4ZGEB

Double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 52
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgeB02
2PVDB 3WVDB 2DD5A 2CZ1B 2PU9B 1IREB 2DXBA 2WSFE 2CZ7B 3HHTB 1UGQB 4OB3B 2PUKB 3VYGA 2QDYB 2WSCE 2DPPB 3X28B 3VYGB 1DJ7B 2D0QB 2DXBB 1JB0E 4ZGJB 2ZPGB 2DD4A 4KT0E 2DXCB 3A8GB 2O01E 2ZPIB 3QYGB 3A8OB 3LW5E 3VYHB 4ZGDB 3QZ9B 3QZ5B 3X24B 2PVGB 4ZGEB 1PSEA 2DXCA 2PUOB 5L8RE 2CZ6B 2ZZDA 1QP3A 2DD5B 1GXIE 2ZPBB 1UGSB 4Y28E 2ZZDB 2WSEE 3X26B 2ZCFB 1AHJB 1QP2A 4XK8E 3WVEB 1V29B 3X25B 4OB1B 2ZPHB 4OB2B 3A8LB 3QYHB 2CYZB 2DD4B 3QXEB 4FM4B 3A8MB 3X20B 3A8HB 2ZPFB 2CZ0B 1UGPB 4L6V5 1UGRB 1PSFA 2PVOB 2ZPEB 4OB0B 4RKUE 2AHJB
chains in the Genus database with same CATH superfamily
2LQ8A 2G9XB 1OU9A 2RD1A 2C0OA 2HQEA 2RMOA 2ABLA 2DL3A 2GNCA 3CBMA 2GTJA 4HVVA 1YN8A 3GNFB 2E6NA 3CCJA 1PKSA 3UWNA 4BE0A 5IHKA 1RUWA 2PU9B 1QCOA 1BU2A 1QMZB 3OB9A 2FZCB 2RQVA 5GJVB 2VC8A 1K0XA 3M58A 2F2XA 3HTRA 2KT1A 3VYGA 2WSCE 1NZ9A 2SEMA 1VYUA 2QXFA 1TUGB 1ZP2A 2RJDA 2KMGA 1XQHA 1U3OA 1H27B 4EC8B 2RJCA 4RODA 2F2CA 3TW6A 2XICA 2AZVA 1VQ5Q 2L3RA 3JB9J 4OP0A 5DQWA 1QVGP 4MFEA 1YITT 1QQJA 3MEWA 1VQ9T 1Y71A 4AG1C 4BCPB 2KYMA 3VUZA 2IW6B 1BU1A 2O9VA 1BI3A 1JJ2A 3SWNA 2DIGA 1MHNA 4EMKA 2K9GA 1VQPA 4LE9A 5GANd 1VQ8A 4PFOA 3I9QA 1I1JA 2ROTA 4N4IA 2C5VB 2A3LA 2MF2A 3CCVT 2E41A 3OYNA 1W2BP 1KC8C 2KXCA 4C92F 1X27A 4A4KA 3QYHB 2EQKA 2JN0A 1H641 3OW2P 3I55Q 3A1PA 1H3HA 4WCIA 3VKHA 2QDJA 1I8FA 1X43A 2EBPA 4JLGA 4C0GA 4BCGB 2V8IA 4GLKA 5KYUB 5IHIA 3M0QA 1YCYA 2KVQG 1RABB 2PHGA 5GANg 4CFWB 4JDSA 2DF6A 5ICPB 1P5EB 1MV3A 2FPDA 2MWPA 4RCBA 1YJWT 3CC4T 2D6FA 2QEXA 2CUDA 2QDLA 3GPLA 2V26A 2KXDA 2HZYA 2KEAA 4YOZA 3EHQA 3FIFA 3S6WA 1N9SA 3BHVB 4BCMB 2XU8A 1VQNT 3GTMS 1O9SA 4GBQA 3TEEA 2NLUA 3I5RA 5KYXB 1YWOA 1V1CA 4BDZA 3LH0A 4J8OA 4DA4A 1Y7XA 3OYDA 5GJWB 4F6WB 4ZGJB 2OAUA 2ZPGB 2M51A 2QI2A 1WFWA 4YTLA 1OKWB 2EAYA 1KQSP 3ME9A 2K7AA 1I4K1 2MCNA 1VQOT 4EOJB 2R5MA 4BE2A 1XJWB 3MO8A 1OPKA 4ANJA 4XTYA 2O4XB 2VYTA 2PMIB 3MHXA 3X24B 3NTHA 3CMEQ 4RTUA 3VS6A 4J9EA 5IF1B 3CCLT 3CCVA 2OI3A 1S72Q 1S72A 4BY6B 3VRZA 2DD5B 2JTMA 4DEYA 2L5QA 3A98A 4PK4A 2WHBB 2WIHB 4XQ3A 2DIQA 4ELJA 1E6GA 4ZN1A 4QT7A 5GANf 2VV5A 1KHIA 2QFZA 1YI2A 5C6SA 2YUNA 4HT8A 1UHFA 4MIMA 1T3SA 3BHTB 4IIOA 1H92A 4OB1B 2F2WA 2J06A 2L3PA 4BD3A 3M03A 3QBYA 3OYLA 4F7SB 2YUQA 2DJQA 5FLXE 1M3CA 2Y90A 3OS2A 1FYNA 1PHTA 2DBMA 3SDZA 1YHQA 4IUQA 1PCXA 4PJMA 2ESWA 4J9DA 2H8HA 4M75F 1VQNA 3M0RA 3CPWP 1ARKA 4Y91A 1WI7A 1EZZB 1PKDB 4RTWA 2I40B 4B6MA 1ZSZB 1WJQA 3INZA 2ED1A 2RQRA 3HRUA 2PQWA 5GAN2 1PC0A 2UZEB 4YOSA 1VOMA 4CC7A 4OGEA 5GAMh 2IW8B 4M6VA 1ZA2B 4JZ3A 4C8QB 1D0ZA 4NOYA 3CCMT 1BI1A 1R77A 1AOJA 4QVCA 2BE7D 1K8AR 4HCKA 1SRLA 4M78B 1WHLA 2D1XA 3BW1A 5IT9E 5FGKB 4BI4A 2DETA 3CCEQ 2B9RA 4XTUA 2XI9A 2ENMA 3QYEA 2OTLT 4DBHA 1AWXA 1FXXA 1U5SA 1ZHIA 2EYZA 3JCMh 3EH1A 3CCUT 5CIUA 5HCKA 3BG9A 3OYAA 3SD4A 2P84A 1M9SA 3QYGB 4PLLA 4D8KA 5LJ5f 1OZ3A 1TUCA 4QSHA 4AI6A 2PVGB 4FT2A 4KH0B 1VA7A 2XHCA 2Z0WA 4MMKA 2DXCA 2E12A 4XU2A 5L8RE 1GBQA 5CKDA 2DO3A 5LL6S 3LWIA 3MCAB 2O9SA 2K3YA 3VS7A 1NLOC 1KD1U 4E6RA 1OU8A 2JNGA 4LUEA 2ZCFB 2EIFA 2LC4A 2RQWA 1H1SB 2D9TA 2DM1A 4DEXA 3CCVQ 3PVLA 2J6FA 4LDUA 1K9MR 3C12A 1G3SA 1QW1A 5KYYB 1WHGA 4GY5A 3S3OA 3JCMb 2X9HA 2AT1B 4BCMD 3X20B 3OY9A 3SEMA 2E10A 1VQ7T 2K2MA 2VKNA 2QAZA 2ZPEB 2FEIA 3E2UA 2FRYA 1IXDA 2CP5A 4JX6A 4EOQB 1W2BA 5EC7A 1PG5B 1LOJA 2JMCA 3EAEA 3BG5A 4LDYA 1YHQT 1RACB 5FWCA 4M7DC 5I22A 1FX7A 1WA7A 2F5KA 3CCRQ 1VQ6T 2JOYA 1BCMA 2X4JA 5GAN4 2DXUA 3L2UA 2EYXA 4LN2A 3H41A 5HK0A 2LW4A 4PL6A 2DMEA 1IRXA 3LQ5B 3HPWA 3PVQA 2RPNA 2QDYB 2DTIA 2OAWA 1TWBA 3H9NA 2LJ1A 4HCCA 4EOIB 2A36A 2FL7A 1TG0A 4HCBA 2BS2A 3KBGA 1TH7A 5KYYA 2QA4Q 1GBRA 3CBPA 2HBWA 5GANe 4F7UB 3SWNB 1VUBA 3OSSC 2DRKA 1WJSA 2CP6A 2H3EB 5J26A 2ZGWA 3FLGA 4PJNA 5C0MA 1AISB 5GAN6 1S72T 2PNIA 4OMQA 2BKZB 3VRYA 1K73C 1YBYA 1H28B 1UJYA 5FU7C 4WTOB 4R55A 3PIOA 1ZSGA 4F7NB 2RJFA 3MIAB 3SB2A 2JM8A 3U23A 1VQ8Q 5ECAA 4E7HA 4JJNK 2EJ9A 3G6EA 4FCYA 2QF7A 1VQPQ 3OYFA 4IURA 2JUFA 1RAAB 3AT1B 4PJOD 5KH6A 2C5OB 3FDRA 5D7UA 4C8QD 3CC7A 1NYGA 1VYTA 4E7IA 1G3NC 2D8JA 5IH2A 1UGRB 1I81A 1I5OB 4IUVA 3JCMf 2J6OA 2RF0A 4C5IA 1UGVA 4Z8AA 2X4WA 1OL2B 3E9FA 5A0GA 3H6ZA 3NMZC 2B8AA 1YIJQ 1AD5A 1Z9QA 1PWTA 2Y4YA 1VQ5A 2PVDB 3MPUB 2RB6A 2MAMA 1P92A 4FYVB 1ZSZA 1KK7A 1MGQA 1D3BB 4KRTA 3CCLA 2CCHB 4PJOA 1ZLMA 2YRDA 5GAN3 3G71Q 4PKCC 3CPWA 4OB3B 4J9BA 3UF4A 1XTDA 1K9MC 3CCLQ 1K4US 2IN3A 1QMCA 1JO8A 3NTKA 1JRIA 3CXCA 1DJ7B 4BY7X 3GNGA 4J83A 2BS4A 2DD4A 2C0IA 3CMAT 2BS3A 3RDVA 5EG2A 2BKDN 4JRQA 2KT8A 3HKSA 3F70A 4EOOB 3NFCA 1XNIA 3OMGA 2HBPA 4EC9B 1JU5C 3V7RA 3THKA 3REAB 3BLRB 4BY6C 5KYWA 1IO6A 2E65A 3PE0A 2PK2A 4PFPA 1YIJA 4KGXB 4ELZC 1FKMA 3RERA 4LDXA 2XG8D 1H25B 1K8AU 1GL5A 5KYXA 4M7DA 3M54A 1QVGS 3OBWA 3PTAA 3MP8A 1TFBA 4E7LA 3QJ6A 5KE2A 4OGRB 2MPXC 1F5QB 3FJ5A 1G3WA 1EX4A 1Y57A 4RUGA 3M56A 3DOGB 4PJOG 2DYBA 2KY9A 4IUTA 1B34B 5LJ5g 4EOLB 3QO3A 4L6V5 2JGZB 4EOMB 3HZJA 5GAMj 4AKHA 1UDLA 2DL7A 1VQNQ 1NJIU 2DL8A 3UPUA 4C0ZA 1AWJA 1V76A 2LX7A 1YHQQ 2YDLA 1H26B 2CS7A 4F7UE 3MP1A 3WVDB 3DLMA 2DD5A 4ATOA 2YT6A 2DTHA 1BIBA 5KYUA 1X2KA 1GUXB 1GCPA 3QIIA 1GY3B 3H0FA 1MMGA 2P4TA 1QVFP 3OYEA 2CH4W 2COWA 2EJFA 2OTJQ 2LQKA 4JLIA 1FWZA 1N5ZA 1TTHB 1VQOQ 1WXBA 1Q81R 1JJ2S 1OIUB 1PRLC 2RQTA 4M7AF 3OS5A 3HSBA 3HFNA 1HJDA 1Q82R 3UDCA 1OX8A 2RHZA 2K79A 3OYYA 5IHNA 4PJLA 1SSFA 3J7AF 4EONB 1VIFA 2BTTA 1U1SA 2GFAA 3LYIA 1M90R 2V1QA 3TW7A 5LJ3j 3D7SB 3CCSQ 1RADB 5J3BA 3NGPA 1RL2A 4B9WA 4G6LB 2QEXT 2UZLB 4RG2A 2XDBA 1X6OA 1X69A 1H1RB 2RHXA 5EJCA 1JQQA 2JT4A 1H8KA 3FB9A 4PJOB 1PM3A 3H4CA 5FWBA 2KNBB 4FW1A 1H3ZA 2O88A 2IIMA 4FSSA 1M27C 2ZPBB 1EFNA 5IXFA 5GANh 2QASA 1GUXA 3KHIA 1K9AA 4J9HA 1KC8R 1T0JA 3DKMA 3OS0A 3M57A 4Y92A 1SPKA 1LNXA 4Z89A 5HBHB 3G4SQ 1RAHB 1RLQC 1J3TA 4A4GA 2BZYA 3HRSA 1WX6A 3A8MB 3M9QA 2CT4A 1RAEB 2A28A 2G6FX 2QGFB 5FROA 3M0SA 3JB9D 3Q1JA 3CCUQ 2MYSA 3EOCB 3TNWB 4NC6A 1K73R 1SSHA 1D1AA 1MMAA 3JV3A 4O5VA 4II1A 4M4ZA 3EH2A 5I2MA 1JEGA 4M7AC 4M7DB 4Z6YA 1FMKA 1ZQ1A 4QVDA 4QVZA 2LNHB 3KUFA 1XO2A 2RH2A 4FYYB 3KFVA 2DK3A 2Y4XA 4OMPA 2E4HA 4ORZA 3GLXA 3TCJA 1UUEA 3CBOA 2DXBA 1ZBJA 4DBFA 5A0DA 4RTZA 1AVZC 4J7IA 5LQFB 3CCJT 1T3LA 2DAQA 1WXTA 4DBRA 1BIAA 4M7AG 4X9CA 3VS2A 4JPBW 4A4FA 5CKHA 1WNLA 4HNTA 2EPDA 1X75C 2DXBB 1TUDA 4BBSM 3CMAQ 3JCMV 1X6BA 1KXUA 1HXDA 4F7UF 2VXEA 1LPLA 4D6WA 3O5ZA 3CMEA 4HA8A 2RI3A 3JB9H 2FPFA 3GF5A 2KMTA 1QCFA 5LJ3e 4CFNB 1TXQA 4C8QF 3QZ9B 1N8RC 5I21A 4KBMB 2EUFA 1R8OB 2NUPA 2DBKA 3CD6A 4M77A 1W98B 1O9KA 3JCMP 2LCSA 2DFUA 2RI2A 4JJCA 3PGGA 4OR5B 1UGSB 3ZFJA 2K5FA 3EFOA 1YWPA 4LNPA 1QLYA 2KI7A 3TQ7P 3V8KA 4NSTB 2KGTA 1G2BA 1I5LA 1GFCA 3EGDB 2CP0A 2HKQB 5LJ3g 2WACA 1VQLA 3EGUA 2M0YA 4NL3A 3JCMe 1ABQA 1M90U 4M7DG 1OV3A 5GAOm 4CFXB 4C0DB 1C9BA 2FG0A 1K8AC 4DQ2A 5LJ3d 3OW2A 4K11A 4N4HA 3M0UA 1Q86U 1M1FA 2J7IA 2B86A 4M75G 2E5QA 2K57A 2LNVA 2KRNA 1R0BG 2RHUA 2IG0A 4NL2A 4M77F 4EDUA 5GAOp 4JRKA 5FRMA 2D0NA 