3X25B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 700 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x25B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x25B02
2D0QB 1PSFA 3X26B 2PVGB 3WVDB 1JB0E 3A8LB 2DD4B 2WSCE 3HHTB 4OB2B 3VYGB 2PUKB 1V29B 2ZPFB 4ZGDB 3QXEB 3QZ9B 4ZGEB 3QZ5B 1UGSB 3QYGB 1GXIE 1QP2A 2AHJB 2CZ1B 5L8RE 3QYHB 1IREB 2DXBB 2DPPB 4OB1B 3A8HB 2CYZB 4KT0E 2DXCB 2DD5B 2ZZDB 3X20B 1UGRB 4ZGJB 1AHJB 4RKUE 2DXBA 2DD4A 3LW5E 1PSEA 3VYGA 3A8GB 2ZPHB 4XK8E 4FM4B 2DXCA 3A8MB 3A8OB 2CZ0B 1QP3A 1UGQB 2DD5A 3VYHB 2O01E 2ZPIB 2PVOB 3WVEB 2ZZDA 1DJ7B 1UGPB 2PU9B 2ZPGB 4OB0B 2PVDB 4L6V5 3X25B 2CZ6B 2ZPEB 4OB3B 2ZCFB 2ZPBB 2PUOB 2WSFE 3X24B 2WSEE 2CZ7B 2QDYB 3X28B 4Y28E
chains in the Genus database with same CATH superfamily
4FYVB 2CT4A 3CC4T 2D0QB 1PSFA 3OB9A 4C8QC 2DIQA 3ME9A 3HZJA 1Q95G 1C0MA 1ZUUA 4Z8AA 2LNHB 5CQYA 2WPAB 1NZ9A 4CXAB 5BNJB 1W2BS 1M1KR 4PK4A 1D09B 2EKHA 3M58A 4FW1A 1MV0B 4ELJA 1WLPB 3EGXA 3NTIA 4A4GA 1NPRA 2HZYA 3EHRA 3VRYA 1OPKA 4L5GA 2KT8A 3PIOA 1BI2A 2UUEB 3QYGB 5CCAA 5IHYA 1E9HB 4YC3B 3DL1A 3G33B 1Q7YU 2AHJB 1X27A 4M7DA 4Z02A 3HKSA 4HXJA 1YJNQ 1VQ8T 4ZTFA 1K8AU 4AFQC 3CC2Q 3G6EQ 3R6OA 1QKXA 3J80E 4KT0E 3M55A 4F6UB 1IB8A 5GAMh 2E5QA 2L2PA 3O0GD 3DJBA 3PE0A 2DBKA 3PNWC 2MAMA 2MMPA 2CCHB 1UGRB 2X4WA 1VQLA 4DOVA 2JTMA 4RTTA 1NLOC 3FB9A 4C8QG 2OTLQ 3O8VA 1QW1A 3JCMe 5GAOl 3TVTA 1AZEA 3BE3A 1NPPA 1M3CA 2C6TB 4ELLA 3C94A 2O01E 2HBWA 2AZSA 2EYQA 2X4YA 1OKWB 3NPFA 2ZZDA 1HJDA 3EG3A 3QUIA 5GAOp 1V1CA 3MIAB 1IZ6A 2A08A 2EQKA 4PL6A 1JXMA 4C0DB 1OEBA 3CPWP 3QHSA 4A4KA 4ANJA 3NTKA 2W0ZA 5FWBA 1GBRA 2ZPEB 3J7AF 1R77A 4TTHA 1VQOQ 1M2OA 2HBPA 2C4GB 3VS2A 3IQLA 1PD0A 3CCLT 5LJ5h 1LNXA 3RKWA 5CQXA 1Q86R 3EH2A 3EOCB 3BFMA 5C0MA 4F7LB 1VIEA 5GAMj 4ZN1A 4JX5A 2G77A 2KRMA 1VQ7A 5J26A 4C92E 2V8KA 1SHGA 3VJPA 4C5EA 1YITQ 1FMWA 2QK0A 3DLLA 3VYGB 3NGPA 4E2FB 3LH5A 3NHNA 2I2LA 4XTUA 1V29B 2GF7A 1KXUA 4EOQB 3UT1A 3GP8A 3EG9A 3HFOA 3CC7T 1WXTA 4PJMA 2DEQA 4WF2A 1GFCA 4M75F 3WXMB 3HFNA 2BKZB 2RMOA 2K3YA 2WXVB 3M54A 4CRIA 5J39A 2AKKA 2E12A 3H6ZA 5GAN2 4JJNK 1LJOA 3OA6A 2X4JA 1VQ5T 2XG8D 4XTXA 2WHBB 3DLMA 4FX3B 3LLRA 1EZZB 1JO8A 5LJ5j 1BI3A 4M7AD 2DRMA 4EOOB 1AHJB 1I1JA 5GAMf 1GRIA 1BB9A 3I55Q 1WHMA 1N9RA 3A8GB 2EQMA 1SEMA 1WNLA 2LC4A 1QVPA 3VRZA 3MEVA 2LMJA 3TCJA 4K11A 3ZEHA 3OMCA 2KAFA 4BI4A 1DJ7B 5FW9A 1N8RR 1BI0A 1UJ0A 1FMVA 1B3QA 2YT6A 4E47A 3QHRB 3JCMJ 4BCKB 3DOGB 1Q7YC 4OB3B 4JZ4A 2YLBA 3VUBA 3G71A 1K8AC 3MY1B 5GAOm 2JMAA 4VUBA 1YI2T 2ENMA 4PJOF 4G6LB 3H0IA 3HSBA 2LJ3A 1I5LA 4BCND 3QHWB 4FYWB 1SRMA 4PJOC 5LJ5f 1OYXA 1KSWA 3CBOA 2DLPA 5DY9A 3OBYA 4UC4A 3M0QA 4C0GA 2OJ2A 2QGSA 1BU1A 2DXUA 3CCJQ 2L5QA 3JSCA 3S6WA 3TREA 4EMHA 1VQ6A 2I40B 1I5OB 4QQGA 1Q86U 4M75B 4E7HA 4LXCA 2RQRA 1B34A 5FU6C 5GMKi 1VQLT 2RHYA 2W99A 2JS0A 5AT1B 2DIGA 1TG0A 4X34A 1WJRA 1K0XA 3AT1B 4KUDK 1JXOA 5D6WA 3BHVB 3FEOA 1M1FA 4Q5WA 1WDXA 1VQNQ 5GAN4 1ACMB 2CGHA 2EWNA 3QYEA 3V8JA 1OX9A 1B7TA 2G9XB 1AWJA 1OZ2A 4PJOG 1BU2A 2QEXA 4MFEA 3CCEQ 5LJ3e 3L2ZA 1ZSZB 1ZSGA 2X35A 1VYVA 2CJMB 2KT1A 4HNTA 4JZ3A 4XK8E 2CP6A 3E2UA 4JLGA 3PFSA 1WPYA 4JPBW 3NMZC 1VQ7T 3CCUT 1VQMA 3ZFJA 5HBJB 1UDLA 3EG0A 4CRLB 4AKGA 2FG0A 3OYDA 1K9MC 3CMEA 2DM1A 1W70A 4FU6A 3L2RA 3CCST 5CAIA 3LWIA 5CEIB 3G7ZA 1Y07A 2XK0A 2K2VA 2DVEA 4HCZA 1LCKA 2J05A 3DDQB 4F70B 4QKUA 1M1KC 3CC4Q 4BCQB 2LX7A 2F2XA 1N8RU 1JU5C 2V8IA 4OGRB 2R57A 4PNOA 3S3OA 2ECZA 5IF1B 2KDSA 1PHTA 4J6YA 3ASKA 4LD9K 3M0TA 1WQWA 4RTWA 2DZCA 4YTLA 1GL5A 1KD1R 2KI7A 4RODA 4N0AC 2DKGA 2FPEA 2ZPFB 2C5XB 1NM7A 2XU8A 4HNVA 4OMFB 1H1QB 4OMNA 1ZA2B 1QWFA 3BG5A 1JJ2A 1IGQA 1VQ8Q 1GBQA 1UB4A 1K73R 1TFBA 3L1AA 5L8RE 3QYHB 1IREB 2QAZA 2DXBB 4A63B 4RTZA 4D8DA 1YJWA 4OF1A 3HRUA 2DL7A 4FYXB 1Q81R 5D7UA 2IW6B 2HD0A 1QVFS 2M16A 5CIUA 3HP9A 4MFDA 3CCVT 4DA4A 4M7DD 1E6HA 4EMKC 4C92B 3HPWA 1WHHA 2HAXA 2F2VA 4IMYB 4B9WA 2DD4A 3LW5E 2K57A 1E7PA 4BBRM 2FPFA 4Y72B 3POMA 3DDPB 1AVZC 3A8MB 2JUFA 1QP3A 5EJCA 4C8QE 2DF6A 4HT8A 2A7YA 3JCMd 1AT1B 2C5VB 4Y91A 4BCMB 1WJQA 2F2CA 1ZLMA 1PKDB 2L8DA 