4ZGEB

Double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 52
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgeB02
3A8GB 4OB1B 1QP3A 1PSEA 3VYHB 3QXEB 2CZ7B 2CZ1B 2DD5B 3VYGA 2DD5A 3A8LB 3X24B 2ZPHB 5L8RE 3WVEB 2PUOB 3QZ9B 2WSCE 4ZGJB 4Y28E 1UGPB 4OB0B 1JB0E 2QDYB 2PU9B 2ZPGB 2CYZB 4KT0E 2WSFE 1UGSB 3LW5E 3VYGB 2PVGB 2WSEE 4ZGEB 2ZPIB 4XK8E 2DD4A 4ZGDB 3HHTB 2PVDB 3QYHB 3A8MB 3X28B 2D0QB 2DPPB 3X25B 2ZZDB 3A8HB 3X20B 1QP2A 1UGRB 2ZPBB 2ZPFB 2CZ0B 2CZ6B 4L6V5 1V29B 2PUKB 2DD4B 3QZ5B 1AHJB 2ZPEB 1GXIE 2ZZDA 1IREB 2ZCFB 3WVDB 3A8OB 2DXCB 2DXBA 2DXCA 1UGQB 1PSFA 2DXBB 1DJ7B 3X26B 2O01E 3QYGB 4FM4B 4OB2B 4RKUE 2PVOB 4OB3B 2AHJB
chains in the Genus database with same CATH superfamily
1R0BG 1NYGA 2DEQA 1YCYA 1KXUA 3L2RA 1ZLMA 4XU2A 1OPLA 2PMIB 1NPPA 4KGZB 2DF6A 1WQ7A 2LNVA 1Q82U 4HNTA 1N4MA 4LN2A 4C5HA 2SRCA 1UFFA 3NPFA 3CCLT 1O9KB 2GNCA 2XI9A 3NMZC 2QYZA 3E2UA 3BW1A 5HK0A 1H25B 4AFUC 5L2WB 3RGFB 1TUCA 3L2QA 4OB0B 2K3YA 4LDWA 2ZPGB 3GNFB 3CC7Q 2Y4YA 1KD1R 2JM9A 1UGSB 5GANe 2DMEA 1Q82C 2C5VB 4BCHB 2ED0A 2RHZA 2KMTA 1WXBA 2HQHA 4DEYA 1JSTB 2LC4A 4CFXB 1MGQA 2CS7A 5GAOp 4GBQA 4JS4A 4QVDA 1M1GA 4QKUA 3A8MB 2A08A 3JCMd 5FU6C 1UHCA 3JRZA 5HBHB 4J8OA 1VQNT 2HSEB 2AIRB 1M3BA 3OMGA 3CD6T 1H4LD 2XU8A 1D3BA 1HYOA 3M0TA 1G2BA 4Y72B 1RACB 3RKXA 2EQIA 3M0QA 2RH2A 3ER0A 2VASA 2DD4B 2YT6A 4F6WB 2KK4A 2QDLA 3TW7A 1JQQA 2CH4A 4OF1A 2O31A 2YUOA 2DLPA 5GAOn 2DTIA 1G8XA 4X9CA 3F5XB 1SSFA 2WMBB 2VGMA 1VQMQ 3CCQT 4M7DA 1H26B 1QVPA 2J6KA 2QQBA 1VQ9A 3EFOA 5DY9A 4M78B 1JKWA 1D0ZA 4R56A 2L3PA 2LJ3A 3BG3A 2RB6A 4OB2B 2VC8A 2FRWA 3M59A 3CCLA 1G3WA 3P8BB 5CKEA 2JS0A 3EIDB 2ESWA 1FYNA 1VUBA 4LUDA 3CCSA 4VUBA 1QVFA 1QP3A 2KDSA 2F2VA 1WXUA 4BACA 2CZ7B 2LDMA 5FU7C 4E7LA 3RUXA 3R6NA 1FINB 1JRIA 4ANJA 5KYUA 3A8LB 2B8AA 4A4GA 1D3UB 3INZA 3RESA 2ECZA 2LP5A 3RKYA 1VYVA 5KYNA 2QDJA 2OTJT 2JT4A 1Q86R 2LCCA 1ZX6A 1K0SA 3OYNA 3VUZA 4PJMA 2A28A 2RK1A 2XK0A 1GRIA 1ENWA 3TN8B 3G6EA 4XTZA 2IW9B 2RNAA 2UZDB 1OPKA 4M7AB 1OKWB 1RABB 4JPBW 1VQLT 2YLBA 1D0XA 3CMAA 2DTOA 3A8HB 1M3AA 2RK2A 5LJ3f 1M1KC 4F7UF 2FPDA 2JS2A 2KAFA 2WACA 4HVWA 3M9QA 2ZPFB 1H8KA 1VQKT 2AZSA 5GAN4 2DX1A 2NUTB 2K3XA 3H9NA 1QW1A 5ACBA 1V1CA 2AZVA 2I0NA 2QK0A 4X34A 1AISB 2K9GA 2I53A 1OKVB 4EOMB 2OJ2A 2CT3A 1OIUB 1AWXA 1BIAA 3A8OB 4E47A 6AT1B 3I56A 1VOLA 2YLCA 1CKBA 4QQDA 4J9GA 3X26B 3CC2T 1RAEB 4FM4B 5GAN6 1ZBJA 3TQ7P 3EG2A 3NFCA 2VVKA 2GQIA 3D7SB 5FU7B 5C6SA 1AEYA 3MEUA 5GANh 2AHJB 2EIFA 3JCMX 2HSPA 1YWOA 3U23A 3S3NA 4CFNB 2EBPA 4C8QE 5EFQB 2FL7A 1I5OB 4F7UE 1ZSZA 1GFDA 3JB9G 4HL4A 3JCMc 3NTHA 1YI2Q 1Q82R 2VXFA 4UN0A 1OX8A 3THKA 2FB7A 3IQLA 2HEQA 4M7AA 3OYMA 4E7ZA 2BS4A 2X4XA 4E7JA 4C5GA 3GF5A 1WXTA 1M5Q1 4JDSA 5KCHA 2K5IA 5GJVB 1VYUA 2DL5A 3CCSQ 2BKDN 3V8KA 2KSSA 2E6ZA 1YHQA 1OEBA 2F2XA 1QVFS 1YJWQ 2V22B 1YJWA 5FRMA 2YUPA 3CCMQ 3CCJT 5FLXE 3OYIA 4F7NB 3HHTB 2W0ZA 3QYHB 1FVVB 3X28B 4BCFB 4OMQA 4LXCA 2M1HA 2XD0A 4EOKB 1ARKA 3HFNA 2DYBA 1OL1B 2HL5C 1B34B 2ZAEA 1R8OB 3CMEQ 3PGGA 3VRYA 4IURA 1UGRB 2ZPBB 2X9HA 5HQ0B 3FIFA 4RTZA 4PL6A 2CZ6B 1Y71A 4J7IA 4FW1A 1JSUB 5GMKi 4HA8A 2JTMA 2ROLA 2DAQA 4R0KA 3SHWA 2C0TA 2LNHB 1K73R 2CSQA 2X3XD 2QGSA 1X43A 4RMOA 3CXCA 1QCFA 5CIUA 2EFIA 2JXBA 5LQFB 3URGA 1FKMA 2MOXA 3MJXA 4B9WA 2W9ZA 2EVRA 4M7DB 2UZLB 2F2WA 5GMKj 3SFMA 4F7UB 1W2BA 9ATCB 3VS0A 4RG2A 2L8DA 4CRIA 4N0AA 1A0NB 1FX7A 1PD0A 4RKUE 3CCUT 2LVMA 4KGVB 2KVQG 1S72A 4M75D 1T0HA 2KRNA 4IUTA 1KFZA 4M75G 3GIBA 1RADB 2FYKA 3SWNC 1UJ0A 4M77G 4Y91A 4JX4A 5FGKB 1G3SA 1PSEA 4KRCB 5FW9A 2UZBB 2BS3A 2EJGA 4HVVA 4F14A 5GAMf 3OSSC 5IHKA 3HRSA 1BI3A 1NLOC 1N27A 3WVEB 1HK9A 4BCJB 4JJNK 4C8QD 3EH2A 1ZQ1A 4J9EA 4XTUA 3ME9A 2K57A 1TS9A 2P0QA 2AKKA 1GBQA 3BG5A 1YITA 2CYZB 1OOTA 3JB9D 2EYXA 1BCOA 2O88A 2VYTA 2FZKB 1UB4A 3AT1B 2V8KA 1AZGB 2KXDA 5HVYB 2ZPIB 2YXYA 1UEBA 4EOSB 2PHGA 3OYCA 3TSWA 4J6YA 4AFQC 4F16A 1XO2A 2JW4A 3NHNA 4QW2A 3CCVT 2XDBA 4B6MA 2A36A 1WHKA 1BCMA 1W6XA 3RMQA 4OP0A 1WNLA 2BKZB 2QXFA 2KE9A 4BUGA 1LOJA 1R77A 1YJNQ 3QZ5B 2F1LA 3QHRB 1M9SA 5CO7A 1OIYB 4L5GA 1VQOT 2G6FX 4II5B 2IVXA 5J26A 1WHLA 3L2ZA 1X2KA 2IN3A 3L2WA 2YHTA 1E9HB 1EIFA 4OMNA 1MUZA 1WGSA 1Q81U 1VQ7Q 4BCND 2OTJQ 1O9SA 2PQWA 3SDZA 4JS5A 2O4XB 3I55T 4KUDK 1H3HA 2OTLA 1YCSB 4V2SA 3KFVA 1JXOA 4D6WA 2DILA 1NJIR 3NTIA 2QASA 3LGLA 3HSBA 4JRQA 2M9UA 1OGUB 1KQ1A 3I55Q 2L3QA 4J9CA 5LJ5f 2RJDA 2WHBB 3GLXA 2RMOA 4DQ2A 1BU1A 1VQ8A 1ZUUA 4BE1A 4IUQA 1ZSZB 5LL6S 1C9BA 3QPHA 5A2QE 2CZ1B 2KRMA 2L3SA 1EFNA 2IIMA 2DD5A 1YJ9T 2E41A 1GL5A 3CPWS 2JN0A 3DDQB 3EGDB 1VQ6Q 3FRNA 4M7AD 2DRMA 1AWWA 2RQRA 4OR5B 1I1JA 4XTVA 4YOZA 3H41A 3JCMf 1K8AC 1AT1B 3OYAA 2JMAA 2RM4A 2E12A 3OYKA 3FLGA 2A0FB 3V8LA 2V26A 2BZ8A 5IHNA 1KQSS 4ZGEB 2DA9A 5GAOm 3KHIA 3HL8A 2X51A 3EH1A 2C0IA 2HCKA 4XQ3A 4AMCA 1W2BP 1SSHA 3CPFA 2W10A 4M77F 3UWNA 1K73C 2KYMA 3H0FA 3AHUA 4EIKA 5LJ5g 2RQTA 4F7UG 3QHSA 2DXTA 4JUVA 1D3BB 2BUDA 5DQVA 4KUIA 3RMSA 2L0AA 1VYWB 3QWYA 4OMPA 4QQ6A 2X3WD 4EOIB 4PJOC 2E65A 2K2VA 4EPCA 1QMCA 3M55A 2J06A 1N9RA 2DXUA 3FC3A 2GFUA 3PE0A 3BHUB 1M90U 3VUBA 2G9XB 1K73U 2CCIB 1K9AA 1U1SA 3TNWB 2E3HA 3EGUA 4Q5WA 2FRYA 1I0CA 1WIEA 4M77B 2D1XA 1VQPA 3GNGA 1VQOQ 1RI9A 1RAGB 1SKUB 1Y96B 1TG0A 3EFOB 3ZBDA 2DXBA 2DXCA 3I56T 2GF7A 1XTDA 4J6WA 3PMTA 3CBOA 2VUBA 1WI7A 1KQ2A 1H1RB 4RG8A 1SRLA 1LNXA 2FPEA 2MMPA 1JO8A 4M7DD 1HJDA 2QA4T 5GAN2 4EMKC 3FJPA 2NYSA 1T0JA 2DZCA 2EWNA 2R5AA 3BDLA 4WCIA 1E7PA 4BY6C 3G71A 5KYXB 4MFEA 2K5LA 3VS1A 4QVCA 4J9BA 4M7AF 1SRMA 2UUEB 2ZPHB 1VQ5T 2DBKA 4WF2A 4NSTB 2KMGA 4ZTFA 1Z9ZA 2COYA 3A5ZB 2RHYA 1HXDA 2RI3A 2KRSA 2EPDA 1JOWA 2YUQA 4EMKB 1H1PB 4BD3A 2QDYB 4C0DC 1IRXA 4OGRB 2Z0WA 4LDUA 4KT0E 3OBWA 4PJOD 1P92A 2V8IA 5A0GA 2C5NB 2LCLA 2XHCA 1QKXA 2RJEA 2DMOA 4C92C 1RUWA 3J81E 3OYLA 1PD1A 2HBWA 2RHXA 4PJOB 4N4HA 2L3RA 1VQ4Q 2OTJA 1VQ5A 2OI3A 1VYTA 4BCQD 5I21A 3EAEA 2WFYB 3JCMW 1Q86C 2LRQA 2QQAA 2MIOA 4FSXA 1C1AA 3EJ1B 1P5EB 4BCMB 4JRIA 5FWBA 1ZUYA 3LYIA 3QDRB 2HKNA 4LE9A 3M0SA 4HXJA 4Z6YA 2W96A 1IB8A 2A3LA 1NJIC 2GCXA 2LQ8A 3FJ5A 5LJ5h 4PLIA 2EQMA 4ATOA 4M78C 4IUPA 1HD3A 2SEMA 2E5QA 1MV0B 3META 4E6RA 1I07A 1NM7A 2D0NA 1I4K1 4NL3A 4M75B 3A8GB 4E7IA 1VQOA 1VQPQ 4O5VA 4EMKA 2KYBA 1H641 2HKQB 1K4US 3SD4A 3V7SA 1K9MU 1NBEB 3M03A 3ZEHA 3CCMT 2CP5A 2QFZA 4AKGA 2DD5B 2CKKA 4BY6B 3X24B 2J05A 1Y0MA 3RR6A 4JRPA 4A4FA 2IVWA 2CGHA 2IPOB 1X27A 2KR6A 4MIMA 1IZ6A 2K3BA 2D9TA 1UGPB 5GANd 1JB0E 4WTOB 4AKIA 1OZ3A 5CVIA 2COWA 3MHXA 1M3CA 5CKBA 1UGVA 1GH6B 4ELZC 3WXMB 2EKHA 5ECAA 3TREA 5EC7A 3QYBA 5CKHA 2CT4A 2YUNA 3PIOA 4CFMB 2V8JA 1XQHA 3QDFA 3EGXB 3OSVA 5EJCA 2D0QB 2X4JA 2FZCB 4JLGA 1U1TA 5GJWB 4PJOE 5KH6A 4JJDA 2DVEA 3OS5A 4XTYA 5IH2A 1QP2A 1VQKQ 3G4ST 3LLRA 4I3ZB 3K7AM 2H3JA 4HT9A 3QSUA 5GAN3 3CCUQ 1VQ6A 3TEEA 5LJ5j 3ZL7C 2CZ0B 3KXTA 4J9HA 5GAMh 1TOVA 2BE9B 1VQNQ 4UC4A 4M77C 4BE2A 3H0IA 4QT7A 1GXIE 4EOJB 2R57A 1WZOA 3L2VA 4JZ4A 1RAHB 1X2QA 2EW3A 3I55A 4LDXA 4KH1B 1KC8U 2E10A 2COZA 4KBMB 4M78A 3CC2Q 1PSFA 5KYYA 1QVGA 2VB6A 2C5OB 3QG1A 1ZA2B 2GQVA 