4ZGEB

Double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 52
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgeB02
2O01E 1GXIE 4XK8E 1UGPB 2DD4A 2ZZDB 1AHJB 4OB3B 3WVDB 3QYHB 2ZPIB 3X20B 4OB2B 2DD5B 3QZ5B 2ZCFB 2PVGB 1QP3A 2WSCE 1DJ7B 2QDYB 2DXCA 4OB0B 1UGQB 2DD5A 2CZ7B 4ZGJB 2ZPEB 2CYZB 2CZ1B 4OB1B 3A8HB 3QYGB 2AHJB 1IREB 3A8MB 5L8RE 4KT0E 3VYHB 2PVOB 1JB0E 3VYGB 2ZPFB 3X28B 3HHTB 2DXCB 2ZPHB 2WSEE 1PSEA 3A8LB 4RKUE 2CZ0B 3WVEB 4L6V5 2PUOB 2ZPBB 2PUKB 2D0QB 2WSFE 2PVDB 2ZZDA 3LW5E 1V29B 1UGSB 3VYGA 4FM4B 3X26B 4ZGDB 3X25B 4Y28E 3QXEB 3X24B 1QP2A 2DXBB 3A8OB 1PSFA 1UGRB 2DPPB 4ZGEB 3QZ9B 2PU9B 2CZ6B 2ZPGB 3A8GB 2DXBA 2DD4B
chains in the Genus database with same CATH superfamily
3KUFA 3CC4Q 2F2CA 2K2MA 3M55A 1AHJB 4HLQA 2C6TB 4BCQD 3OS0A 2H3EB 3O8VA 5DM7R 2FB7A 2NUTA 4A53A 3CXCA 1FWZA 4CC7A 1MV0B 5LJ3j 1X01A 4E6RA 2RF0A 4C0FA 4BCOB 5HY6A 2CCIB 1SSFA 2QG9B 4JZ3A 4PFPA 1TH7A 1H26B 1OULA 5FU7C 3TVTA 3CCJA 1VQMA 1VQPT 4PFOA 4J9EA 1GFDA 1LJOA 3VS0A 1M27C 5LJ3f 4ESRA 2IN3A 1WJQA 1M8MA 1C1AA 3A8HB 5GAN2 3BDLA 3NTHA 1UEBA 4M75E 4RUGA 3BG3A 1YHQQ 3BHVB 6AT1B 4M7DC 2C5XB 3OYAA 1GCQA 3QUIA 5I21A 5FW9A 5LJ5e 2KRNA 1D1AA 2JS2A 5GAOl 3G71A 4FT4A 5A2QE 2HBPA 3BHUB 4JLIA 1X69A 3M0SA 4F7UF 2F69A 1ZA2B 2Y4XA 2FL7A 4F7UB 1UG1A 4KRCB 1UDLA 5CKEA 1VQPQ 1Y07A 4A4HA 2WJ9A 3HKSA 4XTWA 3FC3A 4PJOF 3BFMA 3S3NA 2YLBA 3M59A 1KIKA 2L0AA 3LWHA 2HCKA 2EJGA 5GAN7 2CP0A 2K6DA 1D3UB 3GTMS 1NBEB 4JJBA 1PKDB 1IGUA 1TUDA 4F17A 2R57A 1YJNQ 2FHDA 3NDQA 4C92A 4F7JB 3TW6A 2DO3A 1Z9QA 2LP5A 3CD6T 2RHYA 4JRPA 4E7IA 3CCMT 3CC7T 4C5GA 3RUXA 2BZYA 3AT1B 3FDRA 4M77C 1ZLMA 3LX7A 3EGDB 4XTZA 2M0OA 1WHGA 1W70A 4Y72B 2C0IA 4RTWA 3TCJA 1NPPA 2A28A 4E7HA 2FO0A 4BUGA 4YC3B 2JGZB 3QJYA 1HYOA 1K8AU 4F6SB 4HVWA 2E10A 4EPCA 1S72A 1W98B 2QDYB 1VQLA 4M77D 1VQ4Q 4C0ZA 2YSQA 2LT4A 4M78C 2KYMA 3JCMb 3CD6Q 1U3OA 2QA4A 3ZFJA 4XU0A 5HBJB 2M16A 3CC7Q 5FLXE 1KC8R 2ZPFB 3A5ZB 4C92C 1QCNA 1K73U 4XU1A 5KYUA 3X28B 1K0SA 1TFBA 3OYNA 3HFNA 1MV3A 2QA4T 4FSXA 2GCXA 4AFZC 2L5QA 4BXXX 4PK4A 4PNOA 2DEQA 3JCMd 2KXCA 4KBMB 3DLMA 3JCMW 2V8JA 1QMZB 3QWYA 1EIFA 3F5XB 2XU8A 2PUKB 3G7ZA 2D0QB 2WSFE 5CAIA 1QCOA 3V8KA 1N9RA 4M78B 4MZMA 5A0GA 4M78D 4R55A 2MWPA 1M1KU 2FRWA 1N6AA 4AT1B 4M78A 3AHUA 3H0IA 4BI3A 4BCGB 4FYXB 1RLPC 2YT6A 5J26A 3EOCB 2DNUA 4HT8A 4J9DA 1H27B 3KFVA 2DL3A 2F2WA 2YWWA 1I5LA 5HCKA 4BB7A 4HVUA 1GUXB 3OW2S 2QF7A 2EYQA 2B9RA 2DD4A 3GNFB 1JEGA 1OI1A 1O9KA 1NPRA 1WNLA 5GAN8 3CPWA 3HTRA 1XNIA 2DE0X 2QI2A 2OAUA 4XTUA 2WPAB 1PCXA 1CKAA 1FMWA 2F1LA 1VQNA 2O9SA 2GTOA 1QW1A 1JU5C 1AWJA 2K7AA 2W2HA 2C0OA 1KQSA 1Q82C 2LZ6B 3CCQA 2RK1A 4IUUA 2CZ1B 4Z02A 3CCSA 2PHGA 3CCLT 1C6VX 2RPNA 5CKHA 2KT1A 2EQMA 1PRLC 1T3SA 2I0NA 2DETA 1K4US 2J6FA 2F2XA 2YLCA 1ZUUA 4PL6A 1GRIA 1W2BA 3OA6A 4PJOC 4KRTA 1VQ8A 4ZNXA 1M3AA 5CKFA 1OIUB 4FX3B 4MZTA 2M9UA 2VC8A 4PJNA 3CCJQ 1AWXA 1UE9A 3CCST 4HNTA 2D0NA 2M0YA 3RERA 1KHIA 1RADB 2M1HA 3PNWC 2BIVA 2RHUA 1ZA1B 4Y92A 3TEEA 4OR5B 3GNGA 1VQ8T 4CC2A 1SHGA 1RAFB 2FVUA 2XD0A 2K3XA 2V22B 4EOLB 3TSZA 4II1A 1X6GA 3EG0A 2DZCA 1QMCA 3MEWA 2E65A 1G3SA 2DL7A 4FL6A 4FU6A 4M78E 2QDJA 5KYXB 1W2BP 3VKHA 2EIFA 4ZGEB 5GAMf 1BIAA 4PJOG 5KCOA 3TU4K 1ZHIA 1RI0A 5KYXA 4EMGA 1YIJQ 2L8DA 3PMTA 3CCSQ 1T3LA 2LX7A 2C5VB 1B07A 4IIMA 5IHNA 2WMAB 4M75F 4Z8AA 5FWCA 1TU0B 1WX6A 1SF9A 1U5SA 2YDLA 2ZZDB 3HSBA 3EFSA 2VVKA 4C5IA 4IIOA 1URCB 4CFWB 1X6BA 1VYTA 1Q86C 4Z89A 4LOCA 2FPDA 1WYXA 5GAN5 2HD0A 1BB9A 1H24B 2OTJA 2CSQA 3MEAA 2XK0A 1JOWA 2IG0A 4OGEA 1GL5A 1ZQ1A 2D8HA 4GBQA 3MKDA 1FMKA 1YWOA 2LJ1A 2EJ9A 3C4SA 2JM8A 1VQOQ 2HAXA 1H1PB 3QDRB 1M9SA 4N4HA 1AWOA 2P4TA 2D1XA 2DBMA 1NLOC 5L8RE 2Y90A 3SB2A 4KRDB 1YJNT 2UZBB 1K0XA 2W10A 2O4XA 4WF2A 1U8RA 2PK9B 3CBOA 1VQ9A 3PGGA 3G4ST 3M0TA 1OOTA 4QKUA 4C92D 2DAQA 4CFVB 3VRZA 1OPLA 1PSEA 2K9GA 2EYYA 3BG5A 1E7OA 3BLHB 2QTXA 1CSKA 3CCUA 3I55T 5GAN4 2RJDA 5ECAA 1MMNA 5DQWA 1Q81U 1K9MU 4ZN3A 2KY9A 3JCMe 3CCEQ 3G4SA 4B9WA 4L59A 1Y7XA 5KYWB 3F70A 3HPWA 4A54A 5IF1B 4Y28E 3QSUA 1M8VA 4FW1A 1VQ4T 2DYIA 3V7RA 4MFDA 5BNJB 1M2VA 5KYWA 4J9HA 3CQTA 2RHXA 3QYBA 2HQXA 1TTHB 3META 3QYEA 3VS4A 2MF2A 1V76A 2C5NB 4IURA 3A1PA 3DJBA 3REAB 1FYNA 1RAHB 3S3OA 2KRMA 2ZPIB 3WXMB 4F7UE 3EIDB 2JNGA 5HNBB 4QVCA 3LGFA 4BY6B 5GMKj 3PMIA 2PVGB 4BD3A 3CXCS 4BBRM 1EX4A 4ZTFA 2W0ZA 4PJJA 2KBTA 5GANe 2C5OB 3A98A 2JT4A 2LQ8A 2FZGB 3QIIA 4CFUB 4M7DD 5IDNB 1IHWA 3SWNA 4ATOA 4MDXA 2DX1A 1KD1C 1G3TA 1G2BA 3CC2Q 1WDXA 5CCAA 2KI7A 2LCCA 3INZA 4N4IA 3HB9A 1RAGB 4KGZB 3OYMA 4UN0A 1VQ6T 3MPUB 3KBGA 1NLPC 1T0JA 1QLBA 1HK9A 4RTUA 2YHTA 1NYGA 2JJ9A 3VS6A 1SEMA 1YWPA 1X2KA 1NEBA 2XDDA 2QGFB 4MDWA 1D3BA 3P8BB 1UJYA 4YOSA 2ESWA 3BDUA 1UJ0A 1I1JA 3REBB 2W99A 1LNXA 3I56A 1UHCA 1VQ6A 2QQ9A 2KXDA 4FYWB 4XQ3A 2VASA 1ZSZA 1FXXA 2MMPA 1YITT 1R77A 1D3BB 2OI3A 2PTKA 2I40B 3RBBB 2PVDB 2CSIA 1VYWB 3CC7A 3EGXB 2G6FX 4OF1A 3JB9F 2WEVB 1PWTA 2ABLA 2ATCB 2E5QA 3KXTA 1NJIR 2OTLQ 3M4YA 2KEAA 2BZ8A 5GAMg 2DPPB 4BY6C 2QQBA 2V1RA 4D8DA 2DBKA 3EGUA 1VQKT 3CMEA 3EG1A 3GIBA 3SWNC 4EDUA 2UZLB 3ER0A 1JSTB 2LVMA 2JMCA 3DDPB 1WHKA 1TD6A 1WA7A 2GF7A 4GLKA 2DK3A 1FMVA 4FIBA 3H6ZA 8AT1B 3OMCA 1VQPA 3I56Q 1M90U 1YITQ 1SPKA 1BI3A 2LTOA 2RQUA 3R6OA 3VS3A 1P92A 1YJ9Q 4ANJA 5KYYB 5DLOA 4OVAA 2WSCE 2HQEA 4M77F 4LN2A 1YI2Q 2K79A 1Q7YR 3TNHB 4ZGJB 3VS2A 3UA7A 3RKXA 1YIJA 1OQKA 4OB1B 3PE0A 4KH1B 2YRDA 5FRNA 4NOYA 5IHIA 4KULA 3UPUA 2AHJB 1X6OA 2R5MA 2EKHA 3LLRA 4KT0E 3EG3A 3VYHB 2PVOB 4A4FA 1YCSB 2QEXA 1K9AA 2V8KA 1WQ7A 2NUTB 2AIRB 2AZVA 2EGAA 5GAN6 3PVLA 2HSPA 1I0CA 4YOOA 2LCLA 2RH2A 3I56T 3BLRB 4HKEA 1AD6A 1B34A 2JTEA 1YIJT 3L2QA 2L3PA 5HKCA 4BBSM 2MCNA 1NYFA 1D0XA 3JB9G 4L6V5 4ROEA 1Q86U 2COWA 4X9DA 4LNPA 4DBFA 4N4GA 1M3CA 1YNZA 3V7CA 3DTOA 4EOPB 3OYLA 2JTMA 4E7SA 5LL6S 4FT2A 3K7AM 4ZGDB 3SEMA 3J81E 1Q7YU 2P84A 2AT1B 3JB9H 3KHIA 5GMKl 3OYBA 1VIFA 2F2VA 4CFUD 5GANh 1PSFA 4M7DB 2ZAEA 2RI3A 1H3HA 2FRYA 4NC6A 2DIQA 3OYYA 2QASA 3CBMA 4B9XA 3G6EQ 2ENMA 2NUPA 2XICA 3QHRB 3UF4A 1MUZA 2RQWA 4KH0B 3ME9A 3THKA 2SEMA 3URGA 4OMMA 3OW2P 4J9GA 2QK0A 3CCEA 3HRSA 4K11A 3M58A 1YJWA 4PLIA 3QYHB 3M54A 3M0UA 3MHXA 1NEGA 4L5GA 1E9HB 1PNJA 3NTIA 2H8HA 4JJCA 3OYEA 1DJ7B 2ZGWA 3FRNA 3VUBA 1K1ZA 2JW4A 3LH0A 2R7GA 1O75A 1MGQA 2RJFA 4M7AF 1M1FA 3SDZA 1ZBXA 3CCET 3LYIA 4OGRB 4EOSB 2V26A 3ZEHA 4F70B 1YJWT 1VQ5A 1FVVB 1S72T 2DRMA 1D09B 2P0PA 2D6FA 1ARKA 1RL2A 2IIMA 1WIEA 1HD3A 2J7IA 2ECZA 4ELLA 3NPFA 5FWBA 1AOJA 4AKIA 4ELZC 4PJMA 2VXEA 2CJMB 4XTYA 3O0GD 3MEVA 3PFSA 2JS0A 2W96A 1H3ZA 2CDTA 1Y0MA 5EG2A 3L1AA 2HSEB 2IPOB 2DMOA 3TREA 1R8OB 1F5QB 4GLMA 2DXTA 4E47A 3NTKA 3EG9B 2PUOB 2XI9A 1S1NA 4C8QB 2KGTA 4F14A 1AEYA 1GFCA 1ACMB 4Z6YA 4C8QF 2EYWA 9ATCB 3OYCA 3FEOA 4M77B 1IZ6A 3G71T 1S72Q 3M0RA 4QVDA 3C94A 3X26B 2X4JA 1KQ2A 3PIPA 2JVVA 3M5AA 1SG5A 3V8JA 3CCRQ 5I2MA 1XO2A 2KE9A 1RAAB 2MPXC 4M75C 4J9FA 4LXCA 4EC8B 4EOIB 3JB9D 3E9FA 2YRCA 4QT7A 3UT1A 1VQ8Q 4LE9A 3RKYA 1Q7YC 4LDWA 1PD1A 2EFIA 2DJZA 2MK5A 3CC2T 2P0QA 1JO8A 2LX9A 1WQWA 2DXBA 4F7SB 