5KYXA 3JCMb 2PVDB 2EGAA 3SWNB 1VQ6T 3JCMW 5GJVB 4F7UF 1VOMA 2YWWA 3CCLQ 2RHIA 2PHGA 5LL6S 2X51A 4J5YA 4IKFA 1G3WA 2RF0A 1QMCA 1M5Q1 2BUDA 3PVLA 3QYBA 3SD4A 2E10A 4CC2A 4M7AF 2NUTB 2G6FX 2FZGB 1G8XA 2BE9B 5KE3A 3X26B 1X69A 3QJ6A 4M7AC 2X1NB 1Z9QA 3G4ST 5GMKj 1MNDA 3FLGA 1QVGA 4EOMB 1K1ZA 4AMCA 3JCMP 5A0DA 3CC7Q 3CMAT 4EOPB 4OMPA 4JRPA 1J3TA 2QQRA 5HK3A 1NEGA 2M0OA 4PJJA 1IGUA 4GY5A 2QEXT 3C4SA 4HCCA 1RACB 4EMKB 5GANg 3QWLA 2KMGA 1VQ5Q 2V1RA 2QA4T 4I3ZB 1KD1U 2CKKA 2QYZA 1WJSA 2IN3A 2RQTA 3MEWA 2RNAA 5I11A 2RHXA 2K5LA 2QFZA 3BG9A 1NE8A 3H9NA 1VQMT 2CP7A 5HBEB 2DD5B 1ZP2A 2EYWA 2Y90A 4F7UG 1O9SA 1ZA1B 1BKBA 1K73U 1D1AA 4M78D 1JJ2P 4ZGJB 2DO3A 2KBTA 1M8VA 2JW4A 1N8RC 3ZL7C 2DAQA 4IUVA 3SFMA 1Q81U 4M7AG 1LVKA 3M53A 2EJ9A 1JSUB 1R0CB 2YSQA 4PFZA 3S3NA 2C0OA 2E1HA 3UA7A 2XMFA 2FYKA 3FIFA 1FWZA 1VQ9A 5LMKB 1YJ9A 2DTOA 4L6V5 2M02A 1UHCA 1KHIA 5HQ0B 2YRDA 4IUPA 4C5HA 1YI2Q 2GTOA 1Y0MA 3KHIA 3VUZA 1KG1A 2O4XA 3MI9B 1WFWA 2X3WD 4NC6A 5LQFB 4XTYA 4M75E 3UF4A 2OTJA 2XIDA 4CC4B 4EMGA 1G83A 4BCJB 3OYKA 2AKLA 3BDUA 1IO6A 4BDYA 3A8LB 2DERA 2BIVA 4OB2B 4D6WA 3BW1A 2K5IA 3FRNA 3OYCA 1VQLQ 4LN2A 1KIKA 2LJ1A 4HVVA 2KXDA 2JM9A 1ABQA 2WJ9A 3F5XB 4OVAA 2BS4A 3CCMA 3RBBB 3L42A 2X9HA 4OMLA 2F5TX 2YRVA 1QQJA 3QKJA 2D1XA 4TVRA 1M30A 3VKIA 1IHWA 4NSTB 1WYXA 1VQPA 1ZUKA 2J6OA 1XTDA 1T3SA 1QVGP 3E9GA 2KK4A 2DXCB 2FL7A 1GCQC 1N4MA 3MPUB 2E3HA 2VGMA 4EONB 1GY3B 2D8HA 4JJDA 2NWMA 3CBPA 4BY6C 4XTWA 1M8MA 3F70A 3LX7A 3CBMA 3EAEA 3V7RA 4OMMA 3QIIA 4PJOE 1VQ7Q 1VUBA 3CCUQ 3UA6A 5LJ3d 5GAN7 4BCGB 5AYFA 2LT4A 2VVKA 1HD3A 5FLXE 3CCSQ 3EJ1B 3RNJA 5KCOA 1JKWA 4M77D 4C0ZA 2IVXA 1JRIA 2FO0A 2JM8A 2CZ6B 2AZVA 5HCKA 1WZOA 2CP2A 1PKSA 2C5NB 2VXFA 2COWA 2QTVA 1RI0A 3BG3A 1N5ZA 3CCRT 3TSZA 5LJ3g 3MP6A 1E6GA 1KD1C 1P5EB 4LUEA 5GAOn 4M7DF 3EFRA 1UG1A 1BCMA 3X28B 1A0NB 2YDLA 2J06A 3BLQB 2XDDA 5GAOr 4M7DC 4KUIA 4EOLB 1OULA 4ROCA 1YIJA 2ZAEA 1K73C 1K9AA 1JB0E 1D0XA 2WSCE 1GUXB 2EW3A 4ATOA 4C8QB 4FW2A 1BI1A 1KQSS 1SRLA 3ULRB 2DNUA 1X2KA 2FPDA 1WGSA 3BLHB 4F04B 4ELYC 2JNGA 5GAN6 5GANe 1KC8U 4YOZA 2OAWA 2RI5A 4KULA 4PFOA 3RERA 2KRNA 2LRQA 1I07A 4CFXB 4MMKA 1U1SA 1H641 1X6BA 4CC7A 4IURA 4J9DA 1MV3A 4CFWB 1G2BA 3MHXA 4BY6B 2WFYB 1OX8A 3CCVQ 1VQ4A 1YJNA 5IN1A 5ICPB 3NTHA 2LP5A 3L2QA 3CC2A 1VQ9T 3G6EA 1H3HA 4MDWA 2XICA 3M4GA 3CCQT 4KH1B 4R55A 1NYGA 1MGQA 3K7AM 3GOXA 2PZ1A 4J7IA 4M7DG 1TU0B 1YBYA 4M78A 2ZPHB 1JQQA 2BKDN 3RKYA 3LGLA 3BHTB 4A4HA 2DL3A 4BBSM 3B57A 3MJXA 3CD6T 2KYBA 3OW2A 2PMIB 2FZCB 4ELZC 1RAEB 3M0SA 2EQIA 5CR2A 1T3LA 2JN0A 1VQKT 5I2MA 2R58A 1VQ6Q 5DQVA 2RJCA 3RESA 1H26B 4BE0A 2WMAB 4J9CA 3X25B 1H3ZA 2ED1A 3VS3A 2R5MA 4R56A 2F2WA 1N6AA 3OBWA 2JXBA 2DJQA 4LDXA 4PLLA 4DOWA 2H3EB 2IW8B 2RA2A 1B07A 2WSFE 5KYWB 2K7AA 3CCMT 2QDYB 2E41A 1VQOA 4AKIA 4JRKA 3JCMX 4AG1C 3G4SQ 1CKBA 4XU3A 3JCMc 3M56A 4N4IA 3QPHA 4M78C 2JS2A 3LYIA 4HKEA 2RD1A 5GMKe 4Z88A 1ZQ1A 2LZ6B 2W9FA 2RPNA 1LPLA 4EC8B 2AK5A 3EFSA 3CMAQ 2PK2A 2CP3A 2VC8A 3OYAA 2LCLA 3RMSA 1UECA 4JRQA 1V76A 2QTXA 1OQKA 1YITA 2KEAA 3QZ9B 2QEXQ 1WHKA 1CSKA 5IXBA 4HCKA 2LTOA 2QA4Q 2O88A 2UZLB 1ZHIA 5GAMg 4JJCA 1W1FA 1VQMQ 1CKAA 4N4GA 4A4FA 2QQAA 2QQSA 2CYZB 2MWOA 3P8BB 2EVRA 4JDSA 3HRSA 1S1NA 4XU1A 2RHUA 4ESRA 1H92A 2KR3A 3DB4A 2VXEA 4C5GA 5IT9E 3OYMA 2RJEA 4AKHA 2JGZB 2YUOA 2DBMA 2RH2A 1Y7XA 4HCBA 1C9BA 2DXBA 4F7UE 4P5NA 1ZUYA 3PIPA 2D6FA 3VV0A 4Z6YA 2ED0A 1UNHD 3OS0A 2I0NA 1I4K1 1PD1A 1TS9A 4M78G 1N27A 3I55A 3CXCA 2K3XA 4M7AE 4BCPB 4C92A 5GMKm 4RTXA 1C6VX 1GCPA 2LQKA 2L3PA 4ROEA 3L2UA 2JT4A 1H8KA 1YP5A 2LNVA 3EG9B 4PLIA 2EYYA 1W2BA 5LJ5g 2I53A 4CFMB 1XNIA 3KUFA 4E7LA 1VA7A 2HCKA 3JCMh 2JMCA 3CPWS 1U3OA 2P0PA 3BY7A 2O9SA 3C95A 2ZCFB 4M77A 1O9KA 4II5B 3OYIA 3RGFB 3OW2P 4RG2A 3JB9D 2K6DA 5A2QE 5EG2A 1QWEA 3SWNA 1AWXA 2LX9A 2PVGB 4PKCC 3MP8A 4MZTA 4BXXX 2NYSA 4KRDB 3V7CA 4PJOB 1VQ4T 3I56A 1ARKA 4AI6A 1VYTA 2GQIA 2DETA 3T9NA 2EIFA 2AT1B 4FT4A 4ZGDB 2NUTA 1KHCA 1M2VA 2M9UA 3CCJA 4ZGEB 5IHNA 4JS5A 1QKWA 1D3BB 3QZ5B 3RKXA 2HSPA 1MMNA 2B86A 1HYOA 3EHQA 1K4US 2ROLA 2XI9A 1WXBA 2YLCA 5FU6B 