3JCMg 1NYFA 3VS5A 2DVEA 3ASKA 3JB9G 4CC4B 4EOSB 3CCUA 1AT1B 1C6VX 1FMWA 1ZUYA 2HCKA 4XTWA 2C06A 4ESRA 3J81E 1PD0A 2DILA 3QPHA 1VQMT 1M1KC 3M4GA 3L2RA 2DL4A 1R0CB 1VQ6A 5I11A 2V1RA 2DZCA 1NEGA 3UT1A 3NHNA 1WHHA 2EYQA 5D6WA 3LX7A 4C92C 1UHCA 4JX5A 2AKKA 2HMAA 3VJPA 2LQNA 5LJ5e 1VQ6Q 1QVGA 1JB0E 3DL1A 1K73U 1E7OA 3M4YA 2DXCB 1U06A 2NWMA 5CAIA 7AT1B 2ZPIB 1GCQC 5IDPB 3G6EQ 5GAMg 3VYHB 5CK9A 2FO0A 3P8HA 1ZUUA 4J6XA 2P0QA 1OIYB 1CKBA 1X2QA 1M1KR 1PSEA 5FRNA 4BCKB 1BCOA 1VQLT 2KRSA 2QQRA 2E1HA 1HSQA 4FU6A 2FB7A 3HFOA 1WPYA 3EGXA 1W6XA 3K7AM 2LT1A 2LT4A 2QGGA 3MJXA 3MEVA 1IHVA 1KG1A 3CXCS 5L23A 2QTVA 3VS1A 4EIKA 2NYSA 3F5XB 2KE9A 1UNLD 2XKOC 1X01A 3PMIA 3M0PA 4ZNXA 1YIJT 1KIKA 2DZ9A 4EMHA 2YLBA 1LJOA 2KROA 2A37A 3CC7T 1WXUA 4KGVB 1UNGD 5GAN7 3CC4A 4JJDA 2EW3A 2O4XA 2OTJT 1YJ9T 2RM4A 1VQKT 4HCZA 3P8DA 3OSVA 4RKUE 5KYWB 1W2BS 3C94A 2C4GB 2K6DA 3L2VA 5DY9A 3H8ZA 2QQ8A 2QGSA 2KYBA 3QKJA 3UATA 4RTTA 2QQBA 4HNVA 3JCMd 2KBTA 4XTXA 1KC8U 1TU0B 1KHCA 1O75A 4C92E 3BE3A 1MNDA 2EKOA 2H3JA 4CFUD 2X3XD 3G4SA 4X1VA 3CCJQ 3HHTB 2KQWA 4AFSC 5GMKe 3I5SA 1NPPA 1W1FA 2LJ0A 2C0TA 2YUOA 1VQPT 1KD1R 2GGRA 3EFOB 3VU3C 1VQOA 1M8MA 4AG2C 4IMYB 1N27A 4M7AA 2QA4A 1MV0B 1K76A 4RMOA 4XU1A 5GMKj 4M77C 2DMOA 2EYWA 1HD3A 3JB9F 3QHRB 1PKTA 5CKBA 4RG8A 5KE3A 1YFNA 1Q7YR 3GIBA 1KFZA 4OF1A 1H24B 2O2OA 3OBYA 2VWFA 3E1SA 5DM7R 1Q82U 1QLBA 2K3BA 3RESA 4C5EA 1CKAA 4JRIA 5GAMf 3QWXX 5CEIB 1S1NA 1IGUA 4BI8B 1Q86C 5KYNA 1UECA 2SRCA 1D0XA 4FT4A 5KCOA 2DRMA 3G71T 1V29B 4MZPA 3JCMJ 3RMSA 4M78C 1YI2T 3QYBA 3EG3A 3L1AA 3PT9A 3V8JA 3C4SA 1A0NB 1M3AA 2WEVB 3C95A 4JUVA 2EWNA 4ZTFA 4BUGA 3A8HB 1M5Q1 2X4YA 1WLPB 3G1JA 4LXCA 4ELYC 1WGSA 5IAYA 3OW2S 3OYHA 4XAXB 4AKGA 1M30A 2PVOB 4M77G 2PZ1A 3MKDA 4YC3B 5GMKh 1FMVA 2NUTB 3L2WA 2WXVB 2HNIA 2W2HA 1VIEA 1O9KB 2L3SA 4F14A 2OJ2A 1B3QA 4M78G 1HK9A 3LGFA 2CZ1B 3NDQA 3RUXA 4HVUA 4PJOC 4F7LB 1TS9A 1K9MU 3BLHB 2KSSA 1MMNA 4C8QG 3CEYA 4II5B 4BCNB 2WSFE 4M78A 4M7DD 2UZDB 2G77A 4M75A 2E64A 4QKUA 3I56T 1OEBA 1QKWA 1I07A 2EFIA 4KUIA 3URGA 1RAGB 1BBZA 1JSUB 2AKLA 2W10A 4OMNA 2OX7A 3CMAA 4JRPA 1QVFA 2FYKA 2DL5A 3JRZA 5AYFA 4B9XA 3GP8A 3A8GB 3G33B 4AMCA 1AD6A 1RI9A 2O01E 3OA6A 3RKXA 5FU6C 2L3QA 3V7SA 5IXBA 4J9FA 1G83A 1Q81C 2EQUA 3G4ST 2O31A 4OMOA 2CP2A 2HEQA 4M7AB 1ZX6A 2CZ6B 4FX3B 4BXXX 1BI0A 1ZSZC 1E6HA 1N4MA 4VUBA 4R56A 2GQIA 2YSQA 4Y72B 5GAOr 2FZKB 2QG9B 1B34A 1AHJB 1BB9A 2VXFA 1AEYA 4X34A 3ULRB 1Q82C 5CCAA 3ZBDA 3X25B 4BDYA 4RTXA 4ZTJA 3EG1A 1X6GA 3CCSA 1Y96A 2PTKA 4MDWA 2HQXA 2DD4B 1QCNA 3QXEB 2EVRA 2LDMA 2JW4A 4PJOF 4CFUB 1LVKA 3TVTA 3TU4K 2JVVA 3OQ5A 4EOKB 4PFZA 3LGLA 3TNHB 3RR6A 1ZA1B 4JX4A 1OULA 1H1PB 1PSFA 2AZSA 4FIBA 3CCST 2XD0A 4OB0B 2JS0A 4BBRM 4HLQA 1EIFA 3JCMX 3JCMW 4XTVA 2WPAB 2CREA 3IQLA 3KXTA 5GAOn 2XK0A 2X3WD 1K1ZA 3EGXB 2VUBA 1SHGA 4QW2A 3DDQB 1MUZA 2OTLA 4F7JB 1YNZA 4CRIA 4J7FA 5CQYA 4UC4A 4O6JA 2E3HA 1OGUB 2KR6A 5GAOl 4J5YA 5CKFA 5GAMd 3MP6A 1UGQB 1SHFA 4HVWA 1OOTA 4ELLA 3TNIB 2HSPA 4J9GA 1OYXA 4GLMA 2LJ3A 4OMMA 4PNOA 1KQSS 2WIPB 5J39A 1PRMC 2P0PA 4MZMA 3RNJA 3UA7A 2CDTA 3DB3A 5HQ0B 2K2VA 1D0YA 2VB6A 1VOLA 1UNHD 4Z02A 3B57A 3J80E 3REBB 4PJJA 1Q95G 1WQ7A 3VUBA 4L59A 1KQ1A 4CC2A 2PUOB 2K5IA 4Z88A 1VYWB 1QP3A 2JJ9A 4M77E 2XMFA 4KUDK 3DDPB 4TTHA 1WHMA 3EFSA 3PIPA 3HBLA 2WSEE 4OMFB 1Q81U 2EGEA 3RBBB 1SG5A 1E7PA 1D09B 2CSQA 2PJQA 2HL3A 4BCQD 4N4GA 3OYMA 2NUZA 2KRMA 1F1BB 2KR3A 1NBEB 2YUPA 3QWYA 5CO7A 3VS3A 3DTOA 1BKBA 3CQTA 3AHUA 2HAXA 3O8VA 4L5GA 1VYVA 5GMKl 4HKEA 4C8QE 5A2QE 1PD1A 3P8BB 5HNBB 3CCEA 1WHJA 1JOWA 1T0HA 4BCND 4M75B 5I2SA 5DLOA 2J6KA 2CSIA 2L0AA 2W9ZA 1VQ4Q 4F6UB 2M0OA 2DX1A 5FW9A 1Y07A 2QQSA 3BLQB 3CCQT 2AIRB 2BE9B 2FVUA 3CC4Q 4IKFA 3TREA 4E7SA 3QHSA 1WYXA 3ZEHA 3EIDB 4AFUC 3SFMA 4TVRA 2QQAA 2DEUA 4FYXB 4M75E 1VQ5T 2LCLA 3DJBA 1NG2A 1SKUB 4V2SA 2A0FB 3JB9I 1N8RU 4EMKC 3EG0A 1M4ZA 2HD0A 8ATCB 5IHYA 3CD6T 1QVFS 2V8JA 5HVYB 3R6OA 1D1BA 4BB7A 3QDFA 3CCRA 2I53A 2CGHA 3POMA 3RMQA 4MFDA 2EJGA 2VGMA 1BI2A 1M2OA 3EJ1B 3CPFA 1Z9ZA 4HL4A 3VYGB 3M59A 4C0FA 3O0GD 4IIMA 1LCKA 2M16A 2JM9A 4BCOB 2KDSA 4M77B 2BZXA 3CPWS 2VASA 3JSCA 1VQKQ 2NUTA 4BY1X 2YWWA 2IVWA 3LWHA 2YRVA 2DVJA 3N5BB 2WJ9A 3MY5B 1Y96B 2MMPA 1WZOA 2EGAA 2F2VA 5A0LA 2QEXQ 1RAIB 4QQ6A 2A08A 1D1CA 1QVPA 2CP7A 1W70A 4A53A 2EYYA 3MY1B 3LH5A 3G71A 1U8RA 4LOCA 3EG2A 3QJYA 2ZZDB 4KRCB 2K4YA 3FJPA 1G3YA 4A63B 1E9HB 1HYOA 2RI5A 4XU0A 4R0KA 4D8DA 3CC2Q 3HB9A 3JCMQ 4XK8E 1QWFA 1UB4A 1UG1A 2LZ6B 4EMGA 3MEAA 1VQLQ 5GAN5 2LTOA 4IUPA 3CC2A 3BDUA 4FM4B 4A54A 4AFQC 3OYJA 1FVVB 5GMKi 4EOPB 1Q7YU 4QQGA 3C0CA 9ATCB 3SWNC 2C5NB 2RK1A 2DXTA 2M1HA 5HKCA 3GBQA 3GOXA 4M7AE 2UUEB 1URCB 1GCQA 4J9CA 1VQMA 1YJNA 3META 2FPEA 3G6ET 2RNAA 3OYCA 3L2QA 2UZBB 3M55A 1UTIA 4CRLB 3DLLA 1H1QB 4JS5A 2XDDA 3QG1A 3A5ZB 2K5LA 1IZ6A 3UA6A 5CVIA 1ENWA 2R57A 5I5ZB 4IUUA 4F7UA 2DEQA 4JZ4A 4EORB 3RKYA 4C92A 2MWOA 1D3BA 1ACMB 2FZGB 2COYA 4BACA 3ZL7C 1IGQA 1YJNT 2BZ8A 5FU6B 1UEBA 2YRCA 5D6YA 5GAMe 1G3TA 1WHKA 2K3XA 3CC7Q 4BI3A 2F69A 4CC3A 2C5XB 1OKVB 1VQMQ 4FYWB 4F17A 2QYZA 4M7DE 5HK3A 1JXMA 1QWEA 1ZBXA 3L42A 4LUDA 1OQKA 1GFDA 2G3RA 1JKWA 4P5NA 1N8RR 4M75D 2ZZDA 4X9DA 1KJWA 4J6YA 2JTEA 1YCSB 2LCCA 1YITQ 3X26B 2EGCA 3EG9B 1NPRA 3WXMB 1VQ9Q 1M2VB 2JZ2A 3ER0A 1G8XA 5DLQE 3OYKA 2W96A 4M7AD 2X1NB 3OS1A 2W99A 3E19A 1YJWQ 1GRIA 1TD6A 2LVMA 1RLPC 4E47A 3BY7A 1N9RA 1RAFB 2ATCB 4AT1B 2GTOA 4WF2A 2DA9A 2VVKA 1ZUKA 1YJWA 2KAFA 2DTOA 2L2PA 4E7KA 5LJ5h 4PJOE 1M1KU 1M3BA 1VQ7A 2CH4A 3MI9B 3FRNA 3VV0A 2V22B 2WMAB 2LRQA 2QK0A 4JJBA 1Q7YC 4F70B 1M90C 2GQVA 2XIDA 4ROCA 5AT1B 4M77D 4F16A 5BNJB 3PO3S 1UFFA 2KK4A 4C8QA 4NS5A 3SHWA 3BDLA 4OMLA 3OMCA 2AK5A 2RJEA 3PMTA 3RGFB 3R6NA 1YJ9Q 4XU3A 1YJ9A 4BCHB 2R58A 3EG9A 5GANj 3TN8B 1D3UB 1VQ9A 5GMKm 1ABOA 4F6SB 2JS2A 3OYIA 3CMET 2D0QB 1TOVA 2QA4T 3I55T 2F1LA 2COZA 2R5AA 1SEMA 5LMKB 2WFYB 3CXCP 4BCFB 1XOVA 2MOXA 4DOVA 4FSXA 4MMLA 3JCMc 3H0IA 4KRDB 4ZGDB 2W9FA 1VQ4A 5DQVA 3QZ5B 3PFSA 2JXBA 2HL5C 4BCIB 3JAME 2MK5A 2CT3A 4KGZB 2DJZA 1OZ2A 2BIVA 2ZAEA 2V8KA 1BYMA 1RI0A 1PNJA 5IN1A 1GXIE 2RK2A 4C8QC 5HY6A 1JBMA 2EQMA 1VQ4T 4BCJB 3S3MA 1KSWA 1QKXA 4RTYA 2DLPA 2YLCA 1UJ0A 1OI1A 2ZPHB 4OB2B 2M9UA 2RA2A 5CYIB 4CFMB 4I3ZB 2RQUA 2CYZB 4C92G 3I35A 2OTJA 2R7GA 5L2WB 4ROEA 3TSZA 4C92B 2GF7A 4E7JA 2RHYA 4E2FB 2ECZA 2ZPFB 3M5AA 2DYIA 1UGPB 1OX9A 2HKNA 1C1AA 3VS4A 4AKIA 5HBEB 3HL8A 4BCQB 3M0TA 3FEOA 3S3NA 3VKIA 5GAOq 3QSUA 3QWLA 1KQ2A 4QQDA 2CJMB 4LDWA 4E7ZA 2CP3A 2E70A 3EGDA 4BE1A 1YI2Q 3CCET 2E3IA 4FW2A 5IDNB 1WIEA 1WJRA 1G5VA 1C0MA 2HDAA 2HQHA 5CQXA 1SF9A 4OGCA 2YHTA 3EFRA 2CCIB 2CKKA 2CZ7B 2I2LA 2P4RA 3PNWC 1B07A 4CFVB 3NPFA 2DPPB 2C6TB 2IVXA 2FRWA 4DOWA 5LJ5d 5CKEA 2RO0A 4PLIA 1B7TA 2EQJA 3G7ZA 3I55A 4KT0E 1KD1C 4DBQA 3DB4A 1VQKA 2W0ZA 1MMDA 4HNUA 1VQ8T 2LP5A 1GH6B 4HT9A 3LW5E 4LDVA 4F04B 6AT1B 1IB8A 1H4LD 3I56Q 1NEBA 2LX9A 3I56A 1FINB 1AZGB 4ZGEB 2I0NA 1U1TA 3E9GA 2X51A 3LLRA 2JMAA 2NUPB 2BUDA 2ED0A 1OL1B 4Y28E 2FHDA 3CD6Q 5LJ3h 2DERA 2BPMB 5LJ3f 2IPOB 4OVAA 3HRTA 1I0CA 1NM7A 4MDXA 1M1GA 4M78E 2RHIA 3L2ZA 3WVEB 4RCCA 1SRMA 8AT1B 3CCQQ 3CCQA 4XTZA 3V8LA 5FU7B 3A8LB 4J6WA 2ROLA 3VKGA 3HP9A 3BFMA 1WQWA 4EPCA 2P0KA 4M7DF 2DKGA 2EQIA 2L8DA 4JS4A 4C5HA 2QTXA 2RN8A 2WMBB 4N0AC 4M78D 4KH1B 5CR2A 1YJNQ 1AWWA 1TSFA 2MIOA 1KQSA 1N6AA 1YITA 2LMJA 1IREB 3H0HA 4ME7A 5GAN8 2F5TX 1NJIC 2HSEB 2A7YA 3V7CA 1K0SA 2PUKB 2LQWA 3TSWA 4KULA 2EKHA 5HBJB 3X28B 5KCHA 1JXOA 4C0DC 1IHWA 3NTIA 4M78F 3CCRT 3T9NA 4F7UG 3MEUA 1M2VA 1W4SA 4CI0C 3BHUB 1AWOA 3OYGA 2M02A 4N0AA 1VQ7Q 3A8OB 3CCMQ 5D6XA 2L89A 1MNEA 1NJIR 1JSTB 3EHRA 5EFQB 2GBQA 3OYBA 4C92D 3CCMA 3RKWA 2JTFA 1Y0MA 2IW9B 2QQ9A 1Q86R 5LJ5j 4RTVA 4FL6A 4AFZC 2PK9B 1M8VA 2OTLQ 2DNUA 4UN0A 4HXJA 4EMKB 1CSKA 1QP2A 4M75C 1AZEA 1WDXA 3HO8A 2YXYA 4A4HA 4Q5WA 2X35A 4ZN3A 4LD9K 1VINA 1OPLA 3QUIA 1YP5A 1OI9B 1NLPC 1UE9A 2GFUA 4C5GA 3QHWB 4YOOA 4A4EA 5ACBA 4J9IA 1JJ2P 2MI6A 2GCXA 3QDRB 2CZ0B 2X4XA 4MZTA 5M9OA 3RIRA 1BK2A 4CXAB 2DE0X 3CC2T 1NE8A 2AHJB 2E5KA 2D8HA 3FC3A 3M53A 2CUBA 3VS0A 3BG3A 4LD6A 2VGNA 2XDPA 2J05A 2E6ZA
