3HZJA

Crystal structure of the rabgap domain of the rabgap1l protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
287
structure length
287
Chain Sequence
b'YSWGELLGKWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDRYRILITKDSAQESVITRDIHRTFPAHDYFKDTGGDGQESLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYDYGLRDLYRNNFEDLHCKFYQLERLMQEQLPDLHSHFSDLNLEAHMYASQWFLTLFTAKFPLCMVFHIIDLLLCEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIKVPTKKLKKYEKEYQTMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAB GTPase-activating protein 1-like
publication title Crystal structure of the RabGAP domain of the RABGAP1L protein
rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 97
structure length 287
sequence length 287
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 3hzjA02
1.10.10.750 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ypt/Rab-GAP domain of gyp1p 3hzjA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3hzjA03
5EJCA 1FKMA 3QYEA 2G77A 2QFZA 3QYBA 3QWLA 3HZJA 4NC6A 4Z6YA 4HL4A 4HLQA 4P17A 2QQ8A
chains in the Genus database with same CATH superfamily
2IGKA 1FBUA 4F7NB 1WWXA 1LDJA 3ZOBA 1JKOC 4CSWA 4XQFA 1F43A 2E34A 4M3GA 2J5YA 2L7MP 3ZQ7A 4JI6M 1D2NA 1REPC 1ZAEA 3HHYA 1HXDA 2DCEA 3A8OB 4PCZA 1OCOH 2R7DA 1MH4A 1SMYF 1TWFJ 1K79A 2IS6A 4A3DJ 3QAHA 1M1EB 1D0YA 2VKHA 4ZTFA 4UXNA 3LQ5B 4Z2YA 1SFEA 5F04A 3RYRA 2EFNA 4JI5M 1V5EA 4PK4A 4ZYEA 3OR1C 2CQQA 3H5RA 5EDNA 2FQ4A 2IW6B 4UHTA 3V8KA 3RPUA 2KZGA 1W7PB 5EP3A 4LGWA 4RODA 4MO7A 1FINB 3F6VA 3C9PA 3K2ZA 4U0VA 4HOBA 2C5RA 3LW5F 1OQYA 1Z1DA 2NXNB 2OPFA 1X19A 2RNJA 3F9KA 4RB3C 2JY6B 2JSPA 1AKHB 4BQAA 5CPRB 3DJBA 2UZEB 2FBIA 2HQRA 1Q02A 3OV8A 4BCGB 1FY7A 4AW4A 2RAEA 4EOQB 2WMAB 4DV3M 3W2VA 1FC3A 2YU3A 3K10A 3K9TA 3WVEB 1QAQA 4GGGA 4B4CA 2XDVA 4GC9A 3D5RC 4Q5SF 2IN3A 1G8XA 5K5QA 2LY2A 1I5ZA 3FTCA 2DA2A 3FK6A 4RGRA 2L9RA 3IL2A 2IS1A 4MGYE 5J1YA 2PI0A 1P4XA 3Q8XA 4C2UA 1JQJC 3LFKA 1A36A 3EETA 3HRTA 4CO8A 3FXMA 3W6VA 4DQ2A 2X8AA 2H5XA 2QZ4A 3IKTA 1V3FA 4DR2M 1TQMA 1YITI 4R71A 2NVXJ 1FTZA 1O9KB 2R0QC 4D1QA 3SQNA 3VK8A 4F93B 3A8LB 4LITA 5HVQC 4L9NA 2IS2A 2JQ7A 2VC1A 1USSA 4B7HA 2Q2EA 4PSXA 2IW9B 1JTXA 4FISA 1OL1B 4NSTB 5C1BA 2DMTA 1AD6A 1ZAOA 4HDVA 3HWSA 1F4IA 1QZYA 1KSFX 4KIGA 1ZMWA 5HS7A 1USTA 5GKNA 1FBSA 5HVYB 1EKEA 2DA3A 1X1AA 1OMIA 3VFDA 4J00A 3HOYJ 4IJAA 2BY2A 3GPUA 3LWFA 3GYHX 2ZPGB 4ANRA 1MJGM 2W84A 1W5CC 3HHGA 2V4JC 4A93J 3HOUJ 2DOAA 2M0CA 4HSRA 3SDBA 3WE2A 4R7GA 1L8QA 4LZJA 1IXCA 1ZELA 2DBBA 2ZXWH 1H24B 4BGDA 2LY1A 2CWEA 2BWEA 2HYFA 4R1HA 3KZYA 1GVDA 3L29A 4QOZC 3U1DA 4C9YA 1ZMUA 2CV2A 2QBYA 4LK1F 1PKDB 4MM3B 3X20B 1KZHA 5KHDA 2ZAMA 4F6SB 2EJSA 2DA6A 1B6AA 2F4MB 3FRIA 2AXLA 2V9KA 2CWBA 2ID3A 2WA0A 4GHLA 1SXJD 1P2FA 2F4VM 4A3KJ 3TNHB 1IRGA 5FTJA 1AIPC 1KYIA 3KW6A 2LH9A 1SFOJ 2A6EF 4X1EA 3RGSA 2H94A 2M30A 3IHUA 4S04A 5HLTA 3F92A 2O8XA 1VQMI 1RUOA 2QCOA 3WTWC 1ZGJA 3Q3SA 5K7FA 4QOSA 2HZDA 3BG7A 1OTRA 4WURA 1FIAA 3OMYA 2K40A 3HXLA 3C2HA 3HSRA 2DJNA 1CF7A 2EV6A 4F7SB 3FXKA 4AIKA 2F4OB 4KRDB 1HQYE 5DM7F 2C99A 4UB6C 3LSRA 4A0XA 1T33A 1MX0A 1UZCA 1U8BA 5L8RF 1QZZA 3J81Z 4MLOA 4CRLB 1PUFA 2JSCA 4A3VB 2DMUA 2R7VA 4FX0A 1N36M 2DA7A 1V5FA 2LY9A 1TWAJ 3M6AA 1WJAA 4V2FA 2QEXI 3WHBA 1LJ9A 3MN2A 4BCOB 4Q48A 1G2HA 1HA8A 1DP3A 2Z1DA 4V19K 1L3LA 3GRVA 1ZREA 2BKZB 4HZFA 3S15J 4Q4ZF 3F22A 5L3GA 2R7XA 1QRYA 1NHWC 4PUSA 4L16A 2QQ8A 3HGYA 4B3TM 4OR5B 2JRMA 1JXSA 4BQQA 2KHHA 4HG2A 3I56I 1WXQA 1B72B 1W1WE 5M3MJ 3HOXJ 3EIEA 4OB3B 2X48A 5M5WJ 2CCIB 2E36A 3HRMA 2VONA 4OW0A 1TGUA 4BCMB 3F8MA 3I58A 4BCNB 3QODA 3IH2A 5EEHA 1SEUA 1BC8C 2M5WA 2FRHA 2CHVA 3H4JA 3B6CA 2ISZA 2IEKA 4UNOA 4ZGEB 3LSKA 1H0MA 3ZCOA 3CDHA 4UN0A 3NDQA 2L9VA 2A5YB 2Z99A 2WSCF 4OX9M 2HFHA 2HTJA 2P4WA 4HV6A 4Y3OA 4F3QA 3I51A 4YFNF 3TDZC 1CF7B 1D5YA 3JRGA 3W2AA 1QVRA 3GTMS 4OMZA 3K1JA 2JZ1A 2K9SA 4ROCA 4BCPB 2C98A 1J0RA 3RYPA 3TOAA 3ULQB 3WTTC 1QUTA 1XC5A 3ZGKA 5EQTA 1OAOC 2JWTA 2RRUA 2HWVA 3LSGA 4DW6A 2LR8A 2VBXA 3PSIA 3T38A 2VE8A 3M0EA 2DO7A 1X1CA 2RKHA 1XXHE 3KEOA 4M9ZA 3FYCA 4OU7A 3CF5F 3AG1H 2NS8A 2VT2A 5L3FA 3S8PA 3JR9A 3GLIA 2XF5A 5D8KB 3WTXC 2AHMA 3QPHA 3OYAA 2E19A 2V7FA 1J7KA 4Z6YA 3GQ3A 4JYAM 1EE8A 3EUAA 1PUEE 4C2TA 4YOSA 1T38A 3HY5A 3C3WA 5FKKA 1HLVA 4CFNB 4HX8A 3OYJA 1W4MA 3SEQA 1DQUA 5BMZA 1IN8A 1QGPA 2R65A 3F23A 3UNGC 5J8FA 3W6JB 2BW3B 4XRSA 2PJPA 1QU3A 4BE0A 1CUKA 2HWJA 1U3EM 3HSFA 1TDZA 5ERIA 4JI8M 3QHWB 5FO5A 1Q3BA 1ETKA 4E7ZA 1LPQA 5FROA 3D1NI 1MD0A 2LVQD 1TQIA 3HU1A 4MGIE 4RAYA 4M73A 2CJMB 4I98B 1KFVA 2R7QA 2UUBM 1OI9B 4G4QA 4GKKM 1R5GA 3NWSA 3QU6A 5HBJB 2ZSHB 3GLFA 1HT1E 2JVHA 2BPMB 4E7IA 4DBGB 2LD5A 5JHUA 2L4FA 3BXWA 2ZBKA 2DU9A 5GPAA 4AVPA 2E7WA 4OOIA 3O8HA 3ABUA 4LD5A 2DTRA 2I7NA 5EFQB 1I6XA 2FE8A 1FWZA 4UV8A 3T1BA 5K5OA 2WJ9A 4N9HA 2LF7A 2G8LA 1WR1B 3FUXA 2FQ3A 2L02A 4LRTA 3KDSE 5ITYA 2F5VA 2P7VB 3VK7A 2CMPA 3KPHA 3O8GA 3U1KA 2W96A 1S6LA 4P9FA 2QQAA 2VL8A 4LK0F 3EPZA 1YJ9I 3FK7A 3MHVC 3TE6A 2KIFA 3HEFA 1IM2A 1PYVA 1MMGA 4L9VA 1X4OA 3WODF 1TT0A 3RPQA 5E79C 4XBFA 2R45A 4JI2M 4M3BA 2LVNC 4UN2B 2BGCA 2X0LA 2EKFA 3GLIB 2YR2A 3FKJA 1VFCA 2BYVE 1IN4A 1XMOM 3ZMZA 1AISB 3BPXA 3KIOA 5GPCA 3D5LA 3GXOA 3H9GA 3GTGJ 1GT0C 4L0YB 3CC7I 1A35A 3TP0A 2C4GB 3TWMA 1BC7C 2KFDA 4GITA 2B3TA 2NQ8C 1OL2B 5CYIB 3MJ5A 4KLNA 4DV0M 3VDPA 1HNXM 3ECOA 3REOA 1SAUA 3J81S 1QNTA 1RZ4A 2XF3A 3ZQJA 2AO9A 3S2WA 2LKPA 2CH0A 2K85A 1D0KA 4WXCA 1QAOA 4NRVA 1BM9A 1SD5A 2XLJA 2UXDM 1X37A 5LGTA 3K4MA 2HTSA 2W82A 3PSFA 1K83J 1UFZA 1T56A 1KU2A 1IN5A 1Q39A 2IJLA 4CCKA 4BBRJ 4IQJA 2ZJ2A 5D6EA 1BR1A 3GLGB 2RN7A 1FP1D 3HSEA 3NARA 5IT9K 2DJIA 4Y13A 2O3FA 3IUOA 3T1YM 3U6MA 2ZBKB 3K9PA 5L3CA 4FM4B 1E3PA 1R4NB 3O6BB 4EM0B 1X1DA 1YW9A 2CZ1B 4LJ5A 4AIJA 2D1HA 1IY2A 2PEXA 5FB2A 3LAJA 2EH3A 3HTUA 4B48A 1HW1A 5DUKA 3GQ5A 1RR8C 4IHWA 3FBNB 3CCUI 3F8FA 3ROUA 2VQGA 4ROEA 1YLFA 1XDUA 1OYIA 3V76A 3EDPA 2BE5F 3IP4B 2W99A 3BR3A 1QDRA 3RIRA 2LTPA 1OAIA 2DK5A 4GFBA 3OYMA 3LSIA 2VF8A 3J27B 1V4RA 4PCQA 2M7AA 1XHBA 3KOWE 1ZLJA 2JN6A 2FFJA 3H9JA 1Z77A 2M8EA 3ASNH 3VFZA 1FYMA 1IFYA 1CGPA 4HYEA 4HNVA 5DNYA 5DM6F 1UG0A 4XORA 3T5XA 1ENHA 3C3EA 2UXNA 3ABLH 5AIPA 1ZRDA 4AI6A 1Z5CA 2QLZA 1KXUA 3DWLE 5F0FA 5F08A 2KW0A 4IX7A 1NV8A 4M3FA 1BW6A 4G7HF 3E21A 3AOEC 4PGHA 4FCTA 3VDXA 2GLOA 1ZKGA 3SAWA 2EZIA 2F2EA 3F8BA 2QA4I 1W5SA 2XAFA 4C30A 3AG2H 3S3OA 3FTEA 3CQZJ 4L4UA 1BIAA 4IPAA 2WSFF 1DU6A 3KVWA 2NOGA 5FGMA 3HOVJ 2DAGA 2X85A 2DMNA 3A02A 4ZH4F 3SXYA 2FNAA 1YO5C 1YG2A 2XAUA 3GO8A 2UUEB 2L0KA 1Y0UA 5EG0A 2ZPFB 1VG5A 4KMUX 2V26A 4OAYA 3KCCA 3SHGB 1FOYA 3KP3A 4MGHA 4ESBA 2VQFM 3EOCB 4EGYA 3FHZA 4UUSB 3KYCB 4XK8F 1MJAA 2Y0QA 2PX9A 4LJZF 1J5EM 2F5PA 4OAZA 2VODA 4CH7A 1QLBA 2FSWA 2FUG2 3A03A 1H28B 2P5TA 5K7HA 3WTUC 3M8FA 3MY1B 1T0FA 2C5NB 3ZMDA 1IRXA 2DWMA 2IA1A 2XF6A 1RUNA 1S7OA 2Z4RA 3FE3A 3ZN0A 5BR8M 2BNKA 4CYDA 3AAFA 2ZCFB 4BCFB 3S14J 2Y0SA 2Z3XA 4KRCB 4NL4H 4BLCA 4BCJB 2L7HA 4RGUA 3FM5A 2F5QA 3KFWX 4CICA 1D3YA 4IHTA 2EZHA 4FT8A 4NNJA 1WIVA 3K7AM 4YFKF 4A5MA 4LF5M 4IKFA 3M7GA 2MC4A 1AA7A 2Z16A 4EVIA 1RR7A 1HBXG 2KXEA 1Z5AA 2QVOA 3ISPA 1UNHD 2E1MC 2IP2A 3OIOA 1Y1WJ 3QZ9B 4N0BA 1HKQA 3GEZA 2HAKA 3JRHA 3DV8A 3V7RA 1GDTA 1RU3A 3LSPA 4ZPXA 4EOOB 2RGVA 1T3TA 2G7UA 4A69C 5C4XJ 3RE8A 3GLIE 4ITQA 2K4JA 2Q1ZB 3VYTB 2LNHC 2W57A 4HAMA 2STWA 5E1WA 2HHHM 1HKSA 3BLRB 2MLGA 3ZH9B 1V54H 2Y0MA 2L01A 5CVJA 5FFXA 1J9IA 2W25A 2UV1A 3FXOA 2UXBM 1O3QA 1OCTC 4I4LA 1EF4A 2CO5A 3BCAA 1YTYA 4EJTA 3KP6A 4LOCA 3T8RA 1H6UA 4B3MM 1HR0M 1GXQA 3AV0A 4JI7M 2HOAA 4DJAA 4S05A 2DAMA 2HOEA 5DEQA 3S1QJ 3TN8B 3BWGA 3DPLC 5ICFA 3PL8A 3B7NA 3SARA 1BIBA 4XLPF 3IH4A 4KYWA 4OIQF 2ZC2A 4P55A 2VLAA 1SD6A 4ESJA 4BY1X 4G94A 4NC7A 5F27A 2A6TA 3DCFA 2WAQA 2Q8KA 1SC7A 3HTSB 2F2CA 5JI3E 1WPKA 4S0HB 4N4NB 2K3FA 3DBHB 4AYBN 4I76A 1LKXA 3BP8A 2W9ZA 4PSWA 3GLFE 4BDZA 3TMOA 3FXUA 3U6LA 2OQ4A 5F1RA 4Y28F 3QYBA 1XPXA 1N4MA 1OISA 4LIUA 4IRHA 4PZJA 4CA0A 1MNMC 5KPTA 4DBQA 4XGIA 4WX9A 1IDYA 4KIBA 2CCHB 4L18B 2WZJA 2IS4A 4RMNA 4HBLA 1WJDA 2JY8A 5EJCA 1ZG5A 1ETVA 5ICEA 1OKVB 1LFBA 2HPIA 4U0WA 5HODA 1JHFA 2J7NA 1GO5A 1E7PA 4XKVA 3MKWB 5E8IA 3HPHA 3EIHA 2ICWG 2LYCA 1H25B 2K3PA 1QANA 3GPYA 1OKWB 4LJAA 3UR3C 2YR0A 3IAS2 3GRRA 3R61A 2XAGA 4O5VA 3SEZA 4FX4A 2EK5A 3DZDA 2X1DA 4DYQA 5KNLA 3AOEA 4L5EA 5K7ZA 3TQSA 3BC8A 5HLGA 3TDUC 1ZMVA 3CJRB 2ME6A 2KZUA 2BBYA 1VEJA 3WHCA 2DHYA 5HOOA 1DGGA 5FLXK 1R5HA 2RGHA 1Z7UA 2WV0A 3JAMK 1GXPA 2Z4SA 1BR4A 2IBDA 4XSXF 4F52A 1BN5A 2W7NA 4F6UB 3U6EA 3UMMA 4YIRX 2CFXA 3R8FA 2MABA 3R60A 3PO3J 3GTKJ 2DOFA 4EOMB 3HHZA 2CRUA 1ZGWA 1D0XA 4HL4A 2QSGX 3RTRA 1A5TA 1F1ZA 1GABA 1KGSA 2F5CA 2FEZA 2K02A 2KL4A 4LF6M 2PMHA 2Z3YA 2XGDA 3Q0UA 4AIDA 2RREA 4DNCA 3RKXA 4I7HA 3FUVA 2RV8A 2CQKA 4YFXF 3S1RJ 1T6OA 1TQPA 3WG9A 5B3SH 4HNTA 2D1VA 2JK3A 4ANJA 2H09A 1LFPA 2ZXIA 1XD7A 2X6XA 1QAMA 3KS4A 3TO9A 5IPAA 3CCJI 