1M90R 4CFUD 3CPFA 3EG2A 1OPLA 4M77C 2VYTA 3A98A 3EG1A 1GH6B 4AFZC 2V22B 1X43A 5FWCA 1OL2B 2DL4A 2X4XA 4FIBA 4AT1B 3RUXA 3PO3S 2A3LA 4BY7X 4KRCB 5CKHA 5KCHA 1SKUB 4EPCA 2L0AA 3LH0A 2FRYA 2F5KA 3UWNA 2JOYA 1H25B 1SPKA 2MIOA 2VWFA 4RKUE 5L23A 4CFVB 3H8ZA 4EC9B 3NDQA 1R0BG 1G3YA 3JB9I 3R6NA 2OX7A 2K2MA 2WEVB 4F6SB 6AT1B 2W10A 2KMTA 2CSIA 3L2WA 4BI3A 3A8OB 3THKA 1VIFA 3RIRA 1UGQB 2DD5A 3VYHB 4F7NB 2EQJA 2J7IA 2C06A 3Q1JA 3GNGA 2F1LA 3G1JA 2KRSA 2DVJA 3QSUA 3EGUA 4EORB 5D6XA 2ROTA 2NUZA 2EJFA 2V26A 1QMZB 4KRTA 1I81A 1NEBA 1Y96B 4IUTA 5FRMA 2RJFA 4DBQA 4KGVB 2J6KA 4CI0C 1K0SA 2RQVA 3CCRQ 4KGXB 3G71T 1H1RB 4CC3A 3PMTA 3RDVA 2VV5A 3FC3A 2DA9A 4DEYA 4RTVA 2NUPB 2DMOA 4M77G 1FVVB 3JCMf 2BTTA 3X24B 3CXCP 2IPOB 2QQBA 5KYYB 1Q86C 3E9FA 2LCCA 1ZBXA 4BE2A 1T0HA 1W2BP 3CC4A 2W9ZA 5EFQB 3WVDB 1URCB 4FSSA 1NJIR 7AT1B 3GLXA 3H41A 3PTAA 1AOJA 4E7IA 4IUQA 2H8HA 2KSSA 4BD3A 1PWTA 2HKNA 2CREA 3FDRA 4UN0A 2PTKA 3VS6A 3JV3A 2E65A 5GAMe 4X1VA 5A0LA 1HSQA 3QWXX 1UGSB 4RCCA 2XHCA 4XTZA 2EAYA 3VKGA 3TSWA 3OYNA 3BDLA 5GANd 2CZ1B 2R5AA 4HL4A 1RAAB 4A54A 1VQ8A 3OS5A 2GNCA 1MHNA 3OYYA 1VQ9Q 2P0KA 8AT1B 4O6JA 5D6YA 1D0ZA 4MDXA 4BCHB 1YHQA 3CCQQ 1RL2A 3TQ7P 2EYZA 4X9CA 2M51A 2O9VA 2RHZA 1BYMA 5IXFA 4BB7A 3OQ5A 1BIAA 2LQNA 4LUDA 2J6FA 1M90U 1OL1B 8ATCB 2KROA 2M0YA 1RAIB 2OAUA 3CD6Q 1G3NC 5ECAA 1M4ZA 4FYYB 4L59A 2DL5A 2DXCA 4M7DE 1VQKQ 3QG1A 5CVIA 3RMQA 2MOXA 2YHTA 5LJ5e 4BCFB 2W2HA 1MNEA 2R7GA 2JZ2A 3CMET 1RAFB 2CDTA 5HK0A 3TW6A 2P4TA 5LJ3h 2XD0A 3I56T 4E7JA 4F7JB 2DZ9A 2FZKB 1PNJA 2DTHA 3HO8A 2Y4YA 4EDUA 4DBRA 3CCMQ 2ZPBB 2EKOA 4QW2A 1UUEA 4A53A 3EFOB 1S72A 2CZ7B 2BZXA 2OI3A 2QI2A 3CCLA 1M3AA 2DL8A 1JEGA 1WQ7A 4Y28E 2FB7A 4F7UB 3UPUA 5CYIB 4PFPA 1TTHB 1FX7A 5FROA 4ZN3A 1BCOA 4J9GA 1XQHA 2DD4B 4GLKA 2PNIA 4BI8B 4HT9A 1VOLA 2H3JA 1H24B 4M7AB 2KYMA 1X75C 4DBFA 3VS4A 1VINA 2KVQG 2HL3A 4XAXB 2VB6A 4JUVA 2LCSA 5KYUB 2FHDA 4LE9A 4AG2C 3M03A 1KC8R 2GBQA 4C8QA 3V7SA 1NJIU 3PT9A 1YCSB 4J83A 1YJWT 1KFZA 1PRMC 1UGVA 1WA7A 2V8JA 2JTFA 2B9RA 2EPDA 4FSXA 4D8KA 2HQEA 3V8LA 4A4EA 2K4YA 3JB9F 3EGDB 1I8FA 4DEXA 3DB3A 2WACA 1BK2A 2A0FB 3GTMS 4FT2A 2QGFB 5GJWB 2PJQA 1H1PB 1BIBA 2BE7D 4F6WB 4RUGA 4KBMB 3VYGA 2DXTA 1AD5A 5KE2A 2DMEA 4BCNB 4QQDA 5FU7C 2CSQA 3WVEB 2C0IA 2EYXA 2LW4A 5DQWA 1RI9A 2EGEA 4M78E 4C0DC 2K79A 4HVWA 3QDRB 3MEUA 4X9DA 4EOKB 3OS1A 1WXUA 2C5OB 2QXFA 3FJ5A 3H0FA 2C0TA 1M1GA 2RK2A 4B9XA 2L3RA 1OI9B 4C92D 1H28B 4DBHA 4F7SB 5LJ3f 1H27B 4XTVA 1OI1A 1YI2A 1FYNA 5DLOA 5GAN3 2EJGA 2IW9B 1VQ4Q 5CK9A 3D7SB 3JB9G 1UHFA 1QVFA 1OOTA 4BCMD 4JX6A 1M90C 5I5ZB 1M27C 3GF5A 4XQ3A 4AFUC 5C6SA 1YHQT 5KYWA 3SDZA 1KQ1A 2A36A 4LDYA 1PG5B 3OY9A 2RI2A 2LT1A 4OGCA 4YOOA 4E7SA 2CCIB 2HDAA 4F14A 3META 1RADB 1HXDA 2ESWA 2LQ8A 4XU0A 2BPMB 3I5SA 3MKDA 4EOIB 3J81E 3JAME 1WIEA 2DILA 3M4YA 4EIKA 2A28A 1VYWB 1LOJA 2JTEA 2Z0WA 1WX6A 1NYFA 1Q81C 2O4XB 1D3UB 3GBQA 5FU7B 1XJWB 1UFFA 4BUGA 4E6RA 2QGGA 4GBQA 4BCOB 1FXXA 2DK3A 2DEUA 4J9FA 4WCIA 1NBEB 2HQXA 1JJ2S 2HEQA 5DLQE 2KNBB 4F17A 4M75A 2F69A 1S72T 3LGFA 4MZPA 5GMKl 4CFUB 1PM3A 2L89A 1GFDA 3A1PA 4J6WA 3QJYA 2NLUA 4J9BA 1JBMA 1YJ9T 3CCUA 1SG5A 3OYFA 3G71Q 2VUBA 2MK5A 2SEMA 2LDMA 2QQ8A 2QDLA 3CCSA 5HNBB 5GAN5 2GCXA 2IIMA 2GFUA 1OV3A 4JLIA 2DRKA 2MPXC 4IIOA 1W98B 1NJIC 1SHFA 4O5VA 3L2VA 4PJLA 1JSTB 2WMBB 2CP0A 4KGZB 1K9MU 3AHUA 2RB6A 4FL6A 2ATCB 2OTJT 2OTLA 4M77E 2YXYA 3EGXB 1X2QA 1G5VA 2KR6A 1HK9A 3OMGA 1ZSZA 4OGEA 2PK9B 3U23A 5IDNB 1F1BB 3E19A 2VKNA 4M75C 2UZDB 1M1KU 4M7DB 1QCFA 2KE9A 5KYNA 2QASA 3OYJA 1Z9ZA 4BY1X 4BDZA 3V8KA 2PUKB 1AD6A 5CKBA 1E7OA 3OS2A 2EBPA 5CO7A 4HA8A 3M9QA 5KH6A 3I9QA 3GNFB 2KGTA 4M78F 4BE1A 4LDVA 4PJOA 1QLYA 3CQTA 4MMLA 5GAMd 1U8RA 1EFNA 2X3XD 2P4RA 2XDBA 5GAN8 1QVFP 3HRTA 1VQPT 3TNIB 1MMAA 1TUGB 1Q82R 3HL8A 2BZ8A 1W6XA 1D3BA 1TSFA 1ZBJA 5CKFA 3OSVA 4J8OA 1QVGS 1FINB 2ZZDB 1IHVA 3C12A 3CCVA 4V2SA 2VGNA 4RTYA 2D8JA 1ZSZC 2CP5A 2LVMA 4CFNB 2CUBA 5DM7R 1OIYB 5M9OA 3N5BB 4DQ2A 1D1BA 3HTRA 3C0CA 3M0RA 4IIMA 4M75G 3CMEQ 2YUPA 2P0QA 3UDCA 4N4HA 4HVUA 1MUZA 2B8AA 1ABOA 4RTUA 3I56Q 