  1O3Q A;  2GQF A;  2JY5 A;  1J75 A;  4LB6 B;  2LR8 A;  3VEP A;  4D7M A;  1YJN I;  4D5F A;  2JXN A;  3KVW A;  3U60 B;  3FIS A;  4GO1 A;  3B89 A;  4LIU A;  2E19 A;  4HSR A;  3VYR B;  3J80 K;  2MG4 A;  4KN4 X;  3E46 A;  3GZ6 A;  3GTJ J;  1K82 A;  3LAP A;  1PP7 U;  3GVA A;  3K1M A;  1LVA A;  3ZH9 B;  3B02 A;  5JI2 E;  3GEZ A;  2QZ8 A;  4HLX A;  2AO9 A;  2FS1 A;  5IRE B;  2L7K A;  1DP7 P;  2K3F A;  2O01 F;  3HBL A;  2XGC A;  1BR2 A;  2GWR A;  2ZJ2 A;  2VIX A;  2BY3 A;  3KP6 A;  4A6D A;  1GUU A;  4ZTJ A;  2WAF A;  1HKQ A;  2L01 A;  4NXN M;  2EWN A;  2JN6 A;  3S2D J;  1URC B;  2ZXJ A;  5B1B H;  3KSX A;  3BXW A;  4N9I A;  1GO5 A;  1D0K A;  4CHT B;  2ZTD A;  1B59 A;  1D3Y A;  2BY2 A;  3CCM I;  2DVW B;  2OZU A;  3TMO A;  3HOU J;  3SDG A;  3GYH X;  4E7H A;  1AA7 A;  2AXT C;  2W9F A;  4DR6 M;  2M1B A;  2K4B A;  1XNQ M;  3HHW A;  3HZJ A;  4HEO A;  2CZ0 B;  3FMS A;  3I3L A;  2YX4 A;  2ZPH B;  5BMZ A;  2DZO B;  1Y0U A;  2ZXH A;  4JOM A;  4DR4 M;  1W4M A;  2Z9O A;  2OV7 A;  3GLG A;  2DT5 A;  2WAD A;  1LEA A;  4IHT A;  4A3D J;  1X4P A;  3GQ3 A;  1FSH A;  2V1X A;  1K6Y A;  2IW9 B;  1AKH B;  3WGG A;  5LBQ A;  3PJR A;  2FE8 A;  3LCU A;  1T39 A;  2B9S A;  3KDS E;  3H35 A;  2Z33 A;  1YJ9 I;  1FSE A;  2E7X A;  3BZK A;  4YHH M;  2R7Q A;  3ZQQ A;  4B4C A;  2OCC H;  3L2U A;  3LFU A;  4M6Y A;  2KLO A;  5IDN B;  5J8C A;  1TH4 A;  3ONQ A;  3PO3 J;  1D0Z A;  3LQR A;  2WSF F;  1UHW A;  3GLF B;  3FMR A;  3GZN B;  3NAU A;  4FVM A;  5KQ8 A;  3F6V A;  2VUM J;  4B3A A;  2BNK A;  4AW4 A;  3TGN A;  1ZAR A;  2LK2 A; 
#chains in the Genus database with same CATH homology
 4AI6 A;  2ZPF B;  2DPP B;  2BS4 A;  2BS3 A;  3QWL A;  4JX4 A;  3A8H B;  3X24 B;  2ZZD B;  2ZPE B;  1AHJ B;  4HL4 A;  2QQ8 A;  4BBS M;  3H4C A;  4Z6Y A;  2DD4 B;  3VYG B;  2CYZ B;  4JX6 A;  4LOC A;  5EJC A;  2KMG A;  2QF7 A;  2QDJ A;  4P17 A;  2ZCF B;  2DXC B;  3QYE A;  3DL1 A;  4M6V A;  2ZPI B;  1E7P A;  3X28 B;  3BG3 A;  3A8G B;  2BS2 A;  3A8M B;  3HHT B;  3WVE B;  3QYH B;  4MFD A;  3HB9 A;  2WJ9 A;  4QSH A;  2CZ7 B;  2CZ1 B;  4AKH A;  3HBL A;  3X20 B;  4BBR M;  4HNT A;  2KR6 A;  1UGS B;  3VKG A;  1V29 B;  3QXE B;  3X26 B;  1UGP B;  4ZGJ B;  3BG9 A;  4OB3 B;  4HLQ A;  1UGR B;  4NC6 A;  4JX5 A;  2ZPG B;  3TW7 A;  1FKM A;  2ZPB B;  3HZJ A;  2CZ0 B;  3QYG B;  2AHJ B;  2DD5 B;  3KHI A;  4HNV A;  3WVD B;  2ZPH B;  4FM4 B;  4ZGE B;  4AKG A;  1UGQ B;  3VKH A;  3HO8 A;  3QYB A;  4HNU A;  4OB2 B;  4MFE A;  2QFZ A;  4AKI A;  3TW6 A;  3QZ9 B;  3A8O B;  2QDY B;  1IRE B;  3VYH B;  4OB0 B;  2G77 A;  3X25 B;  3QZ5 B;  2CZ6 B;  2DXB B;  4ELJ A;  4ZGD B;  3BG5 A;  4OB1 B;  3A8L B;  2D0Q B;  1QLB A;  4MIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...