5GAMd 4F6UB 1TTHB 2J6FA 2RD1A 1N5ZA 2HNIA 3G71Q 3M53A 4M78D 2KT8A 2GGRA 3EHQA 4BE0A 2OAWA 1GUXA 1B07A 1QLBA 4QQGA 4Y92A 3CCET 4NS5A 2I2LA 2K2MA 1KD1U 4CC7A 2LT4A 2F69A 1OX9A 4BCOB 1BK2A 5IN1A 1URCB 3CC4A 5KCOA 1YBYA 2DETA 5D6XA 4MFDA 1N8RR 3M56A 2QAZA 3HRUA 1H28B 1ZSGA 4K11A 4CC4B 4RTTA 2OX7A 2KEAA 3EHRA 4Y28E 3JCMh 5HCKA 1RAIB 3CCJA 5GAN8 4C92B 3BLQB 5GAN5 1BI2A 2G3RA 3LW5E 2PVGB 4M7AC 4IUUA 1E7OA 4OMOA 4IMYB 1M27C 5HNBB 1X6OA 1Q7YR 4BCGB 3HTRA 3CC4T 1EX4A 1YNZA 2JM8A 4HCBA 5M9OA 3L42A 1D09B 1PKDB 3X20B 2AK5A 1KQSA 2YRVA 2LX7A 3CCEA 4ORZA 5LJ3d 5CEIB 1ZUKA 1UNLD 1RLPC 1FXXA 3L1AA 2CUDA 1N8RU 4ELLA 5C0MA 4GLMA 2DIGA 4RTVA 1AOJA 3QBYA 4C92E 4FYYB 3CMAQ 1MNDA 1TUGB 4ME7A 4DOWA 2BE7D 3SWNB 2EGEA 3C94A 3E1SA 1TWBA 5AYFA 5KYXA 2O01E 3VKIA 1NPRA 4HKEA 1RLQC 2BIVA 2LQNA 4OB3B 3G71T 5IHIA 1Q81C 5GAMe 4KGXB 1AZEA 2HL3A 2RO0A 3CCVA 3G4SA 1OZ2A 5FWCA 2QGFB 4M7DF 2X4WA 2XIDA 4HVUA 2FHDA 1VQ8T 3JCMJ 4KRTA 5A0LA 4A4KA 1VINA 2E4HA 3SEMA 3V7CA 2EYZA 3PVLA 5HK3A 5GAOr 2EQKA 2JNGA 1V76A 2LW4A 1WPYA 2XG8D 3MP6A 2XDPA 4EOPB 2A7YA 3PTAA 2YRDA 2WIHB 2DO3A 3PIPA 2D8HA 4CFUB 2P84A 2DKGA 4RUGA 3GBQA 1TH7A 4JJBA 3OW2P 2F5KA 3DTOA 1ZP2A 4Z02A 1NJIU 3M57A 3BG9A 3EG1A 5IAYA 1K8AR 3GPLA 1B34A 2DL7A 5CYIB 3JB9H 4NC6A 2KNBB 4BCNB 3OYFA 2RJFA 3PT9A 3CD6A 2LZ6B 5IXBA 3G1JA 4OGCA 1BIBA 3BHTB 5DLOA 4CFVB 2E70A 5FROA 3P8DA 3OW2A 2R7GA 1Y7XA 4E7KA 4QVZA 4BB7A 2JGZB 2NUPB 2ZZDA 3V8JA 1G3NC 1MV3A 1C6VX 3S3OA 1B7TA 4M77A 2KR3A 3M58A 5D6WA 4M7AE 4N0AC 1KQSP 1PNJA 1Y57A 2DXCB 5KYYB 2ATCB 3PFSA 1JJ2S 2P4RA 4DBFA 2OAUA 2KT1A 2QTVA 1K0XA 3J7AF 4C8QF 1NYFA 1D1BA 5BNJB 1OULA 1GCPA 2K5FA 2EGAA 3H6ZA 1Y07A 2V1QA 3EGDA 3OQ5A 4DA4A 3CC7A 1QLYA 3JAME 4BBSM 1GUXB 1YJ9A 2JTEA 2PJQA 3MEWA 3MKDA 2B9RA 5CR2A 2FEIA 2YSQA 2C5XB 1QCOA 1ZSZC 4OVAA 2WMAB 1S72Q 1I8FA 4FT2A 1H24B 3JCMV 4FCYA 4NOYA 1H92A 2DZ9A 1VQ4T 4C8QB 3G6EQ 1SG5A 3OB9A 1VQLA 3EG9A 2DL8A 4O6JA 3EG9B 1JU5C 1KHCA 4NL2A 4BDZA 1AWOA 2EJ9A 4ESRA 2EKOA 4EORB 4J9DA 3BLHB 2O9VA 1O75A 1S1NA 1W1FA 2LQKA 4EC9B 5LJ3g 1FMWA 4C8QG 2E3IA 4FW2A 5ICPB 3SB2A 3QKJA 4AFZC 1OV3A 2UZEB 4ZTJA 4ZGDB 1Q7YU 1MHNA 2Y4XA 1SHFA 4YC3B 2HD0A 4M77E 5CAIA 2DPPB 4CI0C 5IDNB 1OU9A 1KC8R 4E2FB 4BCPB 1TU0B 2E64A 2MPXC 3EG0A 2QQ8A 1GCQA 2NUTA 3CXCS 2QA4A 1UNGD 1K76A 1ZA1B 2MCNA 2K7AA 1YHQQ 1CSKA 1VIFA 1D1AA 1QWFA 4PJLA 3RNJA 4RTUA 4IIMA 1AD5A 5CCAA 3UA7A 3O8VA 5GAOq 1VQMA 3QYEA 3PO3S 4PJNA 3DLLA 3P8HA 3VS6A 1BI0A 4RCCA 4BI4A 1Q81R 4BXXX 2HBPA 1YHQT 1YITT 2R5MA 1PG5B 4M4ZA 1SEMA 2VGNA 1VQPT 3REBB 5HBJB 3CCRA 2JZ2A 1RAAB 4AKHA 1VQ9Q 1VQKA 2WIPB 3CBPA 3QJYA 3FB9A 5LJ3h 3CPWP 2DERA 3OS1A 7AT1B 1VIEA 3UA6A 2FG0A 4RCBA 1CKAA 3O5ZA 4C5IA 2KBTA 2BPMB 1Z9QA 4ROCA 1UJYA 1VQLQ 2KXCA 3HP9A 4IIOA 3C0CA 8ATCB 4C0DB 1NEBA 3TW6A 1M90C 1O9KA 1S72T 2IW6B 2RI2A 5DLQE 2DJQA 5IDPB 3RIRA 4M7DE 1NLPC 3LX7A 4J9IA 3G6ET 3CPWA 1M4ZA 1U5SA 1YFNA 1IXDA 2M51A 3JCMg 1YJ9Q 3KUFA 2PU9B 1QWEA 3UF4A 3R6OA 4HCZA 3LWIA 4FL6A 4M78E 5CKFA 5KYUB 3QWXX 4LDVA 3PNWC 3OMCA 4XK8E 5AT1B 1VA7A 1GFCA 2P0KA 1OU8A 3CCEQ 2PZ1A 3RERA 2CP3A 1UUEA 1VQMT 2DVJA 4BCKB 4EC8B 3RDVA 4F7LB 1IO6A 3CXCP 1Q86U 2M02A 1AVZC 2Y90A 1ABOA 1UECA 4LUEA 1WYXA 1IHWA 2J7IA 2VXEA 4D8DA 1GCQC 4L6V5 3OYDA 2YWWA 1YWPA 2DL4A 4DEXA 4FSSA 4A63B 1WX6A 3V7RA 3CD6Q 1YJWT 4J9FA 3UT1A 4M75F 1X6BA 2FVUA 3CCJQ 3QJ6A 4M75A 3OYEA 5FU6B 4JX5A 2DM1A 3RKWA 2MYSA 3JB9J 3A1PA 3QO3A 4F7UA 1MMNA 3TCJA 5CQXA 1UGQB 2MI6A 2DXBB 1DJ7B 5GMKm 1TFBA 4E7HA 3CCRQ 2LX9A 4A4EA 2EYWA 4GY5A 4M7AG 2CP7A 1YIJT 3NGPA 4JRKA 1H1QB 4DBHA 1M1KU 2RF0A 2HZYA 1VQ4A 2ENMA 4OMMA 1XNIA 4JJCA 3CCLQ 4FYVB 1G3TA 3G33B 2QA4Q 1MNEA 3MO8A 2C06A 2P4TA 4BY7X 1G3YA 4PKCC 4G6LB 1VQ7T 3CC2A 3CCVQ 1IGUA 2QG9B 3CC7T 3VS3A 3I9QA 1JJ2P 3HO8A 3JV3A 3OYHA 2PTKA 4MDXA 2NUZA 4L59A 1KC8C 3L2UA 4C92A 2E6NA 4RTYA 1VQ9T 4QSHA 1YP5A 1PC0A 4CC3A 5KYWA 5I5ZB 3M4GA 3MPUB 1N8RC 3MP1A 3HZJA 4Z89A 1PRMC 2RI5A 4XU3A 4DBQA 2PK9B 2BZXA 3OS2A 1RAFB 2MWOA 2P0PA 4P5NA 1JJ2A 4CC2A 4YOOA 2AKLA 3JB9F 5J39A 1KJWA 3TNHB 5GMKe 1U8RA 2GBQA 3CMAT 1M2VB 2CDTA 3GTMS 4PFOA 4BBRM 1EZZB 3VV0A 2ROTA 1Q7YC 3DB3A 4A53A 1H27B 2ZPEB 2HAXA 1YIJA 4J7FA 3I35A 2KROA 3VKGA 5IF1B 3OW2S 3UPUA 2QEXT 2CH4W 4BCMD 3VJPA 4FX3B 4X1VA 3VS2A 1K1ZA 1LPLA 3CQTA 1I5LA 4HCCA 1W98B 4MMLA 4X9DA 1X6GA 2JUFA 3LH0A 4OMFB 4F70B 1WFWA 2FPFA 2F5TX 4F7SB 2YRCA 8AT1B 1SPKA 1M90R 1HSQA 1VOMA 4ZN3A 2J6OA 3I5RA 3MCAB 5D6YA 1IHVA 1I81A 1PKSA 3EOCB 3M0PA 5EG2A 2ZGWA 2WXVB 2CP0A 3VYHB 3BY7A 5L23A 2DRKA 2WPAB 3VYGA 3DB4A 4BI8B 4GLKA 3CCST 3UDCA 3LGFA 5GAN7 5KYWB 5GAMg 4EONB 3S3MA 2VKNA 4M77D 4MZTA 3REAB 1YI2T 1M30A 5HY6A 1PWTA 3CCQA 2JVVA 4XU1A 4II1A 4ZN1A 3BE3A 2WSEE 2K6DA 5I2MA 4A4HA 1X01A 5I11A 1UDLA 3QWLA 2GTOA 2XMFA 1KIKA 1OQKA 1X69A 4F04B 1G5VA 3DOGB 3HB9A 3B57A 2EQJA 1RL2A 5I2SA 2KY9A 5DM7R 2KQWA 2D6FA 1QVGS 4BDYA 2DIQA 1VQ5Q 3MP8A 2MF2A 2QI2A 5KE2A 5FRNA 4MZPA 1VQNA 3GP8A 3H4CA 1GY3B 2RHIA 4Z88A 1OL2B 1WQWA 2DNUA 1FMKA 2FO0A 1C0MA 4LDYA 1KK7A 3VRZA 2CJMB 2DE0X 3HPWA 4J6XA 4EOLB 2NUPA 4AG2C 2DFUA 2QF7A 3G4SQ 2KI7A 2EJFA 4LD6A 2QEXQ 4EOOB 5GAOl 2L89A 1FWZA 1BU2A 4TTHA 2QTXA 4M75C 2ED1A 1R0CB 2EUFA 2W99A 1QMZB 1SF9A 4KULA 2MK5A 4PNOA 5GANj 1YJNA 1BB9A 3QYGB 1ABQA 1PRLC 3MY5B 4HCKA 3QHWB 5IHYA 2M0OA 3C12A 3OYYA 4F6SB 1XJWB 2HDAA 5HKCA 4M7DG 4C92D 3C4SA 1WJRA 2RA2A 1NG2A 4IUVA 3OS0A 3TSZA 1QVGP 1WJQA 3JSCA 4FIBA 3ASKA 1QKWA 5GMKl 1UNHD 5LJ5d 4CFWB 4ELJA 1PKTA 2E1HA 2DYIA 3FDRA 4M78G 1E6HA 3MIAB 2RQUA 3JCMQ 1W70A 3POMA 2OTLT 2PUOB 3RBBB 3QZ9B 1PM3A 4AG1C 4ZGJB 2X35A 4EMGA 5LJ5e 4FT4A 1NZ9A 2G77A 1WHMA 2LQWA 4PJOG 1G83A 3FEOA 4HNVA 2DL3A 3MY1B 4BCIB 1H1SB 3TVTA 4PK4A 2RPNA 3KBGA 1FMVA 4FYXB 3VYGB 2MWPA 3ZFJA 1PCXA 3PMIA 1E6GA 3HBLA 4CRLB 4A54A 4D8KA 2LJ1A 5LJ3j 4RTXA 4YOSA 3X25B 2X1NB 5GMKh 1N9SA 4CFUD 1K9MC 1BKBA 3NDQA 2W9FA 3BFMA 5CQYA 2CP6A 3OYBA 2CSIA 3CC4Q 1AD6A 3MEVA 1D0YA 1OI9B 4JZ3A 4OMLA 1SHGA 5A0DA 2CCHB 2E5KA 4EDUA 3H0HA 2L2PA 1MMAA 1KSWA 1UE9A 3OA6A 2RJCA 2K79A 4KH0B 2VV5A 3I5SA 5CKDA 4PFZA 1KHIA 1U3OA 2IG0A 3WVDB 1QQJA 1M8VA 3SWNA 3J80E 5GANf 4LNPA 4TVRA 5HBEB 5J3BA 2O4XA 2C4GB 1T3LA 3VS4A 2X4YA 1GBRA 4MZMA 3A98A 1PHTA 1T3SA 4HT8A 2PNIA 1UHFA 4M7DC 2H8HA 1NE8A 1WA7A 3NTKA 1VQ8Q 3G7ZA 1TD6A 2QEXA 4FU6A 1BBZA 3VS5A 4PJJA 3QXEB 1UG1A 3Q1JA 4XTWA 3JCMP 4M78F 3JB9I 2DJZA 2DK3A 2OTLQ 3F70A 3TNIB 4C8QC 3CEYA 1ACMB 2C6TB 2DEUA 4PJOF 1Q95G 2LJ0A 2R58A 4E7SA 3CCUA 3JCMe 1D1CA 2XDDA 2WSCE 4C92G 3GOXA 2RQWA 2NLUA 3BDUA 4AFSC 4N4IA 2NWMA 3CCRT 3H8ZA 1B3QA 2HQXA 2LT1A 4LD9K 5GAMj 4F7JB 2FZGB 2EGCA 4M75E 3HFOA 2YDLA 3M0RA 4BY1X 1YI2A 2DBMA 2ABLA 2CUBA 1F1BB 2GFAA 4JLIA 2CP2A 2A37A 3LWHA 3MI9B 1M8MA 1XOVA 3ULRB 2M16A 4BCQB 4J83A 1KD1C 4J5YA 4ZNXA 4AI6A 4C0GA 1F5QB 4M6VA 1WHHA 5KE3A 4EMHA 3BLRB 2LCSA 5IT9E 3OYJA 5D7UA 3LQ5B 1V29B 2PUKB 1TXQA 3PVQA 4R55A 2D8JA 4XAXB 2RQVA 4DOVA 4PJOA 1JBMA 1M1FA 3I56Q 2LTOA 1YJNT 4MDWA 1LVKA 4OGEA 1QVFP 1WLPB 3BHVB 1WDXA 3E19A 1Y96A 3EG3A 1YIJQ 2MAMA 3CBMA 3DL1A 1OI1A 2QQSA 1WHJA 4Z8AA 2JMCA 2HQEA 4N4GA 4XU0A 5I22A 3TU4K 2LMJA 2V1RA 4ROEA 3T9NA 1ZBXA 4KRDB 1BI1A 2HMAA 5GANg 3N5BB 3M54A 4OB1B 1LCKA 1QCNA 1JEGA 4JX6A 3C95A 1KG1A 1RI0A 3VKHA 1W2BS 1H3ZA 5LJ3e 3VU3C 3OY9A 1VQ6T 3QUIA 3CMET 1W4SA 4C8QA 1IGQA 2RN8A 3EFRA 3EFSA 5L8RE 2JJ9A 3EGXA 3MEAA 2VWFA 4LOCA 2BTTA 4EOQB 1TSFA 2EYQA 3DKMA 2XKOC 3OBYA 2QGGA 2CREA 2QQ9A 3E9GA 3DDPB 1K9MR 1WJSA 3DJBA 3UATA 2O2OA 4DBRA 2DTHA 2WSFE 5DQWA 1X75C 4AT1B 4HLQA 3JCMb 5IXFA 2EQUA 4HNUA 3HRTA 5LMKB 2DD4A 1MMDA 1M2OA 2PVDB 3OYGA 4CXAB 4IKFA 2JTFA 1VQ7A 2AT1B 2ZZDB 3CMEA 3O0GD 1LJOA 2K4YA 2F2CA 3E9FA 1YN8A 3HKSA 1J3TA 4C0FA 4F17A 4PLLA 2I40B 2JOYA 4B9XA 2BZYA 2XICA 2M0YA 4C92F 1N6AA 3CCMA 1MMGA 2B86A 3LH5A 2EYYA 1M2VA 4XTXA 2IW8B 3S6WA 1TUDA 3DLMA 2QQRA 1AHJB 2WJ9A 1U06A 2GTJA 1BYMA 3CCQQ 2BS2A 2RHUA 1K8AU 1WHGA 2C0OA 2H3EB 4RODA 2EAYA 3VS7A 1M1KR 1IREB 2ZCFB 1NEGA 4ELYC 4BI3A 2O9SA 4RTWA 2KGTA 4FYWB 4C0ZA 2L5QA 3QIIA 2W2HA 1JXMA 1UTIA 3M0UA 4PFPA 2WEVB 2PVOB 2PK2A 4MMKA 1OYXA 4C5EA 1ZHIA 5CK9A 3M5AA 3M4YA 1AWJA 1YITQ 4YTLA
