4ZGEB

Double mutant h80w/h81w of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
206
structure length
206
Chain Sequence
b'MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 52
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgeB02
3A8GB 2DPPB 2ZZDB 2CZ7B 2ZPFB 2DD4A 3X20B 4OB3B 3WVEB 3X25B 3LW5E 3WVDB 1UGSB 2PU9B 3A8HB 3A8OB 3X28B 4ZGDB 4L6V5 4FM4B 2PUKB 2PVOB 2ZCFB 2DXBB 2O01E 2ZPGB 2ZPEB 4ZGJB 5L8RE 2PUOB 1V29B 1IREB 2DD5B 3VYGA 3QXEB 3QZ5B 4OB1B 2ZZDA 3X24B 4Y28E 1AHJB 2WSCE 2PVDB 3QZ9B 3VYHB 2AHJB 2ZPBB 4XK8E 2CYZB 1UGQB 1GXIE 1PSFA 1QP2A 2DXCB 2DXBA 2WSEE 3X26B 3HHTB 3QYGB 2QDYB 2ZPHB 2DD4B 2DD5A 4KT0E 1JB0E 2WSFE 3A8LB 3A8MB 2CZ0B 2CZ1B 3QYHB 4OB2B 1UGRB 4RKUE 1DJ7B 2D0QB 2PVGB 2CZ6B 4OB0B 2ZPIB 1PSEA 2DXCA 4ZGEB 1UGPB 1QP3A 3VYGB
chains in the Genus database with same CATH superfamily
1KD1U 5KE3A 1VA7A 2G6FX 2DD4A 3QBYA 1S72A 4Y72B 4DBQA 1LCKA 1X2QA 2PU9B 1VQ4A 1S1NA 2R57A 2E3HA 2DBMA 2EKHA 3PMIA 3HL8A 4HCKA 2LX7A 3CXCA 2P0KA 3I56A 1OPKA 1ZX6A 1MGQA 4JDSA 3I5SA 1WJSA 2CCIB 1KC8C 2LT1A 1WNLA 1WXTA 2E1HA 5IHIA 4KUIA 2PJQA 4M78E 5I2SA 3CCLQ 3SD4A 2L5QA 4B9XA 1SHGA 1VQMQ 3JCMf 3KBGA 3VS4A 3P8HA 2RHXA 2QAZA 3CCQQ 3TQ7P 2ZZDA 2NUZA 1OGUB 1X6OA 2MK5A 3EFOB 4EOJB 4QQDA 4II5B 4P5NA 3CCVA 2RPNA 1VQ5Q 2ZPBB 1UNHD 1Q7YR 2XD0A 4ME7A 1FMKA 2RB6A 4IURA 2FHDA 2JN0A 1XQHA 2IG0A 3MPUB 3E1SA 1KFZA 4C8QB 1D3BB 2KRSA 4ATOA 3H9NA 1ZA2B 1ZSZA 5GAMg 1XOVA 3CC2T 4PFPA 4FYWB 4IIMA 3L2WA 3GLXA 2QDYB 2CP3A 4ZNXA 5GANe 1H3HA 2DXTA 2BE7D 1PD1A 3A8LB 5GAMh 2JJ9A 3CCEA 4WTOB 3TSWA 2F2CA 5FRMA 2QQBA 3KFVA 2M16A 1I5OB 2RNAA 3M59A 1EZZB 2M51A 2KYMA 3GNGA 4J83A 2V26A 4E47A 3S3OA 1U1SA 1TSFA 1OU9A 1FX7A 5GAN5 1H27B 4AFQC 4RCBA 3O5ZA 1V1CA 5FW9A 3G71Q 1UGPB 5LJ5f 1ZSZC 4CXAB 4J6XA 2RHYA 2D8HA 4BD3A 2CREA 2IW8B 4OB3B 2EJ9A 4EONB 2QQAA 5LJ5g 2XMFA 3VS0A 4M7AE 1MNDA 1M30A 4CFMB 3OYYA 1QVPA 2HDAA 2ATCB 4F17A 4L6V5 3VS1A 4DOVA 5HBEB 4BI4A 2XDPA 2V1RA 5IDNB 2BS2A 3CC2Q 1AD5A 2BZYA 4QT7A 3OS0A 4BCGB 3PVQA 1E6GA 2V8IA 2HMAA 2RQUA 3OYJA 2DIQA 2D6FA 3CMAQ 4BCNB 2LJ3A 5J26A 2FB7A 1WHGA 4M75D 1RADB 2PK9B 4BY7X 4M6VA 2K3YA 1CKAA 4ROCA 3CCST 3VS2A 1N6AA 1G83A 4XTYA 2KDSA 2KAFA 1K8AR 2X35A 2QASA 1QKWA 2M0OA 2JS0A 3LYIA 3TCJA 1Q81C 2K3BA 4KBMB 1YJ9A 4J9CA 1M3BA 2X3XD 3HRSA 3LWIA 2QA4T 2WSEE 4M7DF 3CBMA 1QVGA 2LMJA 1QCOA 1QMCA 2EW3A 4JPBW 1UUEA 2LQKA 4RODA 1YWPA 3OBYA 3NHNA 2IVWA 2FZGB 4BI3A 3OB9A 4BXXX 1W2BP 2C5VB 4ROEA 3FEOA 3RMSA 1K0XA 1SG5A 5FU6B 3CMEQ 1D09B 1G5VA 2OTJT 2W2HA 1YFNA 4EOPB 1OYXA 1N9SA 1QWEA 1QMZB 1AOJA 2HNIA 4LNPA 3OA6A 2MPXC 3OYDA 3FJ5A 2O9SA 2B9RA 4KGXB 3G4SA 4XU0A 1ZLMA 2OX7A 1YI2T 3NGPA 1I81A 2FRYA 3BDUA 3SWNA 1ZBXA 4A4FA 1M1KR 4PJLA 1PKDB 1PC0A 4LDXA 1D0YA 2AK5A 4EOQB 4CFVB 3CCMQ 1U5SA 4RTYA 2QGSA 5GAMd 2QF7A 3RMQA 3DL1A 4J7IA 1VQ6Q 6AT1B 2VGNA 4F7UF 1QVFP 3HKSA 1YJNA 1BI2A 4OMFB 2CP5A 3UPUA 2XG8D 3VRZA 1RAIB 3U23A 4CFWB 2H3JA 1WJRA 3BFMA 2DL5A 1QW1A 2OTJQ 4RG2A 3SWNC 5LJ3j 4A4HA 2DZCA 3I5RA 5CKDA 1M8VA 1G3NC 3O8VA 4J9GA 2EWNA 2LCLA 1M1GA 1VQPT 2QG9B 1RABB 2LQNA 2DX1A 1J3TA 3EGUA 4BCOB 2QDLA 1VQ9A 1FYNA 4BACA 4M78D 2QI2A 2GTJA 2JTMA 1NPRA 3SB2A 4B6MA 4NC6A 3CQTA 4OB2B 4MDWA 1AD6A 1AEYA 5J39A 2EQKA 2HQHA 4C0ZA 2PQWA 4HKEA 3EH2A 3JCMc 1H1RB 4RTWA 3DLMA 1JJ2S 2QXFA 2FPFA 2E64A 1VQOQ 1KQSA 4C92A 2SRCA 2ZPIB 4ELLA 4BE0A 2F69A 1ZP2A 1KSWA 4HXJA 3VYGB 3L2RA 2DMOA 5GJWB 4AKGA 2FL7A 5GAOm 1IXDA 4JRIA 1VQNA 1W98B 1M3AA 1JSTB 2RN8A 2O88A 5KYWB 3FB9A 4NS5A 1W1FA 2I2LA 4M77A 1OX9A 1FMWA 2KK4A 1UE9A 1Q82R 2GNCA 2RO0A 5L2WB 2C06A 4AMCA 1M27C 2DAQA 2O01E 1TU0B 4ZTJA 2RI5A 1KK7A 4BCMD 2WEVB 2DL8A 5DY9A 3QG1A 4Q5WA 4QSHA 4BCQD 2YXYA 2J7IA 4BY6C 2KNBB 1AZGB 3OMGA 2MWOA 1V76A 4HVUA 2PVDB 1D3UB 5I21A 2MOXA 3VS5A 3CPWP 2DK3A 1K73U 2KMGA 2JTFA 4EOOB 2DL3A 4M7AD 3RIRA 2V22B 4M77C 1YNZA 4BCFB 2DXCB 4HLQA 2LQ8A 4LDWA 2X1NB 4PLIA 3OYLA 1ZUKA 2D9TA 2YRDA 4DBRA 1WX6A 1JB0E 4C5IA 1VQ7T 2LJ0A 2ZAEA 1AISB 2DVJA 2VUBA 4F16A 2XDDA 1LJOA 3RKXA 2DA9A 5CK9A 4AG1C 3VKHA 1T0HA 2ROLA 1UHCA 2VXEA 3QWXX 4AT1B 4HT9A 4N4IA 1H92A 4XU2A 3CXCS 1NJIU 2E4HA 4XQ3A 4RKUE 2QEXT 3GIBA 3BHTB 2LRQA 5IF1B 3HPWA 4EDUA 2FZKB 1Y71A 2E3IA 2BZXA 1OZ3A 1VQ8A 4D6WA 2NUTA 1PRLC 1WXBA 3CC4T 2UZDB 3M0RA 2COZA 1M1FA 4Y92A 1K9AA 3OYFA 1UTIA 1LNXA 4J9DA 2XDBA 3OQ5A 5GAN4 1AVZC 2AKKA 3LGFA 1QCNA 2RJDA 1K9MU 4MZTA 2FVUA 4JX6A 5FU7C 5GAMe 3X28B 3SFMA 5CQXA 5HY6A 3CCJQ 1UEBA 1VQLT 2PUKB 4IKFA 3C12A 4C92E 3VU3C 1WHMA 3CPFA 2LT4A 2BPMB 4JJCA 3HFOA 1V29B 2QQSA 1IB8A 3GNFB 3BLQB 2QQRA 4ZTFA 2P0PA 4FYXB 1GCQC 1GL5A 4X9DA 3RGFB 1UHFA 4XTVA 1M2VB 3JCMP 1BI0A 2MWPA 2P0QA 3J7AF 2DLPA 4M77E 2F1LA 1M9SA 2CUDA 1JJ2A 1BU1A 4GY5A 2DYIA 5HKCA 2JT4A 4F6SB 2KY9A 5GAN2 4BY1X 2RQVA 3D7SB 2X4XA 2B8AA 1E6HA 1JSUB 2EGAA 4DQ2A 2DXBA 5LJ3h 3BLHB 4D8DA 5LJ5e 3JB9G 3M4YA 4KRTA 4EIKA 1OULA 2K79A 3EIDB 2OTLT 3UA6A 4N0AA 5CAIA 2C5NB 3LX7A 2BKZB 1VQKQ 3OYGA 1B34A 2NUPA 1Y96A 2KXDA 8AT1B 3KXTA 3CC2A 5IDPB 2J6OA 4CC3A 5DQWA 1R0CB 1I0CA 1OOTA 3MKDA 2W0ZA 1YJWQ 2BIVA 4E2FB 3JAME 1X69A 5A2QE 3RNJA 3MCAB 3VUZA 2L8DA 2CZ6B 3DDQB 2WFYB 3M58A 4OMPA 4B9WA 3EGXB 3DLLA 3CCLT 4NSTB 3QIIA 1TUDA 1VQMT 4JZ3A 2FYKA 2Y4XA 1Q7YC 2RA2A 4J7FA 5D6YA 1PRMC 2RF0A 2VV5A 4M78F 2X4WA 3SEMA 1HXDA 1NYGA 2ED1A 1KC8U 4J5YA 4M7DB 3H0HA 4M77G 7AT1B 3GPLA 4DEXA 2DVEA 1R0BG 2PVOB 5FGKB 2ZCFB 3META 2M02A 3JRZA 2NLUA 4DOWA 2ZPGB 4EOSB 1B3QA 2LCCA 3OY9A 4Z6YA 2E6ZA 4PJNA 4KH1B 1C0MA 3V8JA 1B07A 1OZ2A 1QVGS 3MHXA 4OP0A 2E70A 3NTIA 4BE2A 1G3WA 3EG9A 2IPOB 4IIOA 4BBRM 2F5KA 1QLYA 2ECZA 2JTEA 2LTOA 3EG1A 5GAOr 3JCMQ 2MYSA 4TTHA 1YHQA 2AT1B 3GF5A 1WYXA 5IHKA 4LE9A 3V7CA 5IN1A 3VJPA 2HKNA 1H28B 1H8KA 2W10A 3NFCA 3JCMV 1SF9A 1SRMA 1RAHB 5KYUB 2RHUA 3H6ZA 1RAEB 1RL2A 1K4US 1UGQB 4DBFA 5DLOA 2H8HA 2RI3A 3MP6A 2KROA 1Q86C 1ZQ1A 2VWFA 2DTHA 3CCSA 3HBLA 4BBSM 3EFRA 4EOLB 3CBPA 3G71T 1FVVB 4FX3B 3SHWA 4PJOB 3M0PA 3EGDA 3MY5B 5A0GA 4JRKA 3HB9A 1KJWA 5GMKj 2QYZA 2IVXA 3CCRQ 2QA4A 4RTTA 4CRIA 5GAMf 2XHCA 2J06A 4F7NB 2EJFA 1BK2A 3FLGA 4LN2A 3M0UA 5I2MA 2VASA 4EC9B 5CKHA 3UA7A 2IW9B 1T3SA 3QYBA 4F7UB 3RKWA 5C0MA 3QHWB 2DO3A 4HCBA 4M7AF 1X6GA 1ARKA 1IZ6A 1F5QB 4BUGA 2R7GA 1Q95G 5BNJB 1MMDA 1W70A 2O2OA 3CMAT 1OI1A 1H3ZA 1K8AC 5GMKl 1P92A 2GQIA 4FCYA 3I9QA 4AKHA 1OKWB 1GFDA 3MP8A 2PMIB 2RJCA 3VKGA 1ABQA 5LJ3d 1UJYA 4F7JB 1OPLA 2R58A 1YIJT 5FRNA 2FRWA 1YI2A 4BDZA 1PCXA 2IIMA 3CD6A 3E2UA 1EFNA 3H4CA 4BCJB 4R56A 4E7LA 3FJPA 2FPEA 4JRQA 1MNEA 1M90R 3EFSA 1WHJA 3L2QA 1Q86R 2KRMA 1WDXA 3BE3A 4ANJA 5CEIB 2ABLA 2DXUA 4IUVA 3BG5A 4J9EA 1M3CA 3CPWS 2I40B 1ZSGA 3E19A 3DKMA 1Q81U 2AHJB 5ECAA 5AT1B 4ELZC 1NPPA 1PG5B 4KUDK 2K3XA 5A0LA 5LQFB 5HK0A 2D8JA 4J9IA 3CMET 5EFQB 2DILA 4AKIA 3OYEA 1BCMA 1KD1R 1KQSS 4DBHA 3I35A 4C92D 1RAAB 3X26B 2K5IA 4M7DC 2ENMA 3GP8A 5KYXB 2RI2A 2A37A 1M1KC 2UZEB 1S72T 1TH7A 4MFDA 1G8XA 2LP5A 3JCMW 4KT0E 2L3RA 2WSFE 1VQ4T 2DL7A 1MUZA 1GUXB 1H25B 3ZFJA 1YIJQ 1VQPA 4LOCA 3CC7A 1QWFA 3S6WA 1HYOA 3I56T 3QO3A 1GFCA 3EFOA 2HEQA 3QDRB 1U8RA 1OI9B 3LQ5B 1TD6A 