chains in the Genus database with same CATH topology
2LQ8A 2PVDB 4JS5A 2XDDA 2RD1A 3QG1A 3QKJA 3A5ZB 2K5LA 2RB6A 2HQEA 2QQBA 1IZ6A 4HNVA 2MAMA 3CBMA 5CVIA 1P92A 3JCMd 3GNFB 2E6NA 4XTXA 3CCJA 3UWNA 4BE0A 1KC8U 2R57A 1KHCA 1O75A 2PU9B 4IUUA 4C92E 4F7UA 1MGQA 2EKOA 1D3BB 2DEQA 3OB9A 2H3JA 3RKYA 3CCLA 1YI2T 2VC8A 4C92A 2MWOA 3G4SA 1D3BA 3HHTB 4PJOA 5GAN3 2KQWA 4PKCC 3M58A 3CPWA 5GMKe 4OB3B 3VYGA 1NPPA 2WSCE 1NZ9A 1XTDA 1K9MC 1VQPT 2QXFA 3VU3C 1VQOA 2RJDA 4BACA 3NTKA 2KMGA 1JRIA 1DJ7B 3CXCA 1XQHA 3GNGA 4J83A 2BS4A 2RJCA 1YJNT 2DD4A 1N27A 3TW6A 1UEBA 5FU6B 2XICA 5D6YA 2BS3A 5GAMe 3CMAT 4M7AA 2QA4A 5EG2A 1G3TA 2L3RA 2BKDN 2K3XA 4JRQA 3JB9J 4OP0A 3HKSA 4MFEA 3F70A 3NFCA 4BI3A 4RMOA 4XU1A 2F69A 5GMKj 4M77C 1XNIA 1YITT 3OMGA 2HBPA 3MEWA 1VQ9T 1Y71A 3JB9F 4M7DE 3V7RA 5HK3A 1ZBXA 5CKBA 4BY6C 3L42A 4RG8A 5KE3A 3VUZA 2G3RA 2E65A 1YIJA 3GIBA 4OF1A 3OBYA 4P5NA 4M75D 2ZZDA 3E1SA 5DM7R 1Q82U 1BI3A 1QLBA 4X9DA 3RESA 1FKMA 4ELZC 1JJ2A 4J6YA 4C5EA 3RERA 4JRIA 5GAMf 3SWNA 4LDXA 2DIGA 1MHNA 2XG8D 4EMKA 1VQPA 2LCCA 1K8AU 3X26B 4M7DA 3M54A 4BI8B 1NPRA 3WXMB 1QVGS 2JZ2A 3ER0A 3OBWA 5GANd 3PTAA 1Q86C 1VQ8A 3MP8A 4FT4A 5KCOA 4E7LA 5DLQE 3OYKA 3QJ6A 4N4IA 3G71T 4M7AD 1V29B 2A3LA 2MF2A 4MZPA 5KE2A 3JCMJ 3CCVT 2E41A 3OYNA 1KC8C 4C92F 1G3WA 3OS1A 3RMSA 3E19A 4M78C 4A4KA 3QYHB 2EQKA 3QYBA 2JN0A 3L1AA 2LVMA 3M56A 1H641 3PT9A 4E47A 4PJOG 3V8JA 3L2QA 2KY9A 3C4SA 4IUTA 3BY7A 1N9RA 1B34B 3C95A 4JUVA 5LJ5g 3VKHA 2EWNA 2QDJA 4WF2A 1I8FA 4ZTFA 4BUGA 3A8HB 1M5Q1 3QO3A 4JLGA 2X4YA 2KAFA 4C0GA 1YJWA 4ELYC 5IAYA 1WGSA 2V8IA 4GLKA 3OW2S 2DTOA 4L6V5 3OYHA 4XAXB 4AKGA 3HZJA 2PVOB 4M77G 5GAMj 4E7KA 1YCYA 2KVQG 4AKHA 5LJ5h 5GMKh 4PJOE 1NJIU 1M1KU 3L2WA 5GANg 3UPUA 4C0ZA 2HNIA 4JDSA 1VQ7A 1VIEA 3FRNA 3VV0A 2MWPA 2LRQA 4RCBA 1YJWT 1Q7YC 2CS7A 4F7UE 1M90C 3MP1A 3WVDB 2GQVA 2DD5A 2XIDA 3DLMA 3CC4T 2QEXA 2D6FA 4ATOA 4M78G 1HK9A 3LGFA 2DTHA 2CZ1B 4M77D 3RUXA 1BIBA 4PJOC 3GPLA 2KK4A 3FIFA 4C8QA 1K9MU 4NS5A 2KSSA 3BDLA 1N9SA 3QIIA 3S6WA 4C8QG 3CEYA 3OMCA 2XU8A 2P4TA 1VQNT 2WSFE 1O9SA 2RJEA 3OYEA 4M78A 2EJFA 4M7DD 3PMTA 2G77A 2LQKA 4JLIA 2E64A 4M75A 1FWZA 4XU3A 2NLUA 2R58A 3TEEA 1YJ9A 3I56T 1JJ2S 4M7AF 5GANj 1VQ9A 5GMKm 3OS5A 3HSBA 3HFNA 4BDZA 3UDCA 2EFIA 3LH0A 2RHZA 4KUIA 4J8OA 3URGA 3OYIA 3CMET 4DA4A 1Y7XA 3OYYA 3OYDA 1SSFA 2D0QB 3J7AF 5HKCA 1VIFA 3CMAA 4JRPA 4ZGJB 1QVFA 2QA4T 3I55T 2FYKA 2OAUA 2ZPGB 1U1SA 2GFAA 2QI2A 3JRZA 2R5AA 3LYIA 5AYFA 4B9XA 3GP8A 3A8GB 4YTLA 2EAYA 3TW7A 3ME9A 5LJ3j 2O01E 1XOVA 4DOVA 3OA6A 1I4K1 3RKXA 5J3BA 1VQOT 2R5MA 4FSXA 5FU6C 3MO8A 1RL2A 4BE2A 4MMLA 3JCMc 4B9WA 3V7SA 4XTYA 2O4XB 4RG2A 2QEXT 2XDBA 1X6OA 4ZGDB 1VQ4A 2RHXA 2VYTA 3MHXA 3QZ5B 3X24B 3NTHA 1Q81C 5EJCA 2EQUA 3PFSA 3FB9A 3G4ST 4PJOB 3JAME 3H4CA 3CC2T 4M7AB 3CCLT 3CCVA 2DJZA 2CZ6B 1OZ2A 1H3ZA 2BIVA 4BY6B 1S72A 1BYMA 2V8KA 2DD5B 1RI0A 1BI0A 2JTMA 2L5QA 5IN1A 2ZPBB 1GXIE 4VUBA 2RK2A 4R56A 4C8QC 1VQ5A 4XQ3A 5HY6A 5GAOr 1JBMA 2EQMA 5GANh 2DIQA 4ELJA 1VQ4T 4ZN1A 3S3MA 3KHIA 5GANf 1B34A 1AHJB 3DKMA 2VV5A 1KHIA 2VXFA 2QFZA 3M57A 3OS0A 1YI2A 5C6SA 4X34A 4HT8A 2YLCA 1LNXA 1Q82C 5CCAA 4MIMA 3ZBDA 3X25B 4BDYA 4ZTJA 4OB1B 1OI1A 2ZPHB 4OB2B 2M9UA 2RA2A 4BD3A 1Y96A 3CCSA 3QBYA 4A4GA 4MDWA 2CYZB 4C92G 3OYLA 2HQXA 2DD4B 3QXEB 3HRSA 2OTJA 2LDMA 3A8MB 3M9QA 4PJOF 4C92B 2GF7A 5FLXE 5FROA 4E7JA 2RHYA 3JB9D 2Y90A 3Q1JA 3TU4K 3OS2A 2JVVA 3OQ5A 2ZPFB 4NC6A 3M5AA 3SDZA 3LGLA 1UGPB 1YHQA 4IUQA 4JX4A 1PSFA 4AKIA 4FIBA 3HL8A 3CCST 4M75F 4OB0B 2XD0A 1VQNA 3FEOA 4BBRM 4HLQA 4II1A 4O5VA 3VKIA 5GAOq 3S3NA 4Y91A 3QSUA 1EIFA 5I2MA 4HT9A 3QWLA 4M7AC 4M7DB 1KQ2A 4QQDA 3JCMX 3JCMW 1ZQ1A 4Z6YA 4LDWA 4XTVA 4QVZA 4QVDA 3KUFA 2RH2A 3KXTA 5GAOn 2XK0A 2DK3A 2E70A 1WJQA 2Y4XA 3INZA 4BE1A 3HRUA 3CCET 1WJRA 2VUBA 2PQWA 5GAN2 4QW2A 3GLXA 3TCJA 1G5VA 5CQXA 2OTLA 4OGEA 5GAMh 3CBOA 4OGCA 2DXBA 2YHTA 3EFRA 4M6VA 4CRIA 4C8QB 4J7FA 5CQYA 4NOYA 4UC4A 2CKKA 4O6JA 1BI1A 5A0DA 3CCMT 2CZ7B 2KR6A 5GAOl 4J5YA 5CKFA 4QVCA 5GAMd 3MP6A 2I2LA 4J7IA 1UGQB 3CCJT 3PNWC 2DAQA 4M78B 1BIAA 4M7AG 2DPPB 4X9CA 3BW1A 4A4FA 4DOWA 5CKHA 4BI4A 5IT9E 1WNLA 4HNTA 1OYXA 5LJ5d 1X75C 2DXBB 5CKEA 2RO0A 4PNOA 4BBSM 4PLIA 4XTUA 1KQSS 2XI9A 2EQJA 3JCMV 5J39A 2P0PA 3G7ZA 4MZMA 1HXDA 3M55A 4KT0E 3I55A 4F7UF 1KD1C 3QYEA 2OTLT 2VXEA 3DB4A 3DB3A 1VQKA 4D6WA 1FXXA 1ZHIA 3JCMh 3CCUT 2K2VA 4HNUA 5CIUA 1VQ8T 3CMEA 3BG9A 4Z02A 4HA8A 2RI3A 3SD4A 3J80E 3OYAA 1M9SA 3GF5A 3JB9H 3QYGB 4PLLA 2KMTA 5LJ3e 3LW5E 4LDVA 5LJ5f 1OZ3A 4C8QF 3QZ9B 4QSHA 1WQ7A 3VUBA 5I21A 4KBMB 1N8RC 4L59A 1R8OB 4AI6A 1KQ1A 2LX9A 2PVGB 4FT2A 3I56A 4ZGEB 1U1TA 2XHCA 4MMKA 3E9GA 3CD6A 2DXCA 4M77A 2PUOB 3LLRA 2E12A 4XU2A 3JCMP 2K5IA 5L8RE 5CKDA 2DO3A 5LL6S 3LWIA 3MCAB 2RI2A 1QP3A 2BUDA 2K3YA 3PGGA 1UGSB 4M77E 3ZFJA 4KUDK 2K5FA 4Y28E 1KD1U 3PIPA 3EFSA 2FHDA 3HBLA 2WSEE 4OMFB 1Q81U 2JNGA 5LJ3h 1E7PA 2ZCFB 2EIFA 5LJ3f 3V8KA 2LC4A 4OVAA 3HRTA 4MDXA 1M1GA 1I5LA 2D9TA 4M78E 2RHIA 3L2ZA 3WVEB 4N4GA 3OYMA 4RCCA 5LJ3g 2WACA 5CO7A 4LDUA 3CCQA 1VQLA 4XTZA 1BKBA 3V8LA 4NL3A 5FU7B 3JCMe 3AHUA 3A8LB 4J6WA 2HAXA 3C12A 1G3SA 3O8VA 1M90U 4L5GA 4M7DG 5GMKl 1QW1A 4HKEA 4GY5A 4C8QE 5A2QE 3P8BB 5GAOm 4C0DB 3S3OA 3JCMb 3CCEA 3VKGA 3X20B 3HP9A 4M75B 3BFMA 3OY9A 1WQWA 5I2SA 4EPCA 5DLOA 3DLLA 1K8AC 2E10A 2P0KA 4DQ2A 1VQ7T 5LJ3d 4M7DF 2DKGA 3OW2A 2ZPEB 4N4HA 2L8DA 2M0OA 4JS4A 1Q86U 1M1FA 1Y07A 2QQSA 4C5HA 4JX6A 4M75G 1W2BA 3CCQT 2E5QA 1LOJA 2QTXA 3EAEA 3BG5A 2FVUA 4LDYA 4IKFA 2K57A 3TREA 2LNVA 3QHSA 1YHQT 2RHUA 4M78D 4N0AC 3ZEHA 2IG0A 4NL2A 4M77F 4EDUA 5CR2A 5GAOp 3SFMA 4M7DC 4JRKA 1FX7A 5FRMA 4TVRA 2QQAA 3JCMg 1KQSA 2F5KA 4M75E 1VQ6T 1N6AA 1YITA 1VQ5T 2LCLA 2JOYA 2DVEA 3ASKA 2X4JA 5GAN4 3JB9G 2DXUA 3L2UA 4V2SA 1IREB 3JB9I 3CCUA 1N8RU 4EMKC 4XTWA 1M4ZA 2HD0A 5HK0A 2C06A 3J81E 3CD6T 4ME7A 5GAN8 1QVFS 2V8JA 3QPHA 3R6OA 4PL6A 2F5TX 3M4GA 4BB7A 3CCRA 1VQMT 1NJIC 1M1KC 3L2RA 2A7YA 2CGHA 3HPWA 3V7CA 3RMQA 1VQ6A 4MFDA 2EJGA 2PUKB 2DZCA 2VGMA 2QDYB 