chains in the Genus database with same CATH topology
5D6YA 1I81A 2M9UA 1KQ1A 5LJ5f 1Q81C 2DEQA 2RJDA 5GAMe 3GLXA 1YCYA 5EG2A 2ZGWA 2RO0A 4DQ2A 3CCVA 1VQ8A 3G4SA 1OZ2A 3VYHB 3BY7A 4BE1A 3L2RA 4M7DF 2X4WA 2XIDA 4IUQA 4XU2A 5LL6S 3QPHA 5A2QE 1NPPA 2CZ1B 2FHDA 3VYGA 3DB4A 1WQ7A 2DD5A 2LNVA 4GLKA 4BI8B 4HNTA 2E41A 3UDCA 5A0LA 3CCST 3LGFA 1YJ9T 1Q82U 4C5HA 5GAN7 2JN0A 3CPWS 4A4KA 3CCLT 2XI9A 3FRNA 5GAMg 4M7AD 3V7CA 5HK3A 3BW1A 3S3MA 5GAOr 5HK0A 4XTVA 2EQKA 2JNGA 4M77D 4MZTA 3L2QA 3JCMf 1YI2T 5HY6A 4OB0B 2K3YA 1K8AC 4LDWA 1WPYA 3OYAA 3CCQA 2ZPGB 2JVVA 3GNFB 4XU1A 2Y4YA 2XG8D 3MP6A 4II1A 2RM4A 2XDPA 2E12A 3OYKA 1UGSB 3FLGA 4M7DE 3V8LA 5GANe 2A7YA 3PTAA 1Q82C 1KQSS 4ZN1A 2DO3A 3PIPA 2WSEE 4ZGEB 5I2MA 4A4HA 2RHZA 2KMTA 5GAOm 3KHIA 1X01A 2LC4A 3HL8A 1MGQA 2CS7A 2DKGA 1TH7A 3QWLA 5GAOp 2F5KA 4JS4A 4XQ3A 4QVDA 4Z02A 1M1GA 1NJIU 3A8MB 3CPFA 3M57A 3BG9A 4M77F 3UWNA 5IAYA 1K73C 3JCMd 5FU6C 3AHUA 1G5VA 3HB9A 3JRZA 2EQJA 5LJ5g 4J8OA 1RL2A 1B34A 2KY9A 5I2SA 2KQWA 5DM7R 3OMGA 3QHSA 2DXTA 4JUVA 4F7UG 1QVGS 1VQNT 3CD6T 3JB9H 2XU8A 4BDYA 1D3BB 2BUDA 2DIQA 4KUIA 4NC6A 3RMSA 1D3BA 3MP8A 2MF2A 2QI2A 3OYFA 2RJFA 3PT9A 5KE2A 3CD6A 5FRNA 4MZPA 4QQ6A 3GP8A 1VQNA 3H4CA 3RKXA 2E65A 4OGCA 4PJOC 1BIBA 2K2VA 2RHIA 4EPCA 3M55A 5DLOA 2E70A 1N9RA 2DXUA 3FC3A 2GFUA 2RH2A 5FROA 1WQWA 3ER0A 3P8DA 3OW2A 1Y7XA 3VUBA 2DD4B 1M90U 4E7KA 4LDYA 4QVZA 2KK4A 4BB7A 3TW7A 3HPWA 1K73U 4J6XA 4OF1A 1U1SA 2ZZDA 5GAOn 2QF7A 3V8JA 2DTIA 4Q5WA 4X9CA 4M77B 1SSFA 3S3OA 2VGMA 4M77A 1VQPA 2EJFA 4LD6A 3GNGA 3CCQT 3M58A 2L89A 1FWZA 5D6WA 5GAOl 1QVPA 4N0AC 4M7DA 4M7AE 1Y96B 2QQBA 3ZBDA 1W2BA 2QTXA 2DXCB 4M75C 1VQ9A 5DY9A 2DXBA 4M78B 2DXCA 4R56A 3PFSA 4KULA 4PNOA 1YJNA 3I56T 5GANj 1JJ2S 3BG3A 2OAUA 2GF7A 3J7AF 2RB6A 3QYGB 1XTDA 4OB2B 2VC8A 4C8QF 4J6WA 3PMTA 3CBOA 2M0OA 3C12A 2K5FA 2VUBA 3H6ZA 3M59A 3CCLA 3OYYA 1G3WA 1Y07A 3OQ5A 3P8BB 1VQ8T 4DA4A 5HKCA 1KQ2A 5CKEA 4M7DG 4C92D 3C4SA 1WJRA 2RA2A 4IUVA 1LNXA 4RG8A 3JAME 3CC7A 2MMPA 4BBSM 4M7DD 1VUBA 2QA4T 5GAN2 3OS0A 3CCSA 4VUBA 1YJ9A 1QVFA 4EMKC 1WJQA 3FJPA 3MEWA 1QP3A 2KDSA 5CR2A 3JSCA 4FIBA 3ASKA 5GMKl 4BACA 5LJ5d 2DZCA 2EWNA 2R5AA 4ELJA 4OVAA 2CZ7B 2LDMA 2E1HA 5FU7C 3BDLA 4E7LA 3RUXA 3FDRA 1E7PA 4M78G 1I8FA 4FT2A 4BY6C 3JCMV 3G71A 1JRIA 4MFEA 3A8LB 2B8AA 2K5LA 4NOYA 4QVCA 4A4GA 2DZ9A 1VQ4T 3JCMQ 4M7AF 4C8QB 2ZPHB 1VQ5T 4WF2A 2OTLT 3OB9A 2PUOB 1VQLA 3QZ9B 2KMGA 4ZTFA 3INZA 3A5ZB 4O6JA 3RESA 4ZGJB 1KHCA 2RHYA 2QDJA 2X35A 4NL2A 3RKYA 4EMGA 4BDZA 2OTJT 1HXDA 2RI3A 5LJ5e 2EJ9A 4EMKB 4FT4A 2LCCA 4BD3A 2EKOA 2QDYB 1NZ9A 4C0DC 3OYNA 4F7UB 2G77A 4PJOG 3FEOA 4HNVA 1O75A 4LDUA 3VUZA 4KT0E 3OBWA 2RK1A 4PJOD 1P92A 2XK0A 2V8IA 2LQKA 3KBGA 5A0GA 3VYGB 5LJ3g 2MWPA 2LCLA 3ZFJA 3G6EA 4XTZA 2XHCA 3PMIA 4C8QG 2RJEA 4C92C 3HBLA 3SB2A 3QKJA 4A54A 3J81E 4M7AB 3OYLA 4ZTJA 3JCMJ 4ZGDB 1Q7YU 1MHNA 2RHXA 2Y4XA 4PJOB 5LJ3j 4N4HA 2L3RA 2OTJA 1VQ5A 2HD0A 4M77E 5CAIA 2DPPB 5I21A 3X25B 1VQLT 3EAEA 4CI0C 3JCMW 1Q86C 2YLBA 5GMKh 1N9SA 3CMAA 2LRQA 2DTOA 1BKBA 1K9MC 2QQAA 4FSXA 3A8HB 5LJ3f 2RK2A 1M1KC 3BFMA 2D6FA 4F7UF 4JRIA 2KAFA 2E64A 3LYIA 5CQYA 2WACA 3M9QA 2ZPFB 3QDRB 3OYBA 2QQ8A 1VQKT 5GAN4 3CXCS 3MEVA 2QA4A 2K3XA 1QW1A 4Z6YA 5A0DA 1VIFA 4EDUA 3OA6A 4X34A 2A3LA 5CCAA 2RJCA 1NJIC 2VV5A 5CKDA 2GCXA 2LQ8A 3O8VA 5GAOq 1KHIA 3QYEA 4PLIA 5LJ5h 2EQMA 3P8HA 3DLLA 1VQMA 1BI0A 4RCCA 4BI4A 4ATOA 2IG0A 3WVDB 4M78C 1BIAA 1M8VA 3A8OB 4IUPA 3SWNA 4E47A 5GANf 4TVRA 3J80E 2HBPA 2YLCA 3I56A 1YHQT 1YITT 2R5MA 4QQDA 2E5QA 5J3BA 2O4XA 2VGNA 1VQPT 3META 3X26B 3CC2T 4FM4B 2X4YA 5GAN6 3NFCA 4MZMA 5FU7B 5C6SA 3CCRA 1I4K1 2JZ2A 3MEUA 4HT8A 4NL3A 4AKHA 5GANh 1VQKA 4M7DC 1NE8A 3CBPA 3QJYA 2AHJB 3FB9A 2EIFA 3NTKA 3G7ZA 4M75B 3A8GB 5LJ3h 3JCMX 4E7IA 2QEXA 4FU6A 3OS1A 1VQOA 3S3NA 1VIEA 4O5VA 4C8QE 4RCBA 4EMKA 4C5IA 1H641 3SD4A 2FL7A 3V7SA 1K9MU 4F7UE 3QXEB 3JB9G 3ZEHA 4HL4A 3Q1JA 4XTWA 3JCMP 3CCMT 2QFZA 3HP9A 4M78F 3JB9I 4AKGA 2DJZA 2DD5B 3NTHA 3JCMc 2CKKA 2DK3A 3F70A 4C0DB 4C8QC 4BY6B 3X24B 2VXFA 3CEYA 4JRPA 3TW6A 1M90C 1S72T 4A4FA 2IVWA 2CGHA 2FB7A 2RI2A 5DLQE 2R58A 4PJOF 3CCUA 3RIRA 3JCMe 2KR6A 4M7AA 2XDDA 3OYMA 2BS4A 4MIMA 2X4XA 3LX7A 4E7JA 2WSCE 4C92G 3G6ET 3CPWA 1M4ZA 4C5GA 3GOXA 1IZ6A 2NLUA 3BDUA 3GF5A 1M5Q1 4JDSA 4N4IA 2D9TA 5KCHA 3CCRT 3H8ZA 2K5IA 1UGPB 2HQXA 2LT1A 3JCMg 5GANd 1JB0E 5GAMj 4LD9K 3KUFA 2BKDN 2PU9B 3V8KA 4AKIA 1OZ3A 5CVIA 3MHXA 3R6OA 4HCZA 4M75E 5CKBA 3LWIA 4FL6A 4ELZC 2KSSA 2E6ZA 4M78E 5CKFA 3WXMB 1YHQA 3TREA 1QVFS 3HFOA 3QYBA 4LDVA 1YJWA 5FRMA 3PNWC 5CKHA 3OMCA 3CCJT 4XK8E 3PIOA 2V8JA 1YI2A 1XQHA 5FLXE 3OYIA 2P0KA 3OSVA 3HHTB 2GFAA 4JLIA 3QYHB 3RERA 5EJCA 3LWHA 1VQMT 3X28B 2D0QB 2M1HA 2XD0A 1XOVA 2M16A 3HFNA 1Q86U 2X4JA 1B34B 1U1TA 1R8OB 4J83A 4JLGA 4PJOE 2Y90A 3PGGA 4J5YA 1KD1C 5KH6A 2DVEA 4AI6A 3OS5A 4IURA 4XTYA 1QP2A 4C0GA 1UGRB 2ZPBB 3LLRA 2H3JA 4M6VA 3G4ST 4HT9A 3QSUA 5GAN3 1VQ6A 5KE3A 3TEEA 4EMHA 5LJ5j 3FIFA 5IT9E 3OYJA 2VXEA 2CZ0B 4PL6A 2CZ6B 1Y71A 4J7IA 4L6V5 3OYDA 3KXTA 1V29B 2PUKB 5GMKi 5GAMh 4R55A 4HA8A 4XAXB 2JTMA 4UC4A 4DOVA 2DAQA 4M77C 3V7RA 4PJOA 1JBMA 1YJWT 1M1FA 4BE2A 3UT1A 4M75F 2FVUA 1GXIE 2LTOA 3QJ6A 1YJNT 4RMOA 2R57A 3CXCA 4M75A 3L2VA 3OYEA 5FU6B 5CIUA 2EFIA 4JX5A 4MDWA 3I55A 3URGA 1FKMA 4LDXA 4OGEA 3RKWA 4B9WA 3JB9J 1KC8U 2E10A 4M7DB 3E19A 4KBMB 1Y96A 4M78A 3QO3A 4F7UA 5GMKj 3TCJA 3SFMA 2MAMA 5CQXA 1UGQB 1PSFA 2DXBB 3DL1A 1DJ7B 1OI1A 2MI6A 3CBMA 2QQSA 4E7HA 2LX9A 4RG2A 2L8DA 1QVGA 3QG1A 4CRIA 4N0AA 1FX7A 2GQVA 4RKUE 4A4EA 5GAMd 2HQEA 4N4GA 3CCUT 4XU0A 3GPLA 2LVMA 3TU4K 4GY5A 2RD1A 3T9NA 2HNIA 2KVQG 1S72A 3M53A 4M75D 1ZBXA 4M7AG 4IUTA 4M78D 1BI1A 4M75G 5GANg 4BE0A 3N5BB 3GIBA 3M54A 1YIJT 4JRKA 2FYKA 3SWNC 1QLBA 4OB1B 4M77G 4JX6A 3C95A 1KG1A 4QQGA 4Y91A 4JX4A 1M1KU 3CCET 1RI0A 1G3SA 1PSEA 3VKHA 4NS5A 5GMKm 2I2LA 1VQ4A 1KD1U 1W2BS 1XNIA 2LT4A 2F69A 5LJ3e 3VU3C 1H3ZA 2BS3A 2EJGA 3OY9A 5IN1A 5GAMf 1VQ6T 1G3TA 3OSSC 3QUIA 3CMET 1W4SA 4C8QA 3MO8A 5KCOA 