3C4SA 3CCMT 2KE9A 1IO6A 1ZHIA 3UF4A 1VIEA 1D3BA 4C8QA 3M4GA 3GTMS 2JOYA 2BZ8A 1VQ6T 4HA8A 4BCPB 4BE1A 2VVKA 4GBQA 2RJEA 2NWMA 2E12A 2GCXA 4IUPA 1BB9A 3CCVT 1I1JA 2X4YA 3OYCA 1TWBA 4FSXA 2RHIA 2F2VA 4PJOC 2X3WD 2E6NA 3TEEA 2KEAA 2RQTA 4C5GA 2LX9A 2RJFA 2YRCA 4JRPA 1OQKA 2DFUA 1S72Q 2PZ1A 1YP5A 3V8LA 3EG3A 3NTHA 1VQ4Q 1PHTA 2KT8A 4KGZB 2DD5B 4C8QC 3VUBA 2BTTA 4M75B 2AZVA 3I56Q 4JX4A 3OS2A 1AHJB 2E65A 3QZ9B 1RI9A 3H8ZA 2EPDA 2MMPA 1PKSA 4MMLA 3RKYA 2SEMA 4BDYA 4XK8E 2CYZB 3AHUA 1C1AA 1MHNA 4VUBA 4HCZA 4PL6A 1QP2A 5GAOp 1VQOT 1M8MA 3L2ZA 1D0ZA 3M9QA 2G3RA 2K9GA 2ROTA 4PKCC 4EPCA 4XTZA 2KT1A 2Y4YA 3CCVQ 2ZPHB 2RQRA 1Q82C 2RK1A 1OV3A 5GAOl 1BIAA 2VXFA 3OYAA 3QDFA 2O4XB 2CZ0B 2OI3A 5GMKh 2J6KA 4PLLA 3FDRA 3NDQA 3OW2S 1VQ7A 4L59A 4MMKA 2WIPB 2YRVA 3QPHA 3E9FA 1RLQC 2D0QB 1URCB 2BKDN 2JVVA 3UATA 5DM7R 4EOIB 3EH1A 4J6WA 1RI0A 3G1JA 3VV0A 3DDPB 3CCEQ 2DRMA 2QK0A 2LNVA 2BE9B 5KE2A 2RD1A 5GAN7 2QEXA 1O9SA 5GANh 3EG2A 5ACBA 4LUDA 3CPWA 1G2BA 1UFFA 4PJOE 3X20B 3CCUA 3RR6A 1SSHA 3X25B 5KYYB 3C0CA 1E9HB 4D8KA 3CC4A 3F5XB 1QKXA 1RAFB 4AFSC 2HZYA 4FM4B 1JKWA 1B7TA 2L3QA 3RDVA 2YUQA 1TG0A 1SRLA 4GLKA 4AFZC 2K5FA 4C8QE 1N8RU 3REAB 4PFOA 2RM4A 4M7DG 4OMMA 2BS4A 5IH2A 1H1QB 2WPAB 5CKBA 1VQLA 4XTUA 3PTAA 1BU2A 1IGUA 2ESWA 2CUBA 2C0OA 2ZGWA 2DL4A 5EG2A 3QXEB 4CC2A 1UG1A 4Y28E 4EOKB 2PHGA 4NL3A 4KGVB 1WLPB 5I5ZB 1UJ0A 3PIPA 2GFAA 3NPFA 4E7JA 3PIOA 1PWTA 2A0FB 4C0GA 2LCSA 2MAMA 8ATCB 1MMNA 1O9KB 3G6EA 5FU6C 2G77A 4M78B 4F6UB 4PFZA 3G4ST 5KCOA 2L2PA 4FU6A 4JUVA 1C9BA 3MP1A 3JB9F 4XU1A 3NMZC 1YITA 4N4GA 1NBEB 2YSQA 4X9CA 2CZ1B 4PJOG 4DA4A 1YJ9Q 1X43A 2BUDA 4BCHB 2OTLA 5GAOq 2KR3A 1UGRB 1XJWB 1JO8A 4R0KA 4M75C 3CCJT 4PJJA 3OYBA 5KH6A 3K7AM 2K6DA 2CT3A 2L89A 3JCMX 4DEYA 4FW1A 1WA7A 5EC7A 2JMCA 4C8QG 4F7LB 4ZGEB 2CCHB 5HCKA 4EORB 4CC4B 3M03A 4J6YA 5CQYA 1EIFA 4C92F 3A8GB 4PK4A 3TW7A 2CZ7B 2LZ6B 4J9FA 1WPYA 2CSQA 2VC8A 1FKMA 4HL4A 1SKUB 3CCLA 2Z0WA 5GMKi 2WHBB 1VQMA 1I07A 2VGMA 3A8OB 4MZMA 2RHZA 2L3PA 2C4GB 4Y91A 2B86A 3CCQA 1GCQA 3J81E 2CP2A 3PMTA 2DM1A 3M56A 1JEGA 4FL6A 3G4SQ 4BCMB 4M77F 9ATCB 2WJ9A 2CJMB 1PD0A 1MMAA 1ZUUA 3MO8A 1XNIA 4XU3A 2K57A 1VQ5A 1NZ9A 4BCQB 4E7IA 4E6RA 3H0FA 3VYGA 4YTLA 2HBWA 2X51A 1KXUA 4EMKB 2QQ8A 1N5ZA 1VQKT 4I3ZB 2HBPA 2GFUA 2EIFA 2DE0X 1JBMA 1D1BA 2QTVA 3OW2A 3JCMJ 5L23A 1JRIA 2LQWA 2E10A 5FWBA 4YOSA 4XAXB 3T9NA 5KYWA 4M7AB 1RLPC 1X6BA 1ENWA 3VKIA 2EAYA 1P5EB 4QW2A 3QHRB 3V8KA 1YJWT 5GANd 3MEWA 2PK2A 1YJNQ 4YC3B 5I11A 3M0SA 4ELJA 2XIDA 5LJ3f 4OF1A 1UNGD 5HBHB 3CEYA 2OAWA 3DB3A 2DD4B 1PM3A 3PNWC 3OYHA 1M4ZA 4M75E 1K76A 5LJ3g 2YLCA 3N5BB 3QYHB 3G71A 1HD3A 2DF6A 3RERA 4RMOA 1VQ9Q 2DEUA 1NLOC 4O5VA 4MDXA 2JM8A 4ZN3A 3DTOA 1VIFA 1QLBA 3M53A 1AWJA 1VYWB 3NTKA 1Q7YU 1NEGA 2DXCA 4HNTA 1O75A 4UN0A 2AKLA 3L2UA 1K73R 2ZZDB 2ZPFB 1W2BS 2A7YA 4CFNB 5CO7A 4LDVA 1CKBA 2DIGA 1ACMB 2A36A 1OU8A 2COYA 4OMQA 1VYUA 2GF7A 1UGSB 2KYBA 5EJCA 1RUWA 4E7SA 4A53A 4M78C 1T0JA 3CMAA 1G3TA 1LVKA 4RTZA 2CH4A 3G33B 2W9ZA 4HNUA 5HK3A 2HAXA 2WXVB 5CR2A 1KQ1A 1JU5C 2IN3A 1ZSZB 4RTXA 5CIUA 2QDJA 1VQNQ 2KI7A 2DMEA 2PUOB 1UGVA 1TUCA 3OSSC 3QSUA 2ED0A 4FSSA 1OIYB 3DB4A 3PGGA 1VYVA 2D1XA 2EQJA 2YUPA 4E7KA 4QKUA 5IHYA 4N4HA 4EMHA 3CCRT 2CT4A 2YDLA 3MEVA 1OL2B 2Y90A 4IUUA 2CDTA 4M75G 4QVDA 4JZ4A 3S3MA 3G7ZA 3MI9B 1KHIA 2WMAB 4A54A 1FINB 3RESA 4EC8B 1BYMA 3L1AA 1H1PB 4V2SA 2JW4A 3ER0A 1HSQA 4FT2A 1VQ8T 4IUQA 1JXMA 1PSFA 3C95A 2P4RA 4HVVA 1HK9A 2J6FA 1D1AA 1QVFS 3QYGB 1JJ2P 1K9MR 2M1HA 2X4JA 2C5XB 1GH6B 3LLRA 4MZPA 3CMEA 1U3OA 2XICA 3RUXA 4F6WB 2EJGA 3PFSA 1M2OA 1WJQA 1FWZA 3A8MB 4OGEA 1M2VA 3OYMA 5CKEA 2KBTA 1XO2A 2UUEB 3OYNA 3JCMb 3OBWA 1ZUYA 2KR6A 3ULRB 1WGSA 2O9VA 1M90C 1N27A 5DQVA 4EMKC 1WHHA 3MIAB 3JB9I 3POMA 3QKJA 4FW2A 1T3LA 2DERA 2RQWA 1N4MA 2JMAA 1K8AU 2LC4A 4M7AC 1YWOA 3ME9A 1R8OB 1AWOA 2J05A 4J9BA 4G6LB 3CCMA 4QVZA 4AG2C 2M9UA 4X1VA 1H1SB 2LW4A 2EYWA 2YUOA 2K2VA 3QUIA 5HQ0B 1KD1C 1XTDA 3VS7A 1VQ6A 3EJ1B 1H24B 3DOGB 3M0TA 4RG8A 1SHFA 4LDUA 3M5AA 3QHSA 3JCMg 1VQ8Q 5GMKe 5FROA 5KCHA 4FIBA 2EQUA 2HQXA 4HCCA 4PJMA 2HL3A 3C94A 5GANj 4Z88A 1NG2A 4GLMA 2V1QA 1JXOA 4ZGJB 4C5HA 4MFEA 2CP7A 1ABOA 5L8RE 2WACA 3JCMh 4R55A 2OTJA 3V7RA 2I0NA 5CCAA 3TNIB 3EGXA 5HBJB 4K11A 1SEMA 1X2KA 5CKFA 4OB1B 4OR5B 2KRNA 2EYZA 3KUFA 1YCSB 4BCND 2DEQA 3HP9A 2EBPA 2QGFB 2EVRA 3VYHB 4XTWA 3LWHA 2LJ1A 4M7DA 3I55T 1TUGB 1YBYA 3JB9D 2CGHA 3BDLA 4RUGA 1GXIE 3PVLA 1M1KU 3CXCP 2O31A 1NM7A 5HVYB 2JGZB 2G9XB 4TVRA 1ZA1B 1W2BA 5ICPB 5C6SA 4JJBA 4ZN1A 1KC8R 3M55A 1VQOA 1KG1A 3DJBA 4M78G 3JSCA 3QWLA 1D1CA 1IHWA 3SWNB 2F2WA 2CSIA 3TREA 3KHIA 1UNLD 2JNGA 2K5LA 1IGQA 2PTKA 2YHTA 2KVQG 3A98A 5D6WA 3TSZA 1U1TA 1H26B 3OMCA 5KYUA 2CKKA 1SPKA 1NLPC 3EHRA 2EFIA 1I5LA 1WHKA 5LJ5h 5IXFA 2VYTA 3HSBA 4RCCA 3BHUB 4YOZA 2PNIA 2RH2A 1GBRA 2HD0A 1YHQT 4PJOA 1AWWA 2EKOA 4LDYA 2IW6B 1X27A 1K0SA 3LW5E 3WVDB 2LDMA 4M77D 1PNJA 5GMKm 2OJ2A 3I55Q 3ZEHA 5M9OA 1N9RA 2K7AA 4ZGDB 3PO3S 1I8FA 2K4YA 3TNWB 4L5GA 4A63B 4JS4A 3QJ6A 1QVFA 2FO0A 3LGLA 1U06A 3V7SA 4HNVA 4F7UA 2HSPA 5D6XA 1Z9QA 2XK0A 3LH5A 2VKNA 4CFUD 2JZ2A 2M0YA 1OX8A 3BW1A 1MV3A 1OIUB 2COWA 3X24B 3TN8B 3HRUA 2JUFA 2QTXA 5LL6S 4BB7A 4JJNK 2GTOA 2KGTA 2DETA 4C92B 2DTOA 4LXCA 4M7AG 1AWXA 2K2MA 1BCOA 3EG0A 2YUNA 1Q82U 1YHQQ 4BY6B 4MIMA 3UWNA 3CCET 1JOWA 2QFZA 4ESRA 4E7ZA 3QYEA 5IHNA 4O6JA 4Z89A 1FXXA 2A28A 4FYYB 5IXBA 1R77A 3TW6A 1NE8A 1QCFA 4M77B 2FG0A 5HNBB 4M7DE 5GAN6 3JCMd 3CCSQ 1HJDA 2AIRB 1BI3A 1ZBJA 4J8OA 3CD6T 4C0DB 4PJOF 4A4KA 1WIEA 1DJ7B 4WCIA 5FWCA 5I22A 4OB0B 1Y57A 2QA4Q 1W4SA 1PSEA 1UECA 2FZCB 4X34A 1TFBA 2A3LA 2GQVA 1MMGA 4CFXB 3CCJA 3HFNA 5KYXA 3MJXA 4CFUB 2DPPB 2VB6A 4JLGA 1Q81R 4C8QF 1C6VX 1QVGP 5GANf 4BCKB 4LD9K 4EOMB 1GUXA 2C6TB 3VS6A 2NYSA 1CSKA 3SDZA 2XU8A 3HTRA 5GANg 1X75C 3H0IA 2EYQA 2AZSA 4OMOA 2HL5C 4PNOA 5GAOn 2LVMA 1GY3B 1SSFA 5LJ3e 3R6OA 2QQ9A 4IUTA 3THKA 2HQEA 1UB4A 4F7SB 3GBQA 4CRLB 5FU7B 3CC7T 4KRDB 3OS5A 3QZ5B 2DJQA 3URGA 4ELYC 2KSSA 2CH4W 4JX5A 1YI2Q 1OKVB 4NOYA 4XTXA 2BS3A 1Z9ZA 3CD6Q 1YJ9T 5LJ5d 4QVCA 3OYIA 3MEAA 4JJDA 4QQ6A 3PT9A 2YLBA 4ORZA 4E7HA 4LUEA 1VQKA 2L3SA 1LOJA 4F7UE 4C0FA 4Z8AA 1PKTA 1G3SA 2X9HA 3PE0A 3A5ZB 2DNUA 5IAYA 2NUTB 3HHTB 4F14A 4A4EA 1YJWA 5AYFA 4Z02A 2DD5A 2MI6A 2JXBA 4M75A 3TVTA 5FLXE 2WMBB 2I53A 2W96A 1IRXA 2QGGA 2E5QA 1VYTA 3JB9J 3HRTA 1D0XA 1KIKA 3M0QA 3QJYA 2MIOA 5A0DA 4RTUA 1I4K1 5CVIA 2HCKA 2W9FA 4OVAA 2PVGB 4F04B 2R5AA 1VQPQ 3CC7Q 2WIHB 1GCPA 5J3BA 1QP3A 5GAN3 2V8JA 1A0NB 4C92C 2LNHB 1KHCA 1G3YA 1N8RC 3WXMB 2O4XA 5KYNA 4LD6A 3A8HB 1GRIA 3UT1A 2W99A 1YCYA 3EOCB 3M57A 5GJVB 3INZA 3LH0A 5DLQE 2EYYA 1YJNT 2DXBB 2E5KA 1BBZA 3F70A 2ZPEB 4F7UG 2C0IA 3P8BB 4QQGA 1E7OA 3HZJA 1IREB 4KULA 1Y7XA 3REBB 1KQSP 3IQLA 2HSEB 4C0DC 3FC3A 1B34B 1BIBA 2NUPB 3FRNA 1Y96B 1WI7A 4M4ZA 2MCNA 4IMYB 3L42A 3JV3A 1RACB 2DBKA 5KYYA 3L2VA 2EYXA 2H3EB 5GAN8 4FT4A 2P4TA 1OL1B 3CBOA 1IHVA 1TOVA 1VQ9T 2JM9A 3CCRA 1K73C 4F70B 2R5MA 4M75F 4OGCA 3AT1B 1WHLA 3OSVA 2EUFA 3JB9H 4OGRB 2KXCA 2DYBA 1RAGB 1UDLA 3HO8A 5GAMj 