2HQHA 4XAXB 1OIYB 1VQ6Q 3MP1A 2HZYA 2L3QA 2VB6A 3DDQB 1K73C 3VKGA 1N4MA 1O9SA 5DLQE 2DRKA 1WXTA 2KSSA 2KMTA 4RCBA 3MI9B 1HSQA 3CPFA 4ELJA 1WGSA 3CCVQ 2G77A 2RQTA 5LMKB 3HFOA 1KD1R 3H8ZA 4JS5A 3CC4T 3M9QA 4EONB 2PMIB 1RABB 4EMHA 2ZPEB 2LJ0A 4AFSC 5GAOp 3OYKA 3CCUQ 1W4SA 1J3TA 5CYIB 3Q1JA 4JDSA 2W9ZA 1KG1A 3QDFA 3BLQB 1IREB 1KXUA 3EH2A 4EIKA 2YUQA 5IH2A 1UECA 3M57A 2RI2A 4RCCA 1D0ZA 3VYGB 2QGGA 3CCQT 2DTOA 1XTDA 3CCLA 4PJOB 1VQKQ 1VQOT 2EYXA 5AYFA 1EFNA 4J6XA 4MMLA 2ROTA 2LC4A 2D9TA 5GANf 1PM3A 4E7KA 3LH5A 2WSEE 2EW3A 2LDMA 3A8LB 2GFAA 3CCVT 1JQQA 1HXDA 2JXBA 3TN8B 1B3QA 1PKSA 3T9NA 2PQWA 4M7AE 5C6SA 1WHLA 1YP5A 3VJPA 4EOQB 2V1QA 3H41A 2P0KA 1R0BG 4BE0A 4FM4B 2CP5A 4BCHB 1I4K1 1RAEB 1GCQC 4JX5A 2FEIA 2EAYA 2EPDA 5GAOr 1VQLQ 2KNBB 3VKIA 3CMAT 2DM1A 4HCZA 1VQ5Q 2GFUA 2RHIA 1XOVA 3UDCA 1QWFA 2ZPGB 4M75B 2X51A 5D6YA 2QEXQ 4UC4A 4HL4A 2DTIA 1G5VA 2QGSA 2DFUA 2LW4A 4RTXA 5M9OA 1ZSGA 2R5AA 5CQYA 2X9HA 2LJ3A 2A37A 1W6XA 2QFZA 3WVDB 1MMDA 4OB2B 2DVEA 4XU3A 3CMAA 4DBHA 2FPEA 4WCIA 5FGKB 3CCMQ 2KVQG 2CCHB 4YOZA 3CXCP 3S6WA 2J05A 2OTLA 5CEIB 1UHFA 2DXCA 3JCMX 1KC8U 1X43A 1OKWB 3CMEQ 2DIGA 4C8QD 1OYXA 4KGVB 4AFUC 1KQSS 1UTIA 4C92G 2K5IA 4HCKA 4C8QC 1H1QB 2E5KA 2DL5A 3TSWA 3PO3S 2X4WA 4KUIA 2C0TA 2X35A 1SHFA 2I2LA 4OMLA 4F04B 3EFOA 3JV3A 4AKHA 2HEQA 1VYVA 5LJ5f 4MIMA 3JB9J 2A3LA 2XKOC 1KJWA 1YI2A 2GBQA 4M78F 4M7AA 1RUWA 4FSSA 3OBWA 2CZ0B 1SSHA 1Q82R 2O2OA 5J3BA 3CMET 1QQJA 2CH4W 2UZEB 1OU8A 1WJRA 1VQ4A 5LJ3e 4IUTA 4ORZA 1PKTA 5LJ3h 2X4YA 3CCVA 1D0YA 3E19A 2QA4Q 4ROCA 4XU2A 1BYMA 2ED0A 3X24B 1VQ9Q 3JCMV 4RG8A 2BKZB 2MIOA 4QQGA 2EBPA 4PJOE 1AT1B 5GANj 1GBRA 3G33B 3RR6A 1M1GA 5GAMh 1N5ZA 4AG2C 1C0MA 1U1SA 1RI9A 2CZ6B 4M75G 1WPYA 3EG9A 5LJ3d 4D8KA 4F16A 2W9FA 1GXIE 2WXVB 5C0MA 4XK8E 4J9IA 3OS5A 1VYUA 3FIFA 5I2SA 3OW2A 2OTLT 2LNVA 3JSCA 1X75C 4PFZA 5HVYB 1RACB 1OL2B 3X20B 1PG5B 2QAZA 4A4GA 1T0HA 1UNHD 4HVVA 1M1KC 2DYBA 4M78G 2DVJA 1YJNA 3LGLA 1Y57A 4M7AC 2HNIA 4J6YA 5DQVA 2FYKA 1VQ9T 1UGQB 4OB0B 1OX8A 2VGMA 4IKFA 2XHCA 1PRMC 2CZ7B 4R0KA 2EWNA 4J7FA 4CC4B 1NE8A 5A0DA 2UUEB 1UUEA 1YBYA 2E64A 4A4EA 4C5HA 3FJPA 4HA8A 3UA6A 5GAOq 1YI2T 2BPMB 1RAIB 4DQ2A 4DA4A 1A0NB 2KT8A 4J6WA 2MAMA 1BKBA 5CKDA 1KFZA 4C0GA 1RLQC 4E7LA 2WFYB 1H8KA 1MMAA 2ROLA 1VQMQ 4RMOA 2QDLA 1ABOA 1YCYA 1FX7A 5IAYA 4DEXA 5LJ5h 2BS4A 3GBQA 2JM9A 4M77A 1F1BB 2JZ2A 3SD4A 4BCQB 3E2UA 2NLUA 4NL3A 1IB8A 2XDPA 4PJLA 3C0CA 3MO8A 2DILA 4DOVA 3L2RA 5CO7A 2DL8A 2LRQA 4EOOB 3X25B 1U06A 4PJOA 2E3HA 4OMPA 2HBWA 2RJCA 2RNAA 2DXBB 1BK2A 2KR6A 2LQNA 3A8OB 3M4GA 3HZJA 1MMGA 1OU9A 4M77G 4EOKB 1V1CA 2YRVA 4QW2A 1OV3A 2L89A 1AVZC 4C8QE 2RQRA 3PIOA 2COZA 4BI4A 3EG2A 3EAEA 1VQMT 1TUCA 4N0AA 5D6WA 5KYNA 3E9GA 3EJ1B 5GJWB 1Q81C 1K9MC 1IO6A 2BZXA 4IUPA 1VQKA 4KUDK 1SRMA 4CFMB 1ZX6A 5IXBA 3OS1A 2HDAA 3G6ET 2LQKA 3V7SA 4LD6A 3L2UA 4AFQC 2K5LA 3RIRA 4JJNK 3JCMP 2BKDN 1TS9A 4RG2A 1TWBA 2RHZA 1BU1A 4FCYA 4A4KA 2VV5A 3FLGA 1BU2A 1AZEA 2YUOA 3VRYA 2DEUA 4M7AG 4PKCC 3QYGB 4CXAB 5CR2A 1GCPA 2CT4A 4IMYB 3LWIA 3OQ5A 4AG1C 3FB9A 5FROA 1NG2A 2VUBA 3R6NA 5LQFB 3CMAQ 2AZSA 3DKMA 5KYYA 1ENWA 3JCMg 1JXMA 3CPWP 1Y96A 2M02A 1YJWQ 1JJ2S 1K8AR 2E1HA 5KE3A 4R56A 4JX6A 4BY7X 1G3YA 2ED1A 4NS5A 2K3YA 4RKUE 4N0AC 2IW8B 4M6VA 2CP6A 1QVGP 2K2VA 1G3WA 2RB6A 1OEBA 3MP8A 4OMFB 1H641 2KK4A 4EC9B 1TSFA 4IUVA 4F6WB 3MIAB 4F7LB 1M90R 3LW5E 1V29B 3VV0A 1IXDA 2E12A 4JUVA 4J7IA 1KC8C 4I3ZB 1KK7A 1M2OA 1VQ7Q 1R0CB 3QXEB 1VOLA 2A0FB 1NJIU 4PLLA 2OTJQ 4BDZA 4BE1A 3OYGA 2SRCA 5LJ5g 4BCPB 4RTYA 4EMKC 4Y91A 2PU9B 2O4XB 1QVFS 5I5ZB 3G71Q 3ULRB 2RI5A 1UFFA 5GAMd 4EORB 2MOXA 4C92E 1W1FA 3I9QA 3DB4A 3POMA 2AKLA 2KROA 3OS2A 2WMBB 2KDSA 4BDYA 3JAME 4CC3A 4HT9A 2DD5B 3CCLQ 1H1RB 2BUDA 4YTLA 1OGUB 1H28B 1ZUYA 4RTTA 4G6LB 3BW1A 1Q82U 4XTXA 2WACA 1E7PA 2GNCA 2E6ZA 2CP3A 4QQ6A 1AD5A 3MEUA 3OYDA 1VQ7T 4JPBW 1BCOA 2DD5A 5ACBA 2XG8D 1VUBA 1M30A 3L2WA 2HKQB 1BI1A 3CCJT 2X1NB 2K3BA 4QQDA 4BCFB 3IQLA 1JKWA 3A8MB 4EMKB 2EVRA 4F7UG 5J39A 2L2PA 2QXFA 4ME7A 2CP7A 4AI6A 2VXFA 4F7NB 4JZ4A 2DKGA 1UB4A 2B86A 5IT9E 5FU6C 4M7AD 2O88A 4EMKA 3PT9A 1N27A 2UZDB 2MI6A 2ZPHB 3N5BB 3EH1A 2HL3A 1ABQA 3NHNA 4MMKA 1B34B 2KAFA 1WHMA 2F5TX 1ZBJA 3H9NA 3I35A 3OMGA 2LT1A 1E6GA 2IW9B 3MY1B 3EGDA 4OMOA 2IVWA 3M0QA 5KH6A 2D8JA 1G3NC 1WZOA 5HK0A 1CKBA 3TW7A 1LCKA 2LMJA 1C9BA 3OYHA 3P8HA 3VS5A 3RESA 2BE7D 4CFXB 3RMQA 1VINA 2JOYA 1YFNA 4OGCA 2CP2A 2RD1A 3A8GB 4BACA 1VQNT 2DD4B 1WJSA 2X3WD 3RMSA 1ZSZC 1VQLT 3D7SB 1VQ5T 3GPLA 4NSTB 1H1SB 4O6JA 3I5SA 3QWLA 1I81A 3QZ5B 2XDBA 3DL1A 2DERA 4LDVA 5KYUB 2YXYA 1IRXA 2RA2A 2IW6B 2RK2A 3GOXA 2AKKA 4FYYB 5L2WB 4OMQA 1WHJA 3MY5B 4BCMB 2EKOA 4M4ZA 3ASKA 3G4SQ 1G83A 1KQSP 4II5B 2L3RA 1YJ9T 1JRIA 2JUFA 4J83A 1M90C 1VQ7A 3CC4A 2OX7A 5LJ5j 1KHCA 3QKJA 4MZPA 3I55Q 3VU3C 3LQ5B 1MNEA 3S3MA 3SHWA 3BHTB 1Q86R 2O31A 2RMOA 1WHHA 3QG1A 5CIUA 3V8LA 3CEYA 1P5EB 1OI9B 1EZZB 3MCAB 4B6MA 4ELYC 1YJ9A 2E4HA 4J5YA 1D1CA 4OMNA 1N9SA 2FZCB 3P8DA 1NZ9A 1VQOA 3WVEB 5GMKi 2CKKA 1JSUB 5KE2A 2ZPBB 5IDPB 3CC2A 2K5FA 5GAN3 1AZGB 3GLXA 1OKVB 1SRLA 5GMKe 1OPKA 2E6NA 1O9KB 3VYGA 2M51A 2NUZA 4J9CA 1PHTA 1GY3B 2CT3A 2B8AA 2VKNA 4VUBA 1WXBA 2VGNA 4LUEA 2OJ2A 2CH4A 3QZ9B 4M7DG 2JN0A 3H0FA 2WIPB 2FPFA 1YHQA 5GAOn 1B7TA 2O01E 1N8RU 2I53A 1YN8A 1UGPB 1M1KR 1AISB 4M7AB 3EHRA 4JJDA 1PC0A 4C5EA 3UATA 2P4RA 3JRZA 3CCRA 1QP3A 2HMAA 1QCFA 2DA9A 3QJ6A 5GJVB 4J9BA 2RO0A 2Y4YA 4J8OA 4X1VA 3FJ5A 3VS1A 2R58A 3J80E 1ZP2A 2V8IA 3RGFB 1FINB 2PJQA 2EYZA 5GMKh 4GY5A 3GP8A 3DLLA 1VA7A 1Y96B 3PTAA 3SFMA 2LQWA 2MWOA 5IHYA 3CBPA 2OTJT 2KR3A 4JX4A 4FW2A 2HKNA 2LCSA 4A63B 1AWWA 3HRUA 4LDXA 2GTJA 4Z88A 5GAMj 3RKWA 1M4ZA 4BCIB 4BY1X 2H3JA 5HQ0B 2DXCB 2J6KA 2DZ9A 4E7ZA 5EJCA 1D1BA 4BCJB 2LNHB 5HBEB 1GH6B 2KQWA 1JBMA 4TTHA 4HNVA 3H4CA 4MFEA 2BTTA 2EGEA 2OAWA 1M3BA 2EQKA 3B57A 1I07A 2DJQA 1FKMA 3JCMh 3VS7A 2ZZDA 3C95A 1H25B 4D6WA 1UGSB 3E1SA 1OZ2A 3I5RA 3RNJA 2J6OA 1X2QA 1YHQT 1QP2A 4CFNB 2Z0WA 3DB3A 1KSWA 3JB9I 3GF5A 2EQUA 2RQVA 3HBLA 4DBRA 3L2VA 2EGCA 1MHNA 2DTHA 1Y71A 1BBZA 4PJOD 1BI0A 4O5VA 1BI2A 4TVRA 2PK2A 4Q5WA 4X9CA 4C0DC 2CREA 4F6UB 1K76A 4KGXB 1PD0A 2DLPA 4C92B 3MP6A 3TNWB 4C92F 5CQXA 3CCRT 3TQ7P 4EOMB 2WHBB 1KQ1A 5I22A 1I5OB 2EJFA 4X34A 2CUDA 3J7AF 1SKUB 4BI8B 7AT1B 3H0HA 2CS7A 4OP0A 1Q81R 1K9MR 2E3IA 2KYBA 1UNLD 2ZCFB 5KCHA 3OB9A 3QPHA 1NM7A 5CKBA 4XTVA 2G3RA 5EFQB 3TNIB 5A0LA 1QVGA 1UGVA 3UWNA 3G1JA 1HJDA 3HL8A 4DEYA 3M56A 5CVIA 4F7UA 4V2SA 2JMAA 1BIBA 3C12A 5IHKA 2DL4A 5D6XA 8ATCB 3PVQA 4HCBA 4E7JA 1WLPB 5GANg 3MJXA 1JB0E 2MYSA 3QO3A 5IXFA 2VWFA 2A7YA 1M5Q1 2HL5C 5FU6B 4AMCA 4DOWA 1X27A 4JS4A 2QQAA 2K4YA 4LUDA 3CCUT 1NJIC 5LJ3g 3CPWS 3JCMJ 1JJ2P 1OZ3A 3OYJA 1WI7A 3HHTB 2QTVA 1VQNQ 3OYIA 3OY9A 3OSVA 2QQSA 2GQVA 2PZ1A 2A36A 1K8AC 4RTVA 2FG0A 3CCQQ 1QVGS 1I8FA 4E2FB 1U1TA 2DMEA 1WXUA 2C4GB 2XMFA 1QKWA 4JLGA 4DBQA 3QBYA 2E70A 4BCMD 2GGRA 3ZBDA 2O9VA 1KD1U 5I11A 2PNIA 1Z9ZA 5LJ5d 2WIHB 5DY9A 2BS3A 4ZN1A 1WFWA 2VYTA 3QHWB 1UNGD 2J06A 3OSSC 1G8XA 1W2BS 2E41A 1BCMA 5FU7B 4M7DE 4BCKB 1UGRB 3QWXX 5D7UA 1Q95G 1K73R 1QVFP 1H92A 3HRTA 3BG9A 5CK9A 2JTFA 5ICPB 3QHSA 3SWNB 3RDVA 2NUPB 3JCMc 1TXQA 3NFCA 1TUGB 2EUFA 4P5NA 2COYA 4M75D 1QWEA 2QQRA 4M7DF 3U23A 4OB3B 1IGQA 4QSHA 1E6HA 2A08A 2DF6A 1N8RC 3VUZA 4BE2A 2QEXT 3L2ZA 4RODA 1TG0A 2X4XA 5FRMA 3JCMQ 3O5ZA 2DXUA 4JRKA 3BY7A 4CI0C 1H4LD 3G6EA 4EOJB 4CRLB 5GAOm 3JCMf 4HCCA 3HP9A 2CYZB 2CUBA 4HXJA 2EQIA 1JXOA 3BE3A 3L42A 1ZSZB 2RM4A 1VIEA 1OL1B 3DOGB 1LPLA 2CGHA 5GANd 4AKGA 1M2VB 3EGXA 2KMGA 3NMZC 4M75A 4M77E 5L23A 1JJ2A 2EQJA 3EFRA 4JRIA 2X3XD 2AK5A 2BE9B 1OX9A 2RJEA 2G9XB 4ZTJA 1YITA 1QVPA 2FZKB 4NL2A 3HO8A 5IN1A 3ZL7C 1N8RR 2YUNA 2XIDA 5AT1B 2QYZA 2GQIA 1XQHA 1IHVA 5EC7A 1QLYA 2IVXA 1QVFA 1LOJA 4C0DB 4C8QG 4RTZA 2YUPA 2F5KA 2QQ8A 4FYVB 4CRIA 1LVKA 4HNUA 1GUXA 2C06A 2KRSA 2RN8A 5GMKm 1ZUKA 3CD6A 4WTOB 5HBHB 1MNDA 4C8QA 1GBQA 3M53A 4JRQA 4LD9K 4M7DA 2K57A 3CCMA 2BS2A 4LDUA 2NWMA 3EHQA 3NGPA 3OBYA 4BCNB 3I55A 1VOMA 4BCND 5GAMe 5HK3A 3OYFA 3M0PA 2NYSA 4QVZA 3EFOB 3M03A 1TOVA 2L3SA 1XJWB 4IUQA 1QKXA 4LDYA
