4ZGEB

Double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 52
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgeB02
2D0QB 3QZ9B 2DD5A 4ZGDB 2QDYB 1UGSB 2DD4A 2CZ7B 2CYZB 1UGPB 1GXIE 4XK8E 2AHJB 4RKUE 1V29B 5L8RE 2DXBB 3HHTB 4OB1B 2ZPHB 2CZ6B 2ZPEB 2DXCA 1IREB 2O01E 2WSEE 3VYGB 1PSEA 2ZPFB 3X26B 2PVOB 1UGQB 2ZCFB 2CZ0B 4ZGEB 3QXEB 3QZ5B 3X24B 3A8MB 2DD5B 1QP2A 2WSCE 2PVDB 1UGRB 3QYGB 2PVGB 3QYHB 2DXBA 4KT0E 2DD4B 4ZGJB 2PUKB 3A8GB 2ZZDB 1AHJB 3A8LB 1PSFA 4Y28E 2WSFE 4FM4B 3VYGA 3LW5E 4L6V5 4OB2B 3VYHB 3X20B 2DXCB 2PUOB 3X28B 2DPPB 1DJ7B 2ZZDA 1JB0E 2ZPIB 3WVDB 4OB3B 4OB0B 2ZPBB 3X25B 2CZ1B 3WVEB 2PU9B 2ZPGB 1QP3A 3A8HB 3A8OB
chains in the Genus database with same CATH superfamily
2DTHA 3FRNA 4LD6A 1M90U 3EH1A 3KBGA 5CYIB 2CZ7B 3GTMS 2DRMA 2KR3A 4HCBA 2JZ2A 4FYYB 2JM9A 1G3TA 2RQWA 3C94A 4A4EA 4NOYA 1UE9A 3ZFJA 2FPDA 2RQVA 4JRQA 2DEQA 2HL5C 4JZ4A 2DF6A 2Y4YA 2K5FA 3DOGB 4OGCA 5D6XA 5I2MA 1BIBA 1SRMA 4QW2A 8AT1B 2K5LA 2RQTA 3CMET 3G4ST 4F70B 2LQWA 3JCMc 1OV3A 5GAMf 1G8XA 3EG3A 4EC8B 3ZBDA 1EFNA 3EIDB 1VQ6T 1QVPA 4JLIA 1H3HA 2EAYA 1RAEB 3EFOB 3OYFA 1S72T 4CFVB 3A8MB 4BY6C 3QYBA 1RACB 4BBRM 2QA4Q 4ZN3A 2FG0A 4BE1A 3QYHB 1ENWA 1AD5A 4C8QF 4R55A 2K57A 2DRKA 4BDYA 1UFFA 3JCMe 2CP0A 4BCMB 2WSFE 2NUTA 2GBQA 2FVUA 1WPYA 4I3ZB 4IUVA 2DFUA 3FLGA 4HCKA 2P84A 2JXBA 1H26B 2F2CA 1WXBA 4RTYA 1KHIA 1RL2A 2E3HA 2DPPB 1WLPB 3OYIA 2DK3A 2J06A 5GAN6 3TREA 4MFEA 4N4GA 2W10A 2DTOA 4FL6A 4EMHA 5LJ3f 1H4LD 4F17A 4JS4A 4B9XA 4OR5B 5KH6A 4M78C 2KXCA 4G6LB 4FU6A 1WNLA 3H9NA 1K8AC 1B7TA 2CCIB 1S1NA 3WVEB 1JRIA 4OGRB 4QVZA 1ACMB 1VYWB 3GP8A 2NUPB 4JX5A 3HKSA 4J9EA 2DLPA 2KQWA 3RGFB 4QVDA 2DD5A 1HSQA 4AG2C 4LDXA 4Y91A 1AWJA 2J6KA 2E64A 3LH5A 5GAOq 4M75A 2A28A 5L2WB 5IT9E 2EYZA 3DL1A 3RUXA 1D3UB 1WHLA 4RTVA 2DE0X 2WEVB 1IXDA 2HAXA 1D1AA 4DOVA 1VQ4A 4Y92A 1SEMA 2X51A 4OB1B 3TEEA 4F6UB 4L59A 1ZUUA 4EOOB 2LCCA 5KCHA 2IG0A 5CK9A 2M16A 2LW4A 2WJ9A 2B8AA 4K11A 1VUBA 3EGXA 4X9DA 5J39A 2K3YA 4RTXA 1M1KC 3F5XB 1G3WA 4YC3B 1HD3A 2X35A 3R6OA 2EJGA 4KRDB 2QDLA 1K0XA 4HNTA 5GAN7 3M0RA 1ZUYA 1MV0B 2JT4A 3MO8A 1WGSA 2K2VA 4BCKB 3QHSA 2A37A 3RKWA 2D1XA 4PKCC 1WJRA 2CH4A 2CJMB 1OX9A 3L2QA 4FYWB 3LH0A 2QQAA 2GCXA 2CP7A 4M6VA 3TCJA 3VS1A 3QDFA 5A0DA 1T0JA 4CRLB 4C92G 5FWBA 1LNXA 4L6V5 4OB2B 3X20B 2XIDA 3OYBA 4MIMA 4M75F 2MAMA 3HZJA 1QWFA 2C0TA 3VKIA 3VS6A 1R8OB 3CPFA 4A53A 4C0ZA 2LT1A 4TVRA 4FYVB 5I5ZB 1YWOA 2ZPIB 2KYMA 3OW2S 2XK0A 2RJCA 2QGFB 2QA4T 4M78D 4X34A 3RR6A 3HL8A 4BCQD 2YDLA 1ZBJA 2RHYA 1OPLA 2CZ1B 4J9HA 2YRDA 3JCMQ 3OYAA 3L42A 4ROEA 2HBWA 3CCJQ 5GAOr 2BZ8A 3JRZA 1M27C 3EG9A 2HBPA 1Q81U 3CCQQ 3V8LA 3CQTA 5KYXB 3VUBA 1ZHIA 2D9TA 1VQLQ 2AHJB 2IW9B 4PJOE 3MCAB 1FX7A 1SSHA 4BI8B 3VKHA 4GY5A 4MZPA 4XTXA 4PJMA 2OTJA 2GNCA 2DL8A 2WXVB 3REAB 1T3SA 3CCEA 1KFZA 2MOXA 2E4HA 4KGVB 3QSUA 1PC0A 1G3SA 2EBPA 1H28B 2DXTA 2EPDA 4IKFA 2DL7A 1SPKA 4LE9A 4EOKB 2EW3A 2AKLA 2LX9A 1YJNA 1M8VA 2OAUA 2QEXA 2O2OA 3X26B 2VGMA 4XU3A 1WHJA 1D3BB 3PNWC 2UZEB 1QCOA 3OYMA 2KDSA 3M5AA 3OYHA 4AKHA 2FEIA 4C5GA 3CPWP 1UGRB 1LOJA 3HP9A 3BLHB 1JXMA 2PUKB 4CRIA 4JRKA 3NTHA 1M5Q1 3BG9A 3LGFA 3CMAQ 3QG1A 2H3JA 2G77A 2PNIA 5EFQB 3J81E 3VJPA 2DXUA 3GLXA 4EMKA 3MEUA 2QI2A 3UA7A 1E7OA 4EOSB 1UNHD 5GANh 1XTDA 3CC7Q 4RMOA 3V8JA 2DEUA 3M54A 1VQ7Q 1VIFA 3I56A 4EMKC 3LX7A 3RDVA 1G5VA 3G33B 4EOIB 2GQVA 4C0DC 3CCMQ 2RQUA 3CCRQ 3OYLA 3JB9F 4BCIB 2G6FX 1ABQA 3N5BB 1UECA 2HD0A 4FT4A 1XO2A 4D8DA 1JEGA 4PJOB 3KHIA 4BI3A 1VQOQ 3MEWA 5KYYB 3OMCA 3TSZA 1U1SA 2RI5A 1VOLA 5D6WA 1M90R 3DTOA 1BB9A 5C0MA 1J3TA 4VUBA 1W2BP 1VQ5Q 1JBMA 1U06A 1KD1U 4B6MA 2CGHA 5GANj 4RG8A 4E7LA 4GLMA 1H3ZA 3OSSC 3CCSA 4LDWA 3UT1A 2FRWA 5GAOn 1I0CA 2VC8A 3UA6A 1P92A 3L1AA 1NG2A 3M0PA 3OW2A 2ZPHB 2LTOA 2DL4A 4HCZA 5GANd 4C92A 2K7AA 1SSFA 1O9KB 3URGA 2XD0A 5GAMg 3J7AF 1NEBA 1FWZA 1UGQB 3CCJT 1VQMT 1X75C 4BE0A 4HA8A 3CC2A 4C92C 2LQNA 5HK3A 2BE7D 1W98B 5GMKl 2KRMA 2R7GA 3PFSA 2ROLA 3OS2A 2J7IA 2O31A 3G1JA 4A4KA 4C8QG 4M7DC 3I55A 1VQLT 1FMVA 4CXAB 1QVGS 2RI2A 2JTEA 1JJ2S 4NSTB 2LDMA 3M0UA 2JNGA 3GNFB 1WHMA 1YJ9A 2YRCA 5CKEA 5EG2A 3LGLA 3UWNA 1CSKA 4R56A 1D3BA 5FROA 4ROCA 2P4TA 1VQNQ 2GTOA 3H0FA 5IH2A 2QTXA 2VYTA 5KYNA 3CCUQ 4QQDA 1AWOA 1UB4A 1GCPA 2VXEA 2RHIA 1AISB 1YHQQ 1Q86C 1VQMA 3EGUA 4E7KA 3L2UA 1JB0E 4J9IA 5LJ3g 3FJPA 4ANJA 3A98A 2V8JA 3EOCB 3JB9I 2ZPBB 5FLXE 2LMJA 2GFUA 4Z89A 2PU9B 5GAMe 1U3OA 3JCMg 5FRMA 2MWOA 3OYYA 2WPAB 3CMAT 4N0AA 1VA7A 4XU2A 4ZGDB 1UEBA 5I11A 3CBPA 1MMDA 2EWNA 5CVIA 2BTTA 2NUZA 1F1BB 2E41A 3QDRB 2E10A 3CC7T 1ZSZA 1GY3B 3CCVA 3I9QA 1MUZA 2BZXA 3CD6Q 1E9HB 5EJCA 1GH6B 3CCMT 4XQ3A 5KE3A 2FO0A 2KXDA 3CCRT 1ZSZC 1N8RU 3CC4A 3B57A 3TSWA 3HRUA 1M1FA 2VASA 3S3MA 2WSEE 5KYYA 3CXCS 4J9DA 2YHTA 4PL6A 3OYDA 1N27A 1K9MU 1K1ZA 2EYXA 4DEYA 4CFUB 1RLQC 2YT6A 4ELYC 1OKVB 2WHBB 4NL2A 2QGSA 2XDPA 4M7DD 1B34A 4CC7A 5CCAA 2O88A 1VQ5T 2ZGWA 3MEVA 2UZDB 2YSQA 3TW7A 6AT1B 3A8LB 1ARKA 2YUPA 3GBQA 1K73U 1X2QA 3M59A 1VQ8A 1A0NB 4IMYB 1OIUB 1PD1A 5FU7C 4IUUA 1U8RA 5GAN8 3GIBA 4PFOA 4HXJA 4M77E 1UNLD 1ZBXA 3HBLA 4KGZB 5KYUB 4QQGA 1YIJA 2C5VB 4C5IA 4C0GA 3CCLA 2E5QA 1YJWQ 2VB6A 2KMTA 2E1HA 1QMZB 2K79A 2DAQA 2QQSA 4J5YA 4PJOF 1KC8U 1NLOC 1QVGA 3NPFA 2RJFA 1OQKA 1H8KA 3DLLA 1QVFP 1JJ2A 3EG2A 2DL5A 4MMLA 4BE2A 1W6XA 3DDPB 5GANe 4QKUA 1NJIU 1MV3A 2OX7A 1YCYA 3R6NA 4PLIA 5ACBA 3RKXA 2WMBB 2I2LA 2ATCB 2JTMA 1BBZA 2L89A 2BPMB 5KYWB 1UGPB 1Z9QA 2EJFA 3VS7A 3CCUT 1BI0A 1Q86R 4RKUE 1N6AA 2LX7A 4C8QA 1Q95G 1YHQT 1VOMA 5HBJB 2YUNA 4LUDA 4BCND 4M77G 1Y71A 5FRNA 1M3BA 2V22B 3QYEA 4HL4A 1NPPA 2CZ6B 2RH2A 2JOYA 4C8QC 2JMCA 1OOTA 4Z8AA 1M4ZA 3MY5B 2DZCA 1E6GA 2RK1A 3VYGB 1N9SA 3GNGA 2WMAB 3SDZA 2W2HA 2DERA 2HDAA 2W96A 4DBHA 2M51A 5GMKi 1XQHA 2PK9B 2CP2A 2RPNA 1VQ9A 1M3CA 3HRSA 2BS2A 1G83A 2H8HA 5DY9A 3BDUA 4J9CA 2DD4B 3GF5A 3SD4A 2DL3A 5CKDA 4E2FB 1AHJB 1RAHB 4EMGA 3PMTA 1KXUA 1YFNA 3CD6T 2W9FA 4M77B 4BY7X 2G9XB 3SFMA 4D6WA 4F7UE 2XMFA 1M9SA 4CFWB 4AG1C 4JRIA 3CXCA 2DXCB 4XTUA 2LCSA 1XOVA 2Y90A 4BACA 2RD1A 2OI3A 2DZ9A 1WZOA 2CUBA 1TXQA 1Q7YU 5IHNA 4C5HA 2DYBA 3P8BB 3INZA 3JB9G 3VKGA 3TNIB 2MK5A 4GLKA 2B86A 4Q5WA 4AKIA 5J26A 2E65A 2BKDN 2RB6A 4IUQA 5HBEB 2YRVA 1M1GA 3X25B 4OMQA 3M53A 1MMGA 1TH7A 4F14A 3C95A 3CMEA 3SWNB 1QP3A 3G4SA 1H1RB 2I40B 1G3NC 3MPUB 1FYNA 2R5MA 4LNPA 2DMOA 2I0NA 4AFSC 1YITT 1Y96A 5KYUA 2X4WA 1VQ6A 1I5OB 1PRLC 2KAFA 3M4GA 1VQPT 1S72A 1WYXA 5GJVB 1SHFA 2D8HA 4HT9A 4HNUA 3H4CA 4M7AE 4MFDA 5IHKA 1X69A 3JCMf 4E47A 2FRYA 3HO8A 4HKEA 1GFCA 1VINA 1YJWT 5EC7A 5I2SA 1LJOA 1YBYA 4C8QD 1FXXA 3OBYA 4OMOA 1MNDA 1Y57A 1WJSA 2A7YA 5BNJB 3I5RA 2DIQA 3HTRA 2P0QA 5CEIB 1RUWA 2R5AA 2RI3A 1W70A 2BIVA 4M75C 1TS9A 4N4IA 4DBFA 1KQ2A 2ECZA 3I56Q 4TTHA 2PVDB 3EG0A 4ZTJA 1VQPA 1NYFA 2LC4A 2MIOA 4MMKA 4F7UB 2EYQA 1MHNA 1AT1B 5GMKh 1PSFA 1QQJA 2AKKA 1SRLA 3M9QA 4Y28E 1WFWA 5KE2A 2FYKA 3VYGA 2DILA 1OULA 2DVJA 3TU4K 3MY1B 5IAYA 2C0OA 5GAN4 1X01A 1OU9A 3MKDA 5GAN5 4HNVA 1U5SA 2L2PA 3D7SB 2F5KA 2PUOB 3X28B 3RBBB 2KVQG 2QASA 3QO3A 