3CCUT 1H641 3S3NA 3JCMe 1MV0B 2RMOA 1TS9A 4YOOA 3OYKA 2CP0A 2CP6A 2DTIA 1H4LD 3ASKA 1N8RR 1VUBA 1TXQA 3EHQA 4AI6A 2E41A 1Y07A 4CI0C 1EX4A 4KH0B 1YN8A 3P8DA 2DJZA 3A1PA 3OS1A 2DRKA 2C0TA 3RBBB 3O0GD 2OAUA 2EQMA 2UZBB 1NJIC 1VQNT 2C5OB 1O9KA 2XKOC 3QWYA 2V8KA 4NL2A 4M78A 1F1BB 3EG9B 4OMNA 2GBQA 3VRYA 4FYVB 1VQ7Q 3WVEB 1AT1B 4OMLA 2DKGA 1FMVA 3BHVB 1JQQA 3J80E 3B57A 4BI8B 2RK2A 2KQWA 1WQ7A 4J9HA 5LJ5j 2EQIA 3ZBDA 1WFWA 2L0AA 1E7PA 1K9MC 3H41A 4UC4A 2F5TX 4M7DD 4HVWA 4CC7A 2D0NA 2QEXQ 3G6ET 1WQWA 1LPLA 2DZ9A 4JS5A 3CCUQ 2JS2A 3CC4Q 1VINA 3EGDB 1W6XA 1QQJA 1YITT 2HKQB 3MY1B 3MEUA 2YT6A 2WSCE 3BG3A 5LMKB 1WXUA 3TU4K 1M5Q1 2MF2A 5IT9E 1VQLQ 3BY7A 2EGEA 4AFUC 5D7UA 1BI1A 3BG9A 1YIJA 1BKBA 2GGRA 1GBQA 1WZOA 3OW2P 3BLRB 2F2XA 2CS7A 4WF2A 1OEBA 4HT8A 3FIFA 4RTVA 3I55A 4C92G 2YWWA 1X01A 1VOLA 2XI9A 3R6NA 1NJIR 1K1ZA 4PJOD 2FEIA 4EMGA 2UZLB 1NEBA 2A08A 4EMKA 3UDCA 1Y0MA 3EAEA 1M90U 4KRCB 1AZEA 1Q86U 3CCQT 4C5EA 2FPDA 4N0AC 3G6EQ 3GOXA 3E9GA 4M7AA 2P84A 3VS3A 1TTHB 3M54A 4C8QD 1VQ5T 3Q1JA 1KQ2A 3ZL7C 4JLIA 1YITQ 2EGCA 5CYIB 3TNHB 1VOMA 4II1A 4A4GA 1NYFA 2KMTA 4BCIB 2OTLQ
chains in the Genus database with same CATH topology
1O9SA 2HD0A 1YHQT 1LNXA 5GANh 1KD1U 5KE3A 4PJOA 3CPWA 2EKOA 4LDYA 2XDBA 4PJOE 2DD4A 3X20B 3OQ5A 3QBYA 5GAN4 3CCUA 3X25B 3LGFA 3LW5E 2RJDA 3WVDB 2LDMA 4MZTA 1S72A 1K9MU 4M77D 2PU9B 5GMKm 1VQ4A 2FVUA 4JX6A 5FU7C 3ZEHA 5M9OA 2R57A 3CC4A 1N9RA 5GAMe 3X28B 3SFMA 3PMIA 4ZGDB 3HL8A 4FM4B 1I8FA 2K4YA 4L5GA 2P0KA 1UEBA 5CQXA 2PUKB 5HY6A 3I56A 1MGQA 3QJ6A 3CXCA 4JDSA 4JS4A 1WJSA 4IKFA 3C12A 1KC8C 4GLKA 4C92E 1QVFA 2K5FA 3LGLA 2LT1A 1WNLA 2E1HA 4C8QE 3V7SA 1N8RU 4KUIA 4HNVA 3VU3C 2RM4A 3CPFA 4M7DG 4F7UA 2LT4A 4M78E 2BS4A 3HFOA 1V29B 5D6XA 5I2SA 2QQSA 5CKBA 1VQLA 2XK0A 4XTUA 3GNFB 3SD4A 2QQRA 2L5QA 4B9XA 2P0PA 3PTAA 4ZTFA 3JCMf 3KBGA 2JZ2A 4X9DA 3BW1A 2ZGWA 3P8HA 5EG2A 3QXEB 2RHXA 3JCMP 4XTVA 2ZZDA 1BI0A 3X24B 4Y28E 2MWPA 1X6OA 2P0QA 3J7AF 3HRUA 4NL3A 4M77E 1M9SA 2JUFA 2QTXA 4QQDA 4P5NA 5LL6S 4BB7A 4JJNK 3CCVA 4GY5A 1JJ2A 3PIPA 2GFAA 2ZPBB 5HKCA 4E7JA 2KY9A 3PIOA 2XD0A 4ME7A 5GAN2 2X4XA 4C0GA 2RB6A 4IURA 4C92B 2B8AA 2DTOA 2FHDA 2JN0A 1XQHA 2IG0A 2MAMA 3E1SA 4M7AG 4C8QB 1D3BB 4ATOA 4DQ2A 2DXBA 5LJ3h 5GAMg 3G6EA 5FU6C 5LJ5e 1XOVA 3M4YA 4BY6B 3JB9G 1Q82U 3CC2T 4MIMA 2G77A 4M78B 3UWNA 3G4ST 5KCOA 4FU6A 3L2WA 3CCET 4JUVA 3CCSA 3GLXA 2OTLT 2QDYB 3MP1A 2QFZA 4N0AA 5CAIA 5GANe 3LX7A 3JB9F 3QYEA 4O6JA 2DXTA 4XU1A 3OYGA 1B34A 3A8LB 5GAMh 1YITA 1Y96A 4N4GA 1FXXA 3KXTA 3TW6A 3CC2A 4X9CA 2CZ1B 4PJOG 4DA4A 1NE8A 3CCEA 2BUDA 4M77B 2OTLA 5GAOq 4M7DE 5GAN6 3JCMd 2QQBA 5FRMA 1UGRB 2M16A 1BI3A 4J8OA 4M75C 3CCJT 3M59A 3OYBA 3CD6T 4C0DB 4PJOF 2BIVA 5KH6A 2L89A 3JAME 3JCMX 3GNGA 5A2QE 4J83A 4A4KA 4E47A 3S3OA 1DJ7B 1U1SA 3MCAB 3VUZA 2L8DA 2CZ6B 4OB0B 1FX7A 5GAN5 1W4SA 1PSEA 3M58A 4X34A 4C8QG 2GQVA 2A3LA 4RCBA 4B9WA 3CCLT 3DLLA 4ZGEB 1UGPB 5LJ5f 3CCJA 3QIIA 1M1KC 1VQMT 3HFNA 4J6YA 5CQYA 1EIFA 4C92F 3A8GB 2FYKA 4J6XA 2RHYA 2DPPB 4JLGA 2Y4XA 3TW7A 2CZ7B 2RA2A 4BD3A 4C8QF 1Q7YC 4J7FA 5D6YA 5GANf 4OB3B 1WPYA 2EJ9A 2QQAA 4LD9K 5LJ5g 2VV5A 4M78F 2VC8A 1FKMA 4HL4A 2X4WA 3CCLA 1HXDA 1KC8U 5GMKi 4M7AE 1VQMA 3OYYA 2VGMA 1QVPA 3A8OB 2XU8A 4MZMA 3SDZA 4J5YA 4L6V5 4M7DB 2RHZA 4M77G 3GPLA 5GANg 4DOVA 1X75C 4BI4A 2DVEA 2EYQA 2XDPA 4Y91A 3CCQA 4PNOA 2BS2A 2PVOB 3J81E 3PMTA 2ZCFB 3META 3M56A 5GAOn 4FL6A 2LVMA 3JRZA 3OS0A 2NLUA 4M77F 4DOWA 2ZPGB 2WJ9A 2LCCA 3OY9A 1SSFA 4Z6YA 2E6ZA 2V8IA 5LJ3e 3R6OA 3V8JA 2QQ9A 3OYJA 3MO8A 1VQ5A 4IUTA 1XNIA 4XU3A 1OZ2A 2K57A 2HQEA 1UB4A 1NZ9A 2DIQA 3MHXA 4OP0A 4E7IA 1QVGS 2D6FA 2E70A 3NTIA 4BE2A 5J26A 4YTLA 1G3WA 5FU7B 3VYGA 3CC7T 3OS5A 3QZ5B 4EMKB 3URGA 2QQ8A 2FB7A 4BBRM 2F5KA 4ELYC 2KSSA 1VQKT 4M75D 4JX5A 2HBPA 2GFUA 2LTOA 5GAOr 2EIFA 3JCMQ 1YHQA 1JBMA 4NOYA 4XTXA 3GF5A 2BS3A 3OW2A 3JCMJ 3V7CA 5IN1A 1JRIA 2E10A 4M6VA 2K3YA 4XAXB 3T9NA 1YJ9T 5LJ5d 3VJPA 4QVCA 4M7AB 3VKIA 3OYIA 3CCST 3NFCA 1N6AA 3MEAA 3JCMV 4QQ6A 2EAYA 4XTYA 2KDSA 2YLBA 3PT9A 4E7HA 2KAFA 1VQKA 2X35A 4QW2A 2RHUA 3H6ZA 3V8KA 1YJWT 1LOJA 2M0OA 1RL2A 5GANd 1UGQB 5DLOA 3LYIA 4F7UE 2RI3A 3MEWA 3TCJA 4C0FA 1Q81C 1G3SA 4KBMB 3MP6A 1YJ9A 3A5ZB 1Q86C 3HRSA 1ZQ1A 5IAYA 2DTHA 4ELJA 3HBLA 2WSEE 3LWIA 3HHTB 4BBSM 3EFRA 4M7DF 3CBMA 1QVGA 2XIDA 3CBPA 5LJ3f 3G71T 4OF1A 4A4EA 3CEYA 5AYFA 1YJWA 4PJOB 5A0GA 2LQKA 3DB3A 4JRKA 2DD4B 4Z02A 3HB9A 2DD5A 5GMKj 3OBYA 2MI6A 3PNWC 4M75A 3OYHA 1M4ZA 5FLXE 4M75E 2IVWA 5LJ3g 2YLCA 3N5BB 4BI3A 2QA4A 4CRIA 3QYHB 2XHCA 3OB9A 5GAMf 3G71A 2E5QA 2EJFA 3JB9J 3HRTA 3RERA 3FEOA 3FLGA 3RMSA 3QJYA 5I2MA 4RMOA 5CKHA 5FU6B 5A0DA 4O5VA 4MDXA 1I4K1 5CVIA 3QYBA 1G5VA 4F7UB 3RKWA 4OVAA 4ZN3A 5C0MA 2OTJT 2DO3A 4HCBA 1VIFA 2PVGB 1QLBA 3M53A 1OYXA 1N9SA 2R5AA 4M7AF 3NTKA 1IZ6A 1Q7YU 2DXCA 4BUGA 2HNIA 5J3BA 1QP3A 3OA6A 3OYDA 4HNTA 1O75A 2V8JA 5GAN3 3CMAT 3L2UA 1OI1A 1H3ZA 2ZZDB 1K8AC 3G4SA 5GMKl 2ZPFB 1W2BS 2A7YA 1P92A 1KHCA 4XU0A 5CO7A 1G3YA 4LDVA 4C92C 1N8RC 4AKHA 2DIGA 1YI2T 3WXMB 2O4XA 3MP8A 2GF7A 1UGSB 1I81A 2RJCA 5EJCA 3BDUA 3VKGA 3SWNA 4A53A 5LJ3d 1ZBXA 4M78C 4LD6A 3CMAA 3A8HB 4A4FA 1G3TA 3UT1A 2R58A 1YCYA 1YIJT 5FRNA 4LDXA 3M57A 4HNUA 5HK3A 2HAXA 3INZA 3LH0A 1YI2A 5DLQE 5CR2A 4BDZA 1KQ1A 1YJNT 2DXBB 5GAMd 5CIUA 2QF7A 3RMQA 3CD6A 3F70A 2ZPEB 2QDJA 4F7UG 3DL1A 3H4CA 2PUOB 3P8BB 4J7IA 4R56A 4E7LA 3FJPA 3OSSC 4QQGA 3QSUA 3HZJA 1IREB 4KULA 1Y7XA 3DB4A 4JRQA 3EFSA 3PGGA 2VGNA 3L2QA 2EQJA 4C0DC 4F7UF 1B34B 1BIBA 3HKSA 3FC3A 1BI2A 3FRNA 4OMFB 1Y96B 1YJNA 3UPUA 4E7KA 2XG8D 4N4HA 3L42A 4EMHA 3CCRT 2DXUA 3MEVA 3BG5A 4IUVA 1VQLT 2Y90A 3L2VA 4IUUA 3CPWS 2H3JA 4M75G 4QVDA 1WJRA 3E19A 3BFMA 3DKMA 3G7ZA 5GAN8 3S3MA 1Q81U 2AHJB 1KHIA 1QW1A 4A54A 4FT4A 2P4TA 4RG2A 3SWNC 3RESA 3CBOA 4ELZC 1NPPA 4KUDK 2K3XA 5A0LA 3L1AA 5HK0A 1VQ9T 3CCRA 4V2SA 1BYMA 5LJ3j 1K73C 3CMET 2R5MA 4M75F 3ER0A 3OYEA 4AKIA 4A4HA 4OGCA 2DZCA 4FT2A 1VQ8T 4IUQA 3OSVA 5CKDA 1PSFA 3O8VA 3C95A 1KQSS 1M8VA 1HK9A 3JB9H 4C92D 2EWNA 2LCLA 1M1GA 1QVFS 1VQPT 3X26B 2K5IA 3QYGB 2M1HA 2X4JA 3GP8A 4M7DC 1VQ9A 2RI2A 3HO8A 5GAMj 3LLRA 4M78D 4MZPA 1H641 3CMEA 3CCUT 1TH7A 4BACA 2XICA 3RUXA 3S3NA 4MFDA 2QI2A 3JCMe 1S72T 3JCMW 2EJGA 4KT0E 2L3RA 2WSFE 3PFSA 1VQ4T 1WJQA 3ZFJA 2JTMA 1FWZA 3A8MB 4OGEA 1NPRA 3SB2A 2DTIA 3OYMA 5CKEA 4LOCA 3OYKA 3CC7A 1VQPA 4NC6A 4OB2B 3S6WA 3OYNA 3I56T 3JCMb 4MDWA 3QO3A 3ASKA 5J39A 1VUBA 2EQKA 3OBWA 4AI6A 4C0ZA 2KR6A 1Y07A 2E41A 2PQWA 3QDRB 4HKEA 3JCMc 1WGSA 4CI0C 1U8RA 3P8DA 2DJZA 1N27A 1M90C 3DLMA 4EMKC 3OS1A 3C4SA 3CCMT 1JJ2S 2OAUA 2QXFA 2EQMA 3JB9I 1ZHIA 2E64A 1KQSA 4C92A 3QKJA 2ZPIB 1NJIC 4BE0A 1VQNT 1VIEA 1D3BA 2F69A 4C8QA 1K8AU 2LC4A 2XKOC 3M4GA 2V8KA 4M7AC 3ME9A 2JOYA 1R8OB 4NL2A 1VQ6T 3VYGB 4HA8A 4M78A 3L2RA 4BE1A 3CCMA 4QVZA 2M9UA 4AKGA 2FL7A 2RJEA 5GAOm 2E12A 4JRIA 2GCXA 4IUPA 3WVEB 1VQNA 2K2VA 2DKGA 3QUIA 3CCVT 2X4YA 3FB9A 3OYCA 4NS5A 1KD1C 3J80E 4BI8B 1XTDA 2KQWA 1WQ7A 2RK2A 4FSXA 1VQ6A 2I2LA 5LJ5j 2RHIA 4M77A 4RG8A 4LDUA 3M5AA 3QHSA 3ZBDA 1E7PA 1K9MC 4PJOC 3JCMg 2KK4A 