chains in the Genus database with same CATH topology
3QYEA 2MF2A 3KUFA 4IURA 5M9OA 1WJSA 2R5AA 5CQYA 3RMSA 3M55A 1AHJB 4HLQA 3S3OA 1VQLT 2QFZA 3GPLA 3WVDB 3O8VA 2ZPIB 3WXMB 5DM7R 3OS0A 2FB7A 4A53A 4OB2B 2DVEA 4O6JA 3CXCA 1FWZA 4F7UE 4XU3A 3QWLA 1I81A 3QZ5B 1X01A 3DL1A 2JNGA 4C0FA 3LGFA 4BY6B 4QVCA 5GMKj 4LDVA 2XDBA 5HY6A 3PMIA 2KVQG 2PVGB 4BD3A 1SSFA 3CXCS 4BBRM 4ZTFA 3S6WA 1TH7A 5FU7C 3CCJA 2OTLA 1VQMA 5GANe 2RA2A 1VQPT 1KC8U 2DXCA 3JCMX 2RK2A 3GOXA 1LJOA 2LQ8A 2DIGA 4C8QD 1OYXA 3QIIA 5LJ3f 2EKOA 4M7DD 3ASKA 3SWNA 1WJQA 4ATOA 1KQSS 4MDXA 1KD1C 1G3TA 4C92G 2L3RA 1YJ9T 3A8HB 1JRIA 2JUFA 2K5IA 4J83A 3BDLA 4C8QC 5CCAA 3NTHA 5GAN2 1M90C 1VQ7A 1UEBA 3CC4A 4M75E 5LJ5j 3BG3A 2LCCA 3INZA 1KHCA 4N4IA 3HB9A 2X4WA 3QKJA 4KUIA 4MZPA 3OYMA 1VQ6T 4M7DC 3OYAA 2X35A 3KBGA 3VU3C 2I2LA 3QUIA 5I21A 3S3MA 1QLBA 1HK9A 5LJ5e 2YHTA 4AKHA 5GAOl 3QG1A 5CIUA 5LJ5f 4MIMA 3V8LA 3G71A 3CEYA 2XDDA 3JB9J 4FT4A 5A2QE 2HBPA 2A3LA 4MDWA 2XKOC 4JLIA 4F7UF 2F69A 3MCAB 1YI2A 1D3BA 2Y4XA 3P8BB 4M78F 4ELYC 1YJ9A 4M7AA 2FL7A 4J5YA 3BDUA 4F7UB 1N9SA 2CZ0B 3OBWA 3P8DA 1NZ9A 5CKEA 1VQOA 3WVEB 1LNXA 5GMKi 1Y07A 4A4HA 2WJ9A 3HKSA 4XTWA 2CKKA 5J3BA 3I56A 2QQ9A 5KE2A 3FC3A 1VQ6A 4PJOF 2ZPBB 3BFMA 2YLBA 3M59A 4XQ3A 3CMET 2MMPA 1FXXA 2K5FA 5GAN3 3S3NA 3LWHA 1YITT 3CC2A 1WJRA 3GLXA 1D3BB 1VQ4A 2EJGA 5LJ3e 5GAN7 4IUTA 5GMKe 2PVDB 5LJ3h 2E6NA 2X4YA 3CC7A 3CCVA 3E19A 3VYGA 4XU2A 1BYMA 2R57A 4OF1A 3X24B 3JB9F 3JCMV 2FHDA 2E5QA 4RG8A 3KXTA 4C92A 3TW6A 2B8AA 3M4YA 4QQGA 2DO3A 5GAMg 4PJOE 3CD6T 2DPPB 4VUBA 2QQBA 4BY6C 5GANj 2VGNA 2RHYA 1M1GA 5GAMh 4JRPA 4E7IA 1VQKT 3CMEA 3GIBA 3SWNC 3QZ9B 4EDUA 4M7DG 1U1SA 2JN0A 3ER0A 2CZ6B 4M75G 3CCMT 2LVMA 1YHQA 1WPYA 5GAOn 3CC7T 5LJ3d 2O01E 4C5GA 3RUXA 1N8RU 1GXIE 4M77C 3FDRA 5C0MA 4XK8E 3LX7A 1UGPB 2GF7A 3OS5A 4GLKA 2DK3A 3FIFA 2M0OA 4XTZA 5I2SA 2LNVA 4FIBA 3H6ZA 3JSCA 3OW2A 3OMCA 2OTLT 1X75C 4M7AB 3TCJA 1VQPA 1NPPA 1M90U 4C5EA 3X20B 4E7HA 1BI3A 4A4GA 2LTOA 3JRZA 3R6OA 1M1KC 1P92A 4BUGA 4PJOB 4M78G 3QJYA 1YJNA 1K8AU 3CCRA 1QP3A 2E10A 5DLOA 3LGLA 4OVAA 2WSCE 4EPCA 3QJ6A 1S72A 4M7AC 2QDYB 2HQEA 2RO0A 2Y4YA 2HNIA 4J6YA 2FYKA 4M77F 4J8OA 1VQLA 4M77D 1VQ9T 4OB0B 1UGQB 2VGMA 4IKFA 2XHCA 2CZ7B 4ZGJB 2R58A 4C0ZA 3J80E 2V8IA 4M78C 2LT4A 2EWNA 4J7FA 3JCMb 3RKXA 1YIJA 4OB1B 2QA4A 1NE8A 5A0DA 5FRNA 4NOYA 3ZFJA 4KULA 4XU0A 1YBYA 5GMKh 3UPUA 2AHJB 1X6OA 2E64A 2R5MA 3LLRA 4GY5A 4KT0E 3GP8A 4A4EA 3VYHB 2PVOB 4A4FA 3DLLA 1Y96B 4C5HA 3PTAA 2QEXA 2M16A 5FLXE 2V8KA 3SFMA 1WQ7A 2MWOA 3FJPA 4HA8A 5GAOq 3CBPA 1YI2T 2OTJT 2ZPFB 4JX4A 5GAN6 3A5ZB 4C92C 4DQ2A 3HRUA 4DA4A 4J6WA 4LDXA 2LCLA 1BKBA 2MAMA 1K73U 5CKDA 4XU1A 3X28B 2RH2A 4C0GA 5GAMj 3I56T 4E7LA 3RKWA 1M4ZA 4HKEA 3OYNA 1B34A 3HFNA 2H3JA 1YIJT 4RMOA 3L2QA 2DXCB 2DZ9A 5HKCA 2QA4T 4FSXA 1YCYA 5EJCA 2GCXA 1FX7A 5IAYA 2L5QA 4PNOA 5LJ5h 2DEQA 2BS4A 4BBSM 3JCMd 4KBMB 2KQWA 3DLMA 4M77A 1JBMA 4HNVA 2V8JA 3H4CA 3JCMW 2JZ2A 3SD4A 1EIFA 2XU8A 4MFEA 3JB9G 4L6V5 1Q86U 2EQKA 2PUKB 3G7ZA 4X9DA 2D0QB 2WSFE 4N4GA 5CAIA 1FKMA 2NLUA 4NL3A 3JCMh 4D6WA 2ZZDA 2XDPA 3C95A 3V7CA 3MO8A 3V8KA 3OYLA 1N9RA 1UGSB 4DOVA 3L2RA 5CO7A 4M78B 4MZMA 2JTMA 3E1SA 5LL6S 2LRQA 5A0GA 4FT2A 1OZ2A 4M78D 4ZGDB 3X25B 4PJOA 3J81E 1Q7YU 3JB9H 1YHQT 1QP2A 3KHIA 3DB3A 3JB9I 5GMKl 2RJCA 3GF5A 3OYBA 4R55A 2MWPA 2DXBB 2EQUA 3HBLA 2KR6A 1VIFA 3A8OB 3M4GA 5GANh 3HZJA 1PSFA 4M7DB 1M1KU 4M77G 3L2VA 1MHNA 2RI3A 2YRVA 1N6AA 2DTHA 1Y71A 4QW2A 4NC6A 2DIQA 4M78A 3OYYA 2L89A 3CBMA 4B9XA 3AHUA 1BI0A 4C8QE 4PJOD 4O5VA 3PIOA 4BI3A 4BI4A 1BI2A 4TVRA 4X9CA 4Q5WA 4C0DC 3EAEA 2XICA 5J26A 4HT8A 1VQMT 4C92B 3ME9A 3MP6A 1I5LA 4BB7A 4N0AA 5D6WA 3URGA 4C92F 3E9GA 3OW2S 2QF7A 5CQXA 2EYQA 3CCRT 1Q81C 1K9MC 4IUPA 2DD4A 3GNFB 1VQKA 3CCEA 4KUDK 1KQ1A 1OI1A 3HRSA 4X34A 1NPRA 2EJFA 3M58A 1WNLA 3J7AF 5GAN8 1YJWA 3CPWA 4PLIA 3QYHB 4BI8B 3M54A 3OS1A 3MHXA 3G6ET 2LQKA 2CS7A 4L5GA 4OP0A 3V7SA 1XNIA 4LD6A 2QI2A 3L2UA 1QVGS 2OAUA 3NTIA 4XTUA 5KCHA 2ZCFB 2K5LA 3OB9A 3QPHA 5LJ3j 3OYEA 3RIRA 4JJNK 5CKBA 4XTVA 2G3RA 3JCMP 1DJ7B 2ZGWA 5A0LA 3FRNA 2BKDN 1QVGA 3VUBA 4RG2A 1VQNA 1QW1A 3UWNA 2RHZA 3LH0A 1O75A 4A4KA 3HL8A 1MGQA 2RJFA 1KQSA 4M7AF 1M1FA 3SDZA 1Q82C 2VV5A 3M56A 1ZBXA 5CVIA 3FLGA 4F7UA 3CCQA 4V2SA 3CCET 3LYIA 2RK1A 4IUUA 2CZ1B 1BIBA 4Z02A 3C12A 3CCSA 3ZEHA 3CCLT 1YJWT 1VQ5A 4M7AG 5D6XA 5CKHA 1VQ5T 1S72T 2EQMA 4PKCC 3QYGB 2P0PA 2D6FA 5CR2A 4HCBA 4E7JA 2YLCA 4PL6A 5GANg 1JB0E 1RL2A 3QO3A 3LWIA 1W2BA 3OA6A 4PJOC 3OQ5A 3CMAA 2A7YA 1M5Q1 5FU6B 4DOWA 3FB9A 5FROA 4JS4A 1VQ8A 2VUBA 2QQAA 2K4YA 4ELZC 4AKIA 3DKMA 3CCUT 1NJIC 2VXEA 5CKFA 4XTYA 3JCMg 5LJ3g 4MZTA 1Y96A 3CPWS 3JCMJ 1OZ3A 2M9UA 3MEVA 3PFSA 2VC8A 3OYJA 1JJ2S 2E1HA 5KE3A 4R56A 3HHTB 4JX6A 3CCST 1H3ZA 3OYIA 3OY9A 4HNTA 5EG2A 1G3YA 3L1AA 4NS5A 3OSVA 2K3YA 2QQSA 4RKUE 2GQVA 1KHIA 3RERA 4N0AC 1K8AC 4M6VA 2M1HA 1R8OB 2K2VA 1I8FA 3PNWC 1G3WA 2BIVA 2RB6A 1U1TA 3TREA 2DXTA 2RHUA 4E47A 3MP8A 4OMFB 3NTKA 2XI9A 1H641 2KK4A 2PUOB 4JLGA 4IUVA 3TEEA 4C8QB 3GNGA 1VQ8T 3QBYA 2E70A 4Z6YA 3ZBDA 2FVUA 2XD0A 4C8QF 2K3XA 3LW5E 3OYCA 1V29B 3VV0A 1KD1U 2E12A 3FEOA 4II1A 4M77B 1IZ6A 3G71T 4QVDA 4JUVA 4J7IA 1KC8C 5LJ5d 3C94A 2DZCA 5DY9A 3X26B 2X4JA 1KQ2A 2BS3A 4ZN1A 3PIPA 2JVVA 2E65A 3M5AA 2VYTA 3MEWA 1G3SA 4FU6A 4FL6A 3QXEB 3V8JA 1VQNT 5I2MA 3OSSC 2QDJA 4M78E 3JB9D 4M75C 1W2BS 3VKHA 4PLLA 1NJIU 2E41A 4BDZA 3E9FA 4BE1A 5FU7B 4M7DE 3OYGA 1UGRB 2EIFA 3UT1A 5LJ5g 4ZGEB 3RKYA 1Q7YC 4LDWA 4EMKC 5GAMf 1BIAA 2EFIA 4Y91A 2DJZA 4PJOG 5KCOA 2PU9B 3CC2T 2P0QA 2O4XB 3TU4K 1QVFS 3HRTA 3BG9A 2LX9A 1ZHIA 1RI0A 2JTFA 5CK9A 1WQWA 3QHSA 4EMGA 2L8DA 2DXBA 3PMTA 4XAXB 2RI5A 3SWNB 5GAMd 3JCMc 4C92E 3MP1A 3NFCA 3DB4A 4M75F 4P5NA 4M75D 2QQRA 4M7DF 2ZZDB 3HSBA 3EFSA 1K73C 3VKGA 3OS2A 1O9SA 5DLQE 2KDSA 4C5IA 4OB3B 4BDYA 4QSHA 3JAME 2KSSA 2KMTA 4RCBA 4HT9A 2DD5B 1Q86C 4LOCA 1N8RC 2BUDA 4YTLA 3VUZA 3L2ZA 2QEXT 4BE2A 5GAN5 3CPFA 4ELJA 1WGSA 2HD0A 2X4XA 5FRMA 2G77A 3BW1A 3HFOA 4XTXA 2WACA 