2P0PA 4QSHA 1BU1A 2WIPB 1JQQA 1BU2A 1DJ7B 2NLUA 1M2VB 2QAZA 5FWCA 3CCSQ 4M77A 3JV3A 1FVVB 4KBMB 3EGDB 3OS0A 1JKWA 2YWWA 1YNZA 3OS5A 3QKJA 3EFOA 4AT1B 2KRNA 1M90C 3DB4A 3E9FA 5IDPB 5LJ5h 3QZ9B 4M7AB 4JS5A 4DEXA 4MZMA 2QDYB 2HSEB 4JRPA 2CP3A 3OYKA 2EQKA 2ENMA 2JMAA 1OL1B 5CKFA 3L2VA 2QQRA 2CYZB 2CKKA 4FW2A 2YLBA 4XK8E 4A4FA 1RABB 1OGUB 1SHGA 2J05A 1FMWA 5IN1A 2L3RA 1WXUA 1JU5C 2EQIA 4LXCA 2ESWA 1X43A 2A08A 5CO7A 1PNJA 1T3LA 1G2BA 3A5ZB 5GAOm 1E7PA 1Z9ZA 3TVTA 1VYUA 2O01E 1Q82U 2PZ1A 3VS3A 4ATOA 1CKAA 4NC6A 3OY9A 2X9HA 2EFIA 3JB9J 4WF2A 4PJJA 4BDZA 1VYVA 4ORZA 4QT7A 2CZ0B 3FDRA 5DLQE 5LJ5j 4M75D 1K9MR 2EQUA 2OTLQ 1Q7YC 4M77F 1K9AA 2HQHA 2B9RA 1P5EB 2NUPA 2JW4A 5LJ5d 1GL5A 2ZZDB 4JLGA 2QA4A 3META 1M2OA 4CC4B 4BB7A 1BCOA 5DLOA 2UUEB 5DQVA 1X6OA 4Z02A 4A63B 3CBMA 1WQWA 3M0SA 1K73R 5A2QE 2FZKB 2DX1A 4BUGA 4HCCA 4FIBA 4F16A 2QDJA 2BUDA 4YTLA 1IGQA 3VV0A 4E6RA 1D0YA 1I8FA 4JUVA 1PRMC 4YOSA 2QTVA 1TFBA 3F70A 2M9UA 4PJOG 4HVVA 3BLRB 1TWBA 2IIMA 1T0HA 2ED1A 1H27B 3ER0A 3LWHA 1NLPC 1VQKQ 1KC8R 1N5ZA 3V8KA 2L3PA 1OZ3A 4QQ6A 1R77A 2DIGA 1H1QB 2DVEA 1NJIR 4Y72B 3OYJA 5IHYA 1GXIE 3NMZC 1M2VA 3G71Q 2X4YA 5IXBA 3VRZA 1YI2Q 2CUDA 2YLCA 1XJWB 9ATCB 3EGDA 1M8MA 1OPKA 1YN8A 1SF9A 1LCKA 2HZYA 2RF0A 1UGVA 4BCMD 5ECAA 1AZGB 3JCMW 5DQWA 1K0SA 5FGKB 3FIFA 1C6VX 5GJWB 4BCNB 2EIFA 2E6NA 4M7AA 2EKOA 3LWIA 3QJ6A 1PSEA 2M0OA 2ED0A 5GANg 2IW8B 3FC3A 4KH1B 1H92A 1ABOA 3OMGA 3O0GD 4ZGEB 2KGTA 4KRTA 4F7UF 1WHGA 2RHUA 3QHRB 1QP2A 4ELZC 4EIKA 4LDUA 3P8HA 1QCFA 3A8GB 3S3OA 2M1HA 1IHVA 2HQXA 5GAN3 5AT1B 2MPXC 5KYXA 3TW6A 3FB9A 3POMA 3JB9D 2O4XB 2L8DA 1N4MA 2KSSA 4LD9K 3BE3A 3CCQT 3LQ5B 4XTZA 1GFDA 2LJ0A 4F6SB 3OS1A 2K9GA 3TNHB 1KK7A 4GBQA 2XDBA 3C4SA 1B07A 5J3BA 4E7HA 1WJQA 2Y4XA 4IURA 4FW1A 5GMKe 2QQ8A 3PTAA 5LL6S 2ZZDA 1Q7YR 4EDUA 4OB3B 4FT2A 3CBOA 3G6EQ 3TN8B 3HRTA 3BHTB 2HMAA 2LQKA 3LYIA 2VXFA 2QXFA 4M7AF 2ZPGB 2DJQA 1ZQ1A 1U1TA 3JCMb 4BY1X 2D0QB 3NFCA 5FU6B 1Q81C 2BS4A 4OMNA 1OZ2A 5HK0A 4F6WB 3UDCA 2PHGA 3O5ZA 3CCJA 3PVLA 2GTJA 2C5XB 4F7LB 1ZUKA 3H0IA 2C6TB 2C06A 1VQ9Q 2EUFA 4E7ZA 2XKOC 3OBWA 1KSWA 4BI4A 4P5NA 1VQLA 3OW2P 2RQRA 1I1JA 4OF1A 2DXBB 1IHWA 2GQIA 2KRSA 1OI1A 5LJ5e 4HT8A 1UG1A 5HBHB 3J80E 5FW9A 1E6HA 3S3NA 1H24B 4YOOA 2ZPFB 1VQKT 1TUCA 3NDQA 4M78E 4N0AC 2RHXA 2JUFA 4OMLA 1VQ7T 2C4GB 1OI9B 3RNJA 3HFNA 4II1A 1WA7A 1W1FA 2NYSA 5LJ3d 3G71T 4AKGA 1IO6A 4PJOA 5C6SA 1YI2T 1VYTA 2RA2A 1OYXA 5AYFA 2COYA 4XU0A 4F7SB 1ZSGA 5LJ5f 1W4SA 4LUEA 2ZAEA 3JCMX 4PJOC 1MNEA 1H25B 2CSIA 2L0AA 3HB9A 4C92D 1Y7XA 2E12A 1VQOT 1KQSS 3I35A 3CMAA 1QCNA 2JGZB 2BE9B 3QPHA 5GAOp 1VQ6Q 2G3RA 3QBYA 1S72Q 4BY6B 1MMAA 2CP6A 4JJNK 5CKHA 3CC7A 2ROTA 3KFVA 4PNOA 2KBTA 4M78G 4JJBA 2CS7A 2V26A 1I5LA 1O9KA 1FINB 3CCMA 4L5GA 2O4XA 2V8KA 2IW6B 3E2UA 1UDLA 3CCRA 4OMMA 1K8AU 1OX8A 1M3AA 2Z0WA 3QWXX 4HLQA 1HK9A 1D0XA 1KQ1A 2HL3A 3AHUA 2RJDA 2RO0A 2FZGB 1PCXA 2M0YA 1AWXA 3H41A 4BCJB 1C9BA 3DB3A 3MIAB 3OB9A 2RN8A 1KD1C 5CQYA 1VQ4Q 4CC3A 2LT4A 1V29B 4EOMB 1VQ5A 3MJXA 5I22A 2UZBB 1UTIA 4MDWA 1RI9A 4M4ZA 4BD3A 1NEGA 2X3WD 2CT3A 4M78B 4BCQB 3EFRA 2ZPEB 3UATA 2PK2A 2XG8D 4EOQB 1WHKA 4RUGA 1WHHA 4UC4A 4PK4A 3U23A 1M1KU 1VQNT 1OL2B 1Q81R 3EAEA 2DA9A 2EYYA 1Q82R 1AD6A 3OA6A 2XI9A 2X4XA 4D8KA 3L2ZA 4LOCA 4N4HA 4HVUA 1NPRA 2DD5B 2DETA 4PLLA 3QYGB 2DXBA 1UUEA 4ELLA 1H641 2BS3A 1X6GA 2KI7A 2QG9B 1GBRA 2EVRA 1CKBA 4JDSA 3OQ5A 4J7FA 4XAXB 2QF7A 1FMKA 2EQJA 2L3SA 3ASKA 5GANf 1IRXA 1D0ZA 4PJOD 3CEYA 1N9RA 3OYEA 3VS0A 4J6XA 2CP5A 1IZ6A 4E7IA 1BI1A 3P8DA 3SEMA 3M56A 2GGRA 2EGEA 1D1BA 2JN0A 2XU8A 3EGXB 1VQNA 4JX6A 1OIYB 4EPCA 2KYBA 3CCUA 4CFXB 2VKNA 2R57A 1PKDB 2KE9A 3WVDB 1V76A 1YHQA 1QVGP 3OYNA 4BCOB 1JJ2P 2HKQB 2BKZB 2C5OB 2FL7A 7AT1B 1LVKA 2M02A 4EOPB 2JM8A 5HVYB 4PFPA 3FEOA 1QWEA 3JB9H 2W9ZA 2CCHB 1K4US 1KQSA 2RNAA 2OTJQ 4OVAA 2PTKA 2W0ZA 3A1PA 3Q1JA 4DQ2A 3CCEQ 3CPWS 1B3QA 2OJ2A 2F2WA 2QYZA 1O75A 5LJ3e 4RTZA 2IN3A 3RERA 5DM7R 2CDTA 4RODA 2P4RA 3HHTB 2QK0A 2FZCB 1YJNQ 1N8RC 2QEXQ 4XTWA 4BCFB 3CD6A 1X2KA 1WI7A 4O5VA 3I5SA 5D6YA 1IREB 1TOVA 2FPFA 3RMQA 3QJYA 1URCB 2EJ9A 1K9MC 1ZP2A 1I81A 4F7UG 3RIRA 3UF4A 1KD1R 3MEAA 3GPLA 3EG9B 2CH4W 4CFMB 3PO3S 3ZEHA 4M78A 1VQ4T 4WTOB 2IPOB 3MHXA 1K73C 4BCPB 3OYCA 2L5QA 3THKA 1X27A 3NGPA 5KYWA 4V2SA 3CXCP 2HSPA 5GAOl 2RJEA 1KG1A 1GBQA 2AT1B 2F2XA 2J6OA 2I53A 3M55A 2JTFA 3REBB 1YITA 1AEYA 1NM7A 1KQSP 2X4JA 3MP1A 1W2BS 2PJQA 1PM3A 2EGAA 5L23A 5CQXA 2VVKA 3VS4A 4LDVA 5IHIA 4J8OA 1AWWA 1JO8A 4OB0B 2V8IA 4M7AG 1KC8C 3BG5A 4PJNA 4C92E 1YJWA 3E19A 2DKGA 3NTKA 3E9GA 2KROA 4M7DE 2E6ZA 3A8OB 3QWYA 1NJIC 3EH2A 4IUPA 4CFUD 4PJLA 2LP5A 1NZ9A 1UGSB 2DD4A 4DBQA 1QMCA 2X1NB 2V1RA 2LNHB 4ZN1A 1WX6A 4NS5A 2PMIB 4EOJB 1X6BA 4EMKB 4M78F 4C0DB 2E70A 3G7ZA 1TUGB 5ICPB 1OEBA 4IUTA 2HEQA 3KUFA 2VWFA 1LPLA 5GMKj 4M77C 2DXCA 4X1VA 4X9CA 4JJDA 3K7AM 2AK5A 3E1SA 1ZA2B 2LJ3A 4OP0A 2C0IA 3VUZA 1UHCA 3CC2Q 3QUIA 5I21A 4FSXA 2AIRB 4E7SA 5CKBA 3TQ7P 2COZA 3I55Q 4M7DG 4KUIA 2WFYB 2DNUA 4KGXB 2RMOA 1JSUB 3FJ5A 2OTJT 2D8JA 3M0TA 1XNIA 2PVGB 1ZLMA 2YUQA 1IGUA 4ZGJB 3SWNA 4KULA 1QLBA 3CCET 1ZX6A 1YJ9Q 1UJYA 3CPWA 1JOWA 4Z6YA 3M58A 2XHCA 1GUXB 4A54A 1N8RR 2C5NB 4KRCB 3H6ZA 5LJ5g 3JCMV 1QLYA 3OYGA 1YJNT 3PVQA 3LW5E 3SWNC 2QEXT 3VYHB 4JJCA 1TTHB 4QVCA 4OMFB 4BBSM 2VGNA 1EX4A 4MDXA 1VQMQ 2K2MA 4C92B 1QKWA 3DKMA 1Q86U 1RAIB 4M7DB 4J7IA 2R58A 3BFMA 2JS2A 2MWPA 1FKMA 1HJDA 2LJ1A 4RTUA 2F5TX 4EONB 1TSFA 5LQFB 3NHNA 4R0KA 2P0KA 1NYGA 2DTIA 3A8HB 4C5EA 1K8AR 2O9SA 3UPUA 5CR2A 2K3BA 4EC9B 2HCKA 3CCVQ 1JXOA 2KR6A 4J6YA 4F7UA 4CI0C 4E7JA 3I56T 5D7UA 2E5KA 1W2BA 2K4YA 4RCCA 2LRQA 2MCNA 1WXTA 2AZVA 3CC4Q 2MYSA 2RM4A 2QFZA 2XDDA 1O9SA 1KJWA 5HQ0B 4M77D 3BHVB 2O9VA 2WIHB 2HNIA 3RKYA 1OU8A 5HCKA 3C0CA 2DBMA 4C0FA 2MF2A 2HKNA 2YXYA 2PVOB 2WACA 1RI0A 3VRYA 1M1KR 3HFOA 1KHCA 3V7RA 1RAAB 2KEAA 3QXEB 3RESA 1C0MA 4IIOA 1IB8A 5GAN2 3PIOA 2GFAA 4CFNB 3EFSA 2KK4A 2DBKA 1TD6A 3CCST 4KT0E 4J83A 1BYMA 3WXMB 1AZEA 1SG5A 5M9OA 1VQ8Q 2A0FB 4FSSA 1ZSZB 3NTIA 4F7JB 3JAME 3PMIA 1QVFS 2RK2A 3IQLA 2L3QA 3DLMA 1G3YA 2A3LA 3JSCA 4NL3A 4EORB 2VV5A 4HVWA 4M7AC 3HPWA 1MMNA 1YIJQ 3CC2T 5GAMh 1SKUB 3BG3A 2K5IA 2E3IA 3CCLQ 3EHQA 5HY6A 4C8QE 2A36A 1RADB 5LMKB 3PIPA 3I55T 4B9WA 2KMGA 1F5QB 2EYWA 4RTWA 1PKSA 1GUXA 4II5B 2EQMA 3BY7A 3H0HA 2CT4A 3M57A 1B34B 5CIUA 1R0CB 2QGGA 1YJ9T 4BXXX 2H3EB 1PG5B 1EIFA 3OSVA 2ABLA 2KNBB 1HYOA 3M4YA 4ME7A 5FU7B 4XTVA 1H1PB 3KXTA 2F2VA 3H8ZA 1BI3A 4M7DA 1V1CA 2NWMA 4AI6A 1OKWB 3JCMJ 1NBEB 3DDQB 2OTLT 1GRIA 5GAMj 5IDNB 4UN0A 2F69A 5L8RE 1I4K1 4XTYA 1WQ7A 1GCQA 3QIIA 5LJ3h 2KY9A 2BZYA 3BHUB 4RG2A 2GF7A 3HSBA 1MGQA 5GAMd 1YCSB 1Q82C 3EJ1B 2DM1A 1PWTA 1GCQC 3JCMh 4A4GA 1PD0A 1QKXA 2RHZA 3CCQA 1AVZC 4Z88A 1YP5A 4ESRA 4AFQC 2ZCFB 4J9FA 3V7SA 3X24B 3O8VA 3GOXA 2DYIA 4ZTFA 2YUOA 1BIAA 3CCVT 1JSTB 2WSCE 2LVMA 3BLQB 1PHTA 5KCOA 1VIEA 2DJZA 1TG0A 4KUDK 3BW1A 1I07A 2HQEA 2OTLA 1R0BG 1D1CA 2K3XA 1ZA1B 3CC4T 3PT9A 2FHDA 1WIEA 3EHRA 4F7NB 4C8QB 3QWLA 2FPEA 2SRCA 5LJ3j 3PE0A 3MI9B 4M7AD 2IVWA 4XU1A 4C92F 5CAIA 2LNVA 4JZ3A 4CC2A 2XICA 4LN2A 1M30A 4M7DF 5HKCA 1Y07A 2DO3A 4J9BA 4F04B 3SHWA 2SEMA 2X3XD 4OMPA 5IF1B 2QQ9A 2V1QA 3VS5A 1BKBA 2CREA 3C12A 4ELJA 3JCMd 2VUBA 4FYXB 3CMEQ 3G4SQ 5HNBB 4M75E 4EOLB 3VS2A 1VQ8T 4DOWA 3BDLA 3JCMP 1AOJA 5A0GA 3DJBA 3T9NA 2QQBA 2JS0A 1K76A 2MMPA 2COWA 1VQKA 1QVFA 2EGCA 1UJ0A 5GMKm 1TU0B 3PGGA 3SB2A 2KT8A 2KT1A 1YIJT 4IIMA 4FCYA 1VQ7A 2F1LA 1PKTA 3CCLT 4LDYA 1Y0MA 1RAFB 4WCIA 3EG1A 4A4HA 1TUDA 4RTTA 3G71A 5IXFA 1YI2A 3QHWB 4OGEA 1C1AA 3MP8A 2D0NA 3M0QA 4PFZA 8ATCB 1H1SB 1D09B 2W99A 2JVVA 2AZSA 2NUTB 4ZNXA 2K6DA 1RAGB 1VQOA 3S6WA 3M03A 3AT1B 4JX4A 4J9GA 3ZL7C 4M75G 1YITQ 4DBRA 2OAWA 1QW1A 4BCGB 3QZ5B 2J6FA 1VQPQ 3L2WA 4AMCA 4MZTA 2PQWA 3LLRA 1Y96B 2EKHA 2MI6A 3ME9A 3G6ET 1WDXA 4AFUC 1UHFA 1KIKA 1NE8A 2UZLB 2LQ8A 2CSQA 2IVXA 4AFZC 3L2RA 4FM4B 3MP6A 2FB7A 4JPBW 3RMSA 4O6JA 4DA4A 5FU6C 1BK2A 3VU3C 4YOZA 1UNGD 2DMEA 4FX3B 1BI2A 1RLPC 1VQ9T 4M75B 2D6FA 4RCBA 3ULRB 2JJ9A 1BCMA 1EZZB 3V7CA 2LCLA 5A0LA 4J6WA 3TNWB 2LZ6B 4KH0B 1YWPA 3G6EA 1HXDA 4BCHB