4UC4A 2F5TX 5GMKe 2RO0A 5FROA 5KCHA 2E6NA 3TEEA 4FIBA 2EQUA 2HQXA 4HCCA 4M7DD 3C94A 4C5GA 3G6ET 2C06A 1WQWA 5GANj 2DZ9A 2LX9A 2RJFA 4JRPA 2DAQA 2O01E 4JS5A 4ZTJA 2RI5A 4ZGJB 4C5HA 4MFEA 5L8RE 2WACA 3JCMh 4R55A 3V8LA 2OTJA 3V7RA 3NTHA 5DY9A 5CCAA 3QG1A 4Q5WA 2DD5B 4QSHA 4C8QC 1YITT 3VUBA 4M75B 5CKFA 4OB1B 3MEUA 3KUFA 4BY6C 4JX4A 3OS2A 2DEQA 3HP9A 3OMGA 2MWOA 1AHJB 2WSCE 2E65A 2PVDB 3QZ9B 3VYHB 5I21A 3H8ZA 3BG3A 2DK3A 3TU4K 2KMGA 1K73U 2MMPA 1M5Q1 2MF2A 4XTWA 4MMLA 2JTFA 3RKYA 3LWHA 5IT9E 3BY7A 4BDYA 4M7AD 4XK8E 4M7DA 3I55T 2CYZB 1BI1A 2QA4T 3AHUA 1YBYA 4M77C 3RIRA 3JB9D 2CGHA 3BG9A 1YIJA 1BKBA 1MHNA 3BDLA 4VUBA 1GXIE 4HCZA 4PL6A 1QP2A 5GAOp 1VQOT 1M1KU 2DXCB 4HLQA 2CS7A 4WF2A 2LQ8A 4LDWA 4TVRA 4HT8A 3L2ZA 3M9QA 2G3RA 3FIFA 4PKCC 4EPCA 1W2BA 4PLIA 3OYLA 3I55A 5C6SA 4XTZA 4ZN1A 4C92G 1X01A 2Y4YA 2XI9A 2ZPHB 2D9TA 3M55A 5GAN7 2RK1A 1Q82C 5GAOl 1BIAA 1JB0E 4C5IA 4PJOD 1VQ7T 1VQOA 1KG1A 2VXFA 4EMGA 3OYAA 2O4XB 4M78G 2VUBA 3QWLA 2CZ0B 3JSCA 3UDCA 3SWNB 4EMKA 2XDDA 1LJOA 3RKXA 5GMKh 5CK9A 3EAEA 1M90U 3TREA 1Q86U 3CCQT 3KHIA 4PLLA 4C5EA 4N0AC 3VKHA 2JNGA 2K5LA 2YHTA 2VXEA 3FDRA 3GOXA 3E9GA 4HT9A 4N4IA 4M7AA 2KVQG 3OW2S 5D6WA 4XU2A 3CXCS 1VQ7A 4L59A 4MMKA 1NJIU 1U1TA 3OMCA 3M54A 2YRVA 3QPHA 4XQ3A 3E9FA 4RKUE 2CKKA 2QEXT 4C8QD 3GIBA 1VQ5T 2D0QB 2LRQA 3Q1JA 1KQ2A 2BKDN 2JVVA 4JLIA 5DM7R 2EFIA 4EDUA 3HPWA 1I5LA 1Y71A 4II1A 5LJ5h 4A4GA 2VYTA 4J6WA 1RI0A 4RCCA 3HSBA 1OZ3A 3VV0A 1VQ8A 2KMTA 4D6WA 2RH2A 3CC4T 2LNVA 5KE2A 1M1FA 2RD1A 2QEXA 3OYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8G B;  2DPP B;  2ZZD B;  2CZ7 B;  2ZPF B;  2DD4 A;  3X20 B;  4OB3 B;  3WVE B;  3X25 B;  3LW5 E;  3WVD B;  1UGS B;  2PU9 B;  3A8H B;  3A8O B;  3X28 B;  4ZGD B;  4L6V 5;  4FM4 B;  2PUK B;  2PVO B;  2ZCF B;  2DXB B;  2O01 E;  2ZPG B;  2ZPE B;  4ZGJ B;  5L8R E;  2PUO B;  1V29 B;  1IRE B;  2DD5 B;  3VYG A;  3QXE B;  3QZ5 B;  4OB1 B;  2ZZD A;  3X24 B;  4Y28 E;  1AHJ B;  2WSC E;  2PVD B;  3QZ9 B;  3VYH B;  2AHJ B;  2ZPB B;  4XK8 E;  2CYZ B;  1UGQ B;  1GXI E;  1PSF A;  1QP2 A;  2DXC B;  2DXB A;  2WSE E;  3X26 B;  3HHT B;  3QYG B;  2QDY B;  2ZPH B;  2DD4 B;  2DD5 A;  4KT0 E;  1JB0 E;  2WSF E;  3A8L B;  3A8M B;  2CZ0 B;  2CZ1 B;  3QYH B;  4OB2 B;  1UGR B;  4RKU E;  1DJ7 B;  2D0Q B;  2PVG B;  2CZ6 B;  4OB0 B;  2ZPI B;  1PSE A;  2DXC A;  4ZGE B;  1UGP B;  1QP3 A;  3VYG B; 
#chains in the Genus database with same CATH topology
 1KD1 U;  5KE3 A;  1VA7 A;  2G6F X;  2DD4 A;  3QBY A;  1S72 A;  4Y72 B;  4DBQ A;  1LCK A;  1X2Q A;  2PU9 B;  1VQ4 A;  1S1N A;  2R57 A;  2E3H A;  2DBM A;  2EKH A;  3PMI A;  3HL8 A;  4HCK A;  2LX7 A;  3CXC A;  2P0K A;  3I56 A;  1OPK A;  1ZX6 A;  1MGQ A;  4JDS A;  3I5S A;  1WJS A;  2CCI B;  1KC8 C;  2LT1 A;  1WNL A;  1WXT A;  2E1H A;  5IHI A;  4KUI A;  2PJQ A;  4M78 E;  5I2S A;  3CCL Q;  3SD4 A;  2L5Q A;  4B9X A;  1SHG A;  1VQM Q;  3JCM f;  3KBG A;  3VS4 A;  3P8H A;  2RHX A;  2QAZ A;  3CCQ Q;  3TQ7 P;  2ZZD A;  2NUZ A;  1OGU B;  1X6O A;  2MK5 A;  3EFO B;  4EOJ B;  4QQD A;  4II5 B;  4P5N A;  3CCV A;  2RPN A;  1VQ5 Q;  2ZPB B;  1UNH D;  1Q7Y R;  2XD0 A;  4ME7 A;  1FMK A;  2RB6 A;  4IUR A;  2FHD A;  2JN0 A;  1XQH A;  2IG0 A;  3MPU B;  3E1S A;  1KFZ A;  4C8Q B;  1D3B B;  2KRS A;  4ATO A;  3H9N A;  1ZA2 B;  1ZSZ A;  5GAM g;  1XOV A;  3CC2 T;  4PFP A;  4FYW B;  4IIM A;  3L2W A;  3GLX A;  2QDY B;  2CP3 A;  4ZNX A;  5GAN e;  1H3H A;  2DXT A;  2BE7 D;  1PD1 A;  3A8L B;  5GAM h;  2JJ9 A;  3CCE A;  4WTO B;  3TSW A;  2F2C A;  5FRM A;  2QQB A;  3KFV A;  2M16 A;  1I5O B;  2RNA A;  3M59 A;  1EZZ B;  2M51 A;  2KYM A;  3GNG A;  4J83 A;  2V26 A;  4E47 A;  3S3O A;  1U1S A;  1TSF A;  1OU9 A;  1FX7 A;  5GAN 5;  1H27 B;  4AFQ C;  4RCB A;  3O5Z A;  1V1C A;  5FW9 A;  3G71 Q;  1UGP B;  5LJ5 f;  1ZSZ C;  4CXA B;  4J6X A;  2RHY A;  2D8H A;  4BD3 A;  2CRE A;  2IW8 B;  4OB3 B;  2EJ9 A;  4EON B;  2QQA A;  5LJ5 g;  2XMF A;  3VS0 A;  4M7A E;  1MND A;  1M30 A;  4CFM B;  3OYY A;  1QVP A;  2HDA A;  2ATC B;  4F17 A;  4L6V 5;  3VS1 A;  4DOV A;  5HBE B;  4BI4 A;  2XDP A;  2V1R A;  5IDN B;  2BS2 A;  3CC2 Q;  1AD5 A;  2BZY A;  4QT7 A;  3OS0 A;  4BCG B;  3PVQ A;  1E6G A;  2V8I A;  2HMA A;  2RQU A;  3OYJ A;  2DIQ A;  2D6F A;  3CMA Q;  4BCN B;  2LJ3 A;  5J26 A;  2FB7 A;  1WHG A;  4M75 D;  1RAD B;  2PK9 B;  4BY7 X;  4M6V A;  2K3Y A;  1CKA A;  4ROC A;  3CCS T;  3VS2 A;  1N6A A;  1G83 A;  4XTY A;  2KDS A;  2KAF A;  1K8A R;  2X35 A;  2QAS A;  1QKW A;  2M0O A;  2JS0 A;  3LYI A;  3TCJ A;  1Q81 C;  2K3B A;  4KBM B;  1YJ9 A;  4J9C A;  1M3B A;  2X3X D;  3HRS A;  3LWI A;  2QA4 T;  2WSE E;  4M7D F;  3CBM A;  1QVG A;  2LMJ A;  1QCO A;  1QMC A;  2EW3 A;  4JPB W;  1UUE A;  2LQK A;  4ROD A;  1YWP A;  3OBY A;  3NHN A;  2IVW A;  2FZG B;  4BI3 A;  3OB9 A;  4BXX X;  1W2B P;  2C5V B;  4ROE A;  3FEO A;  3RMS A;  1K0X A;  1SG5 A;  5FU6 B;  3CME Q;  1D09 B;  1G5V A;  2OTJ T;  2W2H A;  1YFN A;  4EOP B;  1OYX A;  1N9S A;  1QWE A;  1QMZ B;  1AOJ A;  2HNI A;  4LNP A;  3OA6 A;  2MPX C;  3OYD A;  3FJ5 A;  2O9S A;  2B9R A;  4KGX B;  3G4S A;  4XU0 A;  1ZLM A;  2OX7 A;  1YI2 T;  3NGP A;  1I81 A;  2FRY A;  3BDU A;  3SWN A;  1ZBX A;  4A4F A;  1M1K R;  4PJL A;  1PKD B;  1PC0 A;  4LDX A;  1D0Y A;  2AK5 A;  4EOQ B;  4CFV B;  3CCM Q;  1U5S A;  4RTY A;  2QGS A;  5GAM d;  2QF7 A;  3RMQ A;  3DL1 A;  4J7I A;  1VQ6 Q;  6AT1 B;  2VGN A;  4F7U F;  1QVF P;  3HKS A;  1YJN A;  1BI2 A;  4OMF B;  2CP5 A;  3UPU A;  2XG8 D;  3VRZ A;  1RAI B;  3U23 A;  4CFW B;  2H3J A;  1WJR A;  3BFM A;  2DL5 A;  1QW1 A;  2OTJ Q;  4RG2 A;  3SWN C;  5LJ3 j;  4A4H A;  2DZC A;  3I5R A;  5CKD A;  1M8V A;  1G3N C;  3O8V A;  4J9G A;  2EWN A;  2LCL A;  1M1G A;  1VQP T;  2QG9 B;  1RAB B;  2LQN A;  2DX1 A;  1J3T A;  3EGU A;  4BCO B;  2QDL A;  1VQ9 A;  1FYN A;  4BAC A;  4M78 D;  2QI2 A;  2GTJ A;  2JTM A;  1NPR A;  3SB2 A;  4B6M A;  4NC6 A;  3CQT A;  4OB2 B;  4MDW A;  1AD6 A;  1AEY A;  5J39 A;  2EQK A;  2HQH A;  4C0Z A;  2PQW A;  4HKE A;  3EH2 A;  3JCM c;  1H1R B;  4RTW A;  3DLM A;  1JJ2 S;  2QXF A;  2FPF A;  2E64 A;  1VQO Q;  1KQS A;  4C92 A;  2SRC A;  2ZPI B;  4ELL A;  4BE0 A;  2F69 A;  1ZP2 A;  1KSW A;  4HXJ A;  3VYG B;  3L2R A;  2DMO A;  5GJW B;  4AKG A;  2FL7 A;  5GAO m;  1IXD A;  4JRI A;  1VQN A;  1W98 B;  1M3A A;  1JST B;  2RN8 A;  2O88 A;  5KYW B;  3FB9 A;  4NS5 A;  1W1F A;  2I2L A;  4M77 A;  1OX9 A;  1FMW A;  2KK4 A;  1UE9 A;  1Q82 R;  2GNC A;  2RO0 A;  5L2W B;  2C06 A;  4AMC A;  1M27 C;  2DAQ A;  2O01 E;  1TU0 B;  4ZTJ A;  2RI5 A;  1KK7 A;  4BCM D;  2WEV B;  2DL8 A;  5DY9 A;  3QG1 A;  4Q5W A;  4QSH A;  4BCQ D;  2YXY A;  2J7I A;  4BY6 C;  2KNB B;  1AZG B;  3OMG A;  2MWO A;  1V76 A;  4HVU A;  2PVD B;  1D3U B;  5I21 A;  2MOX A;  3VS5 A;  3CPW P;  2DK3 A;  1K73 U;  2KMG A;  2JTF A;  4EOO B;  2DL3 A;  4M7A D;  3RIR A;  2V22 B;  4M77 C;  1YNZ A;  4BCF B;  2DXC B;  4HLQ A;  2LQ8 A;  4LDW A;  2X1N B;  4PLI A;  3OYL A;  1ZUK A;  2D9T