1BI2A 2DTIA 4KULA 3UT1A 2EYQA 5D6WA 3X28B 3CPFA 5KCHA 4C0DC 4HCCA 4HL4A 3VYGB 3LX7A 4JX5A 3M59A 3VJPA 4C92C 3NTIA 4M78F 4C0FA 3CCRT 5LJ5e 1QVGA 2FL7A 1JB0E 4HCBA 3DL1A 2M16A 2BS2A 3KBGA 3T9NA 4F7UG 2KDSA 3MEUA 1K73U 3M4YA 1TH7A 2DXCB 4M77B 1W4SA 5CAIA 3CPWS 3CBPA 3JSCA 4CI0C 2IVWA 2ZPIB 3LWHA 2YRVA 3OYGA 4N0AA 3N5BB 5GANe 2WJ9A 4F7UB 3SWNB 1VUBA 3A8OB 5GAMg 1Y96B 2MMPA 3VYHB 3OSSC 5CK9A 5D6XA 1WJSA 5A0LA 3P8HA 2L89A 5J26A 4J6XA 4QQ6A 2P0QA 2ZGWA 3FLGA 1QVPA 1PSEA 5C0MA 5FRNA 5GAN6 3OYBA 1S72T 4C92D 1VQLT 3CCMA 4A53A 3G71A 3RKWA 2QQRA 1YBYA 2JTFA 1U8RA 1K73C 4LOCA 3QJYA 2QQ9A 5FU7C 2E1HA 4FU6A 5LJ5j 2FB7A 2ZZDB 4R55A 3HFOA 1WPYA 3PIOA 2K4YA 3FJPA 1G3YA 4FL6A 2LT1A 1M8VA 2LT4A 2RI5A 2RJFA 4XU0A 3SB2A 3MEVA 4EMKB 1KG1A 4E7HA 1QP2A 4M75C 3CXCS 2OTJT 4JJNK 2EJ9A 3HB9A 3G6EA 3JCMQ 3HO8A 4XK8E 2QF7A 4A4HA 4Q5WA 2X35A 1UB4A 4ZN3A 2XKOC 1X01A 3PMIA 4EMGA 3MEAA 5GAN5 1YIJT 3OYFA 3QUIA 4IURA 4LD9K 2JUFA 2LTOA 2DZ9A 4IUPA 3CC2A 3BDUA 2GFUA 4C5GA 4EMHA 2YLBA 5KH6A 4PJOD 4FM4B 1LJOA 4A54A 3OYJA 3FDRA 5GMKi 4A4EA 4C8QD 3CC7A 1Q7YU 4E7IA 3CC7T 4QQGA 2MI6A 2GCXA 3QDRB 2CZ0B 5GAN7 2X4XA 4MZTA 3CC4A 3SWNC 5M9OA 2DXTA 2M1HA 2O4XA 2RK1A 1UGRB 3RIRA 1I81A 4IUVA 3JCMf 2RM4A 3GOXA 1YJ9T 4HCZA 1VQMA 1NE8A 3P8DA 1VQKT 3OSVA 4C5IA 4M7AE 4RKUE 2X4WA 1W2BS 2AHJB 3C94A 3E9FA 3H6ZA 3META 5A0GA 3FC3A 3M53A 1YJNA 3G6ET 3OYCA 3BG3A 3L2VA 2B8AA 4LD6A 2VGNA 5DY9A 2Y4YA 2XDPA 3H8ZA 2QQ8A 2E6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVD B;  3WVD B;  2DD5 A;  2CZ1 B;  2PU9 B;  1IRE B;  2DXB A;  2WSF E;  2CZ7 B;  3HHT B;  1UGQ B;  4OB3 B;  2PUK B;  3VYG A;  2QDY B;  2WSC E;  2DPP B;  3X28 B;  3VYG B;  1DJ7 B;  2D0Q B;  2DXB B;  1JB0 E;  4ZGJ B;  2ZPG B;  2DD4 A;  4KT0 E;  2DXC B;  3A8G B;  2O01 E;  2ZPI B;  3QYG B;  3A8O B;  3LW5 E;  3VYH B;  4ZGD B;  3QZ9 B;  3QZ5 B;  3X24 B;  2PVG B;  4ZGE B;  1PSE A;  2DXC A;  2PUO B;  5L8R E;  2CZ6 B;  2ZZD A;  1QP3 A;  2DD5 B;  1GXI E;  2ZPB B;  1UGS B;  4Y28 E;  2ZZD B;  2WSE E;  3X26 B;  2ZCF B;  1AHJ B;  1QP2 A;  4XK8 E;  3WVE B;  1V29 B;  3X25 B;  4OB1 B;  2ZPH B;  4OB2 B;  3A8L B;  3QYH B;  2CYZ B;  2DD4 B;  3QXE B;  4FM4 B;  3A8M B;  3X20 B;  3A8H B;  2ZPF B;  2CZ0 B;  1UGP B;  4L6V 5;  1UGR B;  1PSF A;  2PVO B;  2ZPE B;  4OB0 B;  4RKU E;  2AHJ B; 
#chains in the Genus database with same CATH topology
 2LQ8 A;  2G9X B;  1OU9 A;  2RD1 A;  2C0O A;  2HQE A;  2RMO A;  2ABL A;  2DL3 A;  2GNC A;  3CBM A;  2GTJ A;  4HVV A;  1YN8 A;  3GNF B;  2E6N A;  3CCJ A;  1PKS A;  3UWN A;  4BE0 A;  5IHK A;  1RUW A;  2PU9 B;  1QCO A;  1BU2 A;  1QMZ B;  3OB9 A;  2FZC B;  2RQV A;  5GJV B;  2VC8 A;  1K0X A;  3M58 A;  2F2X A;  3HTR A;  2KT1 A;  3VYG A;  2WSC E;  1NZ9 A;  2SEM A;  1VYU A;  2QXF A;  1TUG B;  1ZP2 A;  2RJD A;  2KMG A;  1XQH A;  1U3O A;  1H27 B;  4EC8 B;  2RJC A;  4ROD A;  2F2C A;  3TW6 A;  2XIC A;  2AZV A;  1VQ5 Q;  2L3R A;  3JB9 J;  4OP0 A;  5DQW A;  1QVG P;  4MFE A;  1YIT T;  1QQJ A;  3MEW A;  1VQ9 T;  1Y71 A;  4AG1 C;  4BCP B;  2KYM A;  3VUZ A;  2IW6 B;  1BU1 A;  2O9V A;  1BI3 A;  1JJ2 A;  3SWN A;  2DIG A;  1MHN A;  4EMK A;  2K9G A;  1VQP A;  4LE9 A;  5GAN d;  1VQ8 A;  4PFO A;  3I9Q A;  1I1J A;  2ROT A;  4N4I A;  2C5V B;  2A3L A;  2MF2 A;  3CCV T;  2E41 A;  3OYN A;  1W2B P;  1KC8 C;  2KXC A;  4C92 F;  1X27 A;  4A4K A;  3QYH B;  2EQK A;  2JN0 A;  1H64 1;  3OW2 P;  3I55 Q;  3A1P A;  1H3H A;  4WCI A;  3VKH A;  2QDJ A;  1I8F A;  1X43 A;  2EBP A;  4JLG A;  4C0G A;  4BCG B;  2V8I A;  4GLK A;  5KYU B;  5IHI A;  3M0Q A;  1YCY A;  2KVQ G;  1RAB B;  2PHG A;  5GAN g;  4CFW B;  4JDS A;  2DF6 A;  5ICP B;  1P5E B;  1MV3 A;  2FPD A;  2MWP A;  4RCB A;  1YJW T;  3CC4 T;  2D6F A;  2QEX A;  2CUD A;  2QDL A;  3GPL A;  2V26 A;  2KXD A;  2HZY A;  2KEA A;  4YOZ A;  3EHQ A;  3FIF A;  3S6W A;  1N9S A;  3BHV B;  4BCM B;  2XU8 A;  1VQN T;  3GTM S;  1O9S A;  4GBQ A;  3TEE A;  2NLU A;  3I5R A;  5KYX B;  1YWO A;  1V1C A;  4BDZ A;  3LH0 A;  4J8O A;  4DA4 A;  1Y7X A;  3OYD A;  5GJW B;  4F6W B;  4ZGJ B;  2OAU A;  2ZPG B;  2M51 A;  2QI2 A;  1WFW A;  4YTL A;  1OKW B;  2EAY A;  1KQS P;  3ME9 A;  2K7A A;  1I4K 1;  2MCN A;  1VQO T;  4EOJ B;  2R5M A;  4BE2 A;  1XJW B;  3MO8 A;  1OPK A;  4ANJ A;  4XTY A;  2O4X B;  2VYT A;  2PMI B;  3MHX A;  3X24 B;  3NTH A;  3CME Q;  4RTU A;  3VS6 A;  4J9E A;  5IF1 B;  3CCL T;  3CCV A;  2OI3 A;  1S72 Q;  1S72 A;  4BY6 B;  3VRZ A;  2DD5 B;  2JTM A;  4DEY A;  2L5Q A;  3A98 A;  4PK4 A;  2WHB B;  2WIH B;  4XQ3 A;  2DIQ A;  4ELJ A;  1E6G A;  4ZN1 A;  4QT7 A;  5GAN f;  2VV5 A;  1KHI A;  2QFZ A;  1YI2 A;  5C6S A;  2YUN A;  4HT8 A;  1UHF A;  4MIM A;  1T3S A;  3BHT B;  4IIO A;  1H92 A;  4OB1 B;  2F2W A;  2J06 A;  2L3P A;  4BD3 A;  3M03 A;  3QBY A;  3OYL A;  4F7S B;  2YUQ A;  2DJQ A;  5FLX E;  1M3C A;  2Y90 A;  3OS2 A;  1FYN A;  1PHT A;  2DBM A;  3SDZ A;  1YHQ A;  4IUQ A;  1PCX A;  4PJM A;  2ESW A;  4J9D A;  2H8H A;  4M75 F;  1VQN A;  3M0R A;  3CPW P;  1ARK A;  4Y91 A;  1WI7 A;  1EZZ B;  1PKD B;  4RTW A;  2I40 B;  4B6M A;  1ZSZ B;  1WJQ A;  3INZ A;  2ED1 A;  2RQR A;  3HRU A;  2PQW A;  5GAN 2;  1PC0 A;  2UZE B;  4YOS A;  1VOM A;  4CC7 A;  4OGE A;  5GAM h;  2IW8 B;  4M6V A;  1ZA2 B;  4JZ3 A;  4C8Q B;  1D0Z A;  4NOY A;  3CCM T;  1BI1 A;  1R77 A;  1AOJ A;  4QVC A;  2BE7 D;  1K8A R;  4HCK A;  1SRL A;  4M78 B;  1WHL A;  2D1X A;  3BW1 A;  5IT9 E;  5FGK B;  4BI4 A;  2DET A;  3CCE Q;  2B9R A;  4XTU A;  2XI9 A;  2ENM A;  3QYE A;  2OTL T;  4DBH A;  1AWX A;  1FXX A;  1U5S A;  1ZHI A;  2EYZ A;  3JCM h;  3EH1 A;  3CCU T;  5CIU A;  5HCK A;  3BG9 A;  3OYA A;  3SD4 A;  2P84 A;  1M9S A;  3QYG B;  4PLL A;  4D8K A;  5LJ5 f;  1OZ3 A;  1TUC A;  4QSH A;  4AI6 A;  2PVG B;  4FT2 A;  4KH0 B;  1VA7 A;  2XHC A;  2Z0W A;  4MMK A;  2DXC A;  2E12 A;  4XU2 A;  5L8R E;  1GBQ A;  5CKD A;  2DO3 A;  5LL6 S;  3LWI A;  3MCA B;  2O9S A;  2K3Y A;  3VS7 A;  1NLO C;  1KD1 U;  4E6R A;  1OU8 A;  2JNG A;  4LUE A;  2ZCF B;  2EIF A;  2LC4 A;  2RQW A;  1H1S B;  2D9T A;  2DM1 A;  4DEX A;  3CCV Q;  3PVL A;  2J6F A;  4LDU A;  1K9M R;  3C12 A;  1G3S A;  1QW1 A;  5KYY B;  1WHG A;  4GY5 A;  3S3O A;  3JCM b;  2X9H A;  2AT1 B;  4BCM D;  3X20 B;  3OY9 A;  3SEM A;  2E10 A;  1VQ7 T;  2K2M A;  2VKN A;  2QAZ A;  2ZPE B;  2FEI A;  3E2U A;  2FRY A;  1IXD A;  2CP5 A;  4JX6 A;  4EOQ B;  1W2B A;  5EC7 A;  1PG5 B;  1LOJ A;  2JMC A;  3EAE A;  3BG5 A;  4LDY A;  1YHQ T;  1RAC B;  5FWC A;  4M7D C;  5I22 A;  1FX7 A;  1WA7 A;  2F5K A;  3CCR Q;  1VQ6 T;  2JOY A;  1BCM A;  2X4J A;  5GAN 4;  2DXU A;  3L2U A;  2EYX A;  4LN2 A;  3H41 A;  5HK0 A;  2LW4 A;  4PL6 A;  2DME A;  1IRX A;  3LQ5 B;  3HPW A;  3PVQ A;  2RPN A;  2QDY B;  2DTI A;  2OAW A;  1TWB A;  3H9N A;  2LJ1 A;  4HCC A;  4EOI B;  2A36 A;  2FL7 A;  1TG0 A;  4HCB A;  2BS2 A;  3KBG A;  1TH7 A;  5KYY A;  2QA4 Q;  1GBR A;  3CBP A;  2HBW A;  5GAN e;  4F7U B;  3SWN B;  1VUB A;  3OSS C;  2DRK A;  1WJS A;  2CP6 A;  