3JCMQ 1Q82U 3H8ZA 2DXUA 2OTJA 1E7PA 4JRKA 2E6ZA 3MEAA 2XK0A 3BY7A 4QQ6A 4JS5A 3MEUA 3OYDA 3CC4T 2IG0A 4CI0C 1VQ7T 4OGEA 1ZQ1A 3G6EA 3M9QA 2DD5A 2XG8D 4EMHA 2ZPEB 1VUBA 5GAOp 5GAOm 3JCMf 2EJ9A 3OYKA 3C4SA 1W4SA 3HP9A 4HCCA 2CYZB 3L2WA 3Q1JA 1BI1A 4JDSA 2HAXA 3QDRB 1M9SA 4N4HA 3CCJT 1KG1A 3L42A 4QQDA 2P4TA 1IREB 3A8MB 2RM4A 1VIEA 2Y90A 5L8RE 3SB2A 4EMKB 3M57A 1YJNT 2CGHA 2RI2A 5GANd 4AKGA 4F7UG 2QXFA 4ME7A 4RCCA 5J39A 2KMGA 3VYGB 3CCQT 4AI6A 2VXFA 2DTOA 2O4XA 4M75A 4WF2A 1U8RA 1XTDA 2DKGA 1UB4A 4M77E 3CCLA 3CBOA 1JJ2A 1VQ9A 5IT9E 2EQJA 3EFRA 4JRIA 3PGGA 5AYFA 5FU6C 4J6XA 4MMLA 3G4ST 1VQOT 2RJEA 4M7AD 2LC4A 4EMKA 2D9TA 3PT9A 5GANf 1N27A 4ZTJA 4C92D 1QVPA 2MI6A 4E7KA 4NL2A 1YITA 3HO8A 5IN1A 2ZPHB 2DAQA 2WSEE 3N5BB 2XIDA 1PSEA 1XQHA 3BG5A 2LDMA 4MMKA 3A8LB 1B34B 2GFAA 3CCVT 1QVFA 1HXDA 1LOJA 2KAFA 4C0DB 2QTXA 2F5TX 4C8QG 3CCUA 3I55T 5GAN4 3T9NA 2PQWA 2RJDA 2F5KA 4M7AE 3OMGA 2QQ8A 5C6SA 4CRIA 2LT1A 3VJPA 4HNUA 1Q81U 1K9MU 4ZN3A 2KY9A 2C06A 5GMKm 3JCMe 2IVWA 3CD6A 2P0KA 5KH6A 3G4SA 4C8QA 4B9WA 4L59A 4BE0A 1Y7XA 3M53A 5HK0A 4JRQA 4LD9K 4FM4B 3F70A 3HPWA 3TW7A 4A54A 4M7DA 2K57A 4Y28E 3P8HA 3OYHA 2BS2A 1I4K1 3CCMA 4LDUA 4JX5A 3OBYA 3QSUA 1M8VA 1VQ4T 2EAYA 4MFDA 3V7RA 3I55A 5GAOr 3RESA 3VKIA 3CMAT 4HCZA 3RMQA 5GAMe 5HK3A 2JOYA 2GFUA 2RHIA 3OYFA 4OGCA 2RD1A 4QVZA 1XOVA 3UDCA 2RHXA 2ZPGB 3A8GB 3QYBA 4M75B 5D6YA 2HQXA 4HL4A 2DTIA 4IUQA 4UC4A 4BACA 1G5VA 4LDYA 2DD4B 3META
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 E;  1GXI E;  4XK8 E;  1UGP B;  2DD4 A;  2ZZD B;  1AHJ B;  4OB3 B;  3WVD B;  3QYH B;  2ZPI B;  3X20 B;  4OB2 B;  2DD5 B;  3QZ5 B;  2ZCF B;  2PVG B;  1QP3 A;  2WSC E;  1DJ7 B;  2QDY B;  2DXC A;  4OB0 B;  1UGQ B;  2DD5 A;  2CZ7 B;  4ZGJ B;  2ZPE B;  2CYZ B;  2CZ1 B;  4OB1 B;  3A8H B;  3QYG B;  2AHJ B;  1IRE B;  3A8M B;  5L8R E;  4KT0 E;  3VYH B;  2PVO B;  1JB0 E;  3VYG B;  2ZPF B;  3X28 B;  3HHT B;  2DXC B;  2ZPH B;  2WSE E;  1PSE A;  3A8L B;  4RKU E;  2CZ0 B;  3WVE B;  4L6V 5;  2PUO B;  2ZPB B;  2PUK B;  2D0Q B;  2WSF E;  2PVD B;  2ZZD A;  3LW5 E;  1V29 B;  1UGS B;  3VYG A;  4FM4 B;  3X26 B;  4ZGD B;  3X25 B;  4Y28 E;  3QXE B;  3X24 B;  1QP2 A;  2DXB B;  3A8O B;  1PSF A;  1UGR B;  2DPP B;  4ZGE B;  3QZ9 B;  2PU9 B;  2CZ6 B;  2ZPG B;  3A8G B;  2DXB A;  2DD4 B; 
#chains in the Genus database with same CATH topology
 3KUF A;  3CC4 Q;  2F2C A;  2K2M A;  3M55 A;  1AHJ B;  4HLQ A;  2C6T B;  4BCQ D;  3OS0 A;  2H3E B;  3O8V A;  5DM7 R;  2FB7 A;  2NUT A;  4A53 A;  3CXC A;  1FWZ A;  4CC7 A;  1MV0 B;  5LJ3 j;  1X01 A;  4E6R A;  2RF0 A;  4C0F A;  4BCO B;  5HY6 A;  2CCI B;  1SSF A;  2QG9 B;  4JZ3 A;  4PFP A;  1TH7 A;  1H26 B;  1OUL A;  5FU7 C;  3TVT A;  3CCJ A;  1VQM A;  1VQP T;  4PFO A;  4J9E A;  1GFD A;  1LJO A;  3VS0 A;  1M27 C;  5LJ3 f;  4ESR A;  2IN3 A;  1WJQ A;  1M8M A;  1C1A A;  3A8H B;  5GAN 2;  3BDL A;  3NTH A;  1UEB A;  4M75 E;  4RUG A;  3BG3 A;  1YHQ Q;  3BHV B;  6AT1 B;  4M7D C;  2C5X B;  3OYA A;  1GCQ A;  3QUI A;  5I21 A;  5FW9 A;  5LJ5 e;  2KRN A;  1D1A A;  2JS2 A;  5GAO l;  3G71 A;  4FT4 A;  5A2Q E;  2HBP A;  3BHU B;  4JLI A;  1X69 A;  3M0S A;  4F7U F;  2F69 A;  1ZA2 B;  2Y4X A;  2FL7 A;  4F7U B;  1UG1 A;  4KRC B;  1UDL A;  5CKE A;  1VQP Q;  1Y07 A;  4A4H A;  2WJ9 A;  3HKS A;  4XTW A;  3FC3 A;  4PJO F;  3BFM A;  3S3N A;  2YLB A;  3M59 A;  1KIK A;  2L0A A;  3LWH A;  2HCK A;  2EJG A;  5GAN 7;  2CP0 A;  2K6D A;  1D3U B;  3GTM S;  1NBE B;  4JJB A;  1PKD B;  1IGU A;  1TUD A;  4F17 A;  2R57 A;  1YJN Q;  2FHD A;  3NDQ A;  4C92 A;  4F7J B;  3TW6 A;  2DO3 A;  1Z9Q A;  2LP5 A;  3CD6 T;  2RHY A;  4JRP A;  4E7I A;  3CCM T;  3CC7 T;  4C5G A;  3RUX A;  2BZY A;  3AT1 B;  3FDR A;  4M77 C;  1ZLM A;  3LX7 A;  3EGD B;  4XTZ A;  2M0O A;  1WHG A;  1W70 A;  4Y72 B;  2C0I A;  4RTW A;  3TCJ A;  1NPP A;  2A28 A;  4E7H A;  2FO0 A;  4BUG A;  4YC3 B;  2JGZ B;  3QJY A;  1HYO A;  1K8A U;  4F6S B;  4HVW A;  2E10 A;  4EPC A;  1S72 A;  1W98 B;  2QDY B;  1VQL A;  4M77 D;  1VQ4 Q;  4C0Z A;  2YSQ A;  2LT4 A;  4M78 C;  2KYM A;  3JCM b;  3CD6 Q;  1U3O A;  2QA4 A;  3ZFJ A;  4XU0 A;  5HBJ B;  2M16 A;  3CC7 Q;  5FLX E;  1KC8 R;  2ZPF B;  3A5Z B;  4C92 C;  1QCN A;  1K73 U;  4XU1 A;  5KYU A;  3X28 B;  1K0S A;  1TFB A;  3OYN A;  3HFN A;  1MV3 A;  2QA4 T;  4FSX A;  2GCX A;  4AFZ C;  2L5Q A;  4BXX X;  4PK4 A;  4PNO A;  2DEQ A;  3JCM d;  2KXC A;  4KBM B;  3DLM A;  3JCM W;  2V8J A;  1QMZ B;  3QWY A;  1EIF A;  3F5X B;  2XU8 A;  2PUK B;  3G7Z A;  2D0Q B;  2WSF E;  5CAI A;  1QCO A;  3V8K A;  1N9R A;  4M78 B;  4MZM A;  5A0G A;  4M78 D;  4R55 A;  2MWP A;  1M1K U;  2FRW A;  1N6A A;  4AT1 B;  4M78 A;  3AHU A;  3H0I A;  4BI3 A;  4BCG B;  4FYX B;  1RLP C;  2YT6 A;  5J26 A;  3EOC B;  2DNU A;  4HT8 A;  4J9D A;  1H27 B;  3KFV A;  2DL3 A;  2F2W A;  2YWW A;  1I5L A;  5HCK A;  4BB7 A;  4HVU A;  1GUX B;  3OW2 S;  2QF7 A;  2EYQ A;  2B9R A;  2DD4 A;  3GNF B;  1JEG A;  1OI1 A;  1O9K A;  1NPR A;  1WNL A;  5GAN 8;  3CPW A;  3HTR A;  1XNI A;  2DE0 X;  2QI2 A;  2OAU A;  4XTU A;  2WPA B;  1PCX A;  1CKA A;  1FMW A;  2F1L A;  1VQN A;  2O9S A;  2GTO A;  1QW1 A;  1JU5 C;  1AWJ A;  2K7A A;  2W2H A;  2C0O A;  1KQS A;  1Q82 C;  2LZ6 B;  3CCQ A;  2RK1 A;  4IUU A;  2CZ1 B;  4Z02 A;  3CCS A;  2PHG A;  3CCL T;  1C6V X;  2RPN A;  5CKH A;  2KT1 A;  2EQM A;  1PRL C;  1T3S A;  2I0N A;  2DET A;  1K4U S;  2J6F A;  2F2X A;  2YLC A;  1ZUU A;  4PL6 A;  1GRI A;  1W2B A;  3OA6 A;  4PJO C;  4KRT A;  1VQ8 A;  4ZNX A;  1M3A A;  5CKF A;  1OIU B;  4FX3 B;  4MZT A;  2M9U A;  2VC8 A;  4PJN A;  3CCJ Q;  1AWX A;  1UE9 A;  3CCS T;  4HNT A;  2D0N A;  2M0Y A;  3RER A;  1KHI A;  1RAD B;  2M1H A;  3PNW C;  2BIV A;  2RHU A;  1ZA1 B;  4Y92 A;  3TEE A;  4OR5 B;  3GNG A;  1VQ8 T;  4CC2 A;  1SHG A;  1RAF B;  2FVU A;  2XD0 A;  2K3X A;  2V22 B;  4EOL B;  3TSZ A;  4II1 A;  1X6G A;  3EG0 A;  2DZC A;  1QMC A;  3MEW A;  2E65 A;  1G3S A;  2DL7 A;  4FL6 A;  4FU6 A;  4M78 E;  2QDJ A;  5KYX B;  1W2B P;  3VKH A;  2EIF A;  4ZGE B;  5GAM f;  1BIA A;  4PJO G;  5KCO A;  3TU4 K;  1ZHI A;  1RI0 A;  5KYX A;  4EMG A;  1YIJ Q;  2L8D A;  3PMT A;  3CCS Q;  1T3L A;  2LX7 A;  2C5V B;  1B07 A;  4IIM A;  5IHN A;  2WMA B;  4M75 F;  4Z8A A;  5FWC A;  1TU0 B;  1WX6 A;  1SF9 A;  1U5S A;  2YDL A;  2ZZD B;  3HSB A;  3EFS A;  2VVK A;  4C5I A;  4IIO A;  1URC B;  4CFW B;  1X6B A;  1VYT A;  1Q86 C;  4Z89 A;  4LOC A;  2FPD A;  1WYX A;  5GAN 5;  2HD0 A;  1BB9 A;  1H24 B;  2OTJ A;  2CSQ A;  3MEA A;  2XK0 A;  1JOW A;  2IG0 A;  4OGE A;  1GL5 A;  1ZQ1 A;  2D8H A;  4GBQ A;  3MKD A;  1FMK A;  1YWO A;  2LJ1 A;  2EJ9 A;  3C4S A;  2JM8 A;  1VQO Q;  2HAX A;  1H1P B;  3QDR B;  1M9S A;  4N4H A;  1AWO A;  2P4T A;  2D1X A;  2DBM A;  1NLO C;  5L8R E;  2Y90 A;  3SB2 A;  4KRD B;  1YJN T;  2UZB B;  1K0X A;  2W10 A;  2O4X A;  4WF2 A;  1U8R A;  2PK9 B;  3CBO A;  1VQ9 A;  3PGG A;  3G4S T;  3M0T A;  1OOT A;  4QKU A;  4C92 D;  2DAQ A;  4CFV B;  