3HZJA

Crystal structure of the rabgap domain of the rabgap1l protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
YSWGELLGKWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDRYRILITKDSAQESVITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYDYGLRDLYRNNFEDLHCKFYQLERLMQEQLPDLHSHFSDLNLEAHMYASQWFLTLFTAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIKVPTKKLKKYEKEYQTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAB GTPase-activating protein 1-like
publication title Crystal structure of the RabGAP domain of the RABGAP1L protein
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 97
structure length 287
sequence length 287
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3hzjA02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 3hzjA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hzjA03
5EJCA 2QQ8A 4NC6A 4HL4A 2G77A 3QYBA 3HZJA 3QYEA 4HLQA 2QFZA 4P17A 4Z6YA 3QWLA 1FKMA
chains in the Genus database with same CATH superfamily
3I51A 3L1PA 3IRRA 2R4JA 2JTVA 1ZRFA 4LLNA 4RB2C 2KHMA 3I53A 4KJZA 4CGZA 2L2OA 3T8RA 3KPHA 1T43A 4BUPA 2L4FA 1QAMA 2XZUA 3W0FA 5GKNA 2VQFM 4ZYGA 1Z6TA 2LP0A 2CYZB 1MJGM 1R7RA 1OAOC 1NG6A 3SDBA 2V1NA 2JNHA 1N36M 1V5FA 4X66M 3HRSA 5J47A 3MN2A 4J01A 4XICA 2M45A 3HHWA 4G8XA 3I4VA 2ZAOA 3KZZA 4D82A 3GLLA 4A3MJ 2ZTCA 1SD4A 3GQ4A 1TWCJ 1PP7U 5IREB 3E4RA 1HSTA 3GLGA 1UCRA 3E21A 4LZJA 2UXDM 1PJSA 1MIJA 3U1KA 3ZMUA 5IP7J 3A46A 1E3PA 1OMIA 1WJ7A 2YU9J 1FVVB 2RGVA 1MMSA 4F92B 3B89A 4I76A 4KRDB 2DO7A 2LVPC 3LWFA 1H1RB 3FK7A 1U8BA 2JXNA 3TW7A 4M9XA 2DD4B 1QLBA 1R22A 2LH9A 3HOVJ 3OYNA 1FTTA 1DPRA 5IDPB 3BBZA 4BACA 2CW8A 3FM3A 2UUBM 4AD9A 2ZCWA 3EUHC 4G6QA 1SMYF 4EIWA 2D45A 2K6BA 5HDKA 3S1RJ 3BT9A 3ZQFA 5F0FA 1XMAA 3JRFA 1VQ9I 4QPOA 2BV6A 3ZN0A 5IPAA 4Y15A 1F5QB 1XS9A 5E18F 2LBFB 3BTJA 2JVHA 3DA1A 2XLJA 2M0MA 2IW6B 3C7JA 1JJ6C 3OSGA 3FIWA 3RKQA 5FTMA 1UHMA 5EGOA 1TZLA 4KICA 3UR3C 5D4SA 3GCMA 1Y56A 4QWQA 3S8PA 5ICCA 2BKZB 1E3HA 3K69A 1H28B 1BI2A 4NHJA 3BJAA 2RC4A 3K1PA 1X1BA 2D2WA 2DQLA 2L02A 5DD4A 2LVSA 1N75A 4QTRA 4CCOA 4FQGA 1P3QQ 2LKSA 2H09A 2K9NA 2BXYA 3D8BA 2UUEB 3I59B 5D5XB 5FKLA 2M3AA 2ME6A 1MMGA 1HKQA 1FOXA 3J7ZI 1FIPA 3BR0A 4YELA 1FJLA 2DOFA 3MKYB 3L2CA 3D5SC 2ZO4A 3SDGA 5D8KB 1PJJA 1POGA 2K02A 5FKOA 3ZMSA 4OB1B 2O7OA 4IMYB 3C3DA 1WH7A 2OOBA 2FA5A 2XF5A 2HQRA 4FD2A 1V5EA 4KIGA 3ZPLA 4NSOB 2QPAA 2M0CA 3HXLA 3ERED 5E3OA 2PX9A 1W7PB 1ZGWA 3FXKA 2VB6A 1WVRA 2UXNA 1KU2A 2VC1A 3C3EA 2MC3A 2CRGA 2CV1A 2R44A 4G3OA 4DV6M 2FNPA 2VKDA 2WFYB 2IT0A 4E7HA 3M07A 3GLFB 1UGRB 4F52A 2VIXA 3ERMA 4I0BA 2IW8B 1GV2A 1IREB 1Y1WJ 4Q48A 1UZCA 4HEOA 1LFUP 5EP2A 2DA3A 5JI6A 5JI2E 1W98B 3CF6E 4XONA 3GX4X 2R62A 1EV7A 2B0LA 2VE9A 2DK8A 2XRLA 5D5UB 3RZOJ 1H1SB 1BIAA 3MZYA 3RSNA 4CYCB 3HYIA 1DP7P 2HXOA 4OGRB 3HZJA 1WJAA 2RVCA 5E3NA 1IF1A 2DHYA 1YX5A 4XIDA 1E9SA 2ERCA 2BWEA 4BCHB 3EDPA 1XWIA 2MGQA 3VB2A 4WP2A 3E46A 2OOAA 2LWXA 3AFHA 1ZR4A 1SC7A 2EB7A 4LFUA 2QLZA 2C9OA 3I4YA 2H1LA 2ZXJA 2DAIA 4ETSA 4LGMA 4CFNB 4HLQA 4AKGA 2UXBM 1H88C 4BCKB 3GLGB 2Z3YA 2BXZA 2BVMA 4L18B 4B43A 4NOOB 5HLHA 1YS7A 1T6OA 3M1EA 1Q1VA 3WHKA 4ANRA 4HEA2 3EUKL 3NQOA 1OKVB 2BS3A 3HJQA 1Z9CA 3J27B 2WSEF 5EP3A 1SFXA 1Z67A 2I8DA 3GLHE 1HQCA 1Z7UA 1J5YA 2B7EA 4X0GA 4FX3B 4L16A 4BBSJ 2WHBB 3H4MA 1FP2A 4BS9A 2H6CA 5C4XJ 3M4OJ 2XAHA 4GMQA 4DV2M 3D5LA 2ZMEA 3FXLA 2MBFA 1MMNA 3F8NA 3HX3A 4NBQA 2DAGA 1QZYA 2VXDA 2Z4SA 5CVJA 4B3AA 5K7ZA 2R5ZA 2IGNA 3DU5A 2FE8A 2W96A 3ABTA 5FJ8J 5FRNA 2K9DA 3C18A 3ZCBB 4I2OA 2FOKA 2ZC2A 2C5OB 1FBQA 5EGOB 2F2EA 3BCBA 3BLQB 1D3UB 3DBRB 4I5SA 1FT9A 3CDHA 5L3CA 3U9GA 1F1ZA 3PQKA 2VN2A 4F3QA 1LUJB 2WEVB 4PSWA 2FQ4A 4P9FA 1F4KA 5CVRA 2V26A 4ANJA 5JVTA 4A3DJ 1QRYA 1KONA 2W9ZA 2CUJA 2HEOA 4MH0E 1I27A 1IRGA 3N05A 1CF7A 1N33M 3TNHB 3QYFA 4HX8A 3W3CA 3HL2A 5BOXA 4RS8A 2XF3A 4LJ8A 4DV0M 2UV1A 2W57A 2E5LM 2PMUA 2CSOA 3F8FA 3X26B 3VLFB 2VBZA 1IXRC 2WB1A 4NXNM 2LY1A 4QIWN 3F72A 4I8OA 2QCOA 2PG4A 2IEKA 5BPIA 4G6LB 1PUFA 1N78A 1A5JA 1WGLA 4JOMA 3A4CA 1JKRC 1JKPC 1ZRDA 2ZMEC 1P92A 5LLQA 2I40B 2CWBA 3H5RA 1O3TA 2C5VB 5J3LA 1TWFJ 2JZ1A 1OIPA 2JA6J 1ETXA 3MQ0A 2KEBA 3HDDA 4BY7X 3LSKA 2J7OA 4G12A 2HCBA 1KU9A 1X1AA 3X20B 4QSHA 2CE7A 3TEDA 3LMMA 4OX9M 3K1JA 4IO9F 1UB9A 2OQRA 2DMTA 2L4EA 4OAYA 3K4JA 4KISA 3OYJA 2VLAA 4EOMB 1Z5CA 1MBEA 4JI0M 1FYKA 3W2AA 3U1DA 3UZUA 2E7WA 4CGYB 5FD5A 4BCFB 3S2HJ 2DA7A 3R6SA 3Q5FA 2FSWA 2OPFA 4HSTA 1YTYA 4FISA 1C9BA 1MNDA 4ZYDA 3TNWB 2WAQN 3OS0A 4NC6A 2MH8A 3U6EA 4O6JA 2DZLA 1MMAA 5K1YA 3NWLA 4XOTA 4KMFA 2CRUA 1QYRA 3J81S 2TDXA 2C5XB 4M73A 5F27A 2LC2A 4CIZA 1GY3B 2Y9ZA 1HF0A 1EIJA 4DV3M 2ACJA 3S2DJ 4JX6A 3DF8A 4AIJA 2L7FP 2X85A 1YLFA 4ZYAA 5JLXA 4BCQB 3B02A 1R1VA 2HQAA 1LVKA 2R7WA 5F08A 3E6CC 2QFZA 3U6MA 3ZQCA 2OTLI 1QDRA 3WTXC 5IP6A 1QANA 2DAOA 2NAZA 1KQ9A 2WTEA 2F4VM 4C3IJ 4OOIA 1UHWA 4DZPA 4D5FA 1WGNA 4DJAA 3K4MA 1FMVA 4ZGJB 1FC3A 3IHPA 4TV7A 2GAUA 1K7AA 2MJ5B 4Q4ZF 4EORB 3LA7A 5ITXE 3VK7A 1A6QA 2CU7A 4ZYHA 1GLNA 5L3DA 5ILUA 1OI9B 2F5EA 3LFKA 2E2HJ 3GLHA 1QO0D 3HC7A 5H6RA 2R5ZB 4FCTA 4Y17A 3JTHA 4L9JA 1VEKA 4XGIA 4LJAA 2ZXWH 5J6XA 4AWXB 2H5XA 3CESA 2DK5A 3QYBA 1L2DA 1TT5B 4A3KJ 2R4GA 3ZH9B 3ZQ7A 3A0HC 4X64M 2EIJH 2M2EA 1G3IA 1Z05A 3TO7A 1EH7A 4BY7J 2KIFA 3L9FA 2OZUA 1JOWA 2PHGA 5BNJB 3DTOA 4D7NA 4ROCA 3TWKA 3MAJA 2A5WA 2L9NA 4DUZM 2ECCA 2KR6A 1WJDA 4C3HJ 1L2BA 3LSHA 2NXNB 1XMXA 4ESBA 4CCNA 1H4LD 1LJ9A 3LQRA 4HW0A 3JRDA 1NY6A 4CISA 3JRBA 5JI3E 2O8XA 3VYRB 4V19K 5DYMA 4ABZA 3HO8A 4UVAA 4CFXB 3CLOA 2LTUA 1G6NA 3MI9B 5ITRA 4GYIA 5JLWA 2OQ4A 5B1AH 2AXLA 4DUYM 1QPMA 4OIRF 4BYYA 4HX7A 4LF9M 3FXMA 1TH2A 5M3MJ 3TQSA 2HOSA 1RI7A 3GP1A 1G4DA 5CQGA 2EA2A 3HGIA 2GQQA 1DGHA 4IBCA 3U60B 4BU2A 3E7LA 5FB2A 1H26B 1TD6A 5EP4A 4F7LB 1T56A 2ADUA 1FIAA 1RU3A 5HOOA 3PJRA 4MGYE 5FGMA 3QAUA 4ENKA 2DI3A 1IN6A 2OUMA 4KUMA 5IYBJ 1VQMI 4IHYA 4B08A 3SAUA 2JZYA 3HKPA 4XRFA 5FKNA 1NH3A 2QQBA 3DKYA 4BAYA 5GADJ 1LKXA 2LNBA 1VF9A 2LMDA 3R0JA 3PXGA 4K0KM 1FMWA 3OOUA 3VEPA 4A3LJ 5CEIB 3KP0E 3H9GA 4XRMA 2OU2A 3QZ9B 3OYMA 4CJ6A 2IVMA 1SEUA 2CZ6B 3CCUI 3FK6A 2W9FA 2VASA 3HGYA 3MCZA 4R3DA 2R0QC 2BS2A 4BJ5C 4FM4B 1E94E 1N34M 1XSDA 4ZDOA 2HFHA 1JB0F 3VFZA 1J09A 1USSA 1IBKM 3QWLA 4KT6A 3JRIA 3P9IA 4BH9A 4EOOB 1S7EA 2BY2A 2PLYA 1MMDA 2C99A 1CUKA 1BW6A 5J1UA 3ZCOA 3BLRB 2FH0A 1IDYA 3FMRA 1IXSA 1ZLJA 4WXDA 3DPUA 1O3QA 1X3ZB 4BJ6C 3Q8XA 5L8RF 1T33A 1TLHB 4TUWA 3G2BA 3R0AA 5CVIA 1R58A 5F0CA 1B8IB 5EFQB 3KLOA 2JWSA 2QP9X 4GIPA 3DXJF 4OVZB 3IH2A 3S3NA 1UGSB 4C2TA 4YRVA 2N8GA 4M74A 4MTDA 1AUAA 2QHOB 1D1CA 5EQTA 1HNZM 1SMTA 1RUOA 1T98A 4BB9A 5IYDJ 1Y0UA 3OYFA 2X4AA 2NYXA 4RODA 1HW1A 2GOXB 2LSOA 2HWJA 4ENMA 1Y1VJ 2Y9YA 1ETOA 3HHTB 4ZZDA 4BBRM 1YIJI 1JHHA 2NNYA 4KNYA 4D81A 3BR3A 3LVWA 3C3WA 5ITXA 4M3EA 3RFWA 4IHVA 3TN8B 3RJPA 2X6YA 3T0YA 3WHCA 1S5LC 4I98B 5DTDA 1FBSA 4RLFA 1PGYA 2VBWA 4CXFA 4CDGA 2LW4A 3TQNA 1V34A 3QHWB 3KOXE 4P1WA 2E35A 4I99C 4L0YB 5IDNB 3VYTB 4EOQB 4JI1M 1BW5A 4N4NB 4XLNF 1P7IA 1TQIA 5EXXA 1G3YA 1PM5A 4FE4A 2GM4A 2GA1A 5HQ0B 3FX3A 2YS9A 2CJJA 2H1KA 1XHBA 2HNHA 4BXUA 3OWTA 2DYRH 3LSMA 2XFTA 3AOEC 3DKXA 2FU4A 4LGYA 4PSXA 2GQFA 2CQNA 1B1BA 4B09A 4FX4A 5EP1A 1BBYA 3TDUC 4Z6YA 2CZ1B 3CDIA 4FW9A 2E1CA 5ACBA 4AIDA 4CUGA 3L00A 3R61A 3KP1E 2L7IA 2Q2EB 4G4OA 1AA7A 5E17F 3MK6A 1OCOH 2W82A 1L2CA 4PGGA 2QEXI 2GXBA 1HA8A 3F9KA 2P6SA 2EZIA 2X0LA 4U88A 1W5SA 1H24B 4DR4M 3K2LA 4IBGA 4CFVB 1AD6A 5HDNA 4KITB 4PJLA 5KHDA 2RNJA 2W24A 2BOLA 1R4GA 1R4NB 5CYVA 1V29B 1ZR2A 2ZKZA 4KFCA 1UNGD 4S12A 4FCVA 3CTAA 2ESNA 3PUBA 4EVIA 5J1YA 4CFWB 5F6FA 3PIOF 4NRWA 3J81Z 4L0ZB 5C18A 1OLTA 1ENHA 2HS5A 1VEJA 2KRKA 2OA4A 3O0GD 2PJRA 2BBYA 4GHLA 1L0OC 1U9NA 2IBDA 1C7YA 4CSWA 1ZMUA 3PO3J 1AU7A 4P16A 5GAGJ 1LEBA 3B6AA 4OB2B 3LSJA 4IBBA 2IGMA 3A8GB 4IJAA 3TOAA 4IZZA 4I6ZA 3F5XB 4LIUA 2KNVA 3UJNA 4X1EA 2DMPA 3FMSA 4MTEA 2NOJB 4BCMB 3D0SA 1K3XA 4BCPB 4HLXA 1G59A 3KS8A 5GAHJ 4HQEA 1Y0NA 1VEGA 4LF6M 5LBQA 4L8RC 1FLIA 4L5IA 3VDUA 4IXAA 2EV6A 4WXCA 3GFLA 3DZDA 3LCVB 5E1XA 4RAFA 2R7FA 3CCYA 1NK3P 4ENNA 4F7NB 1OKSA 3KYDB 2DOAA 2HVRA 5FTKA 3LA3A 3MMYB 1ZKGA 3ASNH 1PJQA 1U0JA 2FOWA 4UB8C 2A07F 4OW0A 2QKLB 1X2MA 3DEUA 1C0WA 1IRZA 5FGKB 2WC2A 3HJ8A 5BPDA 3IWZA 4HL4A 4ZTFA 4LF8M 3A2KA 2CCIB 2FBKA 4G6ZA 4RAGA 3T8TA 3P5JA 5FLXS 4XLAA 2MROB 1YQAA 2RREA 5FTJA 3HOTA 3FTFA 1LEAA 3BR2A 2UZDB 2R65A 2P81A 3VPRA 3JTGA 4HA8A 1X3WB 2CFOA 3MKLA 4K2EA 4LG0A 1R00A 1NG7A 2LF7A 2QM3A 3KP7A 3QPLA 2M87A 4M9SA 1IRXA 1BL0A 2VT3A 4MFDA 2G5GX 1G3NC 5HBEB 3FXJA 4DV5M 4BGDA 3CCQI 3ECHA 2XSZA 4RDUA 4N9HA 4IHSA 1G3WA 4BXXX 4CXAB 4IRIA 1MBGA 1QA6A 4JK1X 2R0IA 3OYGA 1XGSA 3A0BC 2EINH 3KOWE 8CATA 2L9SA 3FTCA 1I5ZA 5KVRA 4XRSA 1Z5AA 2M34A 2V1UA 1S8NA 3NWTA 5A2QK 2QSFX 1NY5A 1OCPA 5JVGF 2VUMJ 3S14J 1ZMVA 3L2UA 2E2IJ 4BNCA 3QYHB 2ZSIB 4CCMA 3N97A 2OAZA 4AG6A 1R6RA 4PCZA 1WRJA 5IYCJ 1HDDC 4PFPA 