2COZA 2JJ9A 5IHKA 5LJ5d 5IH2A 1K76A 3JCMQ 4OB0B 2BZYA 5I2SA 1Y57A 4J6XA 4QVDA 1G3TA 2W96A 1D1CA 5A0GA 1XO2A 3P8HA 4IUUA 1OGUB 2E6NA 2RJDA 2PUOB 2CS7A 4YOSA 5CKDA 5HBHB 5EC7A 3VS5A 4C0FA 1Y96A 3M0UA 2GTJA 1VYUA 1X6OA 1O75A 5GAOq 1QCNA 1YIJT 3P8DA 3TNHB 4LOCA 1RUWA 2NUPA 1KC8C 2YRCA 1TXQA 3G4SA 4MIMA 4M78B 3MP1A 3S3MA 4RCBA 1TUCA 2DJZA 5FRNA 5KYYA 2MF2A 3DTOA 3QXEB 2EQUA 5CKEA 3VKHA 2GFAA 1D0YA 3CMAA 3OYHA 1YJWQ 2AIRB 3TEEA 1QP2A 1W4SA 2HSEB 1JOWA 4EOSB 1Y71A 2HL5C 4C92F 4OR5B 4OB1B 2HMAA 4ZTJA 2QA4A 1YJNT 1TOVA 1YN8A 2RN8A 4NS5A 3MCAB 4C92C 3TW7A 5IHIA 3CC2T 2E6ZA 2QQ9A 3REAB 4N0AA 3G6ET 4JJBA 1KJWA 5GANh 1YWOA 1WI7A 4F16A 2CUDA 2K3BA 4NL2A 4C8QD 2D9TA 2RI3A 1RLPC 4MZMA 2JVVA 2DE0X 2EGCA 3MY5B 3KXTA 4M77F 2K9GA 2MI6A 5IDPB 2P84A 3EH1A 1T0JA 3PGGA 2FRWA 2V1QA 4QVZA 3KBGA 1Q82U 3ER0A 3I35A 4HLQA 2MWPA 3BHUB 2Y4XA 4QVCA 2ZPIB 2PVOB 4Z89A 2RO0A 2OTLT 3ZBDA 4C5IA 1TUDA 1BBZA 2IG0A 3SWNC 3GIBA 2ABLA 1X01A 2PU9B 4ORZA 4EMKA 3M0PA 1QLBA 2ZPGB 2M1HA 1VQNA 2DYIA 2MYSA 1KQSA 1TWBA 3E1SA 4B6MA 2YUQA 3QO3A 2YUNA 4BACA 1AZGB 3SB2A 4J9HA 3INZA 1VQOT 3CCEA 2QF7A 1PC0A 4NOYA 4QQ6A 4C92G 1QCOA 1PCXA 1H1SB 1IRXA 1UEBA 3REBB 5GANj 2E4HA 1B34B 3QBYA 4HNUA 1IXDA 2SRCA 1SSHA 3H4CA 3QDFA 1YHQQ 1OU8A 4QT7A 3HB9A 2O31A 1MMDA 3HHTB 3VS0A 1UNGD 3EFOA 2DFUA 3VU3C 1M9SA 1YITT 4F7UA 5I22A 4PJNA 1OZ3A 9ATCB 2RM4A 3KFVA 2KXCA 1TH7A 2WIHB 1GXIE 3TN8B 1RLQC 5GMKh 1FMKA 2RK1A 2GGRA 3OYBA 2CT3A 2LJ0A 4M7AA 4BCIB 1TD6A 1NG2A 2UZEB 1XOVA 4J7FA 3A8HB 2ZGWA 3SHWA 2HNIA 2RQWA 4M77B 4JX4A 1F5QB 5KYUA 4GLMA 3JB9J 3I5RA 2HQHA 3NFCA 1O9KB 2E70A 2D0NA 1WHJA 3X20B 1M3BA 1ZX6A 1UJYA 2MCNA 4R0KA 2FEIA 2XKOC 1WHGA 3M5AA 1U1TA 5GANf 3OYGA 1WHLA 4JRIA 4E7KA 1PSEA 1RAGB 1S72Q 1AWWA 2COYA 4Y92A 1KK7A 2KQWA 1I0CA 3I55T 3EGDA 3GPLA 1N9SA 5FGKB 1YJ9Q 3JCMg 2WIPB 4WTOB 3CEYA 1R8OB 4E7ZA 3JRZA 4J9EA 2IVWA 1M2VB 1AISB 3OYLA 5HKCA 2DYBA 1P92A 4M75D 1X6GA 5HY6A 1YCYA 4QSHA 2CH4A 2QG9B 2O2OA 2OTJQ 4RG8A 3LQ5B 2G3RA 3CCRA 1PRLC 4ZNXA 3OW2S 4AFSC 4M4ZA 4XU2A 3OSSC 4RMOA 2FVUA 3PVQA 1UNLD 1Q7YR 1KQSP 1K8AR 2BS2A 1YFNA 4LD6A 1PKTA 1YWPA 1SF9A 3CCJT 1Q82C 1U5SA 3SEMA 1OU9A 1RABB 5I21A 3RR6A 2EUFA 2E64A 3O5ZA 2QDJA 1VQPQ 2KY9A 2BS3A 5ACBA 2DX1A 2GQVA 2L3QA 2DPPB 2LQWA 3EIDB 4FCYA 2L3SA 4JS4A 4ME7A 4LDUA 2K5FA 3MEAA 3HBLA 4PJOD 3M59A 2RQUA 5L2WB 1VQNT 1EX4A 3CPWA 3QWYA 1FKMA 1MMGA 4NL3A 3A5ZB 5IAYA 3LWHA 2EFIA 4OP0A 3CCQA 4OMOA 3CC7A 1GUXA 3UATA 3TNWB 1EIFA 3BLRB 4LDWA 4II1A 5KYXB 1G3SA 4BCQD 1H4LD 2E5KA 4FM4B 5LJ3j 1SSFA 1YNZA 2A37A 2CZ0B 1U06A 3M57A 3CCET 1AEYA 1UTIA 5J3BA 4LNPA 5HVYB 3CD6A 4J9IA 1VQ5A 1RAHB 1UGPB 1GCQA 3VS1A 3TU4K 1KQ2A 1VQKA 1OIUB 1ENWA 2E3IA 4EOJB 2CH4W 3OYEA 1C1AA 3VS7A 1UE9A 3JCMV 1NLPC 1OKVB 3DKMA 1AWOA 2XDPA 4M6VA 3URGA 2HKQB 4KH0B 2UZBB 3MO8A 4OMQA 3JB9H 3H0HA 2PQWA 3PMIA 2WSEE 1YIJQ 2VASA 4C8QF 1K9MR 3FJPA 2DTIA 3CXCS
chains in the Genus database with same CATH topology
3CC4T 5KE3A 1G5VA 2D0QB 1PSFA 2LX9A 3OB9A 4C8QC 3X26B 2KR6A 1HK9A 3HZJA 2DIQA 3ME9A 3OMGA 3QJ6A 4M7AC 4OGEA 2PVGB 4PKCC 3G4ST 3MP8A 4MZTA 3E19A 3V7CA 4M75C 4PJOB 5GMKj 1VQ4T 1M1KU 5CQYA 4M7DB 3I56A 3LWHA 4AI6A 1NZ9A 3FLGA 3CCQA 1W2BS 3OYJA 1QVGA 4BDZA 3V8KA 2PUKB 3T9NA 2EIFA 4FT4A 5CKBA 3M58A 3JCMP 5A0DA 3OS2A 4ZGDB 4ELJA 3CMAT 5CO7A 1KHCA 2M9UA 4HA8A 3CCJA 3M9QA 3NTIA 4JRPA 4ZGEB 1NPRA 4A4GA 5KH6A 4JS5A 2QQRA 1D3BB 4L5GA 3GNFB 5HK3A 2M0OA 4M78F 3QZ5B 3RKXA 3PIOA 4BE1A 1BI2A 4LDVA 3QYGB 5CCAA 3DL1A 4GY5A 2XI9A 2QEXT 4PJOA 3C4SA 1Q7YU 2AHJB 2YLCA 5FU6B 4HCCA 4MMLA 4M7DA 4Z02A 3HKSA 4EMKB 1VQ8T 5GAMd 5GANg 4ZTFA 3QWLA 1U8RA 1K8AU 4MDXA 2KMGA 3CPFA 2QA4T 2XDBA 5GAN8 4M77C 2VYTA 3HRTA 1VQPT 1KD1U 3R6OA 2CKKA 3J80E 2X4XA 4FIBA 1WJSA 3HL8A 3MEWA 3RUXA 4KT0E 2A3LA 2RHXA 1D3BA 2QFZA 3BG9A 1NE8A 2K5LA 3M55A 5CKFA 1VQMT 5CKHA 3OSVA 5GAMh 2DD5B 4J8OA 2E5QA 5KCHA 4EPCA 2Y90A 4F7UG 1O9SA 1QVGS 3LH0A 2ZZDB 1BKBA 2F5KA 3UWNA 3C12A 3PNWC 3CCVA 2JOYA 4M78D 2MAMA 2MMPA 2VGNA 1K73U 2X4WA 1UGRB 4V2SA 4ZGJB 4RKUE 2DO3A 1VQLA 3H8ZA 4DOVA 1M8VA 2LVMA 1N8RC 2JTMA 1G3YA 