2H3E B;  5J26 A;  2ZGW A;  3FLG A;  4PJN A;  5C0M A;  1AIS B;  5GAN 6;  1S72 T;  2PNI A;  4OMQ A;  2BKZ B;  3VRY A;  1K73 C;  1YBY A;  1H28 B;  1UJY A;  5FU7 C;  4WTO B;  4R55 A;  3PIO A;  1ZSG A;  4F7N B;  2RJF A;  3MIA B;  3SB2 A;  2JM8 A;  3U23 A;  1VQ8 Q;  5ECA A;  4E7H A;  4JJN K;  2EJ9 A;  3G6E A;  4FCY A;  2QF7 A;  1VQP Q;  3OYF A;  4IUR A;  2JUF A;  1RAA B;  3AT1 B;  4PJO D;  5KH6 A;  2C5O B;  3FDR A;  5D7U A;  4C8Q D;  3CC7 A;  1NYG A;  1VYT A;  4E7I A;  1G3N C;  2D8J A;  5IH2 A;  1UGR B;  1I81 A;  1I5O B;  4IUV A;  3JCM f;  2J6O A;  2RF0 A;  4C5I A;  1UGV A;  4Z8A A;  2X4W A;  1OL2 B;  3E9F A;  5A0G A;  3H6Z A;  3NMZ C;  2B8A A;  1YIJ Q;  1AD5 A;  1Z9Q A;  1PWT A;  2Y4Y A;  1VQ5 A;  2PVD B;  3MPU B;  2RB6 A;  2MAM A;  1P92 A;  4FYV B;  1ZSZ A;  1KK7 A;  1MGQ A;  1D3B B;  4KRT A;  3CCL A;  2CCH B;  4PJO A;  1ZLM A;  2YRD A;  5GAN 3;  3G71 Q;  4PKC C;  3CPW A;  4OB3 B;  4J9B A;  3UF4 A;  1XTD A;  1K9M C;  3CCL Q;  1K4U S;  2IN3 A;  1QMC A;  1JO8 A;  3NTK A;  1JRI A;  3CXC A;  1DJ7 B;  4BY7 X;  3GNG A;  4J83 A;  2BS4 A;  2DD4 A;  2C0I A;  3CMA T;  2BS3 A;  3RDV A;  5EG2 A;  2BKD N;  4JRQ A;  2KT8 A;  3HKS A;  3F70 A;  4EOO B;  3NFC A;  1XNI A;  3OMG A;  2HBP A;  4EC9 B;  1JU5 C;  3V7R A;  3THK A;  3REA B;  3BLR B;  4BY6 C;  5KYW A;  1IO6 A;  2E65 A;  3PE0 A;  2PK2 A;  4PFP A;  1YIJ A;  4KGX B;  4ELZ C;  1FKM A;  3RER A;  4LDX A;  2XG8 D;  1H25 B;  1K8A U;  1GL5 A;  5KYX A;  4M7D A;  3M54 A;  1QVG S;  3OBW A;  3PTA A;  3MP8 A;  1TFB A;  4E7L A;  3QJ6 A;  5KE2 A;  4OGR B;  2MPX C;  1F5Q B;  3FJ5 A;  1G3W A;  1EX4 A;  1Y57 A;  4RUG A;  3M56 A;  3DOG B;  4PJO G;  2DYB A;  2KY9 A;  4IUT A;  1B34 B;  5LJ5 g;  4EOL B;  3QO3 A;  4L6V 5;  2JGZ B;  4EOM B;  3HZJ A;  5GAM j;  4AKH A;  1UDL A;  2DL7 A;  1VQN Q;  1NJI U;  2DL8 A;  3UPU A;  4C0Z A;  1AWJ A;  1V76 A;  2LX7 A;  1YHQ Q;  2YDL A;  1H26 B;  2CS7 A;  4F7U E;  3MP1 A;  3WVD B;  3DLM A;  2DD5 A;  4ATO A;  2YT6 A;  2DTH A;  1BIB A;  5KYU A;  1X2K A;  1GUX B;  1GCP A;  3QII A;  1GY3 B;  3H0F A;  1MMG A;  2P4T A;  1QVF P;  3OYE A;  2CH4 W;  2COW A;  2EJF A;  2OTJ Q;  2LQK A;  4JLI A;  1FWZ A;  1N5Z A;  1TTH B;  1VQO Q;  1WXB A;  1Q81 R;  1JJ2 S;  1OIU B;  1PRL C;  2RQT A;  4M7A F;  3OS5 A;  3HSB A;  3HFN A;  1HJD A;  1Q82 R;  3UDC A;  1OX8 A;  2RHZ A;  2K79 A;  3OYY A;  5IHN A;  4PJL A;  1SSF A;  3J7A F;  4EON B;  1VIF A;  2BTT A;  1U1S A;  2GFA A;  3LYI A;  1M90 R;  2V1Q A;  3TW7 A;  5LJ3 j;  3D7S B;  3CCS Q;  1RAD B;  5J3B A;  3NGP A;  1RL2 A;  4B9W A;  4G6L B;  2QEX T;  2UZL B;  4RG2 A;  2XDB A;  1X6O A;  1X69 A;  1H1R B;  2RHX A;  5EJC A;  1JQQ A;  2JT4 A;  1H8K A;  3FB9 A;  4PJO B;  1PM3 A;  3H4C A;  5FWB A;  2KNB B;  4FW1 A;  1H3Z A;  2O88 A;  2IIM A;  4FSS A;  1M27 C;  2ZPB B;  1EFN A;  5IXF A;  5GAN h;  2QAS A;  1GUX A;  3KHI A;  1K9A A;  4J9H A;  1KC8 R;  1T0J A;  3DKM A;  3OS0 A;  3M57 A;  4Y92 A;  1SPK A;  1LNX A;  4Z89 A;  5HBH B;  3G4S Q;  1RAH B;  1RLQ C;  1J3T A;  4A4G A;  2BZY A;  3HRS A;  1WX6 A;  3A8M B;  3M9Q A;  2CT4 A;  1RAE B;  2A28 A;  2G6F X;  2QGF B;  5FRO A;  3M0S A;  3JB9 D;  3Q1J A;  3CCU Q;  2MYS A;  3EOC B;  3TNW B;  4NC6 A;  1K73 R;  1SSH A;  1D1A A;  1MMA A;  3JV3 A;  4O5V A;  4II1 A;  4M4Z A;  3EH2 A;  5I2M A;  1JEG A;  4M7A C;  4M7D B;  4Z6Y A;  1FMK A;  1ZQ1 A;  4QVD A;  4QVZ A;  2LNH B;  3KUF A;  1XO2 A;  2RH2 A;  4FYY B;  3KFV A;  2DK3 A;  2Y4X A;  4OMP A;  2E4H A;  4ORZ A;  3GLX A;  3TCJ A;  1UUE A;  3CBO A;  2DXB A;  1ZBJ A;  4DBF A;  5A0D A;  4RTZ A;  1AVZ C;  4J7I A;  5LQF B;  3CCJ T;  1T3L A;  2DAQ A;  1WXT A;  4DBR A;  1BIA A;  4M7A G;  4X9C A;  3VS2 A;  4JPB W;  4A4F A;  5CKH A;  1WNL A;  4HNT A;  2EPD A;  1X75 C;  2DXB B;  1TUD A;  4BBS M;  3CMA Q;  3JCM V;  1X6B A;  1KXU A;  1HXD A;  4F7U F;  2VXE A;  1LPL A;  4D6W A;  3O5Z A;  3CME A;  4HA8 A;  2RI3 A;  3JB9 H;  2FPF A;  3GF5 A;  2KMT A;  1QCF A;  5LJ3 e;  4CFN B;  1TXQ A;  4C8Q F;  3QZ9 B;  1N8R C;  5I21 A;  4KBM B;  2EUF A;  1R8O B;  2NUP A;  2DBK A;  3CD6 A;  4M77 A;  1W98 B;  1O9K A;  3JCM P;  2LCS A;  2DFU A;  2RI2 A;  4JJC A;  3PGG A;  4OR5 B;  1UGS B;  3ZFJ A;  2K5F A;  3EFO A;  1YWP A;  4LNP A;  1QLY A;  2KI7 A;  3TQ7 P;  3V8K A;  4NST B;  2KGT A;  1G2B A;  1I5L A;  1GFC A;  3EGD B;  2CP0 A;  2HKQ B;  5LJ3 g;  2WAC A;  1VQL A;  3EGU A;  2M0Y A;  4NL3 A;  3JCM e;  1ABQ A;  1M90 U;  4M7D G;  1OV3 A;  5GAO m;  4CFX B;  4C0D B;  1C9B A;  2FG0 A;  1K8A C;  4DQ2 A;  5LJ3 d;  3OW2 A;  4K11 A;  4N4H A;  3M0U A;  1Q86 U;  1M1F A;  2J7I A;  2B86 A;  4M75 G;  2E5Q A;  2K57 A;  2LNV A;  2KRN A;  1R0B G;  2RHU A;  2IG0 A;  4NL2 A;  4M77 F;  4EDU A;  5GAO p;  4JRK A;  5FRM A;  2D0N A;  3JCM g;  1NYF A;  3VS5 A;  2DVE A;  3ASK A;  3JB9 G;  4CC4 B;  4EOS B;  3CCU A;  1AT1 B;  1C6V X;  1FMW A;  1ZUY A;  2HCK A;  4XTW A;  2C06 A;  4ESR A;  3J81 E;  1PD0 A;  2DIL A;  3QPH A;  1VQM T;  1M1K C;  3M4G A;  3L2R A;  2DL4 A;  1R0C B;  1VQ6 A;  5I11 A;  2V1R A;  2DZC A;  1NEG A;  3UT1 A;  3NHN A;  1WHH A;  2EYQ A;  5D6W A;  3LX7 A;  4C92 C;  1UHC A;  4JX5 A;  2AKK A;  2HMA A;  3VJP A;  2LQN A;  5LJ5 e;  1VQ6 Q;  1QVG A;  1JB0 E;  3DL1 A;  1K73 U;  1E7O A;  3M4Y A;  2DXC B;  1U06 A;  2NWM A;  5CAI A;  7AT1 B;  2ZPI B;  1GCQ C;  5IDP B;  3G6E Q;  5GAM g;  3VYH B;  5CK9 A;  2FO0 A;  3P8H A;  1ZUU A;  4J6X A;  2P0Q A;  1OIY B;  1CKB A;  1X2Q A;  1M1K R;  1PSE A;  5FRN A;  4BCK B;  1BCO A;  1VQL T;  2KRS A;  2QQR A;  2E1H A;  1HSQ A;  4FU6 A;  2FB7 A;  3HFO A;  1WPY A;  3EGX A;  1W6X A;  3K7A M;  2LT1 A;  2LT4 A;  2QGG A;  3MJX A;  3MEV A;  1IHV A;  1KG1 A;  3CXC S;  5L23 A;  2QTV A;  3VS1 A;  4EIK A;  2NYS A;  3F5X B;  2KE9 A;  1UNL D;  2XKO C;  1X01 A;  3PMI A;  3M0P A;  4ZNX A;  1YIJ T;  1KIK A;  2DZ9 A;  4EMH A;  2YLB A;  1LJO A;  2KRO A;  2A37 A;  3CC7 T;  1WXU A;  4KGV B;  1UNG D;  5GAN 7;  3CC4 A;  4JJD A;  2EW3 A;  2O4X A;  2OTJ T;  1YJ9 T;  2RM4 A;  1VQK T;  4HCZ A;  3P8D A;  3OSV A;  4RKU E;  5KYW B;  1W2B S;  3C94 A;  2C4G B;  2K6D A;  3L2V A;  5DY9 A;  3H8Z A;  2QQ8 A;  2QGS A;  2KYB A;  3QKJ A;  3UAT A;  4RTT A;  2QQB A;  4HNV A;  3JCM d;  2KBT A;  4XTX A;  1KC8 U;  1TU0 B;  1KHC A;  1O75 A;  4C92 E;  3BE3 A;  1MND A;  2EKO A;  2H3J A;  4CFU D;  2X3X D;  3G4S A;  4X1V A;  3CCJ Q;  3HHT B;  2KQW A;  4AFS C;  5GMK e;  3I5S A;  1NPP A;  1W1F A;  2LJ0 A;  2C0T A;  2YUO A;  1VQP T;  1KD1 R;  2GGR A;  3EFO B;  3VU3 C;  1VQO A;  1M8M A;  4AG2 C;  4IMY B;  1N27 A;  4M7A A;  2QA4 A;  1MV0 B;  1K76 A;  4RMO A;  4XU1 A;  5GMK j;  4M77 C;  2DMO A;  2EYW A;  1HD3 A;  3JB9 F;  3QHR B;  1PKT A;  5CKB A;  4RG8 A;  5KE3 A;  1YFN A;  1Q7Y R;  3GIB A;  1KFZ A;  4OF1 A;  1H24 B;  2O2O A;  3OBY A;  2VWF A;  3E1S A;  5DM7 R;  1Q82 U;  1QLB A;  2K3B A;  3RES A;  4C5E A;  1CKA A;  4JRI A;  5GAM f;  3QWX X;  5CEI B;  1S1N A;  1IGU A;  4BI8 B;  1Q86 C;  5KYN A;  1UEC A;  