3HRSA 3CC4A 1BI3A 1YBYA 2C06A 2P4TA 3EFRA 1G3YA 1N27A 3WVEB 4MFDA 3EFSA 4PKCC 1HK9A 5D6XA 5L8RE 1VQ7T 3M56A 3CC2A 3MEAA 3HRUA 4JJNK 4LOCA 4C8QD 1ZQ1A 2EYQA 3DKMA 2XKOC 4XTUA 3OBYA 3ME9A 4Y28E 3JCMh 3CC7T 2K57A 2P0QA 2QQ9A 3E9GA 3HO8A 3BG5A 1WJSA 3OYHA 1YITA 4MDXA 3CCJA 2CYZB 4L59A 1KC8C 3L2UA 5GAN8 2DTHA 2WSFE 4C92A 2E6NA 3JB9D 1X75C 4C92B 5GAN5 1BI2A 4HLQA 2G3RA 2VYTA 2PVGB 3LW5E 3JCMb 2EQUA 4IUUA 4QSHA 1VQ9T 1UB4A 4M7AC 2V8KA 2ZPIB 1UEBA 3M4GA 4HNUA 1N8RC 3HRTA 3HZJA 3MP1A 2DD4A 3OYCA 2RI5A 1X6OA 2PVDB 4J6YA 4XU3A 3OYGA 3OS2A 4IKFA 2JTFA 1VQ7A 2ZZDB 3CMEA 3CC4T 4QW2A 1LJOA 2K4YA 2MWOA 2P0PA 3E9FA 4P5NA 5M9OA 1JJ2A 4HCBA 3CCVT 3L42A 2XDBA 3HKSA 3JB9F 3X20B 5J39A 4C0FA 1KQSA 4PLLA 3RMQA 2YRVA 4OP0A 5GMKe 1WNLA 1U8RA 3CCEA 5LJ3d 2QXFA 2JOYA 4B9XA 2XICA 4C92F 3CMAT 1N6AA 3CCMA 4BUGA 1LOJA 4XTXA 1FXXA 4BBRM 3S6WA 3DLMA 3L1AA 3VV0A 1Q7YC 3QZ5B 1AHJB 2QQRA 3DB3A 4A53A 2ZPEB 1M9SA 2WJ9A 5C0MA 1N8RU 2HAXA 5CO7A 4J7FA 1YIJA 2DIGA 3QBYA 3VKGA 3OW2S 3UPUA 4L5GA 2QEXT 1VQOT 1BYMA 2BS2A 2RHUA 5J26A 3VJPA 1K8AU 4C92E 3L2ZA 2EAYA 1IREB 2ZCFB 3L2WA 2YHTA 1EIFA 4ELYC 4BI3A 1I5LA 1WGSA 4ME7A 1Q81U 4DOWA 4HCCA 4YTLA 4C0ZA 4MMLA 4X9DA 3SWNB 1O9SA 2JUFA 2L5QA 2PQWA 3C94A 3LH0A 3E1SA 3SDZA 4JS5A 2O4XB 4OMFB 3QIIA 3I55T 4KUDK 5AYFA 2O01E 2F5TX 3VKIA 1NPRA 4HKEA 2OTLA 2PVOB 4MMKA 4V2SA 1OYXA 2BIVA 4C5EA 1ZHIA 4ZN3A 4OB3B 5CK9A 3M5AA 4D6WA 3M4YA 3NTIA 3G71T 3LGLA 3HSBA 4JRQA 3MCAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8G B;  4OB1 B;  1QP3 A;  1PSE A;  3VYH B;  3QXE B;  2CZ7 B;  2CZ1 B;  2DD5 B;  3VYG A;  2DD5 A;  3A8L B;  3X24 B;  2ZPH B;  5L8R E;  3WVE B;  2PUO B;  3QZ9 B;  2WSC E;  4ZGJ B;  4Y28 E;  1UGP B;  4OB0 B;  1JB0 E;  2QDY B;  2PU9 B;  2ZPG B;  2CYZ B;  4KT0 E;  2WSF E;  1UGS B;  3LW5 E;  3VYG B;  2PVG B;  2WSE E;  4ZGE B;  2ZPI B;  4XK8 E;  2DD4 A;  4ZGD B;  3HHT B;  2PVD B;  3QYH B;  3A8M B;  3X28 B;  2D0Q B;  2DPP B;  3X25 B;  2ZZD B;  3A8H B;  3X20 B;  1QP2 A;  1UGR B;  2ZPB B;  2ZPF B;  2CZ0 B;  2CZ6 B;  4L6V 5;  1V29 B;  2PUK B;  2DD4 B;  3QZ5 B;  1AHJ B;  2ZPE B;  1GXI E;  2ZZD A;  1IRE B;  2ZCF B;  3WVD B;  3A8O B;  2DXC B;  2DXB A;  2DXC A;  1UGQ B;  1PSF A;  2DXB B;  1DJ7 B;  3X26 B;  2O01 E;  3QYG B;  4FM4 B;  4OB2 B;  4RKU E;  2PVO B;  4OB3 B;  2AHJ B; 
#chains in the Genus database with same CATH topology
 1R0B G;  1NYG A;  2DEQ A;  1YCY A;  1KXU A;  3L2R A;  1ZLM A;  4XU2 A;  1OPL A;  2PMI B;  1NPP A;  4KGZ B;  2DF6 A;  1WQ7 A;  2LNV A;  1Q82 U;  4HNT A;  1N4M A;  4LN2 A;  4C5H A;  2SRC A;  1UFF A;  3NPF A;  3CCL T;  1O9K B;  2GNC A;  2XI9 A;  3NMZ C;  2QYZ A;  3E2U A;  3BW1 A;  5HK0 A;  1H25 B;  4AFU C;  5L2W B;  3RGF B;  1TUC A;  3L2Q A;  4OB0 B;  2K3Y A;  4LDW A;  2ZPG B;  3GNF B;  3CC7 Q;  2Y4Y A;  1KD1 R;  2JM9 A;  1UGS B;  5GAN e;  2DME A;  1Q82 C;  2C5V B;  4BCH B;  2ED0 A;  2RHZ A;  2KMT A;  1WXB A;  2HQH A;  4DEY A;  1JST B;  2LC4 A;  4CFX B;  1MGQ A;  2CS7 A;  5GAO p;  4GBQ A;  4JS4 A;  4QVD A;  1M1G A;  4QKU A;  3A8M B;  2A08 A;  3JCM d;  5FU6 C;  1UHC A;  3JRZ A;  5HBH B;  4J8O A;  1VQN T;  2HSE B;  2AIR B;  1M3B A;  3OMG A;  3CD6 T;  1H4L D;  2XU8 A;  1D3B A;  1HYO A;  3M0T A;  1G2B A;  4Y72 B;  1RAC B;  3RKX A;  2EQI A;  3M0Q A;  2RH2 A;  3ER0 A;  2VAS A;  2DD4 B;  2YT6 A;  4F6W B;  2KK4 A;  2QDL A;  3TW7 A;  1JQQ A;  2CH4 A;  4OF1 A;  2O31 A;  2YUO A;  2DLP A;  5GAO n;  2DTI A;  1G8X A;  4X9C A;  3F5X B;  1SSF A;  2WMB B;  2VGM A;  1VQM Q;  3CCQ T;  4M7D A;  1H26 B;  1QVP A;  2J6K A;  2QQB A;  1VQ9 A;  3EFO A;  5DY9 A;  4M78 B;  1JKW A;  1D0Z A;  4R56 A;  2L3P A;  2LJ3 A;  3BG3 A;  2RB6 A;  4OB2 B;  2VC8 A;  2FRW A;  3M59 A;  3CCL A;  1G3W A;  3P8B B;  5CKE A;  2JS0 A;  3EID B;  2ESW A;  1FYN A;  1VUB A;  4LUD A;  3CCS A;  4VUB A;  1QVF A;  1QP3 A;  2KDS A;  2F2V A;  1WXU A;  4BAC A;  2CZ7 B;  2LDM A;  5FU7 C;  4E7L A;  3RUX A;  3R6N A;  1FIN B;  1JRI A;  4ANJ A;  5KYU A;  3A8L B;  2B8A A;  4A4G A;  1D3U B;  3INZ A;  3RES A;  2ECZ A;  2LP5 A;  3RKY A;  1VYV A;  5KYN A;  2QDJ A;  2OTJ T;  2JT4 A;  1Q86 R;  2LCC A;  1ZX6 A;  1K0S A;  3OYN A;  3VUZ A;  4PJM A;  2A28 A;  2RK1 A;  2XK0 A;  1GRI A;  1ENW A;  3TN8 B;  3G6E A;  4XTZ A;  2IW9 B;  2RNA A;  2UZD B;  1OPK A;  4M7A B;  1OKW B;  1RAB B;  4JPB W;  1VQL T;  2YLB A;  1D0X A;  3CMA A;  2DTO A;  3A8H B;  1M3A A;  2RK2 A;  5LJ3 f;  1M1K C;  4F7U F;  2FPD A;  2JS2 A;  2KAF A;  2WAC A;  4HVW A;  3M9Q A;  2ZPF B;  1H8K A;  1VQK T;  2AZS A;  5GAN 4;  2DX1 A;  2NUT B;  2K3X A;  3H9N A;  1QW1 A;  5ACB A;  1V1C A;  2AZV A;  2I0N A;  2QK0 A;  4X34 A;  1AIS B;  2K9G A;  2I53 A;  1OKV B;  4EOM B;  2OJ2 A;  2CT3 A;  1OIU B;  1AWX A;  1BIA A;  3A8O B;  4E47 A;  6AT1 B;  3I56 A;  1VOL A;  2YLC A;  1CKB A;  4QQD A;  4J9G A;  3X26 B;  3CC2 T;  1RAE B;  4FM4 B;  5GAN 6;  1ZBJ A;  3TQ7 P;  3EG2 A;  3NFC A;  2VVK A;  2GQI A;  3D7S B;  5FU7 B;  5C6S A;  1AEY A;  3MEU A;  5GAN h;  2AHJ B;  2EIF A;  3JCM X;  2HSP A;  1YWO A;  3U23 A;  3S3N A;  4CFN B;  2EBP A;  4C8Q E;  5EFQ B;  2FL7 A;  1I5O B;  4F7U E;  1ZSZ A;  1GFD A;  3JB9 G;  4HL4 A;  3JCM c;  3NTH A;  1YI2 Q;  1Q82 R;  2VXF A;  4UN0 A;  1OX8 A;  3THK A;  2FB7 A;  3IQL A;  2HEQ A;  4M7A A;  3OYM A;  4E7Z A;  2BS4 A;  2X4X A;  4E7J A;  4C5G A;  3GF5 A;  1WXT A;  1M5Q 1;  4JDS A;  5KCH A;  2K5I A;  5GJV B;  1VYU A;  2DL5 A;  3CCS Q;  2BKD N;  3V8K A;  2KSS A;  2E6Z A;  1YHQ A;  1OEB A;  2F2X A;  1QVF S;  1YJW Q;  2V22 B;  1YJW A;  5FRM A;  2YUP A;  3CCM Q;  3CCJ T;  5FLX E;  3OYI A;  4F7N B;  3HHT B;  2W0Z A;  3QYH B;  1FVV B;  3X28 B;  4BCF B;  4OMQ A;  4LXC A;  2M1H A;  2XD0 A;  4EOK B;  1ARK A;  3HFN A;  2DYB A;  1OL1 B;  2HL5 C;  1B34 B;  2ZAE A;  1R8O B;  3CME Q;  3PGG A;  3VRY A;  4IUR A;  1UGR B;  2ZPB B;  2X9H A;  5HQ0 B;  3FIF A;  4RTZ A;  4PL6 A;  2CZ6 B;  1Y71 A;  4J7I A;  4FW1 A;  1JSU B;  5GMK i;  4HA8 A;  2JTM A;  2ROL A;  2DAQ A;  4R0K A;  3SHW A;  2C0T A;  2LNH B;  1K73 R;  2CSQ A;  2X3X D;  2QGS A;  1X43 A;  4RMO A;  3CXC A;  1QCF A;  5CIU A;  2EFI A;  2JXB A;  5LQF B;  3URG A;  1FKM A;  2MOX A;  3MJX A;  4B9W A;  2W9Z A;  2EVR A;  4M7D B;  2UZL B;  2F2W A;  5GMK j;  3SFM A;  4F7U B;  1W2B A;  9ATC B;  3VS0 A;  4RG2 A;  2L8D A;  4CRI A;  4N0A A;  1A0N B;  1FX7 A;  1PD0 A;  4RKU E;  3CCU T;  2LVM A;  4KGV B;  2KVQ G;  1S72 A;  4M75 D;  1T0H A;  2KRN A;  4IUT A;  1KFZ A;  4M75 G;  3GIB A;  1RAD B;  2FYK A;  3SWN C;  1UJ0 A;  4M77 G;  4Y91 A;  4JX4 A;  5FGK B;  1G3S A;  1PSE A;  4KRC B;  5FW9 A;  2UZB B;  2BS3 A;  2EJG A;  4HVV A;  4F14 A;  5GAM f;  3OSS C;  5IHK A;  3HRS A;  1BI3 A;  1NLO C;  1N27 A;  3WVE B;  1HK9 A;  4BCJ B;  4JJN K;  4C8Q D;  3EH2 A;  1ZQ1 A;  4J9E A;  4XTU A;  3ME9 A;  2K57 A;  1TS9 A;  2P0Q A;  2AKK A;  1GBQ A;  3BG5 A;  1YIT A;  2CYZ B;  1OOT A;  3JB9 D;  2EYX A;  1BCO A;  2O88 A;  2VYT A;  2FZK B;  1UB4 A;  3AT1 B;  2V8K A;  1AZG B;  