3JB9I 2DAQA 3FB9A 4IUVA 3SFMA 5DM7R 4C8QG 5M9OA 3O8VA 1QW1A 1Q81U 4M7AG 2KMTA 3JCMe 5GAOl 3N5BB 3L2WA 4BI3A 1NPPA 3A8OB 4DQ2A 1VIFA 3RIRA 1UGQB 2DD5A 3VYHB 3C94A 2O01E 4M75G 2EQJA 2EYQA 2X4YA 3M53A 2EJ9A 2ZZDA 2C06A 3Q1JA 3QUIA 3GNGA 2P0QA 3UDCA 3S3NA 2E1HA 4N4HA 5GAOp 2B8AA 2FYKA 3QSUA 5D6XA 1IZ6A 2EQKA 3FIFA 1FWZA 1VQ9A 2EJFA 4PL6A 4C0DB 1YJ9A 5LJ5d 3QHSA 1I81A 1Y96B 4OB0B 3JCMQ 4IUTA 4A4KA 2DTOA 5I2SA 2RJFA 4L6V5 5FRMA 4J6XA 4QVDA 1KHIA 4CI0C 3NTKA 4IUPA 1G3TA 4C5HA 3G71T 2ZPEB 5A0GA 3J7AF 3PMTA 2VV5A 3FC3A 2HBPA 3KHIA 3P8HA 4IUUA 3VUZA 1KG1A 2E6NA 2O4XA 2RJDA 2PUOB 2CS7A 4M77G 5CKDA 3JCMf 1LNXA 3RKWA 5LJ5h 3CCLT 3X24B 5CQXA 2QQBA 4NC6A 3BFMA 4XTYA 5C0MA 4C0FA 1VIEA 1Y96A 4M75E 2OTJA 1Q86C 2XIDA 5GAMj 3E9FA 4ZN1A 4JX5A 1X6OA 2G77A 1O75A 2LCCA 4EMGA 5GAOq 1YIJT 1VQ7A 5J26A 4C92E 1ZBXA 3P8DA 3OYKA 4BE2A 2V8KA 3CC4A 3BDUA 3VJPA 3WVDB 4BDYA 4LOCA 3A8LB 4C5EA 1KC8C 4M7DG 3GLXA 3G4SA 2BIVA 3DLLA 4OB2B 4D6WA 3BW1A 2K5IA 4MIMA 3VYGB 3FRNA 3PTAA 4E7IA 4M78B 4IUQA 3OYCA 2I2LA 3MP1A 2KSSA 4RCBA 2DJZA 3S3MA 4BD3A 4XTUA 5FRNA 1V29B 2MF2A 2GF7A 3UT1A 3QXEB 3FDRA 2EQUA 3GP8A 5CKEA 3VKHA 2GFAA 3CMAA 2WJ9A 3HFOA 2E65A 4OVAA 5GAMe 5A0LA 3OYHA 2BS4A 3CCMA 3CC7T 1UGSB 3TEEA 3L42A 4RCCA 4WF2A 2DEQA 1QP2A 2XHCA 2F5TX 4XTZA 4M75F 2EAYA 3VKGA 3WXMB 3HFNA 3OYNA 1W4SA 2YRVA 3BDLA 5GANd 2CZ1B 2K3YA 2R5AA 3M54A 3QKJA 4HL4A 1Y71A 4CRIA 5J39A 4C92F 3VKIA 4TVRA 4A54A 1VQ8A 4OB1B 3OS5A 2E12A 1MHNA 3H6ZA 5GAN2 4ZTJA 3OYYA 2QA4A 4JJNK 1YJNT 1LJOA 4NS5A 1VQPA 2P0KA 3MCAB 2X4JA 3OA6A 1XTDA 2XG8D 4C92C 4O6JA 3E9GA 3TW7A 5D6YA 1VQ5T 4XTXA 2E6ZA 2QQ9A 3G6ET 4N0AA 1YHQA 3CC2T 2KK4A 1RL2A 2DXCB 3DLMA 5GANh 3LLRA 4X9CA 2FL7A 5LJ5j 4NL2A 4C8QD 2RHZA 2D9TA 2RI3A 1BYMA 1BI3A 2VGMA 4BB7A 4M7AD 3OQ5A 1BIAA 4MZMA 2JVVA 1M90U 1AHJB 3KXTA 5GAMf 4M77F 2MI6A 3CBPA 4BY6C 1N9RA 4XTWA 2OAUA 3F70A 3LX7A 3A8GB 3PGGA 2EQMA 4QVZA 1WNLA 3CBMA 2LC4A 1M4ZA 1QVPA 3EAEA 4L59A 3V7RA 3KBGA 3MEVA 1Q82U 2DXCA 3ER0A 3QIIA 3TCJA 4HLQA 4PJOE 2MWPA 2Y4XA 4M7DE 1VUBA 4QVCA 2ZPIB 2PVOB 5LJ3d 2RO0A 3QG1A 5CVIA 3RMQA 5GAN7 2OTLT 3ZBDA 2YHTA 5AYFA 3ZEHA 3OMCA 4C5IA 2KAFA 2IG0A 2LT4A 4BI4A 1DJ7B 5LJ5e 3SWNC 3GIBA 2JZ2A 5FLXE 1X01A 2PU9B 3CMET 5KCOA 4EMKA 1BI0A 1QLBA 2ZPGB 2M1HA 5HK0A 1VQNA 3TW6A 2P4TA 1KQSA 4M77D 5LJ3h 4C0ZA 4E47A 2XD0A 3I56T 1JRIA 4E7JA 3E1SA 2CZ6B 2DZ9A 3JCMJ 3QO3A 2DTHA 4BACA 1Q7YC 4OB3B 3HO8A 2Y4YA 2YLBA 4EDUA 2VXFA 3SB2A 2ZPBB 3VUBA 1RI0A 3G71A 1K8AC 3INZA 3BG3A 5GAOm 4VUBA 3CCRT 1YI2T 2EKOA 4QW2A 5LJ3g 3MP6A 4A53A 1KD1C 4PJOF 1S72A 1VQOT 2CZ7B 5GAOn 2QI2A 3CCEA 3CCLA 3HSBA 2QF7A 3EFRA 4M7DF 4NOYA 4QQ6A 4C92G 1WQ7A 3X28B 4Y28E 2FB7A 1UEBA 4F7UB 3UPUA 1I5LA 5GANj 2XDDA 4PJOC 5LJ5f 1B34B 1OYXA 3QBYA 5GAOr 4M7DC 4HNUA 1FX7A 5FROA 4KUIA 4ZN3A 3H4CA 3CBOA 5DY9A 1YIJA 3OBYA 4UC4A 4C0GA 1K73C 1JB0E 1XQHA 2DD4B 3HB9A 4GLKA 2DXUA 2WSCE 4ATOA 2L5QA 3HHTB 4BI8B 4HT9A 2H3JA 3JSCA 3S6WA 3TREA 4C8QB 4EMHA 1BI1A 1VQ6A 4M7AB 1KQSS 1X75C 3VU3C 1M9SA 4QQGA 1YITT 1Q86U 4M75B 2KVQG 4F7UA 4E7HA 1WGSA 1OZ3A 1B34A 2RM4A 4XAXB 5FU6C 4ELYC 5GMKi 2JNGA 5GAN6 1VQLT 1TH7A 4JUVA 5GANe 1KC8U 2RHYA 2FHDA 1GXIE 2RI5A 5GMKh 4KULA 2DIGA 2RK1A 4X34A 3OYBA 4C8QA 1WJRA 3V7SA 3RERA 1NJIU 4KUDK 3PT9A 4J83A 1YJWT 4M7AA 2LRQA 5D6WA 2V8JA 4MMKA 2JTFA 1U1SA 1H641 1XOVA 4IURA 3FEOA 3A8HB 4FSXA 4J7FA 2ZGWA 3MHXA 4BY6B 2HQEA 1M1FA 2HNIA 1VQ4A 4Q5WA 3V8LA 4A4EA 2K4YA 1YJNA 5IN1A 5GAN4 4M77B 2CGHA 3JB9F 4JX4A 3NTHA 1I8FA 2EWNA 3L2QA 3JB9J 3CC2A 1VQ9T 3DB3A 3QYEA 2WACA 4MDWA 3NFCA 3V8JA 3G6EA 2E70A 2XICA 3M4GA 3CCQT 3X20B 4FT2A 4R55A 2XKOC 3M5AA 1MGQA 1U1TA 5GANf 3OYGA 4JRIA 1BIBA 1OZ2A 4E7KA 1PSEA 4PJOG 3GOXA 4J7IA 4KBMB 3VYGA 4MFEA 1YBYA 2DXTA 4M78A 2QEXA 2ZPHB 2KQWA 3L2ZA 5LJ3e 2BKDN 2X35A 3LGLA 4XK8E 3RKYA 3I55T 4HNTA 4A4HA 5KE2A 4QQDA 4BBSM 4JLGA 5FU7C 3GPLA 3CD6T 1N9SA 3PFSA 1WPYA 3WVEB 3OW2A 4ELZC 4M78E 4C0DC 3JCMg 3CEYA 1VQ7T 1R8OB 3CCUT 3ZFJA 5CR2A 3QDRB 3JRZA 2JN0A 1VQMA 2IVWA 1VQKT 5I2MA 2R58A 3MEUA 4AKGA 4X9DA 3OYDA 3OYLA 5HKCA 2RJCA 3OS1A 1K9MC 3RESA 3CMEA 