chains in the Genus database with same CATH topology
3V8KA 2DTHA 3FRNA 1OZ3A 4LD6A 4N0AA 4QQ6A 1M90U 3CMAT 4XU2A 4ZGDB 1UEBA 2DIGA 4IUPA 3KBGA 3CBPA 2DVEA 1NZ9A 1UGSB 2DD4A 4PJOC 2CZ7B 2EWNA 5CVIA 4HCBA 3OYJA 2E41A 2JZ2A 3QDRB 4ZN1A 1GXIE 2E10A 2X4YA 1G3TA 4NS5A 1VQOT 3C94A 4A4EA 3CC7T 4EMKB 4NOYA 4M78F 3CCVA 4C0DB 2E70A 3G7ZA 2YLCA 3ZFJA 4JRQA 2DEQA 5KE2A 5EJCA 2Y4YA 2K5FA 1I5LA 4IUTA 4OGCA 3KUFA 4NL3A 3CCMT 4XQ3A 5D6XA 5I2MA 5KE3A 1BIBA 4QW2A 5GMKj 3CCRT 4M77C 3JCMW 2DXCA 1N8RU 2K5LA 3FIFA 3CC4A 3HRUA 4X9CA 1M1FA 3CMET 3G4ST 2EIFA 2E6NA 4M7AA 3S3MA 2EKOA 2WSEE 3E1SA 3CXCS 3LWIA 3QJ6A 3JCMc 1PSEA 4OP0A 3VUZA 2M0OA 2YHTA 5GAMf 4PL6A 3OYDA 1N27A 3ZBDA 5GANg 1K9MU 3QUIA 5I21A 3FC3A 1VQ6T 1QVPA 4FSXA 4JLIA 3OMGA 5CKBA 2EAYA 4ELYC 3OYFA 3CC4T 4ZGEB 1S72T 4KUIA 4M7DG 3A8MB 4NL2A 4BY6C 3QYBA 2XDPA 4F7UF 2RHUA 1B34A 4M7DD 1QP2A 2OTJT 4BBRM 5CCAA 4ELZC 1VQ5T 1XNIA 2PVGB 4LDUA 4ZN3A 4BE1A 3QYHB 3P8HA 4ZGJB 2ZGWA 3MEVA 4KULA 3SWNA 1QLBA 4C8QF 3CCET 4R55A 3A8GB 2K57A 3S3OA 3CPWA 2M1HA 3TW7A 2HQXA 4Z6YA 5GAN3 3A8LB 3M58A 4BDYA 3JCMe 2XHCA 4A54A 3TW6A 3FB9A 1K73U 2WSFE 3JB9D 3H6ZA 3M59A 5LJ5g 3JCMV 2O4XB 3OYGA 1YJNT 2L8DA 2FVUA 1VQ8A 1WPYA 3LW5E 3SWNC 2QEXT 4IUVA 2KSSA 3FLGA 4LD9K 3VYHB 3CCQT 5FU7C 4QVCA 4OMFB 4IUUA 4BBSM 4XTZA 1U8RA 2VGNA 5GAN8 1KHIA 3GIBA 1RL2A 3OS1A 4MDXA 2DPPB 4M77E 4C92B 3OYIA 1ZBXA 2DK3A 5GAN6 2XDBA 3HBLA 3C4SA 3TREA 4MFEA 3DKMA 5J3BA 4N4GA 4E7HA 4QQGA 1WJQA 1YIJA 2Y4XA 2DTOA 4IURA 4C5IA 4FL6A 1Q86U 4EMHA 4C0GA 4M7DB 3CCLA 5GMKe 2QQ8A 5LJ3f 5LL6S 4J7IA 3PTAA 2E5QA 2R58A 2ZZDA 3BFMA 4EDUA 4JS4A 4OB3B 4FT2A 3CBOA 2KMTA 2MWPA 4B9XA 5KH6A 2E1HA 2QQSA 1FKMA 2DAQA 3HRTA 4J5YA 2LQKA 4M78C 2F5TX 3LYIA 2VXFA 4PJOF 1KC8U 4FU6A 2QXFA 1WNLA 1QVGA 4M7AF 1K8AC 2RJFA 3WVEB 1JRIA 4QVZA 2ZPGB 2P0KA 3DLLA 1ZQ1A 1JJ2A 2DTIA 1U1TA 4MMLA 3A8HB 3JCMb 5GANe 3GP8A 4JX5A 3HKSA 4BE2A 2D0QB 2KQWA 3NFCA 5FU6B 4C5EA 1Q81C 1YCYA 4QVDA 1NJIU 2BS4A 2DD5A 3UPUA 1OZ2A 5HK0A 4PLIA 3UDCA 4LDXA 3RKXA 4Y91A 2I2LA 5CR2A 2E64A 5GAOq 3CCJA 2JTMA 4M75A 2L89A 2KR6A 4J6YA 4F7UA 5IT9E 1UGPB 4CI0C 4E7JA 2EJFA 2C06A 3DL1A 1BI0A 3RUXA 3CCUT 3I56T 4RKUE 2XKOC 1N6AA 3OBWA 1W2BA 2K4YA 4C8QA 4BI4A 4RCCA 4Y28E 2HAXA 2LRQA 4P5NA 1YHQT 1VQLA 4DOVA 4OF1A 1VQ4A 4M77G 2RM4A 2QFZA 2XDDA 2DXBB 1O9SA 1Y71A 4OB1B 5FRNA 3TEEA 4HL4A 3QYEA 4L59A 1OI1A 4M77D 5LJ5e 1NPPA 4HT8A 2HNIA 2CZ6B 2LCCA 2RH2A 3RKYA 4JDSA 5KCHA 2IG0A 2JOYA 4C8QC 5CK9A 2M16A 2WJ9A 3J80E 2B8AA 4X9DA 1M4ZA 1VUBA 5J39A 4C0FA 2DZCA 2K3YA 3S3NA 1M1KC 2RK1A 3VYGB 1G3WA 1N9SA 2X35A 2MF2A 2ZPFB 1VQKT 3GNGA 3R6OA 2EJGA 2PVOB 3SDZA 2OTJA 2WACA 1RI0A 4M78E 4N0AC 3HFOA 2RHXA 4HNTA 1KHCA 5GAN7 3V7RA 2JUFA 3QXEB 3MO8A 3RESA 1WGSA 2K2VA 5GMKi 1XQHA 1VQ7T 1VQ9A 3QHSA 5GAN2 2GFAA 3PIOA 3RKWA 3HRSA 2BS2A 3EFSA 4PKCC 2KK4A 1WJRA 5DY9A 3HFNA 4II1A 3BDUA 5LJ3d 3L2QA 3G71T 3CCST 4KT0E 2DD4B 3GF5A 4AKGA 4J83A 3WXMB 4PJOA 3LH0A 3SD4A 2QQAA 5C6SA 1YI2T 2GCXA 1BYMA 2RA2A 5CKDA 1OYXA 5AYFA 5M9OA 1AHJB 4M6VA 4EMGA 4XU0A 3PMTA 3TCJA 3CD6T 4M77B 3NTIA 5LJ5f 3JAME 5A0DA 3PMIA 1W4SA 4C92G 1QVFS 2RK2A 3JCMX 1LNXA 1G3YA 2A3LA 3DLMA 3JSCA 4L6V5 4OB2B 3HB9A 3SFMA 1Y7XA 2E12A 3X20B 2VV5A 2XIDA 4MIMA 4C92D 3OYBA 4D6WA 3HPWA 3CMAA 4M7AC 4F7UE 1M9SA 3QPHA 2MAMA 4M75F 3HZJA 5GAOp 4JRIA 3CXCA 2DXCB 4XTUA 3VKIA 3CC2T 1XOVA 2Y90A 5GAMh 4BACA 3BG3A 1R8OB 2K5IA 2RD1A 3CPFA 4A53A 2G3RA 5HY6A 4C8QE 2DZ9A 3QBYA 4C0ZA 4BY6B 1Q7YU 3PIPA 2LT1A 4TVRA 4C5HA 5CKHA 3I55T 4B9WA 4JJNK 3CC7A 3P8BB 3INZA 4PNOA 3JB9G 3VKGA 2ZPIB 4M78G 3OW2S 4GLKA 2KMGA 2XK0A 4Q5WA 4AKIA 2CS7A 2RJCA 5J26A 2QA4T 2E65A 2BKDN 2EQMA 2RB6A 3BY7A 3HL8A 2YRVA 4IUQA 4M78D 4X34A 3CCMA 1M1GA 3X25B 4L5GA 2RHYA 1B34B 2O4XA 2V8KA 3M57A 5CIUA 2CZ1B 3CCRA 1YJ9T 1K8AU 3JCMQ 1EIFA 1TH7A 3M53A 4HLQA 3OSVA 3C95A 3L42A 3OYAA 3SWNB 1QP3A 1HK9A 1KQ1A 3G4SA 3CMEA 3M4YA 5GAOr 3JRZA 3AHUA 4ME7A 5FU7B 4XTVA 2HBPA 1Q81U 2RJDA 2R5MA 2RO0A 3V8LA 3KXTA 3VUBA 3H8ZA 1YITT 1Y96A 1BI3A 2X4WA 1VQ6A 1ZHIA 3M4GA 2KAFA 2D9TA 3DB3A 3OB9A 1VQPT 1S72A 4M7DA 1KD1C 2AHJB 4AI6A 5CQYA 3JCMJ 4PJOE 3MCAB 1FX7A 4BI8B 3VKHA 2OTLT 4GY5A 5GAMj 4MZPA 2LT4A 1V29B 3H4CA 4HNUA 4XTXA 4HT9A 4M7AE 4MFDA 2F69A 1VQ5A 5L8RE 1I4K1 4XTYA 1WQ7A 3JCMf 4MDWA 4E47A 3QIIA 3CCEA 4BD3A 5LJ3h 3HO8A 4HKEA 2KY9A 4M78B 1YJWT 3QSUA 3EFRA 5I2SA 1G3SA 2ZPEB 1LJOA 1YBYA 1FXXA 2GF7A 4RG2A 2DXTA 3OBYA 4C8QD 2XG8D 1MGQA 5GAMd 4IKFA 3HSBA 1Q82C 1WJSA 2A7YA 2LX9A 1YJNA 1M8VA 4UC4A 2OAUA 3JCMh 4A4GA 2QEXA 1M1KU 2RHZA 1VQNT 2DIQA 3EAEA 3CCQA 3X26B 2P0QA 2VGMA 4XU3A 3OA6A 1D3BB 2XI9A 3PNWC 2X4XA 2ZCFB 3L2ZA 4LOCA 2R5AA 2RI3A 3V7SA 4N4HA 2BIVA 3OYMA 3X24B 2KDSA 3M5AA 1NPRA 3O8VA 4M75C 3GOXA 3OYHA 4N4IA 4ZTFA 1KQ2A 4AKHA 2DD5B 1BIAA 4C5GA 3CCVT 2WSCE 4PLLA 2PVDB 1UGRB 3QYGB 2LVMA 4ZTJA 2DXBA 1LOJA 3HP9A 1VQPA 1H641 2BS3A 5KCOA 1VIEA 2DJZA 2LC4A 2PUKB 4MMKA 4CRIA 4F7UB 4KUDK 3BW1A 4JRKA 2EYQA 1MHNA 3NTHA 2HQEA 2OTLA 5GMKh 1PSFA 2K3XA 3OQ5A 3M9QA 4J7FA 1M5Q1 2FHDA 2QF7A 2FYKA 3BG9A 2EQJA 3ASKA 3LGFA 3PT9A 4XAXB 4C8QB 3VYGA 3QG1A 3QWLA 5GANf 2H3JA 4PJOD 3TU4K 2G77A 3CEYA 1N9RA 5IAYA 5LJ3j 3OYEA 4J6XA 1KQSS 3J81E 1IZ6A 4M7AD 5GAN4 2IVWA 4XU1A 3VJPA 4C92F 4E7IA 5CAIA 1BI1A 1X01A 3P8DA 2LNVA 2DXUA 3M56A 4HNVA 5GAN5 3GLXA 2XICA 4EMKA 3MEUA 2QI2A 2F5KA 2JN0A 2PUOB 2XU8A 3X28B 5GANh 4M7DF 1XTDA 2KVQG 5HKCA 1VQNA 4JX6A 4RMOA 3QO3A 2P0PA 1Y07A 4QSHA 2DO3A 3V8JA 4EPCA 3M54A 1DJ7B 2NLUA 3CCUA 1VIFA 3I56A 4EMKC 2QQ9A 3LX7A 1G5VA 2R57A 2GQVA 4C0DC 1BKBA 3WVDB 1YHQA 3C12A 4ELJA 3OYNA 3OYLA 3JCMd 4M77A 3JB9F 2VUBA 4KBMB 3OS0A 4M75E 3N5BB 3OS5A 2HD0A 4FT4A 1VQ8T 2FL7A 3QKJA 4DOWA 3BDLA 3JCMP 5A0GA 3T9NA 4PJOB 1M90C 2QQBA 3DB4A 3KHIA 3E9FA 4BI3A 3QZ9B 5LJ5h 3FEOA 4M7AB 4JS5A 2MMPA 3MEWA 1QVFA 1VQKA 4MZMA 2QDYB 3OMCA 3JB9H 4JRPA 5GMKm 1U1SA 2RI5A 5D6WA 3PGGA 2EQKA 3SB2A 5C0MA 3OYKA 5CKFA 3L2VA 1KQSA 4VUBA 2QQRA 2CYZB 2CKKA 4OVAA 2YLBA 1YIJT 4XK8E 1JBMA 4A4FA 1KD1U 1VQ7A 3Q1JA 4DQ2A 