3W2WA 3WTSC 3AG4H 2ZPEB 4JX5A 5ITUA 4CFXB 2K4BA 4A3IJ 3N05A 4RB1A 3KS8A 3W3CA 3BR2A 4I0BA 4NDLA 4B3RM 5DD4A 3LFUA 3DF8A 4BH9A 1PJJA 2KEBA 4C2MJ 3GRYA 4R3DA 3TNIB 1V55H 4Q47A 2CUZA 2G3QA 4B7GA 2BY3A 5DYGA 2QQBA 2BS4A 4GRIA 4GHAA 2EILH 3HHXA 5IY5H 1VEKA 4HF0A 1J2XA 2XF7A 4BDYA 3K0LA 3B7ZA 1TWHJ 4PDGA 3PNVA 4RLQA 3U9GA 3SHFA 3OYIA 3CCMI 3ESWB 4AQYM 1XTAA 2HQ5A 2I5UA 5DUIA 1H1SB 4XLNF 5C3EJ 3HOTA 4XNFA 5CQGA 3BG5A 4KT6A 2OJED 4BXUA 2XSZD 4I02A 5GAEJ 4ZYHA 4MH0E 5C4JJ 3MI9B 1NHGC 1Z6RA 2CHGA 3U5ZA 2F5OA 1R23A 2ECCA 2CQXA 5ILSA 1W7PA 4IBBA 1OR7A 4DZJA 3BROA 4E7HA 1R9TJ 1T8IA 3CC4I 5H6QA 3D8BA 3FHNA 1VQ1A 4P17A 4XKWA 4KN4X 1FSHA 3M03A 3KZIC 1R7RA 5FKLA 3CJNA 5EP1A 3DA1A 3X26B 1FZPB 4QPOA 1ZG3A 5ACBA 1WI9A 3QOEA 1K6YA 3DTEA 4LG3A 4N9IA 1A6QA 3G1OA 4GMQA 3QP6A 3K1MA 4E70A 1XO2A 2PHGA 4QNRA 3MIAB 5HBEB 4IVNA 3HKZN 4JP0A 2ME0A 5M5YJ 3HBLA 5FRMA 4LJ8A 3KEQA 2M87A 1EV7A 1B4AA 3R6SA 3VYHB 4BCKB 1ONVA 4ZDOA 5LGNA 2MROB 4NSOB 4KT0F 3K69A 4K0KM 4JXJA 3QRFF 2E1CA 3O2PE 4EJUA 2LW4A 3A98B 1Y0NA 2M8GX 1WZ2A 1ON1A 3A2KA 4PD2A 2LBCA 3JCUC 3BHTB 4IBFA 2HOTA 1GY3B 1UGQB 3WU2C 2VQEM 2DDBA 1L0OC 2GA1A 1ERDA 2DFHA 5BOXA 2EIKH 3LVWA 4RKUF 4AKGA 1I39A 3NEUA 3ZMUA 5C44J 3B73A 4I0AA 2YU9J 4IOAF 1H27B 1DV0A 2GXBA 3WHLA 2JRTA 2PLYA 2E1MB 4I2OA 2DAEA 2NVQJ 1O9KA 1Z5BA 3X28B 3BHVB 3AFHA 3TGNA 3BTJA 2K9NA 4HNUA 1D0MA 1AU7A 1G59A 1TH3A 2ACJA 4XSZF 2M1BA 1YJNI 1TWCJ 1LE8B 2HVRA 1J59A 2DD5B 1MMNA 4G4NA 4G3OA 3KLNA 4I3ZB 4XOTA 2QENA 3FM3A 1MBGA 3HGGA 1ZG1A 1IC8A 1YSYA 5F6FA 3A46A 3OIQA 2HKOA 3U5ZB 2OZUA 2MBFA 4DYCA 1U78A 2LRDA 1H9TA 4F7LB 3MMYB 1W0TA 2XC7A 2EIJH 1T39A 4ESFA 3UKGA 2B9SA 3PQJA 4J01A 3VYSB 4KISA 2QM3A 4XN0A 2KNVA 3S1MJ 1R7JA 3A0BC 3EQLF 2QNJA 3C1DA 3VKHA 4NUBA 2E5LM 4II2A 4MQVA 4WCGA 3JRIA 2J7OA 1R1VA 3JR4A 2JJ7A 1JHHA 2MH2A 5DV5A 2RQQA 3GX4X 2H1LA 4XK4A 1Z05A 2OOAA 5LLQA 2EO2A 3CDIA 2DXIA 2JY5A 2A6HF 2M0MA 3VPRA 1RETA 4CZZA 2GZWA 2M4GA 4LG0B 4TTHA 3JRFA 1JR3D 1T43A 2D7HA 2DT7B 2KRFA 2VBZA 1N78A 1SFXA 2VF7A 3HUGB 4X65M 2ZPBB 2RQPA 2GOXB 2C9OA 3HPGA 3RGPA 1K61A 4A6EA 3ZQGA 2QWWA 3LA2A 4HLXA 1U2WA 5FTKA 4HV5A 1HW2A 2P81A 2VASA 2XVCA 4IRGA 2HKXA 2EA2A 3OIPA 2VPLA 5J8CA 2CUFA 2JXNA 1H9GA 4D81A 1HNWM 1TWGJ 4XMYA 4LFCM 4EM2A 1JT0A 4XONA 2OOBA 5JLXA 5HLHA 2O5RA 2L4AA 3RQ4A 2QFZA 4BCQD 2PG4A 1FNNA 1YS7A 4XLCA 3GTJJ 2O7OA 3VYUB 2F5DA 1TT5B 1BI0A 2CSOA 5D5WB 3JR5A 4G6QA 3QHRB 2C5VB 5DTDA 2LDUA 1V34A 1GJSA 3CP2A 2XHKA 5E1ZB 5FFZA 2O6GE 4CFVB 2XKPA 3BR0A 3H3ZA 1OIPA 4AIHA 2G77A 3U6CA 2D2WA 5LHGA 3Q9VA 2VIXA 4HRIA 4A3LJ 1S8NA 5KCMA 2WB1N 4GCVA 3W0FA 3I3LA 1BOAA 3NBIA 4M9SA 3BDDA 3ONQA 3S1NJ 4RA2A 1N75A 2JZ0A 2VIIA 4CGYB 3DFZA 2KDOA 3FXLA 2VXDA 3JREA 1ACIA 1GHCA 3NAUA 4G12A 2VBYA 2FOKA 2EA0A 1S9HA 4L6V6 1K78A 2XIGA 1K6OA 4BY7X 1URCB 2R5YA 1Z67A 3T8TA 1KU9A 4R79A 1I94M 3GLLA 2AQEA 3DLLF 3GLHB 3M07A 2V1UA 1B72A 2H6CA 3DKWA 1IRZA 1IY1A 3C58A 3RJPA 3ZQHA 2O01F 2F5EA 1VZ0A 4BXXJ 4PT5A 2CP8A 2CUEA 2KMUA 4XKCA 4QHTA 2DWLA 2DI3A 1SFKA 4WXDA 3PXGA 3KP5A 3PO2J 3ZR8X 2P5KA 2FMLA 3E6CC 3H5AA 2ECBA 2PMZN 3K1PA 3I71A 1Z7LA 2P6TA 1NY5A 3GPXA 3HDDA 2M9HA 3TQNA 2PK2A 1SG9A 2QPAA 2DT5A 3VDUA 2R44A 1OJLA 3HC7A 3S3MA 4ZTJA 5BS6A 2UWMA 1IBLM 2DT6A 2BHZA 1YOVB 1TTEA 1H89C 1NJFA 1LDDA 2XGEA 2W00A 2Y48A 3FKEA 4RM3A 1NY6A 4EONB 3IECA 4KFCA 1B9MA 3SZPA 1N33M 4OB2B 4RM2A 2ETHA 3SFZA 5FTNA 2DFEA 3GZ6A 1GUXB 1ZRCA 4LFBM 3MK6A 1QYRA 1V5GA 4G6LB 5L3BA 3I53A 1IXZA 1E0EA 3PIOF 1NH3A 3D8LA 4F7JB 2EKKA 2M34A 2QYOA 3L2QA 4LB5A 1MH3A 2AHJB 2KPMA 3ZPLA 4NSRA 1FT9A 2QQ9A 4BHCA 1ITYA 2D5VA 4C3HJ 2P6SA 3ZQLA 1DDNA 3I4YA 1IJWC 2M2EA 1H88C 1K78B 1DUXC 2EIMH 2CW8A 2R5YB 1Z91A 2NOJB 3J80K 5LRSA 4MB7A 2WPAB 2BW3A 2P7CB 2YX7A 2DW4A 1WJ5A 1G3WA 3ZXSA 3GTOJ 4E7KA 4B43A 3P7NA 4D5CA 3B6AA 4I8OA 4S12A 4ITVA 1GKIA 5J47A 4WK8F 2DYRH 3L2VA 3SDGA 2NS0A 1O3RA 2K6BA 2MR9A 1ZN2A 4YHHM 1O3TA 1TZLA 2FBKA 3J2PB 4XR6A 4MGZE 2F4IA 2JUGA 2GM4A 4F7ZA 4GXOA 2WFYB 2V6ZM 3HX3A 1SXJC 3W68A 2P5VA 3JSOA 2DFIA 4GH9A 3RZDJ 4UUTA 3GF2A 2EQRA 4RF0A 7CATA 2A05A 4RGXA 2QDYB 2OQRA 1W5TA 2DAKA 2X4HA 3M1EA 1FYLA 4LLGF 4PDKA 5B1BH 3U21A 4C3JJ 1PM5A 4HDUA 4WW0A 3PNTA 4HF1A 4MGRA 3MQ0A 2A5WA 2VPRA 3Q5FA 2UZBB 3KP0E 4OVZB 4RLFA 2LP0A 2KDZA 1B1BA 3DEEA 5TRDA 1R6RA 3E46A 2L2OA 1BJZA 4E4HA 3TBIA 3WGGA 1MIJA 4WP2A 3HIFA 3RCOA 1MJ9A 2ZJPF 3FWEA 2R7UA 2N35A 3BG9A 2WTEA 2KKOA 3V7CA 3F72A 4XLEA 1L1TA 2COBA 3V42A 2DPPB 2XRNA 3GTPJ 3HKPA 1TLHB 1O4XA 3CF2A 4LCBA 2EFQA 2GNOA 2RC4A 3GFLA 4KJZA 1JUMA 2XFTA 5E8GA 2JNHA 5C18A 1BVSA 4MFDA 2A3SA 2O0YA 3CMMA 4XICA 4U88A 1LDKB 4WF2A 5EZGA 4WXHA 1P6RA 4BCQB 2MW8A 5CVRA 2UXCM 2F5FA 2B0LA 3VB2A 1FOKA 5BNGA 1O7FA 1XCVA 1TC3C 1ZLKA 4OIOF 3T15A 1TP4A 3Q0WA 3CO7C 3LSHA 2IT0A 2WEVB 1HOMA 3BT9A 2PN6A 2XH9A 1UAAA 2EFPA 3GW2A 3S2DJ 5TJJA 3GLGA 1MMDA 3MZYA 2XB5A 3KYDB 3QQAA 3VSKA 2UUZA 4RS8A 3VSLA 1FEXA 4R8HA 3DKYA 3KXEC 1FBQA 2WY8Q 3C18A 3K4NA 1E17A 4UUVA 3G6EI 1FOWA 3KP2A 1LEAA 2Y9ZA 3LVVA 2Z9OA 2R7TA 5IT9S 3HU2A 3K4BA 4B47A 2DHRA 1EH7A 2FU4A 2KJBA 3I55I 4BHBA 3B02A 4II7A 2ESHA 2JTVA 2K9MA 5EGOB 2KZSA 1JKQC 4CISA 4I5SA 4DUYM 1TL8A 4LF9M 2QF7A 3BG6A 3QYEA 1JJ6C 1C9BA 2CHQA 3ZN1A 2E2JJ 1UMQA 5E17F 2LFBA 4RAZA 2QGSA 4F92B 4UVCA 3EYYA 2BY1A 2F5SA 2ZMEC 4HSTA 5EZHA 3OSGA 4MEYF 3OR2C 1PDNC 5EP2A 2DENA 5ITXA 3LSMA 2R7FA 4KITB 2HYGD 1U9OA 1E2XA 1W36D 1Z3YA 3O3KA 4KN7X 3B89A 4G8XA 3W67A 4A3FJ 5KVRA 4AG5A 1D5VA 4LB6B 4EV0A 4BKXA 2DN0A 1WJFA 2EJRA 4IHYA 2G0EA 2HR3A 2EUFA 3X2QH 2QKMB 2QZ8A 1H1QB 3DTIA 1B8IA 2E5NA 1S72I 3FF5A 3G3ZA 3FXQA 3QP5A 2AS5F 1X2NA 4X0GA 1VQ7I 4ZGDB 5LEJA 4IBGA 3FXRA 2VQHA 1XS9A 2HZTA 3OYDA 3JAMZ 3BJOA 1JKRC 1ZP2A 1L2DA 3A4CA 2FD5A 4KT5C 4A5NA 3JRAA 1YHQI 1Q1VA 5L2WB 2LWXA 3I04M 2L54A 3DBRB 4JK1X 4KUMA 4CFUD 1JKPC 2C5XB 4IJEA 2L5QA 2EPFA 3KOYE 1RRJA 5CEIB 4F6WB 4P16A 2DA4A 2HPMA 2V6EA 5H37D 3RI4A 1MDMA 5HNBB 4DBRA 2NYXA 3CLOA 4UUSA 2QDJA 1IAWA 2FMYA 2HXOA 4CDGA 1SXJA 3L28A 3UJNA 2OCCH 3WG7H 5FTMA 3PUBA 4XBOA 1UHSA 2OO9A 2TCTA 1LEBA 4A0YA 2C96A 3SYTA 3MZHA 1ETXA 4EOPB 2HQNA 5E6JA 1ON2A 2YQZA 1RKTA 1IV6A 1G71A 1S7EA 3G2BA 2DDAA 3CMEI 1H8AC 1VEGA 2CZ0B 1JI8A 1EH8A 1OFHA 1V92A 2H6BA 1SD7A 2K47A 2DFFA 5E1XA 2W9FA 3OOPA 3A8HB 3H9QA 4FWHA 3B74A 4ASNA 5H6RA 4ENNA 2OZ6A 3KOZE 1VNDA 3PO3S 3CMAI 2WWYA 1U6GA 5B66C 5A2QS 3J7AS 3DEUA 1T98A 3THGA 4BU2A 3B7QA 1R2ZA 3JTGA 5FD5A 3VYRB 3IKVA 1XB4A 3JRCA 2V9PA 5EXSA 3H0DA 3G33B 3ZMSA 4JI0M 1XMAA 2CG4A 1FVVB 5LBQA 3FRHA 3UZUA 3RKYA 1B8IB 5CVIA 1DGFA 2OC6A 1OFCX 2MD0A 4CHTB 4A6DA 4EC8B 3J7AO 1W36C 1NHAA 3GTLJ 4OIPF 5DYIA 2XAQA 4M74A 1MNDA 2HOSA 3G1LA 1FPQA 4Y4RA 3OYFA 1MBHA 1R5LA 4EMSA 5LD2C 2KHMA 5TGTA 1R49A 1YRNB 2JPCA 3BLHB 4IL6C 1L2BA 4KHPM 4IJFA 5IYBJ 4G4RA 1NSFA 4OINF 4RDUA 1MDMB 3QAUA 2IGOA 4DR6M 2JY7A 2W85A 3GUDA 5J40A 1DO2A 1LTMA 5JLWA 1SXJB 4ENJA 1D8JA 1SMTA 4I09A 2RDPA 1QHGA 4E7LA 2MH9A 4P5OA 3TPZA 2CE7A 1OIZA 3ZQQA 4YG2F 3JRBA 2HVSA 4UV9A 1GVJA 3SBJA 1XMKA 2BZTA 2F5NA 3NQOA 2JUJA 3C2BA 4XLHA 2M5ZA 5IHYA 1N77A 5A2QK 3CGWA 2ADUA 2Z33A 3P9IA 2C6YA 2R7OA 1C0WA 4JV5M 1UFMA 2I8DA 1MZBA 2ISYA 4QHSA 2GIZA 2K7LA 3AOGA 2X9DA 3DFGA 1UGSB 3GFJA 2HXIA 2MLKA 2XPWA 2VC0A 4XLFA 1ZR2A 2FS1A 3X25B 2V9VA 1XX5A 3HYIA 4IEJA 2QSFX 2ZMEA 4FD2A 4E6KG 1YFHA 3EUHC 3VODA 2Y2ZA 3K2LA 2I53A 4MGKE 1TF0B 4D80A 1FX7A 1SVLA 1IF1A 4DZPA 4EJVA 2XEPA 4L9JA 2LF8A 3JSPA 1HC8A 3G4SI 1ZTRA 1R36A 3CP8A 3T1HM 5ILUA 5DS9A 2UUCM 1ENWA 2MC3A 2H27A 1SANA 2OTJI 2BWBA 4AD9A 1MN3A 4PFPA 1Y8QB 1E3OC 2DK8A 1N34M 2V1NA 2VKDA 2BS2A 3JTHA 2ZPIB 2BV6A 3HOSA 1BI2A 2JA6J 2WV1A 4G6TB 1VQKI 3SJMA 3GFMA 1BI1A 2ZJRF 1H4LD 4BBAA 1PJTA 1MKMA 1P7JA 1ULYA 4A3GJ 4ELJA 5HLIA 3QPLA 4Y33A 1QA6A 1QPIA 2ELKA 3NWTA 4IOCF 4X6AJ 3HKZA 3LNQA 4L15A 1IUYA 2QGUA 1UHMA 3A45A 3TWKA 5FLXS 2LC2A 1WHUA 3W6KB 4FX3B 1N25A 2EA4A 2CUJA 4IZZA 4CXAB 1YIOA 3JAMS 2X51A 2AXTC 4HQEA 2FJ1A 1BA5A 3ABKH 5E18F 1IBKM 3BTLA 4DV6M 1G4AE 3GLGE 2VKEA 2VN2A 2PJQA 3RKWA 5FLVA 1R5ID 4RAFA 4M6YA 4CGZA 1JTYA 1YI2I 3LAPA 2XPVA 1GUUA 3I59A 3U2RA 1JSTB 1DPUA 2E1OA 2VE9A 3WVDB 3CJTB 1O57A 4LZZA 3M8EA 2ZMEB 3A42A 3OYKA 3HRUA 1XNQM 1TBXA 1I1GA 3ZP5A 2EV0A 1AWCA 2VB6A 3V4GA 4E7JA 4P96A 2VOPA 1D1CA 1ODDA 1WVRA 2HI3A 2L7KA 2R7SA 3BBZA 3HL2A 2FE3A 3OWTA 4I99C 5BPVA 1V29B 2EFWA 3U60A 3S16J 2V6CA 5EXXA 1N32M 5HS9A 5E3LA 3MY5B 1QHHD 1WH5A 3U6SA 2XSDC 4I81A 3HB9A 1P9QC 4F91B 1VQ8I 2WMBB 2DMPA 5EYRA 3Q0VA 2F48A 1OYYA 4FETA 5ITXE 5L3EA 1SFUA 5DCMB 4LFUA 1LQ1A 4UVAA 5D5VB 4ZGJB 5EEAA 2XROA 4KNYA 1V33A 1ZQ9A 4EQQA 1NJGA 1C7YA 2VKVA 1XGNA 5TISC 3E3VA 4EC9B 5BPIA 5DFLA 1MSEC 2IRFG 5EF6A 4L9TA 2C6TB 3FYDA 2Y9YA 2ZANA 5FLMJ 4DR7M 3OS0A 4M9XA 5E20A 3OYEA 1BU2A 5IP7J 1XDSA 2K86A 1QVUA 1SVMA 1UJ8A 3DU6A 4B7FA 2QCUA 1F4KA 3COAC 3MZ8A 1Y1VJ 1IXRC 2E5ZA 4FWGA 1Z59A 1AHDP 1MW7A 1VQ4I 5EP4A 2O03A 5IYDJ 5EXTA 1TR8A 3LCVB 2B63J 3LCUA 2KP6A 2MA3A 2W1OA 2Y69H 4MQ9F 4QWQA 1MMSA 2DZLA 2LVPC 