A;  2YRD A;  4DBR A;  1WX6 A;  1JB0 E;  4C5I A;  1VQ7 T;  2LJ0 A;  2ZAE A;  1AIS B;  2DVJ A;  2VUB A;  4F16 A;  2XDD A;  1LJO A;  3RKX A;  2DA9 A;  5CK9 A;  4AG1 C;  3VKH A;  1T0H A;  2ROL A;  1UHC A;  2VXE A;  3QWX X;  4AT1 B;  4HT9 A;  4N4I A;  1H92 A;  4XU2 A;  3CXC S;  1NJI U;  2E4H A;  4XQ3 A;  4RKU E;  2QEX T;  3GIB A;  3BHT B;  2LRQ A;  5IF1 B;  3HPW A;  4EDU A;  2FZK B;  1Y71 A;  2E3I A;  2BZX A;  1OZ3 A;  1VQ8 A;  4D6W A;  2NUT A;  1PRL C;  1WXB A;  3CC4 T;  2UZD B;  3M0R A;  2COZ A;  1M1F A;  4Y92 A;  1K9A A;  3OYF A;  1UTI A;  1LNX A;  4J9D A;  2XDB A;  3OQ5 A;  5GAN 4;  1AVZ C;  2AKK A;  3LGF A;  1QCN A;  2RJD A;  1K9M U;  4MZT A;  2FVU A;  4JX6 A;  5FU7 C;  5GAM e;  3X28 B;  3SFM A;  5CQX A;  5HY6 A;  3CCJ Q;  1UEB A;  1VQL T;  2PUK B;  4IKF A;  3C12 A;  4C92 E;  3VU3 C;  1WHM A;  3CPF A;  2LT4 A;  2BPM B;  4JJC A;  3HFO A;  1V29 B;  2QQS A;  1IB8 A;  3GNF B;  3BLQ B;  2QQR A;  4ZTF A;  2P0P A;  4FYX B;  1GCQ C;  1GL5 A;  4X9D A;  3RGF B;  1UHF A;  4XTV A;  1M2V B;  3JCM P;  1BI0 A;  2MWP A;  2P0Q A;  3J7A F;  2DLP A;  4M77 E;  2F1L A;  1M9S A;  2CUD A;  1JJ2 A;  1BU1 A;  4GY5 A;  2DYI A;  5HKC A;  2JT4 A;  4F6S B;  2KY9 A;  5GAN 2;  4BY1 X;  2RQV A;  3D7S B;  2X4X A;  2B8A A;  1E6H A;  1JSU B;  2EGA A;  4DQ2 A;  2DXB A;  5LJ3 h;  3BLH B;  4D8D A;  5LJ5 e;  3JB9 G;  3M4Y A;  4KRT A;  4EIK A;  1OUL A;  2K79 A;  3EID B;  2OTL T;  3UA6 A;  4N0A A;  5CAI A;  2C5N B;  3LX7 A;  2BKZ B;  1VQK Q;  3OYG A;  1B34 A;  2NUP A;  1Y96 A;  2KXD A;  8AT1 B;  3KXT A;  3CC2 A;  5IDP B;  2J6O A;  4CC3 A;  5DQW A;  1R0C B;  1I0C A;  1OOT A;  3MKD A;  2W0Z A;  1YJW Q;  2BIV A;  4E2F B;  3JAM E;  1X69 A;  5A2Q E;  3RNJ A;  3MCA B;  3VUZ A;  2L8D A;  2CZ6 B;  3DDQ B;  2WFY B;  3M58 A;  4OMP A;  4B9W A;  3EGX B;  3DLL A;  3CCL T;  4NST B;  3QII A;  1TUD A;  1VQM T;  4JZ3 A;  2FYK A;  2Y4X A;  1Q7Y C;  2RA2 A;  4J7F A;  5D6Y A;  1PRM C;  2RF0 A;  2VV5 A;  4M78 F;  2X4W A;  3SEM A;  1HXD A;  1NYG A;  2ED1 A;  1KC8 U;  4J5Y A;  4M7D B;  3H0H A;  4M77 G;  7AT1 B;  3GPL A;  4DEX A;  2DVE A;  1R0B G;  2PVO B;  5FGK B;  2ZCF B;  3MET A;  2M02 A;  3JRZ A;  2NLU A;  4DOW A;  2ZPG B;  4EOS B;  1B3Q A;  2LCC A;  3OY9 A;  4Z6Y A;  2E6Z A;  4PJN A;  4KH1 B;  1C0M A;  3V8J A;  1B07 A;  1OZ2 A;  1QVG S;  3MHX A;  4OP0 A;  2E70 A;  3NTI A;  4BE2 A;  1G3W A;  3EG9 A;  2IPO B;  4IIO A;  4BBR M;  2F5K A;  1QLY A;  2ECZ A;  2JTE A;  2LTO A;  3EG1 A;  5GAO r;  3JCM Q;  2MYS A;  4TTH A;  1YHQ A;  2AT1 B;  3GF5 A;  1WYX A;  5IHK A;  4LE9 A;  3V7C A;  5IN1 A;  3VJP A;  2HKN A;  1H28 B;  1H8K A;  2W10 A;  3NFC A;  3JCM V;  1SF9 A;  1SRM A;  1RAH B;  5KYU B;  2RHU A;  3H6Z A;  1RAE B;  1RL2 A;  1K4U S;  1UGQ B;  4DBF A;  5DLO A;  2H8H A;  2RI3 A;  3MP6 A;  2KRO A;  1Q86 C;  1ZQ1 A;  2VWF A;  2DTH A;  3CCS A;  3HBL A;  4BBS M;  3EFR A;  4EOL B;  3CBP A;  3G71 T;  1FVV B;  4FX3 B;  3SHW A;  4PJO B;  3M0P A;  3EGD A;  3MY5 B;  5A0G A;  4JRK A;  3HB9 A;  1KJW A;  5GMK j;  2QYZ A;  2IVX A;  3CCR Q;  2QA4 A;  4RTT A;  4CRI A;  5GAM f;  2XHC A;  2J06 A;  4F7N B;  2EJF A;  1BK2 A;  3FLG A;  4LN2 A;  3M0U A;  5I2M A;  2VAS A;  4EC9 B;  5CKH A;  3UA7 A;  2IW9 B;  1T3S A;  3QYB A;  4F7U B;  3RKW A;  5C0M A;  3QHW B;  2DO3 A;  4HCB A;  4M7A F;  1X6G A;  1ARK A;  1IZ6 A;  1F5Q B;  4BUG A;  2R7G A;  1Q95 G;  5BNJ B;  1MMD A;  1W70 A;  2O2O A;  3CMA T;  1OI1 A;  1H3Z A;  1K8A C;  5GMK l;  1P92 A;  2GQI A;  4FCY A;  3I9Q A;  4AKH A;  1OKW B;  1GFD A;  3MP8 A;  2PMI B;  2RJC A;  3VKG A;  1ABQ A;  5LJ3 d;  1UJY A;  4F7J B;  1OPL A;  2R58 A;  1YIJ T;  5FRN A;  2FRW A;  1YI2 A;  4BDZ A;  1PCX A;  2IIM A;  3CD6 A;  3E2U A;  1EFN A;  3H4C A;  4BCJ B;  4R56 A;  4E7L A;  3FJP A;  2FPE A;  4JRQ A;  1MNE A;  1M90 R;  3EFS A;  1WHJ A;  3L2Q A;  1Q86 R;  2KRM A;  1WDX A;  3BE3 A;  4ANJ A;  5CEI B;  2ABL A;  2DXU A;  4IUV A;  3BG5 A;  4J9E A;  1M3C A;  3CPW S;  2I40 B;  1ZSG A;  3E19 A;  3DKM A;  1Q81 U;  2AHJ B;  5ECA A;  5AT1 B;  4ELZ C;  1NPP A;  1PG5 B;  4KUD K;  2K3X A;  5A0L A;  5LQF B;  5HK0 A;  2D8J A;  4J9I A;  3CME T;  5EFQ B;  2DIL A;  4AKI A;  3OYE A;  1BCM A;  1KD1 R;  1KQS S;  4DBH A;  3I35 A;  4C92 D;  1RAA B;  3X26 B;  2K5I A;  4M7D C;  2ENM A;  3GP8 A;  5KYX B;  2RI2 A;  2A37 A;  1M1K C;  2UZE B;  1S72 T;  1TH7 A;  4MFD A;  1G8X A;  2LP5 A;  3JCM W;  4KT0 E;  2L3R A;  2WSF E;  1VQ4 T;  2DL7 A;  1MUZ A;  1GUX B;  1H25 B;  3ZFJ A;  1YIJ Q;  1VQP A;  4LOC A;  3CC7 A;  1QWF A;  3S6W A;  1HYO A;  3I56 T;  3QO3 A;  1GFC A;  3EFO A;  2HEQ A;  3QDR B;  1U8R A;  1OI9 B;  3LQ5 B;  1TD6 A;  3C4S A;  3CCM T;  2KE9 A;  1IO6 A;  1ZHI A;  3UF4 A;  1VIE A;  1D3B A;  4C8Q A;  3M4G A;  3GTM S;  2JOY A;  2BZ8 A;  1VQ6 T;  4HA8 A;  4BCP B;  4BE1 A;  2VVK A;  4GBQ A;  2RJE A;  2NWM A;  2E12 A;  2GCX A;  4IUP A;  1BB9 A;  3CCV T;  1I1J A;  2X4Y A;  3OYC A;  1TWB A;  4FSX A;  2RHI A;  2F2V A;  4PJO C;  2X3W D;  2E6N A;  3TEE A;  2KEA A;  2RQT A;  4C5G A;  2LX9 A;  2RJF A;  2YRC A;  4JRP A;  1OQK A;  2DFU A;  1S72 Q;  2PZ1 A;  1YP5 A;  3V8L A;  3EG3 A;  3NTH A;  1VQ4 Q;  1PHT A;  2KT8 A;  4KGZ B;  2DD5 B;  4C8Q C;  3VUB A;  2BTT A;  4M75 B;  2AZV A;  3I56 Q;  4JX4 A;  3OS2 A;  1AHJ B;  2E65 A;  3QZ9 B;  1RI9 A;  3H8Z A;  2EPD A;  2MMP A;  1PKS A;  4MML A;  3RKY A;  2SEM A;  4BDY A;  4XK8 E;  2CYZ B;  3AHU A;  1C1A A;  1MHN A;  4VUB A;  4HCZ A;  4PL6 A;  1QP2 A;  5GAO p;  1VQO T;  1M8M A;  3L2Z A;  1D0Z A;  3M9Q A;  2G3R A;  2K9G A;  2ROT A;  4PKC C;  4EPC A;  4XTZ A;  2KT1 A;  2Y4Y A;  3CCV Q;  2ZPH B;  2RQR A;  1Q82 C;  2RK1 A;  1OV3 A;  5GAO l;  1BIA A;  2VXF A;  3OYA A;  3QDF A;  2O4X B;  2CZ0 B;  2OI3 A;  5GMK h;  2J6K A;  4PLL A;  3FDR A;  3NDQ A;  3OW2 S;  1VQ7 A;  4L59 A;  4MMK A;  2WIP B;  2YRV A;  3QPH A;  3E9F A;  1RLQ C;  2D0Q B;  1URC B;  2BKD N;  2JVV A;  3UAT A;  5DM7 R;  4EOI B;  3EH1 A;  4J6W A;  1RI0 A;  3G1J A;  3VV0 A;  3DDP B;  3CCE Q;  2DRM A;  2QK0 A;  2LNV A;  2BE9 B;  5KE2 A;  2RD1 A;  5GAN 7;  2QEX A;  1O9S A;  5GAN h;  3EG2 A;  5ACB A;  4LUD A;  3CPW A;  1G2B A;  1UFF A;  4PJO E;  3X20 B;  3CCU A;  3RR6 A;  1SSH A;  3X25 B;  5KYY B;  3C0C A;  1E9H B;  4D8K A;  3CC4 A;  3F5X B;  1QKX A;  1RAF B;  4AFS C;  2HZY A;  4FM4 B;  1JKW A;  1B7T A;  2L3Q A;  3RDV A;  2YUQ A;  1TG0 A;  1SRL A;  4GLK A;  4AFZ C;  2K5F A;  4C8Q E;  1N8R U;  3REA B;  4PFO A;  2RM4 A;  4M7D G;  4OMM A;  2BS4 A;  5IH2 A;  1H1Q B;  2WPA B;  5CKB A;  1VQL A;  4XTU A;  3PTA A;  1BU2 A;  1IGU A;  2ESW A;  2CUB A;  2C0O A;  2ZGW A;  2DL4 A;  5EG2 A;  3QXE B;  4CC2 A;  1UG1 A;  4Y28 E;  4EOK B;  2PHG A;  4NL3 A;  4KGV B;  1WLP B;  5I5Z B;  1UJ0 A;  3PIP A;  2GFA A;  3NPF A;  4E7J A;  3PIO A;  1PWT A;  2A0F B;  4C0G A;  2LCS A;  2MAM A;  8ATC B;  1MMN A;  1O9K B;  3G6E A;  5FU6 C;  2G77 A;  4M78 B;  4F6U B;  4PFZ A;  3G4S T;  5KCO A;  2L2P A;  4FU6 A;  4JUV A;  1C9B A;  3MP1 A;  