4ZGEB

Double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 52
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgeB02
2DD4B 2ZPEB 3X24B 2PU9B 2ZZDA 1UGSB 2CZ7B 4ZGJB 2ZPBB 3X26B 4RKUE 1QP3A 2CZ6B 3QZ9B 2CZ0B 2PVOB 1QP2A 1DJ7B 3VYGA 3QYGB 4ZGDB 3HHTB 4ZGEB 2CZ1B 3WVEB 2O01E 2ZPIB 2DXCB 2ZPFB 3VYHB 2DD5A 2WSCE 2PVGB 1V29B 2DXBB 4Y28E 1IREB 3X25B 3QZ5B 4OB0B 3QYHB 3A8LB 1AHJB 2WSEE 3WVDB 2DD4A 3A8MB 5L8RE 1PSEA 2QDYB 2AHJB 2PUOB 4OB1B 2ZZDB 1JB0E 3LW5E 4L6V5 2ZPGB 2PUKB 1PSFA 2PVDB 4KT0E 3QXEB 1GXIE 2DXCA 2D0QB 2WSFE 3VYGB 4XK8E 2DXBA 2ZPHB 2CYZB 4OB3B 3A8OB 4FM4B 3X20B 3X28B 3A8HB 2DD5B 4OB2B 2ZCFB 1UGRB 1UGQB 3A8GB 2DPPB 1UGPB
chains in the Genus database with same CATH superfamily
1WDXA 4JZ4A 1TH7A 3PMTA 1NYFA 2Z0WA 4ZTFA 2WIHB 2UZLB 1KG1A 2O31A 5HBHB 3CPFA 2F5TX 4N4IA 2RD1A 1TWBA 2CREA 1DJ7B 2DNUA 3G6EQ 2DBKA 5IDPB 4M77G 4MMLA 4F7LB 3HSBA 1U5SA 2HQEA 2X4XA 5CKEA 4C5IA 4BCFB 1YJNA 2J7IA 2DXBB 2COYA 2RK2A 3TSWA 3SWNA 3QZ5B 1VQ9Q 2QQ8A 4BY7X 1K9MU 3EOCB 1D0XA 5DQWA 1WI7A 2O4XB 4DBHA 1NJIC 2DXTA 2BS3A 2HDAA 4RUGA 3M4YA 1OV3A 2HCKA 4BCMB 3OBYA 1VQLQ 3GOXA 2QAZA 4IUVA 4M78F 1Y07A 4IUQA 1K8AC 5GJWB 3FDRA 1ZQ1A 4KGVB 1JO8A 1RLQC 2CH4A 3CMEA 2YXYA 5FWCA 4PJOF 2OTLQ 1VQNT 1VYWB 1RACB 2RHZA 1WZOA 4ZN1A 1UJYA 4PFPA 5HBEB 2A28A 3PTAA 2E5KA 1HK9A 1YIJT 4D8DA 4F14A 5GAN6 2KBTA 3FB9A 4X9DA 4M7AA 1YJNT 2YUNA 4FL6A 4C0DB 2CUDA 5GAMg 2KGTA 2GQIA 1MGQA 2DIGA 4MZPA 5GAN7 4QW2A 2DE0X 1YITT 3CBPA 4LDWA 4PJMA 2NUZA 2DILA 2DJZA 1BBZA 2VB6A 2RH2A 3JCMP 1AZGB 5IHKA 3OS2A 1EIFA 4CFVB 4Z6YA 4C92B 4KUIA 2QQBA 2RB6A 1WHHA 3CMET 1SHFA 1WYXA 3OSSC 1MMDA 2DIQA 1UGSB 2WACA 3VS5A 1MUZA 1EZZB 2FPDA 2NLUA 3WXMB 3AHUA 3GBQA 3META 3OMGA 2M16A 1W2BS 1WHGA 4LN2A 4RG8A 4E2FB 2L2PA 2WJ9A 3VYGA 1NLOC 1WHLA 4HVVA 1YI2A 3GNFB 1W2BP 4M7DB 1BU1A 4PKCC 2DTHA 4CFUB 1PHTA 2W99A 2ZPFB 1N9RA 1YWPA 4FSXA 2V1RA 3G71Q 3CC7T 3TNHB 3LH0A 3TSZA 2L0AA 2CDTA 2MAMA 5LJ5e 4LDYA 3V8JA 4C0DC 1TXQA 1H24B 5HKCA 1I5LA 4F7UB 4NL3A 2JS2A 1WA7A 2DX1A 3FIFA 3QYBA 1VQ6A 4KULA 2JN0A 3IQLA 1R0BG 1H25B 1S1NA 2KSSA 5KYUA 2JOYA 2WPAB 4QT7A 3H4CA 2E1HA 5I2SA 4C92C 3H41A 5IAYA 3OQ5A 2BZYA 3HFOA 3P8HA 3HKSA 2GBQA 5GAMj 2EIFA 1YI2T 4HKEA 4AKGA 2IW8B 4EC8B 3CMAQ 4BDYA 4NC6A 1Q86U 2FB7A 3CCRA 1D1CA 2R5MA 1N5ZA 2ROLA 3BLQB 4M7DC 1P5EB 4ELLA 2C06A 5LJ5d 2QF7A 2KRMA 1RAEB 4JJNK 5KCHA 3KHIA 2Y4XA 1VQ6T 4HNTA 2HL5C 2VKNA 4XU0A 2DBMA 3CPWA 1I81A 3RERA 3BHTB 3GP8A 2BZXA 3X24B 2PQWA 2QG9B 2ZAEA 2P0QA 2DYBA 1H1SB 4Z88A 3M54A 3X26B 1T0HA 3BLRB 5IT9E 3QHWB 2HBWA 1RLPC 3MHXA 3S3MA 4JJCA 1M90C 2QEXA 5J26A 3CCRT 1UJ0A 1YFNA 5J39A 1KQ2A 3NTKA 3A1PA 1C9BA 3DOGB 1I8FA 2Y4YA 2GCXA 2H8HA 4A63B 3BY7A 2KI7A 2LCSA 3EG0A 3BLHB 4Y91A 3CCSA 4PJJA 3CCUQ 3X25B 3FJ5A 2CP5A 3MP1A 3M53A 1QVFA 2EKHA 4E47A 1TD6A 1X6BA 1G3NC 2KROA 4PJLA 4A4EA 1VYVA 2O88A 4XQ3A 2X4YA 1KD1U 2JTEA 2C0TA 2KMGA 3RNJA 3PE0A 2QDJA 1E9HB 3HPWA 2YUPA 3JB9H 4RTZA 4BCNB 2COWA 2AK5A 5CK9A 4GBQA 2F5KA 4M75E 1QMZB 1CSKA 3MJXA 5HK0A 1SKUB 3H9NA 4JLIA 2RM4A 4M77B 4FYWB 1O75A 1H3ZA 1PSFA 1H3HA 2DJQA 5CYIB 3G33B 3MO8A 1VQ5A 1UNHD 3CCST 1C1AA 1YCSB 2Y90A 1NE8A 3M4GA 2ENMA 5KYWB 1YHQQ 2I53A 4JLGA 1Z9QA 4DQ2A 2PK9B 5IN1A 3TW7A 4R0KA 1NEGA 4M75A 4PFOA 1M4ZA 3RMSA 3L1AA 1VQ8Q 3TQ7P 5I5ZB 2KDSA 4Y72B 3CC4Q 3MEAA 1UNLD 4L59A 3UF4A 3A8GB 4C8QE 2KY9A 6AT1B 3RKYA 2HD0A 2IW6B 4IUTA 2WFYB 3TN8B 3CCVA 2WIPB 2DVJA 2I40B 3CEYA 2RHIA 2JVVA 1UUEA 2LJ0A 2CCHB 4J9DA 1JJ2A 1PNJA 3QDRB 4MZTA 3C12A 2CZ6B 4EOJB 1QKWA 3JB9J 1JU5C 4EOIB 1H1RB 1OZ3A 2DL4A 3OS5A 4JUVA 2JJ9A 3D7SB 1OPKA 2HSPA 1GY3B 3QBYA 2W0ZA 4M77C 1M9SA 1KQ1A 4DEXA 3RKWA 1KK7A 4PL6A 5CIUA 1KJWA 2CH4W 1Q81C 1K9MR 2QGFB 4I3ZB 4E6RA 4LOCA 2DAQA 3CCLA 3OYEA 3TREA 5CAIA 1BK2A 5I21A 4RMOA 5GAMh 4ELZC 3NFCA 3EIDB 2JUFA 3VKGA 5LJ3f 3CCVT 2RHXA 4C0ZA 1OX9A 1SSHA 1VQPA 3PT9A 3DB3A 2QASA 1H4LD 1MV0B 4EPCA 1U06A 1RL2A 3EFOB 3MY1B 4OB1B 1I4K1 2A7YA 5DLQE 1U1TA 3LW5E 4AMCA 1W98B 3BG3A 5CR2A 4KH0B 1WFWA 3C95A 3JB9G 1WXBA 3BDLA 1X01A 5KYYB 4KT0E 1NEBA 2GTOA 2O9SA 1YJ9Q 4HA8A 4J7FA 2ZPHB 2W96A 4C92G 3CCLT 1WPYA 2J06A 2BKZB 2IW9B 4OB2B 4NOYA 4ORZA 1WIEA 1VQPT 1AWWA 1UGQB 2YWWA 5GANe 3G4SQ 3JCMg 5HK3A 5LJ5g 1VQ4A 4Z89A 5GAMd 2W2HA 2M1HA 2WMBB 2E6ZA 1YN8A 1UG1A 4XTXA 1ZA1B 3NGPA 1G8XA 2K6DA 3PFSA 4HT8A 4C0FA 2HKNA 4M7DG 1QVPA 4EMHA 1ZA2B 2XK0A 3OYYA 2JMCA 4K11A 4F70B 3CQTA 3S6WA 4OF1A 4OMFB 2KYMA 4CC7A 2LJ1A 3HRUA 4KH1B 2CZ1B 4C5EA 2G77A 3WVEB 2O01E 1E6HA 4F17A 4F7UG 3NTIA 1Y57A 3HP9A 3Q1JA 2RQRA 2A3LA 2EYYA 2LVMA 3M0QA 2KMTA 3OYGA 4HVUA 8ATCB 3TW6A 1G3SA 4XTWA 3MEUA 3ULRB 2DZ9A 1D0YA 3RDVA 2BS2A 1VQ4T 3M5AA 4JX5A 1UECA 2DD4A 2IIMA 4QKUA 3K7AM 3NHNA 1QCFA 3BFMA 2QDYB 4BUGA 1D09B 1AWOA 4NSTB 1SPKA 2G3RA 2CKKA 1ZSZC 2DETA 1YNZA 4M75D 2YRDA 2EGCA 2GF7A 4M4ZA 3QJYA 1M1KU 3I55A 3QWYA 4CFMB 4F04B 1AZEA 2PK2A 4XTZA 3QXEB 1Q82C 1Q86R 4LDVA 4EMKB 3CD6Q 2DXCA 5FU7B 3H0HA 2DL7A 2H3JA 3CCEA 1K73C 1VQKQ 4J9BA 2PZ1A 1UHCA 2K4YA 5LJ5j 3MEWA 1VQ7Q 1ABOA 2CYZB 3QIIA 2LJ3A 2OTJQ 2LRQA 2F2CA 3X20B 4M77A 3X28B 4OMOA 4BCGB 1EX4A 4C8QD 1TTHB 2YUQA 2MK5A 2JS0A 3C4SA 3CCMA 1LOJA 2MWOA 3EG1A 1KSWA 4F6WB 1VQ8T 2E4HA 2RPNA 2E3IA 1BB9A 1QCNA 3QHSA 3RESA 3RUXA 1H1QB 4MDXA 3S3OA 5AYFA 1MHNA 4AKIA 5CCAA 3I55T 2PNIA 3NDQA 2ZPBB 3LGFA 1N8RC 3L2UA 1B07A 3LGLA 3BHVB 3OYKA 1KQSA 4QVDA 2CZ0B 1AEYA 4BCHB 3J7AF 4LUEA 4EC9B 1WGSA 2CT3A 2OAUA 1N6AA 3VS2A 2R7GA 1H26B 3V7CA 3LX7A 1K0SA 2CT4A 4IUUA 4JDSA 4J6WA 3PIPA 2HSEB 2C4GB 3HTRA 1IREB 2NUPB 3JCMV 4EMKC 3RBBB 5FU7C 3LQ5B 3CCMT 4CI0C 4M75F 1FMWA 2EJ9A 1VQNA 2GFUA 3A8MB 2D1XA 4X1VA 1X6GA 2RJDA 2LNHB 2MYSA 5FGKB 2C0IA 3H0FA 2AHJB 1YIJA 2YSQA 4XU2A 5HNBB 1HD3A 2JNGA 5CKFA 5A2QE 1JKWA 4OMNA 2YDLA 1IHVA 3EGXA 2ZZDB 1Y96A 1VOLA 3GIBA 5GAOq 1FKMA 4NS5A 2O9VA 4FW2A 1JXOA 2LC4A 3A5ZB 2DERA 5DY9A 4J6XA 1YITA 4EOLB 4M7AE 2L3PA 1WJSA 3C94A 5D6YA 4JJBA 1KC8U 1LPLA 3VS3A 4C8QF 1N4MA 4BY1X 1EFNA 2FL7A 3VS7A 1KFZA 4MFDA 4HLQA 3OYJA 4FCYA 2GNCA 4F6UB 2MMPA 2L89A 2QYZA 2D8HA 5KYXA 1AWXA 2HQHA 1M2VB 2EFIA 2FZKB 3A8HB 1YJ9T 5I22A 5KE2A 3EG9A 2KR3A 2B9RA 3RGFB 4BI4A 3EG3A 3MP6A 2EWNA 3MCAB 4J9IA 2FO0A 4P5NA 3LWIA 1I07A 2HAXA 2I2LA 4IIMA 3OBWA 3QWXX 1XNIA 3PVQA 4ZGJB 1KHIA 4BB7A 3OYIA 2V1QA 1LJOA 1ZSZA 2RNAA 4BDZA 1G3YA 3CC7A 5GAN3 1U1SA 2PVOB 2KR6A 2DM1A 3NPFA 4CC2A 2UUEB 2YRVA 2DL5A 3KXTA 4TVRA 4J9CA 3RIRA 3DB4A 2EQMA 1S72A 3M0PA 2K5IA 1PWTA 2SRCA 1O9KB 5HY6A 3TU4K 5IHNA 4XTYA 4YTLA 2MWPA 5GAOl 4EOMB 1BI2A 3QO3A 2YHTA 2RQWA 1F5QB 2GGRA 3WVDB 4Q5WA 1Q7YR 1OULA 2B86A 3MKDA 2KVQG 2L3QA 2VC8A 4M78B 1AD5A 1NM7A 4PLLA 3EGDB 5GMKm 1PM3A 5L23A 4MZMA 4X34A 5GANg 1TUCA 4BCQB 1MMNA 2WMAB 4BE1A 1WXUA 2DVEA 3H6ZA 3VRYA 4AFSC 1X69A 5LJ5h 4PJOB 3J80E 1NJIU 2RK1A 1RADB 5EFQB 2ZPGB 2IN3A 3JCMe 1JEGA 1NPPA 4OR5B 4JRPA 1ARKA 5AT1B 1UHFA 1B34A 5DQVA 1QMCA 2AZSA 2QTXA 5FLXE 1LNXA 2CGHA 2LQKA 5GAOp 1S72T 1K8AU 2K3YA 1WX6A 2BE7D 4EOKB 1OL1B 2EGEA 2BTTA 2SEMA 4J8OA 1H28B 2AZVA 2XU8A 2CP6A 4J9FA 4FM4B 1D3BA 2FHDA 2DD5B 4PFZA 1QVGA 