1IGNA 3QXEB 2M3AA 4NC8A 1R22A 1I50J 2E7XA 2ZO4A 2FOWA 3I01M 2DOEA 2Y75A 3FISA 3I59B 5IDPB 3MVPA 1XNRM 4N4OB 1DPRA 4WWCA 1DGHB 1LUJB 3DOAA 1P4WA 2UZKA 4AVZA 2JWSA 3Q8GA 1SXJE 2IGNA 1VINA 1G41A 3GLXA 1PJIA 4OIRF 4LY6A 3UGJA 4BCND 3U61B 2EZKA 4ETSA 1PGYA 2X1EA 4XN3A 3U60B 4CXFA 3FX3A 3DOGB 4LF8M 5HQ0B 1HT2E 1SD4A 1T95A 2CEAA 4P1WA 3H4CA 1KU7A 1X1BA 2V1DA 1OCPA 1FKMA 3OYBA 4DR1M 1XGSA 2QKLB 1G3TA 1MNEA 2DXCB 5D6FA 2WAEA 3KP4A 1LE8A 2KQRA 1R1TA 1IUFA 2EINH 2MGQA 4RB2C 2Z7JA 4DV5M 4JBAA 3OYHA 1OKRA 2DODA 5CYVA 4JX4A 3K4KA 1VI0A 1HSTA 1QQIA 2XSJC 3K4JA 4XL9A 1VQ6I 2B9RA 4LF4M 4TV7A 5J6XA 3OYNA 2DYSH 1IXSB 4W97A 4BBRM 2IVMA 2KJCA 2RNGA 2DAIA 4NXNM 2MJ5B 2X1CA 2VT3A 3BZ6A 4YEJA 1Z6TA 2KRKA 1FMWA 1OPCA 1WJEA 5JVTA 1Y8RB 2G7HA 3QOPA 2V79A 2BS3A 2DMEA 2XGCA 4PJJA 1IQPA 3F6OA 5HS8A 2ZZDB 1TW2A 2JP7A 3DBLB 2EWNA 4KIFA 4LJ9A 3FTDA 2MSYA 4RF1A 3E5XA 3H0GJ 4AKIA 2OU2A 4RAGA 1AOYA 4CFUB 1B59A 2AQFA 1JOWA 5BNJB 3ML6A 2R7WA 3GBGA 3K4CA 4LLLA 4MHGA 3EIDB 1C1KA 5LMNM 5K5RA 1BR2A 3BTIA 4LG0A 1FP2A 1VQPI 1D0ZA 3ERED 4M6XA 3PNYA 4OU0A 4B3XA 1VQOI 1ZK8A 3HUGA 3FUWA 5LMUM 1ETOA 2UUAM 3QPTA 4BY1J 1G3NC 2R92J 2X6WA 1XSVA 2M45A 3ELKA 1XB2B 5IZ7D 4MTEA 3HRSA 2MYSA 3OY9A 1XN7A 2YSRA 3T0YA 4EJOA 4JOMA 1HNZM 3FTFA 4YOZA 1Z21A 3NWLA 5LFAA 4QTRA 4MTDA 4IHVA 4PJ0C 1P7IA 3BJAA 2ZB9A 2X1NB 2KISA 3BHUB 1NTCA 3N97A 5KPRA 1PVEA 1OCZH 3CZ6A 2DD4B 3VYGB 5LHHA 2WAQN 2IXSA 5J4VA 3PVSA 1QBJA 2VJIA 3L09A 2JVGA 3G71I 3JW4A 1WHCA 5IREB 2Z5UA 5HDGA 5LGUA 3FZVA 2L4EA 1E3HA 1WJBA 3AG3H 4D5FA 5FRNA 2A68F 3CLQA 1EFUB 1YQAA 2LXEA 2FBHA 3H35A 3OL4A 4K2EA 3ZCBB 1Z3XA 2BHYA 3GQ4A 3I5UA 3ZMVA 1WFXA 3WGIA 3KLOA 2KNZA 2BXYA 2OF7A 1HF0A 2NVTJ 1VDDA 2L7IA 1XC8A 5J3LA 2HL7A 3E5QA 1ZRFA 1JB0F 5ICPB 3EUKL 4FE7A 5J4YA 4HLQA 4BS9A 4A3CJ 4EOIB 2ELJA 3F8CA 4LGMA 4J19A 3BR1A 4DR5M 3DXJF 4XM3A 1ZQ3P 1VQNI 4BJ5C 2COMA 2KRHA 2TDXA 4Y7NJ 3D0SA 3BZCA 3D5SC 2MFZA 1R4MB 3H36A 4HX7A 3CCRI 3O0GD 1Q3CA 2KRUA 6PAXA 2LKXA 2HDCA 1NNJA 3MWMA 4IQ4A 3NBXX 2O9LA 4HF2A 2CS3A 2BXZA 4XOPA 2PJRA 4CCMA 5AIQA 1Y39A 1JE8A 1LFUP 1HDDC 2K9QA 1IY0A 3A1YA 3HM5A 3K9OA 3QU3A 4MFEA 1QZEA 2Z2SB 3S32A 1FSEA 2GXAA 1ETQA 1JGGA 3GLHA 4EGZA 4IHSA 4ZDLA 5E3MA 1I4WA 1T6SA 1XGMA 3L25A 5CJ9A 2R5ZA 1I1SA 2PQ8A 2JGZB 5BPDA 2GOMA 1X3ZB 5FJ8J 1YS6A 4F1IA 4E7SA 2Q0OA 3P9KA 1A04A 3CTAA 1GL7A 1K82A 4PGGA 2N8GA 3DQVC 2LVOC 4ON0A 4FCVA 2DQRA 3ERMA 3OYGA 2LMDA 2JT1A 4NXMM 4L5JA 4A3EJ 2LHCA 2XGXA 4G6ZA 2FH0A 5DYMA 4F55A 4JI1M 1AHJB 2L09A 3DEWA 4BB9A 4UB8C 3LQQA 4UVBA 2W2HA 2LTUA 3E7LA 4QLCU 2WHBB 5KPZA 1K3XA 3ZQIA 4KA4A 1OGUB 1XXHB 3CMYA 3TOBA 3AL0C 4F70B 3ABMH 5GP9A 3OYCA 1GUXA 1ETWA 2DKLA 2ZFUA 3KE2A 4ELLA 1P3QQ 3HJ8A 3CC2I 4KDPA 1ORYB 1YX5A 2UZDB 3IC7A 4CCNA 3HHWA 3TEDA 1NO1A 3MKZA 2Z8YM 4EJWA 4KO8A 2FA5A 4RNAA 4P9UA 3BJ6A 3ZQFA 2L2DA 1K7AA 3F21A 5L3DA 1GVNA 3DKXA 1GL6A 2H8WA 3BPVA 2BJVA 1R00A 1A31A 4L8RC 1VTNC 3PJRA 4ABZA 5HNHA 4BBSJ 2PJRB 5HNFA 1APLC 5CVVA 3P5JA 2WSEF 4LGYA 3U6PA 2RKOA 2Y30A 3GZNB 4D0PA 4ZZDA 1OIUB 1SAXA 1U9NA 2IA0A 3HU3A 3A01A 2WIPB 2ERCA 5ITQA 2R0IA 2LLKA 5IT9Z 5D4SA 3RDIA 1J75A 1W98B 3BCBA 4JN6A 1U5TC 3R9XB 3RGFB 4YY3M 3GRUA 3LA3A 2YUSA 2R5ZB 3J80S 4REZA 5I5ZB 4AKHA 3KP1E 2NNYA 5FKMA 2ZSIB 1GV5A 2DI0A 1S3JA 3HHHA 1EH6A 1OCCH 3E5UA 3E6MA 5DQVA 1D1AA 1I6HJ 2O8KA 2X4AA 1IW7F 2JUCA 1MJBA 3L9FA 4BQNA 5JFRA 2JZYA 4IBCA 2O61A 1KYWA 3A0HC 3DPTA 3PIPF 4BE2A 2IPQX 2CV0A 3LSJA 4FTHA 1XMXA 4DV1M 1XCBA 5AONA 3EJ1B 3L2CA 4EOKB 1RPWA 1JUSA 4B1RA 5BQTA 1D3UB 4CCLA 4CFWB 2IGMA 4JI3M 1JSUB 3LMMA 4NB5A 2DA5A 2XZFA 2KIUA 4O6JA 4ZC3A 2DQLA 3FMRA 4OVZA 4JQFA 3GCMA 2R62A 2PBIA 3WTYC 4EIWA 3L26A 2X6YA 4BYYA 2HS5A 2WIHB 2BOLA 4I6ZA 1WH7A 3IHPA 4H0EA 2Q2EB 3L2RA 4B8XA 1G8PA 3C2GA 5F3WA 1UM8A 3BZKA 2ZNZA 1E9SA 1OYWA 1IN6A 3M9AA 1QUSA 4DR3M 4DV7M 2IAIA 2XSZA 3C3DA 2WXVB 3ECHA 1TH4A 2Y21A 2OBPA 2M60A 3K7AJ 2OPTA 4AC0A 3A01B 4MEXF 3J7ZI 1RC9A 1X3UA 2V1CA 3FDYA 2NNNA 2R7RA 1YIJI 2E2HJ 1KQ8A 1E9RA 1NV9A 1LVAA 5DDGA 1P5EB 3CCEI 3K4LA 3S2HJ 1H26B 4NOOB 4NC6A 2JMWA 1DGBA 2EV5A 5JHFA 2C5OB 4HPQA 1WJCA 1IDZA 4LG2A 1I3QJ 2WC2A 3F8NA 5D4RA 2QBYB 5J1RA 2KNAA 4M71A 1MBFA 5K1YA 1E32A 3H1CA 3WGHA 4FWDA 5E3OA 1X1PA 4BQOA 3GO5A 3G73A 3TP3A 3IRRA 5A2QZ 4CJ6A 1G4DA 1VQ9I 4U87A 3SATA 3CCYA 4YRVA 1X2MA 3L2WA 2PFBA 4A2UA 4IBKA 2IA2A 3IAM2 4LJ4A 1QO0D 5EGOA 3L2UA 3G1MA 3CF0A 2NRAC 4GIPA 2R93J 4B3AA 4LFAM 2LSOA 3S3NA 2LVSA 5ITRA 2JA2A 3MMPA 1I27A 4Y72B 1R4GA 3K92A 4ZDPA 4PJLA 1MBJA 1VQ5I 2WBMA 2OA4A 2FOIC 2W48A 3M3YJ 3FBIB 1UG2A 2VJ4A 1PJSA 3OTOM 1NK2P 4KMFA 1STZA 1BW5A 1QMZB 2KR6A 2KDLA 3SC3A 1YE9A 1EJ9A 1S7AA 4KICA 2DZOB 5ITTA 3FMSA 2PMIB 1LNWA 3ZQCA 1PP8F 1VDLA 5LEKA 1NK3P 3L7WA 2L9SA 5HDNA 1BBYA 5LRRA 3V8LA 5IOYA 3H3VK 4YOOA 1PUFB 2VDBB 1S29A 3PM1A 1D1BA 4PFOA 3SZGA 5GTIC 2E2IJ 4G7OF 4ZYGA 2L7FP 2V1XA 1QDTA 1TNSA 3CDLA 4G7ZF 4XIDA 2VBWA 2K0BX 4M0WA 2XASA 3H92A 1S5LC 5ICGA 1VYWB 5DQWA 4EORB 1WKMA 2AHQA 2EZLA 3LSTA 1AUAA 1HJPA 3KSJA 5KAFC 3KEYA 4GKJM 4CHUA 1U5TA 3KX2A 4BY7J 3KZZA 5FSWA 5FGKB 3BTCA 4BHPA 1LV7A 1ZV1A 3AJIB 2H1KA 4JYKA 4IIWA 1JR3A 1RI7A 5CKTA 2D45A 3TWLA 3ASOH 3MKLA 3FD9A 3M8JA 4IO9F 4LJ7A 2E1NA 4L0ZB 1JGSA 1G3YA 2ELHA 3GLHE 1OCRH 4CYCA 1POGA 3DDQB 2PK9B 2K27A 4II3A 4OGRB 5KAIC 3HJSA 1UNGD 4XRFA 3POMA 1GH6B 2G5GX 1FYKA 1TDHA 1EA3A 1QVTA 1XWIA 2ZFWA 3B9PA 3GWZA 4OB1B 4NQWA 4IBDA 5ICCA 3WTVC 4RBOA 5FD6A 4IF4A 3M4OJ 3TW6A 3DLAA 5JR3A 4FHTA 3MKYB 3Q9SA 1BJAA 3I54A 3F5XB 1OFIA 3DL1A 3AL0B 1UB9A 1WRJA 1WQ2A 3K1NA 4B3SM 3VWBA 1OIYB 3HGIA 1T0FC 3HOWJ 2M7BA 3CUQC 4NRWA 5IT3A 1MSFC 2H1RA 1Q1HA 1G3SA 1WCMJ 1KA8A 4BEHA 2LK2A 1FJGM 4FW9A 4CCOA 1K4SA 4ZZLA 1WSUA 1L1ZA 3H5NA 4AU7A 1T2KA 3E1SA 1IBMM 1TW3A 4U7BA 1A5JA 2FNPA 2UU9M 4LIVA 3FIWA 5FLXZ 4ZYAA 2RVCA 1IV8A 2XPUA 3H3UA 5GTHC 2P0WA 3J7AY 3VOEA 2YPRA 1XG1A 5KQDA 2YNMD 1U5TB 3SMSA 1TTYA 5ILVA 3CTWB 1ZHFA 3SYKA 2JPBA 4IMYB 3WE3A 2KIMA 1F5QB 2HVQA 1YRNA 2QHOB 2FXAA 2ZCWA 1PP7U 2CV1A 1ZARA 2FX0A 1F5TA 2DWZB 2DLLA 3JRDA 2NS7A 3E6BA 2R7ZJ 3I4NJ 4AYBA 3HOZJ 4CYCB 4PDIA 1NVMA 3MAJA 1R6BX 4X66M 5KQ8A 2KIQA 4A3MJ 3RFWA 2MD5A 4FQGA 3LA7A 4DOZA 3S17J 2ZTDA 3HG9A 4NQWB 4BJTA 1ZGAA 1UELB 5KK1A 2I7PA 1LB2A 3GLFB 3K8ZA 2X49A 2ZXJA 1D8KA 4DV2M 2E35A 4G9YA 3J7YJ 4GC5A 4PJMA 1MBKA 2YFQA 1PJRA 1ZR4A 4CCJA 2QSHX 1P4AA 3OOUA 1NG6A 2DPDA 1DGRM 1HSJA 1KYZA 4QNMA 3LQRA 2CGPA 4BEHB 3OS2A 1IZ1A 3TO7A 2CU7A 1VQLI 1TH2A 3A8MB 4HQMA 3SMPA 1HDPA 2LOOA 1YJWI 5GADJ 2DVWB 1JUPA 1J5YA 2E71A 2G9XB 1KU3A 2ZAOA 3GMEA 5D5XB 2OQGA 4D9JA 4L5IA 2MH8A 3IRQA 3EYIA 3IWZA 1IO2A 3BQZA 4XLAA 3CCQI 4BE1A 4LMYA 3I4MJ 2EB7A 1H1PB 4ZYDA 3MD2A 3QZ5B 1Y56A 2CZ6B 5IP6A 4BBSM 4LJ6A 3I0TA 2W24A 3CF6E 3GTQJ 3BG3A 2BY0A 2XZUA 3J81K 4U7DA 2F6CA 3GPPA 4UY8I 2QP9X 2IW8B 2XRLA 5FKOA 4BUPA 3E0JB 1YUBA 2X6OA 4YIFA 4L78A 4B08A 4Y17A 3CD6I 2KT0A 3BR5A 3BR6A 1R2YA 2MGWA 3KSXA 1DO0A 5JI2E 4HX4A 2JA5J 2K5CA 1WGXA 1W7PD 5M5XJ 4TUWA 2XAHA 2ZNYA 5GAGJ 1R71A 1QQWA 1O3SA 1HCRA 4NHJA 4M6VA 2GXGA 3ZMTA 4RB0A 1SVOA 1KQ9A 1WGLA 3WU0A 4A3JJ 2CZ7B 4PJNA 3GTMJ 3KFUG 4EOLB 4D7MA 1E9HB 2VJJA 3N4MA 2BEOA 1B9NA 2EUCA 5IYCJ 3LOCA 2E60A 5EEGA 2PMUA 4BACA 2WADA 4AUXA 1NG7A 4HW0A 3J7BA 4IBEA 1DP7P 2RGOA 2A61A 3TW7A 5B5EC 4HEOA 2I10A 2BVMA 2C9CA 1YYVA 4JX6A 2R4GA 2CW7A 5CQEA 5IF1B 2VI6A 2HU9A 2IW5A 4ZJZA 4CUGA 1DGWY 3CUQA 3FKIJ 3RZOJ 1IG7A 2DXBB 4YC3B 4JI4M 1RESA 2NVUB 1K4TA 1GV2A 4A3BJ 1X4PA 4EEFG 2DA1A 1HQCA 5H20A 1FIPA 5D5UB 2CJJA 2XFSA 3BOQA 3PUFA 4GO1A 3I64A 2OAZA 5F0CA 5IP9J 2UXXA 4CZCA 5LQFB 1XSDA 3SZTA 2GIVA 3K2AA 4OWRB 1JKWA 2JA7J 4NBQA 2ZKZA 3RQIA 3GZ5A 3R0AA 4QPQA 4AM3A 2OUMA 2A69F 5DCMA 3V8JA 4DGWB 4QIWN 3MFKA 1DU0A 2GQFA 4FE4A 4MNUA 4G6DA 2LH0A 3QPSA 2DWNA 5IDNB 4CFMB 3T6PA 1RKWA 2YS9A 3DPUA 1MGTA 5D8LB 2M4KA 3CJQB 5CVUA 5M3FJ 1I3AA 3RPUD 2K9LA 2XV4S 4M3EA 3CCSI 1FMVA 3GP1A 3TL4X 2ZJQF 3WTZA 2I40B 4AZFA 5JI6A 3E6DA 3IG8A 2L3DA 3I4PA 3CO6C 3KYLA 5EG0B 5CLSA 5JVGF 4BCHB 3RSNA 1VOLA 3H4MA 3DU5A 2R4EA 2ESNA 3TO6A 1OR7C 2P5LC 5KO3A 2XUBA 4X62M 1OKSA 4HEA2 4A12A 3OSFA 2KLOA 3M1CA 2HKJA 3PQKA 1XGOA 3OS1A 2KMGA 2UZLB 2LVAA 2GA2A 2XB0X 1PJQA 2L6OA 4MIMA 2GAUA 1BL0A 1JR3E 2R18A 1L2CA 5HDKA 2GQQA 4W5WA 4V2GA 1YX3A 1PRBA 3DTKA 1DGHA 3KHIA 1UCRA 4M72A 2CFOA 1G3IA 2HEOA 1O7LA 3OYLA 2LHGA 3CUQB 4B09A 2P8TA 2LKSA 2HNHA 2O25A 2ID6A 1TNTA 1Y8GA 1TD6A 4HA8A 3CCLI 1JT6A 4GYIA 1KQ0A 3U61A 5E26A 3F0CA 3WU1B 4LF7M 1KONA 2IVXA 2ZXHA 4Z8XA 4QSHA 4XRSG 4Q7JA 1T08B 3F3XA 3SFIA 2K9DA 1X3WB 4RGSA 4FCYA 3WHKA 3C7JA 5GAHJ 1H1RB 3QYGB 2GBYA 2TRTA 4B44A 4FCWA 4IRIA 3DP7A 2FF4A 3RKQA 2ZPHB 4BJ6C 5F64A 1D0LA 2NAZA 3FUTA 5EXPA 1YW7A 3LL7A 4Y15A 1MU5A 1YW8A 4I01A 4DYRA 4HLYA 4AWXB 2A07F 1MMAA 3IWFA 4DIQA 3I4VA 5HBHB 2DTZA 4Y52J 1BOBA 4XRMA 3K70D 4D7NA 3B57A 2R4JA 1GLNA 3CCVI 3L2AA 2CRGA 2ZM6M 2OV7A 2VOOA 1NNUC 5J1UA 5ED4A 3L00A 3QYFA 4EOJB 3DDPB 4DUZM 1WGNA 1IXSA 1Y6IA 3QYHB 3E9SA 5FKNA 1R58A 1UHWA 4IHXA 