3JB9 F;  4XU1 A;  3NMZ C;  1YIT A;  4N4G A;  1NBE B;  2YSQ A;  4X9C A;  2CZ1 B;  4PJO G;  4DA4 A;  1YJ9 Q;  1X43 A;  2BUD A;  4BCH B;  2OTL A;  5GAO q;  2KR3 A;  1UGR B;  1XJW B;  1JO8 A;  4R0K A;  4M75 C;  3CCJ T;  4PJJ A;  3OYB A;  5KH6 A;  3K7A M;  2K6D A;  2CT3 A;  2L89 A;  3JCM X;  4DEY A;  4FW1 A;  1WA7 A;  5EC7 A;  2JMC A;  4C8Q G;  4F7L B;  4ZGE B;  2CCH B;  5HCK A;  4EOR B;  4CC4 B;  3M03 A;  4J6Y A;  5CQY A;  1EIF A;  4C92 F;  3A8G B;  4PK4 A;  3TW7 A;  2CZ7 B;  2LZ6 B;  4J9F A;  1WPY A;  2CSQ A;  2VC8 A;  1FKM A;  4HL4 A;  1SKU B;  3CCL A;  2Z0W A;  5GMK i;  2WHB B;  1VQM A;  1I07 A;  2VGM A;  3A8O B;  4MZM A;  2RHZ A;  2L3P A;  2C4G B;  4Y91 A;  2B86 A;  3CCQ A;  1GCQ A;  3J81 E;  2CP2 A;  3PMT A;  2DM1 A;  3M56 A;  1JEG A;  4FL6 A;  3G4S Q;  4BCM B;  4M77 F;  9ATC B;  2WJ9 A;  2CJM B;  1PD0 A;  1MMA A;  1ZUU A;  3MO8 A;  1XNI A;  4XU3 A;  2K57 A;  1VQ5 A;  1NZ9 A;  4BCQ B;  4E7I A;  4E6R A;  3H0F A;  3VYG A;  4YTL A;  2HBW A;  2X51 A;  1KXU A;  4EMK B;  2QQ8 A;  1N5Z A;  1VQK T;  4I3Z B;  2HBP A;  2GFU A;  2EIF A;  2DE0 X;  1JBM A;  1D1B A;  2QTV A;  3OW2 A;  3JCM J;  5L23 A;  1JRI A;  2LQW A;  2E10 A;  5FWB A;  4YOS A;  4XAX B;  3T9N A;  5KYW A;  4M7A B;  1RLP C;  1X6B A;  1ENW A;  3VKI A;  2EAY A;  1P5E B;  4QW2 A;  3QHR B;  3V8K A;  1YJW T;  5GAN d;  3MEW A;  2PK2 A;  1YJN Q;  4YC3 B;  5I11 A;  3M0S A;  4ELJ A;  2XID A;  5LJ3 f;  4OF1 A;  1UNG D;  5HBH B;  3CEY A;  2OAW A;  3DB3 A;  2DD4 B;  1PM3 A;  3PNW C;  3OYH A;  1M4Z A;  4M75 E;  1K76 A;  5LJ3 g;  2YLC A;  3N5B B;  3QYH B;  3G71 A;  1HD3 A;  2DF6 A;  3RER A;  4RMO A;  1VQ9 Q;  2DEU A;  1NLO C;  4O5V A;  4MDX A;  2JM8 A;  4ZN3 A;  3DTO A;  1VIF A;  1QLB A;  3M53 A;  1AWJ A;  1VYW B;  3NTK A;  1Q7Y U;  1NEG A;  2DXC A;  4HNT A;  1O75 A;  4UN0 A;  2AKL A;  3L2U A;  1K73 R;  2ZZD B;  2ZPF B;  1W2B S;  2A7Y A;  4CFN B;  5CO7 A;  4LDV A;  1CKB A;  2DIG A;  1ACM B;  2A36 A;  1OU8 A;  2COY A;  4OMQ A;  1VYU A;  2GF7 A;  1UGS B;  2KYB A;  5EJC A;  1RUW A;  4E7S A;  4A53 A;  4M78 C;  1T0J A;  3CMA A;  1G3T A;  1LVK A;  4RTZ A;  2CH4 A;  3G33 B;  2W9Z A;  4HNU A;  5HK3 A;  2HAX A;  2WXV B;  5CR2 A;  1KQ1 A;  1JU5 C;  2IN3 A;  1ZSZ B;  4RTX A;  5CIU A;  2QDJ A;  1VQN Q;  2KI7 A;  2DME A;  2PUO B;  1UGV A;  1TUC A;  3OSS C;  3QSU A;  2ED0 A;  4FSS A;  1OIY B;  3DB4 A;  3PGG A;  1VYV A;  2D1X A;  2EQJ A;  2YUP A;  4E7K A;  4QKU A;  5IHY A;  4N4H A;  4EMH A;  3CCR T;  2CT4 A;  2YDL A;  3MEV A;  1OL2 B;  2Y90 A;  4IUU A;  2CDT A;  4M75 G;  4QVD A;  4JZ4 A;  3S3M A;  3G7Z A;  3MI9 B;  1KHI A;  2WMA B;  4A54 A;  1FIN B;  3RES A;  4EC8 B;  1BYM A;  3L1A A;  1H1P B;  4V2S A;  2JW4 A;  3ER0 A;  1HSQ A;  4FT2 A;  1VQ8 T;  4IUQ A;  1JXM A;  1PSF A;  3C95 A;  2P4R A;  4HVV A;  1HK9 A;  2J6F A;  1D1A A;  1QVF S;  3QYG B;  1JJ2 P;  1K9M R;  2M1H A;  2X4J A;  2C5X B;  1GH6 B;  3LLR A;  4MZP A;  3CME A;  1U3O A;  2XIC A;  3RUX A;  4F6W B;  2EJG A;  3PFS A;  1M2O A;  1WJQ A;  1FWZ A;  3A8M B;  4OGE A;  1M2V A;  3OYM A;  5CKE A;  2KBT A;  1XO2 A;  2UUE B;  3OYN A;  3JCM b;  3OBW A;  1ZUY A;  2KR6 A;  3ULR B;  1WGS A;  2O9V A;  1M90 C;  1N27 A;  5DQV A;  4EMK C;  1WHH A;  3MIA B;  3JB9 I;  3POM A;  3QKJ A;  4FW2 A;  1T3L A;  2DER A;  2RQW A;  1N4M A;  2JMA A;  1K8A U;  2LC4 A;  4M7A C;  1YWO A;  3ME9 A;  1R8O B;  1AWO A;  2J05 A;  4J9B A;  4G6L B;  3CCM A;  4QVZ A;  4AG2 C;  2M9U A;  4X1V A;  1H1S B;  2LW4 A;  2EYW A;  2YUO A;  2K2V A;  3QUI A;  5HQ0 B;  1KD1 C;  1XTD A;  3VS7 A;  1VQ6 A;  3EJ1 B;  1H24 B;  3DOG B;  3M0T A;  4RG8 A;  1SHF A;  4LDU A;  3M5A A;  3QHS A;  3JCM g;  1VQ8 Q;  5GMK e;  5FRO A;  5KCH A;  4FIB A;  2EQU A;  2HQX A;  4HCC A;  4PJM A;  2HL3 A;  3C94 A;  5GAN j;  4Z88 A;  1NG2 A;  4GLM A;  2V1Q A;  1JXO A;  4ZGJ B;  4C5H A;  4MFE A;  2CP7 A;  1ABO A;  5L8R E;  2WAC A;  3JCM h;  4R55 A;  2OTJ A;  3V7R A;  2I0N A;  5CCA A;  3TNI B;  3EGX A;  5HBJ B;  4K11 A;  1SEM A;  1X2K A;  5CKF A;  4OB1 B;  4OR5 B;  2KRN A;  2EYZ A;  3KUF A;  1YCS B;  4BCN D;  2DEQ A;  3HP9 A;  2EBP A;  2QGF B;  2EVR A;  3VYH B;  4XTW A;  3LWH A;  2LJ1 A;  4M7D A;  3I55 T;  1TUG B;  1YBY A;  3JB9 D;  2CGH A;  3BDL A;  4RUG A;  1GXI E;  3PVL A;  1M1K U;  3CXC P;  2O31 A;  1NM7 A;  5HVY B;  2JGZ B;  2G9X B;  4TVR A;  1ZA1 B;  1W2B A;  5ICP B;  5C6S A;  4JJB A;  4ZN1 A;  1KC8 R;  3M55 A;  1VQO A;  1KG1 A;  3DJB A;  4M78 G;  3JSC A;  3QWL A;  1D1C A;  1IHW A;  3SWN B;  2F2W A;  2CSI A;  3TRE A;  3KHI A;  1UNL D;  2JNG A;  2K5L A;  1IGQ A;  2PTK A;  2YHT A;  2KVQ G;  3A98 A;  5D6W A;  3TSZ A;  1U1T A;  1H26 B;  3OMC A;  5KYU A;  2CKK A;  1SPK A;  1NLP C;  3EHR A;  2EFI A;  1I5L A;  1WHK A;  5LJ5 h;  5IXF A;  2VYT A;  3HSB A;  4RCC A;  3BHU B;  4YOZ A;  2PNI A;  2RH2 A;  1GBR A;  2HD0 A;  1YHQ T;  4PJO A;  1AWW A;  2EKO A;  4LDY A;  2IW6 B;  1X27 A;  1K0S A;  3LW5 E;  3WVD B;  2LDM A;  4M77 D;  1PNJ A;  5GMK m;  2OJ2 A;  3I55 Q;  3ZEH A;  5M9O A;  1N9R A;  2K7A A;  4ZGD B;  3PO3 S;  1I8F A;  2K4Y A;  3TNW B;  4L5G A;  4A63 B;  4JS4 A;  3QJ6 A;  1QVF A;  2FO0 A;  3LGL A;  1U06 A;  3V7S A;  4HNV A;  4F7U A;  2HSP A;  5D6X A;  1Z9Q A;  2XK0 A;  3LH5 A;  2VKN A;  4CFU D;  2JZ2 A;  2M0Y A;  1OX8 A;  3BW1 A;  1MV3 A;  1OIU B;  2COW A;  3X24 B;  3TN8 B;  3HRU A;  2JUF A;  2QTX A;  5LL6 S;  4BB7 A;  4JJN K;  2GTO A;  2KGT A;  2DET A;  4C92 B;  2DTO A;  4LXC A;  4M7A G;  1AWX A;  2K2M A;  1BCO A;  3EG0 A;  2YUN A;  1Q82 U;  1YHQ Q;  4BY6 B;  4MIM A;  3UWN A;  3CCE T;  1JOW A;  2QFZ A;  4ESR A;  4E7Z A;  3QYE A;  5IHN A;  4O6J A;  4Z89 A;  1FXX A;  2A28 A;  4FYY B;  5IXB A;  1R77 A;  3TW6 A;  1NE8 A;  1QCF A;  4M77 B;  2FG0 A;  5HNB B;  4M7D E;  5GAN 6;  3JCM d;  3CCS Q;  1HJD A;  2AIR B;  1BI3 A;  1ZBJ A;  4J8O A;  3CD6 T;  4C0D B;  4PJO F;  4A4K A;  1WIE A;  1DJ7 B;  4WCI A;  5FWC A;  5I22 A;  4OB0 B;  1Y57 A;  2QA4 Q;  1W4S A;  1PSE A;  1UEC A;  2FZC B;  4X34 A;  1TFB A;  2A3L A;  2GQV A;  1MMG A;  4CFX B;  3CCJ A;  3HFN A;  5KYX A;  3MJX A;  4CFU B;  2DPP B;  2VB6 A;  4JLG A;  1Q81 R;  4C8Q F;  1C6V X;  1QVG P;  5GAN f;  4BCK B;  4LD9 K;  4EOM B;  1GUX A;  2C6T B;  3VS6 A;  2NYS A;  1CSK A;  3SDZ A;  2XU8 A;  3HTR A;  5GAN g;  1X75 C;  3H0I A;  2EYQ A;  2AZS A;  4OMO A;  2HL5 C;  4PNO A;  5GAO n;  2LVM A;  1GY3 B;  1SSF A;  5LJ3 e;  3R6O A;  2QQ9 A;  4IUT A;  3THK A;  2HQE A;  1UB4 A;  4F7S B;  3GBQ A;  4CRL B;  5FU7 B;  3CC7 T;  4KRD B;  3OS5 A;  3QZ5 B;  2DJQ A;  3URG A;  4ELY C;  2KSS A;  2CH4 W;  4JX5 A;  1YI2 Q;  1OKV B;  4NOY A;  4XTX A;  2BS3 A;  1Z9Z A;  3CD6 Q;  1YJ9 T;  5LJ5 d;  4QVC A;  3OYI A;  3MEA A;  4JJD A;  4QQ6 A;  3PT9 A;  2YLB A;  4ORZ A;  4E7H A;  4LUE A;  1VQK A;  2L3S A;  1LOJ A;  4F7U E;  4C0F A;  4Z8A A;  1PKT A;  1G3S A;  2X9H A;  3PE0 A;  3A5Z B;  2DNU A;  5IAY A;  2NUT B;  3HHT B;  4F14 A;  4A4E A;  1YJW A;  5AYF A;  4Z02 A;  2DD5 A;  2MI6 A;  2JXB