2JZ2A 1QLBA 3RKXA 4EMKA 3CCJQ 1G83A 4GLKA 3ASKA 4BXXX 1G2BA 1SG5A 1VQMQ 4JRQA 4DEYA 2DEQA 3UPUA 1M3AA 1AT1B 2EJFA 4M78C 1M27C 1B3QA 1FYNA 1VIFA 2J6KA 2R57A 3JCMd 1MNEA 2DL8A 3UA6A 5D6XA 1MV3A 1M1FA 5ACBA 3G6EA 4PJOC 2IVWA 2QXFA 4F7NB 1XO2A 1PRMC 1QKXA 1XQHA 1VQ9A 3VYHB 2DZCA 3I9QA 2FG0A 1JSUB 3CC2Q 2FZGB 1IRXA 3SD4A 3OW2A 1VQOQ 1GH6B 5GANj 2LP5A 3V8KA 1YJWQ 1VQLA 2V26A 3VUBA 5GMKe 2YLCA 3OYMA 3HBLA 5HCKA 2JTFA 2XD0A 4N0AC 1SEMA 5I2MA 1BI1A 4JRIA 3GLXA 1QWEA 3M59A 1U3OA 2FPEA 2P4TA 2QA4Q 2OTLA 3GTMS 4CFNB 3G6ET 5CO7A 2RI5A 4LDXA 2P4RA 1M1KR 5LMKB 3UATA 3I56Q 1RAFB 4M7AD 5ICPB 4ME7A 2LNVA 3VS1A 3VS0A 4OGCA 1VQ9T 2DKGA 2WSFE 2ABLA 1CKBA 1JQQA 2DXBA 4DA4A 1UGVA 2EVRA 4RTXA 1MMAA 1WXTA 2J6FA 2XMFA 2YT6A 3C0CA 4XTUA 2O4XA 2DXUA 4VUBA 1VQLT 1ZP2A 2DEUA 3MY5B 4UC4A 3CXCA 1FMVA 1JXMA 1Q7YC 3UA7A 2P0PA 2ECZA 3FC3A 2K2MA 1BKBA 4LDUA 5A0DA 2RO0A 1GBQA 2C5OB 2OTLT 2K5FA 2V8IA 4J9EA 3RR6A 2DF6A 3HL8A 2KYBA 3S3NA 1RI0A 2XIDA 2DMEA 2RA2A 4DOVA 2W10A 4PK4A 1KHCA 1QW1A 2K79A 4C92E 1GCQC 1FMKA 2PMIB 3JCMQ 2F2VA 2CP7A 1JSTB 4ZGDB 3ME9A 3PVLA 2XDDA 2E6NA 3G71A 3LH5A 2ESWA 2KRSA 4B9WA 2EQKA 1BU2A 1AHJB 2J05A 2X3WD 5GAOn 2OI3A 3JV3A 4J9HA 2D6FA 1M90U 4OVAA 4IIOA 4C92A 1OEBA 4EDUA 3M03A 2G9XB 3BW1A 3OS1A 3DDPB 1M8MA 3PO3S 2BS4A 4E7SA 3LYIA 4QVCA 2XG8D 3E9GA 2LDMA 4M7AF 2M02A 1NBEB 2H3EB 2KK4A 2COZA 1WNLA 4HCCA 4J83A 1QVGS 4FW1A 1W4SA 4L6V5 2RJFA 3CMAA 2X3XD 4ATOA 3CCQQ 4M7DA 1PCXA 2JM8A 1HJDA 3G71T 3OYBA 1ZUKA 3LWHA 5LJ3e 4XK8E 4R56A 1OX8A 2KXDA 3EH2A 1IXDA 2DYIA 4EOSB 1H27B 4BE2A 3RMQA 3U23A 4BE0A 4G6LB 5IF1B 1AOJA 4YOOA 3SWNB 2ZCFB 1RI9A 1UDLA 1Y71A 4F7UA 5GAMf 2V22B 5EC7A 3M58A 2DMOA 4JRKA 2C0OA 3CPWS 4E7ZA 1J3TA 2HMAA 2VASA 3CPWP 3F70A 2RF0A 3VRZA 4E7LA 4E7JA 1E7PA 1OIYB 3HRTA 1BIAA 1TUGB 3CMAT 1OKWB 2OJ2A 5GANh 3FRNA 2K3BA 2RQVA 9ATCB 4OGRB 2FZCB 5D7UA 5FRMA 4AT1B 4KGXB 4A4KA 1WJQA 3MPUB 2B8AA 2ZPIB 3CCUA 2JMAA 4M78G 1HXDA 2WSCE 2DTIA 5GJVB 1X6OA 1YP5A 2I0NA 4C8QG 1QVFS 1K4US 3QYHB 1YJNQ 3VUZA 4HCZA 5KE3A 4BCJB 3ZFJA 1QVFP 4PJOG 5L2WB 1V1CA 3L2RA 4WCIA 4C0GA 1ZSGA 3GPLA 1VQOT 3E1SA 3JRZA 2PUOB 1OL2B 2QGSA 2K9GA 1WQ7A 1Q81U 4BCMD 1LCKA 5HVYB 2BKDN 2RI2A 2X4JA 3CMEQ 3V8LA 3URGA 3O5ZA 2W9FA 1M1GA 4D8KA 3HFNA 5GANd 5IXFA 3ER0A 3CCUT 2JM9A 1K8AR 5IXBA 1YHQA 3VYGB 3L42A 3DLMA 4RTVA 4X9CA 3VS6A 4A54A 1GFDA 4RTWA 4E7KA 5D6WA 1VQ8A 4M77E 3CC4A 3BE3A 2RMOA 4A53A 1W1FA 4HNVA 2OX7A 4BACA 1IB8A 3BDUA 4ELYC 1RABB 2E12A 5IDNB 2DL3A 3JB9D 3E19A 1C0MA 2DO3A 1ZUYA 3BG5A 4HCBA 2LCLA 2PU9B 3EGUA 3NMZC 3V7RA 1QQJA 2K7AA 3JCMJ 1BCMA 2DA9A 4EOPB 1JJ2S 5KYUB 1GBRA 4A4FA 4C92D 1K9MC 5CVIA 1UB4A 2KT8A 2NYSA 1JJ2P 4JZ3A 1YHQT 1QP2A 2V8KA 5LQFB 1W2BA 3CBOA 3ZBDA 3OYHA 1OU9A 5CQYA 3TNWB 1Z9ZA 5KYWA 3SHWA 3DL1A 1YI2Q 3M56A 3CC4T 4ZNXA 2O2OA 3OYDA 2VXEA 4FT4A 1BI0A 5A0GA 3PIOA 4M7DD 4KRTA 2L3SA 4CFUD 4FYYB 1JBMA 1X75C 4BCIB 1PD1A 2EW3A 3OS0A 3DKMA 2UZEB 4UN0A 1VQ6Q 1AISB 2PJQA 2AKLA 2EYXA 3UWNA 5I11A 2LT1A 2XICA 2F2WA 4IUPA 2QQ9A 4KRCB 3THKA 2BUDA 4EIKA 3L2WA 3CBMA 2ATCB 4E7IA 4QVZA 5CEIB 1SF9A 2PUKB 3QG1A 1WHMA 4OGEA 1AWJA 1WHKA 1YJ9A 1KD1R 3MP8A 2D0QB 4DBRA 2LX7A 4MDWA 4OMPA 1BCOA 2VV5A 1SSFA 4GY5A 1VINA 3CCQT 3CCRQ 2UZBB 2X51A 1ABQA 3JB9F 4M6VA 4QQ6A 1FWZA 5DM7R 2X9HA 3A98A 5GMKj 3DLLA 2ED1A 1VIEA 2P0KA 2A37A 2F1LA 1TS9A 4EORB 4PLIA 3G4SA 3VV0A 3TNIB 2F2XA 2M51A 1XJWB 1Q82U 1YWOA 4B9XA 4E7HA 1PKTA 4C92F 1K73U 3EFOA 2F69A 1P92A 4RCCA 2EQIA 4YOZA 3OYLA 4LUDA 4WTOB 1RAGB 4LD9K 3SEMA 1A0NB 2KE9A 3VJPA 2JW4A 1UNGD 1IO6A 1FXXA 5KYYA 4RTTA 1GUXB 4BBRM 1IZ6A 4XU3A 4OMLA 2E10A 1Q95G 2FEIA 2KT1A 4OMQA 2QEXQ 1VYTA 2EQJA 4M7DF 3M0RA 2R58A 4N4GA 3POMA 3O8VA 3OYFA 1I1JA 1H641 1H1PB 3G4ST 4LD6A 3EAEA 5LJ3g 1X43A 1N8RU 3CCSQ 3A8LB 2DK3A 1AVZC 5FRNA 1M3BA 1M90R 2IG0A 3QHRB 1RAIB 4CC3A 1M8VA 1H92A 3EFRA 4M75B 4EONB 3SFMA 2XDPA 4RCBA 2RJEA 4F7UF 5L8RE 4FX3B 2WEVB 2D9TA 1Q86C 2RQTA 3DDQB 2YLBA 4II1A 1VUBA 2HNIA 4QSHA 2DRKA 2NUTB 3EG2A 5KYNA 5HQ0B 2E65A 4D6WA 3KFVA 3INZA 4N4HA 1SRMA 2BE9B 1QWFA 3G7ZA 1YCYA 3VU3C 1T3LA 3HB9A 5FROA 2PVDB 2KXCA 3CD6A 1F1BB 4ROCA 4BCND 3H8ZA 1GXIE 4DBQA 4PJNA 1VQKA 1PD0A 2BPMB 4C8QB 1VQ7A 1O9SA 2HQXA 1VQ5Q 4ANJA 2OTJA 3L2ZA 4M77D 3OY9A 4ROEA 1FINB 3JCMh 4JX6A 4AFZC 4XAXB 1JOWA 1UGPB 1UTIA 3ZEHA 4AKHA 2FVUA 3SB2A 5CKDA 2YRCA 3OYNA 4F6SB 2LW4A 4BD3A 1BYMA 4M75C 2JGZB 4ESRA 4FU6A 2JXBA 2PTKA 3P8DA 2PHGA 3JCMf 2GQVA 5LJ5f 3CCVQ 2K57A 2M0YA 2XI9A 1E7OA 1I0CA 2MCNA 2CZ7B 3TVTA 4M7AG 3EFSA 1SHGA 3CD6T 1N9SA 4BCOB 2RN8A 4ZN3A 1KQSS 3MIAB 1VQKT 1PC0A 4AFQC 5LJ3j 5GAN8 1VQ7T 2L5QA 3QYGB 4J7IA 1KQSP 1KD1C 4ZGEB 2K2VA 4GLMA 2OTJT 2IVXA 3QPHA 5EG2A 3ZL7C 2XHCA 3EHRA 1KIKA 2VXFA 3M0TA 1R0CB 4Y28E 2C5VB 5GAOr 4BCKB 1N27A 5C0MA 1LVKA 4C8QC 2ROTA 2L8DA 1ENWA 1IGQA 2FYKA 1K0XA 3M9QA 2KAFA 1UEBA 5HBJB 3CCLQ 4CC4B 2MPXC 1U8RA 4EOQB 3MI9B 4JS5A 2C6TB 1ZHIA 3UDCA 1WLPB 3OSVA 4XTVA 3HO8A 1VQPQ 1D1AA 4YOSA 4YC3B 1Q81R 2W9ZA 2L3RA 4Z02A 2P84A 5GMKh 3VKHA 1ZUUA 1M5Q1 2V8JA 2LTOA 3REBB 7AT1B 2MI6A 4M77F 4AG1C 3JCMW 1XOVA 1WHJA 2DTOA 3T9NA 1TG0A 4AFUC 2QQAA 3PNWC 4II5B 1QLYA 2X35A 2NUPA 2G6FX 4FT2A 1GFCA 1RUWA 5C6SA 1NYGA 2K3XA 4J5YA 3KUFA 4OB3B 1TUDA 3QDFA 4BI8B 1D1BA 1Y0MA 4BBSM 2J6OA 2C5XB 5CKHA 3AT1B 1PKSA 1UGRB 1ZBXA 3M0SA 3OYAA 5CQXA 4ZTJA 2DPPB 1KXUA 2CP2A 2LZ6B 2DD4B 3EHQA 4J9GA 2ZPEB 1VQ4Q 5BNJB 3PMIA 2E5QA 2NWMA 1T0JA 2ZZDA 2QK0A 1OU8A 4FSSA 1B7TA 5KCOA 2DLPA 4CRIA 4BCPB 2QGGA 1D3UB 4OP0A 1QP3A 1W6XA 1R8OB 2XKOC 3QWLA 1UE9A 3I5RA 2EUFA 3QJ6A 2RQUA 3FLGA 4EMGA 5GAOm 2EJGA 1X27A 2CP3A 2DXCB 2A08A 3N5BB 1M2VA 2AT1B 4TTHA 4HCKA 5GAN5 1V29B 2FRYA 1GUXA 2HKQB 2QTVA 3H0IA 5M9OA 2QEXT 2EBPA 3VS4A 4CFXB 1M3CA 2LQ8A 3JSCA 1M30A 4B6MA 8AT1B 3JCMX 1OIUB 2BZ8A 5A0LA 5J3BA 4XU1A 1PSEA 5FWBA 3QYEA 4LXCA 2QQRA 1NZ9A 3I35A 1G5VA 3BG9A 2EPDA 3F5XB 1I5OB 5KH6A 1OI1A 4FIBA 4HT9A 2HEQA 4BI3A 4IURA 2AKKA 1TOVA 4M78E 2MOXA 2LCCA 2EAYA 2E64A 3JAME 4M7DE 2EGAA 2HL3A 3I55Q 2E41A 2LQWA 2NUTA 2CUBA 2DRMA 4DOWA 1RAHB 4KUDK 4PJOE 1M2OA 4C5HA 1O9KA 1TU0B 4MFEA 1TFBA 4MIMA 5IH2A 3CCEQ 5IHIA 4KRDB 1K1ZA 2IPOB 4OMMA 2CCIB 3A8OB 3SDZA 3CCJA 3M57A 2XDBA 3G1JA 4F7UE 2KEAA 1VQ5T 3GNGA 4M78A 4ELJA 3EGDA 2EYQA 2LT4A 1QVGP 1URCB 1TSFA 2HZYA 4C8QA 2QQSA 1Q82R 1VQMA 5LJ3h 2OAWA 4L5GA 3FEOA 3CCMQ 1HSQA 1K73R 1OYXA 1C6VX 1KC8R 1IGUA 4PJOA 1BI3A 4MMKA 2WHBB 2JT4A 4AG2C 3HZJA 1ACMB 2R5AA 3GF5A 2VUBA 2GFAA 2FPFA 3HRSA 1QCOA 1Q7YU 3EGXB 1Y96B 4C5GA 2UZDB 3OB9A 4O6JA 5GAN4 2YUOA 5GAMe 3TCJA 1NLPC 2QDLA 2JTMA 3I5SA 4M75G 3LLRA 1HYOA 3DTOA 1VA7A 2VGMA 4HL4A 3O0GD 3CC2A 3MEVA 4N0AA 3CCJT 2DD5A 2RI3A 2VVKA 2EKOA 1VQOA 2QFZA 1RAAB 3OW2S 1N8RR 4OB0B 2RHUA 3E9FA 1YJWA 1FX7A 1JRIA 1D0ZA 5KYXB 2WSEE 1VQMT 3OW2P 1UFFA 1OKVB 1M1KC 3QKJA 1IHWA 1OPLA 1FVVB 4CRLB 1AD6A 3EG9B 3E2UA 3M55A 1VQNQ 3QUIA 1WQWA 2QA4A 2CS7A 5LJ3d 2K5LA 4M7AB 4F7JB 1H8KA 1YIJQ 3KBGA 1OGUB 2MIOA 4IMYB 1JB0E 2MF2A 3I56A 1V76A 5GANf 3L2VA 2X4WA 1ZSZB 5GAN2 1ZLMA 2KQWA 5CKBA 2D8JA 1Y7XA 3CC2T 1YITQ 3VKIA 4CFWB 1VOMA 4Z8AA 3SWNC 4F16A 1YJWT 3P8BB 2KRNA 1PG5B 4R55A 1YBYA 1MMGA 1X2KA 5LL6S 4IKFA 2DFUA 3CXCS 1WJRA 2A0FB 1OOTA 3NTHA 3DJBA 1NJIR 4A4GA 2QI2A 1GCPA 3L2QA 2M0OA 3EH1A 3CXCP 2QA4T 4FYVB 3REAB 1G3WA 4RTUA 4O5VA 1OQKA 5FU6B 1GCQA 4BY6B 4RTYA 2D0NA 3OYCA 2LX9A 3EJ1B 1GL5A 2E70A 3I56T 2VWFA 4JS4A 4EOOB 3OA6A 4Y92A 3BHUB 2ED0A 2FRWA 3UT1A 4RKUE 2CP0A 1ZBJA 3V7SA 4HNUA 5EJCA 4M7AC 2C5NB 2RJCA 3QZ9B 2LMJA 3JCMc 4PNOA 2RHYA 1K76A 4QQGA 1X2QA 4F7SB 3CC7Q 3QSUA 5ECAA 4DBFA 3M0UA 4QQDA 3FJPA 1ZX6A 3HHTB 2ZGWA 4J6YA 1B34B 2GTJA 2VGNA 1PKDB 1R77A 4A4HA 1XTDA 2CJMB 2AIRB 2M9UA 4CXAB 2PVGB 3R6OA 2A36A 1S72Q 1NPRA 4HVWA 3JB9I 3R6NA 1T3SA 1D3BB 1OI9B 2LQNA 4NL2A 1W70A 5DLOA 4JX4A 4RG2A 2EYZA 2CSQA 4HXJA 3J81E 1CKAA 4RODA 1SRLA 4V2SA 1GRIA 4FYXB 1KC8C 1PRLC 4WF2A 5FW9A 5GMKl 1E6GA 5FU6C 3JCMb 1BIBA 1K9AA 4BY6C 4M78D 5IHYA 4JPBW 3CCQA 2EQUA 3PGGA 1VYUA 3TEEA 4BCQD 3B57A 4LE9A 1MNDA 4AI6A 1NG2A 2BIVA 2EYWA 3OMCA 4PJOD 4KBMB 2VYTA 1OZ2A 2WXVB 4JJDA 2CSIA 1G3TA 2HBPA 2KNBB 2E3HA 2X1NB 5GMKi 4KGZB 3CCET 4LNPA