1VQPI 1W5TA 2XB5A 2NS8A 5LGNA 2XPUA 2QNJA 5B3SH 2KA6B 4RB0A 2IPQX 3WG7H 3GTPJ 2ZPFB 3GYHX 4FHTA 2W2HA 1R4MB 1LQ1A 3FHNA 2RKOA 2D0QB 4F2LA 5IF1B 4L78A 2NOGA 1QZMA 3JR9A 3NBIA 4JI5M 2L9RA 2VKVA 1OTRA 2F5FA 3IAM2 4G6TB 3OYBA 2NVTJ 3ZMZA 4XLHA 3FUUA 4XRSG 3GVAA 2VKHA 3H92A 3J7BA 2ZFUA 4M3DA 2J5PA 2QGSA 4HYEA 1O7LA 5E6JA 2GIVA 2CQKA 2Z1DA 1JXSA 2D5VA 3BOQA 2PJRB 5ILVA 2EJRA 1ZG1A 2WWYA 2DZOB 1R5ID 4KIFA 4OWRB 2MD5A 4HF1A 2K3FA 1ON1A 2GA2A 1ZV1A 4PJ0C 4LRTA 3HUGB 4JQFA 1SVOA 2QDJA 4QHSA 1FOKA 2RAEA 1A5TA 2E1MB 3I4NJ 2P5KA 2WSCF 4I7HA 1DGFA 1P4AA 1OGUB 1T38A 2V9PA 3PO3S 1AOYA 3AG2H 3EIEA 4DYQA 1Z59A 3I55I 3BLYA 4LJ5A 2DFFA 1LDJA 3H9JA 5E3LA 2XAJA 3IRQA 2MC4A 1LV7A 1T08B 1U6GA 3K6GA 3A8MB 3IC7A 5HDGA 4A93J 2K9MA 2P8TA 4BXXJ 1UNHD 3OR1C 1QUSA 1XNQM 2KIUA 1REPC 2K5CA 3SMSA 4OU0A 2VPRA 2ZCFB 2Z5UA 1MH3A 3K70D 4NSRA 1PUEE 2YPRA 1AKHB 5F1JA 1YW8A 2R7OA 1IFYA 2EKKA 3H5AA 5GTIC 1VQ6I 2IAIA 1TDHA 3CJNA 4GKJM 5DUKA 4EV0A 3WVDB 2E1NA 4GO1A 3CUQA 3JR5A 3EUHA 4BEHA 1XGNA 1UJ8A 1ERDA 2XSDC 3JSOA 1YW9A 3FUTA 5E1WA 3FDYA 4ZPXA 2OCEA 4GFBA 3FXRA 2NS7A 1EE8A 1I1GA 3X28B 2XPWA 2MSYA 4OIQF 3GRRA 4MB7A 4DR1M 1MKMA 2HU9A 1JKOC 3I04M 3DDPB 2O9LA 4LJ4A 4E7JA 3KIOA 1Z6RA 2HGCA 3H3ZA 4KO8A 4Y7NJ 2HTJA 5HNFA 2JK3A 3SXYA 4F6WB 4IEJA 2G8LA 3NARA 3A01B 4BDYA 3CCSI 2I10A 3W6JB 4E70A 2ZBKA 4A6DA 1OCZH 3H36A 3KW6A 4M6VA 3QPTA 3RKXA 1VQNI 2ISYA 2XIGA 4XN3A 2LFBA 3QP6A 1D0YA 2Y0QA 1FX7A 2L6OA 1R7JA 2DFHA 2XAFA 3BG6A 3OMYA 1IXCA 1P6RA 1K82A 1XD7A 5KO3A 2ZJ2A 1NVMA 2HZDA 1HKTA 3PNYA 4HAMA 2CW0F 3HHGA 3M0EA 1D0KA 3K2ZA 3J7AY 3AG1H 3CUQC 3MZHA 3BR1A 2HKJA 3IHUA 4EOKB 2ZPGB 3SC3A 1YRNA 4XORA 1O3SA 1YYVA 3T1YM 3D8LA 1S9HA 3KCCA 4A3BJ 4LJ7A 3E3VA 4HRIA 5E79C 2VL8A 4NQWB 5TISC 4W1UA 3WTTC 4E7KA 3ZQHA 2K40A 3U61B 1R1UA 1JI8A 4J19A 3HIFA 3K70C 1GUXA 1OCTC 5F1RA 5DNYA 2JZ0A 1D8KA 4D80A 2UUZA 3HG9A 4HG2A 2DN0A 4I4LA 2E34A 3PNTA 2KDOA 3GRVA 5KPRA 1X4OA 2R5YA 3GFMA 3X25B 2UZLB 1H25B 3HU2A 4C3JJ 1DU6A 2P6TA 3V7RA 2KMGA 4Y13A 3GPUA 3BHUB 1N32M 5B5EC 2XASA 2EK5A 4L9NA 1D1AA 2KKOA 1SXJE 1VI0A 5FLXK 3ZOBA 2BY1A 3F22A 3GZ5A 1WXQA 4FETA 5FLXZ 1AIPC 1B9NA 2LOOA 2XDVA 3IAS2 3OL3A 1XXHE 3SHFA 4IF4A 4QNRA 1UFZA 4DGWB 4RBOA 3OYIA 3BP8A 2Y0TA 1VTNC 5L3GA 2EV0A 2VQGA 3OIOA 3F8MA 3H0GJ 4OB0B 3FUVA 3RYRA 1HW5A 3JAMS 3QODA 3BQYA 4RM2A 3WU1B 3LSRA 1NK2P 3U6DA 4A3CJ 1X4PA 3PNVA 4BL0B 3FUWA 3I0TA 1Z3YA 3MVPA 2VJ4A 5LHHA 3ILKA 4XLCA 2HDWA 3K2AA 4DYRA 2RKHA 1RPWA 2XAQA 4X6AJ 1RKTA 2BHZA 3L2QA 2IN3A 1HXDA 1B9MA 3C2BA 2DJNA 2FUG2 4CHUA 3CTWB 2ZAMA 1XO2A 1U2WA 1YJ9I 3HOXJ 3S1MJ 2QWWA 4C2MJ 1UGQB 4YOSA 3SYLA 5EXTA 3DKWA 4MQ9F 3CCLI 2K9SA 1XN7A 2UXXA 3PSIA 3CCRI 4OIPF 1HC8A 1G8XA 3FKIJ 3CMEI 3C1DA 1Y8RB 1IY2A 2DT5A 5CKTA 1TW3A 3U5ZA 1YS6A 2Z7JA 5CVVA 1WI9A 5EEHA 5LEJA 2CHVA 5TJJA 2RGHA 2WAQA 2EPFA 1A35A 1G8PA 4LFCM 3A8LB 2YNMD 2ETHA 2ZBKB 2A05A 4A12A 3GTMJ 2I7NA 1QZZA 3S17J 3KLNA 1JR3E 4CHTB 3LSTA 3DQVC 3OYKA 2VONA 4HV6A 4II3A 1NJGA 3HKZA 3EYIA 1I4WA 2WSFF 2LF8A 3U6SA 4Y52J 4EOSB 2FMLA 2LNHC 5FLMJ 3GPPA 3H5NA 4AU7A 1YG2A 2DXBB 3A8OB 3TOBA 2WXVB 4RGXA 2CV0A 1XSVA 2WMBB 1NNUC 4R7GA 2KJCA 2DTZA 3KEYA 3VKHA 5LFAA 3KSXA 2M4KA 1YRNB 4BQAA 4KDPA 1ZELA 1MSEC 2P4WA 5HVQC 3QHRB 1R6BX 3ECOA 2DU9A 3J80S 5DUIA 2ZSHB 2EA0A 4HNTA 3FTDA 3CF5F 1DP3A 2GXAA 3WU0A 4L15A 1VQ5I 1ZYRF 4MLOA 2HYGD 5DCMA 1BVSA 4F6UB 3ELKA 2CHQA 4FWGA 4A0ZA 4CICA 1IBLM 4HF0A 3CMMA 2IA2A 1WWXA 2RDPA 4LJ6A 5IT9S 2UUCM 1SXJD 5H2FC 2HYFA 2E1OA 1WIVA 3KP6A 1MBFA 4AIHA 4W5WA 2WV1A 1AISB 3F3XA 4U0YA 2OC6A 3HSEA 3GTQJ 3ZQLA 1XTAA 1LTMA 5D4RA 1DV0A 2Y30A 3I71A 1JT0A 4JN6A 1OIYB 2X9DA 1OISA 2CUFA 5CQEA 1ETVA 1RETA 2E60A 3L7WA 5CYIB 3I9V2 2IS2A 1D1BA 4L4UA 4FX0A 2E7XA 3ZMVA 3EOCB 2V6ZM 1R2YA 3BHTB 1BI0A 2VF8A 4MGHA 3GW2A 3I58A 1IY0A 2X6XA 3IWFA 5JR3A 2JA7J 3EIDB 1H89C 2P7VB 4Y4RA 5E8GA 2Y20A 1Q39A 3E1SA 2H8RA 3GFIA 4I81A 1SXJA 4PD2A 1OIZA 2XPVA 3BR6A 2XUBA 2E5ZA 4L6V6 1OPCA 3VYUB 4LLGF 1XXHA 2L2DA 1FTZA 4EONB 4BHPA 1QZEA 4WURA 1MNMC 3B7NA 3TWLA 3CO6C 1GVNA 2Z8YM 3G6EI 2XC7A 1C1KA 3CUOA 2JUCA 1XC5A 2OD5A 4XM3A 3X24B 5HS7A 1ZP2A 4I02A 4OIOF 3CMAI 4G7ZF 4HLYA 1TNTA 1B72A 1ZAOA 4PFOA 2IA0A 3ASOH 4RLQA 5FLVA 1JR3D 1R2ZA 4NSTB 1AHJB 2VKEA 3GLIE 1IRFA 3GQ5A 5HS9A 5J8FA 1AWCA 1J59A 5FSWA 2C9CA 4FT8A 2LLKA 1O3RA 3HTUA 2DNAA 3U5ZB 3V76A 4W97A 1W0TA 3RGFB 2BWBA 4LB6B 2NVXJ 1ETWA 2WAEA 3KYLA 3WTWC 2WBMA 2EFOA 2JRTA 3M9AA 2K27A 1E7PA 2J5OA 2KRCA 3ML6A 4OMZA 4JI7M 4KYWA 5DYIA 4RGSA 2DYSH 3ZQGA 1BI3A 1JE8A 4ZGDB 4II7A 4RGRA 3OYCA 1U5TA 2XGXA 1BC7C 1SXJC 1HR0M 4EATA 2CFXA 3G33B 2Y48A 4XLFA 2DA1A 3GWZA 1IGNA 3UK6A 1GXPA 1SFUA 2DWNA 3GTMS 1JR3A 4FWDA 1ZGJA 2PFBA 2M9HA 1K4SA 2JVGA 3R60A 1JSTB 4KMUX 3FE3A 2HAKA 4JX5A 5EEGA 1MN3A 3L2VA 5DQVA 2ZMEB 3P7NA 4IRHA 4KT0F 4LK1F 1E32A 3MFKA 2M5WA 1IM2A 5M5WJ 2JY5A 1MNEA 4RF1A 1UG0A 1KQ8A 3LCUA 4EJTA 1PVEA 2QA4I 4IOCF 1BR1A 3S2WA 3SEZA 2BYVE 5L3BA 3HU1A 3CZ6A 4B1RA 4EJUA 1P5EB 4AVZA 1XGOA 4UVCA 5LRRA 3I3LA 1ZG3A 2DWLA 3U6PA 2BHYA 2V9VA 2AQEA 2XGEA 2CH0A 2X4HA 1FY7A 3ABKH 2QQ8A 1R9TJ 4ITVA 1SANA 1KQ0A 2LD5A 4LD5A 1WPKA 1X3UA 1V92A 2M4GA 4B44A 4IJEA 5DEQA 4RB1A 3I64A 1CF7B 2AHMA 3M8JA 3GF2A 3TBIA 1U5TC 3NEUA 5C4JJ 4G4QA 2LBCA 1D2NA 1XC8A 2F6CA 3J7AO 2FOIC 2PMHA 4RAYA 1KFVA 4AYBA 3JAMK 4JI4M 1XGMA 2FF4A 2VC0A 1OFIA 4F93B 3GTGJ 3E97A 3QOEA 3EETA 3JAMZ 2EFWA 5E26A 1PUFB 4FWHA 5JHUA 5LGTA 4E7ZA 2EFNA 4BHCA 2A6TA 2B9SA 2NVQJ 3IG8A 2L7KA 3QYEA 1IN4A 2RGOA 1LNWA 3A1YA 3SYKA 4LLLA 3HRUA 4BQQA 2WIPB 4A6EA 1APLC 2KPMA 5DV5A 1NV9A 3B73A 3GTLJ 1VQOI 1XXHB 4GKKM 1UGPB 1CGPA 1VDLA 4LITA 3HOYJ 2KZVA 3LA2A 5LHGA 2C6TB 4OR5B 1R23A 2CQQA 1ULYA 2DA2A 2KDZA 2EZLA 5IHYA 5DQWA 4P17A 1QVUA 2O6GE 1BOBA 3FUXA 3W2WA 2NNNA 3Q9SA 3B7QA 2EZHA 3T6PA 3FISA 3I5UA 3N4MA 3S1QJ 2W99A 3J2PB 2Z3XA 4PUSA 4WX9A 3M1CA 3K9PA 2DOEA 3ZMTA 2EIMH 2F5PA 5J40A 3RPUD 5I5ZB 1IY1A 1NSFA 4AI6A 1Z21A 2WY7Q 2C96A 3TPZA 3FTEA 3E6DA 1K79A 3OYHA 2M8EA 1BJZA 4DIQA 2QGUA 4F91B 2PBIA 4EGZA 2G9WA 3A8HB 5K7HA 2QVOA 2JMWA 4NDLA 2VQHA 3GLIA 2F5CA 1W1WE 2DAMA 2Y31A 1F4IA 3CCJI 5D5WB 4CA0A 1JKQC 4A3FJ 2CUZA 4IPAA 1S7OA 3G1MA 1BOAA 2O01F 1OKWB 3GMEA 3ABLH 2RN7A 3BTLA 4NC8A 3K7AJ 3S93A 1JGGA 2HDDA 1K78A 1GDTA 3DFGA 3MWMA 1HT1E 4A0XA 2H27A 4UXNA 4B3SM 2QQ9A 3DTIA 1Q1HA 3J80Z 3AOEA 2WY8Q 5H6QA 2LR8A 3NWSA 1XCVA 1G41A 4FE7A 4PJMA 3RPUA 3TO6A 4JI2M 1QU3A 3ZQQA 3TWMA 2OF7A 3LFUA 1TP4A 4UNOA 1Z0XA 2WV0A 3GLHB 2EQRA 4CH7A 2B63J 2UZEB 3C2HA 3FM5A 4MFEA 3ZRGA 3ZP5A 3RI4A 1QMZB 1SD6A 5EXPA 5IT9Z 2FJ1A 3KZIC 4EM0B 4GH9A 2VQCA 4FASD 2V6CA 1XCBA 2F48A 4AZFA 3JREA 4NXMM 3A03A 3WU2C 4AQYM 3U6CA 4R79A 2L4AA 1YJNI 4YC3B 2DA6A 3B74A 4ESJA 7CATA 1Y39A 5LMKB 1XPXA 3DWLE 1HT2E 3ZQJA 4MNUA 3SHGB 2HQNA 2TCTA 5GP9A 4EOIB 3M8EA 1SFOJ 2H1RA 2LVOC 2QCUA 1QHGA 1J0RA 2K7LA 2X1EA 3PUFA 4E7IA 3KEQA 3UMMA 3I54A 1VQKI 2G9XB 3BHVB 4Q5SF 3W67A 3FF5A 3AG4H 1BA5A 2DMQA 1O9KA 3VOEA 2O5RA 4IBEA 3DBLB 4PJNA 5KAFC 2RQPA 3DTKA 3GRUA 2MR9A 3KVWA 4LF5M 5K5QA 5KAIC 1XDSA 4HF2A 2ZPIB 2FQ3A 3HWSA 3FXQA 3P9CA 1HBXG 3FKJA 3L2RA 3I4MJ 4WWCA 3PVSA 1BJAA 1OIUB 1E9HB 3WVEB 1JUSA 2BW3A 3Q0VA 4LB5A 4HPQA 3HU3A 2K0BX 2JY7A 4UUSA 3SEQA 4UUTA 4LJZF 4IQJA 1K6OA 2XHKA 4BBSM 1DGHB 4LFBM 1ZLKA 1D5VA 3DOAA 4E4HA 3AL0C 1WHUA 5L2WB 2C4GB 5DM6F 1BI1A 4EOPB 1UG2A 2EH3A 3QZ5B 1ORYB 2R6FA 1MJ9A 1HNWM 1SFKA 2X1CA 4BCIB 4WCGA 2IS6A 2ZTDA 1X58A 4JBAA 1YJWI 2F5SA 3FMQA 4ZC3A 2DXCB 3VKGA 4RMNA 2EILH 1KU3A 5EF6A 3B9PA 3VDPA 3J81K 2CQXA 4PJJA 3L2WA 4R1HA 4A2UA 2X1DA 4M3BA 1DGRM 4YHHM 1IBMM 1NV8A 3TW6A 3BQZA 1H27B 3HBLA 4BCOB 4B3RM 3FRIA 1I6HJ 5KQDA 3I4PA 3RDIA 5J8CA 2L4MA 3KP2A 4XKCA 2ZNYA 2JA8J 1IV8A 1QVRA 3DTEA 1DGBA 1KYZA 4LK0F 2R7RA 3RZDJ 2R93J 2A61A 1LE8A 2DODA 3GLIB 2M30A 4YFKF 1NNJA 3OY9A 4F6SB 1Q3CA 1IXSB 2DT7B 1HLVA 4BCGB 1WHCA 1O4XA 3NBXX 4V2FA 3D5RC 4BJTA 3A45A 3KX2A 3HHZA 3L2AA 2XB0X 3F8BA 3Q0UA 4HX4A 3LAJA 1K78B 1VOLA 3UGJA 2CS3A 3OSFA 4IHXA 3HSFA 3BWGA 2MABA 4L5EA 5LMNM 2GLOA 4OU7A 1XDUA 2WMAB 2QF7A 4MGZE 4PDKA 3OS1A 1RIOH 4CFUD 5DM7F 5HS8A 2NRAC 2L0KA 3HOZJ 4P55A 1PRBA 4BBAA 3QP5A 2W84A 5AIPA 1X1PA 2DMNA 1TDZA 4XSZF 2DPUA 2COBA 2EKFA 2MFZA 2P5LC 2PMZN 2XF7A 3OYDA 1W36D 3KS4A 3ABMH 3D1NI 3MY1B 1LDKB 1JKWA 2KJBA 4ESFA 2MG4A 1E9RA 1L3LA 1NJFA 3VFDA 2AHQA 4QPQA 1J5EM 2H8WA 5KPTA 4EJVA 3FWEA 1IC8A 3VK8A 1H6UA 4YOOA 1PJTA 2O03A 2IGOA 3OR2C 1PDNC 1MDMA 1GXQA 2R7UA 4HQMA 1RESA 2DA5A 3BG9A 3F23A 2NS0A 4Y33A 1YI2I 2STTA 3EJ1B 3H4JA 1P9QC 1TTEA 4BKXA 4G94A 2RV8A 1NTCA 4G4NA 2VOOA 3F92A 2IW5A 1IDZA 4S0HB 3HY5A 1YIOA 3FBIB 1HJPA 3QXEB 3P9KA 1Z5BA 4BY1J 4N0BA 3DPLC 2G7HA 4EC9B 1R49A 4P96A 3H3VK 2CG4A 2DFIA 5AIQA 5IOZA 3SBJA 1SVMA 4UUSB 2FNAA 1PJIA 5J1RA 2VOPA 4NC7A 5DCFA 4M72A 3QU6A 3DLLF 3S3MA 1VNDA 2GOMA 1N77A 2ID6A 4V2GA 4E7SA 3FHZA 3RTRA 4U87A 2G0EA 3TGNA 2NVYJ 1P7JA 1H9GA 4GHAA 1F43A 4A69C 4A3JJ 2UUAM 2EO2A 5LMUM 3V7SA 2WIHB 4XLPF 