4LDYA 2CGHA 3CCLT 3CPWS 4RG8A 5GANj 4A4HA 4E7LA 5IN1A 2L3RA 1H3ZA 3OSSC 3CC2A 3G71A 3CCSA 4LDWA 3UT1A 1O75A 5LJ3e 5GAOn 3RERA 2VC8A 5CO7A 5DM7R 1YI2A 3HHTB 4OGEA 1P92A 3L1AA 3OW2A 1N8RC 2ZPHB 3MP8A 2LTOA 4XTWA 4HCZA 3CD6A 3A5ZB 5GAOm 1E7PA 4O5VA 5GANd 5D6YA 4C92A 1IREB 2JVVA 2O01E 1Q82U 4ATOA 3RMQA 4NC6A 3OY9A 3QJYA 1SSFA 1VQOA 2EJ9A 2EFIA 3URGA 3S6WA 3JB9J 4WF2A 5GAMg 1K9MC 2XD0A 3J7AF 4JX4A 1FWZA 1I81A 1UGQB 3CCJT 4BDZA 1VQMT 4M75G 1X75C 4BE0A 4HA8A 2CZ0B 3FDRA 1QW1A 5DLQE 3RIRA 4C92C 4F7UG 5HK3A 5LJ5j 3QZ5B 4M75D 5GMKl 3MEAA 3GPLA 3PFSA 2EQUA 3L2WA 3OS2A 4A4KA 4C8QG 4M7DC 4MZTA 3I55A 2PQWA 1Q7YC 1VQLT 3LLRA 1Y96B 2MI6A 3ME9A 4M77F 3ZEHA 4M78A 1VQ4T 3G6ET 1QVGS 2RI2A 1NE8A 5LJ5d 2ZZDB 4JLGA 2QA4A 2LQ8A 3META 1JJ2S 3MHXA 2LDMA 1K73C 2JNGA 3OYCA 2L5QA 3GNFB 3L2RA 4FM4B 3MP6A 2FB7A 1YJ9A 4BB7A 5DLOA 1X6OA 4Z02A 5CKEA 3CBMA 4V2SA 5EG2A 1WQWA 3LGLA 3UWNA 4R56A 3RMSA 4O6JA 5GAOl 1D3BA 5A2QE 4DA4A 2RJEA 5FU6C 4FIBA 2P4TA 5FROA 4BUGA 4HCCA 3VU3C 1KG1A 2QTXA 2QDJA 3M55A 2JTFA 2VYTA 1YITA 2BUDA 4QQDA 1BI2A 1UB4A 2X4JA 4YTLA 3MP1A 1W2BS 3VV0A 2VXEA 1I8FA 2RHIA 1VQ9T 4M75B 4JUVA 5CQXA 1Q86C 2D6FA 4RCBA 1VQMA 4LDVA 3V7CA 4E7KA 3F70A 2M9UA 4J8OA 1JB0E 3L2UA 2LCLA 5LJ3g 3FJPA 4PJOG 4OB0B 2V8JA 2V8IA 5A0LA 4M7AG 4J6WA 1KC8C 3JB9I 3BG5A 4C92E 2ZPBB 1YJWA 3E19A 5FLXE 2GFUA 2DKGA 3ER0A 3LWHA 2PU9B 3NTKA 3G6EA 5FRMA 3E9GA 3JCMg 1HXDA 2MWOA 3OYYA 4M7DE 2E6ZA 5GAMe 3A8OB 1NJIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0Q B;  3QZ9 B;  2DD5 A;  4ZGD B;  2QDY B;  1UGS B;  2DD4 A;  2CZ7 B;  2CYZ B;  1UGP B;  1GXI E;  4XK8 E;  2AHJ B;  4RKU E;  1V29 B;  5L8R E;  2DXB B;  3HHT B;  4OB1 B;  2ZPH B;  2CZ6 B;  2ZPE B;  2DXC A;  1IRE B;  2O01 E;  2WSE E;  3VYG B;  1PSE A;  2ZPF B;  3X26 B;  2PVO B;  1UGQ B;  2ZCF B;  2CZ0 B;  4ZGE B;  3QXE B;  3QZ5 B;  3X24 B;  3A8M B;  2DD5 B;  1QP2 A;  2WSC E;  2PVD B;  1UGR B;  3QYG B;  2PVG B;  3QYH B;  2DXB A;  4KT0 E;  2DD4 B;  4ZGJ B;  2PUK B;  3A8G B;  2ZZD B;  1AHJ B;  3A8L B;  1PSF A;  4Y28 E;  2WSF E;  4FM4 B;  3VYG A;  3LW5 E;  4L6V 5;  4OB2 B;  3VYH B;  3X20 B;  2DXC B;  2PUO B;  3X28 B;  2DPP B;  1DJ7 B;  2ZZD A;  1JB0 E;  2ZPI B;  3WVD B;  4OB3 B;  4OB0 B;  2ZPB B;  3X25 B;  2CZ1 B;  3WVE B;  2PU9 B;  2ZPG B;  1QP3 A;  3A8H B;  3A8O B; 
#chains in the Genus database with same CATH topology
 2DTH A;  3FRN A;  4LD6 A;  1M90 U;  3EH1 A;  3KBG A;  5CYI B;  2CZ7 B;  3GTM S;  2DRM A;  2KR3 A;  4HCB A;  2JZ2 A;  4FYY B;  2JM9 A;  1G3T A;  2RQW A;  3C94 A;  4A4E A;  4NOY A;  1UE9 A;  3ZFJ A;  2FPD A;  2RQV A;  4JRQ A;  2DEQ A;  2HL5 C;  4JZ4 A;  2DF6 A;  2Y4Y A;  2K5F A;  3DOG B;  4OGC A;  5D6X A;  5I2M A;  1BIB A;  1SRM A;  4QW2 A;  8AT1 B;  2K5L A;  2RQT A;  3CME T;  3G4S T;  4F70 B;  2LQW A;  3JCM c;  1OV3 A;  5GAM f;  1G8X A;  3EG3 A;  4EC8 B;  3ZBD A;  1EFN A;  3EID B;  1VQ6 T;  1QVP A;  4JLI A;  1H3H A;  2EAY A;  1RAE B;  3EFO B;  3OYF A;  1S72 T;  4CFV B;  3A8M B;  4BY6 C;  3QYB A;  1RAC B;  4BBR M;  2QA4 Q;  4ZN3 A;  2FG0 A;  4BE1 A;  3QYH B;  1ENW A;  1AD5 A;  4C8Q F;  4R55 A;  2K57 A;  2DRK A;  4BDY A;  1UFF A;  3JCM e;  2CP0 A;  4BCM B;  2WSF E;  2NUT A;  2GBQ A;  2FVU A;  1WPY A;  4I3Z B;  4IUV A;  2DFU A;  3FLG A;  4HCK A;  2P84 A;  2JXB A;  1H26 B;  2F2C A;  1WXB A;  4RTY A;  1KHI A;  1RL2 A;  2E3H A;  2DPP B;  1WLP B;  3OYI A;  2DK3 A;  2J06 A;  5GAN 6;  3TRE A;  4MFE A;  4N4G A;  2W10 A;  2DTO A;  4FL6 A;  4EMH A;  5LJ3 f;  1H4L D;  4F17 A;  4JS4 A;  4B9X A;  4OR5 B;  5KH6 A;  4M78 C;  2KXC A;  4G6L B;  4FU6 A;  1WNL A;  3H9N A;  1K8A C;  1B7T A;  2CCI B;  1S1N A;  3WVE B;  1JRI A;  4OGR B;  4QVZ A;  1ACM B;  1VYW B;  3GP8 A;  2NUP B;  4JX5 A;  3HKS A;  4J9E A;  2DLP A;  2KQW A;  3RGF B;  4QVD A;  2DD5 A;  1HSQ A;  4AG2 C;  4LDX A;  4Y91 A;  1AWJ A;  2J6K A;  2E64 A;  3LH5 A;  5GAO q;  4M75 A;  2A28 A;  5L2W B;  5IT9 E;  2EYZ A;  3DL1 A;  3RUX A;  1D3U B;  1WHL A;  4RTV A;  2DE0 X;  2WEV B;  1IXD A;  2HAX A;  1D1A A;  4DOV A;  1VQ4 A;  4Y92 A;  1SEM A;  2X51 A;  4OB1 B;  3TEE A;  4F6U B;  4L59 A;  1ZUU A;  4EOO B;  2LCC A;  5KCH A;  2IG0 A;  5CK9 A;  2M16 A;  2LW4 A;  2WJ9 A;  2B8A A;  4K11 A;  1VUB A;  3EGX A;  4X9D A;  5J39 A;  2K3Y A;  4RTX A;  1M1K C;  3F5X B;  1G3W A;  4YC3 B;  1HD3 A;  2X35 A;  3R6O A;  2EJG A;  4KRD B;  2QDL A;  1K0X A;  4HNT A;  5GAN 7;  3M0R A;  1ZUY A;  1MV0 B;  2JT4 A;  3MO8 A;  1WGS A;  2K2V A;  4BCK B;  3QHS A;  2A37 A;  3RKW A;  2D1X A;  4PKC C;  1WJR A;  2CH4 A;  2CJM B;  1OX9 A;  3L2Q A;  4FYW B;  3LH0 A;  2QQA A;  2GCX A;  2CP7 A;  4M6V A;  3TCJ A;  3VS1 A;  3QDF A;  5A0D A;  1T0J A;  4CRL B;  4C92 G;  5FWB A;  1LNX A;  4L6V 5;  4OB2 B;  3X20 B;  2XID A;  3OYB A;  4MIM A;  4M75 F;  2MAM A;  3HZJ A;  1QWF A;  2C0T A;  3VKI A;  3VS6 A;  1R8O B;  3CPF A;  4A53 A;  4C0Z A;  2LT1 A;  4TVR A;  4FYV B;  5I5Z B;  1YWO A;  2ZPI B;  2KYM A;  3OW2 S;  2XK0 A;  2RJC A;  2QGF B;  2QA4 T;  4M78 D;  4X34 A;  3RR6 A;  3HL8 A;  4BCQ D;  2YDL A;  1ZBJ A;  2RHY A;  1OPL A;  2CZ1 B;  4J9H A;  2YRD A;  3JCM Q;  3OYA A;  3L42 A;  4ROE A;  2HBW A;  3CCJ Q;  5GAO r;  2BZ8 A;  3JRZ A;  1M27 C;  3EG9 A;  2HBP A;  1Q81 U;  3CCQ Q;  3V8L A;  3CQT A;  5KYX B;  3VUB A;  1ZHI A;  2D9T A;  1VQL Q;  2AHJ B;  2IW9 B;  4PJO E;  3MCA B;  1FX7 A;  1SSH A;  4BI8 B;  3VKH A;  4GY5 A;  4MZP A;  4XTX A;  4PJM A;  2OTJ A;  2GNC A;  2DL8 A;  2WXV B;  3REA B;  1T3S A;  3CCE A;  1KFZ A;  2MOX A;  2E4H A;  4KGV B;  3QSU A;  1PC0 A;  1G3S A;  2EBP A;  1H28 B;  2DXT A;  2EPD A;  4IKF A;  2DL7 A;  1SPK A;  4LE9 A;  4EOK B;  2EW3 A;  2AKL A;  2LX9 A;  1YJN A;  1M8V A;  2OAU A;  2QEX A;  2O2O A;  3X26 B;  2VGM A;  4XU3 A;  1WHJ A;  1D3B B;  3PNW C;  2UZE B;  1QCO A;  3OYM A;  2KDS A;  3M5A A;  3OYH A;  4AKH A;  2FEI A;  4C5G A;  3CPW P;  1UGR B;  1LOJ A;  3HP9 A;  3BLH B;  1JXM A;  2PUK B;  4CRI A;  4JRK A;  3NTH A;  1M5Q 1;  3BG9 A;  3LGF A;  3CMA Q;  3QG1 A;  2H3J A;  2G77 A;  2PNI A;  5EFQ B;  3J81 E;  3VJP A;  2DXU A;  3GLX A;  4EMK A;  3MEU A;  2QI2 A;  3UA7 A;  1E7O A;  4EOS B;  1UNH D;  5GAN h;  1XTD A;  3CC7 Q;  4RMO A;  3V8J A;  2DEU A;  3M54 A;  1VQ7 Q;  1VIF A;  3I56 A;  4EMK C;  3LX7 A;  3RDV A;  1G5V A;  3G33 B;  4EOI B;  2GQV A;  4C0D C;  3CCM Q;  2RQU A;  3CCR Q;  3OYL A;  3JB9 F;  4BCI B;  2G6F X;  1ABQ A;  3N5B B;  1UEC A;  2HD0 A;  4FT4 A;  1XO2 A;  4D8D A;  1JEG A;  4PJO B;  3KHI A;  4BI3 A;  1VQO Q;  3MEW A;  5KYY B;  3OMC A;  3TSZ A;  1U1S A;  2RI5 A;  1VOL A;  5D6W A;  1M90 R;  3DTO A;  1BB9 A;  5C0M A;  1J3T A;  4VUB A;  1W2B P;  1VQ5 Q;  1JBM A;  1U06 A;  1KD1 U;  4B6M A;  2CGH A;  5GAN j;  4RG8 A;  4E7L A;  4GLM A;  1H3Z A;  3OSS C;  3CCS A;  4LDW A;  3UT1 A;  2FRW A;  5GAO n;  1I0C A;  2VC8 A;  3UA6 A;  1P92 A;  3L1A A;  1NG2 A;  3M0P A;  3OW2 A;  2ZPH B;  2LTO A;  2DL4 A;  4HCZ A;  5GAN d;  4C92 A;  2K7A A;  1SSF A;  1O9K B;  3URG A;  