2SRC A;  1D0X A;  4FT4 A;  5KCO A;  2DRM A;  3G71 T;  1V29 B;  4MZP A;  3JCM J;  3RMS A;  4M78 C;  1YI2 T;  3QYB A;  3EG3 A;  3L1A A;  3PT9 A;  3V8J A;  3C4S A;  1A0N B;  1M3A A;  2WEV B;  3C95 A;  4JUV A;  2EWN A;  4ZTF A;  4BUG A;  3A8H B;  1M5Q 1;  2X4Y A;  1WLP B;  3G1J A;  4LXC A;  4ELY C;  1WGS A;  5IAY A;  3OW2 S;  3OYH A;  4XAX B;  4AKG A;  1M30 A;  2PVO B;  4M77 G;  2PZ1 A;  3MKD A;  4YC3 B;  5GMK h;  1FMV A;  2NUT B;  3L2W A;  2WXV B;  2HNI A;  2W2H A;  1VIE A;  1O9K B;  2L3S A;  4F14 A;  2OJ2 A;  1B3Q A;  4M78 G;  1HK9 A;  3LGF A;  2CZ1 B;  3NDQ A;  3RUX A;  4HVU A;  4PJO C;  4F7L B;  1TS9 A;  1K9M U;  3BLH B;  2KSS A;  1MMN A;  4C8Q G;  3CEY A;  4II5 B;  4BCN B;  2WSF E;  4M78 A;  4M7D D;  2UZD B;  2G77 A;  4M75 A;  2E64 A;  4QKU A;  3I56 T;  1OEB A;  1QKW A;  1I07 A;  2EFI A;  4KUI A;  3URG A;  1RAG B;  1BBZ A;  1JSU B;  2AKL A;  2W10 A;  4OMN A;  2OX7 A;  3CMA A;  4JRP A;  1QVF A;  2FYK A;  2DL5 A;  3JRZ A;  5AYF A;  4B9X A;  3GP8 A;  3A8G B;  3G33 B;  4AMC A;  1AD6 A;  1RI9 A;  2O01 E;  3OA6 A;  3RKX A;  5FU6 C;  2L3Q A;  3V7S A;  5IXB A;  4J9F A;  1G83 A;  1Q81 C;  2EQU A;  3G4S T;  2O31 A;  4OMO A;  2CP2 A;  2HEQ A;  4M7A B;  1ZX6 A;  2CZ6 B;  4FX3 B;  4BXX X;  1BI0 A;  1ZSZ C;  1E6H A;  1N4M A;  4VUB A;  4R56 A;  2GQI A;  2YSQ A;  4Y72 B;  5GAO r;  2FZK B;  2QG9 B;  1B34 A;  1AHJ B;  1BB9 A;  2VXF A;  1AEY A;  4X34 A;  3ULR B;  1Q82 C;  5CCA A;  3ZBD A;  3X25 B;  4BDY A;  4RTX A;  4ZTJ A;  3EG1 A;  1X6G A;  3CCS A;  1Y96 A;  2PTK A;  4MDW A;  2HQX A;  2DD4 B;  1QCN A;  3QXE B;  2EVR A;  2LDM A;  2JW4 A;  4PJO F;  4CFU B;  1LVK A;  3TVT A;  3TU4 K;  2JVV A;  3OQ5 A;  4EOK B;  4PFZ A;  3LGL A;  3TNH B;  3RR6 A;  1ZA1 B;  4JX4 A;  1OUL A;  1H1P B;  1PSF A;  2AZS A;  4FIB A;  3CCS T;  2XD0 A;  4OB0 B;  2JS0 A;  4BBR M;  4HLQ A;  1EIF A;  3JCM X;  3JCM W;  4XTV A;  2WPA B;  2CRE A;  3IQL A;  3KXT A;  5GAO n;  2XK0 A;  2X3W D;  1K1Z A;  3EGX B;  2VUB A;  1SHG A;  4QW2 A;  3DDQ B;  1MUZ A;  2OTL A;  4F7J B;  1YNZ A;  4CRI A;  4J7F A;  5CQY A;  4UC4 A;  4O6J A;  2E3H A;  1OGU B;  2KR6 A;  5GAO l;  4J5Y A;  5CKF A;  5GAM d;  3MP6 A;  1UGQ B;  1SHF A;  4HVW A;  1OOT A;  4ELL A;  3TNI B;  2HSP A;  4J9G A;  1OYX A;  4GLM A;  2LJ3 A;  4OMM A;  4PNO A;  1KQS S;  2WIP B;  5J39 A;  1PRM C;  2P0P A;  4MZM A;  3RNJ A;  3UA7 A;  2CDT A;  3DB3 A;  5HQ0 B;  2K2V A;  1D0Y A;  2VB6 A;  1VOL A;  1UNH D;  4Z02 A;  3B57 A;  3J80 E;  3REB B;  4PJJ A;  1Q95 G;  1WQ7 A;  3VUB A;  4L59 A;  1KQ1 A;  4CC2 A;  2PUO B;  2K5I A;  4Z88 A;  1VYW B;  1QP3 A;  2JJ9 A;  4M77 E;  2XMF A;  4KUD K;  3DDP B;  4TTH A;  1WHM A;  3EFS A;  3PIP A;  3HBL A;  2WSE E;  4OMF B;  1Q81 U;  2EGE A;  3RBB B;  1SG5 A;  1E7P A;  1D09 B;  2CSQ A;  2PJQ A;  2HL3 A;  4BCQ D;  4N4G A;  3OYM A;  2NUZ A;  2KRM A;  1F1B B;  2KR3 A;  1NBE B;  2YUP A;  3QWY A;  5CO7 A;  3VS3 A;  3DTO A;  1BKB A;  3CQT A;  3AHU A;  2HAX A;  3O8V A;  4L5G A;  1VYV A;  5GMK l;  4HKE A;  4C8Q E;  5A2Q E;  1PD1 A;  3P8B B;  5HNB B;  3CCE A;  1WHJ A;  1JOW A;  1T0H A;  4BCN D;  4M75 B;  5I2S A;  5DLO A;  2J6K A;  2CSI A;  2L0A A;  2W9Z A;  1VQ4 Q;  4F6U B;  2M0O A;  2DX1 A;  5FW9 A;  1Y07 A;  2QQS A;  3BLQ B;  3CCQ T;  2AIR B;  2BE9 B;  2FVU A;  3CC4 Q;  4IKF A;  3TRE A;  4E7S A;  3QHS A;  1WYX A;  3ZEH A;  3EID B;  4AFU C;  3SFM A;  4TVR A;  2QQA A;  2DEU A;  4FYX B;  4M75 E;  1VQ5 T;  2LCL A;  3DJB A;  1NG2 A;  1SKU B;  4V2S A;  2A0F B;  3JB9 I;  1N8R U;  4EMK C;  3EG0 A;  1M4Z A;  2HD0 A;  8ATC B;  5IHY A;  3CD6 T;  1QVF S;  2V8J A;  5HVY B;  3R6O A;  1D1B A;  4BB7 A;  3QDF A;  3CCR A;  2I53 A;  2CGH A;  3POM A;  3RMQ A;  4MFD A;  2EJG A;  2VGM A;  1BI2 A;  1M2O A;  3EJ1 B;  3CPF A;  1Z9Z A;  4HL4 A;  3VYG B;  3M59 A;  4C0F A;  3O0G D;  4IIM A;  1LCK A;  2M16 A;  2JM9 A;  4BCO B;  2KDS A;  4M77 B;  2BZX A;  3CPW S;  2VAS A;  3JSC A;  1VQK Q;  2NUT A;  4BY1 X;  2YWW A;  2IVW A;  3LWH A;  2YRV A;  2DVJ A;  3N5B B;  2WJ9 A;  3MY5 B;  1Y96 B;  2MMP A;  1WZO A;  2EGA A;  2F2V A;  5A0L A;  2QEX Q;  1RAI B;  4QQ6 A;  2A08 A;  1D1C A;  1QVP A;  2CP7 A;  1W70 A;  4A53 A;  2EYY A;  3MY1 B;  3LH5 A;  3G71 A;  1U8R A;  4LOC A;  3EG2 A;  3QJY A;  2ZZD B;  4KRC B;  2K4Y A;  3FJP A;  1G3Y A;  4A63 B;  1E9H B;  1HYO A;  2RI5 A;  4XU0 A;  4R0K A;  4D8D A;  3CC2 Q;  3HB9 A;  3JCM Q;  4XK8 E;  1QWF A;  1UB4 A;  1UG1 A;  2LZ6 B;  4EMG A;  3MEA A;  1VQL Q;  5GAN 5;  2LTO A;  4IUP A;  3CC2 A;  3BDU A;  4FM4 B;  4A54 A;  4AFQ C;  3OYJ A;  1FVV B;  5GMK i;  4EOP B;  1Q7Y U;  4QQG A;  3C0C A;  9ATC B;  3SWN C;  2C5N B;  2RK1 A;  2DXT A;  2M1H A;  5HKC A;  3GBQ A;  3GOX A;  4M7A E;  2UUE B;  1URC B;  1GCQ A;  4J9C A;  1VQM A;  1YJN A;  3MET A;  2FPE A;  3G6E T;  2RNA A;  3OYC A;  3L2Q A;  2UZB B;  3M55 A;  1UTI A;  4CRL B;  3DLL A;  1H1Q B;  4JS5 A;  2XDD A;  3QG1 A;  3A5Z B;  2K5L A;  1IZ6 A;  3UA6 A;  5CVI A;  1ENW A;  2R57 A;  5I5Z B;  4IUU A;  4F7U A;  2DEQ A;  4JZ4 A;  4EOR B;  3RKY A;  4C92 A;  2MWO A;  1D3B A;  1ACM B;  2FZG B;  2COY A;  4BAC A;  3ZL7 C;  1IGQ A;  1YJN T;  2BZ8 A;  5FU6 B;  1UEB A;  2YRC A;  5D6Y A;  5GAM e;  1G3T A;  1WHK A;  2K3X A;  3CC7 Q;  4BI3 A;  2F69 A;  4CC3 A;  2C5X B;  1OKV B;  1VQM Q;  4FYW B;  4F17 A;  2QYZ A;  4M7D E;  5HK3 A;  1JXM A;  1QWE A;  1ZBX A;  3L42 A;  4LUD A;  1OQK A;  1GFD A;  2G3R A;  1JKW A;  4P5N A;  1N8R R;  4M75 D;  2ZZD A;  4X9D A;  1KJW A;  4J6Y A;  2JTE A;  1YCS B;  2LCC A;  1YIT Q;  3X26 B;  2EGC A;  3EG9 B;  1NPR A;  3WXM B;  1VQ9 Q;  1M2V B;  2JZ2 A;  3ER0 A;  1G8X A;  5DLQ E;  3OYK A;  2W96 A;  4M7A D;  2X1N B;  3OS1 A;  2W99 A;  3E19 A;  1YJW Q;  1GRI A;  1TD6 A;  2LVM A;  1RLP C;  4E47 A;  3BY7 A;  1N9R A;  1RAF B;  2ATC B;  4AT1 B;  2GTO A;  4WF2 A;  2DA9 A;  2VVK A;  1ZUK A;  1YJW A;  2KAF A;  2DTO A;  2L2P A;  4E7K A;  5LJ5 h;  4PJO E;  1M1K U;  1M3B A;  1VQ7 A;  2CH4 A;  3MI9 B;  3FRN A;  3VV0 A;  2V22 B;  2WMA B;  2LRQ A;  2QK0 A;  4JJB A;  1Q7Y C;  4F70 B;  1M90 C;  2GQV A;  2XID A;  4ROC A;  5AT1 B;  4M77 D;  4F16 A;  5BNJ B;  3PO3 S;  1UFF A;  2KK4 A;  4C8Q A;  4NS5 A;  3SHW A;  3BDL A;  4OML A;  3OMC A;  2AK5 A;  2RJE A;  3PMT A;  3RGF B;  3R6N A;  1YJ9 Q;  4XU3 A;  1YJ9 A;  4BCH B;  2R58 A;  3EG9 A;  5GAN j;  3TN8 B;  1D3U B;  1VQ9 A;  5GMK m;  1ABO A;  4F6S B;  2JS2 A;  3OYI A;  3CME T;  2D0Q B;  1TOV A;  2QA4 T;  3I55 T;  2F1L A;  2COZ A;  2R5A A;  1SEM A;  5LMK B;  2WFY B;  3CXC P;  4BCF B;  1XOV A;  2MOX A;  4DOV A;  4FSX A;  4MML A;  3JCM c;  3H0I A;  4KRD B;  4ZGD B;  2W9F A;  1VQ4 A;  5DQV A;  3QZ5 B;  3PFS A;  2JXB A;  2HL5 C;  4BCI B;  3JAM E;  2MK5 A;  2CT3 A;  4KGZ B;  2DJZ A;  1OZ2 A;  2BIV A;  2ZAE A;  2V8K A;  1BYM A;  1RI0 A;  1PNJ A;  5IN1 A;  1GXI E;  2RK2 A;  4C8Q C;  5HY6 A;  1JBM A;  2EQM A;  1VQ4 T;  4BCJ B;  3S3M A;  1KSW A;  1QKX A;  4RTY A;  2DLP A;  2YLC A;  1UJ0 A;  1OI1 A;  