4XR6A 1VG5A 4YIIA 4A0YA 3CP8A 1USTA 1ZN2A 2Q8KA 2FRHA 1V4RA 5EXSA 1D5YA 1FNNA 1W5CC 4CCKA 1D3YA 1QPIA 1HNXM 3GTKJ 4WXHA 2Z99A 4E7LA 1HOMA 1GO5A 4C9YA 2QSGX 1QQIA 1S3SA 2JA5J 2IS4A 5KPZA 3DBHB 1MZBA 1R5GA 2EBIA 3LSPA 1ZK8A 2I7PA 3GZ6A 4FVMA 2R3SA 1U78A 3MY5B 3IH4A 1DPUA 2Z2SB 3CGWA 4G7OF 4A5MA 3A42A 3DU6A 3AJIB 1JT6A 5LGUA 1WSUA 2IRFG 4YIFA 5EG0A 2L9VA 1W36C 4DR6M 2E36A 3BG7A 3EYYA 5E3MA 4UHTA 2ESHA 1LE8B 4B3XA 2QSHX 1GHCA 1TF0B 2PEXA 4UN2B 3PSFA 1U8RA 1JQJC 1B59A 3Q3SA 1PJRA 2BY3A 4RAZA 1EJ9A 1GJTA 1U9OA 2YX4A 1ZG5A 2W00A 2P5VA 2KNZA 2ZJPF 2CWEA 2LK2A 1V55H 4Q47A 4R8HA 4FCYA 2ZXHA 1GUUA 4KT5C 4RA2A 3FKEA 2W85A 1S6LA 6PAXA 3BG5A 1PP8F 2VT2A 2X8AA 2FMYA 2FD5A 4PCQA 1W7PD 2CMPA 4AVPA 4O3MA 1GVDA 3TDZC 3KHIA 1LVAA 3ZQIA 4U0WA 3W2VA 1NHWC 3BJ6A 4IRGA 1JTXA 1URCB 3E6BA 3F8CA 5JFRA 3BR5A 2KT0A 1O57A 4G9YA 3K9OA 1WQ2A 2VQLA 4IQ4A 4ELJA 4BQNA 4F7SB 1YO5C 4B3MM 3GUDA 2DLLA 4JYKA 3A98B 2L09A 5ED4A 4EEFG 5C44J 3I56I 4LG0B 2ZPHB 2CV2A 3JRCA 3CF0A 1I1SA 2IJLA 3CCVI 3X2QH 2JA2A 2RRUA 2XZFA 1MBKA 3NDQA 4BXFA 2V4JC 2ZM6M 4Y3OA 2QYOA 2Z33A 4CFUB 1QBJA 3ISPA 3KFWX 2F4MB 2XKPA 1DGWY 3Q0WA 3K8ZA 5KK1A 1IN7A 1KZHA 3LNQA 3DLAA 3COAC 2BY0A 4G7HF 1YHQI 1IAWA 2PK2A 1OKRA 4QOZC 3BY6A 4DZJA 2IS1A 5LD2C 1GH6B 2M7AA 5ITQA 2QBYA 3WE2A 4QLCU 3E0JB 3G71I 3DP7A 2ECBA 2ZJRF 3FRHA 5F0HA 1FYMA 1QAOA 1LFBA 4A5NA 3K7AM 2Y0SN 1OCRH 2HXIA 2JN6A 2OBPA 3BZCA 5HBHB 3V42A 3JW4A 4QHTA 2FBIA 4AC0A 2O0YA 1YE9A 5IZ7D 4KHPM 2O3FA 2RNGA 3BDDA 1OL1B 2QUFA 3OTOM 4KRCB 1YUBA 4CYCA 4ROEA 4DV4M 2M1BA 3WHBA 3K4CA 5M3FJ 3DCFA 1GVJA 3MKZA 2VODA 1SG9A 2KZUA 1MD0A 2BZTA 4F7JB 4GCVA 1W4MA 1E0EA 2I53A 3BZ6A 4HNVA 4G4RA 1GT0C 3RYPA 2XAUA 3O2PE 4L5JA 4PT5A 1P4XA 1PYVA 3GQ3A 1MJAA 2UXCM 5ERIA 1OR7A 2FBHA 3CC7I 1I3AA 2AXTC 1WZ2A 3RPQA 1FINB 2FXAA 1OFHA 3L29A 1H1QB 3LQ5B 1R36A 2MGWA 1RNLA 2KDLA 2KISA 4M0WA 2R4EA 4LY6A 2XV4S 3SMPA 2VJIA 1ZTRA 2IGKA 4EM2A 4EGYA 3CC2I 5IY5H 3SFIA 3KEOA 2XSJC 2PJQA 2LHGA 2F5QA 3ABUA 3S16J 1F36A 1TT0A 3E5UA 2BNKA 3ZC7B 1MGTA 2I5UA 2OCCH 4R71A 5EG0B 2CZ7B 1VYWB 1IN8A 3J7YJ 4LF4M 1XSXA 2BPMB 1D0ZA 4ZGEB 2EFPA 4C30A 2JP7A 4DV7M 3HHYA 1ZMWA 5EEAA 4MHGA 2DCEA 2EV5A 5LHIA 2HI3A 1UHSA 2KZGA 2MW8A 3GPXA 1D0LA 2D1HA 2EIKH 2KRUA 5ILSA 1IJWC 3M03A 2Z4RA 2OV7A 4KIBA 3WODF 4GYGA 1Q3BA 4Z2YA 4B4CA 3ONQA 2V22B 1XB4A 5KCMA 2FS1A 4RF0A 1WKMA 1Z77A 5FD6A 1F9NA 3SYTA 2V79A 4GEWA 2ZNZA 4F1IA 2R7GA 3K4BA 1DO2A 2KXEA 3O3KA 2DWMA 3CJTB 4MEYF 1OR7C 4IBJA 1T95A 2JQ7A 5LQFB 1AHDP 3WTVC 3FYCA 1VDDA 3OYLA 3REOA 2KW0A 1J2XA 3E5XA 2DENA 3RIRA 2ZJQF 4BE0A 4MGKE 3BLHB 5H20A 5HVYB 1WJFA 2A5YB 2V1XA 1LB2A 1RZ4A 4KODA 1BR2A 5CPRB 3GO5A 4IL6C 2D7HA 2DHRA 3CUQB 4XSXF 5FFXA 4RB3C 1ACIA 4UY8I 4BEHB 1MX0A 1OJLA 1ONVA 2H6BA 1TQMA 1B4AA 4P9UA 3WGIA 1V3FA 2HYJA 3C58A 1LPQA 4PK4A 2CZ0B 1Z3XA 3OYAA 1JHFA 4QOSA 1GL6A 3MHVC 3U6QA 1K83J 4P5OA 2JWTA 5EYRA 5J4YA 4H0EA 1UNLD 2O25A 1X1CA 4D0PA 3WGGA 3AV0A 3ZN1A 2E5NA 5M5YJ 1XX5A 3LL7A 3V7CA 1S7AA 3CMYA 1WJCA 1A36A 2QBYB 4JXJA 4DR7M 3CCMI 1N4MA 4EQQA 3H4CA 2CUEA 2L5QA 2K4BA 1F5TA 3T1BA 2X49A 3IKVA 2DTRA 3BCAA 3G3ZA 2F5VA 1UFMA 2ELKA 2NVUB 2N35A 1J75A 2O61A 4B7HA 1ENWA 4BBRJ 4BCQD 2BE5F 4UV8A 2LXEA 3BG3A 1Y8GA 1IXZA 1HDPA 3CO7C 2J5YA 2VF7A 1K3WA 2XFSA 2K9QA 3BOSA 4EJOA 2KIQA 1OL2B 1MBJA 1EFUB 2JY8A 4LF7M 1UMQA 5EDNA 3GTOJ 4JX4A 1JGSA 3FXOA 1T0FA 4A3EJ 1N25A 2LG4A 3VODA 3K1NA 2BJWA 2Y21A 1HKSA 1JUPA 2OQGA 4MIMA 4WF2A 2L01A 1XB2B 2DMUA 3LOCA 1YSYA 2LDUA 1WGXA 4OB3B 3SARA 1GV5A 2IP2A 3K4KA 4EOLB 5FROA 4XQFA 1K61A 2HKOA 5HBJB 2E19A 4HOBA 3MIAB 2A69F 4LZZA 4YG2F 3RKYA 1VQ7I 4B48A 4N9IA 5FKMA 1TC3C 1FSEA 1D0MA 2ZANA 1GUXB 2OTJI 4YOZA 4HNUA 3KP3A 4HZFA 1A04A 1B6AA 5IOYA 2LVQD 4UV9A 1SAXA 4XBFA 1TW2A 3MD2A 2F5OA 2K3PA 3KXEC 3RE8A 3LQQA 4KN7X 2DKLA 4IBDA 1EKEA 2R5YB 1IZ1A 1A6IA 3K0LA 5DS9A 2LKXA 4ELLA 4D7MA 4YFNF 2HVSA 2IW9B 1GJSA 2LRDA 1X1DA 2DT6A 3HJEA 4CYDA 3E6MA 2R45A 2AO9A 1T0FC 2R7QA 2NQ8C 4B3TM 3KFUG 1G3TA 4DR2M 3WGHA 3R9XB 1IW7F 4LGWA 3FD9A 3CF2A 1IG7A 4I3ZB 1FOYA 2JT1A 1IV6A 2HOAA 3T1HM 1FSHA 2KHHA 2Y69H 2GBYA 3UNGC 1T2KA 2D7GA 2DXIA 2BJVA 1FJGM 3HEFA 4M6YA 3TP0A 2XF6A 2VJJA 3VSKA 2DD5B 1G3SA 3LSGA 2UU9M 5TGTA 4M9ZA 4B47A 1VFCA 4ZDPA 2ME0A 2QQAA 3JSPA 2MH2A 3BJOA 3U6LA 2HDCA 4HSRA 2WZJA 1TQPA 3QU3A 2RQQA 4DOZA 2HPIA 3H0DA 2ZXIA 3VWBA 3U60A 3HRMA 2DWZB 3HJSA 3B57A 1STZA 1YOVB 1R5LA 2VXZA 3BPXA 5D5VB 3SAWA 2B3TA 4JI8M 2DZNB 5BNGA 2G77A 3NAUA 4FTHA 1ZQ3P 3HRTA 2PK9B 4BCJB 1QHHD 4LCBA 4UB6C 1GKIA 3VSLA 3WG9A 1TBXA 1ZH5A 3CP2A 2LHCA 2V1DA 4ITQA 3S1NJ 1TL8A 1RR7A 1Z1DA 3LW5F 3PQJA 2R7XA 2JY6B 5ICPB 4E6KG 3MZ8A 1ZAEA 1Z91A 5EZHA 1TH3A 3IECA 4CCLA 3DDQB 2VQEM 1OQYA 1XMOM 1I3QJ 3SZGA 4LFAM 2VIIA 4RNAA 2Z16A 2F4OB 1MSFC 5BMZA 1A31A 3MJ5A 4MGRA 2KIMA 2JGZB 3VYHB 1JUMA 3GLXA 1BU2A 1WR1B 2JSPA 5BR8M 2HQ5A 3JCUC 2KNAA 2JJ7A 3K4LA 3T38A 5DDGA 3GPYA 1HCRA 3F6VA 3HKZN 1X37A 5FTNA 1QGPA 1TWGJ 2L54A 4C2UA 1J7KA 4UUVA 3ZR8X 2X48A 1OYWA 3OV8A 2F5DA 2LVNC 3FXUA 1JTYA 3H1CA 3V8KA 2C6YA 5DCMB 1TWHJ 2JPBA 2K9LA 4S04A 3ESWB 1B8IA 1RUNA 2B9RA 2MA3A 2C5NB 2YQZA 1OAIA 2G3QA 1ORKA 3FBNB 4F7ZA 4OVZA 3IL2A 1TR8A 4PGHA 1T8IA 1FZPB 5E20A 5IWAM 2XGDA 4DV1M 4EMSA 4BE2A 2HOTA 1MU5A 2KZSA 3PL8A 2IXSA 4ZYEA 2BGCA 2OZ6A 5C3EJ 2ZFWA 1V33A 3T15A 5IT3A 4XL9A 2QZ4A 3BXWA 1KGSA 5CLSA 3OL4A 2L7HA 5L3EA 5EJCA 4AIKA 3S32A 3CJRB 4ZJZA 4ON0A 1DUXC 2XROA 3HM5A 4XK4A 2F5NA 1GL7A 1TNSA 3AKZA 3L25A 4GC9A 2JRMA 3IP4B 4Y28F 4MEXF 1ZREA 4S05A 2C98A 4Y72B 1IUYA 5ICEA 1BR4A 5E1ZB 1RRJA 3ULQB 3HOWJ 4A3VB 2XGCA 5HLIA 1SXJB 3KOYE 4MQVA 2AHJB 3JR4A 5F04A 3RQIA 3G4SI 4HDVA 3EQLF 4XOPA 3W6KB 5FFZA 2WB1N 4DBQA 2E71A 1FYLA 2DQRA 1CQTA 2PJPA 5KNLA 1M1EB 3M7GA 4EOJB 2QKMB 2HR3A 3KOZE 1XMQM 1VQ4I 1XG1A 1IQPA 1WFXA 3WTZA 3HOSA 4LMYA 1KA8A 4M6XA 1HW2A 2E2JJ 2APLA 3R8FA 2XAGA 3Q9VA 2VJ5A 4OMYA 4D9JA 2EUFA 3L09A 3O8HA 1TTYA 4CZZA 3RKWA 1B72B 5HNHA 5ITUA 4AKHA 2HKXA 1SD5A 2Q2EA 2XH9A 2AQFA 4MM3B 2EFQA 3G1LA 1Q02A 4CO8A 3H3UA 3CDLA 2C5RA 1XMKA 3QOPA 3I01M 5A2QS 3RGPA 4M71A 1SFEA 4IHTA 2CHGA 3KSJA 2ZB9A 1FOWA 3TMOA 3PIPF 4FCWA 3DPTA 3TP3A 3UKGA 1I50J 2FFJA 4BCMD 2M60A 1QDTA 1Y8QB 1Y6IA 1LDDA 1FPQA 1MH4A 3AOGA 4B7FA 2ELJA 3A02A 2ID3A 4N4OB 5B66C 4I01A 5BS6A 3CCEI 4GRIA 4X65M 3O8GA 1IUFA 1U5TB 9ANTA 4XN0A 1K6YA 3KE2A 3OIQA 2HHHM 3QRFF 3J80K 4KLNA 2VBYA 3CJQB 2A6HF 1JJ8C 5BPVA 1EH6A 2DPPB 2L3DA 1QUTA 2HZTA 1EA3A 2IA1A 2X51A 2GWRA 2DAKA 2DDBA 1KU7A 2YSRA 4BHBA 3OYEA 2XKOA 4KN4X 4JV5M 1L1TA 2EUCA 2K47A 2HL7A 2YU3A 3DL1A 1I6XA 4L9TA 2DBBA 1FWZA 4F70B 4XKWA 4IJFA 1L1ZA 4IBKA 3GEZA 4IOAF 5IT9K 4A3GJ 2JUGA 4F55A 1RR8C 2R92J 5C1BA 3F0CA 2AS5F 3B6CA 4YFXF 3F21A 3TNIB 1TH4A 4EC8B 1VQ8I 3NRVA 2CCHB 4UN0A 4XK8F 2PMZA 3KZYA 4L9VA 3DEWA 4DYCA 2DAEA 2R7TA 2DVWB 2XEPA 1BIBA 2FEZA 4XKVA 2MYSA 2MLKA 3CC4I 3BZKA 2MD0A 3WTYC 3O6BB 2TRTA 3R4KA 3GO8A 5K5RA 2ISZA 4ZZLA 3W68A 2W25A 2KL4A 3DV8A 2EWNA 1ZRCA 5AONA 3IUOA 3SATA 3L26A 3IG5A 4LG3A 1OYYA 5FO5A 1NHGC 4AG5A 4Q7JA 1ODDA 3VYSB 2LH0A 2W7NA 1G2HA 5F3WA 2XGNA 3ZMDA 2DPDA 4YIRX 1IN5A 3H35A 2A3SA 5L3FA 4PDIA 5ITTA 2M5ZA 4BCND 3LSIA 2VI6A 3HHXA 3BTCA 2G7UA 3EIHA 2K4JA 2OPTA 4J00A 2F4IA 4LOCA 3RQ4A 5ICGA 1R71A 4U7BA 1XNRM 1VINA 1MBHA 4LJ9A 1S3JA 2M7BA 2CEAA 2K86A 2KRFA 4MO7A 2HPMA 2WJ9A 2CQ7A 3KDSE 5FRMA 2LKPA 4IVNA 4O5VA 2Y2ZA 3FZVA 3GFJA 3IKTA 3RGSA 5ITYA 1VQ1A 1VQLI 3H9QA 5K7FA 4PDGA 2WADA 4JI6M 3K10A 1ON2A 1TWAJ 3JRGA 4AYBN 4LIVA 4B7GA 2WAFA 3JRAA 5ICFA 2ZPBB 2MH9A 4AW4A 3WE3A 1YITI 1TFBA 3BC8A 2PQ8A 4JI3M 5GPCA 3K1MA 2WPAB 1MW7A 1OCCH 4ASNA 2BVLA 1BM9A 3LAPA 1HQYE 5GTHC 1W0UA 1QNTA 4EJWA 1E17A 1V5GA 4JP0A 4BY1X 4GITA 2P7CB 1QAQA 2DFEA 4GDFA 1MJBA 1ITYA 2LYCA 2JSCA 2V9KA 3KYCB 4XNFA 1D8JA 1WJBA 2DI0A 5M5XJ 5EZGA 3U2RA 4IKFA 4II5B 3CLQA 2KP6A 1ZGAA 4YY3M 1KYIA 2CYYA 2M8GX 4XKBA 3POMA 2L7ZA 4G6DA 4RKUF 2DJIA 5B1BH 5J4VA 3W6VA 3DJBA 1WJEA 4LRSA 4H4KC 3GRYA 2V1CA 1E2XA 3M8FA 1WJ5A 2YR2A 1YW7A 5F64A 2XRNA 2KMUA 2P5TA 2STWA 2A6EF 5LRSA 4BLCA 3QPSA 5HLTA 3WTUC 4U7DA 1DU0A 4IX7A 5H37D 1WCMJ 4HBLA 2EA4A 1DGGA 4YEJA 4KA4A 3DEEA 3BTIA 5BQTA 4BDZA 1VZ0A 1DO0A 2PMIB 1KSFX 2A68F 2LY9A 4IBIA 3G1OA 3SQNA 1ZHFA 2R7VA 4AKIA 3LVVA 4CCJA 1ETYA 3B7ZA 4WW0A 1SD7A 2HOEA 3SFZA 3S15J 3BPVA 1FKMA 2KFDA 2OO9A 1L8QA 3HUGA 1G4AE 2J7NA 5K5OA 1G71A 1NHAA 5FKKA 4RGUA 5D6EA 2QENA 3JRHA 2HWVA 3AL0B 3QPHA 3FYDA 3C2GA 2DDAA 4DNCA 1FBUA 4UVBA 1X19A 4M3GA 3F6OA 4NB5A 3ROUA 3L27A 4HDUA 1PKDB 3WTSC 4M3FA 2HTSA 2P0WA 3MEXA 3M3YJ 2GNOA 5DYGA 3OOPA 3DOGB 3Q8GA 3KETA 2YFQA 4A3IJ 3PFIA 2WA0A 5HNBB 1I94M 5GAEJ 5HLGA 3C9PA 2ELHA 4GC5A 2CP8A 4D1QA 4REZA 3HHHA 2XSZD 5FTLA 4ZTJA 2Z9OA 2R7ZJ 3J7AS 2DA4A 3GXOA 5CJ9A 1WH5A 4II2A 2ICWG 3TL4X 3GLFE 1KXUA 1P4WA 1R1TA 4QNMA 1T39A 1AKHA 4NL4H 1P2FA 3CQZJ 1O9KB 1V54H 2UWMA 4LG2A 2R7DA 2VBXA 4OINF 1FEXA 3QYGB 1WI3A 3G73A 1BN5A 4RM3A 2O8KA 3HTSB 3EUAA 5TRDA 2R18A 1JSUB 3TO9A 2LY2A 4IBFA 