2XD0 A;  5GAM g;  3J7A F;  1NEB A;  1FWZ A;  1UGQ B;  3CCJ T;  1VQM T;  1X75 C;  4BE0 A;  4HA8 A;  3CC2 A;  4C92 C;  2LQN A;  5HK3 A;  2BE7 D;  1W98 B;  5GMK l;  2KRM A;  2R7G A;  3PFS A;  2ROL A;  3OS2 A;  2J7I A;  2O31 A;  3G1J A;  4A4K A;  4C8Q G;  4M7D C;  3I55 A;  1VQL T;  1FMV A;  4CXA B;  1QVG S;  2RI2 A;  2JTE A;  1JJ2 S;  4NST B;  2LDM A;  3M0U A;  2JNG A;  3GNF B;  1WHM A;  1YJ9 A;  2YRC A;  5CKE A;  5EG2 A;  3LGL A;  3UWN A;  1CSK A;  4R56 A;  1D3B A;  5FRO A;  4ROC A;  2P4T A;  1VQN Q;  2GTO A;  3H0F A;  5IH2 A;  2QTX A;  2VYT A;  5KYN A;  3CCU Q;  4QQD A;  1AWO A;  1UB4 A;  1GCP A;  2VXE A;  2RHI A;  1AIS B;  1YHQ Q;  1Q86 C;  1VQM A;  3EGU A;  4E7K A;  3L2U A;  1JB0 E;  4J9I A;  5LJ3 g;  3FJP A;  4ANJ A;  3A98 A;  2V8J A;  3EOC B;  3JB9 I;  2ZPB B;  5FLX E;  2LMJ A;  2GFU A;  4Z89 A;  2PU9 B;  5GAM e;  1U3O A;  3JCM g;  5FRM A;  2MWO A;  3OYY A;  2WPA B;  3CMA T;  4N0A A;  1VA7 A;  4XU2 A;  4ZGD B;  1UEB A;  5I11 A;  3CBP A;  1MMD A;  2EWN A;  5CVI A;  2BTT A;  2NUZ A;  1F1B B;  2E41 A;  3QDR B;  2E10 A;  3CC7 T;  1ZSZ A;  1GY3 B;  3CCV A;  3I9Q A;  1MUZ A;  2BZX A;  3CD6 Q;  1E9H B;  5EJC A;  1GH6 B;  3CCM T;  4XQ3 A;  5KE3 A;  2FO0 A;  2KXD A;  3CCR T;  1ZSZ C;  1N8R U;  3CC4 A;  3B57 A;  3TSW A;  3HRU A;  1M1F A;  2VAS A;  3S3M A;  2WSE E;  5KYY A;  3CXC S;  4J9D A;  2YHT A;  4PL6 A;  3OYD A;  1N27 A;  1K9M U;  1K1Z A;  2EYX A;  4DEY A;  4CFU B;  1RLQ C;  2YT6 A;  4ELY C;  1OKV B;  2WHB B;  4NL2 A;  2QGS A;  2XDP A;  4M7D D;  1B34 A;  4CC7 A;  5CCA A;  2O88 A;  1VQ5 T;  2ZGW A;  3MEV A;  2UZD B;  2YSQ A;  3TW7 A;  6AT1 B;  3A8L B;  1ARK A;  2YUP A;  3GBQ A;  1K73 U;  1X2Q A;  3M59 A;  1VQ8 A;  1A0N B;  4IMY B;  1OIU B;  1PD1 A;  5FU7 C;  4IUU A;  1U8R A;  5GAN 8;  3GIB A;  4PFO A;  4HXJ A;  4M77 E;  1UNL D;  1ZBX A;  3HBL A;  4KGZ B;  5KYU B;  4QQG A;  1YIJ A;  2C5V B;  4C5I A;  4C0G A;  3CCL A;  2E5Q A;  1YJW Q;  2VB6 A;  2KMT A;  2E1H A;  1QMZ B;  2K79 A;  2DAQ A;  2QQS A;  4J5Y A;  4PJO F;  1KC8 U;  1NLO C;  1QVG A;  3NPF A;  2RJF A;  1OQK A;  1H8K A;  3DLL A;  1QVF P;  1JJ2 A;  3EG2 A;  2DL5 A;  4MML A;  4BE2 A;  1W6X A;  3DDP B;  5GAN e;  4QKU A;  1NJI U;  1MV3 A;  2OX7 A;  1YCY A;  3R6N A;  4PLI A;  5ACB A;  3RKX A;  2WMB B;  2I2L A;  2ATC B;  2JTM A;  1BBZ A;  2L89 A;  2BPM B;  5KYW B;  1UGP B;  1Z9Q A;  2EJF A;  3VS7 A;  3CCU T;  1BI0 A;  1Q86 R;  4RKU E;  1N6A A;  2LX7 A;  4C8Q A;  1Q95 G;  1YHQ T;  1VOM A;  5HBJ B;  2YUN A;  4LUD A;  4BCN D;  4M77 G;  1Y71 A;  5FRN A;  1M3B A;  2V22 B;  3QYE A;  4HL4 A;  1NPP A;  2CZ6 B;  2RH2 A;  2JOY A;  4C8Q C;  2JMC A;  1OOT A;  4Z8A A;  1M4Z A;  3MY5 B;  2DZC A;  1E6G A;  2RK1 A;  3VYG B;  1N9S A;  3GNG A;  2WMA B;  3SDZ A;  2W2H A;  2DER A;  2HDA A;  2W96 A;  4DBH A;  2M51 A;  5GMK i;  1XQH A;  2PK9 B;  2CP2 A;  2RPN A;  1VQ9 A;  1M3C A;  3HRS A;  2BS2 A;  1G83 A;  2H8H A;  5DY9 A;  3BDU A;  4J9C A;  2DD4 B;  3GF5 A;  3SD4 A;  2DL3 A;  5CKD A;  4E2F B;  1AHJ B;  1RAH B;  4EMG A;  3PMT A;  1KXU A;  1YFN A;  3CD6 T;  2W9F A;  4M77 B;  4BY7 X;  2G9X B;  3SFM A;  4D6W A;  4F7U E;  2XMF A;  1M9S A;  4CFW B;  4AG1 C;  4JRI A;  3CXC A;  2DXC B;  4XTU A;  2LCS A;  1XOV A;  2Y90 A;  4BAC A;  2RD1 A;  2OI3 A;  2DZ9 A;  1WZO A;  2CUB A;  1TXQ A;  1Q7Y U;  5IHN A;  4C5H A;  2DYB A;  3P8B B;  3INZ A;  3JB9 G;  3VKG A;  3TNI B;  2MK5 A;  4GLK A;  2B86 A;  4Q5W A;  4AKI A;  5J26 A;  2E65 A;  2BKD N;  2RB6 A;  4IUQ A;  5HBE B;  2YRV A;  1M1G A;  3X25 B;  4OMQ A;  3M53 A;  1MMG A;  1TH7 A;  4F14 A;  3C95 A;  3CME A;  3SWN B;  1QP3 A;  3G4S A;  1H1R B;  2I40 B;  1G3N C;  3MPU B;  1FYN A;  2R5M A;  4LNP A;  2DMO A;  2I0N A;  4AFS C;  1YIT T;  1Y96 A;  5KYU A;  2X4W A;  1VQ6 A;  1I5O B;  1PRL C;  2KAF A;  3M4G A;  1VQP T;  1S72 A;  1WYX A;  5GJV B;  1SHF A;  2D8H A;  4HT9 A;  4HNU A;  3H4C A;  4M7A E;  4MFD A;  5IHK A;  1X69 A;  3JCM f;  4E47 A;  2FRY A;  3HO8 A;  4HKE A;  1GFC A;  1VIN A;  1YJW T;  5EC7 A;  5I2S A;  1LJO A;  1YBY A;  4C8Q D;  1FXX A;  3OBY A;  4OMO A;  1MND A;  1Y57 A;  1WJS A;  2A7Y A;  5BNJ B;  3I5R A;  2DIQ A;  3HTR A;  2P0Q A;  5CEI B;  1RUW A;  2R5A A;  2RI3 A;  1W70 A;  2BIV A;  4M75 C;  1TS9 A;  4N4I A;  4DBF A;  1KQ2 A;  2ECZ A;  3I56 Q;  4TTH A;  2PVD B;  3EG0 A;  4ZTJ A;  1VQP A;  1NYF A;  2LC4 A;  2MIO A;  4MMK A;  4F7U B;  2EYQ A;  1MHN A;  1AT1 B;  5GMK h;  1PSF A;  1QQJ A;  2AKK A;  1SRL A;  3M9Q A;  4Y28 E;  1WFW A;  5KE2 A;  2FYK A;  3VYG A;  2DIL A;  1OUL A;  2DVJ A;  3TU4 K;  3MY1 B;  5IAY A;  2C0O A;  5GAN 4;  1X01 A;  1OU9 A;  3MKD A;  5GAN 5;  4HNV A;  1U5S A;  2L2P A;  3D7S B;  2F5K A;  2PUO B;  3X28 B;  3RBB B;  2KVQ G;  2QAS A;  3QO3 A;  2P0P A;  4QSH A;  1BU1 A;  2WIP B;  1JQQ A;  1BU2 A;  1DJ7 B;  2NLU A;  1M2V B;  2QAZ A;  5FWC A;  3CCS Q;  4M77 A;  3JV3 A;  1FVV B;  4KBM B;  3EGD B;  3OS0 A;  1JKW A;  2YWW A;  1YNZ A;  3OS5 A;  3QKJ A;  3EFO A;  4AT1 B;  2KRN A;  1M90 C;  3DB4 A;  3E9F A;  5IDP B;  5LJ5 h;  3QZ9 B;  4M7A B;  4JS5 A;  4DEX A;  4MZM A;  2QDY B;  2HSE B;  4JRP A;  2CP3 A;  3OYK A;  2EQK A;  2ENM A;  2JMA A;  1OL1 B;  5CKF A;  3L2V A;  2QQR A;  2CYZ B;  2CKK A;  4FW2 A;  2YLB A;  4XK8 E;  4A4F A;  1RAB B;  1OGU B;  1SHG A;  2J05 A;  1FMW A;  5IN1 A;  2L3R A;  1WXU A;  1JU5 C;  2EQI A;  4LXC A;  2ESW A;  1X43 A;  2A08 A;  5CO7 A;  1PNJ A;  1T3L A;  1G2B A;  3A5Z B;  5GAO m;  1E7P A;  1Z9Z A;  3TVT A;  1VYU A;  2O01 E;  1Q82 U;  2PZ1 A;  3VS3 A;  4ATO A;  1CKA A;  4NC6 A;  3OY9 A;  2X9H A;  2EFI A;  3JB9 J;  4WF2 A;  4PJJ A;  4BDZ A;  1VYV A;  4ORZ A;  4QT7 A;  2CZ0 B;  3FDR A;  5DLQ E;  5LJ5 j;  4M75 D;  1K9M R;  2EQU A;  2OTL Q;  1Q7Y C;  4M77 F;  1K9A A;  2HQH A;  2B9R A;  1P5E B;  2NUP A;  2JW4 A;  5LJ5 d;  1GL5 A;  2ZZD B;  4JLG A;  2QA4 A;  3MET A;  1M2O A;  4CC4 B;  4BB7 A;  1BCO A;  5DLO A;  2UUE B;  5DQV A;  1X6O A;  4Z02 A;  4A63 B;  3CBM A;  1WQW A;  3M0S A;  1K73 R;  5A2Q E;  2FZK B;  2DX1 A;  4BUG A;  4HCC A;  4FIB A;  4F16 A;  2QDJ A;  2BUD A;  4YTL A;  1IGQ A;  3VV0 A;  4E6R A;  1D0Y A;  1I8F A;  4JUV A;  1PRM C;  4YOS A;  2QTV A;  1TFB A;  3F70 A;  2M9U A;  4PJO G;  4HVV A;  3BLR B;  1TWB A;  2IIM A;  1T0H A;  2ED1 A;  1H27 B;  3ER0 A;  3LWH A;  1NLP C;  1VQK Q;  1KC8 R;  1N5Z A;  3V8K A;  2L3P A;  1OZ3 A;  4QQ6 A;  1R77 A;  2DIG A;  1H1Q B;  2DVE A;  1NJI R;  4Y72 B;  3OYJ A;  5IHY A;  1GXI E;  3NMZ C;  1M2V A;  3G71 Q;  2X4Y A;  5IXB A;  3VRZ A;  1YI2 Q;  2CUD A;  2YLC A;  1XJW B;  9ATC B;  3EGD A;  1M8M A;  1OPK A;  1YN8 A;  1SF9 A;  1LCK A;  2HZY A;  2RF0 A;  1UGV A;  4BCM D;  5ECA A;  1AZG B;  3JCM W;  5DQW A;  1K0S A;  5FGK B;  3FIF A;  1C6V X;  5GJW B;  4BCN B;  2EIF A;  2E6N A;  4M7A A;  2EKO A;  3LWI A;  3QJ6 A;  1PSE A;  2M0O A;  2ED0 A;  5GAN g;  2IW8 B;  3FC3 A;  4KH1 B;  1H92 A;  1ABO A;  3OMG A;  3O0G D;  4ZGE B;  2KGT A;  4KRT A;  4F7U F;  1WHG A;  