2KXD A;  5HVY B;  2ZPI B;  2YXY A;  1UEB A;  4EOS B;  2PHG A;  3OYC A;  3TSW A;  4J6Y A;  4AFQ C;  4F16 A;  1XO2 A;  2JW4 A;  3NHN A;  4QW2 A;  3CCV T;  2XDB A;  4B6M A;  2A36 A;  1WHK A;  1BCM A;  1W6X A;  3RMQ A;  4OP0 A;  1WNL A;  2BKZ B;  2QXF A;  2KE9 A;  4BUG A;  1LOJ A;  1R77 A;  1YJN Q;  3QZ5 B;  2F1L A;  3QHR B;  1M9S A;  5CO7 A;  1OIY B;  4L5G A;  1VQO T;  2G6F X;  4II5 B;  2IVX A;  5J26 A;  1WHL A;  3L2Z A;  1X2K A;  2IN3 A;  3L2W A;  2YHT A;  1E9H B;  1EIF A;  4OMN A;  1MUZ A;  1WGS A;  1Q81 U;  1VQ7 Q;  4BCN D;  2OTJ Q;  1O9S A;  2PQW A;  3SDZ A;  4JS5 A;  2O4X B;  3I55 T;  4KUD K;  1H3H A;  2OTL A;  1YCS B;  4V2S A;  3KFV A;  1JXO A;  4D6W A;  2DIL A;  1NJI R;  3NTI A;  2QAS A;  3LGL A;  3HSB A;  4JRQ A;  2M9U A;  1OGU B;  1KQ1 A;  3I55 Q;  2L3Q A;  4J9C A;  5LJ5 f;  2RJD A;  2WHB B;  3GLX A;  2RMO A;  4DQ2 A;  1BU1 A;  1VQ8 A;  1ZUU A;  4BE1 A;  4IUQ A;  1ZSZ B;  5LL6 S;  1C9B A;  3QPH A;  5A2Q E;  2CZ1 B;  2KRM A;  2L3S A;  1EFN A;  2IIM A;  2DD5 A;  1YJ9 T;  2E41 A;  1GL5 A;  3CPW S;  2JN0 A;  3DDQ B;  3EGD B;  1VQ6 Q;  3FRN A;  4M7A D;  2DRM A;  1AWW A;  2RQR A;  4OR5 B;  1I1J A;  4XTV A;  4YOZ A;  3H41 A;  3JCM f;  1K8A C;  1AT1 B;  3OYA A;  2JMA A;  2RM4 A;  2E12 A;  3OYK A;  3FLG A;  2A0F B;  3V8L A;  2V26 A;  2BZ8 A;  5IHN A;  1KQS S;  4ZGE B;  2DA9 A;  5GAO m;  3KHI A;  3HL8 A;  2X51 A;  3EH1 A;  2C0I A;  2HCK A;  4XQ3 A;  4AMC A;  1W2B P;  1SSH A;  3CPF A;  2W10 A;  4M77 F;  3UWN A;  1K73 C;  2KYM A;  3H0F A;  3AHU A;  4EIK A;  5LJ5 g;  2RQT A;  4F7U G;  3QHS A;  2DXT A;  4JUV A;  1D3B B;  2BUD A;  5DQV A;  4KUI A;  3RMS A;  2L0A A;  1VYW B;  3QWY A;  4OMP A;  4QQ6 A;  2X3W D;  4EOI B;  4PJO C;  2E65 A;  2K2V A;  4EPC A;  1QMC A;  3M55 A;  2J06 A;  1N9R A;  2DXU A;  3FC3 A;  2GFU A;  3PE0 A;  3BHU B;  1M90 U;  3VUB A;  2G9X B;  1K73 U;  2CCI B;  1K9A A;  1U1S A;  3TNW B;  2E3H A;  3EGU A;  4Q5W A;  2FRY A;  1I0C A;  1WIE A;  4M77 B;  2D1X A;  1VQP A;  3GNG A;  1VQO Q;  1RI9 A;  1RAG B;  1SKU B;  1Y96 B;  1TG0 A;  3EFO B;  3ZBD A;  2DXB A;  2DXC A;  3I56 T;  2GF7 A;  1XTD A;  4J6W A;  3PMT A;  3CBO A;  2VUB A;  1WI7 A;  1KQ2 A;  1H1R B;  4RG8 A;  1SRL A;  1LNX A;  2FPE A;  2MMP A;  1JO8 A;  4M7D D;  1HJD A;  2QA4 T;  5GAN 2;  4EMK C;  3FJP A;  2NYS A;  1T0J A;  2DZC A;  2EWN A;  2R5A A;  3BDL A;  4WCI A;  1E7P A;  4BY6 C;  3G71 A;  5KYX B;  4MFE A;  2K5L A;  3VS1 A;  4QVC A;  4J9B A;  4M7A F;  1SRM A;  2UUE B;  2ZPH B;  1VQ5 T;  2DBK A;  4WF2 A;  4NST B;  2KMG A;  4ZTF A;  1Z9Z A;  2COY A;  3A5Z B;  2RHY A;  1HXD A;  2RI3 A;  2KRS A;  2EPD A;  1JOW A;  2YUQ A;  4EMK B;  1H1P B;  4BD3 A;  2QDY B;  4C0D C;  1IRX A;  4OGR B;  2Z0W A;  4LDU A;  4KT0 E;  3OBW A;  4PJO D;  1P92 A;  2V8I A;  5A0G A;  2C5N B;  2LCL A;  2XHC A;  1QKX A;  2RJE A;  2DMO A;  4C92 C;  1RUW A;  3J81 E;  3OYL A;  1PD1 A;  2HBW A;  2RHX A;  4PJO B;  4N4H A;  2L3R A;  1VQ4 Q;  2OTJ A;  1VQ5 A;  2OI3 A;  1VYT A;  4BCQ D;  5I21 A;  3EAE A;  2WFY B;  3JCM W;  1Q86 C;  2LRQ A;  2QQA A;  2MIO A;  4FSX A;  1C1A A;  3EJ1 B;  1P5E B;  4BCM B;  4JRI A;  5FWB A;  1ZUY A;  3LYI A;  3QDR B;  2HKN A;  4LE9 A;  3M0S A;  4HXJ A;  4Z6Y A;  2W96 A;  1IB8 A;  2A3L A;  1NJI C;  2GCX A;  2LQ8 A;  3FJ5 A;  5LJ5 h;  4PLI A;  2EQM A;  4ATO A;  4M78 C;  4IUP A;  1HD3 A;  2SEM A;  2E5Q A;  1MV0 B;  3MET A;  4E6R A;  1I07 A;  1NM7 A;  2D0N A;  1I4K 1;  4NL3 A;  4M75 B;  3A8G B;  4E7I A;  1VQO A;  1VQP Q;  4O5V A;  4EMK A;  2KYB A;  1H64 1;  2HKQ B;  1K4U S;  3SD4 A;  3V7S A;  1K9M U;  1NBE B;  3M03 A;  3ZEH A;  3CCM T;  2CP5 A;  2QFZ A;  4AKG A;  2DD5 B;  2CKK A;  4BY6 B;  3X24 B;  2J05 A;  1Y0M A;  3RR6 A;  4JRP A;  4A4F A;  2IVW A;  2CGH A;  2IPO B;  1X27 A;  2KR6 A;  4MIM A;  1IZ6 A;  2K3B A;  2D9T A;  1UGP B;  5GAN d;  1JB0 E;  4WTO B;  4AKI A;  1OZ3 A;  5CVI A;  2COW A;  3MHX A;  1M3C A;  5CKB A;  1UGV A;  1GH6 B;  4ELZ C;  3WXM B;  2EKH A;  5ECA A;  3TRE A;  5EC7 A;  3QYB A;  5CKH A;  2CT4 A;  2YUN A;  3PIO A;  4CFM B;  2V8J A;  1XQH A;  3QDF A;  3EGX B;  3OSV A;  5EJC A;  2D0Q B;  2X4J A;  2FZC B;  4JLG A;  1U1T A;  5GJW B;  4PJO E;  5KH6 A;  4JJD A;  2DVE A;  3OS5 A;  4XTY A;  5IH2 A;  1QP2 A;  1VQK Q;  3G4S T;  3LLR A;  4I3Z B;  3K7A M;  2H3J A;  4HT9 A;  3QSU A;  5GAN 3;  3CCU Q;  1VQ6 A;  3TEE A;  5LJ5 j;  3ZL7 C;  2CZ0 B;  3KXT A;  4J9H A;  5GAM h;  1TOV A;  2BE9 B;  1VQN Q;  4UC4 A;  4M77 C;  4BE2 A;  3H0I A;  4QT7 A;  1GXI E;  4EOJ B;  2R57 A;  1WZO A;  3L2V A;  4JZ4 A;  1RAH B;  1X2Q A;  2EW3 A;  3I55 A;  4LDX A;  4KH1 B;  1KC8 U;  2E10 A;  2COZ A;  4KBM B;  4M78 A;  3CC2 Q;  1PSF A;  5KYY A;  1QVG A;  2VB6 A;  2C5O B;  3QG1 A;  1ZA2 B;  2GQV A;  5GAM d;  4F6U B;  1TTH B;  2J6F A;  2RD1 A;  1N5Z A;  2HNI A;  3G71 Q;  3M53 A;  4M78 D;  2KT8 A;  2GGR A;  3EHQ A;  4BE0 A;  2OAW A;  1GUX A;  1B07 A;  1QLB A;  4QQG A;  4Y92 A;  3CCE T;  4NS5 A;  2I2L A;  2K2M A;  1KD1 U;  4CC7 A;  2LT4 A;  2F69 A;  1OX9 A;  4BCO B;  1BK2 A;  5IN1 A;  1URC B;  3CC4 A;  5KCO A;  1YBY A;  2DET A;  5D6X A;  4MFD A;  1N8R R;  3M56 A;  2QAZ A;  3HRU A;  1H28 B;  1ZSG A;  4K11 A;  4CC4 B;  4RTT A;  2OX7 A;  2KEA A;  3EHR A;  4Y28 E;  3JCM h;  5HCK A;  1RAI B;  3CCJ A;  5GAN 8;  4C92 B;  3BLQ B;  5GAN 5;  1BI2 A;  2G3R A;  3LW5 E;  2PVG B;  4M7A C;  4IUU A;  1E7O A;  4OMO A;  4IMY B;  1M27 C;  5HNB B;  1X6O A;  1Q7Y R;  4BCG B;  3HTR A;  3CC4 T;  1EX4 A;  1YNZ A;  2JM8 A;  4HCB A;  5M9O A;  3L42 A;  1D09 B;  1PKD B;  3X20 B;  2AK5 A;  1KQS A;  2YRV A;  2LX7 A;  3CCE A;  4ORZ A;  5LJ3 d;  5CEI B;  1ZUK A;  1UNL D;  1RLP C;  1FXX A;  3L1A A;  2CUD A;  1N8R U;  4ELL A;  5C0M A;  4GLM A;  2DIG A;  4RTV A;  1AOJ A;  3QBY A;  4C92 E;  4FYY B;  3CMA Q;  1MND A;  1TUG B;  4ME7 A;  4DOW A;  2BE7 D;  3SWN B;  2EGE A;  3C94 A;  3E1S A;  1TWB A;  5AYF A;  5KYX A;  2O01 E;  3VKI A;  1NPR A;  4HKE A;  1RLQ C;  2BIV A;  2LQN A;  4OB3 B;  3G71 T;  5IHI A;  1Q81 C;  5GAM e;  4KGX B;  1AZE A;  2HL3 A;  2RO0 A;  3CCV A;  3G4S A;  1OZ2 A;  5FWC A;  2QGF B;  4M7D F;  2X4W A;  2XID A;  4HVU A;  2FHD A;  1VQ8 T;  3JCM J;  4KRT A;  5A0L A;  4A4K A;  1VIN A;  2E4H A;  3SEM A;  3V7C A;  2EYZ A;  3PVL A;  5HK3 A;  5GAO r;  2EQK A;  2JNG A;  1V76 A;  2LW4 A;  1WPY A;  2XG8 D;  3MP6 A;  2XDP A;  4EOP B;  2A7Y A;  3PTA A;  2YRD A;  2WIH B;  2DO3 A;  3PIP A;  2D8H A;  4CFU B;  2P84 A;  2DKG A;  4RUG A;  3GBQ A;  1TH7 A;  4JJB A;  3OW2 P;  2F5K A;  3DTO A;  1ZP2 A;  4Z02 A;  1NJI U;  3M57 A;  3BG9 A;  3EG1 A;  5IAY A;  1K8A R;  3GPL A;  1B34 A;  2DL7 A;  5CYI B;  3JB9 H;  4NC6 A;  2KNB B;  4BCN B;  3OYF A;  2RJF A;  3PT9 A;  3CD6 A;  2LZ6 B;  5IXB A;  3G1J A;  4OGC A;  1BIB A;  3BHT B;  5DLO A;  4CFV B;  2E70 A;  5FRO A;  3P8D A;  3OW2 A;  2R7G A;  1Y7X A;  4E7K A;  4QVZ A;  4BB7 A;  2JGZ B;  2NUP B;  2ZZD A;  3V8J A;  1G3N C;  1MV3 A;  1C6V X;  3S3O A;  1B7T A;  