3SZPA 3U21A 5KQ8A 2BW3B 2PI0A 3QQAA 1IO2A 2KRHA 2FE3A 3GTJJ 1HSJA 4B8XA 3HB9A 5D8LB 1OYIA 2COMA 1T3TA 4OAZA 1EH8A 4ENJA 2Y0SA 2E1MC 3HPHA 3K4NA 4XLEA 3IV5A 3DFZA 1DQUA 3AG3H 3THGA 2KLOA 3T5XA 4BE1A 2MLGA 2Q0OA 3HOUJ 3AAFA 1K4TA 3GLGE 1RKWA 4MGIE 2UZBB 4BCNB 4DQ2A 1T6SA 1GABA 3TE6A 1S29A 3MMPA 1ZARA 1H8AC 1TGUA 4NRVA 4XBOA 2BEOA 1UAAA 2IVXA 2Q1ZB 2CGPA 2W1OA 2CO5A 2GXGA 5A2QZ 3A01A 5D6FA 1X2NA 2K85A 4I0AA 2YUSA 4XMYA 3WHLA 1ZQ9A 4HV5A 1ETKA 3V4GA 1SVLA 4DW6A 2V7FA 3OS2A 3ZGKA 3HPGA 5DD8A 4WK8F 3KP5A 2ZZDB 1SAUA 2CW7A 3TKYA 1H9TA 1YFHA 3SASA 4PZJA 3E9SA 2LREA 2CJMB 1BC8C 4DR3M 2D1VA 2UZKA 1YX3A 4AUXA 3OIPA 3VYGB 5CVUA 4I09A 3VDXA 2HVQA 1ETQA 4TTHA 2LVAA 4ZDLA 2X6OA 4NQWA 3PFYA 2LBFA 4IHWA 1O7FA 2X1NB 3U61A 3K9TA 4M0DA 3BROA 3S3OA 4Z8XA 3SJMA 1J9IA 2F2CA 2X6WA 2VE8A 3IH3A 1QQWA 2PN6A 2QZ8A 1YLAA 3HGGA 3W0LB 4CRLB 1FP1D 1E3OC 3HSRA 4U0VA 2QDYB 3EPZA 1DDNA 1H1PB 3M6AA 3V8LA 4CZCA 4DBRA 1S72I 4CFMB 4DBGB 3SAVA 3GBGA 2YR0A 4D5CA 4JYAM 2H94A 2LTPA 2GZWA 5GPAA 3I59A 3U6OA 3CD6I 4NUBA 4AM3A 2BS4A 1UELB 2Y0MA 5E8IA 2JPCA 2XVCA 2Y75A 2R46A 4GGGA 2KQRA 2L7MP 2V6EA 3PO2J 3ZXSA 3E5QA 1OFCX 3PM1A 2DW4A 4BQOA 1D0XA 5JHFA 1H0MA 5LEKA 1MDMB 2ZPEB 3QAHA 2OJED 1KYWA 4EM1A 1Z7LA 2EJSA 4ZH4F 4DR5M 1W7PA 1QVTA 4IIWA 3MKWB 1I39A 2R7SA 3L28A 3SZTA 5DFLA 4X62M 2JUJA 2GIZA 2EZKA 1EF4A 2DMEA 1LFPA 2W48A 3GZNB 2W4SA 5IP9J 2VDBB 3KP4A 3V8JA 2FX0A 1UM8A 4GXOA 3RCOA 5HODA 2D7EA 1RC9A 3GLFA 2YX7A 1U3EM 1NO1A 2VPLA 3K92A 4NNJA 1R5HA
chains in the Genus database with same CATH topology
4NC6A 4HNUA 3HZJA 1UGPB 2DXCB 3VKGA 5EJCA 3A8MB 4LOCA 3HB9A 2CZ7B 2CYZB 4P17A 4OB0B 2WJ9A 4JX6A 2ZCFB 3TW6A 3HBLA 4HLQA 1UGSB 2QFZA 4AKGA 4ZGEB 3X24B 4HL4A 2ZPBB 4AI6A 2BS3A 4ZGJB 2AHJB 3WVDB 1UGQB 1AHJB 3HHTB 3A8HB 4BBRM 3TW7A 2DD4B 1QLBA 3BG5A 3X28B 1E7PA 4MFDA 2QF7A 3QYBA 3KHIA 2DD5B 2ZZDB 4ZGDB 3A8LB 4AKHA 4ELJA 2CZ0B 3VYGB 2KR6A 2ZPHB 4M6VA 4JX5A 4MFEA 2DXBB 3QYHB 3A8OB 3HO8A 2G77A 2CZ1B 4Z6YA 3VKHA 3H4CA 4AKIA 3BG9A 2ZPFB 2QDYB 3X26B 2DPPB 4HNTA 1FKMA 2D0QB 2ZPGB 3BG3A 3QXEB 3VYHB 2BS4A 4OB1B 2QQ8A 3DL1A 1V29B 4JX4A 2ZPIB 4MIMA 3X20B 4QSHA 2ZPEB 3WVEB 3QZ9B 4OB3B 1UGRB 2QDJA 4HNVA 4BBSM 2CZ6B 3X25B 1IREB 2BS2A 4OB2B 4FM4B 2KMGA 3QYEA 3A8GB 3QYGB 3QWLA 3QZ5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJC A;  2QQ8 A;  4NC6 A;  4HL4 A;  2G77 A;  3QYB A;  3HZJ A;  3QYE A;  4HLQ A;  2QFZ A;  4P17 A;  4Z6Y A;  3QWL A;  1FKM A; 
#chains in the Genus database with same CATH topology
 3I51 A;  3L1P A;  3IRR A;  2R4J A;  2JTV A;  1ZRF A;  4LLN A;  4RB2 C;  2KHM A;  3I53 A;  4KJZ A;  4CGZ A;  2L2O A;  3T8R A;  3KPH A;  1T43 A;  4BUP A;  2L4F A;  1QAM A;  2XZU A;  3W0F A;  5GKN A;  2VQF M;  4ZYG A;  1Z6T A;  2LP0 A;  2CYZ B;  1MJG M;  1R7R A;  1OAO C;  1NG6 A;  3SDB A;  2V1N A;  2JNH A;  1N36 M;  1V5F A;  4X66 M;  3HRS A;  5J47 A;  3MN2 A;  4J01 A;  4XIC A;  2M45 A;  3HHW A;  4G8X A;  3I4V A;  2ZAO A;  3KZZ A;  4D82 A;  3GLL A;  4A3M J;  2ZTC A;  1SD4 A;  3GQ4 A;  1TWC J;  1PP7 U;  5IRE B;  3E4R A;  1HST A;  3GLG A;  1UCR A;  3E21 A;  4LZJ A;  2UXD M;  1PJS A;  1MIJ A;  3U1K A;  3ZMU A;  5IP7 J;  3A46 A;  1E3P A;  1OMI A;  1WJ7 A;  2YU9 J;  1FVV B;  2RGV A;  1MMS A;  4F92 B;  3B89 A;  4I76 A;  4KRD B;  2DO7 A;  2LVP C;  3LWF A;  1H1R B;  3FK7 A;  1U8B A;  2JXN A;  3TW7 A;  4M9X A;  2DD4 B;  1QLB A;  1R22 A;  2LH9 A;  3HOV J;  3OYN A;  1FTT A;  1DPR A;  5IDP B;  3BBZ A;  4BAC A;  2CW8 A;  3FM3 A;  2UUB M;  4AD9 A;  2ZCW A;  3EUH C;  4G6Q A;  1SMY F;  4EIW A;  2D45 A;  2K6B A;  5HDK A;  3S1R J;  3BT9 A;  3ZQF A;  5F0F A;  1XMA A;  3JRF A;  1VQ9 I;  4QPO A;  2BV6 A;  3ZN0 A;  5IPA A;  4Y15 A;  1F5Q B;  1XS9 A;  5E18 F;  2LBF B;  3BTJ A;  2JVH A;  3DA1 A;  2XLJ A;  2M0M A;  2IW6 B;  3C7J A;  1JJ6 C;  3OSG A;  3FIW A;  3RKQ A;  5FTM A;  1UHM A;  5EGO A;  1TZL A;  4KIC A;  3UR3 C;  5D4S A;  3GCM A;  1Y56 A;  4QWQ A;  3S8P A;  5ICC A;  2BKZ B;  1E3H A;  3K69 A;  1H28 B;  1BI2 A;  4NHJ A;  3BJA A;  2RC4 A;  3K1P A;  1X1B A;  2D2W A;  2DQL A;  2L02 A;  5DD4 A;  2LVS A;  1N75 A;  4QTR A;  4CCO A;  4FQG A;  1P3Q Q;  2LKS A;  2H09 A;  2K9N A;  2BXY A;  3D8B A;  2UUE B;  3I59 B;  5D5X B;  5FKL A;  2M3A A;  2ME6 A;  1MMG A;  1HKQ A;  1FOX A;  3J7Z I;  1FIP A;  3BR0 A;  4YEL A;  1FJL A;  2DOF A;  3MKY B;  3L2C A;  3D5S C;  2ZO4 A;  3SDG A;  5D8K B;  1PJJ A;  1POG A;  2K02 A;  5FKO A;  3ZMS A;  4OB1 B;  2O7O A;  4IMY B;  3C3D A;  1WH7 A;  2OOB A;  2FA5 A;  2XF5 A;  2HQR A;  4FD2 A;  1V5E A;  4KIG A;  3ZPL A;  4NSO B;  2QPA A;  2M0C A;  3HXL A;  3ERE D;  5E3O A;  2PX9 A;  1W7P B;  1ZGW A;  3FXK A;  2VB6 A;  1WVR A;  2UXN A;  1KU2 A;  2VC1 A;  3C3E A;  2MC3 A;  2CRG A;  2CV1 A;  2R44 A;  4G3O A;  4DV6 M;  2FNP A;  2VKD A;  2WFY B;  2IT0 A;  4E7H A;  3M07 A;  3GLF B;  1UGR B;  4F52 A;  2VIX A;  3ERM A;  4I0B A;  2IW8 B;  1GV2 A;  1IRE B;  1Y1W J;  4Q48 A;  1UZC A;  4HEO A;  1LFU P;  5EP2 A;  2DA3 A;  5JI6 A;  5JI2 E;  1W98 B;  3CF6 E;  4XON A;  3GX4 X;  2R62 A;  1EV7 A;  2B0L A;  2VE9 A;  2DK8 A;  2XRL A;  5D5U B;  3RZO J;  1H1S B;  1BIA A;  3MZY A;  3RSN A;  4CYC B;  3HYI A;  1DP7 P;  2HXO A;  4OGR B;  3HZJ A;  1WJA A;  2RVC A;  5E3N A;  1IF1 A;  2DHY A;  1YX5 A;  4XID A;  1E9S A;  2ERC A;  2BWE A;  4BCH B;  3EDP A;  1XWI A;  2MGQ A;  3VB2 A;  4WP2 A;  3E46 A;  2OOA A;  2LWX A;  3AFH A;  1ZR4 A;  1SC7 A;  2EB7 A;  4LFU A;  2QLZ A;  2C9O A;  3I4Y A;  2H1L A;  2ZXJ A;  2DAI A;  4ETS A;  4LGM A;  4CFN B;  4HLQ A;  4AKG A;  2UXB M;  1H88 C;  4BCK B;  3GLG B;  2Z3Y A;  2BXZ A;  2BVM A;  4L18 B;  4B43 A;  4NOO B;  5HLH A;  1YS7 A;  1T6O A;  3M1E A;  1Q1V A;  3WHK A;  4ANR A;  4HEA 2;  3EUK L;  3NQO A;  1OKV B;  2BS3 A;  3HJQ A;  1Z9C A;  3J27 B;  2WSE F;  5EP3 A;  1SFX A;  1Z67 A;  2I8D A;  3GLH E;  1HQC A;  1Z7U A;  1J5Y A;  2B7E A;  4X0G A;  4FX3 B;  4L16 A;  4BBS J;  2WHB B;  3H4M A;  1FP2 A;  4BS9 A;  2H6C A;  5C4X J;  3M4O J;  2XAH A;  4GMQ A;  4DV2 M;  3D5L A;  2ZME A;  3FXL A;  2MBF A;  1MMN A;  3F8N A;  3HX3 A;  4NBQ A;  2DAG A;  1QZY A;  2VXD A;  2Z4S A;  5CVJ A;  4B3A A;  5K7Z A;  2R5Z A;  2IGN A;  3DU5 A;  2FE8 A;  2W96 A;  3ABT A;  5FJ8 J;  5FRN A;  2K9D A;  3C18 A;  3ZCB B;  4I2O A;  2FOK A;  2ZC2 A;  2C5O B;  1FBQ A;  5EGO B;  2F2E A;  3BCB A;  3BLQ B;  1D3U B;  3DBR B;  4I5S A;  1FT9 A;  3CDH A;  5L3C A;  3U9G A;  1F1Z A;  3PQK A;  2VN2 A;  4F3Q A;  1LUJ B;  2WEV B;  4PSW A;  2FQ4 A;  4P9F A;  1F4K A;  5CVR A;  2V26 A;  4ANJ A;  5JVT A;  4A3D J;  1QRY A;  1KON A;  2W9Z A;  2CUJ A;  2HEO A;  4MH0 E;  1I27 A;  1IRG A;  3N05 A;  1CF7 A;  1N33 M;  3TNH B;  3QYF A;  4HX8 A;  3W3C A;  3HL2 A;  5BOX A;  4RS8 A;  2XF3 A;  4LJ8 A;  4DV0 M;  2UV1 A;  2W57 A;  2E5L M;  2PMU A;  2CSO A;  3F8F A;  3X26 B;  3VLF B;  2VBZ A;  1IXR C;  2WB1 A;  4NXN M;  2LY1 A;  4QIW N;  3F72 A;  4I8O A;  2QCO A;  2PG4 A;  2IEK A;  5BPI A;  4G6L B;  1PUF A;  1N78 A;  1A5J A;  1WGL A;  4JOM A;  3A4C A;  1JKR C;  1JKP C;  1ZRD A;  2ZME C;  1P92 A;  5LLQ A;  2I40 B;  2CWB A;  3H5R A;  1O3T A;  2C5V B;  5J3L A;  1TWF J;  2JZ1 A;  1OIP A;  2JA6 J;  1ETX A;  3MQ0 A;  2KEB A;  3HDD A;  4BY7 X;  3LSK A;  2J7O A;  4G12 A;  2HCB A;  1KU9 A;  1X1A A;  3X20 B;  4QSH A;  2CE7 A;  3TED A;  3LMM A;  4OX9 M;  3K1J A;  4IO9 F;  1UB9 A;  2OQR A;  2DMT A;  2L4E A;  4OAY A;  3K4J A;  4KIS A;  3OYJ A;  2VLA A;  4EOM B;  1Z5C A;  1MBE A;  4JI0 M;  1FYK A;  3W2A A;  3U1D A;  3UZU A;  2E7W A;  4CGY B;  5FD5 A;  4BCF B;  3S2H J;  2DA7 A;  3R6S A;  3Q5F A;  2FSW A;  2OPF A;  4HST A;  1YTY A;  4FIS A;  1C9B A;  1MND A;  4ZYD A;  3TNW B;  2WAQ N;  3OS0 A;  4NC6 A;  2MH8 A;  3U6E A;  4O6J A;  2DZL A;  1MMA A;  5K1Y A;  3NWL A;  4XOT A;  4KMF A;  2CRU A;  1QYR A;  3J81 S;  2TDX A;  2C5X B;  4M73 A;  5F27 A;  2LC2 A;  4CIZ A;  1GY3 B;  2Y9Z A;  1HF0 A;  1EIJ A;  4DV3 M;  2ACJ A;  3S2D J;  4JX6 A;  3DF8 A;  4AIJ A;  2L7F P;  2X85 A;  1YLF A;  4ZYA A;  5JLX A;  4BCQ B;  3B02 A;  1R1V A;  2HQA A;  1LVK A;  2R7W A;  5F08 A;  3E6C C;  2QFZ A;  3U6M A;  3ZQC A;  2OTL I;  1QDR A;  3WTX C;  5IP6 A;  1QAN A;  2DAO A;  2NAZ A;  1KQ9 A;  2WTE A;  2F4V M;  4C3I J;  4OOI A;  1UHW A;  4DZP A;  4D5F A;  1WGN A;  4DJA A;  3K4M A;  1FMV A;  4ZGJ B;  1FC3 A;  3IHP A;  4TV7 A;  2GAU A;  1K7A A;  2MJ5 B;  4Q4Z F;  4EOR B;  3LA7 A;  5ITX E;  3VK7 A;  1A6Q A;  2CU7 A;  4ZYH A;  1GLN A;  5L3D A;  5ILU A;  1OI9 B;  2F5E A;  3LFK A;  2E2H J;  3GLH A;  1QO0 D;  3HC7 A;  5H6R A;  2R5Z B;  4FCT A;  4Y17 A;  3JTH A;  4L9J A;  1VEK A;  4XGI A;  4LJA A;  2ZXW H;  5J6X A;  4AWX B;  2H5X A;  3CES A;  2DK5 A;  3QYB A;  1L2D A;  1TT5 B;  4A3K J;  2R4G A;  3ZH9 B;  3ZQ7 A;  3A0H C;  4X64 M;  2EIJ H;  2M2E A;  1G3I A;  1Z05 A;  3TO7 A;  1EH7 