2RHU A;  3QHR B;  1QP2 A;  4ELZ C;  4EIK A;  4LDU A;  3P8H A;  1QCF A;  3A8G B;  3S3O A;  2M1H A;  1IHV A;  2HQX A;  5GAN 3;  5AT1 B;  2MPX C;  5KYX A;  3TW6 A;  3FB9 A;  3POM A;  3JB9 D;  2O4X B;  2L8D A;  1N4M A;  2KSS A;  4LD9 K;  3BE3 A;  3CCQ T;  3LQ5 B;  4XTZ A;  1GFD A;  2LJ0 A;  4F6S B;  3OS1 A;  2K9G A;  3TNH B;  1KK7 A;  4GBQ A;  2XDB A;  3C4S A;  1B07 A;  5J3B A;  4E7H A;  1WJQ A;  2Y4X A;  4IUR A;  4FW1 A;  5GMK e;  2QQ8 A;  3PTA A;  5LL6 S;  2ZZD A;  1Q7Y R;  4EDU A;  4OB3 B;  4FT2 A;  3CBO A;  3G6E Q;  3TN8 B;  3HRT A;  3BHT B;  2HMA A;  2LQK A;  3LYI A;  2VXF A;  2QXF A;  4M7A F;  2ZPG B;  2DJQ A;  1ZQ1 A;  1U1T A;  3JCM b;  4BY1 X;  2D0Q B;  3NFC A;  5FU6 B;  1Q81 C;  2BS4 A;  4OMN A;  1OZ2 A;  5HK0 A;  4F6W B;  3UDC A;  2PHG A;  3O5Z A;  3CCJ A;  3PVL A;  2GTJ A;  2C5X B;  4F7L B;  1ZUK A;  3H0I A;  2C6T B;  2C06 A;  1VQ9 Q;  2EUF A;  4E7Z A;  2XKO C;  3OBW A;  1KSW A;  4BI4 A;  4P5N A;  1VQL A;  3OW2 P;  2RQR A;  1I1J A;  4OF1 A;  2DXB B;  1IHW A;  2GQI A;  2KRS A;  1OI1 A;  5LJ5 e;  4HT8 A;  1UG1 A;  5HBH B;  3J80 E;  5FW9 A;  1E6H A;  3S3N A;  1H24 B;  4YOO A;  2ZPF B;  1VQK T;  1TUC A;  3NDQ A;  4M78 E;  4N0A C;  2RHX A;  2JUF A;  4OML A;  1VQ7 T;  2C4G B;  1OI9 B;  3RNJ A;  3HFN A;  4II1 A;  1WA7 A;  1W1F A;  2NYS A;  5LJ3 d;  3G71 T;  4AKG A;  1IO6 A;  4PJO A;  5C6S A;  1YI2 T;  1VYT A;  2RA2 A;  1OYX A;  5AYF A;  2COY A;  4XU0 A;  4F7S B;  1ZSG A;  5LJ5 f;  1W4S A;  4LUE A;  2ZAE A;  3JCM X;  4PJO C;  1MNE A;  1H25 B;  2CSI A;  2L0A A;  3HB9 A;  4C92 D;  1Y7X A;  2E12 A;  1VQO T;  1KQS S;  3I35 A;  3CMA A;  1QCN A;  2JGZ B;  2BE9 B;  3QPH A;  5GAO p;  1VQ6 Q;  2G3R A;  3QBY A;  1S72 Q;  4BY6 B;  1MMA A;  2CP6 A;  4JJN K;  5CKH A;  3CC7 A;  2ROT A;  3KFV A;  4PNO A;  2KBT A;  4M78 G;  4JJB A;  2CS7 A;  2V26 A;  1I5L A;  1O9K A;  1FIN B;  3CCM A;  4L5G A;  2O4X A;  2V8K A;  2IW6 B;  3E2U A;  1UDL A;  3CCR A;  4OMM A;  1K8A U;  1OX8 A;  1M3A A;  2Z0W A;  3QWX X;  4HLQ A;  1HK9 A;  1D0X A;  1KQ1 A;  2HL3 A;  3AHU A;  2RJD A;  2RO0 A;  2FZG B;  1PCX A;  2M0Y A;  1AWX A;  3H41 A;  4BCJ B;  1C9B A;  3DB3 A;  3MIA B;  3OB9 A;  2RN8 A;  1KD1 C;  5CQY A;  1VQ4 Q;  4CC3 A;  2LT4 A;  1V29 B;  4EOM B;  1VQ5 A;  3MJX A;  5I22 A;  2UZB B;  1UTI A;  4MDW A;  1RI9 A;  4M4Z A;  4BD3 A;  1NEG A;  2X3W D;  2CT3 A;  4M78 B;  4BCQ B;  3EFR A;  2ZPE B;  3UAT A;  2PK2 A;  2XG8 D;  4EOQ B;  1WHK A;  4RUG A;  1WHH A;  4UC4 A;  4PK4 A;  3U23 A;  1M1K U;  1VQN T;  1OL2 B;  1Q81 R;  3EAE A;  2DA9 A;  2EYY A;  1Q82 R;  1AD6 A;  3OA6 A;  2XI9 A;  2X4X A;  4D8K A;  3L2Z A;  4LOC A;  4N4H A;  4HVU A;  1NPR A;  2DD5 B;  2DET A;  4PLL A;  3QYG B;  2DXB A;  1UUE A;  4ELL A;  1H64 1;  2BS3 A;  1X6G A;  2KI7 A;  2QG9 B;  1GBR A;  2EVR A;  1CKB A;  4JDS A;  3OQ5 A;  4J7F A;  4XAX B;  2QF7 A;  1FMK A;  2EQJ A;  2L3S A;  3ASK A;  5GAN f;  1IRX A;  1D0Z A;  4PJO D;  3CEY A;  1N9R A;  3OYE A;  3VS0 A;  4J6X A;  2CP5 A;  1IZ6 A;  4E7I A;  1BI1 A;  3P8D A;  3SEM A;  3M56 A;  2GGR A;  2EGE A;  1D1B A;  2JN0 A;  2XU8 A;  3EGX B;  1VQN A;  4JX6 A;  1OIY B;  4EPC A;  2KYB A;  3CCU A;  4CFX B;  2VKN A;  2R57 A;  1PKD B;  2KE9 A;  3WVD B;  1V76 A;  1YHQ A;  1QVG P;  3OYN A;  4BCO B;  1JJ2 P;  2HKQ B;  2BKZ B;  2C5O B;  2FL7 A;  7AT1 B;  1LVK A;  2M02 A;  4EOP B;  2JM8 A;  5HVY B;  4PFP A;  3FEO A;  1QWE A;  3JB9 H;  2W9Z A;  2CCH B;  1K4U S;  1KQS A;  2RNA A;  2OTJ Q;  4OVA A;  2PTK A;  2W0Z A;  3A1P A;  3Q1J A;  4DQ2 A;  3CCE Q;  3CPW S;  1B3Q A;  2OJ2 A;  2F2W A;  2QYZ A;  1O75 A;  5LJ3 e;  4RTZ A;  2IN3 A;  3RER A;  5DM7 R;  2CDT A;  4ROD A;  2P4R A;  3HHT B;  2QK0 A;  2FZC B;  1YJN Q;  1N8R C;  2QEX Q;  4XTW A;  4BCF B;  3CD6 A;  1X2K A;  1WI7 A;  4O5V A;  3I5S A;  5D6Y A;  1IRE B;  1TOV A;  2FPF A;  3RMQ A;  3QJY A;  1URC B;  2EJ9 A;  1K9M C;  1ZP2 A;  1I81 A;  4F7U G;  3RIR A;  3UF4 A;  1KD1 R;  3MEA A;  3GPL A;  3EG9 B;  2CH4 W;  4CFM B;  3PO3 S;  3ZEH A;  4M78 A;  1VQ4 T;  4WTO B;  2IPO B;  3MHX A;  1K73 C;  4BCP B;  3OYC A;  2L5Q A;  3THK A;  1X27 A;  3NGP A;  5KYW A;  4V2S A;  3CXC P;  2HSP A;  5GAO l;  2RJE A;  1KG1 A;  1GBQ A;  2AT1 B;  2F2X A;  2J6O A;  2I53 A;  3M55 A;  2JTF A;  3REB B;  1YIT A;  1AEY A;  1NM7 A;  1KQS P;  2X4J A;  3MP1 A;  1W2B S;  2PJQ A;  1PM3 A;  2EGA A;  5L23 A;  5CQX A;  2VVK A;  3VS4 A;  4LDV A;  5IHI A;  4J8O A;  1AWW A;  1JO8 A;  4OB0 B;  2V8I A;  4M7A G;  1KC8 C;  3BG5 A;  4PJN A;  4C92 E;  1YJW A;  3E19 A;  2DKG A;  3NTK A;  3E9G A;  2KRO A;  4M7D E;  2E6Z A;  3A8O B;  3QWY A;  1NJI C;  3EH2 A;  4IUP A;  4CFU D;  4PJL A;  2LP5 A;  1NZ9 A;  1UGS B;  2DD4 A;  4DBQ A;  1QMC A;  2X1N B;  2V1R A;  2LNH B;  4ZN1 A;  1WX6 A;  4NS5 A;  2PMI B;  4EOJ B;  1X6B A;  4EMK B;  4M78 F;  4C0D B;  2E70 A;  3G7Z A;  1TUG B;  5ICP B;  1OEB A;  4IUT A;  2HEQ A;  3KUF A;  2VWF A;  1LPL A;  5GMK j;  4M77 C;  2DXC A;  4X1V A;  4X9C A;  4JJD A;  3K7A M;  2AK5 A;  3E1S A;  1ZA2 B;  2LJ3 A;  4OP0 A;  2C0I A;  3VUZ A;  1UHC A;  3CC2 Q;  3QUI A;  5I21 A;  4FSX A;  2AIR B;  4E7S A;  5CKB A;  3TQ7 P;  2COZ A;  3I55 Q;  4M7D G;  4KUI A;  2WFY B;  2DNU A;  4KGX B;  2RMO A;  1JSU B;  3FJ5 A;  2OTJ T;  2D8J A;  3M0T A;  1XNI A;  2PVG B;  1ZLM A;  2YUQ A;  1IGU A;  4ZGJ B;  3SWN A;  4KUL A;  1QLB A;  3CCE T;  1ZX6 A;  1YJ9 Q;  1UJY A;  3CPW A;  1JOW A;  4Z6Y A;  3M58 A;  2XHC A;  1GUX B;  4A54 A;  1N8R R;  2C5N B;  4KRC B;  3H6Z A;  5LJ5 g;  3JCM V;  1QLY A;  3OYG A;  1YJN T;  3PVQ A;  3LW5 E;  3SWN C;  2QEX T;  3VYH B;  4JJC A;  1TTH B;  4QVC A;  4OMF B;  4BBS M;  2VGN A;  1EX4 A;  4MDX A;  1VQM Q;  2K2M A;  4C92 B;  1QKW A;  3DKM A;  1Q86 U;  1RAI B;  4M7D B;  4J7I A;  2R58 A;  3BFM A;  2JS2 A;  2MWP A;  1FKM A;  1HJD A;  2LJ1 A;  4RTU A;  2F5T X;  4EON B;  1TSF A;  5LQF B;  3NHN A;  4R0K A;  2P0K A;  1NYG A;  2DTI A;  3A8H B;  4C5E A;  1K8A R;  2O9S A;  3UPU A;  5CR2 A;  2K3B A;  4EC9 B;  2HCK A;  3CCV Q;  1JXO A;  2KR6 A;  4J6Y A;  4F7U A;  4CI0 C;  4E7J A;  3I56 T;  5D7U A;  2E5K A;  1W2B A;  2K4Y A;  4RCC A;  2LRQ A;  2MCN A;  1WXT A;  2AZV A;  3CC4 Q;  2MYS A;  2RM4 A;  2QFZ A;  2XDD A;  1O9S A;  1KJW A;  5HQ0 B;  4M77 D;  3BHV B;  2O9V A;  2WIH B;  2HNI A;  3RKY A;  1OU8 A;  5HCK A;  3C0C A;  2DBM A;  4C0F A;  2MF2 A;  2HKN A;  2YXY A;  2PVO B;  2WAC A;  1RI0 A;  3VRY A;  1M1K R;  3HFO A;  1KHC A;  3V7R A;  1RAA B;  2KEA A;  3QXE B;  3RES A;  1C0M A;  4IIO A;  1IB8 A;  5GAN 2;  3PIO A;  2GFA A;  4CFN B;  3EFS A;  2KK4 A;  2DBK A;  1TD6 A;  3CCS T;  4KT0 E;  4J83 A;  1BYM A;  3WXM B;  1AZE A;  1SG5 A;  5M9O A;  1VQ8 Q;  2A0F B;  4FSS A;  1ZSZ B;  3NTI A;  4F7J B;  3JAM E;  3PMI A;  1QVF S;  2RK2 A;  3IQL A;  2L3Q A;  3DLM A;  1G3Y A;  2A3L A;  3JSC A;  4NL3 A;  4EOR B;  2VV5 A;  4HVW A;  4M7A C;  3HPW A;  1MMN A;  1YIJ Q;  3CC2 T;  5GAM h;  1SKU B;  3BG3 A;  2K5I A;  2E3I A;  3CCL Q;  3EHQ A;  