2XAJA 1EIJA 3E97A 3VLFB 1XMQM 5E3NA 2KA6B 1YLAA 2R46A 3R4KA 2OTLI 3MEXA 1UNLD 4ENMA 4O3MA 1FOXA 3ILKA 3S93A 4EATA 3ZRGA 2HCBA 2EFOA 2HDWA 1LVKA 2H8RA 4GDFA 4XKBA 4F2LA 3BOSA 8CATA 3CESA 3FXJA 1WJ7A 3AKZA 3GVAA 3TKYA 2HQAA 3VEPA 1F9NA 2VJ5A 4BCMD 5LMKB 1FJLA 1MBEA 3TNWB 4M0DA 5IWAM 1XSXA 2OD5A 3NRVA 3P9CA 5DCFA 2VUMJ 2Y20A 5F1JA 1W0UA 1S3SA 3EUHA 1J09A 2DPUA 3L1PA 2DNAA 1HW5A 2V22B 2Y0TA 2VQLA 4G4OA 3K6GA 2MG4A 1VF9A 3R0JA 5B1AH 4LRSA 4GEWA 4X64M 2DZNB 2Y0SN 2D7EA 2W4SA 4H4KC 2L4MA 1RIOH 3DTOA 2J5PA 2NVYJ 2XGNA 5F0HA 2WB1A 3CUOA 2LREA 3HHTB 1RNLA 2LBFA 4OB0B 3VKGA 4EOSB 1G6NA 1JJ8C 2B7EA 2R3SA 2Y31A 2JA8J 4FVMA 2QUFA 3KETA 2R7GA 2YX4A 1UGRB 2LG4A 3MCZA 4IXAA 1K3WA 2KZVA 3OL3A 1TFBA 2BJWA 3I9V2 3SASA 1ZH5A 4U0YA 1ETYA 3SYLA 1WI3A 2ZTCA 3K70C 3SAUA 3J80Z 3IV5A 4AG6A 2CYYA 3HJQA 1U0JA 3IH3A 1HKTA 3ABTA 4EM1A 3BLQB 4YELA 3U6DA 1BI3A 4LLNA 1IRFA 3FMQA 4BAYA 3ZC7B 1OLTA 2HYJA 3KP7A 1U8RA 3BQYA 1ORKA 4IBIA 1F36A 1Z0XA 3QWLA 4C3IJ 1IREB 1GJTA 4KODA 3UK6A 3L27A 4IBJA 2G9WA 2L9NA 4FASD 2R6FA 4II5B 2APLA 1UGPB 3U6OA 2GWRA 2WY7Q 3V7SA 4OMYA 1IN7A 2VXZA 1A6IA 3KOXE 2VQCA 4DV4M 1Z9CA 4W1UA 3HJEA 5FTLA 2PMZA 2DAOA 5H2FC 9ANTA 4D82A 2DMQA 4A0ZA 2CQ7A 2EBIA 2D0QB 3HO8A 1QZMA 1AKHA 4M3DA 2STTA 4BXXX 1X58A 2XKOA 5IOZA 2J5OA 4ENKA 4BNCA 3E4RA 3W0LB 2HGCA 4BXFA 2CYZB 3X24B 4BCIB 3FUUA 2OCEA 3BLYA 5DD8A 2LNBA 4BL0B 2BVLA 4YIIA 3PFIA 3GFIA 4CIZA 1FLIA 3IG5A 3PFYA 2HDDA 3SAVA 1R1UA 2CW0F 2D7GA 2WAFA 1QPMA 2CQNA 3HZJA 3BY6A 4GYGA 1CQTA 4DR4M 1FTTA 1ZYRF 2KRCA 3A8GB 5LHIA 1E94E 2LBFB 3U6QA 1P92A 2L7ZA 1XXHA
chains in the Genus database with same CATH topology
2G77A 3X26B 3QYBA 4AI6A 2BS2A 2ZPIB 3TW7A 3H4CA 2QDJA 1FKMA 4JX6A 3A8OB 4NC6A 3HBLA 2DXCB 3VYHB 4ELJA 5EJCA 3BG9A 2DXBB 1E7PA 1AHJB 2DPPB 4JX4A 2CZ0B 4BBRM 2ZPFB 4MFDA 3A8HB 1UGQB 2WJ9A 2BS3A 2QDYB 4AKGA 2ZZDB 4AKIA 3X28B 3WVDB 4HNUA 1QLBA 3WVEB 2DD5B 3HHTB 4OB0B 3VKGA 2KR6A 2ZCFB 1V29B 1UGRB 2QQ8A 3HB9A 4OB2B 4HL4A 4OB3B 2KMGA 4AKHA 3VKHA 3A8LB 2DD4B 4MIMA 3VYGB 3A8MB 4HNTA 2QF7A 3KHIA 2AHJB 3QYEA 4ZGEB 3QZ9B 3QWLA 1IREB 2ZPEB 4JX5A 3QZ5B 1UGPB 4BBSM 2CZ6B 2ZPBB 3BG3A 4FM4B 4QSHA 2CZ1B 2D0QB 2ZPGB 3HO8A 3QYGB 4HLQA 2BS4A 1UGSB 2ZPHB 2CYZB 3X25B 3QXEB 3X24B 4LOCA 4OB1B 4M6VA 3BG5A 2QFZA 4ZGDB 3HZJA 2CZ7B 4Z6YA 3TW6A 3A8GB 3X20B 3QYHB 4ZGJB 3DL1A 4MFEA 4P17A 4HNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJC A;  1FKM A;  3QYE A;  2G77 A;  2QFZ A;  3QYB A;  3QWL A;  3HZJ A;  4NC6 A;  4Z6Y A;  4HL4 A;  4HLQ A;  4P17 A;  2QQ8 A; 
#chains in the Genus database with same CATH topology
 2IGK A;  1FBU A;  4F7N B;  1WWX A;  1LDJ A;  3ZOB A;  1JKO C;  4CSW A;  4XQF A;  1F43 A;  2E34 A;  4M3G A;  2J5Y A;  2L7M P;  3ZQ7 A;  4JI6 M;  1D2N A;  1REP C;  1ZAE A;  3HHY A;  1HXD A;  2DCE A;  3A8O B;  4PCZ A;  1OCO H;  2R7D A;  1MH4 A;  1SMY F;  1TWF J;  1K79 A;  2IS6 A;  4A3D J;  3QAH A;  1M1E B;  1D0Y A;  2VKH A;  4ZTF A;  4UXN A;  3LQ5 B;  4Z2Y A;  1SFE A;  5F04 A;  3RYR A;  2EFN A;  4JI5 M;  1V5E A;  4PK4 A;  4ZYE A;  3OR1 C;  2CQQ A;  3H5R A;  5EDN A;  2FQ4 A;  2IW6 B;  4UHT A;  3V8K A;  3RPU A;  2KZG A;  1W7P B;  5EP3 A;  4LGW A;  4ROD A;  4MO7 A;  1FIN B;  3F6V A;  3C9P A;  3K2Z A;  4U0V A;  4HOB A;  2C5R A;  3LW5 F;  1OQY A;  1Z1D A;  2NXN B;  2OPF A;  1X19 A;  2RNJ A;  3F9K A;  4RB3 C;  2JY6 B;  2JSP A;  1AKH B;  4BQA A;  5CPR B;  3DJB A;  2UZE B;  2FBI A;  2HQR A;  1Q02 A;  3OV8 A;  4BCG B;  1FY7 A;  4AW4 A;  2RAE A;  4EOQ B;  2WMA B;  4DV3 M;  3W2V A;  1FC3 A;  2YU3 A;  3K10 A;  3K9T A;  3WVE B;  1QAQ A;  4GGG A;  4B4C A;  2XDV A;  4GC9 A;  3D5R C;  4Q5S F;  2IN3 A;  1G8X A;  5K5Q A;  2LY2 A;  1I5Z A;  3FTC A;  2DA2 A;  3FK6 A;  4RGR A;  2L9R A;  3IL2 A;  2IS1 A;  4MGY E;  5J1Y A;  2PI0 A;  1P4X A;  3Q8X A;  4C2U A;  1JQJ C;  3LFK A;  1A36 A;  3EET A;  3HRT A;  4CO8 A;  3FXM A;  3W6V A;  4DQ2 A;  2X8A A;  2H5X A;  2QZ4 A;  3IKT A;  1V3F A;  4DR2 M;  1TQM A;  1YIT I;  4R71 A;  2NVX J;  1FTZ A;  1O9K B;  2R0Q C;  4D1Q A;  3SQN A;  3VK8 A;  4F93 B;  3A8L B;  4LIT A;  5HVQ C;  4L9N A;  2IS2 A;  2JQ7 A;  2VC1 A;  1USS A;  4B7H A;  2Q2E A;  4PSX A;  2IW9 B;  1JTX A;  4FIS A;  1OL1 B;  4NST B;  5C1B A;  2DMT A;  1AD6 A;  1ZAO A;  4HDV A;  3HWS A;  1F4I A;  1QZY A;  1KSF X;  4KIG A;  1ZMW A;  5HS7 A;  1UST A;  5GKN A;  1FBS A;  5HVY B;  1EKE A;  2DA3 A;  1X1A A;  1OMI A;  3VFD A;  4J00 A;  3HOY J;  4IJA A;  2BY2 A;  3GPU A;  3LWF A;  3GYH X;  2ZPG B;  4ANR A;  1MJG M;  2W84 A;  1W5C C;  3HHG A;  2V4J C;  4A93 J;  3HOU J;  2DOA A;  2M0C A;  4HSR A;  3SDB A;  3WE2 A;  4R7G A;  1L8Q A;  4LZJ A;  1IXC A;  1ZEL A;  2DBB A;  2ZXW H;  1H24 B;  4BGD A;  2LY1 A;  2CWE A;  2BWE A;  2HYF A;  4R1H A;  3KZY A;  1GVD A;  3L29 A;  4QOZ C;  3U1D A;  4C9Y A;  1ZMU A;  2CV2 A;  2QBY A;  4LK1 F;  1PKD B;  4MM3 B;  3X20 B;  1KZH A;  5KHD A;  2ZAM A;  4F6S B;  2EJS A;  2DA6 A;  1B6A A;  2F4M B;  3FRI A;  2AXL A;  2V9K A;  2CWB A;  2ID3 A;  2WA0 A;  4GHL A;  1SXJ D;  1P2F A;  2F4V M;  4A3K J;  3TNH B;  1IRG A;  5FTJ A;  1AIP C;  1KYI A;  3KW6 A;  2LH9 A;  1SFO J;  2A6E F;  4X1E A;  3RGS A;  2H94 A;  2M30 A;  3IHU A;  4S04 A;  5HLT A;  3F92 A;  2O8X A;  1VQM I;  1RUO A;  2QCO A;  3WTW C;  1ZGJ A;  3Q3S A;  5K7F A;  4QOS A;  2HZD A;  3BG7 A;  1OTR A;  4WUR A;  1FIA A;  3OMY A;  2K40 A;  3HXL A;  3C2H A;  3HSR A;  2DJN A;  1CF7 A;  2EV6 A;  4F7S B;  3FXK A;  4AIK A;  2F4O B;  4KRD B;  1HQY E;  5DM7 F;  2C99 A;  4UB6 C;  3LSR A;  4A0X A;  1T33 A;  1MX0 A;  1UZC A;  1U8B A;  5L8R F;  1QZZ A;  3J81 Z;  4MLO A;  4CRL B;  1PUF A;  2JSC A;  4A3V B;  2DMU A;  2R7V A;  4FX0 A;  1N36 M;  2DA7 A;  1V5F A;  2LY9 A;  1TWA J;  3M6A A;  1WJA A;  4V2F A;  2QEX I;  3WHB A;  1LJ9 A;  3MN2 A;  4BCO B;  4Q48 A;  1G2H A;  1HA8 A;  1DP3 A;  2Z1D A;  4V19 K;  1L3L A;  3GRV A;  1ZRE A;  2BKZ B;  4HZF A;  3S15 J;  4Q4Z F;  3F22 A;  5L3G A;  2R7X A;  1QRY A;  1NHW C;  4PUS A;  4L16 A;  2QQ8 A;  3HGY A;  4B3T M;  4OR5 B;  2JRM A;  1JXS A;  4BQQ A;  2KHH A;  4HG2 A;  3I56 I;  1WXQ A;  1B72 B;  1W1W E;  5M3M J;  3HOX J;  3EIE A;  4OB3 B;  2X48 A;  5M5W J;  2CCI B;  2E36 A;  3HRM A;  2VON A;  4OW0 A;  1TGU A;  4BCM B;  3F8M A;  3I58 A;  4BCN B;  3QOD A;  3IH2 A;  5EEH A;  1SEU A;  1BC8 C;  2M5W A;  2FRH A;  2CHV A;  3H4J A;  3B6C A;  2ISZ A;  2IEK A;  4UNO A;  4ZGE B;  3LSK A;  1H0M A;  3ZCO A;  3CDH A;  4UN0 A;  3NDQ A;  2L9V A;  2A5Y B;  2Z99 A;  2WSC F;  4OX9 M;  2HFH A;  2HTJ A;  2P4W A;  4HV6 A;  4Y3O A;  4F3Q A;  3I51 A;  4YFN F;  3TDZ C;  1CF7 B;  1D5Y A;  3JRG A;  3W2A A;  1QVR A;  3GTM S;  4OMZ A;  3K1J A;  2JZ1 A;  2K9S A;  4ROC A;  4BCP B;  2C98 A;  1J0R A;  3RYP A;  3TOA A;  3ULQ B;  3WTT C;  1QUT A;  1XC5 A;  3ZGK A;  5EQT A;  1OAO C;  2JWT A;  2RRU A;  2HWV A;  3LSG A;  4DW6 A;  2LR8 A;  2VBX A;  3PSI A;  3T38 A;  2VE8 A;  3M0E A;  2DO7 A;  1X1C A;  2RKH A;  1XXH E;  3KEO A;  4M9Z A;  3FYC A;  4OU7 A;  3CF5 F;  3AG1 H;  2NS8 A;  2VT2 A;  5L3F A;  3S8P A;  3JR9 A;  3GLI A;  2XF5 A;  5D8K B;  3WTX C;  2AHM A;  3QPH A;  3OYA A;  2E19 A;  2V7F A;  1J7K A;  4Z6Y A;  3GQ3 A;  4JYA M;  1EE8 A;  3EUA A;  1PUE E;  4C2T A;  4YOS A;  1T38 A;  3HY5 A;  3C3W A;  5FKK A;  1HLV A;  4CFN B;  4HX8 A;  3OYJ A;  1W4M A;  3SEQ A;  1DQU A;  5BMZ A;  1IN8 A;  1QGP A;  2R65 A;  3F23 A;  3UNG C;  5J8F A;  3W6J B;  2BW3 B;  4XRS A;  2PJP A;  1QU3 A;  4BE0 A;  1CUK A;  2HWJ A;  1U3E M;  3HSF A;  1TDZ A;  5ERI A;  4JI8 M;  3QHW B;  5FO5 A;  1Q3B A;  1ETK A;  4E7Z A;  1LPQ A;  5FRO A;  3D1N I;  1MD0 A;  2LVQ D;  1TQI A;  3HU1 A;  4MGI E;  4RAY A;  4M73 A;  2CJM B;  4I98 B;  1KFV A;  2R7Q A;  2UUB M;  1OI9 B;  4G4Q A;  4GKK M;  1R5G A;  3NWS A;  3QU6 A;  5HBJ B;  2ZSH B;  3GLF A;  1HT1 E;  2JVH A;  2BPM B;  4E7I A;  4DBG B;  2LD5 A;  5JHU A;  2L4F A;  3BXW A;  2ZBK A;  2DU9 A;  5GPA A;  4AVP A;  2E7W A;  4OOI A;  3O8H A;  3ABU A;  4LD5 A;  2DTR A;  2I7N A;  5EFQ B;  1I6X A;  2FE8 A;  1FWZ A;  4UV8 A;  3T1B A;  5K5O A;  2WJ9 A;  4N9H A;  2LF7 A;  2G8L A;  1WR1 B;  3FUX A;  2FQ3 A;  2L02 A;  4LRT A;  3KDS E;  5ITY A;  2F5V A;  2P7V B;  3VK7 A;  2CMP A;  3KPH A;  3O8G A;  3U1K A;  2W96 A;  1S6L A;  4P9F A;  2QQA A;  2VL8 A;  4LK0 F;  3EPZ A;  1YJ9 I;  3FK7 A;  3MHV C;  3TE6 A;  2KIF A;  3HEF A;  1IM2 A;  1PYV A;  1MMG A;  4L9V A;  1X4O A;  3WOD F;  1TT0 A;  3RPQ A;  5E79 C;  4XBF A;  2R45 A;  4JI2 M;  4M3B A;  2LVN C;  4UN2 B;  2BGC A;  2X0L A;  2EKF A;  3GLI B;  2YR2 A;  3FKJ A;  1VFC A;  2BYV E;  1IN4 A;  1XMO M;  3ZMZ A;  1AIS B;  3BPX A;  3KIO A;  5GPC A;  3D5L A;  3GXO A;  3H9G A;  3GTG J;  1GT0 C;  4L0Y B;  3CC7 I;  1A35 A;  3TP0 A;  2C4G B;  3TWM A;  1BC7 C;  2KFD A;  4GIT A;  2B3T A;  2NQ8 C;  1OL2 B;  5CYI B;  3MJ5 A;  4KLN A;  4DV0 M;  3VDP