4M77 A;  2KR3 A;  3M58 A;  5D6W A;  4M7A E;  4N0A C;  1KQS P;  1PNJ A;  1Y57 A;  2DXC B;  5KYY B;  2ATC B;  3PFS A;  1JJ2 S;  2P4R A;  4DBF A;  2OAU A;  2KT1 A;  2QTV A;  1K0X A;  3J7A F;  4C8Q F;  1NYF A;  1D1B A;  5BNJ B;  1OUL A;  1GCP A;  2K5F A;  2EGA A;  3H6Z A;  1Y07 A;  2V1Q A;  3EGD A;  3OQ5 A;  4DA4 A;  3CC7 A;  1QLY A;  3JAM E;  4BBS M;  1GUX B;  1YJ9 A;  2JTE A;  2PJQ A;  3MEW A;  3MKD A;  2B9R A;  5CR2 A;  2FEI A;  2YSQ A;  2C5X B;  1QCO A;  1ZSZ C;  4OVA A;  2WMA B;  1S72 Q;  1I8F A;  4FT2 A;  1H24 B;  3JCM V;  4FCY A;  4NOY A;  1H92 A;  2DZ9 A;  1VQ4 T;  4C8Q B;  3G6E Q;  1SG5 A;  3OB9 A;  1VQL A;  3EG9 A;  2DL8 A;  4O6J A;  3EG9 B;  1JU5 C;  1KHC A;  4NL2 A;  4BDZ A;  1AWO A;  2EJ9 A;  4ESR A;  2EKO A;  4EOR B;  4J9D A;  3BLH B;  2O9V A;  1O75 A;  1S1N A;  1W1F A;  2LQK A;  4EC9 B;  5LJ3 g;  1FMW A;  4C8Q G;  2E3I A;  4FW2 A;  5ICP B;  3SB2 A;  3QKJ A;  4AFZ C;  1OV3 A;  2UZE B;  4ZTJ A;  4ZGD B;  1Q7Y U;  1MHN A;  2Y4X A;  1SHF A;  4YC3 B;  2HD0 A;  4M77 E;  5CAI A;  2DPP B;  4CI0 C;  5IDN B;  1OU9 A;  1KC8 R;  4E2F B;  4BCP B;  1TU0 B;  2E64 A;  2MPX C;  3EG0 A;  2QQ8 A;  1GCQ A;  2NUT A;  3CXC S;  2QA4 A;  1UNG D;  1K76 A;  1ZA1 B;  2MCN A;  2K7A A;  1YHQ Q;  1CSK A;  1VIF A;  1D1A A;  1QWF A;  4PJL A;  3RNJ A;  4RTU A;  4IIM A;  1AD5 A;  5CCA A;  3UA7 A;  3O8V A;  5GAO q;  1VQM A;  3QYE A;  3PO3 S;  4PJN A;  3DLL A;  3P8H A;  3VS6 A;  1BI0 A;  4RCC A;  4BI4 A;  1Q81 R;  4BXX X;  2HBP A;  1YHQ T;  1YIT T;  2R5M A;  1PG5 B;  4M4Z A;  1SEM A;  2VGN A;  1VQP T;  3REB B;  5HBJ B;  3CCR A;  2JZ2 A;  1RAA B;  4AKH A;  1VQ9 Q;  1VQK A;  2WIP B;  3CBP A;  3QJY A;  3FB9 A;  5LJ3 h;  3CPW P;  2DER A;  3OS1 A;  7AT1 B;  1VIE A;  3UA6 A;  2FG0 A;  4RCB A;  1CKA A;  3O5Z A;  4C5I A;  2KBT A;  2BPM B;  1Z9Q A;  4ROC A;  1UJY A;  1VQL Q;  2KXC A;  3HP9 A;  4IIO A;  3C0C A;  8ATC B;  4C0D B;  1NEB A;  3TW6 A;  1M90 C;  1O9K A;  1S72 T;  2IW6 B;  2RI2 A;  5DLQ E;  2DJQ A;  5IDP B;  3RIR A;  4M7D E;  1NLP C;  3LX7 A;  4J9I A;  3G6E T;  3CPW A;  1M4Z A;  1U5S A;  1YFN A;  1IXD A;  2M51 A;  3JCM g;  1YJ9 Q;  3KUF A;  2PU9 B;  1QWE A;  3UF4 A;  3R6O A;  4HCZ A;  3LWI A;  4FL6 A;  4M78 E;  5CKF A;  5KYU B;  3QWX X;  4LDV A;  3PNW C;  3OMC A;  4XK8 E;  5AT1 B;  1VA7 A;  1GFC A;  2P0K A;  1OU8 A;  3CCE Q;  2PZ1 A;  3RER A;  2CP3 A;  1UUE A;  1VQM T;  2DVJ A;  4BCK B;  4EC8 B;  3RDV A;  4F7L B;  1IO6 A;  3CXC P;  1Q86 U;  2M02 A;  1AVZ C;  2Y90 A;  1ABO A;  1UEC A;  4LUE A;  1WYX A;  1IHW A;  2J7I A;  2VXE A;  4D8D A;  1GCQ C;  4L6V 5;  3OYD A;  2YWW A;  1YWP A;  2DL4 A;  4DEX A;  4FSS A;  4A63 B;  1WX6 A;  3V7R A;  3CD6 Q;  1YJW T;  4J9F A;  3UT1 A;  4M75 F;  1X6B A;  2FVU A;  3CCJ Q;  3QJ6 A;  4M75 A;  3OYE A;  5FU6 B;  4JX5 A;  2DM1 A;  3RKW A;  2MYS A;  3JB9 J;  3A1P A;  3QO3 A;  4F7U A;  1MMN A;  3TCJ A;  5CQX A;  1UGQ B;  2MI6 A;  2DXB B;  1DJ7 B;  5GMK m;  1TFB A;  4E7H A;  3CCR Q;  2LX9 A;  4A4E A;  2EYW A;  4GY5 A;  4M7A G;  2CP7 A;  1YIJ T;  3NGP A;  4JRK A;  1H1Q B;  4DBH A;  1M1K U;  2RF0 A;  2HZY A;  1VQ4 A;  2ENM A;  4OMM A;  1XNI A;  4JJC A;  3CCL Q;  4FYV B;  1G3T A;  3G33 B;  2QA4 Q;  1MNE A;  3MO8 A;  2C06 A;  2P4T A;  4BY7 X;  1G3Y A;  4PKC C;  4G6L B;  1VQ7 T;  3CC2 A;  3CCV Q;  1IGU A;  2QG9 B;  3CC7 T;  3VS3 A;  3I9Q A;  1JJ2 P;  3HO8 A;  3JV3 A;  3OYH A;  2PTK A;  4MDX A;  2NUZ A;  4L59 A;  1KC8 C;  3L2U A;  4C92 A;  2E6N A;  4RTY A;  1VQ9 T;  4QSH A;  1YP5 A;  1PC0 A;  4CC3 A;  5KYW A;  5I5Z B;  3M4G A;  3MPU B;  1N8R C;  3MP1 A;  3HZJ A;  4Z89 A;  1PRM C;  2RI5 A;  4XU3 A;  4DBQ A;  2PK9 B;  2BZX A;  3OS2 A;  1RAF B;  2MWO A;  2P0P A;  4P5N A;  1JJ2 A;  4CC2 A;  4YOO A;  2AKL A;  3JB9 F;  5J39 A;  1KJW A;  3TNH B;  5GMK e;  1U8R A;  2GBQ A;  3CMA T;  1M2V B;  2CDT A;  3GTM S;  4PFO A;  4BBR M;  1EZZ B;  3VV0 A;  2ROT A;  1Q7Y C;  3DB3 A;  4A53 A;  1H27 B;  2ZPE B;  2HAX A;  1YIJ A;  4J7F A;  3I35 A;  2KRO A;  3VKG A;  5IF1 B;  3OW2 S;  3UPU A;  2QEX T;  2CH4 W;  4BCM D;  3VJP A;  4FX3 B;  4X1V A;  3VS2 A;  1K1Z A;  1LPL A;  3CQT A;  1I5L A;  4HCC A;  1W98 B;  4MML A;  4X9D A;  1X6G A;  2JUF A;  3LH0 A;  4OMF B;  4F70 B;  1WFW A;  2FPF A;  2F5T X;  4F7S B;  2YRC A;  8AT1 B;  1SPK A;  1M90 R;  1HSQ A;  1VOM A;  4ZN3 A;  2J6O A;  3I5R A;  3MCA B;  5D6Y A;  1IHV A;  1I81 A;  1PKS A;  3EOC B;  3M0P A;  5EG2 A;  2ZGW A;  2WXV B;  2CP0 A;  3VYH B;  3BY7 A;  5L23 A;  2DRK A;  2WPA B;  3VYG A;  3DB4 A;  4BI8 B;  4GLK A;  3CCS T;  3UDC A;  3LGF A;  5GAN 7;  5KYW B;  5GAM g;  4EON B;  3S3M A;  2VKN A;  4M77 D;  4MZT A;  3REA B;  1YI2 T;  1M30 A;  5HY6 A;  1PWT A;  3CCQ A;  2JVV A;  4XU1 A;  4II1 A;  4ZN1 A;  3BE3 A;  2WSE E;  2K6D A;  5I2M A;  4A4H A;  1X01 A;  5I11 A;  1UDL A;  3QWL A;  2GTO A;  2XMF A;  1KIK A;  1OQK A;  1X69 A;  4F04 B;  1G5V A;  3DOG B;  3HB9 A;  3B57 A;  2EQJ A;  1RL2 A;  5I2S A;  2KY9 A;  5DM7 R;  2KQW A;  2D6F A;  1QVG S;  4BDY A;  2DIQ A;  1VQ5 Q;  3MP8 A;  2MF2 A;  2QI2 A;  5KE2 A;  5FRN A;  4MZP A;  1VQN A;  3GP8 A;  3H4C A;  1GY3 B;  2RHI A;  4Z88 A;  1OL2 B;  1WQW A;  2DNU A;  1FMK A;  2FO0 A;  1C0M A;  4LDY A;  1KK7 A;  3VRZ A;  2CJM B;  2DE0 X;  3HPW A;  4J6X A;  4EOL B;  2NUP A;  4AG2 C;  2DFU A;  2QF7 A;  3G4S Q;  2KI7 A;  2EJF A;  4LD6 A;  2QEX Q;  4EOO B;  5GAO l;  2L89 A;  1FWZ A;  1BU2 A;  4TTH A;  2QTX A;  4M75 C;  2ED1 A;  1R0C B;  2EUF A;  2W99 A;  1QMZ B;  1SF9 A;  4KUL A;  2MK5 A;  4PNO A;  5GAN j;  1YJN A;  1BB9 A;  3QYG B;  1ABQ A;  1PRL C;  3MY5 B;  4HCK A;  3QHW B;  5IHY A;  2M0O A;  3C12 A;  3OYY A;  4F6S B;  1XJW B;  2HDA A;  5HKC A;  4M7D G;  4C92 D;  3C4S A;  1WJR A;  2RA2 A;  1NG2 A;  4IUV A;  3OS0 A;  3TSZ A;  1QVG P;  1WJQ A;  3JSC A;  4FIB A;  3ASK A;  1QKW A;  5GMK l;  1UNH D;  5LJ5 d;  4CFW B;  4ELJ A;  1PKT A;  2E1H A;  2DYI A;  3FDR A;  4M78 G;  1E6H A;  3MIA B;  2RQU A;  3JCM Q;  1W70 A;  3POM A;  2OTL T;  2PUO B;  3RBB B;  3QZ9 B;  1PM3 A;  4AG1 C;  4ZGJ B;  2X35 A;  4EMG A;  5LJ5 e;  4FT4 A;  1NZ9 A;  2G77 A;  1WHM A;  2LQW A;  4PJO G;  1G83 A;  3FEO A;  4HNV A;  2DL3 A;  3MY1 B;  4BCI B;  1H1S B;  3TVT A;  4PK4 A;  2RPN A;  3KBG A;  1FMV A;  4FYX B;  3VYG B;  2MWP A;  3ZFJ A;  1PCX A;  3PMI A;  1E6G A;  3HBL A;  4CRL B;  4A54 A;  4D8K A;  2LJ1 A;  5LJ3 j;  4RTX A;  4YOS A;  3X25 B;  2X1N B;  5GMK h;  1N9S A;  4CFU D;  1K9M C;  1BKB A;  3NDQ A;  2W9F A;  3BFM A;  5CQY A;  2CP6 A;  3OYB A;  2CSI A;  3CC4 Q;  1AD6 A;  3MEV A;  1D0Y A;  1OI9 B;  4JZ3 A;  4OML A;  1SHG A;  5A0D A;  2CCH B;  2E5K A;  4EDU A;  3H0H A;  2L2P A;  1MMA A;  1KSW A;  1UE9 A;  3OA6 A;  2RJC A;  2K79 A;  4KH0 B;  2VV5 A;  3I5S A;  5CKD A;  4PFZ A;  1KHI A;  1U3O A;  2IG0 A;  3WVD B;  1QQJ A;  1M8V A;  3SWN A;  3J80 E;  5GAN f;  4LNP A;  4TVR A;  5HBE B;  5J3B A;  2O4X A;  2C4G B;  1T3L A;  3VS4 A;  2X4Y A;  1GBR A;  4MZM A;  3A98 A;  1PHT A;  