2ZPH B;  4OB2 B;  2M9U A;  2RA2 A;  5CYI B;  4CFM B;  4I3Z B;  2RQU A;  2CYZ B;  4C92 G;  3I35 A;  2OTJ A;  2R7G A;  5L2W B;  4ROE A;  3TSZ A;  4C92 B;  2GF7 A;  4E7J A;  2RHY A;  4E2F B;  2ECZ A;  2ZPF B;  3M5A A;  2DYI A;  1UGP B;  1OX9 A;  2HKN A;  1C1A A;  3VS4 A;  4AKI A;  5HBE B;  3HL8 A;  4BCQ B;  3M0T A;  3FEO A;  3S3N A;  3VKI A;  5GAO q;  3QSU A;  3QWL A;  1KQ2 A;  4QQD A;  2CJM B;  4LDW A;  4E7Z A;  2CP3 A;  2E70 A;  3EGD A;  4BE1 A;  1YI2 Q;  3CCE T;  2E3I A;  4FW2 A;  5IDN B;  1WIE A;  1WJR A;  1G5V A;  1C0M A;  2HDA A;  2HQH A;  5CQX A;  1SF9 A;  4OGC A;  2YHT A;  3EFR A;  2CCI B;  2CKK A;  2CZ7 B;  2I2L A;  2P4R A;  3PNW C;  1B07 A;  4CFV B;  3NPF A;  2DPP B;  2C6T B;  2IVX A;  2FRW A;  4DOW A;  5LJ5 d;  5CKE A;  2RO0 A;  4PLI A;  1B7T A;  2EQJ A;  3G7Z A;  3I55 A;  4KT0 E;  1KD1 C;  4DBQ A;  3DB4 A;  1VQK A;  2W0Z A;  1MMD A;  4HNU A;  1VQ8 T;  2LP5 A;  1GH6 B;  4HT9 A;  3LW5 E;  4LDV A;  4F04 B;  6AT1 B;  1IB8 A;  1H4L D;  3I56 Q;  1NEB A;  2LX9 A;  3I56 A;  1FIN B;  1AZG B;  4ZGE B;  2I0N A;  1U1T A;  3E9G A;  2X51 A;  3LLR A;  2JMA A;  2NUP B;  2BUD A;  2ED0 A;  1OL1 B;  4Y28 E;  2FHD A;  3CD6 Q;  5LJ3 h;  2DER A;  2BPM B;  5LJ3 f;  2IPO B;  4OVA A;  3HRT A;  1I0C A;  1NM7 A;  4MDX A;  1M1G A;  4M78 E;  2RHI A;  3L2Z A;  3WVE B;  4RCC A;  1SRM A;  8AT1 B;  3CCQ Q;  3CCQ A;  4XTZ A;  3V8L A;  5FU7 B;  3A8L B;  4J6W A;  2ROL A;  3VKG A;  3HP9 A;  3BFM A;  1WQW A;  4EPC A;  2P0K A;  4M7D F;  2DKG A;  2EQI A;  2L8D A;  4JS4 A;  4C5H A;  2QTX A;  2RN8 A;  2WMB B;  4N0A C;  4M78 D;  4KH1 B;  5CR2 A;  1YJN Q;  1AWW A;  1TSF A;  2MIO A;  1KQS A;  1N6A A;  1YIT A;  2LMJ A;  1IRE B;  3H0H A;  4ME7 A;  5GAN 8;  2F5T X;  1NJI C;  2HSE B;  2A7Y A;  3V7C A;  1K0S A;  2PUK B;  2LQW A;  3TSW A;  4KUL A;  2EKH A;  5HBJ B;  3X28 B;  5KCH A;  1JXO A;  4C0D C;  1IHW A;  3NTI A;  4M78 F;  3CCR T;  3T9N A;  4F7U G;  3MEU A;  1M2V A;  1W4S A;  4CI0 C;  3BHU B;  1AWO A;  3OYG A;  2M02 A;  4N0A A;  1VQ7 Q;  3A8O B;  3CCM Q;  5D6X A;  2L89 A;  1MNE A;  1NJI R;  1JST B;  3EHR A;  5EFQ B;  2GBQ A;  3OYB A;  4C92 D;  3CCM A;  3RKW A;  2JTF A;  1Y0M A;  2IW9 B;  2QQ9 A;  1Q86 R;  5LJ5 j;  4RTV A;  4FL6 A;  4AFZ C;  2PK9 B;  1M8V A;  2OTL Q;  2DNU A;  4UN0 A;  4HXJ A;  4EMK B;  1CSK A;  1QP2 A;  4M75 C;  1AZE A;  1WDX A;  3HO8 A;  2YXY A;  4A4H A;  4Q5W A;  2X35 A;  4ZN3 A;  4LD9 K;  1VIN A;  1OPL A;  3QUI A;  1YP5 A;  1OI9 B;  1NLP C;  1UE9 A;  2GFU A;  4C5G A;  3QHW B;  4YOO A;  4A4E A;  5ACB A;  4J9I A;  1JJ2 P;  2MI6 A;  2GCX A;  3QDR B;  2CZ0 B;  2X4X A;  4MZT A;  5M9O A;  3RIR A;  1BK2 A;  4CXA B;  2DE0 X;  3CC2 T;  1NE8 A;  2AHJ B;  2E5K A;  2D8H A;  3FC3 A;  3M53 A;  2CUB A;  3VS0 A;  3BG3 A;  4LD6 A;  2VGN A;  2XDP A;  2J05 A;  2E6Z A; 
#chains in the Genus database with same CATH homology
 2LQ8 A;  2PVD B;  4JS5 A;  2XDD A;  2RD1 A;  3QG1 A;  3QKJ A;  3A5Z B;  2K5L A;  2RB6 A;  2HQE A;  2QQB A;  1IZ6 A;  4HNV A;  2MAM A;  3CBM A;  5CVI A;  1P92 A;  3JCM d;  3GNF B;  2E6N A;  4XTX A;  3CCJ A;  3UWN A;  4BE0 A;  1KC8 U;  2R57 A;  1KHC A;  1O75 A;  2PU9 B;  4IUU A;  4C92 E;  4F7U A;  1MGQ A;  2EKO A;  1D3B B;  2DEQ A;  3OB9 A;  2H3J A;  3RKY A;  3CCL A;  1YI2 T;  2VC8 A;  4C92 A;  2MWO A;  3G4S A;  1D3B A;  3HHT B;  4PJO A;  5GAN 3;  2KQW A;  4PKC C;  3M58 A;  3CPW A;  5GMK e;  4OB3 B;  3VYG A;  1NPP A;  2WSC E;  1NZ9 A;  1XTD A;  1K9M C;  1VQP T;  2QXF A;  3VU3 C;  1VQO A;  2RJD A;  4BAC A;  3NTK A;  2KMG A;  1JRI A;  1DJ7 B;  3CXC A;  1XQH A;  3GNG A;  4J83 A;  2BS4 A;  2RJC A;  1YJN T;  2DD4 A;  1N27 A;  3TW6 A;  1UEB A;  5FU6 B;  2XIC A;  5D6Y A;  2BS3 A;  5GAM e;  3CMA T;  4M7A A;  2QA4 A;  5EG2 A;  1G3T A;  2L3R A;  2BKD N;  2K3X A;  4JRQ A;  3JB9 J;  4OP0 A;  3HKS A;  4MFE A;  3F70 A;  3NFC A;  4BI3 A;  4RMO A;  4XU1 A;  2F69 A;  5GMK j;  4M77 C;  1XNI A;  1YIT T;  3OMG A;  2HBP A;  3MEW A;  1VQ9 T;  1Y71 A;  3JB9 F;  4M7D E;  3V7R A;  5HK3 A;  1ZBX A;  5CKB A;  4BY6 C;  3L42 A;  4RG8 A;  5KE3 A;  3VUZ A;  2G3R A;  2E65 A;  1YIJ A;  3GIB A;  4OF1 A;  3OBY A;  4P5N A;  4M75 D;  2ZZD A;  3E1S A;  5DM7 R;  1Q82 U;  1BI3 A;  1QLB A;  4X9D A;  3RES A;  1FKM A;  4ELZ C;  1JJ2 A;  4J6Y A;  4C5E A;  3RER A;  4JRI A;  5GAM f;  3SWN A;  4LDX A;  2DIG A;  1MHN A;  2XG8 D;  4EMK A;  1VQP A;  2LCC A;  1K8A U;  3X26 B;  4M7D A;  3M54 A;  4BI8 B;  1NPR A;  3WXM B;  1QVG S;  2JZ2 A;  3ER0 A;  3OBW A;  5GAN d;  3PTA A;  1Q86 C;  1VQ8 A;  3MP8 A;  4FT4 A;  5KCO A;  4E7L A;  5DLQ E;  3OYK A;  3QJ6 A;  4N4I A;  3G71 T;  4M7A D;  1V29 B;  2A3L A;  2MF2 A;  4MZP A;  5KE2 A;  3JCM J;  3CCV T;  2E41 A;  3OYN A;  1KC8 C;  4C92 F;  1G3W A;  3OS1 A;  3RMS A;  3E19 A;  4M78 C;  4A4K A;  3QYH B;  2EQK A;  3QYB A;  2JN0 A;  3L1A A;  2LVM A;  3M56 A;  1H64 1;  3PT9 A;  4E47 A;  4PJO G;  3V8J A;  3L2Q A;  2KY9 A;  3C4S A;  4IUT A;  3BY7 A;  1N9R A;  1B34 B;  3C95 A;  4JUV A;  5LJ5 g;  3VKH A;  2EWN A;  2QDJ A;  4WF2 A;  1I8F A;  4ZTF A;  4BUG A;  3A8H B;  1M5Q 1;  3QO3 A;  4JLG A;  2X4Y A;  2KAF A;  4C0G A;  1YJW A;  4ELY C;  5IAY A;  1WGS A;  2V8I A;  4GLK A;  3OW2 S;  2DTO A;  4L6V 5;  3OYH A;  4XAX B;  4AKG A;  3HZJ A;  2PVO B;  4M77 G;  5GAM j;  4E7K A;  1YCY A;  2KVQ G;  4AKH A;  5LJ5 h;  5GMK h;  4PJO E;  1NJI U;  1M1K U;  3L2W A;  5GAN g;  3UPU A;  4C0Z A;  2HNI A;  4JDS A;  1VQ7 A;  1VIE A;  3FRN A;  3VV0 A;  2MWP A;  2LRQ A;  4RCB A;  1YJW T;  1Q7Y C;  2CS7 A;  4F7U E;  1M90 C;  3MP1 A;  3WVD B;  2GQV A;  2DD5 A;  2XID A;  3DLM A;  3CC4 T;  2QEX A;  2D6F A;  4ATO A;  4M78 G;  1HK9 A;  3LGF A;  2DTH A;  2CZ1 B;  4M77 D;  3RUX A;  1BIB A;  4PJO C;  3GPL A;  2KK4 A;  3FIF A;  4C8Q A;  1K9M U;  4NS5 A;  2KSS A;  3BDL A;  1N9S A;  3QII A;  3S6W A;  4C8Q G;  3CEY A;  3OMC A;  2XU8 A;  2P4T A;  1VQN T;  2WSF E;  1O9S A;  2RJE A;  3OYE A;  4M78 A;  2EJF A;  4M7D D;  3PMT A;  2G77 A;  2LQK A;  4JLI A;  2E64 A;  4M75 A;  1FWZ A;  4XU3 A;  2NLU A;  2R58 A;  3TEE A;  1YJ9 A;  3I56 T;  1JJ2 S;  4M7A F;  5GAN j;  1VQ9 A;  5GMK m;  3OS5 A;  3HSB A;  3HFN A;  4BDZ A;  3UDC A;  2EFI A;  3LH0 A;  2RHZ A;  4KUI A;  4J8O A;  3URG A;  3OYI A;  3CME T;  4DA4 A;  1Y7X A;  3OYY A;  3OYD A;  1SSF A;  2D0Q B;  3J7A F;  5HKC A;  1VIF A;  3CMA A;  4JRP A;  4ZGJ B;  1QVF A;  2QA4 T;  3I55 T;  2FYK A;  2OAU A;  2ZPG B;  1U1S A;  2GFA A;  2QI2 A;  3JRZ A;  2R5A A;  3LYI A;  5AYF A;  4B9X A;  3GP8 A;  3A8G B;  4YTL A;  2EAY A;  3TW7 A;  3ME9 A;  5LJ3 j;  2O01 E;  1XOV A;  4DOV A;  3OA6 A;  1I4K 1;  3RKX A;  5J3B A;  1VQO T;  2R5M A;  4FSX A;  5FU6 C;  3MO8 A;  1RL2 A;  4BE2 A;  4MML A;  3JCM c;  4B9W A;  3V7S A;  4XTY A;  2O4X B;  4RG2 A;  2QEX T;  2XDB A;  1X6O A;  4ZGD B;  1VQ4 A;  2RHX A;  2VYT A;  3MHX A;  3QZ5 B;  3X24 B;  3NTH A;  1Q81 C;  5EJC A;  2EQU A;  3PFS A;  3FB9 A;  3G4S T;  4PJO B;  3JAM E;  3H4C A;  3CC2 T;  4M7A