3VRZ A;  1OPL A;  1PSE A;  2K9G A;  2EYY A;  3BG5 A;  1E7O A;  3BLH B;  2QTX A;  1CSK A;  3CCU A;  3I55 T;  5GAN 4;  2RJD A;  5ECA A;  1MMN A;  5DQW A;  1Q81 U;  1K9M U;  4ZN3 A;  2KY9 A;  3JCM e;  3CCE Q;  3G4S A;  4B9W A;  4L59 A;  1Y7X A;  5KYW B;  3F70 A;  3HPW A;  4A54 A;  5IF1 B;  4Y28 E;  3QSU A;  1M8V A;  4FW1 A;  1VQ4 T;  2DYI A;  3V7R A;  4MFD A;  5BNJ B;  1M2V A;  5KYW A;  4J9H A;  3CQT A;  2RHX A;  3QYB A;  2HQX A;  1TTH B;  3MET A;  3QYE A;  3VS4 A;  2MF2 A;  1V76 A;  2C5N B;  4IUR A;  3A1P A;  3DJB A;  3REA B;  1FYN A;  1RAH B;  3S3O A;  2KRM A;  2ZPI B;  3WXM B;  4F7U E;  3EID B;  2JNG A;  5HNB B;  4QVC A;  3LGF A;  4BY6 B;  5GMK j;  3PMI A;  2PVG B;  4BD3 A;  3CXC S;  4BBR M;  1EX4 A;  4ZTF A;  2W0Z A;  4PJJ A;  2KBT A;  5GAN e;  2C5O B;  3A98 A;  2JT4 A;  2LQ8 A;  2FZG B;  3QII A;  4CFU B;  4M7D D;  5IDN B;  1IHW A;  3SWN A;  4ATO A;  4MDX A;  2DX1 A;  1KD1 C;  1G3T A;  1G2B A;  3CC2 Q;  1WDX A;  5CCA A;  2KI7 A;  2LCC A;  3INZ A;  4N4I A;  3HB9 A;  1RAG B;  4KGZ B;  3OYM A;  4UN0 A;  1VQ6 T;  3MPU B;  3KBG A;  1NLP C;  1T0J A;  1QLB A;  1HK9 A;  4RTU A;  2YHT A;  1NYG A;  2JJ9 A;  3VS6 A;  1SEM A;  1YWP A;  1X2K A;  1NEB A;  2XDD A;  2QGF B;  4MDW A;  1D3B A;  3P8B B;  1UJY A;  4YOS A;  2ESW A;  3BDU A;  1UJ0 A;  1I1J A;  3REB B;  2W99 A;  1LNX A;  3I56 A;  1UHC A;  1VQ6 A;  2QQ9 A;  2KXD A;  4FYW B;  4XQ3 A;  2VAS A;  1ZSZ A;  1FXX A;  2MMP A;  1YIT T;  1R77 A;  1D3B B;  2OI3 A;  2PTK A;  2I40 B;  3RBB B;  2PVD B;  2CSI A;  1VYW B;  3CC7 A;  3EGX B;  2G6F X;  4OF1 A;  3JB9 F;  2WEV B;  1PWT A;  2ABL A;  2ATC B;  2E5Q A;  3KXT A;  1NJI R;  2OTL Q;  3M4Y A;  2KEA A;  2BZ8 A;  5GAM g;  2DPP B;  4BY6 C;  2QQB A;  2V1R A;  4D8D A;  2DBK A;  3EGU A;  1VQK T;  3CME A;  3EG1 A;  3GIB A;  3SWN C;  4EDU A;  2UZL B;  3ER0 A;  1JST B;  2LVM A;  2JMC A;  3DDP B;  1WHK A;  1TD6 A;  1WA7 A;  2GF7 A;  4GLK A;  2DK3 A;  1FMV A;  4FIB A;  3H6Z A;  8AT1 B;  3OMC A;  1VQP A;  3I56 Q;  1M90 U;  1YIT Q;  1SPK A;  1BI3 A;  2LTO A;  2RQU A;  3R6O A;  3VS3 A;  1P92 A;  1YJ9 Q;  4ANJ A;  5KYY B;  5DLO A;  4OVA A;  2WSC E;  2HQE A;  4M77 F;  4LN2 A;  1YI2 Q;  2K79 A;  1Q7Y R;  3TNH B;  4ZGJ B;  3VS2 A;  3UA7 A;  3RKX A;  1YIJ A;  1OQK A;  4OB1 B;  3PE0 A;  4KH1 B;  2YRD A;  5FRN A;  4NOY A;  5IHI A;  4KUL A;  3UPU A;  2AHJ B;  1X6O A;  2R5M A;  2EKH A;  3LLR A;  4KT0 E;  3EG3 A;  3VYH B;  2PVO B;  4A4F A;  1YCS B;  2QEX A;  1K9A A;  2V8K A;  1WQ7 A;  2NUT B;  2AIR B;  2AZV A;  2EGA A;  5GAN 6;  3PVL A;  2HSP A;  1I0C A;  4YOO A;  2LCL A;  2RH2 A;  3I56 T;  3BLR B;  4HKE A;  1AD6 A;  1B34 A;  2JTE A;  1YIJ T;  3L2Q A;  2L3P A;  5HKC A;  4BBS M;  2MCN A;  1NYF A;  1D0X A;  3JB9 G;  4L6V 5;  4ROE A;  1Q86 U;  2COW A;  4X9D A;  4LNP A;  4DBF A;  4N4G A;  1M3C A;  1YNZ A;  3V7C A;  3DTO A;  4EOP B;  3OYL A;  2JTM A;  4E7S A;  5LL6 S;  4FT2 A;  3K7A M;  4ZGD B;  3SEM A;  3J81 E;  1Q7Y U;  2P84 A;  2AT1 B;  3JB9 H;  3KHI A;  5GMK l;  3OYB A;  1VIF A;  2F2V A;  4CFU D;  5GAN h;  1PSF A;  4M7D B;  2ZAE A;  2RI3 A;  1H3H A;  2FRY A;  4NC6 A;  2DIQ A;  3OYY A;  2QAS A;  3CBM A;  4B9X A;  3G6E Q;  2ENM A;  2NUP A;  2XIC A;  3QHR B;  3UF4 A;  1MUZ A;  2RQW A;  4KH0 B;  3ME9 A;  3THK A;  2SEM A;  3URG A;  4OMM A;  3OW2 P;  4J9G A;  2QK0 A;  3CCE A;  3HRS A;  4K11 A;  3M58 A;  1YJW A;  4PLI A;  3QYH B;  3M54 A;  3M0U A;  3MHX A;  1NEG A;  4L5G A;  1E9H B;  1PNJ A;  3NTI A;  2H8H A;  4JJC A;  3OYE A;  1DJ7 B;  2ZGW A;  3FRN A;  3VUB A;  1K1Z A;  2JW4 A;  3LH0 A;  2R7G A;  1O75 A;  1MGQ A;  2RJF A;  4M7A F;  1M1F A;  3SDZ A;  1ZBX A;  3CCE T;  3LYI A;  4OGR B;  4EOS B;  2V26 A;  3ZEH A;  4F70 B;  1YJW T;  1VQ5 A;  1FVV B;  1S72 T;  2DRM A;  1D09 B;  2P0P A;  2D6F A;  1ARK A;  1RL2 A;  2IIM A;  1WIE A;  1HD3 A;  2J7I A;  2ECZ A;  4ELL A;  3NPF A;  5FWB A;  1AOJ A;  4AKI A;  4ELZ C;  4PJM A;  2VXE A;  2CJM B;  4XTY A;  3O0G D;  3MEV A;  3PFS A;  2JS0 A;  2W96 A;  1H3Z A;  2CDT A;  1Y0M A;  5EG2 A;  3L1A A;  2HSE B;  2IPO B;  2DMO A;  3TRE A;  1R8O B;  1F5Q B;  4GLM A;  2DXT A;  4E47 A;  3NTK A;  3EG9 B;  2PUO B;  2XI9 A;  1S1N A;  4C8Q B;  2KGT A;  4F14 A;  1AEY A;  1GFC A;  1ACM B;  4Z6Y A;  4C8Q F;  2EYW A;  9ATC B;  3OYC A;  3FEO A;  4M77 B;  1IZ6 A;  3G71 T;  1S72 Q;  3M0R A;  4QVD A;  3C94 A;  3X26 B;  2X4J A;  1KQ2 A;  3PIP A;  2JVV A;  3M5A A;  1SG5 A;  3V8J A;  3CCR Q;  5I2M A;  1XO2 A;  2KE9 A;  1RAA B;  2MPX C;  4M75 C;  4J9F A;  4LXC A;  4EC8 B;  4EOI B;  3JB9 D;  3E9F A;  2YRC A;  4QT7 A;  3UT1 A;  1VQ8 Q;  4LE9 A;  3RKY A;  1Q7Y C;  4LDW A;  1PD1 A;  2EFI A;  2DJZ A;  2MK5 A;  3CC2 T;  2P0Q A;  1JO8 A;  2LX9 A;  1WQW A;  2DXB A;  4F7S B;  2HQH A;  4XAX B;  1OIY B;  1VQ6 Q;  3MP1 A;  2HZY A;  2L3Q A;  2VB6 A;  3DDQ B;  1K73 C;  3VKG A;  1N4M A;  1O9S A;  5DLQ E;  2DRK A;  1WXT A;  2KSS A;  2KMT A;  4RCB A;  3MI9 B;  1HSQ A;  3CPF A;  4ELJ A;  1WGS A;  3CCV Q;  2G77 A;  2RQT A;  5LMK B;  3HFO A;  1KD1 R;  3H8Z A;  4JS5 A;  3CC4 T;  3M9Q A;  4EON B;  2PMI B;  1RAB B;  4EMH A;  2ZPE B;  2LJ0 A;  4AFS C;  5GAO p;  3OYK A;  3CCU Q;  1W4S A;  1J3T A;  5CYI B;  3Q1J A;  4JDS A;  2W9Z A;  1KG1 A;  3QDF A;  3BLQ B;  1IRE B;  1KXU A;  3EH2 A;  4EIK A;  2YUQ A;  5IH2 A;  1UEC A;  3M57 A;  2RI2 A;  4RCC A;  1D0Z A;  3VYG B;  2QGG A;  3CCQ T;  2DTO A;  1XTD A;  3CCL A;  4PJO B;  1VQK Q;  1VQO T;  2EYX A;  5AYF A;  1EFN A;  4J6X A;  4MML A;  2ROT A;  2LC4 A;  2D9T A;  5GAN f;  1PM3 A;  4E7K A;  3LH5 A;  2WSE E;  2EW3 A;  2LDM A;  3A8L B;  2GFA A;  3CCV T;  1JQQ A;  1HXD A;  2JXB A;  3TN8 B;  1B3Q A;  1PKS A;  3T9N A;  2PQW A;  4M7A E;  5C6S A;  1WHL A;  1YP5 A;  3VJP A;  4EOQ B;  2V1Q A;  3H41 A;  2P0K A;  1R0B G;  4BE0 A;  4FM4 B;  2CP5 A;  4BCH B;  1I4K 1;  1RAE B;  1GCQ C;  4JX5 A;  2FEI A;  2EAY A;  2EPD A;  5GAO r;  1VQL Q;  2KNB B;  3VKI A;  3CMA T;  2DM1 A;  4HCZ A;  1VQ5 Q;  2GFU A;  2RHI A;  1XOV A;  3UDC A;  1QWF A;  2ZPG B;  4M75 B;  2X51 A;  5D6Y A;  2QEX Q;  4UC4 A;  4HL4 A;  2DTI A;  1G5V A;  2QGS A;  2DFU A;  2LW4 A;  4RTX A;  5M9O A;  1ZSG A;  2R5A A;  5CQY A;  2X9H A;  2LJ3 A;  2A37 A;  1W6X A;  2QFZ A;  3WVD B;  1MMD A;  4OB2 B;  2DVE A;  4XU3 A;  3CMA A;  4DBH A;  2FPE A;  4WCI A;  5FGK B;  3CCM Q;  2KVQ G;  2CCH B;  4YOZ A;  3CXC P;  3S6W A;  2J05 A;  2OTL A;  5CEI B;  1UHF A;  2DXC A;  3JCM X;  1KC8 U;  1X43 A;  1OKW B;  3CME Q;  2DIG A;  4C8Q D;  1OYX A;  4KGV B;  4AFU C;  1KQS S;  1UTI A;  4C92 G;  2K5I A;  4HCK A;  4C8Q C;  1H1Q B;  2E5K A;  2DL5 A;  3TSW A;  3PO3 S;  2X4W A;  4KUI A;  2C0T A;  2X35 A;  1SHF A;  2I2L A;  4OML A;  4F04 B;  3EFO A;  3JV3 A;  4AKH A;  2HEQ A;  1VYV A;  5LJ5 f;  4MIM A;  3JB9 J;  2A3L A;  2XKO C;  1KJW A;  1YI2 A;  2GBQ A;  4M78 F;  4M7A A;  1RUW A;  4FSS A;  3OBW A;  2CZ0 B;  1SSH A;  1Q82 R;  2O2O A;  5J3B A;  3CME T;  1QQJ A;  2CH4 W;  2UZE B;  1OU8 A;  