A;  1HNX M;  3ECO A;  3REO A;  1SAU A;  3J81 S;  1QNT A;  1RZ4 A;  2XF3 A;  3ZQJ A;  2AO9 A;  3S2W A;  2LKP A;  2CH0 A;  2K85 A;  1D0K A;  4WXC A;  1QAO A;  4NRV A;  1BM9 A;  1SD5 A;  2XLJ A;  2UXD M;  1X37 A;  5LGT A;  3K4M A;  2HTS A;  2W82 A;  3PSF A;  1K83 J;  1UFZ A;  1T56 A;  1KU2 A;  1IN5 A;  1Q39 A;  2IJL A;  4CCK A;  4BBR J;  4IQJ A;  2ZJ2 A;  5D6E A;  1BR1 A;  3GLG B;  2RN7 A;  1FP1 D;  3HSE A;  3NAR A;  5IT9 K;  2DJI A;  4Y13 A;  2O3F A;  3IUO A;  3T1Y M;  3U6M A;  2ZBK B;  3K9P A;  5L3C A;  4FM4 B;  1E3P A;  1R4N B;  3O6B B;  4EM0 B;  1X1D A;  1YW9 A;  2CZ1 B;  4LJ5 A;  4AIJ A;  2D1H A;  1IY2 A;  2PEX A;  5FB2 A;  3LAJ A;  2EH3 A;  3HTU A;  4B48 A;  1HW1 A;  5DUK A;  3GQ5 A;  1RR8 C;  4IHW A;  3FBN B;  3CCU I;  3F8F A;  3ROU A;  2VQG A;  4ROE A;  1YLF A;  1XDU A;  1OYI A;  3V76 A;  3EDP A;  2BE5 F;  3IP4 B;  2W99 A;  3BR3 A;  1QDR A;  3RIR A;  2LTP A;  1OAI A;  2DK5 A;  4GFB A;  3OYM A;  3LSI A;  2VF8 A;  3J27 B;  1V4R A;  4PCQ A;  2M7A A;  1XHB A;  3KOW E;  1ZLJ A;  2JN6 A;  2FFJ A;  3H9J A;  1Z77 A;  2M8E A;  3ASN H;  3VFZ A;  1FYM A;  1IFY A;  1CGP A;  4HYE A;  4HNV A;  5DNY A;  5DM6 F;  1UG0 A;  4XOR A;  3T5X A;  1ENH A;  3C3E A;  2UXN A;  3ABL H;  5AIP A;  1ZRD A;  4AI6 A;  1Z5C A;  2QLZ A;  1KXU A;  3DWL E;  5F0F A;  5F08 A;  2KW0 A;  4IX7 A;  1NV8 A;  4M3F A;  1BW6 A;  4G7H F;  3E21 A;  3AOE C;  4PGH A;  4FCT A;  3VDX A;  2GLO A;  1ZKG A;  3SAW A;  2EZI A;  2F2E A;  3F8B A;  2QA4 I;  1W5S A;  2XAF A;  4C30 A;  3AG2 H;  3S3O A;  3FTE A;  3CQZ J;  4L4U A;  1BIA A;  4IPA A;  2WSF F;  1DU6 A;  3KVW A;  2NOG A;  5FGM A;  3HOV J;  2DAG A;  2X85 A;  2DMN A;  3A02 A;  4ZH4 F;  3SXY A;  2FNA A;  1YO5 C;  1YG2 A;  2XAU A;  3GO8 A;  2UUE B;  2L0K A;  1Y0U A;  5EG0 A;  2ZPF B;  1VG5 A;  4KMU X;  2V26 A;  4OAY A;  3KCC A;  3SHG B;  1FOY A;  3KP3 A;  4MGH A;  4ESB A;  2VQF M;  3EOC B;  4EGY A;  3FHZ A;  4UUS B;  3KYC B;  4XK8 F;  1MJA A;  2Y0Q A;  2PX9 A;  4LJZ F;  1J5E M;  2F5P A;  4OAZ A;  2VOD A;  4CH7 A;  1QLB A;  2FSW A;  2FUG 2;  3A03 A;  1H28 B;  2P5T A;  5K7H A;  3WTU C;  3M8F A;  3MY1 B;  1T0F A;  2C5N B;  3ZMD A;  1IRX A;  2DWM A;  2IA1 A;  2XF6 A;  1RUN A;  1S7O A;  2Z4R A;  3FE3 A;  3ZN0 A;  5BR8 M;  2BNK A;  4CYD A;  3AAF A;  2ZCF B;  4BCF B;  3S14 J;  2Y0S A;  2Z3X A;  4KRC B;  4NL4 H;  4BLC A;  4BCJ B;  2L7H A;  4RGU A;  3FM5 A;  2F5Q A;  3KFW X;  4CIC A;  1D3Y A;  4IHT A;  2EZH A;  4FT8 A;  4NNJ A;  1WIV A;  3K7A M;  4YFK F;  4A5M A;  4LF5 M;  4IKF A;  3M7G A;  2MC4 A;  1AA7 A;  2Z16 A;  4EVI A;  1RR7 A;  1HBX G;  2KXE A;  1Z5A A;  2QVO A;  3ISP A;  1UNH D;  2E1M C;  2IP2 A;  3OIO A;  1Y1W J;  3QZ9 B;  4N0B A;  1HKQ A;  3GEZ A;  2HAK A;  3JRH A;  3DV8 A;  3V7R A;  1GDT A;  1RU3 A;  3LSP A;  4ZPX A;  4EOO B;  2RGV A;  1T3T A;  2G7U A;  4A69 C;  5C4X J;  3RE8 A;  3GLI E;  4ITQ A;  2K4J A;  2Q1Z B;  3VYT B;  2LNH C;  2W57 A;  4HAM A;  2STW A;  5E1W A;  2HHH M;  1HKS A;  3BLR B;  2MLG A;  3ZH9 B;  1V54 H;  2Y0M A;  2L01 A;  5CVJ A;  5FFX A;  1J9I A;  2W25 A;  2UV1 A;  3FXO A;  2UXB M;  1O3Q A;  1OCT C;  4I4L A;  1EF4 A;  2CO5 A;  3BCA A;  1YTY A;  4EJT A;  3KP6 A;  4LOC A;  3T8R A;  1H6U A;  4B3M M;  1HR0 M;  1GXQ A;  3AV0 A;  4JI7 M;  2HOA A;  4DJA A;  4S05 A;  2DAM A;  2HOE A;  5DEQ A;  3S1Q J;  3TN8 B;  3BWG A;  3DPL C;  5ICF A;  3PL8 A;  3B7N A;  3SAR A;  1BIB A;  4XLP F;  3IH4 A;  4KYW A;  4OIQ F;  2ZC2 A;  4P55 A;  2VLA A;  1SD6 A;  4ESJ A;  4BY1 X;  4G94 A;  4NC7 A;  5F27 A;  2A6T A;  3DCF A;  2WAQ A;  2Q8K A;  1SC7 A;  3HTS B;  2F2C A;  5JI3 E;  1WPK A;  4S0H B;  4N4N B;  2K3F A;  3DBH B;  4AYB N;  4I76 A;  1LKX A;  3BP8 A;  2W9Z A;  4PSW A;  3GLF E;  4BDZ A;  3TMO A;  3FXU A;  3U6L A;  2OQ4 A;  5F1R A;  4Y28 F;  3QYB A;  1XPX A;  1N4M A;  1OIS A;  4LIU A;  4IRH A;  4PZJ A;  4CA0 A;  1MNM C;  5KPT A;  4DBQ A;  4XGI A;  4WX9 A;  1IDY A;  4KIB A;  2CCH B;  4L18 B;  2WZJ A;  2IS4 A;  4RMN A;  4HBL A;  1WJD A;  2JY8 A;  5EJC A;  1ZG5 A;  1ETV A;  5ICE A;  1OKV B;  1LFB A;  2HPI A;  4U0W A;  5HOD A;  1JHF A;  2J7N A;  1GO5 A;  1E7P A;  4XKV A;  3MKW B;  5E8I A;  3HPH A;  3EIH A;  2ICW G;  2LYC A;  1H25 B;  2K3P A;  1QAN A;  3GPY A;  1OKW B;  4LJA A;  3UR3 C;  2YR0 A;  3IAS 2;  3GRR A;  3R61 A;  2XAG A;  4O5V A;  3SEZ A;  4FX4 A;  2EK5 A;  3DZD A;  2X1D A;  4DYQ A;  5KNL A;  3AOE A;  4L5E A;  5K7Z A;  3TQS A;  3BC8 A;  5HLG A;  3TDU C;  1ZMV A;  3CJR B;  2ME6 A;  2KZU A;  2BBY A;  1VEJ A;  3WHC A;  2DHY A;  5HOO A;  1DGG A;  5FLX K;  1R5H A;  2RGH A;  1Z7U A;  2WV0 A;  3JAM K;  1GXP A;  2Z4S A;  1BR4 A;  2IBD A;  4XSX F;  4F52 A;  1BN5 A;  2W7N A;  4F6U B;  3U6E A;  3UMM A;  4YIR X;  2CFX A;  3R8F A;  2MAB A;  3R60 A;  3PO3 J;  3GTK J;  2DOF A;  4EOM B;  3HHZ A;  2CRU A;  1ZGW A;  1D0X A;  4HL4 A;  2QSG X;  3RTR A;  1A5T A;  1F1Z A;  1GAB A;  1KGS A;  2F5C A;  2FEZ A;  2K02 A;  2KL4 A;  4LF6 M;  2PMH A;  2Z3Y A;  2XGD A;  3Q0U A;  4AID A;  2RRE A;  4DNC A;  3RKX A;  4I7H A;  3FUV A;  2RV8 A;  2CQK A;  4YFX F;  3S1R J;  1T6O A;  1TQP A;  3WG9 A;  5B3S H;  4HNT A;  2D1V A;  2JK3 A;  4ANJ A;  2H09 A;  1LFP A;  2ZXI A;  1XD7 A;  2X6X A;  1QAM A;  3KS4 A;  3TO9 A;  5IPA A;  3CCJ I;  3W2W A;  3WTS C;  3AG4 H;  2ZPE B;  4JX5 A;  5ITU A;  4CFX B;  2K4B A;  4A3I J;  3N05 A;  4RB1 A;  3KS8 A;  3W3C A;  3BR2 A;  4I0B A;  4NDL A;  4B3R M;  5DD4 A;  3LFU A;  3DF8 A;  4BH9 A;  1PJJ A;  2KEB A;  4C2M J;  3GRY A;  4R3D A;  3TNI B;  1V55 H;  4Q47 A;  2CUZ A;  2G3Q A;  4B7G A;  2BY3 A;  5DYG A;  2QQB A;  2BS4 A;  4GRI A;  4GHA A;  2EIL H;  3HHX A;  5IY5 H;  1VEK A;  4HF0 A;  1J2X A;  2XF7 A;  4BDY A;  3K0L A;  3B7Z A;  1TWH J;  4PDG A;  3PNV A;  4RLQ A;  3U9G A;  3SHF A;  3OYI A;  3CCM I;  3ESW B;  4AQY M;  1XTA A;  2HQ5 A;  2I5U A;  5DUI A;  1H1S B;  4XLN F;  5C3E J;  3HOT A;  4XNF A;  5CQG A;  3BG5 A;  4KT6 A;  2OJE D;  4BXU A;  2XSZ D;  4I02 A;  5GAE J;  4ZYH A;  4MH0 E;  5C4J J;  3MI9 B;  1NHG C;  1Z6R A;  2CHG A;  3U5Z A;  2F5O A;  1R23 A;  2ECC A;  2CQX A;  5ILS A;  1W7P A;  4IBB A;  1OR7 A;  4DZJ A;  3BRO A;  4E7H A;  1R9T J;  1T8I A;  3CC4 I;  5H6Q A;  3D8B A;  3FHN A;  1VQ1 A;  4P17 A;  4XKW A;  4KN4 X;  1FSH A;  3M03 A;  3KZI C;  1R7R A;  5FKL A;  3CJN A;  5EP1 A;  3DA1 A;  3X26 B;  1FZP B;  4QPO A;  1ZG3 A;  5ACB A;  1WI9 A;  3QOE A;  1K6Y A;  3DTE A;  4LG3 A;  4N9I A;  1A6Q A;  3G1O A;  4GMQ A;  3QP6 A;  3K1M A;  4E70 A;  1XO2 A;  2PHG A;  4QNR A;  3MIA B;  5HBE B;  4IVN A;  3HKZ N;  4JP0 A;  2ME0 A;  5M5Y J;  3HBL A;  5FRM A;  4LJ8 A;  3KEQ A;  2M87 A;  1EV7 A;  1B4A A;  3R6S A;  3VYH B;  4BCK B;  1ONV A;  4ZDO A;  5LGN A;  2MRO B;  4NSO B;  4KT0 F;  3K69 A;  4K0K M;  4JXJ A;  3QRF F;  2E1C A;  3O2P E;  4EJU A;  2LW4 A;  3A98 B;  1Y0N A;  2M8G X;  1WZ2 A;  1ON1 A;  3A2K A;  4PD2 A;  2LBC A;  3JCU C;  3BHT B;  4IBF A;  2HOT A;  1GY3 B;  1UGQ B;  3WU2 C;  2VQE M;  2DDB A;  1L0O C;  2GA1 A;  1ERD A;  2DFH A;  5BOX A;  2EIK H;  3LVW A;  4RKU F;  4AKG A;  1I39 A;  3NEU A;  3ZMU A;  5C44 J;  3B73 A;  4I0A A;  2YU9 J;  4IOA F;  1H27 B;  1DV0 A;  2GXB A;  3WHL A;  2JRT A;  2PLY A;  2E1M B;  4I2O A;  2DAE A;  2NVQ J;  1O9K A;  1Z5B A;  3X28 B;  3BHV B;  3AFH A;  3TGN A;  3BTJ A;  2K9N A;  4HNU A;  1D0M A;  1AU7 A;  1G59 A;  1TH3 A;  2ACJ A;  4XSZ F;  2M1B A;  1YJN I;  1TWC J;  1LE8 B;  2HVR A;  1J59 A;  2DD5 B;  1MMN A;  4G4N A;  4G3O A;  3KLN A;  4I3Z B;  4XOT A;  2QEN A;  3FM3 A;  1MBG A;  3HGG A;  1ZG1 A;  1IC8 A;  1YSY A;  5F6F A;  3A46 A;  3OIQ A;  2HKO A;  3U5Z B;  2OZU A;  2MBF A;  4DYC A;  1U78 A;  2LRD A;  1H9T A;  4F7L B;  3MMY B;  1W0T A;  2XC7 A;  2EIJ H;  1T39 A;  4ESF A;  3UKG A;  2B9S A;  3PQJ A;  4J01 A;  3VYS B;  4KIS A;  2QM3 A;  4XN0 A;  2KNV A;  3S1M J;  1R7J A;  3A0B C;  3EQL F;  2QNJ A;  3C1D A;  3VKH A;  4NUB A;  2E5L M;  4II2 A;  4MQV A;  4WCG A;  3JRI A;  2J7O A;  1R1V A;  3JR4 A;  2JJ7 A;  1JHH A;  2MH2 A;  5DV5 A;  2RQQ A;  3GX4 X;  2H1L A;  4XK4 A;  1Z05 A;  2OOA A;  5LLQ A;  2EO2 A;  3CDI A;  2DXI A;  2JY5 A;  2A6H F;  2M0M A;  3VPR A;  1RET A;  4CZZ A;  2GZW A;  2M4G A;  4LG0 B;  4TTH A;  3JRF A;  1JR3 D;  1T43 A;  2D7H A;  2DT7 B;  2KRF A;  2VBZ A;  1N78 A;  1SFX A;  2VF7 A;  3HUG B;  4X65 M;  2ZPB B;  2RQP A;  2GOX B;  2C9O A;  3HPG A;  3RGP A;  1K61 A;  4A6E A;  3ZQG A;  2QWW A;  3LA2 A;  4HLX A;  1U2W A;  5FTK A;  4HV5 A;  1HW2 A;  2P81 A;  2VAS A;  2XVC A;  4IRG A;  2HKX A;  2EA2 A;  3OIP A;  2VPL A;  5J8C A;  2CUF A;  2JXN A;  1H9G A;  4D81 A;  1HNW M;  1TWG J;  4XMY A;  4LFC M;  4EM2 A;  1JT0 A;  4XON A;  2OOB A;  5JLX A;  5HLH A;  2O5R A;  2L4A A;  3RQ4 A;  2QFZ A;  4BCQ D;  2PG4 A;  1FNN A;  1YS7 A;  4XLC A;  3GTJ J;  2O7O A;  3VYU B;  2F5D A;  1TT5 B;  1BI0 