1T3S A;  4HT8 A;  2PNI A;  1UHF A;  4M7D C;  2H8H A;  1NE8 A;  1WA7 A;  3NTK A;  1VQ8 Q;  3G7Z A;  1TD6 A;  2QEX A;  4FU6 A;  1BBZ A;  3VS5 A;  4PJJ A;  3QXE B;  1UG1 A;  3Q1J A;  4XTW A;  3JCM P;  4M78 F;  3JB9 I;  2DJZ A;  2DK3 A;  2OTL Q;  3F70 A;  3TNI B;  4C8Q C;  3CEY A;  1ACM B;  2C6T B;  2DEU A;  4PJO F;  1Q95 G;  2LJ0 A;  2R58 A;  4E7S A;  3CCU A;  3JCM e;  1D1C A;  2XDD A;  2WSC E;  4C92 G;  3GOX A;  2RQW A;  2NLU A;  3BDU A;  4AFS C;  4N4I A;  2NWM A;  3CCR T;  3H8Z A;  1B3Q A;  2HQX A;  2LT1 A;  4LD9 K;  5GAM j;  4F7J B;  2FZG B;  2EGC A;  4M75 E;  3HFO A;  2YDL A;  3M0R A;  4BY1 X;  1YI2 A;  2DBM A;  2ABL A;  2CUB A;  1F1B B;  2GFA A;  4JLI A;  2CP2 A;  2A37 A;  3LWH A;  3MI9 B;  1M8M A;  1XOV A;  3ULR B;  2M16 A;  4BCQ B;  4J83 A;  1KD1 C;  4J5Y A;  4ZNX A;  4AI6 A;  4C0G A;  1F5Q B;  4M6V A;  1WHH A;  5KE3 A;  4EMH A;  3BLR B;  2LCS A;  5IT9 E;  3OYJ A;  5D7U A;  3LQ5 B;  1V29 B;  2PUK B;  1TXQ A;  3PVQ A;  4R55 A;  2D8J A;  4XAX B;  2RQV A;  4DOV A;  4PJO A;  1JBM A;  1M1F A;  3I56 Q;  2LTO A;  1YJN T;  4MDW A;  1LVK A;  4OGE A;  1QVF P;  1WLP B;  3BHV B;  1WDX A;  3E19 A;  1Y96 A;  3EG3 A;  1YIJ Q;  2MAM A;  3CBM A;  3DL1 A;  1OI1 A;  2QQS A;  1WHJ A;  4Z8A A;  2JMC A;  2HQE A;  4N4G A;  4XU0 A;  5I22 A;  3TU4 K;  2LMJ A;  2V1R A;  4ROE A;  3T9N A;  1ZBX A;  4KRD B;  1BI1 A;  2HMA A;  5GAN g;  3N5B B;  3M54 A;  4OB1 B;  1LCK A;  1QCN A;  1JEG A;  4JX6 A;  3C95 A;  1KG1 A;  1RI0 A;  3VKH A;  1W2B S;  1H3Z A;  5LJ3 e;  3VU3 C;  3OY9 A;  1VQ6 T;  3QUI A;  3CME T;  1W4S A;  4C8Q A;  1IGQ A;  2RN8 A;  3EFR A;  3EFS A;  5L8R E;  2JJ9 A;  3EGX A;  3MEA A;  2VWF A;  4LOC A;  2BTT A;  4EOQ B;  1TSF A;  2EYQ A;  3DKM A;  2XKO C;  3OBY A;  2QGG A;  2CRE A;  2QQ9 A;  3E9G A;  3DDP B;  1K9M R;  1WJS A;  3DJB A;  3UAT A;  2O2O A;  4DBR A;  2DTH A;  2WSF E;  5DQW A;  1X75 C;  4AT1 B;  4HLQ A;  3JCM b;  5IXF A;  2EQU A;  4HNU A;  3HRT A;  5LMK B;  2DD4 A;  1MMD A;  1M2O A;  2PVD B;  3OYG A;  4CXA B;  4IKF A;  2JTF A;  1VQ7 A;  2AT1 B;  2ZZD B;  3CME A;  3O0G D;  1LJO A;  2K4Y A;  2F2C A;  3E9F A;  1YN8 A;  3HKS A;  1J3T A;  4C0F A;  4F17 A;  4PLL A;  2I40 B;  2JOY A;  4B9X A;  2BZY A;  2XIC A;  2M0Y A;  4C92 F;  1N6A A;  3CCM A;  1MMG A;  2B86 A;  3LH5 A;  2EYY A;  1M2V A;  4XTX A;  2IW8 B;  3S6W A;  1TUD A;  3DLM A;  2QQR A;  1AHJ B;  2WJ9 A;  1U06 A;  2GTJ A;  1BYM A;  3CCQ Q;  2BS2 A;  2RHU A;  1K8A U;  1WHG A;  2C0O A;  2H3E B;  4ROD A;  2EAY A;  3VS7 A;  1M1K R;  1IRE B;  2ZCF B;  1NEG A;  4ELY C;  4BI3 A;  2O9S A;  4RTW A;  2KGT A;  4FYW B;  4C0Z A;  2L5Q A;  3QII A;  2W2H A;  1JXM A;  1UTI A;  3M0U A;  4PFP A;  2WEV B;  2PVO B;  2PK2 A;  4MMK A;  1OYX A;  4C5E A;  1ZHI A;  5CK9 A;  3M5A A;  3M4Y A;  1AWJ A;  1YIT Q;  4YTL A; 
#chains in the Genus database with same CATH homology
 5D6Y A;  1I81 A;  2M9U A;  1KQ1 A;  5LJ5 f;  1Q81 C;  2DEQ A;  2RJD A;  5GAM e;  3GLX A;  1YCY A;  5EG2 A;  2ZGW A;  2RO0 A;  4DQ2 A;  3CCV A;  1VQ8 A;  3G4S A;  1OZ2 A;  3VYH B;  3BY7 A;  4BE1 A;  3L2R A;  4M7D F;  2X4W A;  2XID A;  4IUQ A;  4XU2 A;  5LL6 S;  3QPH A;  5A2Q E;  1NPP A;  2CZ1 B;  2FHD A;  3VYG A;  3DB4 A;  1WQ7 A;  2DD5 A;  2LNV A;  4GLK A;  4BI8 B;  4HNT A;  2E41 A;  3UDC A;  5A0L A;  3CCS T;  3LGF A;  1YJ9 T;  1Q82 U;  4C5H A;  5GAN 7;  2JN0 A;  3CPW S;  4A4K A;  3CCL T;  2XI9 A;  3FRN A;  5GAM g;  4M7A D;  3V7C A;  5HK3 A;  3BW1 A;  3S3M A;  5GAO r;  5HK0 A;  4XTV A;  2EQK A;  2JNG A;  4M77 D;  4MZT A;  3L2Q A;  3JCM f;  1YI2 T;  5HY6 A;  4OB0 B;  2K3Y A;  1K8A C;  4LDW A;  1WPY A;  3OYA A;  3CCQ A;  2ZPG B;  2JVV A;  3GNF B;  4XU1 A;  2Y4Y A;  2XG8 D;  3MP6 A;  4II1 A;  2RM4 A;  2XDP A;  2E12 A;  3OYK A;  1UGS B;  3FLG A;  4M7D E;  3V8L A;  5GAN e;  2A7Y A;  3PTA A;  1Q82 C;  1KQS S;  4ZN1 A;  2DO3 A;  3PIP A;  2WSE E;  4ZGE B;  5I2M A;  4A4H A;  2RHZ A;  2KMT A;  5GAO m;  3KHI A;  1X01 A;  2LC4 A;  3HL8 A;  1MGQ A;  2CS7 A;  2DKG A;  1TH7 A;  3QWL A;  5GAO p;  2F5K A;  4JS4 A;  4XQ3 A;  4QVD A;  4Z02 A;  1M1G A;  1NJI U;  3A8M B;  3CPF A;  3M57 A;  3BG9 A;  4M77 F;  3UWN A;  5IAY A;  1K73 C;  3JCM d;  5FU6 C;  3AHU A;  1G5V A;  3HB9 A;  3JRZ A;  2EQJ A;  5LJ5 g;  4J8O A;  1RL2 A;  1B34 A;  2KY9 A;  5I2S A;  2KQW A;  5DM7 R;  3OMG A;  3QHS A;  2DXT A;  4JUV A;  4F7U G;  1QVG S;  1VQN T;  3CD6 T;  3JB9 H;  2XU8 A;  4BDY A;  1D3B B;  2BUD A;  2DIQ A;  4KUI A;  4NC6 A;  3RMS A;  1D3B A;  3MP8 A;  2MF2 A;  2QI2 A;  3OYF A;  2RJF A;  3PT9 A;  5KE2 A;  3CD6 A;  5FRN A;  4MZP A;  4QQ6 A;  3GP8 A;  1VQN A;  3H4C A;  3RKX A;  2E65 A;  4OGC A;  4PJO C;  1BIB A;  2K2V A;  2RHI A;  4EPC A;  3M55 A;  5DLO A;  2E70 A;  1N9R A;  2DXU A;  3FC3 A;  2GFU A;  2RH2 A;  5FRO A;  1WQW A;  3ER0 A;  3P8D A;  3OW2 A;  1Y7X A;  3VUB A;  2DD4 B;  1M90 U;  4E7K A;  4LDY A;  4QVZ A;  2KK4 A;  4BB7 A;  3TW7 A;  3HPW A;  1K73 U;  4J6X A;  4OF1 A;  1U1S A;  2ZZD A;  5GAO n;  2QF7 A;  3V8J A;  2DTI A;  4Q5W A;  4X9C A;  4M77 B;  1SSF A;  3S3O A;  2VGM A;  4M77 A;  1VQP A;  2EJF A;  4LD6 A;  3GNG A;  3CCQ T;  3M58 A;  2L89 A;  1FWZ A;  5D6W A;  5GAO l;  1QVP A;  4N0A C;  4M7D A;  4M7A E;  1Y96 B;  2QQB A;  3ZBD A;  1W2B A;  2QTX A;  2DXC B;  4M75 C;  1VQ9 A;  5DY9 A;  2DXB A;  4M78 B;  2DXC A;  4R56 A;  3PFS A;  4KUL A;  4PNO A;  1YJN A;  3I56 T;  5GAN j;  1JJ2 S;  3BG3 A;  2OAU A;  2GF7 A;  3J7A F;  2RB6 A;  3QYG B;  1XTD A;  4OB2 B;  2VC8 A;  4C8Q F;  4J6W A;  3PMT A;  3CBO A;  2M0O A;  3C12 A;  2K5F A;  2VUB A;  3H6Z A;  3M59 A;  3CCL A;  3OYY A;  1G3W A;  1Y07 A;  3OQ5 A;  3P8B B;  1VQ8 T;  4DA4 A;  5HKC A;  1KQ2 A;  5CKE A;  4M7D G;  4C92 D;  3C4S A;  1WJR A;  2RA2 A;  4IUV A;  1LNX A;  4RG8 A;  3JAM E;  3CC7 A;  2MMP A;  4BBS M;  4M7D D;  1VUB A;  2QA4 T;  5GAN 2;  3OS0 A;  3CCS A;  4VUB A;  1YJ9 A;  1QVF A;  4EMK C;  1WJQ A;  3FJP A;  3MEW A;  1QP3 A;  2KDS A;  5CR2 A;  3JSC A;  4FIB A;  3ASK A;  5GMK l;  4BAC A;  5LJ5 d;  2DZC A;  2EWN A;  2R5A A;  4ELJ A;  4OVA A;  2CZ7 B;  2LDM A;  2E1H A;  5FU7 C;  3BDL A;  4E7L A;  3RUX A;  3FDR A;  1E7P A;  4M78 G;  1I8F A;  4FT2 A;  4BY6 C;  3JCM V;  3G71 A;  1JRI A;  4MFE A;  3A8L B;  2B8A A;  2K5L A;  4NOY A;  4QVC A;  4A4G A;  2DZ9 A;  1VQ4 T;  3JCM Q;  4M7A F;  4C8Q B;  2ZPH B;  1VQ5 T;  4WF2 A;  2OTL T;  3OB9 A;  2PUO B;  1VQL A;  3QZ9 B;  2KMG A;  4ZTF A;  3INZ A;  3A5Z B;  4O6J A;  3RES A;  4ZGJ B;  1KHC A;  2RHY A;  2QDJ A;  2X35 A;  4NL2 A;  3RKY A;  4EMG A;  4BDZ A;  2OTJ T;  1HXD A;  2RI3 A;  5LJ5 e;  2EJ9 A;  4EMK B;  4FT4 A;  2LCC A;  4BD3 A;  2EKO A;  2QDY B;  1NZ9 A;  4C0D C;  3OYN A;  4F7U B;  2G77 A;  4PJO G;  3FEO A;  4HNV A;  1O75 A;  4LDU A;  3VUZ A;  4KT0 E;  3OBW A;  2RK1 A;  4PJO D;  1P92 A;  2XK0 A;  2V8I A;  2LQK A;  3KBG A;  5A0G A;  3VYG B;  5LJ3 g;  2MWP A;  2LCL A;  3ZFJ A;  3G6E A;  4XTZ A;  2XHC A;  3PMI A;  4C8Q G;  2RJE A;  4C92 