4BE0A 4FU6A 2QXFA 3L2RA 3CCST 1P92A 5CAIA 3LWIA 4M75D 1M1GA 3G7ZA 1Y07A 2RK2A 4B9XA 3X25B 2L3RA 5HY6A 1H3ZA 2XK0A 2K2VA 1YCYA 4QSHA 4C92D 2DVEA 2R5MA 4R56A 4HCZA 1N6AA 3OBWA 5LJ3f 4RG8A 4PLLA 4LDXA 4DOWA 2RA2A 2G3RA 2WSFE 4XTVA 1OI1A 1M1KC 3CCMT 3CCRA 1YI2A 2QDYB 2E41A 5DLOA 1N8RU 1VQOA 4AKIA 4JRKA 5GAN3 2EJGA 3JCMX 3OW2S 4XU3A 3JCMc 2V8IA 3M56A 4N4IA 2R57A 3QPHA 4PNOA 3S3OA 4XU2A 3OSSC 4M78C 5CK9A 2FVUA 4RMOA 2KDSA 3LYIA 4HKEA 2RD1A 4J6YA 5GMKe 3JB9G 1QVFA 3ASKA 1ZQ1A 4LD9K 4JX6A 2BS2A 1WQWA 3EFSA 4XQ3A 3GF5A 1M90C 5C6SA 4LD6A 2VC8A 1YHQT 3OYAA 2DZCA 2LCLA 4YTLA 3SDZA 1KQ1A 4N0AC 3RMSA 4LDYA 2DKGA 3CCJT 4JRQA 2ZPFB 3OY9A 2QTXA 1YITA 1Q82C 2XU8A 3QZ9B 4HNVA 2RI2A 2LT1A 4OMFB 4OGCA 3BG5A 1JJ2A 5I21A 3META 2E64A 2LTOA 1HXDA 1UB4A 2QDJA 2LQ8A 4XU0A 2KY9A 3L1AA 2BS3A 1ZHIA 5GAMg 2GQVA 3JAME 3J81E 5L8RE 3QYHB 1IREB 2DXBB 3M4YA 2DPPB 1LOJA 1YJWA 4OF1A 3HRUA 4N4GA 4A4FA 2QQAA 2QQSA 2CYZB 2MWOA 3P8BB 4JDSA 3HRSA 4XU1A 2HD0A 2RHUA 4JS4A 4ME7A 1QVFS 2M16A 4LDUA 5CIUA 2K5FA 2VXEA 3DB4A 3HP9A 3MEAA 4C5GA 4MFDA 2O4XB 3OYMA 5IT9E 3HBLA 1Q81C 2RJEA 4PJOD 3M59A 5FU7B 3CCVT 4DA4A 4M7DD 4EMKC 4AKHA 4BUGA 4C92B 3HPWA 1VQNT 3CPWA 1FKMA 2HAXA 2RH2A 1Y7XA 4NL3A 4HCBA 3A5ZB 2DXBA 4F7UE 2EFIA 4OP0A 1FXXA 4P5NA 4B9WA 2DD4A 5IAYA 3PIPA 2DK3A 3LW5E 3CC7A 2K57A 2D6FA 1E7PA 1EIFA 3VV0A 2HQXA 4Z6YA 4II1A 4LDWA 4BBRM 5DLQE 3OS0A 1G3SA 1JJ2S 1I4K1 4FM4B 4M78G 5LJ3j 1SSFA 3A8MB 4M75A 2JUFA 2CZ0B 1N27A 2F69A 1QP3A 1S72T 3LGFA 3M57A 5EJCA 4MZPA 3I55A 3CCET 5J3BA 4C8QE 5GMKl 3CXCA 2K3XA 2L89A 4HT8A 4M7AE 2A7YA 4C92A 3CD6A 5GMKm 3JCMd 4J6WA 3QJYA 1VQ5A 2LQKA 2NLUA 4Y91A 3L2UA 1UGPB 1JBMA 1WJQA 1YJ9T 3TU4K 3CCUA 1KQ2A 1VQKA 2LNVA 3OYFA 4PLIA 2L8DA 1W2BA 5LJ5g 3OYEA 2VUBA 1XNIA 3JCMb 2PVDB 2LDMA 3SWNB 3KUFA 4E7LA 3JCMV 2QQ8A 1VQ6T 3JCMW 3JCMh 4F7UF 3CCSA 3DKMA 3CPWS 2XDPA 5GAN5 2P0PA 4M6VA 3BY7A 2GCXA 3URGA 2GFUA 2RHIA 3C95A 4JLIA 2ZCFB 3MO8A 4M77A 1NJIC 3JB9H 5LL6S 4O5VA 3L2VA 4J5YA 4IKFA 3OYIA 2PQWA 3PMIA 1G3WA 2WSEE 4RG2A 2RB6A 4FL6A 1K9MU 1M5Q1 3JB9D 3AHUA 2BUDA 2OTJT 3QYBA 3SD4A 4C8QF 2OTLA 4M77E 2E10A 5A2QE 4M7AF 3FJPA 5EG2A 2DTIA 3SWNA 3CXCS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0Q B;  1PSF A;  3X26 B;  2PVG B;  3WVD B;  1JB0 E;  3A8L B;  2DD4 B;  2WSC E;  3HHT B;  4OB2 B;  3VYG B;  2PUK B;  1V29 B;  2ZPF B;  4ZGD B;  3QXE B;  3QZ9 B;  4ZGE B;  3QZ5 B;  1UGS B;  3QYG B;  1GXI E;  1QP2 A;  2AHJ B;  2CZ1 B;  5L8R E;  3QYH B;  1IRE B;  2DXB B;  2DPP B;  4OB1 B;  3A8H B;  2CYZ B;  4KT0 E;  2DXC B;  2DD5 B;  2ZZD B;  3X20 B;  1UGR B;  4ZGJ B;  1AHJ B;  4RKU E;  2DXB A;  2DD4 A;  3LW5 E;  1PSE A;  3VYG A;  3A8G B;  2ZPH B;  4XK8 E;  4FM4 B;  2DXC A;  3A8M B;  3A8O B;  2CZ0 B;  1QP3 A;  1UGQ B;  2DD5 A;  3VYH B;  2O01 E;  2ZPI B;  2PVO B;  3WVE B;  2ZZD A;  1DJ7 B;  1UGP B;  2PU9 B;  2ZPG B;  4OB0 B;  2PVD B;  4L6V 5;  3X25 B;  2CZ6 B;  2ZPE B;  4OB3 B;  2ZCF B;  2ZPB B;  2PUO B;  2WSF E;  3X24 B;  2WSE E;  2CZ7 B;  2QDY B;  3X28 B;  4Y28 E; 
#chains in the Genus database with same CATH topology
 4FYV B;  2CT4 A;  3CC4 T;  2D0Q B;  1PSF A;  3OB9 A;  4C8Q C;  2DIQ A;  3ME9 A;  3HZJ A;  1Q95 G;  1C0M A;  1ZUU A;  4Z8A A;  2LNH B;  5CQY A;  2WPA B;  1NZ9 A;  4CXA B;  5BNJ B;  1W2B S;  1M1K R;  4PK4 A;  1D09 B;  2EKH A;  3M58 A;  4FW1 A;  1MV0 B;  4ELJ A;  1WLP B;  3EGX A;  3NTI A;  4A4G A;  1NPR A;  2HZY A;  3EHR A;  3VRY A;  1OPK A;  4L5G A;  2KT8 A;  3PIO A;  1BI2 A;  2UUE B;  3QYG B;  5CCA A;  5IHY A;  1E9H B;  4YC3 B;  3DL1 A;  3G33 B;  1Q7Y U;  2AHJ B;  1X27 A;  4M7D A;  4Z02 A;  3HKS A;  4HXJ A;  1YJN Q;  1VQ8 T;  4ZTF A;  1K8A U;  4AFQ C;  3CC2 Q;  3G6E Q;  3R6O A;  1QKX A;  3J80 E;  4KT0 E;  3M55 A;  4F6U B;  1IB8 A;  5GAM h;  2E5Q A;  2L2P A;  3O0G D;  3DJB A;  3PE0 A;  2DBK A;  3PNW C;  2MAM A;  2MMP A;  2CCH B;  1UGR B;  2X4W A;  1VQL A;  4DOV A;  2JTM A;  4RTT A;  1NLO C;  3FB9 A;  4C8Q G;  2OTL Q;  3O8V A;  1QW1 A;  3JCM e;  5GAO l;  3TVT A;  1AZE A;  3BE3 A;  1NPP A;  1M3C A;  2C6T