A;  2CSO A;  5D5W B;  3JR5 A;  4G6Q A;  3QHR B;  2C5V B;  5DTD A;  2LDU A;  1V34 A;  1GJS A;  3CP2 A;  2XHK A;  5E1Z B;  5FFZ A;  2O6G E;  4CFV B;  2XKP A;  3BR0 A;  3H3Z A;  1OIP A;  4AIH A;  2G77 A;  3U6C A;  2D2W A;  5LHG A;  3Q9V A;  2VIX A;  4HRI A;  4A3L J;  1S8N A;  5KCM A;  2WB1 N;  4GCV A;  3W0F A;  3I3L A;  1BOA A;  3NBI A;  4M9S A;  3BDD A;  3ONQ A;  3S1N J;  4RA2 A;  1N75 A;  2JZ0 A;  2VII A;  4CGY B;  3DFZ A;  2KDO A;  3FXL A;  2VXD A;  3JRE A;  1ACI A;  1GHC A;  3NAU A;  4G12 A;  2VBY A;  2FOK A;  2EA0 A;  1S9H A;  4L6V 6;  1K78 A;  2XIG A;  1K6O A;  4BY7 X;  1URC B;  2R5Y A;  1Z67 A;  3T8T A;  1KU9 A;  4R79 A;  1I94 M;  3GLL A;  2AQE A;  3DLL F;  3GLH B;  3M07 A;  2V1U A;  1B72 A;  2H6C A;  3DKW A;  1IRZ A;  1IY1 A;  3C58 A;  3RJP A;  3ZQH A;  2O01 F;  2F5E A;  1VZ0 A;  4BXX J;  4PT5 A;  2CP8 A;  2CUE A;  2KMU A;  4XKC A;  4QHT A;  2DWL A;  2DI3 A;  1SFK A;  4WXD A;  3PXG A;  3KP5 A;  3PO2 J;  3ZR8 X;  2P5K A;  2FML A;  3E6C C;  3H5A A;  2ECB A;  2PMZ N;  3K1P A;  3I71 A;  1Z7L A;  2P6T A;  1NY5 A;  3GPX A;  3HDD A;  2M9H A;  3TQN A;  2PK2 A;  1SG9 A;  2QPA A;  2DT5 A;  3VDU A;  2R44 A;  1OJL A;  3HC7 A;  3S3M A;  4ZTJ A;  5BS6 A;  2UWM A;  1IBL M;  2DT6 A;  2BHZ A;  1YOV B;  1TTE A;  1H89 C;  1NJF A;  1LDD A;  2XGE A;  2W00 A;  2Y48 A;  3FKE A;  4RM3 A;  1NY6 A;  4EON B;  3IEC A;  4KFC A;  1B9M A;  3SZP A;  1N33 M;  4OB2 B;  4RM2 A;  2ETH A;  3SFZ A;  5FTN A;  2DFE A;  3GZ6 A;  1GUX B;  1ZRC A;  4LFB M;  3MK6 A;  1QYR A;  1V5G A;  4G6L B;  5L3B A;  3I53 A;  1IXZ A;  1E0E A;  3PIO F;  1NH3 A;  3D8L A;  4F7J B;  2EKK A;  2M34 A;  2QYO A;  3L2Q A;  4LB5 A;  1MH3 A;  2AHJ B;  2KPM A;  3ZPL A;  4NSR A;  1FT9 A;  2QQ9 A;  4BHC A;  1ITY A;  2D5V A;  4C3H J;  2P6S A;  3ZQL A;  1DDN A;  3I4Y A;  1IJW C;  2M2E A;  1H88 C;  1K78 B;  1DUX C;  2EIM H;  2CW8 A;  2R5Y B;  1Z91 A;  2NOJ B;  3J80 K;  5LRS A;  4MB7 A;  2WPA B;  2BW3 A;  2P7C B;  2YX7 A;  2DW4 A;  1WJ5 A;  1G3W A;  3ZXS A;  3GTO J;  4E7K A;  4B43 A;  3P7N A;  4D5C A;  3B6A A;  4I8O A;  4S12 A;  4ITV A;  1GKI A;  5J47 A;  4WK8 F;  2DYR H;  3L2V A;  3SDG A;  2NS0 A;  1O3R A;  2K6B A;  2MR9 A;  1ZN2 A;  4YHH M;  1O3T A;  1TZL A;  2FBK A;  3J2P B;  4XR6 A;  4MGZ E;  2F4I A;  2JUG A;  2GM4 A;  4F7Z A;  4GXO A;  2WFY B;  2V6Z M;  3HX3 A;  1SXJ C;  3W68 A;  2P5V A;  3JSO A;  2DFI A;  4GH9 A;  3RZD J;  4UUT A;  3GF2 A;  2EQR A;  4RF0 A;  7CAT A;  2A05 A;  4RGX A;  2QDY B;  2OQR A;  1W5T A;  2DAK A;  2X4H A;  3M1E A;  1FYL A;  4LLG F;  4PDK A;  5B1B H;  3U21 A;  4C3J J;  1PM5 A;  4HDU A;  4WW0 A;  3PNT A;  4HF1 A;  4MGR A;  3MQ0 A;  2A5W A;  2VPR A;  3Q5F A;  2UZB B;  3KP0 E;  4OVZ B;  4RLF A;  2LP0 A;  2KDZ A;  1B1B A;  3DEE A;  5TRD A;  1R6R A;  3E46 A;  2L2O A;  1BJZ A;  4E4H A;  3TBI A;  3WGG A;  1MIJ A;  4WP2 A;  3HIF A;  3RCO A;  1MJ9 A;  2ZJP F;  3FWE A;  2R7U A;  2N35 A;  3BG9 A;  2WTE A;  2KKO A;  3V7C A;  3F72 A;  4XLE A;  1L1T A;  2COB A;  3V42 A;  2DPP B;  2XRN A;  3GTP J;  3HKP A;  1TLH B;  1O4X A;  3CF2 A;  4LCB A;  2EFQ A;  2GNO A;  2RC4 A;  3GFL A;  4KJZ A;  1JUM A;  2XFT A;  5E8G A;  2JNH A;  5C18 A;  1BVS A;  4MFD A;  2A3S A;  2O0Y A;  3CMM A;  4XIC A;  4U88 A;  1LDK B;  4WF2 A;  5EZG A;  4WXH A;  1P6R A;  4BCQ B;  2MW8 A;  5CVR A;  2UXC M;  2F5F A;  2B0L A;  3VB2 A;  1FOK A;  5BNG A;  1O7F A;  1XCV A;  1TC3 C;  1ZLK A;  4OIO F;  3T15 A;  1TP4 A;  3Q0W A;  3CO7 C;  3LSH A;  2IT0 A;  2WEV B;  1HOM A;  3BT9 A;  2PN6 A;  2XH9 A;  1UAA A;  2EFP A;  3GW2 A;  3S2D J;  5TJJ A;  3GLG A;  1MMD A;  3MZY A;  2XB5 A;  3KYD B;  3QQA A;  3VSK A;  2UUZ A;  4RS8 A;  3VSL A;  1FEX A;  4R8H A;  3DKY A;  3KXE C;  1FBQ A;  2WY8 Q;  3C18 A;  3K4N A;  1E17 A;  4UUV A;  3G6E I;  1FOW A;  3KP2 A;  1LEA A;  2Y9Z A;  3LVV A;  2Z9O A;  2R7T A;  5IT9 S;  3HU2 A;  3K4B A;  4B47 A;  2DHR A;  1EH7 A;  2FU4 A;  2KJB A;  3I55 I;  4BHB A;  3B02 A;  4II7 A;  2ESH A;  2JTV A;  2K9M A;  5EGO B;  2KZS A;  1JKQ C;  4CIS A;  4I5S A;  4DUY M;  1TL8 A;  4LF9 M;  2QF7 A;  3BG6 A;  3QYE A;  1JJ6 C;  1C9B A;  2CHQ A;  3ZN1 A;  2E2J J;  1UMQ A;  5E17 F;  2LFB A;  4RAZ A;  2QGS A;  4F92 B;  4UVC A;  3EYY A;  2BY1 A;  2F5S A;  2ZME C;  4HST A;  5EZH A;  3OSG A;  4MEY F;  3OR2 C;  1PDN C;  5EP2 A;  2DEN A;  5ITX A;  3LSM A;  2R7F A;  4KIT B;  2HYG D;  1U9O A;  1E2X A;  1W36 D;  1Z3Y A;  3O3K A;  4KN7 X;  3B89 A;  4G8X A;  3W67 A;  4A3F J;  5KVR A;  4AG5 A;  1D5V A;  4LB6 B;  4EV0 A;  4BKX A;  2DN0 A;  1WJF A;  2EJR A;  4IHY A;  2G0E A;  2HR3 A;  2EUF A;  3X2Q H;  2QKM B;  2QZ8 A;  1H1Q B;  3DTI A;  1B8I A;  2E5N A;  1S72 I;  3FF5 A;  3G3Z A;  3FXQ A;  3QP5 A;  2AS5 F;  1X2N A;  4X0G A;  1VQ7 I;  4ZGD B;  5LEJ A;  4IBG A;  3FXR A;  2VQH A;  1XS9 A;  2HZT A;  3OYD A;  3JAM Z;  3BJO A;  1JKR C;  1ZP2 A;  1L2D A;  3A4C A;  2FD5 A;  4KT5 C;  4A5N A;  3JRA A;  1YHQ I;  1Q1V A;  5L2W B;  2LWX A;  3I04 M;  2L54 A;  3DBR B;  4JK1 X;  4KUM A;  4CFU D;  1JKP C;  2C5X B;  4IJE A;  2L5Q A;  2EPF A;  3KOY E;  1RRJ A;  5CEI B;  4F6W B;  4P16 A;  2DA4 A;  2HPM A;  2V6E A;  5H37 D;  3RI4 A;  1MDM A;  5HNB B;  4DBR A;  2NYX A;  3CLO A;  4UUS A;  2QDJ A;  1IAW A;  2FMY A;  2HXO A;  4CDG A;  1SXJ A;  3L28 A;  3UJN A;  2OCC H;  3WG7 H;  5FTM A;  3PUB A;  4XBO A;  1UHS A;  2OO9 A;  2TCT A;  1LEB A;  4A0Y A;  2C96 A;  3SYT A;  3MZH A;  1ETX A;  4EOP B;  2HQN A;  5E6J A;  1ON2 A;  2YQZ A;  1RKT A;  1IV6 A;  1G71 A;  1S7E A;  3G2B A;  2DDA A;  3CME I;  1H8A C;  1VEG A;  2CZ0 B;  1JI8 A;  1EH8 A;  1OFH A;  1V92 A;  2H6B A;  1SD7 A;  2K47 A;  2DFF A;  5E1X A;  2W9F A;  3OOP A;  3A8H B;  3H9Q A;  4FWH A;  3B74 A;  4ASN A;  5H6R A;  4ENN A;  2OZ6 A;  3KOZ E;  1VND A;  3PO3 S;  3CMA I;  2WWY A;  1U6G A;  5B66 C;  5A2Q S;  3J7A S;  3DEU A;  1T98 A;  3THG A;  4BU2 A;  3B7Q A;  1R2Z A;  3JTG A;  5FD5 A;  3VYR B;  3IKV A;  1XB4 A;  3JRC A;  2V9P A;  5EXS A;  3H0D A;  3G33 B;  3ZMS A;  4JI0 M;  1XMA A;  2CG4 A;  1FVV B;  5LBQ A;  3FRH A;  3UZU A;  3RKY A;  1B8I B;  5CVI A;  1DGF A;  2OC6 A;  1OFC X;  2MD0 A;  4CHT B;  4A6D A;  4EC8 B;  3J7A O;  1W36 C;  1NHA A;  3GTL J;  4OIP F;  5DYI A;  2XAQ A;  4M74 A;  1MND A;  2HOS A;  3G1L A;  1FPQ A;  4Y4R A;  3OYF A;  1MBH A;  1R5L A;  4EMS A;  5LD2 C;  2KHM A;  5TGT A;  1R49 A;  1YRN B;  2JPC A;  3BLH B;  4IL6 C;  1L2B A;  4KHP M;  4IJF A;  5IYB J;  4G4R A;  1NSF A;  4OIN F;  4RDU A;  1MDM B;  3QAU A;  2IGO A;  4DR6 M;  2JY7 A;  2W85 A;  3GUD A;  5J40 A;  1DO2 A;  1LTM A;  5JLW A;  1SXJ B;  4ENJ A;  1D8J A;  1SMT A;  4I09 A;  2RDP A;  1QHG A;  4E7L A;  2MH9 A;  4P5O A;  3TPZ A;  2CE7 A;  1OIZ A;  3ZQQ A;  4YG2 F;  3JRB A;  2HVS A;  4UV9 A;  1GVJ A;  3SBJ A;  1XMK A;  2BZT A;  2F5N A;  3NQO A;  2JUJ A;  3C2B A;  4XLH A;  2M5Z A;  5IHY A;  1N77 A;  5A2Q K;  3CGW A;  2ADU A;  2Z33 A;  3P9I A;  2C6Y A;  2R7O A;  1C0W A;  4JV5 M;  1UFM A;  2I8D A;  1MZB A;  2ISY A;  4QHS A;  2GIZ A;  2K7L A;  3AOG A;  2X9D A;  3DFG A;  1UGS B;  3GFJ A;  2HXI A;  2MLK A;  2XPW A;  2VC0 A;  4XLF A;  1ZR2 A;  2FS1 A;  3X25 B;  2V9V A;  1XX5 A;  3HYI A;  4IEJ A;  2QSF X;  2ZME A;  4FD2 A;  4E6K G;  1YFH A;  3EUH C;  3VOD A;  2Y2Z A;  3K2L A;  2I53 A;  4MGK E;  1TF0 B;  4D80 A;  1FX7 A;  1SVL A;  1IF1 A;  4DZP A;  4EJV A;  2XEP A;  4L9J A;  2LF8 A;  3JSP A;  1HC8 A;  3G4S I;  1ZTR A;  1R36 A;  3CP8 A;  3T1H M;  5ILU A;  5DS9 A;  2UUC M;  1ENW A;  2MC3 A;  2H27 A;  1SAN A;  2OTJ I;  2BWB A;  4AD9 A;  1MN3 A;  4PFP A;  1Y8Q B;  1E3O C;  2DK8 A;  1N34 M;  2V1N A;  2VKD A;  2BS2 A;  3JTH A;  2ZPI B;  2BV6 A;  3HOS A;  1BI2 A;  2JA6 J;  2WV1 A;  4G6T B;  1VQK I;  3SJM A;  3GFM A;  1BI1 A;  2ZJR F;  1H4L D;  4BBA A;  1PJT A;  1MKM A;  1P7J A;  1ULY A;  4A3G J;  4ELJ A;  5HLI A;  3QPL A;  4Y33 A;  1QA6 A;  1QPI A;  2ELK A;  3NWT A;  4IOC F;  4X6A J;  3HKZ A;  3LNQ A;  4L15 A;  1IUY A;  2QGU A;  1UHM A;  3A45 A;  3TWK A;  5FLX S;  2LC2 A;  1WHU A;  3W6K B;  4FX3 B;  1N25 A;  2EA4 A;  2CUJ A;  4IZZ A;  4CXA B;  1YIO A;  3JAM S;  2X51 A;  2AXT C;  4HQE A;  2FJ1 A;  1BA5 A;  3ABK H;  5E18 F;  1IBK M;  3BTL A;  4DV6 M;  1G4A E;  3GLG E;  2VKE A;  2VN2 A;  2PJQ A;  3RKW A;  5FLV A;  1R5I D;  4RAF A;  4M6Y A;  4CGZ A;  1JTY A;  1YI2 I;  3LAP A;  2XPV A;  1GUU A;  3I59 A;  3U2R A;  1JST B;  1DPU A;  2E1O A;  2VE9 A;  3WVD B;  3CJT B;  1O57 A;  4LZZ A;  3M8E A;  2ZME B;  3A42 A;  3OYK A;  3HRU A;  1XNQ M;  1TBX A;  1I1G A;  3ZP5 A;  2EV0 A;  1AWC A;  2VB6 A;  3V4G A;  4E7J A;  4P96 A;  2VOP A;  1D1C A;  1ODD A;  1WVR A;  2HI3 A;  2L7K A;  2R7S A;  3BBZ A;  3HL2 A;  2FE3 A;  3OWT A;  4I99 C;  5BPV A;  1V29 B;  2EFW A;  3U60 A;  3S16 J;  2V6C A;  5EXX A;  1N32 M;  5HS9 A;  5E3L A;  3MY5 B;  1QHH D;  1WH5 A;  