A;  4M75 A;  3TVT A;  5FLX E;  2WMB B;  2I53 A;  2W96 A;  1IRX A;  2QGG A;  2E5Q A;  1VYT A;  3JB9 J;  3HRT A;  1D0X A;  1KIK A;  3M0Q A;  3QJY A;  2MIO A;  5A0D A;  4RTU A;  1I4K 1;  5CVI A;  2HCK A;  2W9F A;  4OVA A;  2PVG B;  4F04 B;  2R5A A;  1VQP Q;  3CC7 Q;  2WIH B;  1GCP A;  5J3B A;  1QP3 A;  5GAN 3;  2V8J A;  1A0N B;  4C92 C;  2LNH B;  1KHC A;  1G3Y A;  1N8R C;  3WXM B;  2O4X A;  5KYN A;  4LD6 A;  3A8H B;  1GRI A;  3UT1 A;  2W99 A;  1YCY A;  3EOC B;  3M57 A;  5GJV B;  3INZ A;  3LH0 A;  5DLQ E;  2EYY A;  1YJN T;  2DXB B;  2E5K A;  1BBZ A;  3F70 A;  2ZPE B;  4F7U G;  2C0I A;  3P8B B;  4QQG A;  1E7O A;  3HZJ A;  1IRE B;  4KUL A;  1Y7X A;  3REB B;  1KQS P;  3IQL A;  2HSE B;  4C0D C;  3FC3 A;  1B34 B;  1BIB A;  2NUP B;  3FRN A;  1Y96 B;  1WI7 A;  4M4Z A;  2MCN A;  4IMY B;  3L42 A;  3JV3 A;  1RAC B;  2DBK A;  5KYY A;  3L2V A;  2EYX A;  2H3E B;  5GAN 8;  4FT4 A;  2P4T A;  1OL1 B;  3CBO A;  1IHV A;  1TOV A;  1VQ9 T;  2JM9 A;  3CCR A;  1K73 C;  4F70 B;  2R5M A;  4M75 F;  4OGC A;  3AT1 B;  1WHL A;  3OSV A;  2EUF A;  3JB9 H;  4OGR B;  2KXC A;  2DYB A;  1RAG B;  1UDL A;  3HO8 A;  5GAM j;  3CCU T;  1H64 1;  3S3N A;  3JCM e;  1MV0 B;  2RMO A;  1TS9 A;  4YOO A;  3OYK A;  2CP0 A;  2CP6 A;  2DTI A;  1H4L D;  3ASK A;  1N8R R;  1VUB A;  1TXQ A;  3EHQ A;  4AI6 A;  2E41 A;  1Y07 A;  4CI0 C;  1EX4 A;  4KH0 B;  1YN8 A;  3P8D A;  2DJZ A;  3A1P A;  3OS1 A;  2DRK A;  2C0T A;  3RBB B;  3O0G D;  2OAU A;  2EQM A;  2UZB B;  1NJI C;  1VQN T;  2C5O B;  1O9K A;  2XKO C;  3QWY A;  2V8K A;  4NL2 A;  4M78 A;  1F1B B;  3EG9 B;  4OMN A;  2GBQ A;  3VRY A;  4FYV B;  1VQ7 Q;  3WVE B;  1AT1 B;  4OML A;  2DKG A;  1FMV A;  3BHV B;  1JQQ A;  3J80 E;  3B57 A;  4BI8 B;  2RK2 A;  2KQW A;  1WQ7 A;  4J9H A;  5LJ5 j;  2EQI A;  3ZBD A;  1WFW A;  2L0A A;  1E7P A;  1K9M C;  3H41 A;  4UC4 A;  2F5T X;  4M7D D;  4HVW A;  4CC7 A;  2D0N A;  2QEX Q;  3G6E T;  1WQW A;  1LPL A;  2DZ9 A;  4JS5 A;  3CCU Q;  2JS2 A;  3CC4 Q;  1VIN A;  3EGD B;  1W6X A;  1QQJ A;  1YIT T;  2HKQ B;  3MY1 B;  3MEU A;  2YT6 A;  2WSC E;  3BG3 A;  5LMK B;  1WXU A;  3TU4 K;  1M5Q 1;  2MF2 A;  5IT9 E;  1VQL Q;  3BY7 A;  2EGE A;  4AFU C;  5D7U A;  1BI1 A;  3BG9 A;  1YIJ A;  1BKB A;  2GGR A;  1GBQ A;  1WZO A;  3OW2 P;  3BLR B;  2F2X A;  2CS7 A;  4WF2 A;  1OEB A;  4HT8 A;  3FIF A;  4RTV A;  3I55 A;  4C92 G;  2YWW A;  1X01 A;  1VOL A;  2XI9 A;  3R6N A;  1NJI R;  1K1Z A;  4PJO D;  2FEI A;  4EMG A;  2UZL B;  1NEB A;  2A08 A;  4EMK A;  3UDC A;  1Y0M A;  3EAE A;  1M90 U;  4KRC B;  1AZE A;  1Q86 U;  3CCQ T;  4C5E A;  2FPD A;  4N0A C;  3G6E Q;  3GOX A;  3E9G A;  4M7A A;  2P84 A;  3VS3 A;  1TTH B;  3M54 A;  4C8Q D;  1VQ5 T;  3Q1J A;  1KQ2 A;  3ZL7 C;  4JLI A;  1YIT Q;  2EGC A;  5CYI B;  3TNH B;  1VOM A;  4II1 A;  4A4G A;  1NYF A;  2KMT A;  4BCI B;  2OTL Q; 
#chains in the Genus database with same CATH homology
 1O9S A;  2HD0 A;  1YHQ T;  1LNX A;  5GAN h;  1KD1 U;  5KE3 A;  4PJO A;  3CPW A;  2EKO A;  4LDY A;  2XDB A;  4PJO E;  2DD4 A;  3X20 B;  3OQ5 A;  3QBY A;  5GAN 4;  3CCU A;  3X25 B;  3LGF A;  3LW5 E;  2RJD A;  3WVD B;  2LDM A;  4MZT A;  1S72 A;  1K9M U;  4M77 D;  2PU9 B;  5GMK m;  1VQ4 A;  2FVU A;  4JX6 A;  5FU7 C;  3ZEH A;  5M9O A;  2R57 A;  3CC4 A;  1N9R A;  5GAM e;  3X28 B;  3SFM A;  3PMI A;  4ZGD B;  3HL8 A;  4FM4 B;  1I8F A;  2K4Y A;  4L5G A;  2P0K A;  1UEB A;  5CQX A;  2PUK B;  5HY6 A;  3I56 A;  1MGQ A;  3QJ6 A;  3CXC A;  4JDS A;  4JS4 A;  1WJS A;  4IKF A;  3C12 A;  1KC8 C;  4GLK A;  4C92 E;  1QVF A;  2K5F A;  3LGL A;  2LT1 A;  1WNL A;  2E1H A;  4C8Q E;  3V7S A;  1N8R U;  4KUI A;  4HNV A;  3VU3 C;  2RM4 A;  3CPF A;  4M7D G;  4F7U A;  2LT4 A;  4M78 E;  2BS4 A;  3HFO A;  1V29 B;  5D6X A;  5I2S A;  2QQS A;  5CKB A;  1VQL A;  2XK0 A;  4XTU A;  3GNF B;  3SD4 A;  2QQR A;  2L5Q A;  4B9X A;  2P0P A;  3PTA A;  4ZTF A;  3JCM f;  3KBG A;  2JZ2 A;  4X9D A;  3BW1 A;  2ZGW A;  3P8H A;  5EG2 A;  3QXE B;  2RHX A;  3JCM P;  4XTV A;  2ZZD A;  1BI0 A;  3X24 B;  4Y28 E;  2MWP A;  1X6O A;  2P0Q A;  3J7A F;  3HRU A;  4NL3 A;  4M77 E;  1M9S A;  2JUF A;  2QTX A;  4QQD A;  4P5N A;  5LL6 S;  4BB7 A;  4JJN K;  3CCV A;  4GY5 A;  1JJ2 A;  3PIP A;  2GFA A;  2ZPB B;  5HKC A;  4E7J A;  2KY9 A;  3PIO A;  2XD0 A;  4ME7 A;  5GAN 2;  2X4X A;  4C0G A;  2RB6 A;  4IUR A;  4C92 B;  2B8A A;  2DTO A;  2FHD A;  2JN0 A;  1XQH A;  2IG0 A;  2MAM A;  3E1S A;  4M7A G;  4C8Q B;  1D3B B;  4ATO A;  4DQ2 A;  2DXB A;  5LJ3 h;  5GAM g;  3G6E A;  5FU6 C;  5LJ5 e;  1XOV A;  3M4Y A;  4BY6 B;  3JB9 G;  1Q82 U;  3CC2 T;  4MIM A;  2G77 A;  4M78 B;  3UWN A;  3G4S T;  5KCO A;  4FU6 A;  3L2W A;  3CCE T;  4JUV A;  3CCS A;  3GLX A;  2OTL T;  2QDY B;  3MP1 A;  2QFZ A;  4N0A A;  5CAI A;  5GAN e;  3LX7 A;  3JB9 F;  3QYE A;  4O6J A;  2DXT A;  4XU1 A;  3OYG A;  1B34 A;  3A8L B;  5GAM h;  1YIT A;  1Y96 A;  4N4G A;  1FXX A;  3KXT A;  3TW6 A;  3CC2 A;  4X9C A;  2CZ1 B;  4PJO G;  4DA4 A;  1NE8 A;  3CCE A;  2BUD A;  4M77 B;  2OTL A;  5GAO q;  4M7D E;  5GAN 6;  3JCM d;  2QQB A;  5FRM A;  1UGR B;  2M16 A;  1BI3 A;  4J8O A;  4M75 C;  3CCJ T;  3M59 A;  3OYB A;  3CD6 T;  4C0D B;  4PJO F;  2BIV A;  5KH6 A;  2L89 A;  3JAM E;  3JCM X;  3GNG A;  5A2Q E;  4J83 A;  4A4K A;  4E47 A;  3S3O A;  1DJ7 B;  1U1S A;  3MCA B;  3VUZ A;  2L8D A;  2CZ6 B;  4OB0 B;  1FX7 A;  5GAN 5;  1W4S A;  1PSE A;  3M58 A;  4X34 A;  4C8Q G;  2GQV A;  2A3L A;  4RCB A;  4B9W A;  3CCL T;  3DLL A;  4ZGE B;  1UGP B;  5LJ5 f;  3CCJ A;  3QII A;  1M1K C;  1VQM T;  3HFN A;  4J6Y A;  5CQY A;  1EIF A;  4C92 F;  3A8G B;  2FYK A;  4J6X A;  2RHY A;  2DPP B;  4JLG A;  2Y4X A;  3TW7 A;  2CZ7 B;  2RA2 A;  4BD3 A;  4C8Q F;  1Q7Y C;  4J7F A;  5D6Y A;  5GAN f;  4OB3 B;  1WPY A;  2EJ9 A;  2QQA A;  4LD9 K;  5LJ5 g;  2VV5 A;  4M78 F;  2VC8 A;  1FKM A;  4HL4 A;  2X4W A;  3CCL A;  1HXD A;  1KC8 U;  5GMK i;  4M7A E;  1VQM A;  3OYY A;  2VGM A;  1QVP A;  3A8O B;  2XU8 A;  4MZM A;  3SDZ A;  4J5Y A;  4L6V 5;  4M7D B;  2RHZ A;  4M77 G;  3GPL A;  5GAN g;  4DOV A;  1X75 C;  4BI4 A;  2DVE A;  2EYQ A;  2XDP A;  4Y91 A;  3CCQ A;  4PNO A;  2BS2 A;  2PVO B;  3J81 E;  3PMT A;  2ZCF B;  3MET A;  3M56 A;  5GAO n;  4FL6 A;  2LVM A;  3JRZ A;  3OS0 A;  2NLU A;  4M77 F;  4DOW A;  2ZPG B;  2WJ9 A;  2LCC A;  3OY9 A;  1SSF A;  4Z6Y A;  2E6Z A;  2V8I A;  5LJ3 e;  3R6O A;  3V8J A;  2QQ9 A;  3OYJ A;  3MO8 A;  1VQ5 A;  4IUT A;  1XNI A;  4XU3 A;  1OZ2 A;  2K57 A;  2HQE A;  1UB4 A;  1NZ9 A;  2DIQ A;  3MHX A;  4OP0 A;  4E7I A;  1QVG S;  2D6F A;  2E70 A;  3NTI A;  4BE2 A;  5J26 A;  4YTL A;  1G3W A;  5FU7 B;  3VYG A;  3CC7 T;  3OS5 A;  3QZ5 B;  4EMK B;  3URG A;  2QQ8 A;  2FB7 A;  4BBR M;  2F5K A;  4ELY C;  2KSS A;  1VQK T;  4M75 D;  4JX5 A;  2HBP A;  2GFU A;  2LTO A;  5GAO r;  2EIF A;  3JCM Q;  1YHQ A;  1JBM A;  4NOY A;  4XTX A;  3GF5 A;  2BS3 A;  3OW2 A;  3JCM J;  3V7C A;  5IN1 A;  1JRI A;  2E10 A;  4M6V A;  2K3Y A;  4XAX B;  3T9N A;  1YJ9 T;  