B;  4ELL A;  3C94 A;  2O01 E;  2HBW A;  2AZS A;  2EYQ A;  2X4Y A;  1OKW B;  3NPF A;  2ZZD A;  1HJD A;  3EG3 A;  3QUI A;  5GAO p;  1V1C A;  3MIA B;  1IZ6 A;  2A08 A;  2EQK A;  4PL6 A;  1JXM A;  4C0D B;  1OEB A;  3CPW P;  3QHS A;  4A4K A;  4ANJ A;  3NTK A;  2W0Z A;  5FWB A;  1GBR A;  2ZPE B;  3J7A F;  1R77 A;  4TTH A;  1VQO Q;  1M2O A;  2HBP A;  2C4G B;  3VS2 A;  3IQL A;  1PD0 A;  3CCL T;  5LJ5 h;  1LNX A;  3RKW A;  5CQX A;  1Q86 R;  3EH2 A;  3EOC B;  3BFM A;  5C0M A;  4F7L B;  1VIE A;  5GAM j;  4ZN1 A;  4JX5 A;  2G77 A;  2KRM A;  1VQ7 A;  5J26 A;  4C92 E;  2V8K A;  1SHG A;  3VJP A;  4C5E A;  1YIT Q;  1FMW A;  2QK0 A;  3DLL A;  3VYG B;  3NGP A;  4E2F B;  3LH5 A;  3NHN A;  2I2L A;  4XTU A;  1V29 B;  2GF7 A;  1KXU A;  4EOQ B;  3UT1 A;  3GP8 A;  3EG9 A;  3HFO A;  3CC7 T;  1WXT A;  4PJM A;  2DEQ A;  4WF2 A;  1GFC A;  4M75 F;  3WXM B;  3HFN A;  2BKZ B;  2RMO A;  2K3Y A;  2WXV B;  3M54 A;  4CRI A;  5J39 A;  2AKK A;  2E12 A;  3H6Z A;  5GAN 2;  4JJN K;  1LJO A;  3OA6 A;  2X4J A;  1VQ5 T;  2XG8 D;  4XTX A;  2WHB B;  3DLM A;  4FX3 B;  3LLR A;  1EZZ B;  1JO8 A;  5LJ5 j;  1BI3 A;  4M7A D;  2DRM A;  4EOO B;  1AHJ B;  1I1J A;  5GAM f;  1GRI A;  1BB9 A;  3I55 Q;  1WHM A;  1N9R A;  3A8G B;  2EQM A;  1SEM A;  1WNL A;  2LC4 A;  1QVP A;  3VRZ A;  3MEV A;  2LMJ A;  3TCJ A;  4K11 A;  3ZEH A;  3OMC A;  2KAF A;  4BI4 A;  1DJ7 B;  5FW9 A;  1N8R R;  1BI0 A;  1UJ0 A;  1FMV A;  1B3Q A;  2YT6 A;  4E47 A;  3QHR B;  3JCM J;  4BCK B;  3DOG B;  1Q7Y C;  4OB3 B;  4JZ4 A;  2YLB A;  3VUB A;  3G71 A;  1K8A C;  3MY1 B;  5GAO m;  2JMA A;  4VUB A;  1YI2 T;  2ENM A;  4PJO F;  4G6L B;  3H0I A;  3HSB A;  2LJ3 A;  1I5L A;  4BCN D;  3QHW B;  4FYW B;  1SRM A;  4PJO C;  5LJ5 f;  1OYX A;  1KSW A;  3CBO A;  2DLP A;  5DY9 A;  3OBY A;  4UC4 A;  3M0Q A;  4C0G A;  2OJ2 A;  2QGS A;  1BU1 A;  2DXU A;  3CCJ Q;  2L5Q A;  3JSC A;  3S6W A;  3TRE A;  4EMH A;  1VQ6 A;  2I40 B;  1I5O B;  4QQG A;  1Q86 U;  4M75 B;  4E7H A;  4LXC A;  2RQR A;  1B34 A;  5FU6 C;  5GMK i;  1VQL T;  2RHY A;  2W99 A;  2JS0 A;  5AT1 B;  2DIG A;  1TG0 A;  4X34 A;  1WJR A;  1K0X A;  3AT1 B;  4KUD K;  1JXO A;  5D6W A;  3BHV B;  3FEO A;  1M1F A;  4Q5W A;  1WDX A;  1VQN Q;  5GAN 4;  1ACM B;  2CGH A;  2EWN A;  3QYE A;  3V8J A;  1OX9 A;  1B7T A;  2G9X B;  1AWJ A;  1OZ2 A;  4PJO G;  1BU2 A;  2QEX A;  4MFE A;  3CCE Q;  5LJ3 e;  3L2Z A;  1ZSZ B;  1ZSG A;  2X35 A;  1VYV A;  2CJM B;  2KT1 A;  4HNT A;  4JZ3 A;  4XK8 E;  2CP6 A;  3E2U A;  4JLG A;  3PFS A;  1WPY A;  4JPB W;  3NMZ C;  1VQ7 T;  3CCU T;  1VQM A;  3ZFJ A;  5HBJ B;  1UDL A;  3EG0 A;  4CRL B;  4AKG A;  2FG0 A;  3OYD A;  1K9M C;  3CME A;  2DM1 A;  1W70 A;  4FU6 A;  3L2R A;  3CCS T;  5CAI A;  3LWI A;  5CEI B;  3G7Z A;  1Y07 A;  2XK0 A;  2K2V A;  2DVE A;  4HCZ A;  1LCK A;  2J05 A;  3DDQ B;  4F70 B;  4QKU A;  1M1K C;  3CC4 Q;  4BCQ B;  2LX7 A;  2F2X A;  1N8R U;  1JU5 C;  2V8I A;  4OGR B;  2R57 A;  4PNO A;  3S3O A;  2ECZ A;  5IF1 B;  2KDS A;  1PHT A;  4J6Y A;  3ASK A;  4LD9 K;  3M0T A;  1WQW A;  4RTW A;  2DZC A;  4YTL A;  1GL5 A;  1KD1 R;  2KI7 A;  4ROD A;  4N0A C;  2DKG A;  2FPE A;  2ZPF B;  2C5X B;  1NM7 A;  2XU8 A;  4HNV A;  4OMF B;  1H1Q B;  4OMN A;  1ZA2 B;  1QWF A;  3BG5 A;  1JJ2 A;  1IGQ A;  1VQ8 Q;  1GBQ A;  1UB4 A;  1K73 R;  1TFB A;  3L1A A;  5L8R E;  3QYH B;  1IRE B;  2QAZ A;  2DXB B;  4A63 B;  4RTZ A;  4D8D A;  1YJW A;  4OF1 A;  3HRU A;  2DL7 A;  4FYX B;  1Q81 R;  5D7U A;  2IW6 B;  2HD0 A;  1QVF S;  2M16 A;  5CIU A;  3HP9 A;  4MFD A;  3CCV T;  4DA4 A;  4M7D D;  1E6H A;  4EMK C;  4C92 B;  3HPW A;  1WHH A;  2HAX A;  2F2V A;  4IMY B;  4B9W A;  2DD4 A;  3LW5 E;  2K57 A;  1E7P A;  4BBR M;  2FPF A;  4Y72 B;  3POM A;  3DDP B;  1AVZ C;  3A8M B;  2JUF A;  1QP3 A;  5EJC A;  4C8Q E;  2DF6 A;  4HT8 A;  2A7Y A;  3JCM d;  1AT1 B;  2C5V B;  4Y91 A;  4BCM B;  1WJQ A;  2F2C A;  1ZLM A;  1PKD B;  2L8D A;  5KYX A;  3JCM b;  2PVD B;  2EGA A;  3SWN B;  1VQ6 T;  3JCM W;  5GJV B;  4F7U F;  1VOM A;  2YWW A;  3CCL Q;  2RHI A;  2PHG