chains in the Genus database with same CATH topology
3ZEHA 4AKHA 2FVUA 2M1HA 2RO0A 2E6ZA 3SB2A 5CKDA 2K5FA 2V8IA 2OTLT 4XTXA 3OYNA 3HL8A 4BD3A 1BYMA 1TH7A 4M75C 3PMTA 3S3NA 1RI0A 2XIDA 3PFSA 4FU6A 4C0FA 4ZTFA 4HT8A 3P8DA 3JCMf 2GQVA 5LJ5f 1KG1A 4M7DG 2K57A 2XI9A 1QVPA 3CPFA 2F5TX 2CZ7B 4EMHA 4M7AG 2RA2A 2XK0A 3EFSA 4N4IA 4DOVA 3CD6T 1N9SA 3OYYA 1KHCA 1QW1A 1KQSS 4ZN3A 2RD1A 4C92E 1VQKT 3S6WA 4OF1A 4OMFB 5LJ3j 5GAN8 1VQ7T 1DJ7B 2L5QA 3QYGB 4J7IA 3JCMQ 1KD1C 4ZGDB 4ZGEB 2K2VA 4M77G 3HRUA 2OTJT 2CZ1B 4C5EA 3ME9A 2G77A 3QPHA 5EG2A 3WVEB 4MMLA 2O01E 2XDDA 4F7UG 3HSBA 3NTIA 2HQEA 2E6NA 2XHCA 3G71A 3HP9A 2VXFA 2X4XA 3Q1JA 5CKEA 4C5IA 2A3LA 2LVMA 1YJNA 2KMTA 3OYGA 2DXBB 4Y28E 2RK2A 4B9WA 3SWNA 2EQKA 3QZ5B 5GAOr 1N27A 3TW6A 2QQ8A 5C0MA 1G3SA 1AHJB 3MEUA 4XTWA 1K9MU 5GAOn 2DZ9A 4C8QC 2O4XB 1NJIC 2BS2A 1VQ4T 1M90U 2D6FA 2L8DA 2DXTA 2BS3A 2FYKA 3M9QA 4OVAA 2KAFA 3M5AA 1UEBA 4JX5A 4C92A 2DD4A 3M4YA 1U8RA 4EDUA 3OBYA 4JS5A 3GOXA 3BW1A 3OS1A 4IUVA 4M78F 1Y07A 3BFMA 2QDYB 4IUQA 1ZHIA 3UDCA 2BS4A 1K8AC 3LYIA 4BUGA 4QVCA 2XG8D 3FDRA 3OSVA 3E9GA 4XTVA 3HO8A 2G3RA 2LDMA 1ZQ1A 2CKKA 4M7AF 4M75D 2KK4A 3CMEA 1WNLA 4HCCA 4J83A 4PJOF 1VQNT 1QVGS 2L3RA 2GF7A 4Z02A 5GMKh 2RHZA 3VKHA 1W4SA 1M5Q1 3QJYA 4L6V5 2RJFA 3CMAA 4ZN1A 2V8JA 3I55A 1M1KU 2LTOA 3PTAA 4ATOA 2MI6A 4M77F 1HK9A 3JCMW 1YIJT 4M7DA 1XOVA 5GAN6 2DTOA 3T9NA 3FB9A 4X9DA 4XTZA 3QXEB 3OYBA 3G71T 4LDVA 4EMKB 1Q82C 4M7AA 2DXCA 5FU7B 1YJNT 2QQAA 3PNWC 2H3JA 4FL6A 5LJ3e 4XK8E 4C0DB 3LWHA 3CCEA 1K73C 2X35A 4R56A 5GAMg 4FT2A 5C6SA 2K4YA 5LJ5j 3MEWA 1MGQA 2DIGA 2K3XA 4J5YA 2CYZB 3KUFA 4OB3B 3QIIA 4MZPA 4BI8B 2LRQA 5GAN7 3X20B 4M77A 4BE2A 4BBSM 4QW2A 3X28B 3RMQA 1YITT 3CBPA 4LDWA 4BE0A 3SWNB 2ZCFB 1Y71A 4F7UA 5GAMf 5CKHA 2DJZA 3M58A 4C8QD 1UGRB 1ZBXA 4JRKA 3OYAA 5CQXA 3CPWS 2RH2A 2DPPB 3C4SA 3JCMP 4ZTJA 3CCMA 1LOJA 3OS2A 1EIFA 4Z6YA 2MWOA 4C92B 2DD4B 4KUIA 2QQBA 2ZPEB 2RB6A 5HK3A 1VQ8T 3CMET 3F70A 3PMIA 2E5QA 4E7LA 3RUXA 3OSSC 2ZZDA 2DIQA 1UGSB 1E7PA 2WACA 3HRTA 1BIAA 3QHSA 3RESA 4E7JA 3S3OA 5AYFA 1MHNA 4MDXA 3CMAT 4AKIA 5CCAA 3I55T 5KCOA 2NLUA 2ZPBB 3LGFA 3WXMB 1N8RC 4CRIA 3L2UA 5GANh 3AHUA 3LGLA 3FRNA 4OP0A 3META 1QP3A 3OMGA 1R8OB 2M16A 1W2BS 2XKOC 3QWLA 3OYKA 1KQSA 4QVDA 2CZ0B 4RG8A 5FRMA 3J7AF 3QJ6A 2WJ9A 3VYGA 5A0DA 1WGSA 4A4KA 1YI2A 1WJQA 3FLGA 2OAUA 3GNFB 1N6AA 4M7DB 4EMGA 4PKCC 3V7CA 2EJGA 2DTHA 5GAOm 3LX7A 2B8AA 4IUUA 2ZPIB 3CCUA 2DXCB 4JDSA 3N5BB 4M78G 2ZPFB 4J6WA 1HXDA 1N9RA 2WSCE 5GAN5 2DTIA 1V29B 4FSXA 1X6OA 1IREB 5M9OA 4C8QG 3PIPA 2QEXT 3CC7T 3JCMV 4EMKC 1QVFS 5FU7C 3QYHB 3LH0A 3VUZA 1YJWA 2MAMA 4HCZA 5KE3A 5LJ5e 4LDYA 3V8JA 4C0DC 3CCMT 3ZFJA 2LQ8A 3JSCA 4CI0C 4M75F 4PJOG 3JCMX 2EJ9A 5HKCA 1VQNA 2GFUA 1I5LA 3A8MB 4F7UB 4NL3A 3L2RA 5A0LA 5J3BA 4XU1A 2RJDA 1PSEA 3FIFA 4C0GA 3GPLA 3QYBA 1VQOT 3QYEA 1VQ6A 3E1SA 2JN0A 4KULA 2AHJB 1YIJA 3JRZA 3TU4K 2PUOB 2QQRA 1NZ9A 4XU2A 2KSSA 3BG9A 2JNGA 2JOYA 5CKFA 1G5VA 5KH6A 1WQ7A 3H4CA 5A2QE 2E1HA 1OI1A 4C92C 5I2SA 4FIBA 5IAYA 1Q81U 4HT9A 3OQ5A 2ZZDB 1Y96A 2X4JA 2BKDN 2RI2A 3HFOA 3P8HA 4BI3A 3GIBA 3HKSA 5GAOq 1FKMA 4IURA 4NS5A 3V8LA 3URGA 5GAMj 2EIFA 4M78E 2LCCA 1YI2T 4HKEA 4AKGA 2LC4A 2EAYA 2E64A 3A5ZB 3JAME 1M1GA 5DY9A 4M7DE 4J6XA 1YITA 3HFNA 5GANd 4BDYA 2E41A 4NC6A 3ER0A 3CCUT 4M7AE 1Q86U 4DOWA 2FB7A 1WJSA 3C94A 4KUDK 5D6YA 1YHQA 1KC8U 3VYGB 3CCRA 3L42A 4PJOE 4C8QF 3DLMA 2FL7A 4C5HA 4MFEA 4X9CA 4MIMA 4A54A 4MFDA 4HLQA 2R5MA 3OYJA 4E7KA 5D6WA 2MMPA 2L89A 3A8OB 1VQ8A 3SDZA 4M7DC 4M77E 2EFIA 2C06A 3A8HB 3CC4A 5LJ5d 4A53A 3M57A 3CCJA 1YJ9T 4HNVA 2XDBA 5KE2A 4F7UE 1VQ5T 4BACA 2QF7A 3GNGA 4M78A 3BDUA 4ELJA 5KCHA 4JJNK 3KHIA 2Y4XA 2EYQA 4HNTA 2LT4A 3MP6A 4BI4A 1VQ6T 4XU0A 4ELYC 2E12A 4C8QA 2QQSA 1VQMA 5LJ3h 3CPWA 2EWNA 1I81A 3JB9D 4L5GA 3MCAB 3RERA 4P5NA 3FEOA 3GP8A 3LWIA 2HAXA 3X24B 1OYXA 3E19A 2PQWA 2I2LA 2DO3A 4PJOA 3BG5A 1BI3A 3OBWA 2LCLA 2PU9B 2P0QA 4MMKA 3V7RA 4HCBA 3HZJA 1XNIA 3JCMJ 1JJ2S 4ZGJB 1KHIA 2R5AA 3GF5A 3M54A 3X26B 4BB7A 2VUBA 3OYIA 1LJOA 2GFAA 4A4FA 4BDZA 4C92D 5IT9E 3MHXA 1K9MC 1G3YA 3HRSA 5CVIA 1UB4A 3S3MA 1Q7YU 1Y96B 4C5GA 1M90C 3CC7A 2QEXA 5J26A 3OB9A 4O6JA 1U1SA 5GAN3 2PVOB 5GAN4 2KR6A 1QP2A 2V8KA 3CCRT 1YHQT 1W2BA 5GAMe 3CBOA 3TCJA 3ZBDA 3OYHA 2JTMA 5CQYA 5J39A 1KQ2A 3NTKA 2YRVA 1I8FA 2Y4YA 4M75G 3LLRA 2GCXA 4TVRA 3KXTA 3DL1A 3RIRA 3DB4A 2EQMA 2VGMA 3BY7A 3M56A 4HL4A 3CC4T 3CC2A 3MEVA 1S72A 2K5IA 4N0AA 3CCJT 4Y91A 3CCSA 2DD5A 2RI3A 1VQOA 2EKOA 2QFZA 3OW2S 3OYDA 3X25B 2VXEA 4FT4A 5HY6A 1BI0A 3MP1A 4XTYA 4YTLA 4OB0B 2MWPA 2RHUA 3E9FA 1FX7A 1JRIA 3M53A 1BI2A 5A0GA 5GAOl 3PIOA 1QVFA 4E47A 3QO3A 2WSEE 2YHTA 1VQMT 4M7DD 3WVDB 4Q5WA 1M1KC 3QKJA 4A4EA 2KVQG 2VC8A 4XQ3A 1JBMA 2X4YA 1X75C 1KD1U 4M78B 3M55A 4PLLA 5GMKm 2KMGA 3QUIA 2QDJA 1WQWA 4MZMA 2QA4A 2CS7A 3DKMA 4X34A 5GANg 3OS0A 1VQ4A 5LJ3d 3HPWA 2K5LA 4M7AB 4BE1A 3JB9H 2DVEA 3H6ZA 3UWNA 2LT1A 3KBGA 2XICA 5CK9A 5LJ5h 4PJOB 2F5KA 4M75E 4IUPA 1JB0E 2MF2A 2QQ9A 5HK0A 3J80E 2BUDA 3I56A 3L2WA 3CBMA 2RK1A 5GANf 3L2VA 1NJIU 2ZPGB 3JCMe 4E7IA 2X4WA 4QVZA 2PUKB 1NPPA 3QG1A 2RM4A 4JLIA 4M77B 4JRPA 1O75A 5GAN2 4OGEA 1H3ZA 1PSFA 1B34A 2KQWA 5CKBA 2QTXA 1YJ9A 1Y7XA 5FLXE 1LNXA 2CGHA 2LQKA 3MO8A 5GAOp 3VKIA 1S72T 1K8AU 1VQ5A 3CC2T 3MP8A 3CCST 2K3YA 2D0QB 1NE8A 2Y90A 4MDWA 3SWNC 2VV5A 1SSFA 3M4GA 4GY5A 1YJWT 3CCQT 4JLGA 4J8OA 3P8BB 4DQ2A 2XU8A 3JB9F 4M6VA 5IN1A 4QQ6A 1FWZA 1YBYA 4FM4B 3TW7A 5LL6S 5DM7R 1D3BA 5GMKj 4R55A 4M75A 2FHDA 3CXCS 1M4ZA 1WJRA 2DD5B 3DLLA 3NTHA 1VIEA 3RMSA 3L1AA 2P0KA 4PLIA 3G4SA 2KDSA 4A4GA 2QI2A 3L2QA 2JZ2A 1QLBA 2M0OA 3MEAA 3RKXA 1QVGA 4EMKA 4L59A 2QA4T 3VV0A 3A8GB 4C8QE 2KY9A 4GLKA 1Q82U 3RKYA 1G3WA 3ASKA 4B9XA 4E7HA 4O5VA 2HD0A 5FU6B 4C92F 4IUTA 4BY6B 1K73U 4JRQA 3OYCA 2F69A 2LX9A 3CCVA 1P92A 4RCCA 2DEQA 2E70A 3UPUA 3I56T 3CEYA 2RHIA 3OYLA 2JVVA 4JS4A 2EJFA 4M78C 4LD9K 3OA6A 3UT1A 4RKUE 3VJPA 1VIFA 1JJ2A 1FXXA 2R57A 3JCMd 3QDRB 3V7SA 4HNUA 5EJCA 4BBRM 4M7AC 1IZ6A 3C12A 