B;  3CCL T;  3CCV A;  2DJZ A;  2CZ6 B;  1OZ2 A;  1H3Z A;  2BIV A;  4BY6 B;  1S72 A;  1BYM A;  2V8K A;  2DD5 B;  1RI0 A;  1BI0 A;  2JTM A;  2L5Q A;  5IN1 A;  2ZPB B;  1GXI E;  4VUB A;  2RK2 A;  4R56 A;  4C8Q C;  1VQ5 A;  4XQ3 A;  5HY6 A;  5GAO r;  1JBM A;  2EQM A;  5GAN h;  2DIQ A;  4ELJ A;  1VQ4 T;  4ZN1 A;  3S3M A;  3KHI A;  5GAN f;  1B34 A;  1AHJ B;  3DKM A;  2VV5 A;  1KHI A;  2VXF A;  2QFZ A;  3M57 A;  3OS0 A;  1YI2 A;  5C6S A;  4X34 A;  4HT8 A;  2YLC A;  1LNX A;  1Q82 C;  5CCA A;  4MIM A;  3ZBD A;  3X25 B;  4BDY A;  4ZTJ A;  4OB1 B;  1OI1 A;  2ZPH B;  4OB2 B;  2M9U A;  2RA2 A;  4BD3 A;  1Y96 A;  3CCS A;  3QBY A;  4A4G A;  4MDW A;  2CYZ B;  4C92 G;  3OYL A;  2HQX A;  2DD4 B;  3QXE B;  3HRS A;  2OTJ A;  2LDM A;  3A8M B;  3M9Q A;  4PJO F;  4C92 B;  2GF7 A;  5FLX E;  5FRO A;  4E7J A;  2RHY A;  3JB9 D;  2Y90 A;  3Q1J A;  3TU4 K;  3OS2 A;  2JVV A;  3OQ5 A;  2ZPF B;  4NC6 A;  3M5A A;  3SDZ A;  3LGL A;  1UGP B;  1YHQ A;  4IUQ A;  4JX4 A;  1PSF A;  4AKI A;  4FIB A;  3HL8 A;  3CCS T;  4M75 F;  4OB0 B;  2XD0 A;  1VQN A;  3FEO A;  4BBR M;  4HLQ A;  4II1 A;  4O5V A;  3VKI A;  5GAO q;  3S3N A;  4Y91 A;  3QSU A;  1EIF A;  5I2M A;  4HT9 A;  3QWL A;  4M7A C;  4M7D B;  1KQ2 A;  4QQD A;  3JCM X;  3JCM W;  1ZQ1 A;  4Z6Y A;  4LDW A;  4XTV A;  4QVZ A;  4QVD A;  3KUF A;  2RH2 A;  3KXT A;  5GAO n;  2XK0 A;  2DK3 A;  2E70 A;  1WJQ A;  2Y4X A;  3INZ A;  4BE1 A;  3HRU A;  3CCE T;  1WJR A;  2VUB A;  2PQW A;  5GAN 2;  4QW2 A;  3GLX A;  3TCJ A;  1G5V A;  5CQX A;  2OTL A;  4OGE A;  5GAM h;  3CBO A;  4OGC A;  2DXB A;  2YHT A;  3EFR A;  4M6V A;  4CRI A;  4C8Q B;  4J7F A;  5CQY A;  4NOY A;  4UC4 A;  2CKK A;  4O6J A;  1BI1 A;  5A0D A;  3CCM T;  2CZ7 B;  2KR6 A;  5GAO l;  4J5Y A;  5CKF A;  4QVC A;  5GAM d;  3MP6 A;  2I2L A;  4J7I A;  1UGQ B;  3CCJ T;  3PNW C;  2DAQ A;  4M78 B;  1BIA A;  4M7A G;  2DPP B;  4X9C A;  3BW1 A;  4A4F A;  4DOW A;  5CKH A;  4BI4 A;  5IT9 E;  1WNL A;  4HNT A;  1OYX A;  5LJ5 d;  1X75 C;  2DXB B;  5CKE A;  2RO0 A;  4PNO A;  4BBS M;  4PLI A;  4XTU A;  1KQS S;  2XI9 A;  2EQJ A;  3JCM V;  5J39 A;  2P0P A;  3G7Z A;  4MZM A;  1HXD A;  3M55 A;  4KT0 E;  3I55 A;  4F7U F;  1KD1 C;  3QYE A;  2OTL T;  2VXE A;  3DB4 A;  3DB3 A;  1VQK A;  4D6W A;  1FXX A;  1ZHI A;  3JCM h;  3CCU T;  2K2V A;  4HNU A;  5CIU A;  1VQ8 T;  3CME A;  3BG9 A;  4Z02 A;  4HA8 A;  2RI3 A;  3SD4 A;  3J80 E;  3OYA A;  1M9S A;  3GF5 A;  3JB9 H;  3QYG B;  4PLL A;  2KMT A;  5LJ3 e;  3LW5 E;  4LDV A;  5LJ5 f;  1OZ3 A;  4C8Q F;  3QZ9 B;  4QSH A;  1WQ7 A;  3VUB A;  5I21 A;  4KBM B;  1N8R C;  4L59 A;  1R8O B;  4AI6 A;  1KQ1 A;  2LX9 A;  2PVG B;  4FT2 A;  3I56 A;  4ZGE B;  1U1T A;  2XHC A;  4MMK A;  3E9G A;  3CD6 A;  2DXC A;  4M77 A;  2PUO B;  3LLR A;  2E12 A;  4XU2 A;  3JCM P;  2K5I A;  5L8R E;  5CKD A;  2DO3 A;  5LL6 S;  3LWI A;  3MCA B;  2RI2 A;  1QP3 A;  2BUD A;  2K3Y A;  3PGG A;  1UGS B;  4M77 E;  3ZFJ A;  4KUD K;  2K5F A;  4Y28 E;  1KD1 U;  3PIP A;  3EFS A;  2FHD A;  3HBL A;  2WSE E;  4OMF B;  1Q81 U;  2JNG A;  5LJ3 h;  1E7P A;  2ZCF B;  2EIF A;  5LJ3 f;  3V8K A;  2LC4 A;  4OVA A;  3HRT A;  4MDX A;  1M1G A;  1I5L A;  2D9T A;  4M78 E;  2RHI A;  3L2Z A;  3WVE B;  4N4G A;  3OYM A;  4RCC A;  5LJ3 g;  2WAC A;  5CO7 A;  4LDU A;  3CCQ A;  1VQL A;  4XTZ A;  1BKB A;  3V8L A;  4NL3 A;  5FU7 B;  3JCM e;  3AHU A;  3A8L B;  4J6W A;  2HAX A;  3C12 A;  1G3S A;  3O8V A;  1M90 U;  4L5G A;  4M7D G;  5GMK l;  1QW1 A;  4HKE A;  4GY5 A;  4C8Q E;  5A2Q E;  3P8B B;  5GAO m;  4C0D B;  3S3O A;  3JCM b;  3CCE A;  3VKG A;  3X20 B;  3HP9 A;  4M75 B;  3BFM A;  3OY9 A;  1WQW A;  5I2S A;  4EPC A;  5DLO A;  3DLL A;  1K8A C;  2E10 A;  2P0K A;  4DQ2 A;  1VQ7 T;  5LJ3 d;  4M7D F;  2DKG A;  3OW2 A;  2ZPE B;  4N4H A;  2L8D A;  2M0O A;  4JS4 A;  1Q86 U;  1M1F A;  1Y07 A;  2QQS A;  4C5H A;  4JX6 A;  4M75 G;  1W2B A;  3CCQ T;  2E5Q A;  1LOJ A;  2QTX A;  3EAE A;  3BG5 A;  2FVU A;  4LDY A;  4IKF A;  2K57 A;  3TRE A;  2LNV A;  3QHS A;  1YHQ T;  2RHU A;  4M78 D;  4N0A C;  3ZEH A;  2IG0 A;  4NL2 A;  4M77 F;  4EDU A;  5CR2 A;  5GAO p;  3SFM A;  4M7D C;  4JRK A;  1FX7 A;  5FRM A;  4TVR A;  2QQA A;  3JCM g;  1KQS A;  2F5K A;  4M75 E;  1VQ6 T;  1N6A A;  1YIT A;  1VQ5 T;  2LCL A;  2JOY A;  2DVE A;  3ASK A;  2X4J A;  5GAN 4;  3JB9 G;  2DXU A;  3L2U A;  4V2S A;  1IRE B;  3JB9 I;  3CCU A;  1N8R U;  4EMK C;  4XTW A;  1M4Z A;  2HD0 A;  5HK0 A;  2C06 A;  3J81 E;  3CD6 T;  4ME7 A;  5GAN 8;  1QVF S;  2V8J A;  3QPH A;  3R6O A;  4PL6 A;  2F5T X;  3M4G A;  4BB7 A;  3CCR A;  1VQM T;  1NJI C;  1M1K C;  3L2R A;  2A7Y A;  2CGH A;  3HPW A;  3V7C A;  3RMQ A;  1VQ6 A;  4MFD A;  2EJG A;  2PUK B;  2DZC A;  2VGM A;  2QDY B;  1BI2 A;  2DTI A;  4KUL A;  3UT1 A;  2EYQ A;  5D6W A;  3X28 B;  3CPF A;  5KCH A;  4C0D C;  4HCC A;  4HL4 A;  3VYG B;  3LX7 A;  4JX5 A;  3M59 A;  3VJP A;  4C92 C;  3NTI A;  4M78 F;  4C0F A;  3CCR T;  5LJ5 e;  1QVG A;  2FL7 A;  1JB0 E;  4HCB A;  3DL1 A;  2M16 A;  2BS2 A;  3KBG A;  3T9N A;  4F7U G;  2KDS A;  3MEU A;  1K73 U;  3M4Y A;  1TH7 A;  2DXC B;  4M77 B;  1W4S A;  5CAI A;  3CPW S;  3CBP A;  3JSC A;  4CI0 C;  2IVW A;  2ZPI B;  3LWH A;  2YRV A;  3OYG A;  4N0A A;  3N5B B;  5GAN e;  2WJ9 A;  4F7U B;  3SWN B;  1VUB A;  3A8O B;  5GAM g;  1Y96 B;  2MMP A;  3VYH B;  3OSS C;  5CK9 A;  5D6X A;  1WJS A;  5A0L A;  3P8H A;  2L89 A;  5J26 A;  4J6X A;  4QQ6 A;  2P0Q A;  2ZGW A;  3FLG A;  1QVP A;  1PSE A;  5C0M A;  5FRN A;  5GAN 6;  3OYB A;  1S72 T;  4C92 D;  1VQL T;  3CCM A;  4A53 A;  3G71 A;  3RKW A;  2QQR A;  1YBY A;  2JTF A;  1U8R A;  1K73 C;  4LOC A;  3QJY A;  2QQ9 A;  5FU7 C;  2E1H A;  4FU6 A;  5LJ5 j;  2FB7 A;  2ZZD B;  4R55 A;  3HFO A;  1WPY A;  3PIO A;  2K4Y A;  3FJP A;  1G3Y A;  4FL6 A;  2LT1 A;  1M8V A;  2LT4 A;  2RI5 A;  2RJF A;  4XU0 A;  3SB2 A;  3MEV A;  4EMK B;  1KG1 A;  4E7H A;  1QP2 A;  4M75 C;  3CXC S;  2OTJ T;  4JJN K;  2EJ9 A;  3HB9 A;  3G6E A;  3JCM Q;  3HO8 A;  4XK8 E;  2QF7 A;  4A4H A;  4Q5W A;  2X35 A;  1UB4 A;  4ZN3 A;  2XKO C;  1X01 A;  3PMI A;  4EMG A;  3MEA A;  5GAN 5;  1YIJ T;  3OYF A;  3QUI A;  4IUR A;  4LD9 K;  2JUF A;  2LTO A;  2DZ9 A;  4IUP A;  3CC2 A;  3BDU A;  2GFU A;  4C5G A;  4EMH A;  2YLB A;  5KH6 A;  4PJO D;  4FM4 B;  1LJO A;  4A54 A;  3OYJ A;  3FDR A;  5GMK i;  4A4E A;  4C8Q D;  3CC7 A;  1Q7Y U;  4E7I A;  3CC7 T;  4QQG A;  2MI6 A;  2GCX A;  3QDR B;  2CZ0 B;  5GAN 7;  2X4X A;  4MZT A;  3CC4 A;  3SWN C;  5M9O A;  2DXT A;  2M1H A;  2O4X A;  2RK1 A;  1UGR B;  3RIR A;  1I81 A;  4IUV A;  3JCM f;  2RM4 A;  3GOX A;  1YJ9 T;  4HCZ A;  1VQM A;  1NE8 A;  3P8D A;  1VQK T;  3OSV A;  4C5I A;  4M7A E;  4RKU E;  2X4W A;  1W2B S;  2AHJ B;  3C94 A;  3E9F A;  3H6Z A;  3MET A;  5A0G A;  3FC3 A;  3M53 A;  1YJN A;  3G6E T;  3OYC A;  3BG3 A;  3L2V A;  2B8A A;  4LD6 A;  2VGN A;  5DY9 A;  2Y4Y A;  2XDP A;  3H8Z A;  2QQ8 A;  2E6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...