1WJR A;  1VQ4 A;  5LJ3 e;  4IUT A;  4ORZ A;  1PKT A;  5LJ3 h;  2X4Y A;  3CCV A;  1D0Y A;  3E19 A;  2QA4 Q;  4ROC A;  4XU2 A;  1BYM A;  2ED0 A;  3X24 B;  1VQ9 Q;  3JCM V;  4RG8 A;  2BKZ B;  2MIO A;  4QQG A;  2EBP A;  4PJO E;  1AT1 B;  5GAN j;  1GBR A;  3G33 B;  3RR6 A;  1M1G A;  5GAM h;  1N5Z A;  4AG2 C;  1C0M A;  1U1S A;  1RI9 A;  2CZ6 B;  4M75 G;  1WPY A;  3EG9 A;  5LJ3 d;  4D8K A;  4F16 A;  2W9F A;  1GXI E;  2WXV B;  5C0M A;  4XK8 E;  4J9I A;  3OS5 A;  1VYU A;  3FIF A;  5I2S A;  3OW2 A;  2OTL T;  2LNV A;  3JSC A;  1X75 C;  4PFZ A;  5HVY B;  1RAC B;  1OL2 B;  3X20 B;  1PG5 B;  2QAZ A;  4A4G A;  1T0H A;  1UNH D;  4HVV A;  1M1K C;  2DYB A;  4M78 G;  2DVJ A;  1YJN A;  3LGL A;  1Y57 A;  4M7A C;  2HNI A;  4J6Y A;  5DQV A;  2FYK A;  1VQ9 T;  1UGQ B;  4OB0 B;  1OX8 A;  2VGM A;  4IKF A;  2XHC A;  1PRM C;  2CZ7 B;  4R0K A;  2EWN A;  4J7F A;  4CC4 B;  1NE8 A;  5A0D A;  2UUE B;  1UUE A;  1YBY A;  2E64 A;  4A4E A;  4C5H A;  3FJP A;  4HA8 A;  3UA6 A;  5GAO q;  1YI2 T;  2BPM B;  1RAI B;  4DQ2 A;  4DA4 A;  1A0N B;  2KT8 A;  4J6W A;  2MAM A;  1BKB A;  5CKD A;  1KFZ A;  4C0G A;  1RLQ C;  4E7L A;  2WFY B;  1H8K A;  1MMA A;  2ROL A;  1VQM Q;  4RMO A;  2QDL A;  1ABO A;  1YCY A;  1FX7 A;  5IAY A;  4DEX A;  5LJ5 h;  2BS4 A;  3GBQ A;  2JM9 A;  4M77 A;  1F1B B;  2JZ2 A;  3SD4 A;  4BCQ B;  3E2U A;  2NLU A;  4NL3 A;  1IB8 A;  2XDP A;  4PJL A;  3C0C A;  3MO8 A;  2DIL A;  4DOV A;  3L2R A;  5CO7 A;  2DL8 A;  2LRQ A;  4EOO B;  3X25 B;  1U06 A;  4PJO A;  2E3H A;  4OMP A;  2HBW A;  2RJC A;  2RNA A;  2DXB B;  1BK2 A;  2KR6 A;  2LQN A;  3A8O B;  3M4G A;  3HZJ A;  1MMG A;  1OU9 A;  4M77 G;  4EOK B;  1V1C A;  2YRV A;  4QW2 A;  1OV3 A;  2L89 A;  1AVZ C;  4C8Q E;  2RQR A;  3PIO A;  2COZ A;  4BI4 A;  3EG2 A;  3EAE A;  1VQM T;  1TUC A;  4N0A A;  5D6W A;  5KYN A;  3E9G A;  3EJ1 B;  5GJW B;  1Q81 C;  1K9M C;  1IO6 A;  2BZX A;  4IUP A;  1VQK A;  4KUD K;  1SRM A;  4CFM B;  1ZX6 A;  5IXB A;  3OS1 A;  2HDA A;  3G6E T;  2LQK A;  3V7S A;  4LD6 A;  3L2U A;  4AFQ C;  2K5L A;  3RIR A;  4JJN K;  3JCM P;  2BKD N;  1TS9 A;  4RG2 A;  1TWB A;  2RHZ A;  1BU1 A;  4FCY A;  4A4K A;  2VV5 A;  3FLG A;  1BU2 A;  1AZE A;  2YUO A;  3VRY A;  2DEU A;  4M7A G;  4PKC C;  3QYG B;  4CXA B;  5CR2 A;  1GCP A;  2CT4 A;  4IMY B;  3LWI A;  3OQ5 A;  4AG1 C;  3FB9 A;  5FRO A;  1NG2 A;  2VUB A;  3R6N A;  5LQF B;  3CMA Q;  2AZS A;  3DKM A;  5KYY A;  1ENW A;  3JCM g;  1JXM A;  3CPW P;  1Y96 A;  2M02 A;  1YJW Q;  1JJ2 S;  1K8A R;  2E1H A;  5KE3 A;  4R56 A;  4JX6 A;  4BY7 X;  1G3Y A;  2ED1 A;  4NS5 A;  2K3Y A;  4RKU E;  4N0A C;  2IW8 B;  4M6V A;  2CP6 A;  1QVG P;  2K2V A;  1G3W A;  2RB6 A;  1OEB A;  3MP8 A;  4OMF B;  1H64 1;  2KK4 A;  4EC9 B;  1TSF A;  4IUV A;  4F6W B;  3MIA B;  4F7L B;  1M90 R;  3LW5 E;  1V29 B;  3VV0 A;  1IXD A;  2E12 A;  4JUV A;  4J7I A;  1KC8 C;  4I3Z B;  1KK7 A;  1M2O A;  1VQ7 Q;  1R0C B;  3QXE B;  1VOL A;  2A0F B;  1NJI U;  4PLL A;  2OTJ Q;  4BDZ A;  4BE1 A;  3OYG A;  2SRC A;  5LJ5 g;  4BCP B;  4RTY A;  4EMK C;  4Y91 A;  2PU9 B;  2O4X B;  1QVF S;  5I5Z B;  3G71 Q;  3ULR B;  2RI5 A;  1UFF A;  5GAM d;  4EOR B;  2MOX A;  4C92 E;  1W1F A;  3I9Q A;  3DB4 A;  3POM A;  2AKL A;  2KRO A;  3OS2 A;  2WMB B;  2KDS A;  4BDY A;  3JAM E;  4CC3 A;  4HT9 A;  2DD5 B;  3CCL Q;  1H1R B;  2BUD A;  4YTL A;  1OGU B;  1H28 B;  1ZUY A;  4RTT A;  4G6L B;  3BW1 A;  1Q82 U;  4XTX A;  2WAC A;  1E7P A;  2GNC A;  2E6Z A;  2CP3 A;  4QQ6 A;  1AD5 A;  3MEU A;  3OYD A;  1VQ7 T;  4JPB W;  1BCO A;  2DD5 A;  5ACB A;  2XG8 D;  1VUB A;  1M30 A;  3L2W A;  2HKQ B;  1BI1 A;  3CCJ T;  2X1N B;  2K3B A;  4QQD A;  4BCF B;  3IQL A;  1JKW A;  3A8M B;  4EMK B;  2EVR A;  4F7U G;  5J39 A;  2L2P A;  2QXF A;  4ME7 A;  2CP7 A;  4AI6 A;  2VXF A;  4F7N B;  4JZ4 A;  2DKG A;  1UB4 A;  2B86 A;  5IT9 E;  5FU6 C;  4M7A D;  2O88 A;  4EMK A;  3PT9 A;  1N27 A;  2UZD B;  2MI6 A;  2ZPH B;  3N5B B;  3EH1 A;  2HL3 A;  1ABQ A;  3NHN A;  4MMK A;  1B34 B;  2KAF A;  1WHM A;  2F5T X;  1ZBJ A;  3H9N A;  3I35 A;  3OMG A;  2LT1 A;  1E6G A;  2IW9 B;  3MY1 B;  3EGD A;  4OMO A;  2IVW A;  3M0Q A;  5KH6 A;  2D8J A;  1G3N C;  1WZO A;  5HK0 A;  1CKB A;  3TW7 A;  1LCK A;  2LMJ A;  1C9B A;  3OYH A;  3P8H A;  3VS5 A;  3RES A;  2BE7 D;  4CFX B;  3RMQ A;  1VIN A;  2JOY A;  1YFN A;  4OGC A;  2CP2 A;  2RD1 A;  3A8G B;  4BAC A;  1VQN T;  2DD4 B;  1WJS A;  2X3W D;  3RMS A;  1ZSZ C;  1VQL T;  3D7S B;  1VQ5 T;  3GPL A;  4NST B;  1H1S B;  4O6J A;  3I5S A;  3QWL A;  1I81 A;  3QZ5 B;  2XDB A;  3DL1 A;  2DER A;  4LDV A;  5KYU B;  2YXY A;  1IRX A;  2RA2 A;  2IW6 B;  2RK2 A;  3GOX A;  2AKK A;  4FYY B;  5L2W B;  4OMQ A;  1WHJ A;  3MY5 B;  4BCM B;  2EKO A;  4M4Z A;  3ASK A;  3G4S Q;  1G83 A;  1KQS P;  4II5 B;  2L3R A;  1YJ9 T;  1JRI A;  2JUF A;  4J83 A;  1M90 C;  1VQ7 A;  3CC4 A;  2OX7 A;  5LJ5 j;  1KHC A;  3QKJ A;  4MZP A;  3I55 Q;  3VU3 C;  3LQ5 B;  1MNE A;  3S3M A;  3SHW A;  3BHT B;  1Q86 R;  2O31 A;  2RMO A;  1WHH A;  3QG1 A;  5CIU A;  3V8L A;  3CEY A;  1P5E B;  1OI9 B;  1EZZ B;  3MCA B;  4B6M A;  4ELY C;  1YJ9 A;  2E4H A;  4J5Y A;  1D1C A;  4OMN A;  1N9S A;  2FZC B;  3P8D A;  1NZ9 A;  1VQO A;  3WVE B;  5GMK i;  2CKK A;  1JSU B;  5KE2 A;  2ZPB B;  5IDP B;  3CC2 A;  2K5F A;  5GAN 3;  1AZG B;  3GLX A;  1OKV B;  1SRL A;  5GMK e;  1OPK A;  2E6N A;  1O9K B;  3VYG A;  2M51 A;  2NUZ A;  4J9C A;  1PHT A;  1GY3 B;  2CT3 A;  2B8A A;  2VKN A;  4VUB A;  1WXB A;  2VGN A;  4LUE A;  2OJ2 A;  2CH4 A;  3QZ9 B;  4M7D G;  2JN0 A;  3H0F A;  2WIP B;  2FPF A;  1YHQ A;  5GAO n;  1B7T A;  2O01 E;  1N8R U;  2I53 A;  1YN8 A;  1UGP B;  1M1K R;  1AIS B;  4M7A B;  3EHR A;  4JJD A;  1PC0 A;  4C5E A;  3UAT A;  2P4R A;  3JRZ A;  3CCR A;  1QP3 A;  2HMA A;  1QCF A;  2DA9 A;  3QJ6 A;  5GJV B;  4J9B A;  2RO0 A;  2Y4Y A;  4J8O A;  4X1V A;  3FJ5 A;  3VS1 A;  2R58 A;  3J80 E;  1ZP2 A;  2V8I A;  3RGF B;  1FIN B;  2PJQ A;  2EYZ A;  5GMK h;  4GY5 A;  3GP8 A;  3DLL A;  1VA7 A;  1Y96 B;  3PTA A;  3SFM A;  2LQW A;  2MWO A;  5IHY A;  3CBP A;  2OTJ T;  2KR3 A;  4JX4 A;  4FW2 A;  2HKN A;  2LCS A;  4A63 B;  1AWW A;  3HRU A;  4LDX A;  2GTJ A;  4Z88 A;  5GAM j;  3RKW A;  1M4Z A;  4BCI B;  4BY1 X;  2H3J A;  5HQ0 B;  2DXC B;  2J6K A;  2DZ9 A;  4E7Z A;  5EJC A;  1D1B A;  4BCJ B;  2LNH B;  5HBE B;  1GH6 B;  2KQW A;  1JBM A;  4TTH A;  4HNV A;  3H4C A;  4MFE A;  2BTT A;  2EGE A;  2OAW A;  1M3B A;  2EQK A;  3B57 A;  1I07 A;  2DJQ A;  1FKM A;  3JCM h;  3VS7 A;  2ZZD A;  3C95 A;  1H25 B;  4D6W A;  1UGS B;  3E1S A;  1OZ2 A;  3I5R A;  3RNJ A;  2J6O A;  1X2Q A;  1YHQ T;  1QP2 A;  4CFN B;  2Z0W A;  3DB3 A;  1KSW A;  3JB9 I;  3GF5 A;  2EQU A;  2RQV A;  3HBL A;  4DBR A;  3L2V A;  2EGC A;  1MHN A;  2DTH A;  1Y71 A;  1BBZ A;  4PJO D;  1BI0 A;  4O5V A;  1BI2 A;  4TVR A;  2PK2 A;  4Q5W A;  4X9C A;  4C0D C;  2CRE A;  4F6U B;  1K76 A;  4KGX B;  1PD0 A;  2DLP A;  4C92 B;  3MP6 A;  3TNW B;  4C92 F;  5CQX A;  