4MZTA 2RJCA 5D6XA 2CZ6B 3QZ9B 1M1FA 3G6EA 3JB9J 3JCMc 4PNOA 4XU3A 2E10A 2RHYA 4QQGA 4PJOC 3QSUA 2IVWA 1OZ3A 2EQJA 4QQDA 3FJPA 3OS5A 3HHTB 2ZGWA 2QXFA 4JUVA 4J6YA 1B34B 4M7DF 2R58A 3QBYA 4N4GA 2VGNA 1M9SA 1KQ1A 3O8VA 4M77C 1XTDA 4A4HA 1XQHA 3OYFA 3RKWA 1VQ9A 1H641 3VYHB 2DZCA 2M9UA 2PVGB 4PL6A 4LD6A 3EAEA 3R6OA 3G4ST 5CIUA 5LJ3g 1Q81C 1N8RU 1NPRA 3JB9I 3A8LB 2DK3A 3SD4A 3OW2A 5FRNA 5GANj 4LOCA 3V8KA 2DAQA 3CCLA 3OYEA 2IG0A 3TREA 5CAIA 5I21A 1M8VA 1D3BB 3EFRA 5GAMh 4M75B 4NL2A 4ELZC 4RMOA 1VQLA 5DLOA 3NFCA 3VUBA 4JX4A 2YLCA 4RG2A 5GMKe 3OYMA 3SFMA 2XDPA 2JUFA 3HBLA 2RJEA 3VKGA 4RCBA 2JTFA 5L8RE 5LJ3f 4F7UF 2D9TA 2RHXA 3CCVT 4N0AC 4C0ZA 2XD0A 4V2SA 1Q86C 2YLBA 5I2MA 4II1A 1BI1A 4JRIA 1VQPA 3GLXA 3PT9A 1VUBA 3DB3A 2HNIA 4QSHA 3M59A 1KC8C 2P4TA 4WF2A 4EPCA 1RL2A 2OTLA 2E65A 4D6WA 4OB1B 1I4K1 5GMKl 2A7YA 5FU6C 3JCMb 1BIBA 3INZA 5DLQE 1U1TA 3LW5E 4N4HA 4BY6C 3G6ET 3G7ZA 5CO7A 2RI5A 4M78D 4LDXA 3BG3A 5CR2A 3CCQA 2EQUA 3PGGA 1YCYA 3C95A 3TEEA 3VU3C 3JB9G 3BDLA 1X01A 3HB9A 5FROA 2PVDB 3CD6A 4M7AD 4ME7A 2LNVA 4KT0E 4AI6A 2BIVA 3H8ZA 3OMCA 1GXIE 4OGCA 1VQ9T 1VQKA 4PJOD 2DKGA 2WSFE 4HA8A 4KBMB 4C8QB 2VYTA 1VQ7A 1O9SA 2DXBA 2HQXA 4J7FA 4DA4A 2ZPHB 1OZ2A 4IKFA 2OTJA 4C92G 3CCLT 1WPYA 3L2ZA 4M77D 4XTUA 2O4XA 3OY9A 1G3TA 2DXUA 4VUBA 3JCMh 2HBPA 3J81E 1VQLT 4JX6A 4OB2B 4NOYA 4UC4A 3CXCA 5GMKi 1Q7YC 4XAXB 1VQPT 2P0PA 3CCET 1UGQB 5GANe 3FC3A 3JCMg 5LJ5g 1UGPB 1BKBA 5GAMd 4LDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD4 B;  2ZPE B;  3X24 B;  2PU9 B;  2ZZD A;  1UGS B;  2CZ7 B;  4ZGJ B;  2ZPB B;  3X26 B;  4RKU E;  1QP3 A;  2CZ6 B;  3QZ9 B;  2CZ0 B;  2PVO B;  1QP2 A;  1DJ7 B;  3VYG A;  3QYG B;  4ZGD B;  3HHT B;  4ZGE B;  2CZ1 B;  3WVE B;  2O01 E;  2ZPI B;  2DXC B;  2ZPF B;  3VYH B;  2DD5 A;  2WSC E;  2PVG B;  1V29 B;  2DXB B;  4Y28 E;  1IRE B;  3X25 B;  3QZ5 B;  4OB0 B;  3QYH B;  3A8L B;  1AHJ B;  2WSE E;  3WVD B;  2DD4 A;  3A8M B;  5L8R E;  1PSE A;  2QDY B;  2AHJ B;  2PUO B;  4OB1 B;  2ZZD B;  1JB0 E;  3LW5 E;  4L6V 5;  2ZPG B;  2PUK B;  1PSF A;  2PVD B;  4KT0 E;  3QXE B;  1GXI E;  2DXC A;  2D0Q B;  2WSF E;  3VYG B;  4XK8 E;  2DXB A;  2ZPH B;  2CYZ B;  4OB3 B;  3A8O B;  4FM4 B;  3X20 B;  3X28 B;  3A8H B;  2DD5 B;  4OB2 B;  2ZCF B;  1UGR B;  1UGQ B;  3A8G B;  2DPP B;  1UGP B; 
#chains in the Genus database with same CATH topology
 1WDX A;  4JZ4 A;  1TH7 A;  3PMT A;  1NYF A;  2Z0W A;  4ZTF A;  2WIH B;  2UZL B;  1KG1 A;  2O31 A;  5HBH B;  3CPF A;  2F5T X;  4N4I A;  2RD1 A;  1TWB A;  2CRE A;  1DJ7 B;  2DNU A;  3G6E Q;  2DBK A;  5IDP B;  4M77 G;  4MML A;  4F7L B;  3HSB A;  1U5S A;  2HQE A;  2X4X A;  5CKE A;  4C5I A;  4BCF B;  1YJN A;  2J7I A;  2DXB B;  2COY A;  2RK2 A;  3TSW A;  3SWN A;  3QZ5 B;  1VQ9 Q;  2QQ8 A;  4BY7 X;  1K9M U;  3EOC B;  1D0X A;  5DQW A;  1WI7 A;  2O4X B;  4DBH A;  1NJI C;  2DXT A;  2BS3 A;  2HDA A;  4RUG A;  3M4Y A;  1OV3 A;  2HCK A;  4BCM B;  3OBY A;  1VQL Q;  3GOX A;  2QAZ A;  4IUV A;  4M78 F;  1Y07 A;  4IUQ A;  1K8A C;  5GJW B;  3FDR A;  1ZQ1 A;  4KGV B;  1JO8 A;  1RLQ C;  2CH4 A;  3CME A;  2YXY A;  5FWC A;  4PJO F;  2OTL Q;  1VQN T;  1VYW B;  1RAC B;  2RHZ A;  1WZO A;  4ZN1 A;  1UJY A;  4PFP A;  5HBE B;  2A28 A;  3PTA A;  2E5K A;  1HK9 A;  1YIJ T;  4D8D A;  4F14 A;  5GAN 6;  2KBT A;  3FB9 A;  4X9D A;  4M7A A;  1YJN T;  2YUN A;  4FL6 A;  4C0D B;  2CUD A;  5GAM g;  2KGT A;  2GQI A;  1MGQ A;  2DIG A;  4MZP A;  5GAN 7;  4QW2 A;  2DE0 X;  1YIT T;  3CBP A;  4LDW A;  4PJM A;  2NUZ A;  2DIL A;  2DJZ A;  1BBZ A;  2VB6 A;  2RH2 A;  3JCM P;  1AZG B;  5IHK A;  3OS2 A;  1EIF A;  4CFV B;  4Z6Y A;  4C92 B;  4KUI A;  2QQB A;  2RB6 A;  1WHH A;  3CME T;  1SHF A;  1WYX A;  3OSS C;  1MMD A;  2DIQ A;  1UGS B;  2WAC A;  3VS5 A;  1MUZ A;  1EZZ B;  2FPD A;  2NLU A;  3WXM B;  3AHU A;  3GBQ A;  3MET A;  3OMG A;  2M16 A;  1W2B S;  1WHG A;  4LN2 A;  4RG8 A;  4E2F B;  2L2P A;  2WJ9 A;  3VYG A;  1NLO C;  1WHL A;  4HVV A;  1YI2 A;  3GNF B;  1W2B P;  4M7D B;  1BU1 A;  4PKC C;  2DTH A;  4CFU B;  1PHT A;  2W99 A;  2ZPF B;  1N9R A;  1YWP A;  4FSX A;  2V1R A;  3G71 Q;  3CC7 T;  3TNH B;  3LH0 A;  3TSZ A;  2L0A A;  2CDT A;  2MAM A;  5LJ5 e;  4LDY A;  3V8J A;  4C0D C;  1TXQ A;  1H24 B;  5HKC A;  1I5L A;  4F7U B;  4NL3 A;  2JS2 A;  1WA7 A;  2DX1 A;  3FIF A;  3QYB A;  1VQ6 A;  4KUL A;  2JN0 A;  3IQL A;  1R0B G;  1H25 B;  1S1N A;  2KSS A;  5KYU A;  2JOY A;  2WPA B;  4QT7 A;  3H4C A;  2E1H A;  5I2S A;  4C92 C;  3H41 A;  5IAY A;  3OQ5 A;  2BZY A;  3HFO A;  3P8H A;  3HKS A;  2GBQ A;  5GAM j;  2EIF A;  1YI2 T;  4HKE A;  4AKG A;  2IW8 B;  4EC8 B;  3CMA Q;  4BDY A;  4NC6 A;  1Q86 U;  2FB7 A;  3CCR A;  1D1C A;  2R5M A;  1N5Z A;  2ROL A;  3BLQ B;  4M7D C;  1P5E B;  4ELL A;  2C06 A;  5LJ5 d;  2QF7 A;  2KRM A;  1RAE B;  4JJN K;  5KCH A;  3KHI A;  2Y4X A;  1VQ6 T;  4HNT A;  2HL5 C;  2VKN A;  4XU0 A;  2DBM A;  3CPW A;  1I81 A;  3RER A;  3BHT B;  3GP8 A;  2BZX A;  3X24 B;  2PQW A;  2QG9 B;  2ZAE A;  2P0Q A;  2DYB A;  1H1S B;  4Z88 A;  3M54 A;  3X26 B;  1T0H A;  3BLR B;  5IT9 E;  3QHW B;  2HBW A;  1RLP C;  3MHX A;  3S3M A;  4JJC A;  1M90 C;  2QEX A;  5J26 A;  3CCR T;  1UJ0 A;  1YFN A;  5J39 A;  1KQ2 A;  3NTK A;  3A1P A;  1C9B A;  3DOG B;  1I8F A;  2Y4Y A;  2GCX A;  2H8H A;  4A63 B;  3BY7 A;  2KI7 A;  2LCS A;  3EG0 A;  3BLH B;  4Y91 A;  3CCS A;  4PJJ A;  3CCU Q;  3X25 B;  3FJ5 A;  2CP5 A;  3MP1 A;  3M53 A;  1QVF A;  2EKH A;  4E47 A;  1TD6 A;  1X6B A;  1G3N C;  2KRO A;  4PJL A;  4A4E A;  1VYV A;  2O88 A;  4XQ3 A;  2X4Y A;  1KD1 U;  2JTE A;  2C0T A;  2KMG A;  3RNJ A;  3PE0 A;  2QDJ A;  1E9H B;  3HPW A;  2YUP A;  3JB9 H;  4RTZ A;  4BCN B;  2COW A;  2AK5 A;  5CK9 A;  4GBQ A;  2F5K A;  4M75 E;  1QMZ B;  1CSK A;  3MJX A;  5HK0 A;  1SKU B;  3H9N A;  4JLI A;  2RM4 A;  4M77 B;  4FYW B;  1O75 A;  1H3Z A;  1PSF A;  1H3H A;  2DJQ A;  5CYI B;  3G33 B;  3MO8 A;  1VQ5 A;  1UNH D;  3CCS T;  1C1A A;  1YCS B;  2Y90 A;  1NE8 A;  3M4G A;  2ENM A;  5KYW B;  1YHQ Q;  2I53 A;  4JLG A;  1Z9Q A;  4DQ2 A;  2PK9 B;  5IN1 A;  3TW7 A;  4R0K A;  1NEG A;  4M75 A;  4PFO A;  1M4Z A;  3RMS A;  3L1A A;  1VQ8 Q;  3TQ7 P;  5I5Z B;  2KDS A;  4Y72 B;  3CC4 Q;  3MEA A;  1UNL D;  4L59 A;  3UF4 A;  3A8G B;  4C8Q E;  2KY9 A;  6AT1 B;  3RKY A;  2HD0 A;  2IW6 B;  4IUT A;  2WFY B;  3TN8 B;  3CCV A;  2WIP B;  2DVJ A;  2I40 B;  3CEY A;  2RHI A;  2JVV A;  1UUE A;  2LJ0 A;  2CCH B;  4J9D A;  1JJ2 A;  1PNJ A;  3QDR B;  4MZT A;  3C12 A;  2CZ6 B;  4EOJ B;  1QKW A;  3JB9 J;  1JU5 C;  4EOI B;  1H1R B;  1OZ3 A;  2DL4 A;  3OS5 A;  4JUV A;  2JJ9 A;  3D7S B;  1OPK A;  2HSP A;  1GY3 B;  3QBY A;  2W0Z A;  4M77 C;  1M9S A;  1KQ1 A;  4DEX A;  3RKW A;  1KK7 A;  4PL6 A;  5CIU A;  1KJW A;  2CH4 W;  1Q81 C;  1K9M R;  2QGF B;  4I3Z B;  4E6R A;  4LOC A;  2DAQ A;  3CCL A;  3OYE A;  3TRE A;  5CAI A;  1BK2 A;  5I21 A;  4RMO A;  5GAM h;  4ELZ C;  3NFC A;  3EID B;  2JUF A;  3VKG A;  5LJ3 f;  3CCV T;  