A;  4BY7 J;  2KIF A;  3L9F A;  2OZU A;  1JOW A;  2PHG A;  5BNJ B;  3DTO A;  4D7N A;  4ROC A;  3TWK A;  3MAJ A;  2A5W A;  2L9N A;  4DUZ M;  2ECC A;  2KR6 A;  1WJD A;  4C3H J;  1L2B A;  3LSH A;  2NXN B;  1XMX A;  4ESB A;  4CCN A;  1H4L D;  1LJ9 A;  3LQR A;  4HW0 A;  3JRD A;  1NY6 A;  4CIS A;  3JRB A;  5JI3 E;  2O8X A;  3VYR B;  4V19 K;  5DYM A;  4ABZ A;  3HO8 A;  4UVA A;  4CFX B;  3CLO A;  2LTU A;  1G6N A;  3MI9 B;  5ITR A;  4GYI A;  5JLW A;  2OQ4 A;  5B1A H;  2AXL A;  4DUY M;  1QPM A;  4OIR F;  4BYY A;  4HX7 A;  4LF9 M;  3FXM A;  1TH2 A;  5M3M J;  3TQS A;  2HOS A;  1RI7 A;  3GP1 A;  1G4D A;  5CQG A;  2EA2 A;  3HGI A;  2GQQ A;  1DGH A;  4IBC A;  3U60 B;  4BU2 A;  3E7L A;  5FB2 A;  1H26 B;  1TD6 A;  5EP4 A;  4F7L B;  1T56 A;  2ADU A;  1FIA A;  1RU3 A;  5HOO A;  3PJR A;  4MGY E;  5FGM A;  3QAU A;  4ENK A;  2DI3 A;  1IN6 A;  2OUM A;  4KUM A;  5IYB J;  1VQM I;  4IHY A;  4B08 A;  3SAU A;  2JZY A;  3HKP A;  4XRF A;  5FKN A;  1NH3 A;  2QQB A;  3DKY A;  4BAY A;  5GAD J;  1LKX A;  2LNB A;  1VF9 A;  2LMD A;  3R0J A;  3PXG A;  4K0K M;  1FMW A;  3OOU A;  3VEP A;  4A3L J;  5CEI B;  3KP0 E;  3H9G A;  4XRM A;  2OU2 A;  3QZ9 B;  3OYM A;  4CJ6 A;  2IVM A;  1SEU A;  2CZ6 B;  3CCU I;  3FK6 A;  2W9F A;  2VAS A;  3HGY A;  3MCZ A;  4R3D A;  2R0Q C;  2BS2 A;  4BJ5 C;  4FM4 B;  1E94 E;  1N34 M;  1XSD A;  4ZDO A;  2HFH A;  1JB0 F;  3VFZ A;  1J09 A;  1USS A;  1IBK M;  3QWL A;  4KT6 A;  3JRI A;  3P9I A;  4BH9 A;  4EOO B;  1S7E A;  2BY2 A;  2PLY A;  1MMD A;  2C99 A;  1CUK A;  1BW6 A;  5J1U A;  3ZCO A;  3BLR B;  2FH0 A;  1IDY A;  3FMR A;  1IXS A;  1ZLJ A;  4WXD A;  3DPU A;  1O3Q A;  1X3Z B;  4BJ6 C;  3Q8X A;  5L8R F;  1T33 A;  1TLH B;  4TUW A;  3G2B A;  3R0A A;  5CVI A;  1R58 A;  5F0C A;  1B8I B;  5EFQ B;  3KLO A;  2JWS A;  2QP9 X;  4GIP A;  3DXJ F;  4OVZ B;  3IH2 A;  3S3N A;  1UGS B;  4C2T A;  4YRV A;  2N8G A;  4M74 A;  4MTD A;  1AUA A;  2QHO B;  1D1C A;  5EQT A;  1HNZ M;  1SMT A;  1RUO A;  1T98 A;  4BB9 A;  5IYD J;  1Y0U A;  3OYF A;  2X4A A;  2NYX A;  4ROD A;  1HW1 A;  2GOX B;  2LSO A;  2HWJ A;  4ENM A;  1Y1V J;  2Y9Y A;  1ETO A;  3HHT B;  4ZZD A;  4BBR M;  1YIJ I;  1JHH A;  2NNY A;  4KNY A;  4D81 A;  3BR3 A;  3LVW A;  3C3W A;  5ITX A;  4M3E A;  3RFW A;  4IHV A;  3TN8 B;  3RJP A;  2X6Y A;  3T0Y A;  3WHC A;  1S5L C;  4I98 B;  5DTD A;  1FBS A;  4RLF A;  1PGY A;  2VBW A;  4CXF A;  4CDG A;  2LW4 A;  3TQN A;  1V34 A;  3QHW B;  3KOX E;  4P1W A;  2E35 A;  4I99 C;  4L0Y B;  5IDN B;  3VYT B;  4EOQ B;  4JI1 M;  1BW5 A;  4N4N B;  4XLN F;  1P7I A;  1TQI A;  5EXX A;  1G3Y A;  1PM5 A;  4FE4 A;  2GM4 A;  2GA1 A;  5HQ0 B;  3FX3 A;  2YS9 A;  2CJJ A;  2H1K A;  1XHB A;  2HNH A;  4BXU A;  3OWT A;  2DYR H;  3LSM A;  2XFT A;  3AOE C;  3DKX A;  2FU4 A;  4LGY A;  4PSX A;  2GQF A;  2CQN A;  1B1B A;  4B09 A;  4FX4 A;  5EP1 A;  1BBY A;  3TDU C;  4Z6Y A;  2CZ1 B;  3CDI A;  4FW9 A;  2E1C A;  5ACB A;  4AID A;  4CUG A;  3L00 A;  3R61 A;  3KP1 E;  2L7I A;  2Q2E B;  4G4O A;  1AA7 A;  5E17 F;  3MK6 A;  1OCO H;  2W82 A;  1L2C A;  4PGG A;  2QEX I;  2GXB A;  1HA8 A;  3F9K A;  2P6S A;  2EZI A;  2X0L A;  4U88 A;  1W5S A;  1H24 B;  4DR4 M;  3K2L A;  4IBG A;  4CFV B;  1AD6 A;  5HDN A;  4KIT B;  4PJL A;  5KHD A;  2RNJ A;  2W24 A;  2BOL A;  1R4G A;  1R4N B;  5CYV A;  1V29 B;  1ZR2 A;  2ZKZ A;  4KFC A;  1UNG D;  4S12 A;  4FCV A;  3CTA A;  2ESN A;  3PUB A;  4EVI A;  5J1Y A;  4CFW B;  5F6F A;  3PIO F;  4NRW A;  3J81 Z;  4L0Z B;  5C18 A;  1OLT A;  1ENH A;  2HS5 A;  1VEJ A;  2KRK A;  2OA4 A;  3O0G D;  2PJR A;  2BBY A;  4GHL A;  1L0O C;  1U9N A;  2IBD A;  1C7Y A;  4CSW A;  1ZMU A;  3PO3 J;  1AU7 A;  4P16 A;  5GAG J;  1LEB A;  3B6A A;  4OB2 B;  3LSJ A;  4IBB A;  2IGM A;  3A8G B;  4IJA A;  3TOA A;  4IZZ A;  4I6Z A;  3F5X B;  4LIU A;  2KNV A;  3UJN A;  4X1E A;  2DMP A;  3FMS A;  4MTE A;  2NOJ B;  4BCM B;  3D0S A;  1K3X A;  4BCP B;  4HLX A;  1G59 A;  3KS8 A;  5GAH J;  4HQE A;  1Y0N A;  1VEG A;  4LF6 M;  5LBQ A;  4L8R C;  1FLI A;  4L5I A;  3VDU A;  4IXA A;  2EV6 A;  4WXC A;  3GFL A;  3DZD A;  3LCV B;  5E1X A;  4RAF A;  2R7F A;  3CCY A;  1NK3 P;  4ENN A;  4F7N B;  1OKS A;  3KYD B;  2DOA A;  2HVR A;  5FTK A;  3LA3 A;  3MMY B;  1ZKG A;  3ASN H;  1PJQ A;  1U0J A;  2FOW A;  4UB8 C;  2A07 F;  4OW0 A;  2QKL B;  1X2M A;  3DEU A;  1C0W A;  1IRZ A;  5FGK B;  2WC2 A;  3HJ8 A;  5BPD A;  3IWZ A;  4HL4 A;  4ZTF A;  4LF8 M;  3A2K A;  2CCI B;  2FBK A;  4G6Z A;  4RAG A;  3T8T A;  3P5J A;  5FLX S;  4XLA A;  2MRO B;  1YQA A;  2RRE A;  5FTJ A;  3HOT A;  3FTF A;  1LEA A;  3BR2 A;  2UZD B;  2R65 A;  2P81 A;  3VPR A;  3JTG A;  4HA8 A;  1X3W B;  2CFO A;  3MKL A;  4K2E A;  4LG0 A;  1R00 A;  1NG7 A;  2LF7 A;  2QM3 A;  3KP7 A;  3QPL A;  2M87 A;  4M9S A;  1IRX A;  1BL0 A;  2VT3 A;  4MFD A;  2G5G X;  1G3N C;  5HBE B;  3FXJ A;  4DV5 M;  4BGD A;  3CCQ I;  3ECH A;  2XSZ A;  4RDU A;  4N9H A;  4IHS A;  1G3W A;  4BXX X;  4CXA B;  4IRI A;  1MBG A;  1QA6 A;  4JK1 X;  2R0I A;  3OYG A;  1XGS A;  3A0B C;  2EIN H;  3KOW E;  8CAT A;  2L9S A;  3FTC A;  1I5Z A;  5KVR A;  4XRS A;  1Z5A A;  2M34 A;  2V1U A;  1S8N A;  3NWT A;  5A2Q K;  2QSF X;  1NY5 A;  1OCP A;  5JVG F;  2VUM J;  3S14 J;  1ZMV A;  3L2U A;  2E2I J;  4BNC A;  3QYH B;  2ZSI B;  4CCM A;  3N97 A;  2OAZ A;  4AG6 A;  1R6R A;  4PCZ A;  1WRJ A;  5IYC J;  1HDD C;  4PFP A;  1VQP I;  1W5T A;  2XB5 A;  2NS8 A;  5LGN A;  2XPU A;  2QNJ A;  5B3S H;  2KA6 B;  4RB0 A;  2IPQ X;  3WG7 H;  3GTP J;  2ZPF B;  3GYH X;  4FHT A;  2W2H A;  1R4M B;  1LQ1 A;  3FHN A;  2RKO A;  2D0Q B;  4F2L A;  5IF1 B;  4L78 A;  2NOG A;  1QZM A;  3JR9 A;  3NBI A;  4JI5 M;  2L9R A;  2VKV A;  1OTR A;  2F5F A;  3IAM 2;  4G6T B;  3OYB A;  2NVT J;  3ZMZ A;  4XLH A;  3FUU A;  4XRS G;  3GVA A;  2VKH A;  3H92 A;  3J7B A;  2ZFU A;  4M3D A;  2J5P A;  2QGS A;  4HYE A;  1O7L A;  5E6J A;  2GIV A;  2CQK A;  2Z1D A;  1JXS A;  2D5V A;  3BOQ A;  2PJR B;  5ILV A;  2EJR A;  1ZG1 A;  2WWY A;  2DZO B;  1R5I D;  4KIF A;  4OWR B;  2MD5 A;  4HF1 A;  2K3F A;  1ON1 A;  2GA2 A;  1ZV1 A;  4PJ0 C;  4LRT A;  3HUG B;  4JQF A;  1SVO A;  2QDJ A;  4QHS A;  1FOK A;  2RAE A;  1A5T A;  2E1M B;  3I4N J;  2P5K A;  2WSC F;  4I7H A;  1DGF A;  1P4A A;  1OGU B;  1T38 A;  2V9P A;  3PO3 S;  1AOY A;  3AG2 H;  3EIE A;  4DYQ A;  1Z59 A;  3I55 I;  3BLY A;  4LJ5 A;  2DFF A;  1LDJ A;  3H9J A;  5E3L A;  2XAJ A;  3IRQ A;  2MC4 A;  1LV7 A;  1T08 B;  1U6G A;  3K6G A;  3A8M B;  3IC7 A;  5HDG A;  4A93 J;  2K9M A;  2P8T A;  4BXX J;  1UNH D;  3OR1 C;  1QUS A;  1XNQ M;  2KIU A;  1REP C;  2K5C A;  3SMS A;  4OU0 A;  2VPR A;  2ZCF B;  2Z5U A;  1MH3 A;  3K70 D;  4NSR A;  1PUE E;  2YPR A;  1AKH B;  5F1J A;  1YW8 A;  2R7O A;  1IFY A;  2EKK A;  3H5A A;  5GTI C;  1VQ6 I;  2IAI A;  1TDH A;  3CJN A;  4GKJ M;  5DUK A;  4EV0 A;  3WVD B;  2E1N A;  4GO1 A;  3CUQ A;  3JR5 A;  3EUH A;  4BEH A;  1XGN A;  1UJ8 A;  1ERD A;  2XSD C;  3JSO A;  1YW9 A;  3FUT A;  5E1W A;  3FDY A;  4ZPX A;  2OCE A;  4GFB A;  3FXR A;  2NS7 A;  1EE8 A;  1I1G A;  3X28 B;  2XPW A;  2MSY A;  4OIQ F;  3GRR A;  4MB7 A;  4DR1 M;  1MKM A;  2HU9 A;  1JKO C;  3I04 M;  3DDP B;  2O9L A;  4LJ4 A;  4E7J A;  3KIO A;  1Z6R A;  2HGC A;  3H3Z A;  4KO8 A;  4Y7N J;  2HTJ A;  5HNF A;  2JK3 A;  3SXY A;  4F6W B;  4IEJ A;  2G8L A;  3NAR A;  3A01 B;  4BDY A;  3CCS I;  2I10 A;  3W6J B;  4E70 A;  2ZBK A;  4A6D A;  1OCZ H;  3H36 A;  3KW6 A;  4M6V A;  3QPT A;  3RKX A;  1VQN I;  2ISY A;  2XIG A;  4XN3 A;  2LFB A;  3QP6 A;  1D0Y A;  2Y0Q A;  1FX7 A;  2L6O A;  1R7J A;  2DFH A;  2XAF A;  3BG6 A;  3OMY A;  1IXC A;  1P6R A;  1K82 A;  1XD7 A;  5KO3 A;  2ZJ2 A;  1NVM A;  2HZD A;  1HKT A;  3PNY A;  4HAM A;  2CW0 F;  3HHG A;  3M0E A;  1D0K A;  3K2Z A;  3J7A Y;  3AG1 H;  3CUQ C;  3MZH A;  3BR1 A;  2HKJ A;  3IHU A;  4EOK B;  2ZPG B;  3SC3 A;  1YRN A;  4XOR A;  1O3S A;  1YYV A;  3T1Y M;  3D8L A;  1S9H A;  3KCC A;  4A3B J;  4LJ7 A;  3E3V A;  4HRI A;  5E79 C;  2VL8 A;  4NQW B;  5TIS C;  4W1U A;  3WTT C;  4E7K A;  3ZQH A;  2K40 A;  3U61 B;  1R1U A;  1JI8 A;  4J19 A;  3HIF A;  3K70 C;  1GUX A;  1OCT C;  5F1R A;  5DNY A;  2JZ0 A;  1D8K A;  4D80 A;  2UUZ A;  3HG9 A;  4HG2 A;  2DN0 A;  4I4L A;  2E34 A;  3PNT A;  2KDO A;  3GRV A;  5KPR A;  1X4O A;  2R5Y A;  3GFM A;  3X25 B;  2UZL B;  1H25 B;  3HU2 A;  4C3J J;  1DU6 A;  2P6T A;  3V7R A;  2KMG A;  4Y13 A;  3GPU A;  3BHU B;  1N32 M;  5B5E C;  2XAS A;  2EK5 A;  4L9N A;  1D1A A;  2KKO A;  1SXJ E;  1VI0 A;  5FLX K;  3ZOB A;  2BY1 A;  3F22 A;  3GZ5 A;  1WXQ A;  4FET A;  5FLX Z;  1AIP C;  1B9N A;  2LOO A;  2XDV A;  3IAS 2;  3OL3 A;  1XXH E;  3SHF A;  4IF4 A;  4QNR A;  1UFZ A;  4DGW B;  4RBO A;  3OYI A;  3BP8 A;  2Y0T A;  1VTN C;  5L3G A;  2EV0 A;  2VQG A;  3OIO A;  3F8M A;  3H0G J;  4OB0 B;  3FUV