3CCR T;  3TQ7 P;  4EOM B;  2WHB B;  1KQ1 A;  5I22 A;  1I5O B;  2EJF A;  4X34 A;  2CUD A;  3J7A F;  1SKU B;  4BI8 B;  7AT1 B;  3H0H A;  2CS7 A;  4OP0 A;  1Q81 R;  1K9M R;  2E3I A;  2KYB A;  1UNL D;  2ZCF B;  5KCH A;  3OB9 A;  3QPH A;  1NM7 A;  5CKB A;  4XTV A;  2G3R A;  5EFQ B;  3TNI B;  5A0L A;  1QVG A;  1UGV A;  3UWN A;  3G1J A;  1HJD A;  3HL8 A;  4DEY A;  3M56 A;  5CVI A;  4F7U A;  4V2S A;  2JMA A;  1BIB A;  3C12 A;  5IHK A;  2DL4 A;  5D6X A;  8ATC B;  3PVQ A;  4HCB A;  4E7J A;  1WLP B;  5GAN g;  3MJX A;  1JB0 E;  2MYS A;  3QO3 A;  5IXF A;  2VWF A;  2A7Y A;  1M5Q 1;  2HL5 C;  5FU6 B;  4AMC A;  4DOW A;  1X27 A;  4JS4 A;  2QQA A;  2K4Y A;  4LUD A;  3CCU T;  1NJI C;  5LJ3 g;  3CPW S;  3JCM J;  1JJ2 P;  1OZ3 A;  3OYJ A;  1WI7 A;  3HHT B;  2QTV A;  1VQN Q;  3OYI A;  3OY9 A;  3OSV A;  2QQS A;  2GQV A;  2PZ1 A;  2A36 A;  1K8A C;  4RTV A;  2FG0 A;  3CCQ Q;  1QVG S;  1I8F A;  4E2F B;  1U1T A;  2DME A;  1WXU A;  2C4G B;  2XMF A;  1QKW A;  4JLG A;  4DBQ A;  3QBY A;  2E70 A;  4BCM D;  2GGR A;  3ZBD A;  2O9V A;  1KD1 U;  5I11 A;  2PNI A;  1Z9Z A;  5LJ5 d;  2WIH B;  5DY9 A;  2BS3 A;  4ZN1 A;  1WFW A;  2VYT A;  3QHW B;  1UNG D;  2J06 A;  3OSS C;  1G8X A;  1W2B S;  2E41 A;  1BCM A;  5FU7 B;  4M7D E;  4BCK B;  1UGR B;  3QWX X;  5D7U A;  1Q95 G;  1K73 R;  1QVF P;  1H92 A;  3HRT A;  3BG9 A;  5CK9 A;  2JTF A;  5ICP B;  3QHS A;  3SWN B;  3RDV A;  2NUP B;  3JCM c;  1TXQ A;  3NFC A;  1TUG B;  2EUF A;  4P5N A;  2COY A;  4M75 D;  1QWE A;  2QQR A;  4M7D F;  3U23 A;  4OB3 B;  1IGQ A;  4QSH A;  1E6H A;  2A08 A;  2DF6 A;  1N8R C;  3VUZ A;  4BE2 A;  2QEX T;  3L2Z A;  4ROD A;  1TG0 A;  2X4X A;  5FRM A;  3JCM Q;  3O5Z A;  2DXU A;  4JRK A;  3BY7 A;  4CI0 C;  1H4L D;  3G6E A;  4EOJ B;  4CRL B;  5GAO m;  3JCM f;  4HCC A;  3HP9 A;  2CYZ B;  2CUB A;  4HXJ A;  2EQI A;  1JXO A;  3BE3 A;  3L42 A;  1ZSZ B;  2RM4 A;  1VIE A;  1OL1 B;  3DOG B;  1LPL A;  2CGH A;  5GAN d;  4AKG A;  1M2V B;  3EGX A;  2KMG A;  3NMZ C;  4M75 A;  4M77 E;  5L23 A;  1JJ2 A;  2EQJ A;  3EFR A;  4JRI A;  2X3X D;  2AK5 A;  2BE9 B;  1OX9 A;  2RJE A;  2G9X B;  4ZTJ A;  1YIT A;  1QVP A;  2FZK B;  4NL2 A;  3HO8 A;  5IN1 A;  3ZL7 C;  1N8R R;  2YUN A;  2XID A;  5AT1 B;  2QYZ A;  2GQI A;  1XQH A;  1IHV A;  5EC7 A;  1QLY A;  2IVX A;  1QVF A;  1LOJ A;  4C0D B;  4C8Q G;  4RTZ A;  2YUP A;  2F5K A;  2QQ8 A;  4FYV B;  4CRI A;  1LVK A;  4HNU A;  1GUX A;  2C06 A;  2KRS A;  2RN8 A;  5GMK m;  1ZUK A;  3CD6 A;  4WTO B;  5HBH B;  1MND A;  4C8Q A;  1GBQ A;  3M53 A;  4JRQ A;  4LD9 K;  4M7D A;  2K57 A;  3CCM A;  2BS2 A;  4LDU A;  2NWM A;  3EHQ A;  3NGP A;  3OBY A;  4BCN B;  3I55 A;  1VOM A;  4BCN D;  5GAM e;  5HK3 A;  3OYF A;  3M0P A;  2NYS A;  4QVZ A;  3EFO B;  3M03 A;  1TOV A;  2L3S A;  1XJW B;  4IUQ A;  1QKX A;  4LDY A; 
#chains in the Genus database with same CATH homology
 3QYE A;  2MF2 A;  3KUF A;  4IUR A;  5M9O A;  1WJS A;  2R5A A;  5CQY A;  3RMS A;  3M55 A;  1AHJ B;  4HLQ A;  3S3O A;  1VQL T;  2QFZ A;  3GPL A;  3WVD B;  3O8V A;  2ZPI B;  3WXM B;  5DM7 R;  3OS0 A;  2FB7 A;  4A53 A;  4OB2 B;  2DVE A;  4O6J A;  3CXC A;  1FWZ A;  4F7U E;  4XU3 A;  3QWL A;  1I81 A;  3QZ5 B;  1X01 A;  3DL1 A;  2JNG A;  4C0F A;  3LGF A;  4BY6 B;  4QVC A;  5GMK j;  4LDV A;  2XDB A;  5HY6 A;  3PMI A;  2KVQ G;  2PVG B;  4BD3 A;  1SSF A;  3CXC S;  4BBR M;  4ZTF A;  3S6W A;  1TH7 A;  5FU7 C;  3CCJ A;  2OTL A;  1VQM A;  5GAN e;  2RA2 A;  1VQP T;  1KC8 U;  2DXC A;  3JCM X;  2RK2 A;  3GOX A;  1LJO A;  2LQ8 A;  2DIG A;  4C8Q D;  1OYX A;  3QII A;  5LJ3 f;  2EKO A;  4M7D D;  3ASK A;  3SWN A;  1WJQ A;  4ATO A;  1KQS S;  4MDX A;  1KD1 C;  1G3T A;  4C92 G;  2L3R A;  1YJ9 T;  3A8H B;  1JRI A;  2JUF A;  2K5I A;  4J83 A;  3BDL A;  4C8Q C;  5CCA A;  3NTH A;  5GAN 2;  1M90 C;  1VQ7 A;  1UEB A;  3CC4 A;  4M75 E;  5LJ5 j;  3BG3 A;  2LCC A;  3INZ A;  1KHC A;  4N4I A;  3HB9 A;  2X4W A;  3QKJ A;  4KUI A;  4MZP A;  3OYM A;  1VQ6 T;  4M7D C;  3OYA A;  2X35 A;  3KBG A;  3VU3 C;  2I2L A;  3QUI A;  5I21 A;  3S3M A;  1QLB A;  1HK9 A;  5LJ5 e;  2YHT A;  4AKH A;  5GAO l;  3QG1 A;  5CIU A;  5LJ5 f;  4MIM A;  3V8L A;  3G71 A;  3CEY A;  2XDD A;  3JB9 J;  4FT4 A;  5A2Q E;  2HBP A;  2A3L A;  4MDW A;  2XKO C;  4JLI A;  4F7U F;  2F69 A;  3MCA B;  1YI2 A;  1D3B A;  2Y4X A;  3P8B B;  4M78 F;  4ELY C;  1YJ9 A;  4M7A A;  2FL7 A;  4J5Y A;  3BDU A;  4F7U B;  1N9S A;  2CZ0 B;  3OBW A;  3P8D A;  1NZ9 A;  5CKE A;  1VQO A;  3WVE B;  1LNX A;  5GMK i;  1Y07 A;  4A4H A;  2WJ9 A;  3HKS A;  4XTW A;  2CKK A;  5J3B A;  3I56 A;  2QQ9 A;  5KE2 A;  3FC3 A;  1VQ6 A;  4PJO F;  2ZPB B;  3BFM A;  2YLB A;  3M59 A;  4XQ3 A;  3CME T;  2MMP A;  1FXX A;  2K5F A;  5GAN 3;  3S3N A;  3LWH A;  1YIT T;  3CC2 A;  1WJR A;  3GLX A;  1D3B B;  1VQ4 A;  2EJG A;  5LJ3 e;  5GAN 7;  4IUT A;  5GMK e;  2PVD B;  5LJ3 h;  2E6N A;  2X4Y A;  3CC7 A;  3CCV A;  3E19 A;  3VYG A;  4XU2 A;  1BYM A;  2R57 A;  4OF1 A;  3X24 B;  3JB9 F;  3JCM V;  2FHD A;  2E5Q A;  4RG8 A;  3KXT A;  4C92 A;  3TW6 A;  2B8A A;  3M4Y A;  4QQG A;  2DO3 A;  5GAM g;  4PJO E;  3CD6 T;  2DPP B;  4VUB A;  2QQB A;  4BY6 C;  5GAN j;  2VGN A;  2RHY A;  1M1G A;  5GAM h;  4JRP A;  4E7I A;  1VQK T;  3CME A;  3GIB A;  3SWN C;  3QZ9 B;  4EDU A;  4M7D G;  1U1S A;  2JN0 A;  3ER0 A;  2CZ6 B;  4M75 G;  3CCM T;  2LVM A;  1YHQ A;  1WPY A;  5GAO n;  3CC7 T;  5LJ3 d;  2O01 E;  4C5G A;  3RUX A;  1N8R U;  1GXI E;  4M77 C;  3FDR A;  5C0M A;  4XK8 E;  3LX7 A;  1UGP B;  2GF7 A;  3OS5 A;  4GLK A;  2DK3 A;  3FIF A;  2M0O A;  4XTZ A;  5I2S A;  2LNV A;  4FIB A;  3H6Z A;  3JSC A;  3OW2 A;  3OMC A;  2OTL T;  1X75 C;  4M7A B;  3TCJ A;  1VQP A;  1NPP A;  1M90 U;  4C5E A;  3X20 B;  4E7H A;  1BI3 A;  4A4G A;  2LTO A;  3JRZ A;  3R6O A;  1M1K C;  1P92 A;  4BUG A;  4PJO B;  4M78 G;  3QJY A;  1YJN A;  1K8A U;  3CCR A;  1QP3 A;  2E10 A;  5DLO A;  3LGL A;  4OVA A;  2WSC E;  4EPC A;  3QJ6 A;  1S72 A;  4M7A C;  2QDY B;  2HQE A;  2RO0 A;  2Y4Y A;  2HNI A;  4J6Y A;  2FYK A;  4M77 F;  4J8O A;  1VQL A;  4M77 D;  1VQ9 T;  4OB0 B;  1UGQ B;  2VGM A;  4IKF A;  2XHC A;  2CZ7 B;  4ZGJ B;  2R58 A;  4C0Z A;  3J80 E;  2V8I A;  4M78 C;  2LT4 A;  2EWN A;  4J7F A;  3JCM b;  3RKX A;  1YIJ A;  4OB1 B;  2QA4 A;  1NE8 A;  5A0D A;  5FRN A;  4NOY A;  3ZFJ A;  4KUL A;  4XU0 A;  1YBY A;  5GMK h;  3UPU A;  2AHJ B;  1X6O A;  2E64 A;  2R5M A;  3LLR A;  4GY5 A;  4KT0 E;  3GP8 A;  4A4E A;  3VYH B;  2PVO B;  4A4F A;  3DLL A;  1Y96 B;  4C5H A;  3PTA A;  2QEX A;  2M16 A;  5FLX E;  2V8K A;  3SFM A;  1WQ7 A;  2MWO A;  3FJP A;  4HA8 A;  5GAO q;  3CBP A;  1YI2 T;  2OTJ T;  2ZPF B;  4JX4 A;  5GAN 6;  3A5Z B;  4C92 C;  4DQ2 A;  3HRU A;  4DA4 A;  4J6W A;  4LDX A;  2LCL A;  1BKB A;  2MAM A;  1K73 U;  5CKD A;  4XU1 A;  3X28 B;  2RH2 A;  4C0G A;  5GAM j;  3I56 T;  4E7L A;  3RKW A;  1M4Z A;  4HKE A;  3OYN A;  1B34 A;  3HFN A;  2H3J A;  1YIJ T;  4RMO A;  3L2Q A;  2DXC B;  2DZ9 A;  5HKC