2RHX A;  4C0Z A;  1OX9 A;  1SSH A;  1VQP A;  3PT9 A;  3DB3 A;  2QAS A;  1H4L D;  1MV0 B;  4EPC A;  1U06 A;  1RL2 A;  3EFO B;  3MY1 B;  4OB1 B;  1I4K 1;  2A7Y A;  5DLQ E;  1U1T A;  3LW5 E;  4AMC A;  1W98 B;  3BG3 A;  5CR2 A;  4KH0 B;  1WFW A;  3C95 A;  3JB9 G;  1WXB A;  3BDL A;  1X01 A;  5KYY B;  4KT0 E;  1NEB A;  2GTO A;  2O9S A;  1YJ9 Q;  4HA8 A;  4J7F A;  2ZPH B;  2W96 A;  4C92 G;  3CCL T;  1WPY A;  2J06 A;  2BKZ B;  2IW9 B;  4OB2 B;  4NOY A;  4ORZ A;  1WIE A;  1VQP T;  1AWW A;  1UGQ B;  2YWW A;  5GAN e;  3G4S Q;  3JCM g;  5HK3 A;  5LJ5 g;  1VQ4 A;  4Z89 A;  5GAM d;  2W2H A;  2M1H A;  2WMB B;  2E6Z A;  1YN8 A;  1UG1 A;  4XTX A;  1ZA1 B;  3NGP A;  1G8X A;  2K6D A;  3PFS A;  4HT8 A;  4C0F A;  2HKN A;  4M7D G;  1QVP A;  4EMH A;  1ZA2 B;  2XK0 A;  3OYY A;  2JMC A;  4K11 A;  4F70 B;  3CQT A;  3S6W A;  4OF1 A;  4OMF B;  2KYM A;  4CC7 A;  2LJ1 A;  3HRU A;  4KH1 B;  2CZ1 B;  4C5E A;  2G77 A;  3WVE B;  2O01 E;  1E6H A;  4F17 A;  4F7U G;  3NTI A;  1Y57 A;  3HP9 A;  3Q1J A;  2RQR A;  2A3L A;  2EYY A;  2LVM A;  3M0Q A;  2KMT A;  3OYG A;  4HVU A;  8ATC B;  3TW6 A;  1G3S A;  4XTW A;  3MEU A;  3ULR B;  2DZ9 A;  1D0Y A;  3RDV A;  2BS2 A;  1VQ4 T;  3M5A A;  4JX5 A;  1UEC A;  2DD4 A;  2IIM A;  4QKU A;  3K7A M;  3NHN A;  1QCF A;  3BFM A;  2QDY B;  4BUG A;  1D09 B;  1AWO A;  4NST B;  1SPK A;  2G3R A;  2CKK A;  1ZSZ C;  2DET A;  1YNZ A;  4M75 D;  2YRD A;  2EGC A;  2GF7 A;  4M4Z A;  3QJY A;  1M1K U;  3I55 A;  3QWY A;  4CFM B;  4F04 B;  1AZE A;  2PK2 A;  4XTZ A;  3QXE B;  1Q82 C;  1Q86 R;  4LDV A;  4EMK B;  3CD6 Q;  2DXC A;  5FU7 B;  3H0H A;  2DL7 A;  2H3J A;  3CCE A;  1K73 C;  1VQK Q;  4J9B A;  2PZ1 A;  1UHC A;  2K4Y A;  5LJ5 j;  3MEW A;  1VQ7 Q;  1ABO A;  2CYZ B;  3QII A;  2LJ3 A;  2OTJ Q;  2LRQ A;  2F2C A;  3X20 B;  4M77 A;  3X28 B;  4OMO A;  4BCG B;  1EX4 A;  4C8Q D;  1TTH B;  2YUQ A;  2MK5 A;  2JS0 A;  3C4S A;  3CCM A;  1LOJ A;  2MWO A;  3EG1 A;  1KSW A;  4F6W B;  1VQ8 T;  2E4H A;  2RPN A;  2E3I A;  1BB9 A;  1QCN A;  3QHS A;  3RES A;  3RUX A;  1H1Q B;  4MDX A;  3S3O A;  5AYF A;  1MHN A;  4AKI A;  5CCA A;  3I55 T;  2PNI A;  3NDQ A;  2ZPB B;  3LGF A;  1N8R C;  3L2U A;  1B07 A;  3LGL A;  3BHV B;  3OYK A;  1KQS A;  4QVD A;  2CZ0 B;  1AEY A;  4BCH B;  3J7A F;  4LUE A;  4EC9 B;  1WGS A;  2CT3 A;  2OAU A;  1N6A A;  3VS2 A;  2R7G A;  1H26 B;  3V7C A;  3LX7 A;  1K0S A;  2CT4 A;  4IUU A;  4JDS A;  4J6W A;  3PIP A;  2HSE B;  2C4G B;  3HTR A;  1IRE B;  2NUP B;  3JCM V;  4EMK C;  3RBB B;  5FU7 C;  3LQ5 B;  3CCM T;  4CI0 C;  4M75 F;  1FMW A;  2EJ9 A;  1VQN A;  2GFU A;  3A8M B;  2D1X A;  4X1V A;  1X6G A;  2RJD A;  2LNH B;  2MYS A;  5FGK B;  2C0I A;  3H0F A;  2AHJ B;  1YIJ A;  2YSQ A;  4XU2 A;  5HNB B;  1HD3 A;  2JNG A;  5CKF A;  5A2Q E;  1JKW A;  4OMN A;  2YDL A;  1IHV A;  3EGX A;  2ZZD B;  1Y96 A;  1VOL A;  3GIB A;  5GAO q;  1FKM A;  4NS5 A;  2O9V A;  4FW2 A;  1JXO A;  2LC4 A;  3A5Z B;  2DER A;  5DY9 A;  4J6X A;  1YIT A;  4EOL B;  4M7A E;  2L3P A;  1WJS A;  3C94 A;  5D6Y A;  4JJB A;  1KC8 U;  1LPL A;  3VS3 A;  4C8Q F;  1N4M A;  4BY1 X;  1EFN A;  2FL7 A;  3VS7 A;  1KFZ A;  4MFD A;  4HLQ A;  3OYJ A;  4FCY A;  2GNC A;  4F6U B;  2MMP A;  2L89 A;  2QYZ A;  2D8H A;  5KYX A;  1AWX A;  2HQH A;  1M2V B;  2EFI A;  2FZK B;  3A8H B;  1YJ9 T;  5I22 A;  5KE2 A;  3EG9 A;  2KR3 A;  2B9R A;  3RGF B;  4BI4 A;  3EG3 A;  3MP6 A;  2EWN A;  3MCA B;  4J9I A;  2FO0 A;  4P5N A;  3LWI A;  1I07 A;  2HAX A;  2I2L A;  4IIM A;  3OBW A;  3QWX X;  1XNI A;  3PVQ A;  4ZGJ B;  1KHI A;  4BB7 A;  3OYI A;  2V1Q A;  1LJO A;  1ZSZ A;  2RNA A;  4BDZ A;  1G3Y A;  3CC7 A;  5GAN 3;  1U1S A;  2PVO B;  2KR6 A;  2DM1 A;  3NPF A;  4CC2 A;  2UUE B;  2YRV A;  2DL5 A;  3KXT A;  4TVR A;  4J9C A;  3RIR A;  3DB4 A;  2EQM A;  1S72 A;  3M0P A;  2K5I A;  1PWT A;  2SRC A;  1O9K B;  5HY6 A;  3TU4 K;  5IHN A;  4XTY A;  4YTL A;  2MWP A;  5GAO l;  4EOM B;  1BI2 A;  3QO3 A;  2YHT A;  2RQW A;  1F5Q B;  2GGR A;  3WVD B;  4Q5W A;  1Q7Y R;  1OUL A;  2B86 A;  3MKD A;  2KVQ G;  2L3Q A;  2VC8 A;  4M78 B;  1AD5 A;  1NM7 A;  4PLL A;  3EGD B;  5GMK m;  1PM3 A;  5L23 A;  4MZM A;  4X34 A;  5GAN g;  1TUC A;  4BCQ B;  1MMN A;  2WMA B;  4BE1 A;  1WXU A;  2DVE A;  3H6Z A;  3VRY A;  4AFS C;  1X69 A;  5LJ5 h;  4PJO B;  3J80 E;  1NJI U;  2RK1 A;  1RAD B;  5EFQ B;  2ZPG B;  2IN3 A;  3JCM e;  1JEG A;  1NPP A;  4OR5 B;  4JRP A;  1ARK A;  5AT1 B;  1UHF A;  1B34 A;  5DQV A;  1QMC A;  2AZS A;  2QTX A;  5FLX E;  1LNX A;  2CGH A;  2LQK A;  5GAO p;  1S72 T;  1K8A U;  2K3Y A;  1WX6 A;  2BE7 D;  4EOK B;  1OL1 B;  2EGE A;  2BTT A;  2SEM A;  4J8O A;  1H28 B;  2AZV A;  2XU8 A;  2CP6 A;  4J9F A;  4FM4 B;  1D3B A;  2FHD A;  2DD5 B;  4PFZ A;  1QVG A;  2JZ2 A;  1QLB A;  3RKX A;  4EMK A;  3CCJ Q;  1G83 A;  4GLK A;  3ASK A;  4BXX X;  1G2B A;  1SG5 A;  1VQM Q;  4JRQ A;  4DEY A;  2DEQ A;  3UPU A;  1M3A A;  1AT1 B;  2EJF A;  4M78 C;  1M27 C;  1B3Q A;  1FYN A;  1VIF A;  2J6K A;  2R57 A;  3JCM d;  1MNE A;  2DL8 A;  3UA6 A;  5D6X A;  1MV3 A;  1M1F A;  5ACB A;  3G6E A;  4PJO C;  2IVW A;  2QXF A;  4F7N B;  1XO2 A;  1PRM C;  1QKX A;  1XQH A;  1VQ9 A;  3VYH B;  2DZC A;  3I9Q A;  2FG0 A;  1JSU B;  3CC2 Q;  2FZG B;  1IRX A;  3SD4 A;  3OW2 A;  1VQO Q;  1GH6 B;  5GAN j;  2LP5 A;  3V8K A;  1YJW Q;  1VQL A;  2V26 A;  3VUB A;  5GMK e;  2YLC A;  3OYM A;  3HBL A;  5HCK A;  2JTF A;  2XD0 A;  4N0A C;  1SEM A;  5I2M A;  1BI1 A;  4JRI A;  3GLX A;  1QWE A;  3M59 A;  1U3O A;  2FPE A;  2P4T A;  2QA4 Q;  2OTL A;  3GTM S;  4CFN B;  3G6E T;  5CO7 A;  2RI5 A;  4LDX A;  2P4R A;  1M1K R;  5LMK B;  3UAT A;  3I56 Q;  1RAF B;  4M7A D;  5ICP B;  4ME7 A;  2LNV A;  3VS1 A;  3VS0 A;  4OGC A;  1VQ9 T;  2DKG A;  2WSF E;  2ABL A;  1CKB A;  1JQQ A;  2DXB A;  4DA4 A;  1UGV A;  2EVR A;  4RTX A;  1MMA A;  1WXT A;  2J6F A;  2XMF A;  2YT6 A;  3C0C A;  4XTU A;  2O4X A;  2DXU A;  4VUB A;  1VQL T;  1ZP2 A;  2DEU A;  3MY5 B;  4UC4 A;  3CXC A;  1FMV A;  1JXM A;  1Q7Y C;  3UA7 A;  2P0P A;  2ECZ A;  3FC3 A;  2K2M A;  1BKB A;  4LDU A;  5A0D A;  2RO0 A;  1GBQ A;  2C5O B;  2OTL T;  2K5F A;  2V8I A;  4J9E A;  3RR6 A;  2DF6 A;  3HL8 A;  2KYB A;  3S3N A;  1RI0 A;  2XID A;  2DME A;  2RA2 A;  4DOV A;  2W10 A;  4PK4 A;  1KHC A;  1QW1 A;  2K79 A;  4C92 E;  1GCQ C;  1FMK A;  2PMI B;  3JCM Q;  2F2V A;  2CP7 A;  1JST B;  4ZGD B;  3ME9 A;  3PVL A;  2XDD A;  2E6N A;  3G71 A;  3LH5 A;  2ESW A;  2KRS A;  4B9W A;  2EQK A;  1BU2 A;  1AHJ B;  2J05 A;  2X3W D;  5GAO n;  2OI3 A;  3JV3 A;  4J9H A;  2D6F A;  1M90 U;  4OVA A;  4IIO A;  4C92 A;  1OEB A;  4EDU A;  3M03 A;  2G9X B;  3BW1 A;  3OS1 A;  3DDP B;  1M8M A;  3PO3 S;  2BS4 A;  4E7S A;  3LYI A;  4QVC A;  2XG8 D;  3E9G A;  2LDM A;  4M7A F;  2M02 A;  1NBE B;  2H3E B;  2KK4 A;  2COZ A;  1WNL A;  4HCC A;  4J83 A;  1QVG S;  4FW1 A;  1W4S A;  4L6V 5;  2RJF A;  3CMA A;  2X3X D;  4ATO A;  3CCQ Q;  4M7D A;  1PCX A;  2JM8 A;  1HJD A;  3G71 T;  