A;  3RYR A;  1HW5 A;  3JAM S;  3QOD A;  3BQY A;  4RM2 A;  3WU1 B;  3LSR A;  1NK2 P;  3U6D A;  4A3C J;  1X4P A;  3PNV A;  4BL0 B;  3FUW A;  3I0T A;  1Z3Y A;  3MVP A;  2VJ4 A;  5LHH A;  3ILK A;  4XLC A;  2HDW A;  3K2A A;  4DYR A;  2RKH A;  1RPW A;  2XAQ A;  4X6A J;  1RKT A;  2BHZ A;  3L2Q A;  2IN3 A;  1HXD A;  1B9M A;  3C2B A;  2DJN A;  2FUG 2;  4CHU A;  3CTW B;  2ZAM A;  1XO2 A;  1U2W A;  1YJ9 I;  3HOX J;  3S1M J;  2QWW A;  4C2M J;  1UGQ B;  4YOS A;  3SYL A;  5EXT A;  3DKW A;  4MQ9 F;  3CCL I;  2K9S A;  1XN7 A;  2UXX A;  3PSI A;  3CCR I;  4OIP F;  1HC8 A;  1G8X A;  3FKI J;  3CME I;  3C1D A;  1Y8R B;  1IY2 A;  2DT5 A;  5CKT A;  1TW3 A;  3U5Z A;  1YS6 A;  2Z7J A;  5CVV A;  1WI9 A;  5EEH A;  5LEJ A;  2CHV A;  5TJJ A;  2RGH A;  2WAQ A;  2EPF A;  1A35 A;  1G8P A;  4LFC M;  3A8L B;  2YNM D;  2ETH A;  2ZBK B;  2A05 A;  4A12 A;  3GTM J;  2I7N A;  1QZZ A;  3S17 J;  3KLN A;  1JR3 E;  4CHT B;  3LST A;  3DQV C;  3OYK A;  2VON A;  4HV6 A;  4II3 A;  1NJG A;  3HKZ A;  3EYI A;  1I4W A;  2WSF F;  2LF8 A;  3U6S A;  4Y52 J;  4EOS B;  2FML A;  2LNH C;  5FLM J;  3GPP A;  3H5N A;  4AU7 A;  1YG2 A;  2DXB B;  3A8O B;  3TOB A;  2WXV B;  4RGX A;  2CV0 A;  1XSV A;  2WMB B;  1NNU C;  4R7G A;  2KJC A;  2DTZ A;  3KEY A;  3VKH A;  5LFA A;  3KSX A;  2M4K A;  1YRN B;  4BQA A;  4KDP A;  1ZEL A;  1MSE C;  2P4W A;  5HVQ C;  3QHR B;  1R6B X;  3ECO A;  2DU9 A;  3J80 S;  5DUI A;  2ZSH B;  2EA0 A;  4HNT A;  3FTD A;  3CF5 F;  1DP3 A;  2GXA A;  3WU0 A;  4L15 A;  1VQ5 I;  1ZYR F;  4MLO A;  2HYG D;  5DCM A;  1BVS A;  4F6U B;  3ELK A;  2CHQ A;  4FWG A;  4A0Z A;  4CIC A;  1IBL M;  4HF0 A;  3CMM A;  2IA2 A;  1WWX A;  2RDP A;  4LJ6 A;  5IT9 S;  2UUC M;  1SXJ D;  5H2F C;  2HYF A;  2E1O A;  1WIV A;  3KP6 A;  1MBF A;  4AIH A;  4W5W A;  2WV1 A;  1AIS B;  3F3X A;  4U0Y A;  2OC6 A;  3HSE A;  3GTQ J;  3ZQL A;  1XTA A;  1LTM A;  5D4R A;  1DV0 A;  2Y30 A;  3I71 A;  1JT0 A;  4JN6 A;  1OIY B;  2X9D A;  1OIS A;  2CUF A;  5CQE A;  1ETV A;  1RET A;  2E60 A;  3L7W A;  5CYI B;  3I9V 2;  2IS2 A;  1D1B A;  4L4U A;  4FX0 A;  2E7X A;  3ZMV A;  3EOC B;  2V6Z M;  1R2Y A;  3BHT B;  1BI0 A;  2VF8 A;  4MGH A;  3GW2 A;  3I58 A;  1IY0 A;  2X6X A;  3IWF A;  5JR3 A;  2JA7 J;  3EID B;  1H89 C;  2P7V B;  4Y4R A;  5E8G A;  2Y20 A;  1Q39 A;  3E1S A;  2H8R A;  3GFI A;  4I81 A;  1SXJ A;  4PD2 A;  1OIZ A;  2XPV A;  3BR6 A;  2XUB A;  2E5Z A;  4L6V 6;  1OPC A;  3VYU B;  4LLG F;  1XXH A;  2L2D A;  1FTZ A;  4EON B;  4BHP A;  1QZE A;  4WUR A;  1MNM C;  3B7N A;  3TWL A;  3CO6 C;  1GVN A;  2Z8Y M;  3G6E I;  2XC7 A;  1C1K A;  3CUO A;  2JUC A;  1XC5 A;  2OD5 A;  4XM3 A;  3X24 B;  5HS7 A;  1ZP2 A;  4I02 A;  4OIO F;  3CMA I;  4G7Z F;  4HLY A;  1TNT A;  1B72 A;  1ZAO A;  4PFO A;  2IA0 A;  3ASO H;  4RLQ A;  5FLV A;  1JR3 D;  1R2Z A;  4NST B;  1AHJ B;  2VKE A;  3GLI E;  1IRF A;  3GQ5 A;  5HS9 A;  5J8F A;  1AWC A;  1J59 A;  5FSW A;  2C9C A;  4FT8 A;  2LLK A;  1O3R A;  3HTU A;  2DNA A;  3U5Z B;  3V76 A;  4W97 A;  1W0T A;  3RGF B;  2BWB A;  4LB6 B;  2NVX J;  1ETW A;  2WAE A;  3KYL A;  3WTW C;  2WBM A;  2EFO A;  2JRT A;  3M9A A;  2K27 A;  1E7P A;  2J5O A;  2KRC A;  3ML6 A;  4OMZ A;  4JI7 M;  4KYW A;  5DYI A;  4RGS A;  2DYS H;  3ZQG A;  1BI3 A;  1JE8 A;  4ZGD B;  4II7 A;  4RGR A;  3OYC A;  1U5T A;  2XGX A;  1BC7 C;  1SXJ C;  1HR0 M;  4EAT A;  2CFX A;  3G33 B;  2Y48 A;  4XLF A;  2DA1 A;  3GWZ A;  1IGN A;  3UK6 A;  1GXP A;  1SFU A;  2DWN A;  3GTM S;  1JR3 A;  4FWD A;  1ZGJ A;  2PFB A;  2M9H A;  1K4S A;  2JVG A;  3R60 A;  1JST B;  4KMU X;  3FE3 A;  2HAK A;  4JX5 A;  5EEG A;  1MN3 A;  3L2V A;  5DQV A;  2ZME B;  3P7N A;  4IRH A;  4KT0 F;  4LK1 F;  1E32 A;  3MFK A;  2M5W A;  1IM2 A;  5M5W J;  2JY5 A;  1MNE A;  4RF1 A;  1UG0 A;  1KQ8 A;  3LCU A;  4EJT A;  1PVE A;  2QA4 I;  4IOC F;  1BR1 A;  3S2W A;  3SEZ A;  2BYV E;  5L3B A;  3HU1 A;  3CZ6 A;  4B1R A;  4EJU A;  1P5E B;  4AVZ A;  1XGO A;  4UVC A;  5LRR A;  3I3L A;  1ZG3 A;  2DWL A;  3U6P A;  2BHY A;  2V9V A;  2AQE A;  2XGE A;  2CH0 A;  2X4H A;  1FY7 A;  3ABK H;  2QQ8 A;  1R9T J;  4ITV A;  1SAN A;  1KQ0 A;  2LD5 A;  4LD5 A;  1WPK A;  1X3U A;  1V92 A;  2M4G A;  4B44 A;  4IJE A;  5DEQ A;  4RB1 A;  3I64 A;  1CF7 B;  2AHM A;  3M8J A;  3GF2 A;  3TBI A;  1U5T C;  3NEU A;  5C4J J;  4G4Q A;  2LBC A;  1D2N A;  1XC8 A;  2F6C A;  3J7A O;  2FOI C;  2PMH A;  4RAY A;  1KFV A;  4AYB A;  3JAM K;  4JI4 M;  1XGM A;  2FF4 A;  2VC0 A;  1OFI A;  4F93 B;  3GTG J;  3E97 A;  3QOE A;  3EET A;  3JAM Z;  2EFW A;  5E26 A;  1PUF B;  4FWH A;  5JHU A;  5LGT A;  4E7Z A;  2EFN A;  4BHC A;  2A6T A;  2B9S A;  2NVQ J;  3IG8 A;  2L7K A;  3QYE A;  1IN4 A;  2RGO A;  1LNW A;  3A1Y A;  3SYK A;  4LLL A;  3HRU A;  4BQQ A;  2WIP B;  4A6E A;  1APL C;  2KPM A;  5DV5 A;  1NV9 A;  3B73 A;  3GTL J;  1VQO I;  1XXH B;  4GKK M;  1UGP B;  1CGP A;  1VDL A;  4LIT A;  3HOY J;  2KZV A;  3LA2 A;  5LHG A;  2C6T B;  4OR5 B;  1R23 A;  2CQQ A;  1ULY A;  2DA2 A;  2KDZ A;  2EZL A;  5IHY A;  5DQW A;  4P17 A;  1QVU A;  2O6G E;  1BOB A;  3FUX A;  3W2W A;  2NNN A;  3Q9S A;  3B7Q A;  2EZH A;  3T6P A;  3FIS A;  3I5U A;  3N4M A;  3S1Q J;  2W99 A;  3J2P B;  2Z3X A;  4PUS A;  4WX9 A;  3M1C A;  3K9P A;  2DOE A;  3ZMT A;  2EIM H;  2F5P A;  5J40 A;  3RPU D;  5I5Z B;  1IY1 A;  1NSF A;  4AI6 A;  1Z21 A;  2WY7 Q;  2C96 A;  3TPZ A;  3FTE A;  3E6D A;  1K79 A;  3OYH A;  2M8E A;  1BJZ A;  4DIQ A;  2QGU A;  4F91 B;  2PBI A;  4EGZ A;  2G9W A;  3A8H B;  5K7H A;  2QVO A;  2JMW A;  4NDL A;  2VQH A;  3GLI A;  2F5C A;  1W1W E;  2DAM A;  2Y31 A;  1F4I A;  3CCJ I;  5D5W B;  4CA0 A;  1JKQ C;  4A3F J;  2CUZ A;  4IPA A;  1S7O A;  3G1M A;  1BOA A;  2O01 F;  1OKW B;  3GME A;  3ABL H;  2RN7 A;  3BTL A;  4NC8 A;  3K7A J;  3S93 A;  1JGG A;  2HDD A;  1K78 A;  1GDT A;  3DFG A;  3MWM A;  1HT1 E;  4A0X A;  2H27 A;  4UXN A;  4B3S M;  2QQ9 A;  3DTI A;  1Q1H A;  3J80 Z;  3AOE A;  2WY8 Q;  5H6Q A;  2LR8 A;  3NWS A;  1XCV A;  1G41 A;  4FE7 A;  4PJM A;  3RPU A;  3TO6 A;  4JI2 M;  1QU3 A;  3ZQQ A;  3TWM A;  2OF7 A;  3LFU A;  1TP4 A;  4UNO A;  1Z0X A;  2WV0 A;  3GLH B;  2EQR A;  4CH7 A;  2B63 J;  2UZE B;  3C2H A;  3FM5 A;  4MFE A;  3ZRG A;  3ZP5 A;  3RI4 A;  1QMZ B;  1SD6 A;  5EXP A;  5IT9 Z;  2FJ1 A;  3KZI C;  4EM0 B;  4GH9 A;  2VQC A;  4FAS D;  2V6C A;  1XCB A;  2F48 A;  4AZF A;  3JRE A;  4NXM M;  3A03 A;  3WU2 C;  4AQY M;  3U6C A;  4R79 A;  2L4A A;  1YJN I;  4YC3 B;  2DA6 A;  3B74 A;  4ESJ A;  7CAT A;  1Y39 A;  5LMK B;  1XPX A;  3DWL E;  1HT2 E;  3ZQJ A;  4MNU A;  3SHG B;  2HQN A;  2TCT A;  5GP9 A;  4EOI B;  3M8E A;  1SFO J;  2H1R A;  2LVO C;  2QCU A;  1QHG A;  1J0R A;  2K7L A;  2X1E A;  3PUF A;  4E7I A;  3KEQ A;  3UMM A;  3I54 A;  1VQK I;  2G9X B;  3BHV B;  4Q5S F;  3W67 A;  3FF5 A;  3AG4 H;  1BA5 A;  2DMQ A;  1O9K A;  3VOE A;  2O5R A;  4IBE A;  3DBL B;  4PJN A;  5KAF C;  2RQP A;  3DTK A;  3GRU A;  2MR9 A;  3KVW A;  4LF5 M;  5K5Q A;  5KAI C;  1XDS A;  4HF2 A;  2ZPI B;  2FQ3 A;  3HWS A;  3FXQ A;  3P9C A;  1HBX G;  3FKJ A;  3L2R A;  3I4M J;  4WWC A;  3PVS A;  1BJA A;  1OIU B;  1E9H B;  3WVE B;  1JUS A;  2BW3 A;  3Q0V A;  4LB5 A;  4HPQ A;  3HU3 A;  2K0B X;  2JY7 A;  4UUS A;  3SEQ A;  4UUT A;  4LJZ F;  4IQJ A;  1K6O A;  2XHK A;  4BBS M;  1DGH B;  4LFB M;  1ZLK A;  1D5V A;  3DOA A;  4E4H A;  3AL0 C;  1WHU A;  5L2W B;  2C4G B;  5DM6 F;  1BI1 A;  4EOP B;  1UG2 A;  2EH3 A;  3QZ5 B;  1ORY B;  2R6F A;  1MJ9 A;  1HNW M;  1SFK A;  2X1C A;  4BCI B;  4WCG A;  2IS6 A;  2ZTD A;  1X58 A;  4JBA A;  1YJW I;  2F5S A;  3FMQ A;  4ZC3 A;  2DXC B;  3VKG A;  4RMN A;  2EIL H;  1KU3 A;  5EF6 A;  3B9P A;  3VDP A;  3J81 K;  2CQX A;  4PJJ A;  3L2W A;  4R1H A;  4A2U A;  2X1D A;  4M3B A;  1DGR M;  4YHH M;  1IBM M;  1NV8 A;  3TW6 A;  3BQZ A;  1H27 B;  3HBL A;  4BCO B;  4B3R M;  3FRI A;  1I6H J;  5KQD A;  3I4P A;  3RDI A;  5J8C A;  2L4M A;  3KP2 A;  4XKC A;  2ZNY A;  2JA8 J;  1IV8 A;  1QVR A;  3DTE A;  1DGB A;  1KYZ A;  4LK0 F;  2R7R A;  3RZD J;  2R93 J;  2A61 A;  1LE8 A;  2DOD A;  3GLI B;  2M30 A;  4YFK F;  1NNJ A;  3OY9 A;  4F6S B;  1Q3C A;  1IXS B;  2DT7 B;  1HLV A;  4BCG B;  1WHC A;  1O4X A;  3NBX X;  4V2F A;  3D5R C;  4BJT A;  3A45 A;  3KX2 A;  3HHZ A;  3L2A A;  2XB0 X;  3F8B A;  3Q0U A;  4HX4 A;  3LAJ A;  1K78 B;  1VOL A;  3UGJ A;  2CS3 A;  3OSF A;  4IHX A;  3HSF A;  3BWG A;  2MAB A;  4L5E A;  5LMN M;  2GLO A;  4OU7 A;  1XDU A;  2WMA B;  2QF7 A;  4MGZ E;  4PDK A;  3OS1 A;  1RIO H;  4CFU D;  5DM7 F;  5HS8 A;  2NRA C;  2L0K A;  3HOZ J;  4P55 A;  1PRB A;  4BBA A;  3QP5 A;  2W84 A;  5AIP A;  1X1P A;  2DMN A;  1TDZ A;  4XSZ F;  2DPU A;  2COB A;  2EKF A;  2MFZ A;  2P5L C;  2PMZ N;  2XF7 A;  3OYD A;  1W36 D;  3KS4 A;  3ABM H;  3D1N I;  3MY1 B;  1LDK B;  1JKW A;  2KJB A;  4ESF A;  2MG4 