C;  3HBL A;  3SB2 A;  3QKJ A;  4A54 A;  3J81 E;  4M7A B;  3OYL A;  4ZTJ A;  3JCM J;  4ZGD B;  1Q7Y U;  1MHN A;  2RHX A;  2Y4X A;  4PJO B;  5LJ3 j;  4N4H A;  2L3R A;  2OTJ A;  1VQ5 A;  2HD0 A;  4M77 E;  5CAI A;  2DPP B;  5I21 A;  3X25 B;  1VQL T;  3EAE A;  4CI0 C;  3JCM W;  1Q86 C;  2YLB A;  5GMK h;  1N9S A;  3CMA A;  2LRQ A;  2DTO A;  1BKB A;  1K9M C;  2QQA A;  4FSX A;  3A8H B;  5LJ3 f;  2RK2 A;  1M1K C;  3BFM A;  2D6F A;  4F7U F;  4JRI A;  2KAF A;  2E64 A;  3LYI A;  5CQY A;  2WAC A;  3M9Q A;  2ZPF B;  3QDR B;  3OYB A;  2QQ8 A;  1VQK T;  5GAN 4;  3CXC S;  3MEV A;  2QA4 A;  2K3X A;  1QW1 A;  4Z6Y A;  5A0D A;  1VIF A;  4EDU A;  3OA6 A;  4X34 A;  2A3L A;  5CCA A;  2RJC A;  1NJI C;  2VV5 A;  5CKD A;  2GCX A;  2LQ8 A;  3O8V A;  5GAO q;  1KHI A;  3QYE A;  4PLI A;  5LJ5 h;  2EQM A;  3P8H A;  3DLL A;  1VQM A;  1BI0 A;  4RCC A;  4BI4 A;  4ATO A;  2IG0 A;  3WVD B;  4M78 C;  1BIA A;  1M8V A;  3A8O B;  4IUP A;  3SWN A;  4E47 A;  5GAN f;  4TVR A;  3J80 E;  2HBP A;  2YLC A;  3I56 A;  1YHQ T;  1YIT T;  2R5M A;  4QQD A;  2E5Q A;  5J3B A;  2O4X A;  2VGN A;  1VQP T;  3MET A;  3X26 B;  3CC2 T;  4FM4 B;  2X4Y A;  5GAN 6;  3NFC A;  4MZM A;  5FU7 B;  5C6S A;  3CCR A;  1I4K 1;  2JZ2 A;  3MEU A;  4HT8 A;  4NL3 A;  4AKH A;  5GAN h;  1VQK A;  4M7D C;  1NE8 A;  3CBP A;  3QJY A;  2AHJ B;  3FB9 A;  2EIF A;  3NTK A;  3G7Z A;  4M75 B;  3A8G B;  5LJ3 h;  3JCM X;  4E7I A;  2QEX A;  4FU6 A;  3OS1 A;  1VQO A;  3S3N A;  1VIE A;  4O5V A;  4C8Q E;  4RCB A;  4EMK A;  4C5I A;  1H64 1;  3SD4 A;  2FL7 A;  3V7S A;  1K9M U;  4F7U E;  3QXE B;  3JB9 G;  3ZEH A;  4HL4 A;  3Q1J A;  4XTW A;  3JCM P;  3CCM T;  2QFZ A;  3HP9 A;  4M78 F;  3JB9 I;  4AKG A;  2DJZ A;  2DD5 B;  3NTH A;  3JCM c;  2CKK A;  2DK3 A;  3F70 A;  4C0D B;  4C8Q C;  4BY6 B;  3X24 B;  2VXF A;  3CEY A;  4JRP A;  3TW6 A;  1M90 C;  1S72 T;  4A4F A;  2IVW A;  2CGH A;  2FB7 A;  2RI2 A;  5DLQ E;  2R58 A;  4PJO F;  3CCU A;  3RIR A;  3JCM e;  2KR6 A;  4M7A A;  2XDD A;  3OYM A;  2BS4 A;  4MIM A;  2X4X A;  3LX7 A;  4E7J A;  2WSC E;  4C92 G;  3G6E T;  3CPW A;  1M4Z A;  4C5G A;  3GOX A;  1IZ6 A;  2NLU A;  3BDU A;  3GF5 A;  1M5Q 1;  4JDS A;  4N4I A;  2D9T A;  5KCH A;  3CCR T;  3H8Z A;  2K5I A;  1UGP B;  2HQX A;  2LT1 A;  3JCM g;  5GAN d;  1JB0 E;  5GAM j;  4LD9 K;  3KUF A;  2BKD N;  2PU9 B;  3V8K A;  4AKI A;  1OZ3 A;  5CVI A;  3MHX A;  3R6O A;  4HCZ A;  4M75 E;  5CKB A;  3LWI A;  4FL6 A;  4ELZ C;  2KSS A;  2E6Z A;  4M78 E;  5CKF A;  3WXM B;  1YHQ A;  3TRE A;  1QVF S;  3HFO A;  3QYB A;  4LDV A;  1YJW A;  5FRM A;  3PNW C;  5CKH A;  3OMC A;  3CCJ T;  4XK8 E;  3PIO A;  2V8J A;  1YI2 A;  1XQH A;  5FLX E;  3OYI A;  2P0K A;  3OSV A;  3HHT B;  2GFA A;  4JLI A;  3QYH B;  3RER A;  5EJC A;  3LWH A;  1VQM T;  3X28 B;  2D0Q B;  2M1H A;  2XD0 A;  1XOV A;  2M16 A;  3HFN A;  1Q86 U;  2X4J A;  1B34 B;  1U1T A;  1R8O B;  4J83 A;  4JLG A;  4PJO E;  2Y90 A;  3PGG A;  4J5Y A;  1KD1 C;  5KH6 A;  2DVE A;  4AI6 A;  3OS5 A;  4IUR A;  4XTY A;  1QP2 A;  4C0G A;  1UGR B;  2ZPB B;  3LLR A;  2H3J A;  4M6V A;  3G4S T;  4HT9 A;  3QSU A;  5GAN 3;  1VQ6 A;  5KE3 A;  3TEE A;  4EMH A;  5LJ5 j;  3FIF A;  5IT9 E;  3OYJ A;  2VXE A;  2CZ0 B;  4PL6 A;  2CZ6 B;  1Y71 A;  4J7I A;  4L6V 5;  3OYD A;  3KXT A;  1V29 B;  2PUK B;  5GMK i;  5GAM h;  4R55 A;  4HA8 A;  4XAX B;  2JTM A;  4UC4 A;  4DOV A;  2DAQ A;  4M77 C;  3V7R A;  4PJO A;  1JBM A;  1YJW T;  1M1F A;  4BE2 A;  3UT1 A;  4M75 F;  2FVU A;  1GXI E;  2LTO A;  3QJ6 A;  1YJN T;  4RMO A;  2R57 A;  3CXC A;  4M75 A;  3L2V A;  3OYE A;  5FU6 B;  5CIU A;  2EFI A;  4JX5 A;  4MDW A;  3I55 A;  3URG A;  1FKM A;  4LDX A;  4OGE A;  3RKW A;  4B9W A;  3JB9 J;  1KC8 U;  2E10 A;  4M7D B;  3E19 A;  4KBM B;  1Y96 A;  4M78 A;  3QO3 A;  4F7U A;  5GMK j;  3TCJ A;  3SFM A;  2MAM A;  5CQX A;  1UGQ B;  1PSF A;  2DXB B;  3DL1 A;  1DJ7 B;  1OI1 A;  2MI6 A;  3CBM A;  2QQS A;  4E7H A;  2LX9 A;  4RG2 A;  2L8D A;  1QVG A;  3QG1 A;  4CRI A;  4N0A A;  1FX7 A;  2GQV A;  4RKU E;  4A4E A;  5GAM d;  2HQE A;  4N4G A;  3CCU T;  4XU0 A;  3GPL A;  2LVM A;  3TU4 K;  4GY5 A;  2RD1 A;  3T9N A;  2HNI A;  2KVQ G;  1S72 A;  3M53 A;  4M75 D;  1ZBX A;  4M7A G;  4IUT A;  4M78 D;  1BI1 A;  4M75 G;  5GAN g;  4BE0 A;  3N5B B;  3GIB A;  3M54 A;  1YIJ T;  4JRK A;  2FYK A;  3SWN C;  1QLB A;  4OB1 B;  4M77 G;  4JX6 A;  3C95 A;  1KG1 A;  4QQG A;  4Y91 A;  4JX4 A;  1M1K U;  3CCE T;  1RI0 A;  1G3S A;  1PSE A;  3VKH A;  4NS5 A;  5GMK m;  2I2L A;  1VQ4 A;  1KD1 U;  1W2B S;  1XNI A;  2LT4 A;  2F69 A;  5LJ3 e;  3VU3 C;  1H3Z A;  2BS3 A;  2EJG A;  3OY9 A;  5IN1 A;  5GAM f;  1VQ6 T;  1G3T A;  3OSS C;  3QUI A;  3CME T;  1W4S A;  4C8Q A;  3MO8 A;  5KCO A;  3HRS A;  3CC4 A;  1BI3 A;  1YBY A;  2C06 A;  2P4T A;  3EFR A;  1G3Y A;  1N27 A;  3WVE B;  4MFD A;  3EFS A;  4PKC C;  1HK9 A;  5D6X A;  5L8R E;  1VQ7 T;  3M56 A;  3CC2 A;  3MEA A;  3HRU A;  4JJN K;  4LOC A;  4C8Q D;  1ZQ1 A;  2EYQ A;  3DKM A;  2XKO C;  4XTU A;  3OBY A;  3ME9 A;  4Y28 E;  3JCM h;  3CC7 T;  2K57 A;  2P0Q A;  2QQ9 A;  3E9G A;  3HO8 A;  3BG5 A;  1WJS A;  3OYH A;  1YIT A;  4MDX A;  3CCJ A;  2CYZ B;  4L59 A;  1KC8 C;  3L2U A;  5GAN 8;  2DTH A;  2WSF E;  4C92 A;  2E6N A;  3JB9 D;  1X75 C;  4C92 B;  5GAN 5;  1BI2 A;  4HLQ A;  2G3R A;  2VYT A;  2PVG B;  3LW5 E;  3JCM b;  2EQU A;  4IUU A;  4QSH A;  1VQ9 T;  1UB4 A;  4M7A C;  2V8K A;  2ZPI B;  1UEB A;  3M4G A;  4HNU A;  1N8R C;  3HRT A;  3HZJ A;  3MP1 A;  2DD4 A;  3OYC A;  2RI5 A;  1X6O A;  2PVD B;  4J6Y A;  4XU3 A;  3OYG A;  3OS2 A;  4IKF A;  2JTF A;  1VQ7 A;  2ZZD B;  3CME A;  3CC4 T;  4QW2 A;  1LJO A;  2K4Y A;  2MWO A;  2P0P A;  3E9F A;  4P5N A;  5M9O A;  1JJ2 A;  4HCB A;  3CCV T;  3L42 A;  2XDB A;  3HKS A;  3JB9 F;  3X20 B;  5J39 A;  4C0F A;  1KQS A;  4PLL A;  3RMQ A;  2YRV A;  4OP0 A;  5GMK e;  1WNL A;  1U8R A;  3CCE A;  5LJ3 d;  2QXF A;  2JOY A;  4B9X A;  2XIC A;  4C92 F;  3CMA T;  1N6A A;  3CCM A;  4BUG A;  1LOJ A;  4XTX A;  1FXX A;  4BBR M;  3S6W A;  3DLM A;  3L1A A;  3VV0 A;  1Q7Y C;  3QZ5 B;  1AHJ B;  2QQR A;  3DB3 A;  4A53 A;  2ZPE B;  1M9S A;  2WJ9 A;  5C0M A;  1N8R U;  2HAX A;  5CO7 A;  4J7F A;  1YIJ A;  2DIG A;  3QBY A;  3VKG A;  3OW2 S;  3UPU A;  4L5G A;  2QEX T;  1VQO T;  1BYM A;  2BS2 A;  2RHU A;  5J26 A;  3VJP A;  1K8A U;  4C92 E;  3L2Z A;  2EAY A;  1IRE B;  2ZCF B;  3L2W A;  2YHT A;  1EIF A;  4ELY C;  4BI3 A;  1I5L A;  1WGS A;  4ME7 A;  1Q81 U;  4DOW A;  4HCC A;  4YTL A;  4C0Z A;  4MML A;  4X9D A;  3SWN B;  1O9S A;  2JUF A;  2L5Q A;  2PQW A;  3C94 A;  3LH0 A;  3E1S A;  3SDZ A;  4JS5 A;  2O4X B;  4OMF B;  3QII A;  3I55 T;  4KUD K;  5AYF A;  2O01 E;  2F5T X;  3VKI A;  1NPR A;  4HKE A;  2OTL A;  2PVO B;  4MMK A;  4V2S A;  1OYX A;  2BIV A;  4C5E A;  1ZHI A;  4ZN3 A;  4OB3 B;  5CK9 A;  3M5A A;  4D6W A;  3M4Y A;  3NTI A;  3G71 T;  3LGL A;  3HSB A;  4JRQ A;  3MCA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...