3OYB A;  1ZUK A;  3LWH A;  5LJ3 e;  4XK8 E;  4R56 A;  1OX8 A;  2KXD A;  3EH2 A;  1IXD A;  2DYI A;  4EOS B;  1H27 B;  4BE2 A;  3RMQ A;  3U23 A;  4BE0 A;  4G6L B;  5IF1 B;  1AOJ A;  4YOO A;  3SWN B;  2ZCF B;  1RI9 A;  1UDL A;  1Y71 A;  4F7U A;  5GAM f;  2V22 B;  5EC7 A;  3M58 A;  2DMO A;  4JRK A;  2C0O A;  3CPW S;  4E7Z A;  1J3T A;  2HMA A;  2VAS A;  3CPW P;  3F70 A;  2RF0 A;  3VRZ A;  4E7L A;  4E7J A;  1E7P A;  1OIY B;  3HRT A;  1BIA A;  1TUG B;  3CMA T;  1OKW B;  2OJ2 A;  5GAN h;  3FRN A;  2K3B A;  2RQV A;  9ATC B;  4OGR B;  2FZC B;  5D7U A;  5FRM A;  4AT1 B;  4KGX B;  4A4K A;  1WJQ A;  3MPU B;  2B8A A;  2ZPI B;  3CCU A;  2JMA A;  4M78 G;  1HXD A;  2WSC E;  2DTI A;  5GJV B;  1X6O A;  1YP5 A;  2I0N A;  4C8Q G;  1QVF S;  1K4U S;  3QYH B;  1YJN Q;  3VUZ A;  4HCZ A;  5KE3 A;  4BCJ B;  3ZFJ A;  1QVF P;  4PJO G;  5L2W B;  1V1C A;  3L2R A;  4WCI A;  4C0G A;  1ZSG A;  3GPL A;  1VQO T;  3E1S A;  3JRZ A;  2PUO B;  1OL2 B;  2QGS A;  2K9G A;  1WQ7 A;  1Q81 U;  4BCM D;  1LCK A;  5HVY B;  2BKD N;  2RI2 A;  2X4J A;  3CME Q;  3V8L A;  3URG A;  3O5Z A;  2W9F A;  1M1G A;  4D8K A;  3HFN A;  5GAN d;  5IXF A;  3ER0 A;  3CCU T;  2JM9 A;  1K8A R;  5IXB A;  1YHQ A;  3VYG B;  3L42 A;  3DLM A;  4RTV A;  4X9C A;  3VS6 A;  4A54 A;  1GFD A;  4RTW A;  4E7K A;  5D6W A;  1VQ8 A;  4M77 E;  3CC4 A;  3BE3 A;  2RMO A;  4A53 A;  1W1F A;  4HNV A;  2OX7 A;  4BAC A;  1IB8 A;  3BDU A;  4ELY C;  1RAB B;  2E12 A;  5IDN B;  2DL3 A;  3JB9 D;  3E19 A;  1C0M A;  2DO3 A;  1ZUY A;  3BG5 A;  4HCB A;  2LCL A;  2PU9 B;  3EGU A;  3NMZ C;  3V7R A;  1QQJ A;  2K7A A;  3JCM J;  1BCM A;  2DA9 A;  4EOP B;  1JJ2 S;  5KYU B;  1GBR A;  4A4F A;  4C92 D;  1K9M C;  5CVI A;  1UB4 A;  2KT8 A;  2NYS A;  1JJ2 P;  4JZ3 A;  1YHQ T;  1QP2 A;  2V8K A;  5LQF B;  1W2B A;  3CBO A;  3ZBD A;  3OYH A;  1OU9 A;  5CQY A;  3TNW B;  1Z9Z A;  5KYW A;  3SHW A;  3DL1 A;  1YI2 Q;  3M56 A;  3CC4 T;  4ZNX A;  2O2O A;  3OYD A;  2VXE A;  4FT4 A;  1BI0 A;  5A0G A;  3PIO A;  4M7D D;  4KRT A;  2L3S A;  4CFU D;  4FYY B;  1JBM A;  1X75 C;  4BCI B;  1PD1 A;  2EW3 A;  3OS0 A;  3DKM A;  2UZE B;  4UN0 A;  1VQ6 Q;  1AIS B;  2PJQ A;  2AKL A;  2EYX A;  3UWN A;  5I11 A;  2LT1 A;  2XIC A;  2F2W A;  4IUP A;  2QQ9 A;  4KRC B;  3THK A;  2BUD A;  4EIK A;  3L2W A;  3CBM A;  2ATC B;  4E7I A;  4QVZ A;  5CEI B;  1SF9 A;  2PUK B;  3QG1 A;  1WHM A;  4OGE A;  1AWJ A;  1WHK A;  1YJ9 A;  1KD1 R;  3MP8 A;  2D0Q B;  4DBR A;  2LX7 A;  4MDW A;  4OMP A;  1BCO A;  2VV5 A;  1SSF A;  4GY5 A;  1VIN A;  3CCQ T;  3CCR Q;  2UZB B;  2X51 A;  1ABQ A;  3JB9 F;  4M6V A;  4QQ6 A;  1FWZ A;  5DM7 R;  2X9H A;  3A98 A;  5GMK j;  3DLL A;  2ED1 A;  1VIE A;  2P0K A;  2A37 A;  2F1L A;  1TS9 A;  4EOR B;  4PLI A;  3G4S A;  3VV0 A;  3TNI B;  2F2X A;  2M51 A;  1XJW B;  1Q82 U;  1YWO A;  4B9X A;  4E7H A;  1PKT A;  4C92 F;  1K73 U;  3EFO A;  2F69 A;  1P92 A;  4RCC A;  2EQI A;  4YOZ A;  3OYL A;  4LUD A;  4WTO B;  1RAG B;  4LD9 K;  3SEM A;  1A0N B;  2KE9 A;  3VJP A;  2JW4 A;  1UNG D;  1IO6 A;  1FXX A;  5KYY A;  4RTT A;  1GUX B;  4BBR M;  1IZ6 A;  4XU3 A;  4OML A;  2E10 A;  1Q95 G;  2FEI A;  2KT1 A;  4OMQ A;  2QEX Q;  1VYT A;  2EQJ A;  4M7D F;  3M0R A;  2R58 A;  4N4G A;  3POM A;  3O8V A;  3OYF A;  1I1J A;  1H64 1;  1H1P B;  3G4S T;  4LD6 A;  3EAE A;  5LJ3 g;  1X43 A;  1N8R U;  3CCS Q;  3A8L B;  2DK3 A;  1AVZ C;  5FRN A;  1M3B A;  1M90 R;  2IG0 A;  3QHR B;  1RAI B;  4CC3 A;  1M8V A;  1H92 A;  3EFR A;  4M75 B;  4EON B;  3SFM A;  2XDP A;  4RCB A;  2RJE A;  4F7U F;  5L8R E;  4FX3 B;  2WEV B;  2D9T A;  1Q86 C;  2RQT A;  3DDQ B;  2YLB A;  4II1 A;  1VUB A;  2HNI A;  4QSH A;  2DRK A;  2NUT B;  3EG2 A;  5KYN A;  5HQ0 B;  2E65 A;  4D6W A;  3KFV A;  3INZ A;  4N4H A;  1SRM A;  2BE9 B;  1QWF A;  3G7Z A;  1YCY A;  3VU3 C;  1T3L A;  3HB9 A;  5FRO A;  2PVD B;  2KXC A;  3CD6 A;  1F1B B;  4ROC A;  4BCN D;  3H8Z A;  1GXI E;  4DBQ A;  4PJN A;  1VQK A;  1PD0 A;  2BPM B;  4C8Q B;  1VQ7 A;  1O9S A;  2HQX A;  1VQ5 Q;  4ANJ A;  2OTJ A;  3L2Z A;  4M77 D;  3OY9 A;  4ROE A;  1FIN B;  3JCM h;  4JX6 A;  4AFZ C;  4XAX B;  1JOW A;  1UGP B;  1UTI A;  3ZEH A;  4AKH A;  2FVU A;  3SB2 A;  5CKD A;  2YRC A;  3OYN A;  4F6S B;  2LW4 A;  4BD3 A;  1BYM A;  4M75 C;  2JGZ B;  4ESR A;  4FU6 A;  2JXB A;  2PTK A;  3P8D A;  2PHG A;  3JCM f;  2GQV A;  5LJ5 f;  3CCV Q;  2K57 A;  2M0Y A;  2XI9 A;  1E7O A;  1I0C A;  2MCN A;  2CZ7 B;  3TVT A;  4M7A G;  3EFS A;  1SHG A;  3CD6 T;  1N9S A;  4BCO B;  2RN8 A;  4ZN3 A;  1KQS S;  3MIA B;  1VQK T;  1PC0 A;  4AFQ C;  5LJ3 j;  5GAN 8;  1VQ7 T;  2L5Q A;  3QYG B;  4J7I A;  1KQS P;  1KD1 C;  4ZGE B;  2K2V A;  4GLM A;  2OTJ T;  2IVX A;  3QPH A;  5EG2 A;  3ZL7 C;  2XHC A;  3EHR A;  1KIK A;  2VXF A;  3M0T A;  1R0C B;  4Y28 E;  2C5V B;  5GAO r;  4BCK B;  1N27 A;  5C0M A;  1LVK A;  4C8Q C;  2ROT A;  2L8D A;  1ENW A;  1IGQ A;  2FYK A;  1K0X A;  3M9Q A;  2KAF A;  1UEB A;  5HBJ B;  3CCL Q;  4CC4 B;  2MPX C;  1U8R A;  4EOQ B;  3MI9 B;  4JS5 A;  2C6T B;  1ZHI A;  3UDC A;  1WLP B;  3OSV A;  4XTV A;  3HO8 A;  1VQP Q;  1D1A A;  4YOS A;  4YC3 B;  1Q81 R;  2W9Z A;  2L3R A;  4Z02 A;  2P84 A;  5GMK h;  3VKH A;  1ZUU A;  1M5Q 1;  2V8J A;  2LTO A;  3REB B;  7AT1 B;  2MI6 A;  4M77 F;  4AG1 C;  3JCM W;  1XOV A;  1WHJ A;  2DTO A;  3T9N A;  1TG0 A;  4AFU C;  2QQA A;  3PNW C;  4II5 B;  1QLY A;  2X35 A;  2NUP A;  2G6F X;  4FT2 A;  1GFC A;  1RUW A;  5C6S A;  1NYG A;  2K3X A;  4J5Y A;  3KUF A;  4OB3 B;  1TUD A;  3QDF A;  4BI8 B;  1D1B A;  1Y0M A;  4BBS M;  2J6O A;  2C5X B;  5CKH A;  3AT1 B;  1PKS A;  1UGR B;  1ZBX A;  3M0S A;  3OYA A;  5CQX A;  4ZTJ A;  2DPP B;  1KXU A;  2CP2 A;  2LZ6 B;  2DD4 B;  3EHQ A;  4J9G A;  2ZPE B;  1VQ4 Q;  5BNJ B;  3PMI A;  2E5Q A;  2NWM A;  1T0J A;  2ZZD A;  2QK0 A;  1OU8 A;  4FSS A;  1B7T A;  5KCO A;  2DLP A;  4CRI A;  4BCP B;  2QGG A;  1D3U B;  4OP0 A;  1QP3 A;  1W6X A;  1R8O B;  2XKO C;  3QWL A;  1UE9 A;  3I5R A;  2EUF A;  3QJ6 A;  2RQU A;  3FLG A;  4EMG A;  5GAO m;  2EJG A;  1X27 A;  2CP3 A;  2DXC B;  2A08 A;  3N5B B;  1M2V A;  2AT1 B;  4TTH A;  4HCK A;  5GAN 5;  1V29 B;  2FRY A;  1GUX A;  2HKQ B;  2QTV A;  3H0I A;  5M9O A;  2QEX T;  2EBP A;  3VS4 A;  4CFX B;  1M3C A;  2LQ8 A;  3JSC A;  1M30 A;  4B6M A;  8AT1 B;  3JCM X;  1OIU B;  2BZ8 A;  5A0L A;  5J3B A;  4XU1 A;  1PSE A;  5FWB A;  3QYE A;  4LXC A;  2QQR A;  1NZ9 A;  3I35 A;  1G5V A;  3BG9 A;  2EPD A;  3F5X B;  1I5O B;  5KH6 A;  1OI1 A;  4FIB A;  4HT9 A;  2HEQ A;  4BI3 A;  4IUR A;  2AKK A;  1TOV A;  4M78 E;  2MOX A;  2LCC A;  2EAY A;  2E64 A;  3JAM E;  4M7D E;  2EGA A;  2HL3 A;  3I55 Q;  2E41 A;  2LQW A;  2NUT A;  2CUB A;  2DRM A;  4DOW A;  1RAH B;  4KUD K;  4PJO E;  1M2O A;  4C5H A;  1O9K A;  1TU0 B;  4MFE A;  1TFB A;  4MIM A;  5IH2 A;  3CCE Q;  5IHI A;  4KRD B;  1K1Z A;  2IPO B;  4OMM A;  2CCI B;  3A8O B;  3SDZ A;  3CCJ A;  3M57 A;  2XDB A;  3G1J A;  4F7U E;  2KEA A;  1VQ5 T;  3GNG A;  