3U6S A;  2XSD C;  4I81 A;  3HB9 A;  1P9Q C;  4F91 B;  1VQ8 I;  2WMB B;  2DMP A;  5EYR A;  3Q0V A;  2F48 A;  1OYY A;  4FET A;  5ITX E;  5L3E A;  1SFU A;  5DCM B;  4LFU A;  1LQ1 A;  4UVA A;  5D5V B;  4ZGJ B;  5EEA A;  2XRO A;  4KNY A;  1V33 A;  1ZQ9 A;  4EQQ A;  1NJG A;  1C7Y A;  2VKV A;  1XGN A;  5TIS C;  3E3V A;  4EC9 B;  5BPI A;  5DFL A;  1MSE C;  2IRF G;  5EF6 A;  4L9T A;  2C6T B;  3FYD A;  2Y9Y A;  2ZAN A;  5FLM J;  4DR7 M;  3OS0 A;  4M9X A;  5E20 A;  3OYE A;  1BU2 A;  5IP7 J;  1XDS A;  2K86 A;  1QVU A;  1SVM A;  1UJ8 A;  3DU6 A;  4B7F A;  2QCU A;  1F4K A;  3COA C;  3MZ8 A;  1Y1V J;  1IXR C;  2E5Z A;  4FWG A;  1Z59 A;  1AHD P;  1MW7 A;  1VQ4 I;  5EP4 A;  2O03 A;  5IYD J;  5EXT A;  1TR8 A;  3LCV B;  2B63 J;  3LCU A;  2KP6 A;  2MA3 A;  2W1O A;  2Y69 H;  4MQ9 F;  4QWQ A;  1MMS A;  2DZL A;  2LVP C;  1IGN A;  3QXE B;  2M3A A;  4NC8 A;  1R22 A;  1I50 J;  2E7X A;  2ZO4 A;  2FOW A;  3I01 M;  2DOE A;  2Y75 A;  3FIS A;  3I59 B;  5IDP B;  3MVP A;  1XNR M;  4N4O B;  1DPR A;  4WWC A;  1DGH B;  1LUJ B;  3DOA A;  1P4W A;  2UZK A;  4AVZ A;  2JWS A;  3Q8G A;  1SXJ E;  2IGN A;  1VIN A;  1G41 A;  3GLX A;  1PJI A;  4OIR F;  4LY6 A;  3UGJ A;  4BCN D;  3U61 B;  2EZK A;  4ETS A;  1PGY A;  2X1E A;  4XN3 A;  3U60 B;  4CXF A;  3FX3 A;  3DOG B;  4LF8 M;  5HQ0 B;  1HT2 E;  1SD4 A;  1T95 A;  2CEA A;  4P1W A;  3H4C A;  1KU7 A;  1X1B A;  2V1D A;  1OCP A;  1FKM A;  3OYB A;  4DR1 M;  1XGS A;  2QKL B;  1G3T A;  1MNE A;  2DXC B;  5D6F A;  2WAE A;  3KP4 A;  1LE8 A;  2KQR A;  1R1T A;  1IUF A;  2EIN H;  2MGQ A;  4RB2 C;  2Z7J A;  4DV5 M;  4JBA A;  3OYH A;  1OKR A;  2DOD A;  5CYV A;  4JX4 A;  3K4K A;  1VI0 A;  1HST A;  1QQI A;  2XSJ C;  3K4J A;  4XL9 A;  1VQ6 I;  2B9R A;  4LF4 M;  4TV7 A;  5J6X A;  3OYN A;  2DYS H;  1IXS B;  4W97 A;  4BBR M;  2IVM A;  2KJC A;  2RNG A;  2DAI A;  4NXN M;  2MJ5 B;  2X1C A;  2VT3 A;  3BZ6 A;  4YEJ A;  1Z6T A;  2KRK A;  1FMW A;  1OPC A;  1WJE A;  5JVT A;  1Y8R B;  2G7H A;  3QOP A;  2V79 A;  2BS3 A;  2DME A;  2XGC A;  4PJJ A;  1IQP A;  3F6O A;  5HS8 A;  2ZZD B;  1TW2 A;  2JP7 A;  3DBL B;  2EWN A;  4KIF A;  4LJ9 A;  3FTD A;  2MSY A;  4RF1 A;  3E5X A;  3H0G J;  4AKI A;  2OU2 A;  4RAG A;  1AOY A;  4CFU B;  1B59 A;  2AQF A;  1JOW A;  5BNJ B;  3ML6 A;  2R7W A;  3GBG A;  3K4C A;  4LLL A;  4MHG A;  3EID B;  1C1K A;  5LMN M;  5K5R A;  1BR2 A;  3BTI A;  4LG0 A;  1FP2 A;  1VQP I;  1D0Z A;  3ERE D;  4M6X A;  3PNY A;  4OU0 A;  4B3X A;  1VQO I;  1ZK8 A;  3HUG A;  3FUW A;  5LMU M;  1ETO A;  2UUA M;  3QPT A;  4BY1 J;  1G3N C;  2R92 J;  2X6W A;  1XSV A;  2M45 A;  3ELK A;  1XB2 B;  5IZ7 D;  4MTE A;  3HRS A;  2MYS A;  3OY9 A;  1XN7 A;  2YSR A;  3T0Y A;  4EJO A;  4JOM A;  1HNZ M;  3FTF A;  4YOZ A;  1Z21 A;  3NWL A;  5LFA A;  4QTR A;  4MTD A;  4IHV A;  4PJ0 C;  1P7I A;  3BJA A;  2ZB9 A;  2X1N B;  2KIS A;  3BHU B;  1NTC A;  3N97 A;  5KPR A;  1PVE A;  1OCZ H;  3CZ6 A;  2DD4 B;  3VYG B;  5LHH A;  2WAQ N;  2IXS A;  5J4V A;  3PVS A;  1QBJ A;  2VJI A;  3L09 A;  2JVG A;  3G71 I;  3JW4 A;  1WHC A;  5IRE B;  2Z5U A;  5HDG A;  5LGU A;  3FZV A;  2L4E A;  1E3H A;  1WJB A;  3AG3 H;  4D5F A;  5FRN A;  2A68 F;  3CLQ A;  1EFU B;  1YQA A;  2LXE A;  2FBH A;  3H35 A;  3OL4 A;  4K2E A;  3ZCB B;  1Z3X A;  2BHY A;  3GQ4 A;  3I5U A;  3ZMV A;  1WFX A;  3WGI A;  3KLO A;  2KNZ A;  2BXY A;  2OF7 A;  1HF0 A;  2NVT J;  1VDD A;  2L7I A;  1XC8 A;  5J3L A;  2HL7 A;  3E5Q A;  1ZRF A;  1JB0 F;  5ICP B;  3EUK L;  4FE7 A;  5J4Y A;  4HLQ A;  4BS9 A;  4A3C J;  4EOI B;  2ELJ A;  3F8C A;  4LGM A;  4J19 A;  3BR1 A;  4DR5 M;  3DXJ F;  4XM3 A;  1ZQ3 P;  1VQN I;  4BJ5 C;  2COM A;  2KRH A;  2TDX A;  4Y7N J;  3D0S A;  3BZC A;  3D5S C;  2MFZ A;  1R4M B;  3H36 A;  4HX7 A;  3CCR I;  3O0G D;  1Q3C A;  2KRU A;  6PAX A;  2LKX A;  2HDC A;  1NNJ A;  3MWM A;  4IQ4 A;  3NBX X;  2O9L A;  4HF2 A;  2CS3 A;  2BXZ A;  4XOP A;  2PJR A;  4CCM A;  5AIQ A;  1Y39 A;  1JE8 A;  1LFU P;  1HDD C;  2K9Q A;  1IY0 A;  3A1Y A;  3HM5 A;  3K9O A;  3QU3 A;  4MFE A;  1QZE A;  2Z2S B;  3S32 A;  1FSE A;  2GXA A;  1ETQ A;  1JGG A;  3GLH A;  4EGZ A;  4IHS A;  4ZDL A;  5E3M A;  1I4W A;  1T6S A;  1XGM A;  3L25 A;  5CJ9 A;  2R5Z A;  1I1S A;  2PQ8 A;  2JGZ B;  5BPD A;  2GOM A;  1X3Z B;  5FJ8 J;  1YS6 A;  4F1I A;  4E7S A;  2Q0O A;  3P9K A;  1A04 A;  3CTA A;  1GL7 A;  1K82 A;  4PGG A;  2N8G A;  3DQV C;  2LVO C;  4ON0 A;  4FCV A;  2DQR A;  3ERM A;  3OYG A;  2LMD A;  2JT1 A;  4NXM M;  4L5J A;  4A3E J;  2LHC A;  2XGX A;  4G6Z A;  2FH0 A;  5DYM A;  4F55 A;  4JI1 M;  1AHJ B;  2L09 A;  3DEW A;  4BB9 A;  4UB8 C;  3LQQ A;  4UVB A;  2W2H A;  2LTU A;  3E7L A;  4QLC U;  2WHB B;  5KPZ A;  1K3X A;  3ZQI A;  4KA4 A;  1OGU B;  1XXH B;  3CMY A;  3TOB A;  3AL0 C;  4F70 B;  3ABM H;  5GP9 A;  3OYC A;  1GUX A;  1ETW A;  2DKL A;  2ZFU A;  3KE2 A;  4ELL A;  1P3Q Q;  3HJ8 A;  3CC2 I;  4KDP A;  1ORY B;  1YX5 A;  2UZD B;  3IC7 A;  4CCN A;  3HHW A;  3TED A;  1NO1 A;  3MKZ A;  2Z8Y M;  4EJW A;  4KO8 A;  2FA5 A;  4RNA A;  4P9U A;  3BJ6 A;  3ZQF A;  2L2D A;  1K7A A;  3F21 A;  5L3D A;  1GVN A;  3DKX A;  1GL6 A;  2H8W A;  3BPV A;  2BJV A;  1R00 A;  1A31 A;  4L8R C;  1VTN C;  3PJR A;  4ABZ A;  5HNH A;  4BBS J;  2PJR B;  5HNF A;  1APL C;  5CVV A;  3P5J A;  2WSE F;  4LGY A;  3U6P A;  2RKO A;  2Y30 A;  3GZN B;  4D0P A;  4ZZD A;  1OIU B;  1SAX A;  1U9N A;  2IA0 A;  3HU3 A;  3A01 A;  2WIP B;  2ERC A;  5ITQ A;  2R0I A;  2LLK A;  5IT9 Z;  5D4S A;  3RDI A;  1J75 A;  1W98 B;  3BCB A;  4JN6 A;  1U5T C;  3R9X B;  3RGF B;  4YY3 M;  3GRU A;  3LA3 A;  2YUS A;  2R5Z B;  3J80 S;  4REZ A;  5I5Z B;  4AKH A;  3KP1 E;  2NNY A;  5FKM A;  2ZSI B;  1GV5 A;  2DI0 A;  1S3J A;  3HHH A;  1EH6 A;  1OCC H;  3E5U A;  3E6M A;  5DQV A;  1D1A A;  1I6H J;  2O8K A;  2X4A A;  1IW7 F;  2JUC A;  1MJB A;  3L9F A;  4BQN A;  5JFR A;  2JZY A;  4IBC A;  2O61 A;  1KYW A;  3A0H C;  3DPT A;  3PIP F;  4BE2 A;  2IPQ X;  2CV0 A;  3LSJ A;  4FTH A;  1XMX A;  4DV1 M;  1XCB A;  5AON A;  3EJ1 B;  3L2C A;  4EOK B;  1RPW A;  1JUS A;  4B1R A;  5BQT A;  1D3U B;  4CCL A;  4CFW B;  2IGM A;  4JI3 M;  1JSU B;  3LMM A;  4NB5 A;  2DA5 A;  2XZF A;  2KIU A;  4O6J A;  4ZC3 A;  2DQL A;  3FMR A;  4OVZ A;  4JQF A;  3GCM A;  2R62 A;  2PBI A;  3WTY C;  4EIW A;  3L26 A;  2X6Y A;  4BYY A;  2HS5 A;  2WIH B;  2BOL A;  4I6Z A;  1WH7 A;  3IHP A;  4H0E A;  2Q2E B;  3L2R A;  4B8X A;  1G8P A;  3C2G A;  5F3W A;  1UM8 A;  3BZK A;  2ZNZ A;  1E9S A;  1OYW A;  1IN6 A;  3M9A A;  1QUS A;  4DR3 M;  4DV7 M;  2IAI A;  2XSZ A;  3C3D A;  2WXV B;  3ECH A;  1TH4 A;  2Y21 A;  2OBP A;  2M60 A;  3K7A J;  2OPT A;  4AC0 A;  3A01 B;  4MEX F;  3J7Z I;  1RC9 A;  1X3U A;  2V1C A;  3FDY A;  2NNN A;  2R7R A;  1YIJ I;  2E2H J;  1KQ8 A;  1E9R A;  1NV9 A;  1LVA A;  5DDG A;  1P5E B;  3CCE I;  3K4L A;  3S2H J;  1H26 B;  4NOO B;  4NC6 A;  2JMW A;  1DGB A;  2EV5 A;  5JHF A;  2C5O B;  4HPQ A;  1WJC A;  1IDZ A;  4LG2 A;  1I3Q J;  2WC2 A;  3F8N A;  5D4R A;  2QBY B;  5J1R A;  2KNA A;  4M71 A;  1MBF A;  5K1Y A;  1E32 A;  3H1C A;  3WGH A;  4FWD A;  5E3O A;  1X1P A;  4BQO A;  3GO5 A;  3G73 A;  3TP3 A;  3IRR A;  5A2Q Z;  4CJ6 A;  1G4D A;  1VQ9 I;  4U87 A;  3SAT A;  3CCY A;  4YRV A;  1X2M A;  3L2W A;  2PFB A;  4A2U A;  4IBK A;  2IA2 A;  3IAM 2;  4LJ4 A;  1QO0 D;  5EGO A;  3L2U A;  3G1M A;  3CF0 A;  2NRA C;  4GIP A;  2R93 J;  4B3A A;  4LFA M;  2LSO A;  3S3N A;  2LVS A;  5ITR A;  2JA2 A;  3MMP A;  1I27 A;  4Y72 B;  1R4G A;  3K92 A;  4ZDP A;  4PJL A;  1MBJ A;  1VQ5 I;  2WBM A;  2OA4 A;  2FOI C;  2W48 A;  3M3Y J;  3FBI B;  1UG2 A;  2VJ4 A;  1PJS A;  3OTO M;  1NK2 P;  4KMF A;  1STZ A;  1BW5 A;  1QMZ B;  2KR6 A;  2KDL A;  3SC3 A;  1YE9 A;  1EJ9 A;  1S7A A;  4KIC A;  2DZO B;  5ITT A;  3FMS A;  2PMI B;  1LNW A;  3ZQC A;  1PP8 F;  1VDL A;  5LEK A;  1NK3 P;  3L7W A;  2L9S A;  5HDN A;  1BBY A;  5LRR A;  3V8L A;  5IOY A;  3H3V K;  4YOO A;  1PUF B;  2VDB B;  1S29 A;  3PM1 A;  1D1B A;  4PFO A;  3SZG A;  5GTI C;  2E2I J;  4G7O F;  4ZYG A;  2L7F P;  2V1X A;  1QDT A;  1TNS A;  3CDL A;  4G7Z F;  4XID A;  2VBW A;  2K0B X;  4M0W A;  2XAS A;  3H92 A;  1S5L C;  5ICG A;  1VYW B;  5DQW A;  4EOR B;  1WKM A;  2AHQ A;  2EZL A;  3LST A;  1AUA A;  1HJP A;  3KSJ A;  5KAF C;  3KEY A;  4GKJ M;  4CHU A;  1U5T A;  3KX2 A;  4BY7 J;  3KZZ A;  5FSW A;  5FGK B;  3BTC A;  4BHP A;  1LV7 A;  1ZV1 A;  3AJI B;  2H1K A;  4JYK A;  4IIW A;  1JR3 A;  1RI7 A;  5CKT A;  2D45 A;  3TWL A;  3ASO H;  3MKL A;  3FD9 A;  3M8J A;  4IO9 F;  4LJ7 A;  2E1N A;  4L0Z B;  1JGS A;  1G3Y A;  2ELH A;  3GLH E;  1OCR H;  4CYC A;  1POG A;  3DDQ B;  2PK9 B;  2K27 A;  4II3 A;  4OGR B;  5KAI C;  3HJS A;  1UNG D;  4XRF A;  3POM A;  1GH6 B;  2G5G X;  1FYK A;  1TDH A;  1EA3 A;  1QVT A;  1XWI A;  2ZFW A;  3B9P A;  3GWZ A;  4OB1 B;  4NQW A;  