5LJ5 d;  3VJP A;  4QVC A;  4M7A B;  3VKI A;  3OYI A;  3CCS T;  3NFC A;  1N6A A;  3MEA A;  3JCM V;  4QQ6 A;  2EAY A;  4XTY A;  2KDS A;  2YLB A;  3PT9 A;  4E7H A;  2KAF A;  1VQK A;  2X35 A;  4QW2 A;  2RHU A;  3H6Z A;  3V8K A;  1YJW T;  1LOJ A;  2M0O A;  1RL2 A;  5GAN d;  1UGQ B;  5DLO A;  3LYI A;  4F7U E;  2RI3 A;  3MEW A;  3TCJ A;  4C0F A;  1Q81 C;  1G3S A;  4KBM B;  3MP6 A;  1YJ9 A;  3A5Z B;  1Q86 C;  3HRS A;  1ZQ1 A;  5IAY A;  2DTH A;  4ELJ A;  3HBL A;  2WSE E;  3LWI A;  3HHT B;  4BBS M;  3EFR A;  4M7D F;  3CBM A;  1QVG A;  2XID A;  3CBP A;  5LJ3 f;  3G71 T;  4OF1 A;  4A4E A;  3CEY A;  5AYF A;  1YJW A;  4PJO B;  5A0G A;  2LQK A;  3DB3 A;  4JRK A;  2DD4 B;  4Z02 A;  3HB9 A;  2DD5 A;  5GMK j;  3OBY A;  2MI6 A;  3PNW C;  4M75 A;  3OYH A;  1M4Z A;  5FLX E;  4M75 E;  2IVW A;  5LJ3 g;  2YLC A;  3N5B B;  4BI3 A;  2QA4 A;  4CRI A;  3QYH B;  2XHC A;  3OB9 A;  5GAM f;  3G71 A;  2E5Q A;  2EJF A;  3JB9 J;  3HRT A;  3RER A;  3FEO A;  3FLG A;  3RMS A;  3QJY A;  5I2M A;  4RMO A;  5CKH A;  5FU6 B;  5A0D A;  4O5V A;  4MDX A;  1I4K 1;  5CVI A;  3QYB A;  1G5V A;  4F7U B;  3RKW A;  4OVA A;  4ZN3 A;  5C0M A;  2OTJ T;  2DO3 A;  4HCB A;  1VIF A;  2PVG B;  1QLB A;  3M53 A;  1OYX A;  1N9S A;  2R5A A;  4M7A F;  3NTK A;  1IZ6 A;  1Q7Y U;  2DXC A;  4BUG A;  2HNI A;  5J3B A;  1QP3 A;  3OA6 A;  3OYD A;  4HNT A;  1O75 A;  2V8J A;  5GAN 3;  3CMA T;  3L2U A;  1OI1 A;  1H3Z A;  2ZZD B;  1K8A C;  3G4S A;  5GMK l;  2ZPF B;  1W2B S;  2A7Y A;  1P92 A;  1KHC A;  4XU0 A;  5CO7 A;  1G3Y A;  4LDV A;  4C92 C;  1N8R C;  4AKH A;  2DIG A;  1YI2 T;  3WXM B;  2O4X A;  3MP8 A;  2GF7 A;  1UGS B;  1I81 A;  2RJC A;  5EJC A;  3BDU A;  3VKG A;  3SWN A;  4A53 A;  5LJ3 d;  1ZBX A;  4M78 C;  4LD6 A;  3CMA A;  3A8H B;  4A4F A;  1G3T A;  3UT1 A;  2R58 A;  1YCY A;  1YIJ T;  5FRN A;  4LDX A;  3M57 A;  4HNU A;  5HK3 A;  2HAX A;  3INZ A;  3LH0 A;  1YI2 A;  5DLQ E;  5CR2 A;  4BDZ A;  1KQ1 A;  1YJN T;  2DXB B;  5GAM d;  5CIU A;  2QF7 A;  3RMQ A;  3CD6 A;  3F70 A;  2ZPE B;  2QDJ A;  4F7U G;  3DL1 A;  3H4C A;  2PUO B;  3P8B B;  4J7I A;  4R56 A;  4E7L A;  3FJP A;  3OSS C;  4QQG A;  3QSU A;  3HZJ A;  1IRE B;  4KUL A;  1Y7X A;  3DB4 A;  4JRQ A;  3EFS A;  3PGG A;  2VGN A;  3L2Q A;  2EQJ A;  4C0D C;  4F7U F;  1B34 B;  1BIB A;  3HKS A;  3FC3 A;  1BI2 A;  3FRN A;  4OMF B;  1Y96 B;  1YJN A;  3UPU A;  4E7K A;  2XG8 D;  4N4H A;  3L42 A;  4EMH A;  3CCR T;  2DXU A;  3MEV A;  3BG5 A;  4IUV A;  1VQL T;  2Y90 A;  3L2V A;  4IUU A;  3CPW S;  2H3J A;  4M75 G;  4QVD A;  1WJR A;  3E19 A;  3BFM A;  3DKM A;  3G7Z A;  5GAN 8;  3S3M A;  1Q81 U;  2AHJ B;  1KHI A;  1QW1 A;  4A54 A;  4FT4 A;  2P4T A;  4RG2 A;  3SWN C;  3RES A;  3CBO A;  4ELZ C;  1NPP A;  4KUD K;  2K3X A;  5A0L A;  3L1A A;  5HK0 A;  1VQ9 T;  3CCR A;  4V2S A;  1BYM A;  5LJ3 j;  1K73 C;  3CME T;  2R5M A;  4M75 F;  3ER0 A;  3OYE A;  4AKI A;  4A4H A;  4OGC A;  2DZC A;  4FT2 A;  1VQ8 T;  4IUQ A;  3OSV A;  5CKD A;  1PSF A;  3O8V A;  3C95 A;  1KQS S;  1M8V A;  1HK9 A;  3JB9 H;  4C92 D;  2EWN A;  2LCL A;  1M1G A;  1QVF S;  1VQP T;  3X26 B;  2K5I A;  3QYG B;  2M1H A;  2X4J A;  3GP8 A;  4M7D C;  1VQ9 A;  2RI2 A;  3HO8 A;  5GAM j;  3LLR A;  4M78 D;  4MZP A;  1H64 1;  3CME A;  3CCU T;  1TH7 A;  4BAC A;  2XIC A;  3RUX A;  3S3N A;  4MFD A;  2QI2 A;  3JCM e;  1S72 T;  3JCM W;  2EJG A;  4KT0 E;  2L3R A;  2WSF E;  3PFS A;  1VQ4 T;  1WJQ A;  3ZFJ A;  2JTM A;  1FWZ A;  3A8M B;  4OGE A;  1NPR A;  3SB2 A;  2DTI A;  3OYM A;  5CKE A;  4LOC A;  3OYK A;  3CC7 A;  1VQP A;  4NC6 A;  4OB2 B;  3S6W A;  3OYN A;  3I56 T;  3JCM b;  4MDW A;  3QO3 A;  3ASK A;  5J39 A;  1VUB A;  2EQK A;  3OBW A;  4AI6 A;  4C0Z A;  2KR6 A;  1Y07 A;  2E41 A;  2PQW A;  3QDR B;  4HKE A;  3JCM c;  1WGS A;  4CI0 C;  1U8R A;  3P8D A;  2DJZ A;  1N27 A;  1M90 C;  3DLM A;  4EMK C;  3OS1 A;  3C4S A;  3CCM T;  1JJ2 S;  2OAU A;  2QXF A;  2EQM A;  3JB9 I;  1ZHI A;  2E64 A;  1KQS A;  4C92 A;  3QKJ A;  2ZPI B;  1NJI C;  4BE0 A;  1VQN T;  1VIE A;  1D3B A;  2F69 A;  4C8Q A;  1K8A U;  2LC4 A;  2XKO C;  3M4G A;  2V8K A;  4M7A C;  3ME9 A;  2JOY A;  1R8O B;  4NL2 A;  1VQ6 T;  3VYG B;  4HA8 A;  4M78 A;  3L2R A;  4BE1 A;  3CCM A;  4QVZ A;  2M9U A;  4AKG A;  2FL7 A;  2RJE A;  5GAO m;  2E12 A;  4JRI A;  2GCX A;  4IUP A;  3WVE B;  1VQN A;  2K2V A;  2DKG A;  3QUI A;  3CCV T;  2X4Y A;  3FB9 A;  3OYC A;  4NS5 A;  1KD1 C;  3J80 E;  4BI8 B;  1XTD A;  2KQW A;  1WQ7 A;  2RK2 A;  4FSX A;  1VQ6 A;  2I2L A;  5LJ5 j;  2RHI A;  4M77 A;  4RG8 A;  4LDU A;  3M5A A;  3QHS A;  3ZBD A;  1E7P A;  1K9M C;  4PJO C;  3JCM g;  2KK4 A;  4UC4 A;  2F5T X;  5GMK e;  2RO0 A;  5FRO A;  5KCH A;  2E6N A;  3TEE A;  4FIB A;  2EQU A;  2HQX A;  4HCC A;  4M7D D;  3C94 A;  4C5G A;  3G6E T;  2C06 A;  1WQW A;  5GAN j;  2DZ9 A;  2LX9 A;  2RJF A;  4JRP A;  2DAQ A;  2O01 E;  4JS5 A;  4ZTJ A;  2RI5 A;  4ZGJ B;  4C5H A;  4MFE A;  5L8R E;  2WAC A;  3JCM h;  4R55 A;  3V8L A;  2OTJ A;  3V7R A;  3NTH A;  5DY9 A;  5CCA A;  3QG1 A;  4Q5W A;  2DD5 B;  4QSH A;  4C8Q C;  1YIT T;  3VUB A;  4M75 B;  5CKF A;  4OB1 B;  3MEU A;  3KUF A;  4BY6 C;  4JX4 A;  3OS2 A;  2DEQ A;  3HP9 A;  3OMG A;  2MWO A;  1AHJ B;  2WSC E;  2E65 A;  2PVD B;  3QZ9 B;  3VYH B;  5I21 A;  3H8Z A;  3BG3 A;  2DK3 A;  3TU4 K;  2KMG A;  1K73 U;  2MMP A;  1M5Q 1;  2MF2 A;  4XTW A;  4MML A;  2JTF A;  3RKY A;  3LWH A;  5IT9 E;  3BY7 A;  4BDY A;  4M7A D;  4XK8 E;  4M7D A;  3I55 T;  2CYZ B;  1BI1 A;  2QA4 T;  3AHU A;  1YBY A;  4M77 C;  3RIR A;  3JB9 D;  2CGH A;  3BG9 A;  1YIJ A;  1BKB A;  1MHN A;  3BDL A;  4VUB A;  1GXI E;  4HCZ A;  4PL6 A;  1QP2 A;  5GAO p;  1VQO T;  1M1K U;  2DXC B;  4HLQ A;  2CS7 A;  4WF2 A;  2LQ8 A;  4LDW A;  4TVR A;  4HT8 A;  3L2Z A;  3M9Q A;  2G3R A;  3FIF A;  4PKC C;  4EPC A;  1W2B A;  4PLI A;  3OYL A;  3I55 A;  5C6S A;  4XTZ A;  4ZN1 A;  4C92 G;  1X01 A;  2Y4Y A;  2XI9 A;  2ZPH B;  2D9T A;  3M55 A;  5GAN 7;  2RK1 A;  1Q82 C;  5GAO l;  1BIA A;  1JB0 E;  4C5I A;  4PJO D;  1VQ7 T;  1VQO A;  1KG1 A;  2VXF A;  4EMG A;  3OYA A;  2O4X B;  4M78 G;  2VUB A;  3QWL A;  2CZ0 B;  3JSC A;  3UDC A;  3SWN B;  4EMK A;  2XDD A;  1LJO A;  3RKX A;  5GMK h;  5CK9 A;  3EAE A;  1M90 U;  3TRE A;  1Q86 U;  3CCQ T;  3KHI A;  4PLL A;  4C5E A;  4N0A C;  3VKH A;  2JNG A;  2K5L A;  2YHT A;  2VXE A;  3FDR A;  3GOX A;  3E9G A;  4HT9 A;  4N4I A;  4M7A A;  2KVQ G;  3OW2 S;  5D6W A;  4XU2 A;  3CXC S;  1VQ7 A;  4L59 A;  4MMK A;  1NJI U;  1U1T A;  3OMC A;  3M54 A;  2YRV A;  3QPH A;  4XQ3 A;  3E9F A;  4RKU E;  2CKK A;  2QEX T;  4C8Q D;  3GIB A;  1VQ5 T;  2D0Q B;  2LRQ A;  3Q1J A;  1KQ2 A;  2BKD N;  2JVV A;  4JLI A;  5DM7 R;  2EFI A;  4EDU A;  3HPW A;  1I5L A;  1Y71 A;  4II1 A;  5LJ5 h;  4A4G A;  2VYT A;  4J6W A;  1RI0 A;  4RCC A;  3HSB A;  1OZ3 A;  3VV0 A;  1VQ8 A;  2KMT A;  4D6W A;  2RH2 A;  3CC4 T;  2LNV A;  5KE2 A;  1M1F A;  2RD1 A;  2QEX A;  3OYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...