4M78 A;  4ELJ A;  3EGD A;  2EYQ A;  2LT4 A;  1QVG P;  1URC B;  1TSF A;  2HZY A;  4C8Q A;  2QQS A;  1Q82 R;  1VQM A;  5LJ3 h;  2OAW A;  4L5G A;  3FEO A;  3CCM Q;  1HSQ A;  1K73 R;  1OYX A;  1C6V X;  1KC8 R;  1IGU A;  4PJO A;  1BI3 A;  4MMK A;  2WHB B;  2JT4 A;  4AG2 C;  3HZJ A;  1ACM B;  2R5A A;  3GF5 A;  2VUB A;  2GFA A;  2FPF A;  3HRS A;  1QCO A;  1Q7Y U;  3EGX B;  1Y96 B;  4C5G A;  2UZD B;  3OB9 A;  4O6J A;  5GAN 4;  2YUO A;  5GAM e;  3TCJ A;  1NLP C;  2QDL A;  2JTM A;  3I5S A;  4M75 G;  3LLR A;  1HYO A;  3DTO A;  1VA7 A;  2VGM A;  4HL4 A;  3O0G D;  3CC2 A;  3MEV A;  4N0A A;  3CCJ T;  2DD5 A;  2RI3 A;  2VVK A;  2EKO A;  1VQO A;  2QFZ A;  1RAA B;  3OW2 S;  1N8R R;  4OB0 B;  2RHU A;  3E9F A;  1YJW A;  1FX7 A;  1JRI A;  1D0Z A;  5KYX B;  2WSE E;  1VQM T;  3OW2 P;  1UFF A;  1OKV B;  1M1K C;  3QKJ A;  1IHW A;  1OPL A;  1FVV B;  4CRL B;  1AD6 A;  3EG9 B;  3E2U A;  3M55 A;  1VQN Q;  3QUI A;  1WQW A;  2QA4 A;  2CS7 A;  5LJ3 d;  2K5L A;  4M7A B;  4F7J B;  1H8K A;  1YIJ Q;  3KBG A;  1OGU B;  2MIO A;  4IMY B;  1JB0 E;  2MF2 A;  3I56 A;  1V76 A;  5GAN f;  3L2V A;  2X4W A;  1ZSZ B;  5GAN 2;  1ZLM A;  2KQW A;  5CKB A;  2D8J A;  1Y7X A;  3CC2 T;  1YIT Q;  3VKI A;  4CFW B;  1VOM A;  4Z8A A;  3SWN C;  4F16 A;  1YJW T;  3P8B B;  2KRN A;  1PG5 B;  4R55 A;  1YBY A;  1MMG A;  1X2K A;  5LL6 S;  4IKF A;  2DFU A;  3CXC S;  1WJR A;  2A0F B;  1OOT A;  3NTH A;  3DJB A;  1NJI R;  4A4G A;  2QI2 A;  1GCP A;  3L2Q A;  2M0O A;  3EH1 A;  3CXC P;  2QA4 T;  4FYV B;  3REA B;  1G3W A;  4RTU A;  4O5V A;  1OQK A;  5FU6 B;  1GCQ A;  4BY6 B;  4RTY A;  2D0N A;  3OYC A;  2LX9 A;  3EJ1 B;  1GL5 A;  2E70 A;  3I56 T;  2VWF A;  4JS4 A;  4EOO B;  3OA6 A;  4Y92 A;  3BHU B;  2ED0 A;  2FRW A;  3UT1 A;  4RKU E;  2CP0 A;  1ZBJ A;  3V7S A;  4HNU A;  5EJC A;  4M7A C;  2C5N B;  2RJC A;  3QZ9 B;  2LMJ A;  3JCM c;  4PNO A;  2RHY A;  1K76 A;  4QQG A;  1X2Q A;  4F7S B;  3CC7 Q;  3QSU A;  5ECA A;  4DBF A;  3M0U A;  4QQD A;  3FJP A;  1ZX6 A;  3HHT B;  2ZGW A;  4J6Y A;  1B34 B;  2GTJ A;  2VGN A;  1PKD B;  1R77 A;  4A4H A;  1XTD A;  2CJM B;  2AIR B;  2M9U A;  4CXA B;  2PVG B;  3R6O A;  2A36 A;  1S72 Q;  1NPR A;  4HVW A;  3JB9 I;  3R6N A;  1T3S A;  1D3B B;  1OI9 B;  2LQN A;  4NL2 A;  1W70 A;  5DLO A;  4JX4 A;  4RG2 A;  2EYZ A;  2CSQ A;  4HXJ A;  3J81 E;  1CKA A;  4ROD A;  1SRL A;  4V2S A;  1GRI A;  4FYX B;  1KC8 C;  1PRL C;  4WF2 A;  5FW9 A;  5GMK l;  1E6G A;  5FU6 C;  3JCM b;  1BIB A;  1K9A A;  4BY6 C;  4M78 D;  5IHY A;  4JPB W;  3CCQ A;  2EQU A;  3PGG A;  1VYU A;  3TEE A;  4BCQ D;  3B57 A;  4LE9 A;  1MND A;  4AI6 A;  1NG2 A;  2BIV A;  2EYW A;  3OMC A;  4PJO D;  4KBM B;  2VYT A;  1OZ2 A;  2WXV B;  4JJD A;  2CSI A;  1G3T A;  2HBP A;  2KNB B;  2E3H A;  2X1N B;  5GMK i;  4KGZ B;  3CCE T;  4LNP A; 
#chains in the Genus database with same CATH homology
 3ZEH A;  4AKH A;  2FVU A;  2M1H A;  2RO0 A;  2E6Z A;  3SB2 A;  5CKD A;  2K5F A;  2V8I A;  2OTL T;  4XTX A;  3OYN A;  3HL8 A;  4BD3 A;  1BYM A;  1TH7 A;  4M75 C;  3PMT A;  3S3N A;  1RI0 A;  2XID A;  3PFS A;  4FU6 A;  4C0F A;  4ZTF A;  4HT8 A;  3P8D A;  3JCM f;  2GQV A;  5LJ5 f;  1KG1 A;  4M7D G;  2K57 A;  2XI9 A;  1QVP A;  3CPF A;  2F5T X;  2CZ7 B;  4EMH A;  4M7A G;  2RA2 A;  2XK0 A;  3EFS A;  4N4I A;  4DOV A;  3CD6 T;  1N9S A;  3OYY A;  1KHC A;  1QW1 A;  1KQS S;  4ZN3 A;  2RD1 A;  4C92 E;  1VQK T;  3S6W A;  4OF1 A;  4OMF B;  5LJ3 j;  5GAN 8;  1VQ7 T;  1DJ7 B;  2L5Q A;  3QYG B;  4J7I A;  3JCM Q;  1KD1 C;  4ZGD B;  4ZGE B;  2K2V A;  4M77 G;  3HRU A;  2OTJ T;  2CZ1 B;  4C5E A;  3ME9 A;  2G77 A;  3QPH A;  5EG2 A;  3WVE B;  4MML A;  2O01 E;  2XDD A;  4F7U G;  3HSB A;  3NTI A;  2HQE A;  2E6N A;  2XHC A;  3G71 A;  3HP9 A;  2VXF A;  2X4X A;  3Q1J A;  5CKE A;  4C5I A;  2A3L A;  2LVM A;  1YJN A;  2KMT A;  3OYG A;  2DXB B;  4Y28 E;  2RK2 A;  4B9W A;  3SWN A;  2EQK A;  3QZ5 B;  5GAO r;  1N27 A;  3TW6 A;  2QQ8 A;  5C0M A;  1G3S A;  1AHJ B;  3MEU A;  4XTW A;  1K9M U;  5GAO n;  2DZ9 A;  4C8Q C;  2O4X B;  1NJI C;  2BS2 A;  1VQ4 T;  1M90 U;  2D6F A;  2L8D A;  2DXT A;  2BS3 A;  2FYK A;  3M9Q A;  4OVA A;  2KAF A;  3M5A A;  1UEB A;  4JX5 A;  4C92 A;  2DD4 A;  3M4Y A;  1U8R A;  4EDU A;  3OBY A;  4JS5 A;  3GOX A;  3BW1 A;  3OS1 A;  4IUV A;  4M78 F;  1Y07 A;  3BFM A;  2QDY B;  4IUQ A;  1ZHI A;  3UDC A;  2BS4 A;  1K8A C;  3LYI A;  4BUG A;  4QVC A;  2XG8 D;  3FDR A;  3OSV A;  3E9G A;  4XTV A;  3HO8 A;  2G3R A;  2LDM A;  1ZQ1 A;  2CKK A;  4M7A F;  4M75 D;  2KK4 A;  3CME A;  1WNL A;  4HCC A;  4J83 A;  4PJO F;  1VQN T;  1QVG S;  2L3R A;  2GF7 A;  4Z02 A;  5GMK h;  2RHZ A;  3VKH A;  1W4S A;  1M5Q 1;  3QJY A;  4L6V 5;  2RJF A;  3CMA A;  4ZN1 A;  2V8J A;  3I55 A;  1M1K U;  2LTO A;  3PTA A;  4ATO A;  2MI6 A;  4M77 F;  1HK9 A;  3JCM W;  1YIJ T;  4M7D A;  1XOV A;  5GAN 6;  2DTO A;  3T9N A;  3FB9 A;  4X9D A;  4XTZ A;  3QXE B;  3OYB A;  3G71 T;  4LDV A;  4EMK B;  1Q82 C;  4M7A A;  2DXC A;  5FU7 B;  1YJN T;  2QQA A;  3PNW C;  2H3J A;  4FL6 A;  5LJ3 e;  4XK8 E;  4C0D B;  3LWH A;  3CCE A;  1K73 C;  2X35 A;  4R56 A;  5GAM g;  4FT2 A;  5C6S A;  2K4Y A;  5LJ5 j;  3MEW A;  1MGQ A;  2DIG A;  2K3X A;  4J5Y A;  2CYZ B;  3KUF A;  4OB3 B;  3QII A;  4MZP A;  4BI8 B;  2LRQ A;  5GAN 7;  3X20 B;  4M77 A;  4BE2 A;  4BBS M;  4QW2 A;  3X28 B;  3RMQ A;  1YIT T;  3CBP A;  4LDW A;  4BE0 A;  3SWN B;  2ZCF B;  1Y71 A;  4F7U A;  5GAM f;  5CKH A;  2DJZ A;  3M58 A;  4C8Q D;  1UGR B;  1ZBX A;  4JRK A;  3OYA A;  5CQX A;  3CPW S;  2RH2 A;  2DPP B;  3C4S A;  3JCM P;  4ZTJ A;  3CCM A;  1LOJ A;  3OS2 A;  1EIF A;  4Z6Y A;  2MWO A;  4C92 B;  2DD4 B;  4KUI A;  2QQB A;  2ZPE B;  2RB6 A;  5HK3 A;  1VQ8 T;  3CME T;  3F70 A;  3PMI A;  2E5Q A;  4E7L A;  3RUX A;  3OSS C;  2ZZD A;  2DIQ A;  1UGS B;  1E7P A;  2WAC A;  3HRT A;  1BIA A;  3QHS A;  3RES A;  4E7J A;  3S3O A;  5AYF A;  1MHN A;  4MDX A;  3CMA T;  4AKI A;  5CCA A;  3I55 T;  5KCO A;  2NLU A;  2ZPB B;  3LGF A;  3WXM B;  1N8R C;  4CRI A;  3L2U A;  5GAN h;  3AHU A;  3LGL A;  3FRN A;  4OP0 A;  3MET A;  1QP3 A;  3OMG A;  1R8O B;  2M16 A;  1W2B S;  2XKO C;  3QWL A;  3OYK A;  1KQS A;  4QVD A;  2CZ0 B;  4RG8 A;  5FRM A;  3J7A F;  3QJ6 A;  2WJ9 A;  3VYG A;  5A0D A;  1WGS A;  4A4K A;  1YI2 A;  1WJQ A;  3FLG A;  2OAU A;  3GNF B;  1N6A A;  4M7D B;  4EMG A;  4PKC C;  3V7C A;  2EJG A;  2DTH A;  5GAO m;  3LX7 A;  2B8A A;  4IUU A;  2ZPI B;  3CCU A;  2DXC B;  4JDS A;  3N5B B;  4M78 G;  2ZPF B;  4J6W A;  1HXD A;  1N9R A;  2WSC E;  5GAN 5;  2DTI A;  1V29 B;  4FSX A;  1X6O A;  1IRE B;  5M9O A;  4C8Q G;  3PIP A;  2QEX T;  3CC7 T;  3JCM V;  4EMK C;  1QVF S;  5FU7 C;  3QYH B;  3LH0 A;  3VUZ A;  1YJW A;  2MAM A;  4HCZ A;  5KE3 A;  5LJ5 e;  4LDY A;  3V8J A;  4C0D C;  3CCM T;  3ZFJ A;  2LQ8 A;  3JSC A;  4CI0 C;  4M75 F;  4PJO G;  3JCM X;  2EJ9 A;  5HKC A;  1VQN A;  2GFU A;  1I5L A;  3A8M B;  4F7U B;  4NL3 A;  3L2R A;  5A0L A;  5J3B A;  4XU1 