4IBD A;  5ICC A;  3WTV C;  4RBO A;  5FD6 A;  4IF4 A;  3M4O J;  3TW6 A;  3DLA A;  5JR3 A;  4FHT A;  3MKY B;  3Q9S A;  1BJA A;  3I54 A;  3F5X B;  1OFI A;  3DL1 A;  3AL0 B;  1UB9 A;  1WRJ A;  1WQ2 A;  3K1N A;  4B3S M;  3VWB A;  1OIY B;  3HGI A;  1T0F C;  3HOW J;  2M7B A;  3CUQ C;  4NRW A;  5IT3 A;  1MSF C;  2H1R A;  1Q1H A;  1G3S A;  1WCM J;  1KA8 A;  4BEH A;  2LK2 A;  1FJG M;  4FW9 A;  4CCO A;  1K4S A;  4ZZL A;  1WSU A;  1L1Z A;  3H5N A;  4AU7 A;  1T2K A;  3E1S A;  1IBM M;  1TW3 A;  4U7B A;  1A5J A;  2FNP A;  2UU9 M;  4LIV A;  3FIW A;  5FLX Z;  4ZYA A;  2RVC A;  1IV8 A;  2XPU A;  3H3U A;  5GTH C;  2P0W A;  3J7A Y;  3VOE A;  2YPR A;  1XG1 A;  5KQD A;  2YNM D;  1U5T B;  3SMS A;  1TTY A;  5ILV A;  3CTW B;  1ZHF A;  3SYK A;  2JPB A;  4IMY B;  3WE3 A;  2KIM A;  1F5Q B;  2HVQ A;  1YRN A;  2QHO B;  2FXA A;  2ZCW A;  1PP7 U;  2CV1 A;  1ZAR A;  2FX0 A;  1F5T A;  2DWZ B;  2DLL A;  3JRD A;  2NS7 A;  3E6B A;  2R7Z J;  3I4N J;  4AYB A;  3HOZ J;  4CYC B;  4PDI A;  1NVM A;  3MAJ A;  1R6B X;  4X66 M;  5KQ8 A;  2KIQ A;  4A3M J;  3RFW A;  2MD5 A;  4FQG A;  3LA7 A;  4DOZ A;  3S17 J;  2ZTD A;  3HG9 A;  4NQW B;  4BJT A;  1ZGA A;  1UEL B;  5KK1 A;  2I7P A;  1LB2 A;  3GLF B;  3K8Z A;  2X49 A;  2ZXJ A;  1D8K A;  4DV2 M;  2E35 A;  4G9Y A;  3J7Y J;  4GC5 A;  4PJM A;  1MBK A;  2YFQ A;  1PJR A;  1ZR4 A;  4CCJ A;  2QSH X;  1P4A A;  3OOU A;  1NG6 A;  2DPD A;  1DGR M;  1HSJ A;  1KYZ A;  4QNM A;  3LQR A;  2CGP A;  4BEH B;  3OS2 A;  1IZ1 A;  3TO7 A;  2CU7 A;  1VQL I;  1TH2 A;  3A8M B;  4HQM A;  3SMP A;  1HDP A;  2LOO A;  1YJW I;  5GAD J;  2DVW B;  1JUP A;  1J5Y A;  2E71 A;  2G9X B;  1KU3 A;  2ZAO A;  3GME A;  5D5X B;  2OQG A;  4D9J A;  4L5I A;  2MH8 A;  3IRQ A;  3EYI A;  3IWZ A;  1IO2 A;  3BQZ A;  4XLA A;  3CCQ I;  4BE1 A;  4LMY A;  3I4M J;  2EB7 A;  1H1P B;  4ZYD A;  3MD2 A;  3QZ5 B;  1Y56 A;  2CZ6 B;  5IP6 A;  4BBS M;  4LJ6 A;  3I0T A;  2W24 A;  3CF6 E;  3GTQ J;  3BG3 A;  2BY0 A;  2XZU A;  3J81 K;  4U7D A;  2F6C A;  3GPP A;  4UY8 I;  2QP9 X;  2IW8 B;  2XRL A;  5FKO A;  4BUP A;  3E0J B;  1YUB A;  2X6O A;  4YIF A;  4L78 A;  4B08 A;  4Y17 A;  3CD6 I;  2KT0 A;  3BR5 A;  3BR6 A;  1R2Y A;  2MGW A;  3KSX A;  1DO0 A;  5JI2 E;  4HX4 A;  2JA5 J;  2K5C A;  1WGX A;  1W7P D;  5M5X J;  4TUW A;  2XAH A;  2ZNY A;  5GAG J;  1R71 A;  1QQW A;  1O3S A;  1HCR A;  4NHJ A;  4M6V A;  2GXG A;  3ZMT A;  4RB0 A;  1SVO A;  1KQ9 A;  1WGL A;  3WU0 A;  4A3J J;  2CZ7 B;  4PJN A;  3GTM J;  3KFU G;  4EOL B;  4D7M A;  1E9H B;  2VJJ A;  3N4M A;  2BEO A;  1B9N A;  2EUC A;  5IYC J;  3LOC A;  2E60 A;  5EEG A;  2PMU A;  4BAC A;  2WAD A;  4AUX A;  1NG7 A;  4HW0 A;  3J7B A;  4IBE A;  1DP7 P;  2RGO A;  2A61 A;  3TW7 A;  5B5E C;  4HEO A;  2I10 A;  2BVM A;  2C9C A;  1YYV A;  4JX6 A;  2R4G A;  2CW7 A;  5CQE A;  5IF1 B;  2VI6 A;  2HU9 A;  2IW5 A;  4ZJZ A;  4CUG A;  1DGW Y;  3CUQ A;  3FKI J;  3RZO J;  1IG7 A;  2DXB B;  4YC3 B;  4JI4 M;  1RES A;  2NVU B;  1K4T A;  1GV2 A;  4A3B J;  1X4P A;  4EEF G;  2DA1 A;  1HQC A;  5H20 A;  1FIP A;  5D5U B;  2CJJ A;  2XFS A;  3BOQ A;  3PUF A;  4GO1 A;  3I64 A;  2OAZ A;  5F0C A;  5IP9 J;  2UXX A;  4CZC A;  5LQF B;  1XSD A;  3SZT A;  2GIV A;  3K2A A;  4OWR B;  1JKW A;  2JA7 J;  4NBQ A;  2ZKZ A;  3RQI A;  3GZ5 A;  3R0A A;  4QPQ A;  4AM3 A;  2OUM A;  2A69 F;  5DCM A;  3V8J A;  4DGW B;  4QIW N;  3MFK A;  1DU0 A;  2GQF A;  4FE4 A;  4MNU A;  4G6D A;  2LH0 A;  3QPS A;  2DWN A;  5IDN B;  4CFM B;  3T6P A;  1RKW A;  2YS9 A;  3DPU A;  1MGT A;  5D8L B;  2M4K A;  3CJQ B;  5CVU A;  5M3F J;  1I3A A;  3RPU D;  2K9L A;  2XV4 S;  4M3E A;  3CCS I;  1FMV A;  3GP1 A;  3TL4 X;  2ZJQ F;  3WTZ A;  2I40 B;  4AZF A;  5JI6 A;  3E6D A;  3IG8 A;  2L3D A;  3I4P A;  3CO6 C;  3KYL A;  5EG0 B;  5CLS A;  5JVG F;  4BCH B;  3RSN A;  1VOL A;  3H4M A;  3DU5 A;  2R4E A;  2ESN A;  3TO6 A;  1OR7 C;  2P5L C;  5KO3 A;  2XUB A;  4X62 M;  1OKS A;  4HEA 2;  4A12 A;  3OSF A;  2KLO A;  3M1C A;  2HKJ A;  3PQK A;  1XGO A;  3OS1 A;  2KMG A;  2UZL B;  2LVA A;  2GA2 A;  2XB0 X;  1PJQ A;  2L6O A;  4MIM A;  2GAU A;  1BL0 A;  1JR3 E;  2R18 A;  1L2C A;  5HDK A;  2GQQ A;  4W5W A;  4V2G A;  1YX3 A;  1PRB A;  3DTK A;  1DGH A;  3KHI A;  1UCR A;  4M72 A;  2CFO A;  1G3I A;  2HEO A;  1O7L A;  3OYL A;  2LHG A;  3CUQ B;  4B09 A;  2P8T A;  2LKS A;  2HNH A;  2O25 A;  2ID6 A;  1TNT A;  1Y8G A;  1TD6 A;  4HA8 A;  3CCL I;  1JT6 A;  4GYI A;  1KQ0 A;  3U61 A;  5E26 A;  3F0C A;  3WU1 B;  4LF7 M;  1KON A;  2IVX A;  2ZXH A;  4Z8X A;  4QSH A;  4XRS G;  4Q7J A;  1T08 B;  3F3X A;  3SFI A;  2K9D A;  1X3W B;  4RGS A;  4FCY A;  3WHK A;  3C7J A;  5GAH J;  1H1R B;  3QYG B;  2GBY A;  2TRT A;  4B44 A;  4FCW A;  4IRI A;  3DP7 A;  2FF4 A;  3RKQ A;  2ZPH B;  4BJ6 C;  5F64 A;  1D0L A;  2NAZ A;  3FUT A;  5EXP A;  1YW7 A;  3LL7 A;  4Y15 A;  1MU5 A;  1YW8 A;  4I01 A;  4DYR A;  4HLY A;  4AWX B;  2A07 F;  1MMA A;  3IWF A;  4DIQ A;  3I4V A;  5HBH B;  2DTZ A;  4Y52 J;  1BOB A;  4XRM A;  3K70 D;  4D7N A;  3B57 A;  2R4J A;  1GLN A;  3CCV I;  3L2A A;  2CRG A;  2ZM6 M;  2OV7 A;  2VOO A;  1NNU C;  5J1U A;  5ED4 A;  3L00 A;  3QYF A;  4EOJ B;  3DDP B;  4DUZ M;  1WGN A;  1IXS A;  1Y6I A;  3QYH B;  3E9S A;  5FKN A;  1R58 A;  1UHW A;  4IHX A;  2XAJ A;  1EIJ A;  3E97 A;  3VLF B;  1XMQ M;  5E3N A;  2KA6 B;  1YLA A;  2R46 A;  3R4K A;  2OTL I;  3MEX A;  1UNL D;  4ENM A;  4O3M A;  1FOX A;  3ILK A;  3S93 A;  4EAT A;  3ZRG A;  2HCB A;  2EFO A;  2HDW A;  1LVK A;  2H8R A;  4GDF A;  4XKB A;  4F2L A;  3BOS A;  8CAT A;  3CES A;  3FXJ A;  1WJ7 A;  3AKZ A;  3GVA A;  3TKY A;  2HQA A;  3VEP A;  1F9N A;  2VJ5 A;  4BCM D;  5LMK B;  1FJL A;  1MBE A;  3TNW B;  4M0D A;  5IWA M;  1XSX A;  2OD5 A;  3NRV A;  3P9C A;  5DCF A;  2VUM J;  2Y20 A;  5F1J A;  1W0U A;  1S3S A;  3EUH A;  1J09 A;  2DPU A;  3L1P A;  2DNA A;  1HW5 A;  2V22 B;  2Y0T A;  2VQL A;  4G4O A;  3K6G A;  2MG4 A;  1VF9 A;  3R0J A;  5B1A H;  4LRS A;  4GEW A;  4X64 M;  2DZN B;  2Y0S N;  2D7E A;  2W4S A;  4H4K C;  2L4M A;  1RIO H;  3DTO A;  2J5P A;  2NVY J;  2XGN A;  5F0H A;  2WB1 A;  3CUO A;  2LRE A;  3HHT B;  1RNL A;  2LBF A;  4OB0 B;  3VKG A;  4EOS B;  1G6N A;  1JJ8 C;  2B7E A;  2R3S A;  2Y31 A;  2JA8 J;  4FVM A;  2QUF A;  3KET A;  2R7G A;  2YX4 A;  1UGR B;  2LG4 A;  3MCZ A;  4IXA A;  1K3W A;  2KZV A;  3OL3 A;  1TFB A;  2BJW A;  3I9V 2;  3SAS A;  1ZH5 A;  4U0Y A;  1ETY A;  3SYL A;  1WI3 A;  2ZTC A;  3K70 C;  3SAU A;  3J80 Z;  3IV5 A;  4AG6 A;  2CYY A;  3HJQ A;  1U0J A;  3IH3 A;  1HKT A;  3ABT A;  4EM1 A;  3BLQ B;  4YEL A;  3U6D A;  1BI3 A;  4LLN A;  1IRF A;  3FMQ A;  4BAY A;  3ZC7 B;  1OLT A;  2HYJ A;  3KP7 A;  1U8R A;  3BQY A;  1ORK A;  4IBI A;  1F36 A;  1Z0X A;  3QWL A;  4C3I J;  1IRE B;  1GJT A;  4KOD A;  3UK6 A;  3L27 A;  4IBJ A;  2G9W A;  2L9N A;  4FAS D;  2R6F A;  4II5 B;  2APL A;  1UGP B;  3U6O A;  2GWR A;  2WY7 Q;  3V7S A;  4OMY A;  1IN7 A;  2VXZ A;  1A6I A;  3KOX E;  2VQC A;  4DV4 M;  1Z9C A;  4W1U A;  3HJE A;  5FTL A;  2PMZ A;  2DAO A;  5H2F C;  9ANT A;  4D82 A;  2DMQ A;  4A0Z A;  2CQ7 A;  2EBI A;  2D0Q B;  3HO8 A;  1QZM A;  1AKH A;  4M3D A;  2STT A;  4BXX X;  1X58 A;  2XKO A;  5IOZ A;  2J5O A;  4ENK A;  4BNC A;  3E4R A;  3W0L B;  2HGC A;  4BXF A;  2CYZ B;  3X24 B;  4BCI B;  3FUU A;  2OCE A;  3BLY A;  5DD8 A;  2LNB A;  4BL0 B;  2BVL A;  4YII A;  3PFI A;  3GFI A;  4CIZ A;  1FLI A;  3IG5 A;  3PFY A;  2HDD A;  3SAV A;  1R1U A;  2CW0 F;  2D7G A;  2WAF A;  1QPM A;  2CQN A;  3HZJ A;  3BY6 A;  4GYG A;  1CQT A;  4DR4 M;  1FTT A;  1ZYR F;  2KRC A;  3A8G B;  5LHI A;  1E94 E;  2LBF B;  3U6Q A;  1P92 A;  2L7Z A;  1XXH A; 
#chains in the Genus database with same CATH homology
 2G77 A;  3X26 B;  3QYB A;  4AI6 A;  2BS2 A;  2ZPI B;  3TW7 A;  3H4C A;  2QDJ A;  1FKM A;  4JX6 A;  3A8O B;  4NC6 A;  3HBL A;  2DXC B;  3VYH B;  4ELJ A;  5EJC A;  3BG9 A;  2DXB B;  1E7P A;  1AHJ B;  2DPP B;  4JX4 A;  2CZ0 B;  4BBR M;  2ZPF B;  4MFD A;  3A8H B;  1UGQ B;  2WJ9 A;  2BS3 A;  2QDY B;  4AKG A;  2ZZD B;  4AKI A;  3X28 B;  3WVD B;  4HNU A;  1QLB A;  3WVE B;  2DD5 B;  3HHT B;  4OB0 B;  3VKG A;  2KR6 A;  2ZCF B;  1V29 B;  1UGR B;  2QQ8 A;  3HB9 A;  4OB2 B;  4HL4 A;  4OB3 B;  2KMG A;  4AKH A;  3VKH A;  3A8L B;  2DD4 B;  4MIM A;  3VYG B;  3A8M B;  4HNT A;  2QF7 A;  3KHI A;  2AHJ B;  3QYE A;  4ZGE B;  3QZ9 B;  3QWL A;  1IRE B;  2ZPE B;  4JX5 A;  3QZ5 B;  1UGP B;  4BBS M;  2CZ6 B;  2ZPB B;  3BG3 A;  4FM4 B;  4QSH A;  2CZ1 B;  2D0Q B;  2ZPG B;  3HO8 A;  3QYG B;  4HLQ A;  2BS4 A;  1UGS B;  2ZPH B;  2CYZ B;  3X25 B;  3QXE B;  3X24 B;  4LOC A;  4OB1 B;  4M6V A;  3BG5 A;  2QFZ A;  4ZGD B;  3HZJ A;  2CZ7 B;  4Z6Y A;  3TW6 A;  3A8G B;  3X20 B;  3QYH B;  4ZGJ B;  3DL1 A;  4MFE A;  4P17 A;  4HNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...