A;  1E9R A;  1L3L A;  1NJF A;  3VFD A;  2AHQ A;  4QPQ A;  1J5E M;  2H8W A;  5KPT A;  4EJV A;  3FWE A;  1IC8 A;  3VK8 A;  1H6U A;  4YOO A;  1PJT A;  2O03 A;  2IGO A;  3OR2 C;  1PDN C;  1MDM A;  1GXQ A;  2R7U A;  4HQM A;  1RES A;  2DA5 A;  3BG9 A;  3F23 A;  2NS0 A;  4Y33 A;  1YI2 I;  2STT A;  3EJ1 B;  3H4J A;  1P9Q C;  1TTE A;  4BKX A;  4G94 A;  2RV8 A;  1NTC A;  4G4N A;  2VOO A;  3F92 A;  2IW5 A;  1IDZ A;  4S0H B;  3HY5 A;  1YIO A;  3FBI B;  1HJP A;  3QXE B;  3P9K A;  1Z5B A;  4BY1 J;  4N0B A;  3DPL C;  2G7H A;  4EC9 B;  1R49 A;  4P96 A;  3H3V K;  2CG4 A;  2DFI A;  5AIQ A;  5IOZ A;  3SBJ A;  1SVM A;  4UUS B;  2FNA A;  1PJI A;  5J1R A;  2VOP A;  4NC7 A;  5DCF A;  4M72 A;  3QU6 A;  3DLL F;  3S3M A;  1VND A;  2GOM A;  1N77 A;  2ID6 A;  4V2G A;  4E7S A;  3FHZ A;  3RTR A;  4U87 A;  2G0E A;  3TGN A;  2NVY J;  1P7J A;  1H9G A;  4GHA A;  1F43 A;  4A69 C;  4A3J J;  2UUA M;  2EO2 A;  5LMU M;  3V7S A;  2WIH B;  4XLP F;  4XR6 A;  1VG5 A;  4YII A;  4A0Y A;  3CP8 A;  1UST A;  1ZN2 A;  2Q8K A;  2FRH A;  1V4R A;  5EXS A;  1D5Y A;  1FNN A;  1W5C C;  4CCK A;  1D3Y A;  1QPI A;  1HNX M;  3GTK J;  4WXH A;  2Z99 A;  4E7L A;  1HOM A;  1GO5 A;  4C9Y A;  2QSG X;  1QQI A;  1S3S A;  2JA5 J;  2IS4 A;  5KPZ A;  3DBH B;  1MZB A;  1R5G A;  2EBI A;  3LSP A;  1ZK8 A;  2I7P A;  3GZ6 A;  4FVM A;  2R3S A;  1U78 A;  3MY5 B;  3IH4 A;  1DPU A;  2Z2S B;  3CGW A;  4G7O F;  4A5M A;  3A42 A;  3DU6 A;  3AJI B;  1JT6 A;  5LGU A;  1WSU A;  2IRF G;  4YIF A;  5EG0 A;  2L9V A;  1W36 C;  4DR6 M;  2E36 A;  3BG7 A;  3EYY A;  5E3M A;  4UHT A;  2ESH A;  1LE8 B;  4B3X A;  2QSH X;  1GHC A;  1TF0 B;  2PEX A;  4UN2 B;  3PSF A;  1U8R A;  1JQJ C;  1B59 A;  3Q3S A;  1PJR A;  2BY3 A;  4RAZ A;  1EJ9 A;  1GJT A;  1U9O A;  2YX4 A;  1ZG5 A;  2W00 A;  2P5V A;  2KNZ A;  2ZJP F;  2CWE A;  2LK2 A;  1V55 H;  4Q47 A;  4R8H A;  4FCY A;  2ZXH A;  1GUU A;  4KT5 C;  4RA2 A;  3FKE A;  2W85 A;  1S6L A;  6PAX A;  3BG5 A;  1PP8 F;  2VT2 A;  2X8A A;  2FMY A;  2FD5 A;  4PCQ A;  1W7P D;  2CMP A;  4AVP A;  4O3M A;  1GVD A;  3TDZ C;  3KHI A;  1LVA A;  3ZQI A;  4U0W A;  3W2V A;  1NHW C;  3BJ6 A;  4IRG A;  1JTX A;  1URC B;  3E6B A;  3F8C A;  5JFR A;  3BR5 A;  2KT0 A;  1O57 A;  4G9Y A;  3K9O A;  1WQ2 A;  2VQL A;  4IQ4 A;  4ELJ A;  4BQN A;  4F7S B;  1YO5 C;  4B3M M;  3GUD A;  2DLL A;  4JYK A;  3A98 B;  2L09 A;  5ED4 A;  4EEF G;  5C44 J;  3I56 I;  4LG0 B;  2ZPH B;  2CV2 A;  3JRC A;  3CF0 A;  1I1S A;  2IJL A;  3CCV I;  3X2Q H;  2JA2 A;  2RRU A;  2XZF A;  1MBK A;  3NDQ A;  4BXF A;  2V4J C;  2ZM6 M;  4Y3O A;  2QYO A;  2Z33 A;  4CFU B;  1QBJ A;  3ISP A;  3KFW X;  2F4M B;  2XKP A;  1DGW Y;  3Q0W A;  3K8Z A;  5KK1 A;  1IN7 A;  1KZH A;  3LNQ A;  3DLA A;  3COA C;  2BY0 A;  4G7H F;  1YHQ I;  1IAW A;  2PK2 A;  1OKR A;  4QOZ C;  3BY6 A;  4DZJ A;  2IS1 A;  5LD2 C;  1GH6 B;  2M7A A;  5ITQ A;  2QBY A;  3WE2 A;  4QLC U;  3E0J B;  3G71 I;  3DP7 A;  2ECB A;  2ZJR F;  3FRH A;  5F0H A;  1FYM A;  1QAO A;  1LFB A;  4A5N A;  3K7A M;  2Y0S N;  1OCR H;  2HXI A;  2JN6 A;  2OBP A;  3BZC A;  5HBH B;  3V42 A;  3JW4 A;  4QHT A;  2FBI A;  4AC0 A;  2O0Y A;  1YE9 A;  5IZ7 D;  4KHP M;  2O3F A;  2RNG A;  3BDD A;  1OL1 B;  2QUF A;  3OTO M;  4KRC B;  1YUB A;  4CYC A;  4ROE A;  4DV4 M;  2M1B A;  3WHB A;  3K4C A;  5M3F J;  3DCF A;  1GVJ A;  3MKZ A;  2VOD A;  1SG9 A;  2KZU A;  1MD0 A;  2BZT A;  4F7J B;  4GCV A;  1W4M A;  1E0E A;  2I53 A;  3BZ6 A;  4HNV A;  4G4R A;  1GT0 C;  3RYP A;  2XAU A;  3O2P E;  4L5J A;  4PT5 A;  1P4X A;  1PYV A;  3GQ3 A;  1MJA A;  2UXC M;  5ERI A;  1OR7 A;  2FBH A;  3CC7 I;  1I3A A;  2AXT C;  1WZ2 A;  3RPQ A;  1FIN B;  2FXA A;  1OFH A;  3L29 A;  1H1Q B;  3LQ5 B;  1R36 A;  2MGW A;  1RNL A;  2KDL A;  2KIS A;  4M0W A;  2R4E A;  4LY6 A;  2XV4 S;  3SMP A;  2VJI A;  1ZTR A;  2IGK A;  4EM2 A;  4EGY A;  3CC2 I;  5IY5 H;  3SFI A;  3KEO A;  2XSJ C;  2PJQ A;  2LHG A;  2F5Q A;  3ABU A;  3S16 J;  1F36 A;  1TT0 A;  3E5U A;  2BNK A;  3ZC7 B;  1MGT A;  2I5U A;  2OCC H;  4R71 A;  5EG0 B;  2CZ7 B;  1VYW B;  1IN8 A;  3J7Y J;  4LF4 M;  1XSX A;  2BPM B;  1D0Z A;  4ZGE B;  2EFP A;  4C30 A;  2JP7 A;  4DV7 M;  3HHY A;  1ZMW A;  5EEA A;  4MHG A;  2DCE A;  2EV5 A;  5LHI A;  2HI3 A;  1UHS A;  2KZG A;  2MW8 A;  3GPX A;  1D0L A;  2D1H A;  2EIK H;  2KRU A;  5ILS A;  1IJW C;  3M03 A;  2Z4R A;  2OV7 A;  4KIB A;  3WOD F;  4GYG A;  1Q3B A;  4Z2Y A;  4B4C A;  3ONQ A;  2V22 B;  1XB4 A;  5KCM A;  2FS1 A;  4RF0 A;  1WKM A;  1Z77 A;  5FD6 A;  1F9N A;  3SYT A;  2V79 A;  4GEW A;  2ZNZ A;  4F1I A;  2R7G A;  3K4B A;  1DO2 A;  2KXE A;  3O3K A;  2DWM A;  3CJT B;  4MEY F;  1OR7 C;  4IBJ A;  1T95 A;  2JQ7 A;  5LQF B;  1AHD P;  3WTV C;  3FYC A;  1VDD A;  3OYL A;  3REO A;  2KW0 A;  1J2X A;  3E5X A;  2DEN A;  3RIR A;  2ZJQ F;  4BE0 A;  4MGK E;  3BLH B;  5H20 A;  5HVY B;  1WJF A;  2A5Y B;  2V1X A;  1LB2 A;  1RZ4 A;  4KOD A;  1BR2 A;  5CPR B;  3GO5 A;  4IL6 C;  2D7H A;  2DHR A;  3CUQ B;  4XSX F;  5FFX A;  4RB3 C;  1ACI A;  4UY8 I;  4BEH B;  1MX0 A;  1OJL A;  1ONV A;  2H6B A;  1TQM A;  1B4A A;  4P9U A;  3WGI A;  1V3F A;  2HYJ A;  3C58 A;  1LPQ A;  4PK4 A;  2CZ0 B;  1Z3X A;  3OYA A;  1JHF A;  4QOS A;  1GL6 A;  3MHV C;  3U6Q A;  1K83 J;  4P5O A;  2JWT A;  5EYR A;  5J4Y A;  4H0E A;  1UNL D;  2O25 A;  1X1C A;  4D0P A;  3WGG A;  3AV0 A;  3ZN1 A;  2E5N A;  5M5Y J;  1XX5 A;  3LL7 A;  3V7C A;  1S7A A;  3CMY A;  1WJC A;  1A36 A;  2QBY B;  4JXJ A;  4DR7 M;  3CCM I;  1N4M A;  4EQQ A;  3H4C A;  2CUE A;  2L5Q A;  2K4B A;  1F5T A;  3T1B A;  2X49 A;  3IKV A;  2DTR A;  3BCA A;  3G3Z A;  2F5V A;  1UFM A;  2ELK A;  2NVU B;  2N35 A;  1J75 A;  2O61 A;  4B7H A;  1ENW A;  4BBR J;  4BCQ D;  2BE5 F;  4UV8 A;  2LXE A;  3BG3 A;  1Y8G A;  1IXZ A;  1HDP A;  3CO7 C;  2J5Y A;  2VF7 A;  1K3W A;  2XFS A;  2K9Q A;  3BOS A;  4EJO A;  2KIQ A;  1OL2 B;  1MBJ A;  1EFU B;  2JY8 A;  4LF7 M;  1UMQ A;  5EDN A;  3GTO J;  4JX4 A;  1JGS A;  3FXO A;  1T0F A;  4A3E J;  1N25 A;  2LG4 A;  3VOD A;  3K1N A;  2BJW A;  2Y21 A;  1HKS A;  1JUP A;  2OQG A;  4MIM A;  4WF2 A;  2L01 A;  1XB2 B;  2DMU A;  3LOC A;  1YSY A;  2LDU A;  1WGX A;  4OB3 B;  3SAR A;  1GV5 A;  2IP2 A;  3K4K A;  4EOL B;  5FRO A;  4XQF A;  1K61 A;  2HKO A;  5HBJ B;  2E19 A;  4HOB A;  3MIA B;  2A69 F;  4LZZ A;  4YG2 F;  3RKY A;  1VQ7 I;  4B48 A;  4N9I A;  5FKM A;  1TC3 C;  1FSE A;  1D0M A;  2ZAN A;  1GUX B;  2OTJ I;  4YOZ A;  4HNU A;  3KP3 A;  4HZF A;  1A04 A;  1B6A A;  5IOY A;  2LVQ D;  4UV9 A;  1SAX A;  4XBF A;  1TW2 A;  3MD2 A;  2F5O A;  2K3P A;  3KXE C;  3RE8 A;  3LQQ A;  4KN7 X;  2DKL A;  4IBD A;  1EKE A;  2R5Y B;  1IZ1 A;  1A6I A;  3K0L A;  5DS9 A;  2LKX A;  4ELL A;  4D7M A;  4YFN F;  2HVS A;  2IW9 B;  1GJS A;  2LRD A;  1X1D A;  2DT6 A;  3HJE A;  4CYD A;  3E6M A;  2R45 A;  2AO9 A;  1T0F C;  2R7Q A;  2NQ8 C;  4B3T M;  3KFU G;  1G3T A;  4DR2 M;  3WGH A;  3R9X B;  1IW7 F;  4LGW A;  3FD9 A;  3CF2 A;  1IG7 A;  4I3Z B;  1FOY A;  2JT1 A;  1IV6 A;  2HOA A;  3T1H M;  1FSH A;  2KHH A;  2Y69 H;  2GBY A;  3UNG C;  1T2K A;  2D7G A;  2DXI A;  2BJV A;  1FJG M;  3HEF A;  4M6Y A;  3TP0 A;  2XF6 A;  2VJJ A;  3VSK A;  2DD5 B;  1G3S A;  3LSG A;  2UU9 M;  5TGT A;  4M9Z A;  4B47 A;  1VFC A;  4ZDP A;  2ME0 A;  2QQA A;  3JSP A;  2MH2 A;  3BJO A;  3U6L A;  2HDC A;  4HSR A;  2WZJ A;  1TQP A;  3QU3 A;  2RQQ A;  4DOZ A;  2HPI A;  3H0D A;  2ZXI A;  3VWB A;  3U60 A;  3HRM A;  2DWZ B;  3HJS A;  3B57 A;  1STZ A;  1YOV B;  1R5L A;  2VXZ A;  3BPX A;  5D5V B;  3SAW A;  2B3T A;  4JI8 M;  2DZN B;  5BNG A;  2G77 A;  3NAU A;  4FTH A;  1ZQ3 P;  3HRT A;  2PK9 B;  4BCJ B;  1QHH D;  4LCB A;  4UB6 C;  1GKI A;  3VSL A;  3WG9 A;  1TBX A;  1ZH5 A;  3CP2 A;  2LHC A;  2V1D A;  4ITQ A;  3S1N J;  1TL8 A;  1RR7 A;  1Z1D A;  3LW5 F;  3PQJ A;  2R7X A;  2JY6 B;  5ICP B;  4E6K G;  3MZ8 A;  1ZAE A;  1Z91 A;  5EZH A;  1TH3 A;  3IEC A;  4CCL A;  3DDQ B;  2VQE M;  1OQY A;  1XMO M;  1I3Q J;  3SZG A;  4LFA M;  2VII A;  4RNA A;  2Z16 A;  2F4O B;  1MSF C;  5BMZ A;  1A31 A;  3MJ5 A;  4MGR A;  2KIM A;  2JGZ B;  3VYH B;  1JUM A;  3GLX A;  1BU2 A;  1WR1 B;  2JSP A;  5BR8 M;  2HQ5 A;  3JCU C;  2KNA A;  2JJ7 A;  3K4L A;  3T38 A;  5DDG A;  3GPY A;  1HCR A;  3F6V A;  3HKZ N;  1X37 A;  5FTN A;  1QGP A;  1TWG J;  2L54 A;  4C2U A;  1J7K A;  4UUV A;  3ZR8 X;  2X48 A;  1OYW A;  3OV8 A;  2F5D A;  2LVN C;  3FXU A;  1JTY A;  3H1C A;  3V8K A;  2C6Y A;  5DCM B;  1TWH J;  2JPB A;  2K9L A;  4S04 A;  3ESW B;  1B8I A;  1RUN A;  2B9R A;  2MA3 A;  2C5N B;  2YQZ A;  1OAI A;  2G3Q A;  1ORK A;  3FBN B;  4F7Z A;  4OVZ A;  3IL2 A;  1TR8 A;  4PGH A;  1T8I A;  1FZP B;  5E20 A;  5IWA M;  2XGD A;  4DV1 M;  4EMS A;  4BE2 A;  2HOT A;  1MU5 A;  2KZS A;  3PL8 A;  2IXS A;  4ZYE A;  2BGC A;  2OZ6 A;  5C3E J;  2ZFW A;  1V33 