5HY6 A;  4C8Q E;  2A36 A;  1RAD B;  5LMK B;  3PIP A;  3I55 T;  4B9W A;  2KMG A;  1F5Q B;  2EYW A;  4RTW A;  1PKS A;  1GUX A;  4II5 B;  2EQM A;  3BY7 A;  3H0H A;  2CT4 A;  3M57 A;  1B34 B;  5CIU A;  1R0C B;  2QGG A;  1YJ9 T;  4BXX X;  2H3E B;  1PG5 B;  1EIF A;  3OSV A;  2ABL A;  2KNB B;  1HYO A;  3M4Y A;  4ME7 A;  5FU7 B;  4XTV A;  1H1P B;  3KXT A;  2F2V A;  3H8Z A;  1BI3 A;  4M7D A;  1V1C A;  2NWM A;  4AI6 A;  1OKW B;  3JCM J;  1NBE B;  3DDQ B;  2OTL T;  1GRI A;  5GAM j;  5IDN B;  4UN0 A;  2F69 A;  5L8R E;  1I4K 1;  4XTY A;  1WQ7 A;  1GCQ A;  3QII A;  5LJ3 h;  2KY9 A;  2BZY A;  3BHU B;  4RG2 A;  2GF7 A;  3HSB A;  1MGQ A;  5GAM d;  1YCS B;  1Q82 C;  3EJ1 B;  2DM1 A;  1PWT A;  1GCQ C;  3JCM h;  4A4G A;  1PD0 A;  1QKX A;  2RHZ A;  3CCQ A;  1AVZ C;  4Z88 A;  1YP5 A;  4ESR A;  4AFQ C;  2ZCF B;  4J9F A;  3V7S A;  3X24 B;  3O8V A;  3GOX A;  2DYI A;  4ZTF A;  2YUO A;  1BIA A;  3CCV T;  1JST B;  2WSC E;  2LVM A;  3BLQ B;  1PHT A;  5KCO A;  1VIE A;  2DJZ A;  1TG0 A;  4KUD K;  3BW1 A;  1I07 A;  2HQE A;  2OTL A;  1R0B G;  1D1C A;  2K3X A;  1ZA1 B;  3CC4 T;  3PT9 A;  2FHD A;  1WIE A;  3EHR A;  4F7N B;  4C8Q B;  3QWL A;  2FPE A;  2SRC A;  5LJ3 j;  3PE0 A;  3MI9 B;  4M7A D;  2IVW A;  4XU1 A;  4C92 F;  5CAI A;  2LNV A;  4JZ3 A;  4CC2 A;  2XIC A;  4LN2 A;  1M30 A;  4M7D F;  5HKC A;  1Y07 A;  2DO3 A;  4J9B A;  4F04 B;  3SHW A;  2SEM A;  2X3X D;  4OMP A;  5IF1 B;  2QQ9 A;  2V1Q A;  3VS5 A;  1BKB A;  2CRE A;  3C12 A;  4ELJ A;  3JCM d;  2VUB A;  4FYX B;  3CME Q;  3G4S Q;  5HNB B;  4M75 E;  4EOL B;  3VS2 A;  1VQ8 T;  4DOW A;  3BDL A;  3JCM P;  1AOJ A;  5A0G A;  3DJB A;  3T9N A;  2QQB A;  2JS0 A;  1K76 A;  2MMP A;  2COW A;  1VQK A;  1QVF A;  2EGC A;  1UJ0 A;  5GMK m;  1TU0 B;  3PGG A;  3SB2 A;  2KT8 A;  2KT1 A;  1YIJ T;  4IIM A;  4FCY A;  1VQ7 A;  2F1L A;  1PKT A;  3CCL T;  4LDY A;  1Y0M A;  1RAF B;  4WCI A;  3EG1 A;  4A4H A;  1TUD A;  4RTT A;  3G71 A;  5IXF A;  1YI2 A;  3QHW B;  4OGE A;  1C1A A;  3MP8 A;  2D0N A;  3M0Q A;  4PFZ A;  8ATC B;  1H1S B;  1D09 B;  2W99 A;  2JVV A;  2AZS A;  2NUT B;  4ZNX A;  2K6D A;  1RAG B;  1VQO A;  3S6W A;  3M03 A;  3AT1 B;  4JX4 A;  4J9G A;  3ZL7 C;  4M75 G;  1YIT Q;  4DBR A;  2OAW A;  1QW1 A;  4BCG B;  3QZ5 B;  2J6F A;  1VQP Q;  3L2W A;  4AMC A;  4MZT A;  2PQW A;  3LLR A;  1Y96 B;  2EKH A;  2MI6 A;  3ME9 A;  3G6E T;  1WDX A;  4AFU C;  1UHF A;  1KIK A;  1NE8 A;  2UZL B;  2LQ8 A;  2CSQ A;  2IVX A;  4AFZ C;  3L2R A;  4FM4 B;  3MP6 A;  2FB7 A;  4JPB W;  3RMS A;  4O6J A;  4DA4 A;  5FU6 C;  1BK2 A;  3VU3 C;  4YOZ A;  1UNG D;  2DME A;  4FX3 B;  1BI2 A;  1RLP C;  1VQ9 T;  4M75 B;  2D6F A;  4RCB A;  3ULR B;  2JJ9 A;  1BCM A;  1EZZ B;  3V7C A;  2LCL A;  5A0L A;  4J6W A;  3TNW B;  2LZ6 B;  4KH0 B;  1YWP A;  3G6E A;  1HXD A;  4BCH B; 
#chains in the Genus database with same CATH homology
 3V8K A;  2DTH A;  3FRN A;  1OZ3 A;  4LD6 A;  4N0A A;  4QQ6 A;  1M90 U;  3CMA T;  4XU2 A;  4ZGD B;  1UEB A;  2DIG A;  4IUP A;  3KBG A;  3CBP A;  2DVE A;  1NZ9 A;  1UGS B;  2DD4 A;  4PJO C;  2CZ7 B;  2EWN A;  5CVI A;  4HCB A;  3OYJ A;  2E41 A;  2JZ2 A;  3QDR B;  4ZN1 A;  1GXI E;  2E10 A;  2X4Y A;  1G3T A;  4NS5 A;  1VQO T;  3C94 A;  4A4E A;  3CC7 T;  4EMK B;  4NOY A;  4M78 F;  3CCV A;  4C0D B;  2E70 A;  3G7Z A;  2YLC A;  3ZFJ A;  4JRQ A;  2DEQ A;  5KE2 A;  5EJC A;  2Y4Y A;  2K5F A;  1I5L A;  4IUT A;  4OGC A;  3KUF A;  4NL3 A;  3CCM T;  4XQ3 A;  5D6X A;  5I2M A;  5KE3 A;  1BIB A;  4QW2 A;  5GMK j;  3CCR T;  4M77 C;  3JCM W;  2DXC A;  1N8R U;  2K5L A;  3FIF A;  3CC4 A;  3HRU A;  4X9C A;  1M1F A;  3CME T;  3G4S T;  2EIF A;  2E6N A;  4M7A A;  3S3M A;  2EKO A;  2WSE E;  3E1S A;  3CXC S;  3LWI A;  3QJ6 A;  3JCM c;  1PSE A;  4OP0 A;  3VUZ A;  2M0O A;  2YHT A;  5GAM f;  4PL6 A;  3OYD A;  1N27 A;  3ZBD A;  5GAN g;  1K9M U;  3QUI A;  5I21 A;  3FC3 A;  1VQ6 T;  1QVP A;  4FSX A;  4JLI A;  3OMG A;  5CKB A;  2EAY A;  4ELY C;  3OYF A;  3CC4 T;  4ZGE B;  1S72 T;  4KUI A;  4M7D G;  3A8M B;  4NL2 A;  4BY6 C;  3QYB A;  2XDP A;  4F7U F;  2RHU A;  1B34 A;  4M7D D;  1QP2 A;  2OTJ T;  4BBR M;  5CCA A;  4ELZ C;  1VQ5 T;  1XNI A;  2PVG B;  4LDU A;  4ZN3 A;  4BE1 A;  3QYH B;  3P8H A;  4ZGJ B;  2ZGW A;  3MEV A;  4KUL A;  3SWN A;  1QLB A;  4C8Q F;  3CCE T;  4R55 A;  3A8G B;  2K57 A;  3S3O A;  3CPW A;  2M1H A;  3TW7 A;  2HQX A;  4Z6Y A;  5GAN 3;  3A8L B;  3M58 A;  4BDY A;  3JCM e;  2XHC A;  4A54 A;  3TW6 A;  3FB9 A;  1K73 U;  2WSF E;  3JB9 D;  3H6Z A;  3M59 A;  5LJ5 g;  3JCM V;  2O4X B;  3OYG A;  1YJN T;  2L8D A;  2FVU A;  1VQ8 A;  1WPY A;  3LW5 E;  3SWN C;  2QEX T;  4IUV A;  2KSS A;  3FLG A;  4LD9 K;  3VYH B;  3CCQ T;  5FU7 C;  4QVC A;  4OMF B;  4IUU A;  4BBS M;  4XTZ A;  1U8R A;  2VGN A;  5GAN 8;  1KHI A;  3GIB A;  1RL2 A;  3OS1 A;  4MDX A;  2DPP B;  4M77 E;  4C92 B;  3OYI A;  1ZBX A;  2DK3 A;  5GAN 6;  2XDB A;  3HBL A;  3C4S A;  3TRE A;  4MFE A;  3DKM A;  5J3B A;  4N4G A;  4E7H A;  4QQG A;  1WJQ A;  1YIJ A;  2Y4X A;  2DTO A;  4IUR A;  4C5I A;  4FL6 A;  1Q86 U;  4EMH A;  4C0G A;  4M7D B;  3CCL A;  5GMK e;  2QQ8 A;  5LJ3 f;  5LL6 S;  4J7I A;  3PTA A;  2E5Q A;  2R58 A;  2ZZD A;  3BFM A;  4EDU A;  4JS4 A;  4OB3 B;  4FT2 A;  3CBO A;  2KMT A;  2MWP A;  4B9X A;  5KH6 A;  2E1H A;  2QQS A;  1FKM A;  2DAQ A;  3HRT A;  4J5Y A;  2LQK A;  4M78 C;  2F5T X;  3LYI A;  2VXF A;  4PJO F;  1KC8 U;  4FU6 A;  2QXF A;  1WNL A;  1QVG A;  4M7A F;  1K8A C;  2RJF A;  3WVE B;  1JRI A;  4QVZ A;  2ZPG B;  2P0K A;  3DLL A;  1ZQ1 A;  1JJ2 A;  2DTI A;  1U1T A;  4MML A;  3A8H B;  3JCM b;  5GAN e;  3GP8 A;  4JX5 A;  3HKS A;  4BE2 A;  2D0Q B;  2KQW A;  3NFC A;  5FU6 B;  4C5E A;  1Q81 C;  1YCY A;  4QVD A;  1NJI U;  2BS4 A;  2DD5 A;  3UPU A;  1OZ2 A;  5HK0 A;  4PLI A;  3UDC A;  4LDX A;  3RKX A;  4Y91 A;  2I2L A;  5CR2 A;  2E64 A;  5GAO q;  3CCJ A;  2JTM A;  4M75 A;  2L89 A;  2KR6 A;  4J6Y A;  4F7U A;  5IT9 E;  1UGP B;  4CI0 C;  4E7J A;  2EJF A;  2C06 A;  3DL1 A;  1BI0 A;  3RUX A;  3CCU T;  3I56 T;  4RKU E;  2XKO C;  1N6A A;  3OBW A;  1W2B A;  2K4Y A;  4C8Q A;  4BI4 A;  4RCC A;  4Y28 E;  2HAX A;  2LRQ A;  4P5N A;  1YHQ T;  1VQL A;  4DOV A;  4OF1 A;  1VQ4 A;  4M77 G;  2RM4 A;  2QFZ A;  2XDD A;  2DXB B;  1O9S A;  1Y71 A;  4OB1 B;  5FRN A;  3TEE A;  4HL4 A;  3QYE A;  4L59 A;  1OI1 A;  4M77 D;  5LJ5 e;  1NPP A;  4HT8 A;  2HNI A;  2CZ6 B;  2LCC A;  2RH2 A;  3RKY A;  4JDS A;  5KCH A;  2IG0 A;  2JOY A;  4C8Q C;  5CK9 A;  2M16 A;  2WJ9 A;  3J80 E;  2B8A A;  4X9D A;  1M4Z A;  1VUB A;  5J39 A;  4C0F A;  2DZC A;  2K3Y A;  3S3N A;  1M1K C;  2RK1 A;  3VYG B;  1G3W A;  1N9S A;  2X35 A;  2MF2 A;  2ZPF B;  1VQK T;  3GNG A;  3R6O A;  2EJG A;  2PVO B;  3SDZ A;  2OTJ A;  2WAC A;  1RI0 A;  4M78 E;  4N0A C;  3HFO A;  2RHX A;  4HNT A;  1KHC A;  5GAN 7;  3V7R A;  2JUF A;  3QXE B;  3MO8 A;  3RES A;  1WGS A;  2K2V A;  5GMK i;  1XQH A;  1VQ7 T;  1VQ9 A;  3QHS A;  5GAN 2;  2GFA A;  3PIO