A;  2RJD A;  1PSE A;  3FIF A;  4C0G A;  3GPL A;  3QYB A;  1VQO T;  3QYE A;  1VQ6 A;  3E1S A;  2JN0 A;  4KUL A;  2AHJ B;  1YIJ A;  3JRZ A;  3TU4 K;  2PUO B;  2QQR A;  1NZ9 A;  4XU2 A;  2KSS A;  3BG9 A;  2JNG A;  2JOY A;  5CKF A;  1G5V A;  5KH6 A;  1WQ7 A;  3H4C A;  5A2Q E;  2E1H A;  1OI1 A;  4C92 C;  5I2S A;  4FIB A;  5IAY A;  1Q81 U;  4HT9 A;  3OQ5 A;  2ZZD B;  1Y96 A;  2X4J A;  2BKD N;  2RI2 A;  3HFO A;  3P8H A;  4BI3 A;  3GIB A;  3HKS A;  5GAO q;  1FKM A;  4IUR A;  4NS5 A;  3V8L A;  3URG A;  5GAM j;  2EIF A;  4M78 E;  2LCC A;  1YI2 T;  4HKE A;  4AKG A;  2LC4 A;  2EAY A;  2E64 A;  3A5Z B;  3JAM E;  1M1G A;  5DY9 A;  4M7D E;  4J6X A;  1YIT A;  3HFN A;  5GAN d;  4BDY A;  2E41 A;  4NC6 A;  3ER0 A;  3CCU T;  4M7A E;  1Q86 U;  4DOW A;  2FB7 A;  1WJS A;  3C94 A;  4KUD K;  5D6Y A;  1YHQ A;  1KC8 U;  3VYG B;  3CCR A;  3L42 A;  4PJO E;  4C8Q F;  3DLM A;  2FL7 A;  4C5H A;  4MFE A;  4X9C A;  4MIM A;  4A54 A;  4MFD A;  4HLQ A;  2R5M A;  3OYJ A;  4E7K A;  5D6W A;  2MMP A;  2L89 A;  3A8O B;  1VQ8 A;  3SDZ A;  4M7D C;  4M77 E;  2EFI A;  2C06 A;  3A8H B;  3CC4 A;  5LJ5 d;  4A53 A;  3M57 A;  3CCJ A;  1YJ9 T;  4HNV A;  2XDB A;  5KE2 A;  4F7U E;  1VQ5 T;  4BAC A;  2QF7 A;  3GNG A;  4M78 A;  3BDU A;  4ELJ A;  5KCH A;  4JJN K;  3KHI A;  2Y4X A;  2EYQ A;  4HNT A;  2LT4 A;  3MP6 A;  4BI4 A;  1VQ6 T;  4XU0 A;  4ELY C;  2E12 A;  4C8Q A;  2QQS A;  1VQM A;  5LJ3 h;  3CPW A;  2EWN A;  1I81 A;  3JB9 D;  4L5G A;  3MCA B;  3RER A;  4P5N A;  3FEO A;  3GP8 A;  3LWI A;  2HAX A;  3X24 B;  1OYX A;  3E19 A;  2PQW A;  2I2L A;  2DO3 A;  4PJO A;  3BG5 A;  1BI3 A;  3OBW A;  2LCL A;  2PU9 B;  2P0Q A;  4MMK A;  3V7R A;  4HCB A;  3HZJ A;  1XNI A;  3JCM J;  1JJ2 S;  4ZGJ B;  1KHI A;  2R5A A;  3GF5 A;  3M54 A;  3X26 B;  4BB7 A;  2VUB A;  3OYI A;  1LJO A;  2GFA A;  4A4F A;  4BDZ A;  4C92 D;  5IT9 E;  3MHX A;  1K9M C;  1G3Y A;  3HRS A;  5CVI A;  1UB4 A;  3S3M A;  1Q7Y U;  1Y96 B;  4C5G A;  1M90 C;  3CC7 A;  2QEX A;  5J26 A;  3OB9 A;  4O6J A;  1U1S A;  5GAN 3;  2PVO B;  5GAN 4;  2KR6 A;  1QP2 A;  2V8K A;  3CCR T;  1YHQ T;  1W2B A;  5GAM e;  3CBO A;  3TCJ A;  3ZBD A;  3OYH A;  2JTM A;  5CQY A;  5J39 A;  1KQ2 A;  3NTK A;  2YRV A;  1I8F A;  2Y4Y A;  4M75 G;  3LLR A;  2GCX A;  4TVR A;  3KXT A;  3DL1 A;  3RIR A;  3DB4 A;  2EQM A;  2VGM A;  3BY7 A;  3M56 A;  4HL4 A;  3CC4 T;  3CC2 A;  3MEV A;  1S72 A;  2K5I A;  4N0A A;  3CCJ T;  4Y91 A;  3CCS A;  2DD5 A;  2RI3 A;  1VQO A;  2EKO A;  2QFZ A;  3OW2 S;  3OYD A;  3X25 B;  2VXE A;  4FT4 A;  5HY6 A;  1BI0 A;  3MP1 A;  4XTY A;  4YTL A;  4OB0 B;  2MWP A;  2RHU A;  3E9F A;  1FX7 A;  1JRI A;  3M53 A;  1BI2 A;  5A0G A;  5GAO l;  3PIO A;  1QVF A;  4E47 A;  3QO3 A;  2WSE E;  2YHT A;  1VQM T;  4M7D D;  3WVD B;  4Q5W A;  1M1K C;  3QKJ A;  4A4E A;  2KVQ G;  2VC8 A;  4XQ3 A;  1JBM A;  2X4Y A;  1X75 C;  1KD1 U;  4M78 B;  3M55 A;  4PLL A;  5GMK m;  2KMG A;  3QUI A;  2QDJ A;  1WQW A;  4MZM A;  2QA4 A;  2CS7 A;  3DKM A;  4X34 A;  5GAN g;  3OS0 A;  1VQ4 A;  5LJ3 d;  3HPW A;  2K5L A;  4M7A B;  4BE1 A;  3JB9 H;  2DVE A;  3H6Z A;  3UWN A;  2LT1 A;  3KBG A;  2XIC A;  5CK9 A;  5LJ5 h;  4PJO B;  2F5K A;  4M75 E;  4IUP A;  1JB0 E;  2MF2 A;  2QQ9 A;  5HK0 A;  3J80 E;  2BUD A;  3I56 A;  3L2W A;  3CBM A;  2RK1 A;  5GAN f;  3L2V A;  1NJI U;  2ZPG B;  3JCM e;  4E7I A;  2X4W A;  4QVZ A;  2PUK B;  1NPP A;  3QG1 A;  2RM4 A;  4JLI A;  4M77 B;  4JRP A;  1O75 A;  5GAN 2;  4OGE A;  1H3Z A;  1PSF A;  1B34 A;  2KQW A;  5CKB A;  2QTX A;  1YJ9 A;  1Y7X A;  5FLX E;  1LNX A;  2CGH A;  2LQK A;  3MO8 A;  5GAO p;  3VKI A;  1S72 T;  1K8A U;  1VQ5 A;  3CC2 T;  3MP8 A;  3CCS T;  2K3Y A;  2D0Q B;  1NE8 A;  2Y90 A;  4MDW A;  3SWN C;  2VV5 A;  1SSF A;  3M4G A;  4GY5 A;  1YJW T;  3CCQ T;  4JLG A;  4J8O A;  3P8B B;  4DQ2 A;  2XU8 A;  3JB9 F;  4M6V A;  5IN1 A;  4QQ6 A;  1FWZ A;  1YBY A;  4FM4 B;  3TW7 A;  5LL6 S;  5DM7 R;  1D3B A;  5GMK j;  4R55 A;  4M75 A;  2FHD A;  3CXC S;  1M4Z A;  1WJR A;  2DD5 B;  3DLL A;  3NTH A;  1VIE A;  3RMS A;  3L1A A;  2P0K A;  4PLI A;  3G4S A;  2KDS A;  4A4G A;  2QI2 A;  3L2Q A;  2JZ2 A;  1QLB A;  2M0O A;  3MEA A;  3RKX A;  1QVG A;  4EMK A;  4L59 A;  2QA4 T;  3VV0 A;  3A8G B;  4C8Q E;  2KY9 A;  4GLK A;  1Q82 U;  3RKY A;  1G3W A;  3ASK A;  4B9X A;  4E7H A;  4O5V A;  2HD0 A;  5FU6 B;  4C92 F;  4IUT A;  4BY6 B;  1K73 U;  4JRQ A;  3OYC A;  2F69 A;  2LX9 A;  3CCV A;  1P92 A;  4RCC A;  2DEQ A;  2E70 A;  3UPU A;  3I56 T;  3CEY A;  2RHI A;  3OYL A;  2JVV A;  4JS4 A;  2EJF A;  4M78 C;  4LD9 K;  3OA6 A;  3UT1 A;  4RKU E;  3VJP A;  1VIF A;  1JJ2 A;  1FXX A;  2R57 A;  3JCM d;  3QDR B;  3V7S A;  4HNU A;  5EJC A;  4BBR M;  4M7A C;  1IZ6 A;  3C12 A;  4MZT A;  2RJC A;  5D6X A;  2CZ6 B;  3QZ9 B;  1M1F A;  3G6E A;  3JB9 J;  3JCM c;  4PNO A;  4XU3 A;  2E10 A;  2RHY A;  4QQG A;  4PJO C;  3QSU A;  2IVW A;  1OZ3 A;  2EQJ A;  4QQD A;  3FJP A;  3OS5 A;  3HHT B;  2ZGW A;  2QXF A;  4JUV A;  4J6Y A;  1B34 B;  4M7D F;  2R58 A;  3QBY A;  4N4G A;  2VGN A;  1M9S A;  1KQ1 A;  3O8V A;  4M77 C;  1XTD A;  4A4H A;  1XQH A;  3OYF A;  3RKW A;  1VQ9 A;  1H64 1;  3VYH B;  2DZC A;  2M9U A;  2PVG B;  4PL6 A;  4LD6 A;  3EAE A;  3R6O A;  3G4S T;  5CIU A;  5LJ3 g;  1Q81 C;  1N8R U;  1NPR A;  3JB9 I;  3A8L B;  2DK3 A;  3SD4 A;  3OW2 A;  5FRN A;  5GAN j;  4LOC A;  3V8K A;  2DAQ A;  3CCL A;  3OYE A;  2IG0 A;  3TRE A;  5CAI A;  5I21 A;  1M8V A;  1D3B B;  3EFR A;  5GAM h;  4M75 B;  4NL2 A;  4ELZ C;  4RMO A;  1VQL A;  5DLO A;  3NFC A;  3VUB A;  4JX4 A;  2YLC A;  4RG2 A;  5GMK e;  3OYM A;  3SFM A;  2XDP A;  2JUF A;  3HBL A;  2RJE A;  3VKG A;  4RCB A;  2JTF A;  5L8R E;  5LJ3 f;  4F7U F;  2D9T A;  2RHX A;  3CCV T;  4N0A C;  4C0Z A;  2XD0 A;  4V2S A;  1Q86 C;  2YLB A;  5I2M A;  4II1 A;  1BI1 A;  4JRI A;  1VQP A;  3GLX A;  3PT9 A;  1VUB A;  3DB3 A;  2HNI A;  4QSH A;  3M59 A;  1KC8 C;  2P4T A;  4WF2 A;  4EPC A;  1RL2 A;  2OTL A;  2E65 A;  4D6W A;  4OB1 B;  1I4K 1;  5GMK l;  2A7Y A;  5FU6 C;  3JCM b;  1BIB A;  3INZ A;  5DLQ E;  1U1T A;  3LW5 E;  4N4H A;  4BY6 C;  3G6E T;  3G7Z A;  5CO7 A;  2RI5 A;  4M78 D;  4LDX A;  3BG3 A;  5CR2 A;  3CCQ A;  2EQU A;  3PGG A;  1YCY A;  3C95 A;  3TEE A;  3VU3 C;  3JB9 G;  3BDL A;  1X01 A;  3HB9 A;  5FRO A;  2PVD B;  3CD6 A;  4M7A D;  4ME7 A;  2LNV A;  4KT0 E;  4AI6 A;  2BIV A;  3H8Z A;  3OMC A;  1GXI E;  4OGC A;  1VQ9 T;  1VQK A;  4PJO D;  2DKG A;  2WSF E;  4HA8 A;  4KBM B;  4C8Q B;  2VYT A;  1VQ7 A;  1O9S A;  2DXB A;  2HQX A;  4J7F A;  4DA4 A;  2ZPH B;  1OZ2 A;  4IKF A;  2OTJ A;  4C92 G;  3CCL T;  1WPY A;  3L2Z A;  4M77 D;  4XTU A;  2O4X A;  3OY9 A;  1G3T A;  2DXU A;  4VUB A;  3JCM h;  2HBP A;  3J81 E;  1VQL T;  4JX6 A;  4OB2 B;  4NOY A;  4UC4 A;  3CXC A;  5GMK i;  1Q7Y C;  4XAX B;  1VQP T;  2P0P A;  3CCE T;  1UGQ B;  5GAN e;  3FC3 A;  3JCM g;  5LJ5 g;  1UGP B;  1BKB A;  5GAM d;  4LDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...