A;  3T15 A;  5IT3 A;  4XL9 A;  2QZ4 A;  3BXW A;  1KGS A;  5CLS A;  3OL4 A;  2L7H A;  5L3E A;  5EJC A;  4AIK A;  3S32 A;  3CJR B;  4ZJZ A;  4ON0 A;  1DUX C;  2XRO A;  3HM5 A;  4XK4 A;  2F5N A;  1GL7 A;  1TNS A;  3AKZ A;  3L25 A;  4GC9 A;  2JRM A;  3IP4 B;  4Y28 F;  4MEX F;  1ZRE A;  4S05 A;  2C98 A;  4Y72 B;  1IUY A;  5ICE A;  1BR4 A;  5E1Z B;  1RRJ A;  3ULQ B;  3HOW J;  4A3V B;  2XGC A;  5HLI A;  1SXJ B;  3KOY E;  4MQV A;  2AHJ B;  3JR4 A;  5F04 A;  3RQI A;  3G4S I;  4HDV A;  3EQL F;  4XOP A;  3W6K B;  5FFZ A;  2WB1 N;  4DBQ A;  2E71 A;  1FYL A;  2DQR A;  1CQT A;  2PJP A;  5KNL A;  1M1E B;  3M7G A;  4EOJ B;  2QKM B;  2HR3 A;  3KOZ E;  1XMQ M;  1VQ4 I;  1XG1 A;  1IQP A;  1WFX A;  3WTZ A;  3HOS A;  4LMY A;  1KA8 A;  4M6X A;  1HW2 A;  2E2J J;  2APL A;  3R8F A;  2XAG A;  3Q9V A;  2VJ5 A;  4OMY A;  4D9J A;  2EUF A;  3L09 A;  3O8H A;  1TTY A;  4CZZ A;  3RKW A;  1B72 B;  5HNH A;  5ITU A;  4AKH A;  2HKX A;  1SD5 A;  2Q2E A;  2XH9 A;  2AQF A;  4MM3 B;  2EFQ A;  3G1L A;  1Q02 A;  4CO8 A;  3H3U A;  3CDL A;  2C5R A;  1XMK A;  3QOP A;  3I01 M;  5A2Q S;  3RGP A;  4M71 A;  1SFE A;  4IHT A;  2CHG A;  3KSJ A;  2ZB9 A;  1FOW A;  3TMO A;  3PIP F;  4FCW A;  3DPT A;  3TP3 A;  3UKG A;  1I50 J;  2FFJ A;  4BCM D;  2M60 A;  1QDT A;  1Y8Q B;  1Y6I A;  1LDD A;  1FPQ A;  1MH4 A;  3AOG A;  4B7F A;  2ELJ A;  3A02 A;  2ID3 A;  4N4O B;  5B66 C;  4I01 A;  5BS6 A;  3CCE I;  4GRI A;  4X65 M;  3O8G A;  1IUF A;  1U5T B;  9ANT A;  4XN0 A;  1K6Y A;  3KE2 A;  3OIQ A;  2HHH M;  3QRF F;  3J80 K;  4KLN A;  2VBY A;  3CJQ B;  2A6H F;  1JJ8 C;  5BPV A;  1EH6 A;  2DPP B;  2L3D A;  1QUT A;  2HZT A;  1EA3 A;  2IA1 A;  2X51 A;  2GWR A;  2DAK A;  2DDB A;  1KU7 A;  2YSR A;  4BHB A;  3OYE A;  2XKO A;  4KN4 X;  4JV5 M;  1L1T A;  2EUC A;  2K47 A;  2HL7 A;  2YU3 A;  3DL1 A;  1I6X A;  4L9T A;  2DBB A;  1FWZ A;  4F70 B;  4XKW A;  4IJF A;  1L1Z A;  4IBK A;  3GEZ A;  4IOA F;  5IT9 K;  4A3G J;  2JUG A;  4F55 A;  1RR8 C;  2R92 J;  5C1B A;  3F0C A;  2AS5 F;  3B6C A;  4YFX F;  3F21 A;  3TNI B;  1TH4 A;  4EC8 B;  1VQ8 I;  3NRV A;  2CCH B;  4UN0 A;  4XK8 F;  2PMZ A;  3KZY A;  4L9V A;  3DEW A;  4DYC A;  2DAE A;  2R7T A;  2DVW B;  2XEP A;  1BIB A;  2FEZ A;  4XKV A;  2MYS A;  2MLK A;  3CC4 I;  3BZK A;  2MD0 A;  3WTY C;  3O6B B;  2TRT A;  3R4K A;  3GO8 A;  5K5R A;  2ISZ A;  4ZZL A;  3W68 A;  2W25 A;  2KL4 A;  3DV8 A;  2EWN A;  1ZRC A;  5AON A;  3IUO A;  3SAT A;  3L26 A;  3IG5 A;  4LG3 A;  1OYY A;  5FO5 A;  1NHG C;  4AG5 A;  4Q7J A;  1ODD A;  3VYS B;  2LH0 A;  2W7N A;  1G2H A;  5F3W A;  2XGN A;  3ZMD A;  2DPD A;  4YIR X;  1IN5 A;  3H35 A;  2A3S A;  5L3F A;  4PDI A;  5ITT A;  2M5Z A;  4BCN D;  3LSI A;  2VI6 A;  3HHX A;  3BTC A;  2G7U A;  3EIH A;  2K4J A;  2OPT A;  4J00 A;  2F4I A;  4LOC A;  3RQ4 A;  5ICG A;  1R71 A;  4U7B A;  1XNR M;  1VIN A;  1MBH A;  4LJ9 A;  1S3J A;  2M7B A;  2CEA A;  2K86 A;  2KRF A;  4MO7 A;  2HPM A;  2WJ9 A;  2CQ7 A;  3KDS E;  5FRM A;  2LKP A;  4IVN A;  4O5V A;  2Y2Z A;  3FZV A;  3GFJ A;  3IKT A;  3RGS A;  5ITY A;  1VQ1 A;  1VQL I;  3H9Q A;  5K7F A;  4PDG A;  2WAD A;  4JI6 M;  3K10 A;  1ON2 A;  1TWA J;  3JRG A;  4AYB N;  4LIV A;  4B7G A;  2WAF A;  3JRA A;  5ICF A;  2ZPB B;  2MH9 A;  4AW4 A;  3WE3 A;  1YIT I;  1TFB A;  3BC8 A;  2PQ8 A;  4JI3 M;  5GPC A;  3K1M A;  2WPA B;  1MW7 A;  1OCC H;  4ASN A;  2BVL A;  1BM9 A;  3LAP A;  1HQY E;  5GTH C;  1W0U A;  1QNT A;  4EJW A;  1E17 A;  1V5G A;  4JP0 A;  4BY1 X;  4GIT A;  2P7C B;  1QAQ A;  2DFE A;  4GDF A;  1MJB A;  1ITY A;  2LYC A;  2JSC A;  2V9K A;  3KYC B;  4XNF A;  1D8J A;  1WJB A;  2DI0 A;  5M5X J;  5EZG A;  3U2R A;  4IKF A;  4II5 B;  3CLQ A;  2KP6 A;  1ZGA A;  4YY3 M;  1KYI A;  2CYY A;  2M8G X;  4XKB A;  3POM A;  2L7Z A;  4G6D A;  4RKU F;  2DJI A;  5B1B H;  5J4V A;  3W6V A;  3DJB A;  1WJE A;  4LRS A;  4H4K C;  3GRY A;  2V1C A;  1E2X A;  3M8F A;  1WJ5 A;  2YR2 A;  1YW7 A;  5F64 A;  2XRN A;  2KMU A;  2P5T A;  2STW A;  2A6E F;  5LRS A;  4BLC A;  3QPS A;  5HLT A;  3WTU C;  4U7D A;  1DU0 A;  4IX7 A;  5H37 D;  1WCM J;  4HBL A;  2EA4 A;  1DGG A;  4YEJ A;  4KA4 A;  3DEE A;  3BTI A;  5BQT A;  4BDZ A;  1VZ0 A;  1DO0 A;  2PMI B;  1KSF X;  2A68 F;  2LY9 A;  4IBI A;  3G1O A;  3SQN A;  1ZHF A;  2R7V A;  4AKI A;  3LVV A;  4CCJ A;  1ETY A;  3B7Z A;  4WW0 A;  1SD7 A;  2HOE A;  3SFZ A;  3S15 J;  3BPV A;  1FKM A;  2KFD A;  2OO9 A;  1L8Q A;  3HUG A;  1G4A E;  2J7N A;  5K5O A;  1G71 A;  1NHA A;  5FKK A;  4RGU A;  5D6E A;  2QEN A;  3JRH A;  2HWV A;  3AL0 B;  3QPH A;  3FYD A;  3C2G A;  2DDA A;  4DNC A;  1FBU A;  4UVB A;  1X19 A;  4M3G A;  3F6O A;  4NB5 A;  3ROU A;  3L27 A;  4HDU A;  1PKD B;  3WTS C;  4M3F A;  2HTS A;  2P0W A;  3MEX A;  3M3Y J;  2GNO A;  5DYG A;  3OOP A;  3DOG B;  3Q8G A;  3KET A;  2YFQ A;  4A3I J;  3PFI A;  2WA0 A;  5HNB B;  1I94 M;  5GAE J;  5HLG A;  3C9P A;  2ELH A;  4GC5 A;  2CP8 A;  4D1Q A;  4REZ A;  3HHH A;  2XSZ D;  5FTL A;  4ZTJ A;  2Z9O A;  2R7Z J;  3J7A S;  2DA4 A;  3GXO A;  5CJ9 A;  1WH5 A;  4II2 A;  2ICW G;  3TL4 X;  3GLF E;  1KXU A;  1P4W A;  1R1T A;  4QNM A;  1T39 A;  1AKH A;  4NL4 H;  1P2F A;  3CQZ J;  1O9K B;  1V54 H;  2UWM A;  4LG2 A;  2R7D A;  2VBX A;  4OIN F;  1FEX A;  3QYG B;  1WI3 A;  3G73 A;  1BN5 A;  4RM3 A;  2O8K A;  3HTS B;  3EUA A;  5TRD A;  2R18 A;  1JSU B;  3TO9 A;  2LY2 A;  4IBF A;  3SZP A;  3U21 A;  5KQ8 A;  2BW3 B;  2PI0 A;  3QQA A;  1IO2 A;  2KRH A;  2FE3 A;  3GTJ J;  1HSJ A;  4B8X A;  3HB9 A;  5D8L B;  1OYI A;  2COM A;  1T3T A;  4OAZ A;  1EH8 A;  4ENJ A;  2Y0S A;  2E1M C;  3HPH A;  3K4N A;  4XLE A;  3IV5 A;  3DFZ A;  1DQU A;  3AG3 H;  3THG A;  2KLO A;  3T5X A;  4BE1 A;  2MLG A;  2Q0O A;  3HOU J;  3AAF A;  1K4T A;  3GLG E;  1RKW A;  4MGI E;  2UZB B;  4BCN B;  4DQ2 A;  1T6S A;  1GAB A;  3TE6 A;  1S29 A;  3MMP A;  1ZAR A;  1H8A C;  1TGU A;  4NRV A;  4XBO A;  2BEO A;  1UAA A;  2IVX A;  2Q1Z B;  2CGP A;  2W1O A;  2CO5 A;  2GXG A;  5A2Q Z;  3A01 A;  5D6F A;  1X2N A;  2K85 A;  4I0A A;  2YUS A;  4XMY A;  3WHL A;  1ZQ9 A;  4HV5 A;  1ETK A;  3V4G A;  1SVL A;  4DW6 A;  2V7F A;  3OS2 A;  3ZGK A;  3HPG A;  5DD8 A;  4WK8 F;  3KP5 A;  2ZZD B;  1SAU A;  2CW7 A;  3TKY A;  1H9T A;  1YFH A;  3SAS A;  4PZJ A;  3E9S A;  2LRE A;  2CJM B;  1BC8 C;  4DR3 M;  2D1V A;  2UZK A;  1YX3 A;  4AUX A;  3OIP A;  3VYG B;  5CVU A;  4I09 A;  3VDX A;  2HVQ A;  1ETQ A;  4TTH A;  2LVA A;  4ZDL A;  2X6O A;  4NQW A;  3PFY A;  2LBF A;  4IHW A;  1O7F A;  2X1N B;  3U61 A;  3K9T A;  4M0D A;  3BRO A;  3S3O A;  4Z8X A;  3SJM A;  1J9I A;  2F2C A;  2X6W A;  2VE8 A;  3IH3 A;  1QQW A;  2PN6 A;  2QZ8 A;  1YLA A;  3HGG A;  3W0L B;  4CRL B;  1FP1 D;  1E3O C;  3HSR A;  4U0V A;  2QDY B;  3EPZ A;  1DDN A;  1H1P B;  3M6A A;  3V8L A;  4CZC A;  4DBR A;  1S72 I;  4CFM B;  4DBG B;  3SAV A;  3GBG A;  2YR0 A;  4D5C A;  4JYA M;  2H94 A;  2LTP A;  2GZW A;  5GPA A;  3I59 A;  3U6O A;  3CD6 I;  4NUB A;  4AM3 A;  2BS4 A;  1UEL B;  2Y0M A;  5E8I A;  2JPC A;  2XVC A;  2Y75 A;  2R46 A;  4GGG A;  2KQR A;  2L7M P;  2V6E A;  3PO2 J;  3ZXS A;  3E5Q A;  1OFC X;  3PM1 A;  2DW4 A;  4BQO A;  1D0X A;  5JHF A;  1H0M A;  5LEK A;  1MDM B;  2ZPE B;  3QAH A;  2OJE D;  1KYW A;  4EM1 A;  1Z7L A;  2EJS A;  4ZH4 F;  4DR5 M;  1W7P A;  1QVT A;  4IIW A;  3MKW B;  1I39 A;  2R7S A;  3L28 A;  3SZT A;  5DFL A;  4X62 M;  2JUJ A;  2GIZ A;  2EZK A;  1EF4 A;  2DME A;  1LFP A;  2W48 A;  3GZN B;  2W4S A;  5IP9 J;  2VDB B;  3KP4 A;  3V8J A;  2FX0 A;  1UM8 A;  4GXO A;  3RCO A;  5HOD A;  2D7E A;  1RC9 A;  3GLF A;  2YX7 A;  1U3E M;  1NO1 A;  2VPL A;  3K92 A;  4NNJ A;  1R5H A; 
#chains in the Genus database with same CATH homology
 4NC6 A;  4HNU A;  3HZJ A;  1UGP B;  2DXC B;  3VKG A;  5EJC A;  3A8M B;  4LOC A;  3HB9 A;  2CZ7 B;  2CYZ B;  4P17 A;  4OB0 B;  2WJ9 A;  4JX6 A;  2ZCF B;  3TW6 A;  3HBL A;  4HLQ A;  1UGS B;  2QFZ A;  4AKG A;  4ZGE B;  3X24 B;  4HL4 A;  2ZPB B;  4AI6 A;  2BS3 A;  4ZGJ B;  2AHJ B;  3WVD B;  1UGQ B;  1AHJ B;  3HHT B;  3A8H B;  4BBR M;  3TW7 A;  2DD4 B;  1QLB A;  3BG5 A;  3X28 B;  1E7P A;  4MFD A;  2QF7 A;  3QYB A;  3KHI A;  2DD5 B;  2ZZD B;  4ZGD B;  3A8L B;  4AKH A;  4ELJ A;  2CZ0 B;  3VYG B;  2KR6 A;  2ZPH B;  4M6V A;  4JX5 A;  4MFE A;  2DXB B;  3QYH B;  3A8O B;  3HO8 A;  2G77 A;  2CZ1 B;  4Z6Y A;  3VKH A;  3H4C A;  4AKI A;  3BG9 A;  2ZPF B;  2QDY B;  3X26 B;  2DPP B;  4HNT A;  1FKM A;  2D0Q B;  2ZPG B;  3BG3 A;  3QXE B;  3VYH B;  2BS4 A;  4OB1 B;  2QQ8 A;  3DL1 A;  1V29 B;  4JX4 A;  2ZPI B;  4MIM A;  3X20 B;  4QSH A;  2ZPE B;  3WVE B;  3QZ9 B;  4OB3 B;  1UGR B;  2QDJ A;  4HNV A;  4BBS M;  2CZ6 B;  3X25 B;  1IRE B;  2BS2 A;  4OB2 B;  4FM4 B;  2KMG A;  3QYE A;  3A8G B;  3QYG B;  3QWL A;  3QZ5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...