A;  2QA4 T;  4FSX A;  1YCY A;  5EJC A;  2GCX A;  1FX7 A;  5IAY A;  2L5Q A;  4PNO A;  5LJ5 h;  2DEQ A;  2BS4 A;  4BBS M;  3JCM d;  4KBM B;  2KQW A;  3DLM A;  4M77 A;  1JBM A;  4HNV A;  2V8J A;  3H4C A;  3JCM W;  2JZ2 A;  3SD4 A;  1EIF A;  2XU8 A;  4MFE A;  3JB9 G;  4L6V 5;  1Q86 U;  2EQK A;  2PUK B;  3G7Z A;  4X9D A;  2D0Q B;  2WSF E;  4N4G A;  5CAI A;  1FKM A;  2NLU A;  4NL3 A;  3JCM h;  4D6W A;  2ZZD A;  2XDP A;  3C95 A;  3V7C A;  3MO8 A;  3V8K A;  3OYL A;  1N9R A;  1UGS B;  4DOV A;  3L2R A;  5CO7 A;  4M78 B;  4MZM A;  2JTM A;  3E1S A;  5LL6 S;  2LRQ A;  5A0G A;  4FT2 A;  1OZ2 A;  4M78 D;  4ZGD B;  3X25 B;  4PJO A;  3J81 E;  1Q7Y U;  3JB9 H;  1YHQ T;  1QP2 A;  3KHI A;  3DB3 A;  3JB9 I;  5GMK l;  2RJC A;  3GF5 A;  3OYB A;  4R55 A;  2MWP A;  2DXB B;  2EQU A;  3HBL A;  2KR6 A;  1VIF A;  3A8O B;  3M4G A;  5GAN h;  3HZJ A;  1PSF A;  4M7D B;  1M1K U;  4M77 G;  3L2V A;  1MHN A;  2RI3 A;  2YRV A;  1N6A A;  2DTH A;  1Y71 A;  4QW2 A;  4NC6 A;  2DIQ A;  4M78 A;  3OYY A;  2L89 A;  3CBM A;  4B9X A;  3AHU A;  1BI0 A;  4C8Q E;  4PJO D;  4O5V A;  3PIO A;  4BI3 A;  4BI4 A;  1BI2 A;  4TVR A;  4X9C A;  4Q5W A;  4C0D C;  3EAE A;  2XIC A;  5J26 A;  4HT8 A;  1VQM T;  4C92 B;  3ME9 A;  3MP6 A;  1I5L A;  4BB7 A;  4N0A A;  5D6W A;  3URG A;  4C92 F;  3E9G A;  3OW2 S;  2QF7 A;  5CQX A;  2EYQ A;  3CCR T;  1Q81 C;  1K9M C;  4IUP A;  2DD4 A;  3GNF B;  1VQK A;  3CCE A;  4KUD K;  1KQ1 A;  1OI1 A;  3HRS A;  4X34 A;  1NPR A;  2EJF A;  3M58 A;  1WNL A;  3J7A F;  5GAN 8;  1YJW A;  3CPW A;  4PLI A;  3QYH B;  4BI8 B;  3M54 A;  3OS1 A;  3MHX A;  3G6E T;  2LQK A;  2CS7 A;  4L5G A;  4OP0 A;  3V7S A;  1XNI A;  4LD6 A;  2QI2 A;  3L2U A;  1QVG S;  2OAU A;  3NTI A;  4XTU A;  5KCH A;  2ZCF B;  2K5L A;  3OB9 A;  3QPH A;  5LJ3 j;  3OYE A;  3RIR A;  4JJN K;  5CKB A;  4XTV A;  2G3R A;  3JCM P;  1DJ7 B;  2ZGW A;  5A0L A;  3FRN A;  2BKD N;  1QVG A;  3VUB A;  4RG2 A;  1VQN A;  1QW1 A;  3UWN A;  2RHZ A;  3LH0 A;  1O75 A;  4A4K A;  3HL8 A;  1MGQ A;  2RJF A;  1KQS A;  4M7A F;  1M1F A;  3SDZ A;  1Q82 C;  2VV5 A;  3M56 A;  1ZBX A;  5CVI A;  3FLG A;  4F7U A;  3CCQ A;  4V2S A;  3CCE T;  3LYI A;  2RK1 A;  4IUU A;  2CZ1 B;  1BIB A;  4Z02 A;  3C12 A;  3CCS A;  3ZEH A;  3CCL T;  1YJW T;  1VQ5 A;  4M7A G;  5D6X A;  5CKH A;  1VQ5 T;  1S72 T;  2EQM A;  4PKC C;  3QYG B;  2P0P A;  2D6F A;  5CR2 A;  4HCB A;  4E7J A;  2YLC A;  4PL6 A;  5GAN g;  1JB0 E;  1RL2 A;  3QO3 A;  3LWI A;  1W2B A;  3OA6 A;  4PJO C;  3OQ5 A;  3CMA A;  2A7Y A;  1M5Q 1;  5FU6 B;  4DOW A;  3FB9 A;  5FRO A;  4JS4 A;  1VQ8 A;  2VUB A;  2QQA A;  2K4Y A;  4ELZ C;  4AKI A;  3DKM A;  3CCU T;  1NJI C;  2VXE A;  5CKF A;  4XTY A;  3JCM g;  5LJ3 g;  4MZT A;  1Y96 A;  3CPW S;  3JCM J;  1OZ3 A;  2M9U A;  3MEV A;  3PFS A;  2VC8 A;  3OYJ A;  1JJ2 S;  2E1H A;  5KE3 A;  4R56 A;  3HHT B;  4JX6 A;  3CCS T;  1H3Z A;  3OYI A;  3OY9 A;  4HNT A;  5EG2 A;  1G3Y A;  3L1A A;  4NS5 A;  3OSV A;  2K3Y A;  2QQS A;  4RKU E;  2GQV A;  1KHI A;  3RER A;  4N0A C;  1K8A C;  4M6V A;  2M1H A;  1R8O B;  2K2V A;  1I8F A;  3PNW C;  1G3W A;  2BIV A;  2RB6 A;  1U1T A;  3TRE A;  2DXT A;  2RHU A;  4E47 A;  3MP8 A;  4OMF B;  3NTK A;  2XI9 A;  1H64 1;  2KK4 A;  2PUO B;  4JLG A;  4IUV A;  3TEE A;  4C8Q B;  3GNG A;  1VQ8 T;  3QBY A;  2E70 A;  4Z6Y A;  3ZBD A;  2FVU A;  2XD0 A;  4C8Q F;  2K3X A;  3LW5 E;  3OYC A;  1V29 B;  3VV0 A;  1KD1 U;  2E12 A;  3FEO A;  4II1 A;  4M77 B;  1IZ6 A;  3G71 T;  4QVD A;  4JUV A;  4J7I A;  1KC8 C;  5LJ5 d;  3C94 A;  2DZC A;  5DY9 A;  3X26 B;  2X4J A;  1KQ2 A;  2BS3 A;  4ZN1 A;  3PIP A;  2JVV A;  2E65 A;  3M5A A;  2VYT A;  3MEW A;  1G3S A;  4FU6 A;  4FL6 A;  3QXE B;  3V8J A;  1VQN T;  5I2M A;  3OSS C;  2QDJ A;  4M78 E;  3JB9 D;  4M75 C;  1W2B S;  3VKH A;  4PLL A;  1NJI U;  2E41 A;  4BDZ A;  3E9F A;  4BE1 A;  5FU7 B;  4M7D E;  3OYG A;  1UGR B;  2EIF A;  3UT1 A;  5LJ5 g;  4ZGE B;  3RKY A;  1Q7Y C;  4LDW A;  4EMK C;  5GAM f;  1BIA A;  2EFI A;  4Y91 A;  2DJZ A;  4PJO G;  5KCO A;  2PU9 B;  3CC2 T;  2P0Q A;  2O4X B;  3TU4 K;  1QVF S;  3HRT A;  3BG9 A;  2LX9 A;  1ZHI A;  1RI0 A;  2JTF A;  5CK9 A;  1WQW A;  3QHS A;  4EMG A;  2L8D A;  2DXB A;  3PMT A;  4XAX B;  2RI5 A;  3SWN B;  5GAM d;  3JCM c;  4C92 E;  3MP1 A;  3NFC A;  3DB4 A;  4M75 F;  4P5N A;  4M75 D;  2QQR A;  4M7D F;  2ZZD B;  3HSB A;  3EFS A;  1K73 C;  3VKG A;  3OS2 A;  1O9S A;  5DLQ E;  2KDS A;  4C5I A;  4OB3 B;  4BDY A;  4QSH A;  3JAM E;  2KSS A;  2KMT A;  4RCB A;  4HT9 A;  2DD5 B;  1Q86 C;  4LOC A;  1N8R C;  2BUD A;  4YTL A;  3VUZ A;  3L2Z A;  2QEX T;  4BE2 A;  5GAN 5;  3CPF A;  4ELJ A;  1WGS A;  2HD0 A;  2X4X A;  5FRM A;  2G77 A;  3BW1 A;  3HFO A;  4XTX A;  2WAC A;  3JCM Q;  1Q82 U;  3H8Z A;  2DXU A;  2OTJ A;  1E7P A;  4JRK A;  2E6Z A;  3MEA A;  2XK0 A;  3BY7 A;  4QQ6 A;  4JS5 A;  3MEU A;  3OYD A;  3CC4 T;  2IG0 A;  4CI0 C;  1VQ7 T;  4OGE A;  1ZQ1 A;  3G6E A;  3M9Q A;  2DD5 A;  2XG8 D;  4EMH A;  2ZPE B;  1VUB A;  5GAO p;  5GAO m;  3JCM f;  2EJ9 A;  3OYK A;  3C4S A;  1W4S A;  3HP9 A;  4HCC A;  2CYZ B;  3L2W A;  3Q1J A;  1BI1 A;  4JDS A;  2HAX A;  3QDR B;  1M9S A;  4N4H A;  3CCJ T;  1KG1 A;  3L42 A;  4QQD A;  2P4T A;  1IRE B;  3A8M B;  2RM4 A;  1VIE A;  2Y90 A;  5L8R E;  3SB2 A;  4EMK B;  3M57 A;  1YJN T;  2CGH A;  2RI2 A;  5GAN d;  4AKG A;  4F7U G;  2QXF A;  4ME7 A;  4RCC A;  5J39 A;  2KMG A;  3VYG B;  3CCQ T;  4AI6 A;  2VXF A;  2DTO A;  2O4X A;  4M75 A;  4WF2 A;  1U8R A;  1XTD A;  2DKG A;  1UB4 A;  4M77 E;  3CCL A;  3CBO A;  1JJ2 A;  1VQ9 A;  5IT9 E;  2EQJ A;  3EFR A;  4JRI A;  3PGG A;  5AYF A;  5FU6 C;  4J6X A;  4MML A;  3G4S T;  1VQO T;  2RJE A;  4M7A D;  2LC4 A;  4EMK A;  2D9T A;  3PT9 A;  5GAN f;  1N27 A;  4ZTJ A;  4C92 D;  1QVP A;  2MI6 A;  4E7K A;  4NL2 A;  1YIT A;  3HO8 A;  5IN1 A;  2ZPH B;  2DAQ A;  2WSE E;  3N5B B;  2XID A;  1PSE A;  1XQH A;  3BG5 A;  2LDM A;  4MMK A;  3A8L B;  1B34 B;  2GFA A;  3CCV T;  1QVF A;  1HXD A;  1LOJ A;  2KAF A;  4C0D B;  2QTX A;  2F5T X;  4C8Q G;  3CCU A;  3I55 T;  5GAN 4;  3T9N A;  2PQW A;  2RJD A;  2F5K A;  4M7A E;  3OMG A;  2QQ8 A;  5C6S A;  4CRI A;  2LT1 A;  3VJP A;  4HNU A;  1Q81 U;  1K9M U;  4ZN3 A;  2KY9 A;  2C06 A;  5GMK m;  3JCM e;  2IVW A;  3CD6 A;  2P0K A;  5KH6 A;  3G4S A;  4C8Q A;  4B9W A;  4L59 A;  4BE0 A;  1Y7X A;  3M53 A;  5HK0 A;  4JRQ A;  4LD9 K;  4FM4 B;  3F70 A;  3HPW A;  3TW7 A;  4A54 A;  4M7D A;  2K57 A;  4Y28 E;  3P8H A;  3OYH A;  2BS2 A;  1I4K 1;  3CCM A;  4LDU A;  4JX5 A;  3OBY A;  3QSU A;  1M8V A;  1VQ4 T;  2EAY A;  4MFD A;  3V7R A;  3I55 A;  5GAO r;  3RES A;  3VKI A;  3CMA T;  4HCZ A;  3RMQ A;  5GAM e;  5HK3 A;  2JOY A;  2GFU A;  2RHI A;  3OYF A;  4OGC A;  2RD1 A;  4QVZ A;  1XOV A;  3UDC A;  2RHX A;  2ZPG B;  3A8G B;  3QYB A;  4M75 B;  5D6Y A;  2HQX A;  4HL4 A;  2DTI A;  4IUQ A;  4UC4 A;  4BAC A;  1G5V A;  4LDY A;  2DD4 B;  3MET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...