A;  3RKW A;  3HRS A;  2BS2 A;  3EFS A;  4PKC C;  2KK4 A;  1WJR A;  5DY9 A;  3HFN A;  4II1 A;  3BDU A;  5LJ3 d;  3L2Q A;  3G71 T;  3CCS T;  4KT0 E;  2DD4 B;  3GF5 A;  4AKG A;  4J83 A;  3WXM B;  4PJO A;  3LH0 A;  3SD4 A;  2QQA A;  5C6S A;  1YI2 T;  2GCX A;  1BYM A;  2RA2 A;  5CKD A;  1OYX A;  5AYF A;  5M9O A;  1AHJ B;  4M6V A;  4EMG A;  4XU0 A;  3PMT A;  3TCJ A;  3CD6 T;  4M77 B;  3NTI A;  5LJ5 f;  3JAM E;  5A0D A;  3PMI A;  1W4S A;  4C92 G;  1QVF S;  2RK2 A;  3JCM X;  1LNX A;  1G3Y A;  2A3L A;  3DLM A;  3JSC A;  4L6V 5;  4OB2 B;  3HB9 A;  3SFM A;  1Y7X A;  2E12 A;  3X20 B;  2VV5 A;  2XID A;  4MIM A;  4C92 D;  3OYB A;  4D6W A;  3HPW A;  3CMA A;  4M7A C;  4F7U E;  1M9S A;  3QPH A;  2MAM A;  4M75 F;  3HZJ A;  5GAO p;  4JRI A;  3CXC A;  2DXC B;  4XTU A;  3VKI A;  3CC2 T;  1XOV A;  2Y90 A;  5GAM h;  4BAC A;  3BG3 A;  1R8O B;  2K5I A;  2RD1 A;  3CPF A;  4A53 A;  2G3R A;  5HY6 A;  4C8Q E;  2DZ9 A;  3QBY A;  4C0Z A;  4BY6 B;  1Q7Y U;  3PIP A;  2LT1 A;  4TVR A;  4C5H A;  5CKH A;  3I55 T;  4B9W A;  4JJN K;  3CC7 A;  3P8B B;  3INZ A;  4PNO A;  3JB9 G;  3VKG A;  2ZPI B;  4M78 G;  3OW2 S;  4GLK A;  2KMG A;  2XK0 A;  4Q5W A;  4AKI A;  2CS7 A;  2RJC A;  5J26 A;  2QA4 T;  2E65 A;  2BKD N;  2EQM A;  2RB6 A;  3BY7 A;  3HL8 A;  2YRV A;  4IUQ A;  4M78 D;  4X34 A;  3CCM A;  1M1G A;  3X25 B;  4L5G A;  2RHY A;  1B34 B;  2O4X A;  2V8K A;  3M57 A;  5CIU A;  2CZ1 B;  3CCR A;  1YJ9 T;  1K8A U;  3JCM Q;  1EIF A;  1TH7 A;  3M53 A;  4HLQ A;  3OSV A;  3C95 A;  3L42 A;  3OYA A;  3SWN B;  1QP3 A;  1HK9 A;  1KQ1 A;  3G4S A;  3CME A;  3M4Y A;  5GAO r;  3JRZ A;  3AHU A;  4ME7 A;  5FU7 B;  4XTV A;  2HBP A;  1Q81 U;  2RJD A;  2R5M A;  2RO0 A;  3V8L A;  3KXT A;  3VUB A;  3H8Z A;  1YIT T;  1Y96 A;  1BI3 A;  2X4W A;  1VQ6 A;  1ZHI A;  3M4G A;  2KAF A;  2D9T A;  3DB3 A;  3OB9 A;  1VQP T;  1S72 A;  4M7D A;  1KD1 C;  2AHJ B;  4AI6 A;  5CQY A;  3JCM J;  4PJO E;  3MCA B;  1FX7 A;  4BI8 B;  3VKH A;  2OTL T;  4GY5 A;  5GAM j;  4MZP A;  2LT4 A;  1V29 B;  3H4C A;  4HNU A;  4XTX A;  4HT9 A;  4M7A E;  4MFD A;  2F69 A;  1VQ5 A;  5L8R E;  1I4K 1;  4XTY A;  1WQ7 A;  3JCM f;  4MDW A;  4E47 A;  3QII A;  3CCE A;  4BD3 A;  5LJ3 h;  3HO8 A;  4HKE A;  2KY9 A;  4M78 B;  1YJW T;  3QSU A;  3EFR A;  5I2S A;  1G3S A;  2ZPE B;  1LJO A;  1YBY A;  1FXX A;  2GF7 A;  4RG2 A;  2DXT A;  3OBY A;  4C8Q D;  2XG8 D;  1MGQ A;  5GAM d;  4IKF A;  3HSB A;  1Q82 C;  1WJS A;  2A7Y A;  2LX9 A;  1YJN A;  1M8V A;  4UC4 A;  2OAU A;  3JCM h;  4A4G A;  2QEX A;  1M1K U;  2RHZ A;  1VQN T;  2DIQ A;  3EAE A;  3CCQ A;  3X26 B;  2P0Q A;  2VGM A;  4XU3 A;  3OA6 A;  1D3B B;  2XI9 A;  3PNW C;  2X4X A;  2ZCF B;  3L2Z A;  4LOC A;  2R5A A;  2RI3 A;  3V7S A;  4N4H A;  2BIV A;  3OYM A;  3X24 B;  2KDS A;  3M5A A;  1NPR A;  3O8V A;  4M75 C;  3GOX A;  3OYH A;  4N4I A;  4ZTF A;  1KQ2 A;  4AKH A;  2DD5 B;  1BIA A;  4C5G A;  3CCV T;  2WSC E;  4PLL A;  2PVD B;  1UGR B;  3QYG B;  2LVM A;  4ZTJ A;  2DXB A;  1LOJ A;  3HP9 A;  1VQP A;  1H64 1;  2BS3 A;  5KCO A;  1VIE A;  2DJZ A;  2LC4 A;  2PUK B;  4MMK A;  4CRI A;  4F7U B;  4KUD K;  3BW1 A;  4JRK A;  2EYQ A;  1MHN A;  3NTH A;  2HQE A;  2OTL A;  5GMK h;  1PSF A;  2K3X A;  3OQ5 A;  3M9Q A;  4J7F A;  1M5Q 1;  2FHD A;  2QF7 A;  2FYK A;  3BG9 A;  2EQJ A;  3ASK A;  3LGF A;  3PT9 A;  4XAX B;  4C8Q B;  3VYG A;  3QG1 A;  3QWL A;  5GAN f;  2H3J A;  4PJO D;  3TU4 K;  2G77 A;  3CEY A;  1N9R A;  5IAY A;  5LJ3 j;  3OYE A;  4J6X A;  1KQS S;  3J81 E;  1IZ6 A;  4M7A D;  5GAN 4;  2IVW A;  4XU1 A;  3VJP A;  4C92 F;  4E7I A;  5CAI A;  1BI1 A;  1X01 A;  3P8D A;  2LNV A;  2DXU A;  3M56 A;  4HNV A;  5GAN 5;  3GLX A;  2XIC A;  4EMK A;  3MEU A;  2QI2 A;  2F5K A;  2JN0 A;  2PUO B;  2XU8 A;  3X28 B;  5GAN h;  4M7D F;  1XTD A;  2KVQ G;  5HKC A;  1VQN A;  4JX6 A;  4RMO A;  3QO3 A;  2P0P A;  1Y07 A;  4QSH A;  2DO3 A;  3V8J A;  4EPC A;  3M54 A;  1DJ7 B;  2NLU A;  3CCU A;  1VIF A;  3I56 A;  4EMK C;  2QQ9 A;  3LX7 A;  1G5V A;  2R57 A;  2GQV A;  4C0D C;  1BKB A;  3WVD B;  1YHQ A;  3C12 A;  4ELJ A;  3OYN A;  3OYL A;  3JCM d;  4M77 A;  3JB9 F;  2VUB A;  4KBM B;  3OS0 A;  4M75 E;  3N5B B;  3OS5 A;  2HD0 A;  4FT4 A;  1VQ8 T;  2FL7 A;  3QKJ A;  4DOW A;  3BDL A;  3JCM P;  5A0G A;  3T9N A;  4PJO B;  1M90 C;  2QQB A;  3DB4 A;  3KHI A;  3E9F A;  4BI3 A;  3QZ9 B;  5LJ5 h;  3FEO A;  4M7A B;  4JS5 A;  2MMP A;  3MEW A;  1QVF A;  1VQK A;  4MZM A;  2QDY B;  3OMC A;  3JB9 H;  4JRP A;  5GMK m;  1U1S A;  2RI5 A;  5D6W A;  3PGG A;  2EQK A;  3SB2 A;  5C0M A;  3OYK A;  5CKF A;  3L2V A;  1KQS A;  4VUB A;  2QQR A;  2CYZ B;  2CKK A;  4OVA A;  2YLB A;  1YIJ T;  4XK8 E;  1JBM A;  4A4F A;  1KD1 U;  1VQ7 A;  3Q1J A;  4DQ2 A;  4LDY A;  2CGH A;  3CCL T;  3CPW S;  4RG8 A;  5GAN j;  4A4H A;  4E7L A;  5IN1 A;  2L3R A;  1H3Z A;  3OSS C;  3CC2 A;  3G71 A;  3CCS A;  4LDW A;  3UT1 A;  1O75 A;  5LJ3 e;  5GAO n;  3RER A;  2VC8 A;  5CO7 A;  5DM7 R;  1YI2 A;  3HHT B;  4OGE A;  1P92 A;  3L1A A;  3OW2 A;  1N8R C;  2ZPH B;  3MP8 A;  2LTO A;  4XTW A;  4HCZ A;  3CD6 A;  3A5Z B;  5GAO m;  1E7P A;  4O5V A;  5GAN d;  5D6Y A;  4C92 A;  1IRE B;  2JVV A;  2O01 E;  1Q82 U;  4ATO A;  3RMQ A;  4NC6 A;  3OY9 A;  3QJY A;  1SSF A;  1VQO A;  2EJ9 A;  2EFI A;  3URG A;  3S6W A;  3JB9 J;  4WF2 A;  5GAM g;  1K9M C;  2XD0 A;  3J7A F;  4JX4 A;  1FWZ A;  1I81 A;  1UGQ B;  3CCJ T;  4BDZ A;  1VQM T;  4M75 G;  1X75 C;  4BE0 A;  4HA8 A;  2CZ0 B;  3FDR A;  1QW1 A;  5DLQ E;  3RIR A;  4C92 C;  4F7U G;  5HK3 A;  5LJ5 j;  3QZ5 B;  4M75 D;  5GMK l;  3MEA A;  3GPL A;  3PFS A;  2EQU A;  3L2W A;  3OS2 A;  4A4K A;  4C8Q G;  4M7D C;  4MZT A;  3I55 A;  2PQW A;  1Q7Y C;  1VQL T;  3LLR A;  1Y96 B;  2MI6 A;  3ME9 A;  4M77 F;  3ZEH A;  4M78 A;  1VQ4 T;  3G6E T;  1QVG S;  2RI2 A;  1NE8 A;  5LJ5 d;  2ZZD B;  4JLG A;  2QA4 A;  2LQ8 A;  3MET A;  1JJ2 S;  3MHX A;  2LDM A;  1K73 C;  2JNG A;  3OYC A;  2L5Q A;  3GNF B;  3L2R A;  4FM4 B;  3MP6 A;  2FB7 A;  1YJ9 A;  4BB7 A;  5DLO A;  1X6O A;  4Z02 A;  5CKE A;  3CBM A;  4V2S A;  5EG2 A;  1WQW A;  3LGL A;  3UWN A;  4R56 A;  3RMS A;  4O6J A;  5GAO l;  1D3B A;  5A2Q E;  4DA4 A;  2RJE A;  5FU6 C;  4FIB A;  2P4T A;  5FRO A;  4BUG A;  4HCC A;  3VU3 C;  1KG1 A;  2QTX A;  2QDJ A;  3M55 A;  2JTF A;  2VYT A;  1YIT A;  2BUD A;  4QQD A;  1BI2 A;  1UB4 A;  2X4J A;  4YTL A;  3MP1 A;  1W2B S;  3VV0 A;  2VXE A;  1I8F A;  2RHI A;  1VQ9 T;  4M75 B;  4JUV A;  5CQX A;  1Q86 C;  2D6F A;  4RCB A;  1VQM A;  4LDV A;  3V7C A;  4E7K A;  3F70 A;  2M9U A;  4J8O A;  1JB0 E;  3L2U A;  2LCL A;  5LJ3 g;  3FJP A;  4PJO G;  4OB0 B;  2V8J A;  2V8I A;  5A0L A;  4M7A G;  4J6W A;  1KC8 C;  3JB9 I;  3BG5 A;  4C92 E;  2ZPB B;  1YJW A;  3E19 A;  5FLX E;  2GFU A;  2DKG A;  3ER0 A;  3LWH A;  2PU9 B;  3NTK A;  3G6E A;  5FRM A;  3E9G A;  3JCM g;  1HXD A;  2MWO A;  3OYY A;  4M7D E;  2E6Z A;  5GAM e;  3A8O B;  1NJI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...