A;  5LL6 S;  2X51 A;  4J5Y A;  4IKF A;  1G3W A;  2RF0 A;  1QMC A;  1M5Q 1;  2BUD A;  3PVL A;  3QYB A;  3SD4 A;  2E10 A;  4CC2 A;  4M7A F;  2NUT B;  2G6F X;  2FZG B;  1G8X A;  2BE9 B;  5KE3 A;  3X26 B;  1X69 A;  3QJ6 A;  4M7A C;  2X1N B;  1Z9Q A;  3G4S T;  5GMK j;  1MND A;  3FLG A;  1QVG A;  4EOM B;  1K1Z A;  4AMC A;  3JCM P;  5A0D A;  3CC7 Q;  3CMA T;  4EOP B;  4OMP A;  4JRP A;  1J3T A;  2QQR A;  5HK3 A;  1NEG A;  2M0O A;  4PJJ A;  1IGU A;  4GY5 A;  2QEX T;  3C4S A;  4HCC A;  1RAC B;  4EMK B;  5GAN g;  3QWL A;  2KMG A;  1VQ5 Q;  2V1R A;  2QA4 T;  4I3Z B;  1KD1 U;  2CKK A;  2QYZ A;  1WJS A;  2IN3 A;  2RQT A;  3MEW A;  2RNA A;  5I11 A;  2RHX A;  2K5L A;  2QFZ A;  3BG9 A;  1NE8 A;  3H9N A;  1VQM T;  2CP7 A;  5HBE B;  2DD5 B;  1ZP2 A;  2EYW A;  2Y90 A;  4F7U G;  1O9S A;  1ZA1 B;  1BKB A;  1K73 U;  1D1A A;  4M78 D;  1JJ2 P;  4ZGJ B;  2DO3 A;  2KBT A;  1M8V A;  2JW4 A;  1N8R C;  3ZL7 C;  2DAQ A;  4IUV A;  3SFM A;  1Q81 U;  4M7A G;  1LVK A;  3M53 A;  2EJ9 A;  1JSU B;  1R0C B;  2YSQ A;  4PFZ A;  3S3N A;  2C0O A;  2E1H A;  3UA7 A;  2XMF A;  2FYK A;  3FIF A;  1FWZ A;  1VQ9 A;  5LMK B;  1YJ9 A;  2DTO A;  4L6V 5;  2M02 A;  1UHC A;  1KHI A;  5HQ0 B;  2YRD A;  4IUP A;  4C5H A;  1YI2 Q;  2GTO A;  1Y0M A;  3KHI A;  3VUZ A;  1KG1 A;  2O4X A;  3MI9 B;  1WFW A;  2X3W D;  4NC6 A;  5LQF B;  4XTY A;  4M75 E;  3UF4 A;  2OTJ A;  2XID A;  4CC4 B;  4EMG A;  1G83 A;  4BCJ B;  3OYK A;  2AKL A;  3BDU A;  1IO6 A;  4BDY A;  3A8L B;  2DER A;  2BIV A;  4OB2 B;  4D6W A;  3BW1 A;  2K5I A;  3FRN A;  3OYC A;  1VQL Q;  4LN2 A;  1KIK A;  2LJ1 A;  4HVV A;  2KXD A;  2JM9 A;  1ABQ A;  2WJ9 A;  3F5X B;  4OVA A;  2BS4 A;  3CCM A;  3RBB B;  3L42 A;  2X9H A;  4OML A;  2F5T X;  2YRV A;  1QQJ A;  3QKJ A;  2D1X A;  4TVR A;  1M30 A;  3VKI A;  1IHW A;  4NST B;  1WYX A;  1VQP A;  1ZUK A;  2J6O A;  1XTD A;  1T3S A;  1QVG P;  3E9G A;  2KK4 A;  2DXC B;  2FL7 A;  1GCQ C;  1N4M A;  3MPU B;  2E3H A;  2VGM A;  4EON B;  1GY3 B;  2D8H A;  4JJD A;  2NWM A;  3CBP A;  4BY6 C;  4XTW A;  1M8M A;  3F70 A;  3LX7 A;  3CBM A;  3EAE A;  3V7R A;  4OMM A;  3QII A;  4PJO E;  1VQ7 Q;  1VUB A;  3CCU Q;  3UA6 A;  5LJ3 d;  5GAN 7;  4BCG B;  5AYF A;  2LT4 A;  2VVK A;  1HD3 A;  5FLX E;  3CCS Q;  3EJ1 B;  3RNJ A;  5KCO A;  1JKW A;  4M77 D;  4C0Z A;  2IVX A;  1JRI A;  2FO0 A;  2JM8 A;  2CZ6 B;  2AZV A;  5HCK A;  1WZO A;  2CP2 A;  1PKS A;  2C5N B;  2VXF A;  2COW A;  2QTV A;  1RI0 A;  3BG3 A;  1N5Z A;  3CCR T;  3TSZ A;  5LJ3 g;  3MP6 A;  1E6G A;  1KD1 C;  1P5E B;  4LUE A;  5GAO n;  4M7D F;  3EFR A;  1UG1 A;  1BCM A;  3X28 B;  1A0N B;  2YDL A;  2J06 A;  3BLQ B;  2XDD A;  5GAO r;  4M7D C;  4KUI A;  4EOL B;  1OUL A;  4ROC A;  1YIJ A;  2ZAE A;  1K73 C;  1K9A A;  1JB0 E;  1D0X A;  2WSC E;  1GUX B;  2EW3 A;  4ATO A;  4C8Q B;  4FW2 A;  1BI1 A;  1KQS S;  1SRL A;  3ULR B;  2DNU A;  1X2K A;  2FPD A;  1WGS A;  3BLH B;  4F04 B;  4ELY C;  2JNG A;  5GAN 6;  5GAN e;  1KC8 U;  4YOZ A;  2OAW A;  2RI5 A;  4KUL A;  4PFO A;  3RER A;  2KRN A;  2LRQ A;  1I07 A;  4CFX B;  4MMK A;  1U1S A;  1H64 1;  1X6B A;  4CC7 A;  4IUR A;  4J9D A;  1MV3 A;  4CFW B;  1G2B A;  3MHX A;  4BY6 B;  2WFY B;  1OX8 A;  3CCV Q;  1VQ4 A;  1YJN A;  5IN1 A;  5ICP B;  3NTH A;  2LP5 A;  3L2Q A;  3CC2 A;  1VQ9 T;  3G6E A;  1H3H A;  4MDW A;  2XIC A;  3M4G A;  3CCQ T;  4KH1 B;  4R55 A;  1NYG A;  1MGQ A;  3K7A M;  3GOX A;  2PZ1 A;  4J7I A;  4M7D G;  1TU0 B;  1YBY A;  4M78 A;  2ZPH B;  1JQQ A;  2BKD N;  3RKY A;  3LGL A;  3BHT B;  4A4H A;  2DL3 A;  4BBS M;  3B57 A;  3MJX A;  3CD6 T;  2KYB A;  3OW2 A;  2PMI B;  2FZC B;  4ELZ C;  1RAE B;  3M0S A;  2EQI A;  5CR2 A;  1T3L A;  2JN0 A;  1VQK T;  5I2M A;  2R58 A;  1VQ6 Q;  5DQV A;  2RJC A;  3RES A;  1H26 B;  4BE0 A;  2WMA B;  4J9C A;  3X25 B;  1H3Z A;  2ED1 A;  3VS3 A;  2R5M A;  4R56 A;  2F2W A;  1N6A A;  3OBW A;  2JXB A;  2DJQ A;  4LDX A;  4PLL A;  4DOW A;  2H3E B;  2IW8 B;  2RA2 A;  1B07 A;  2WSF E;  5KYW B;  2K7A A;  3CCM T;  2QDY B;  2E41 A;  1VQO A;  4AKI A;  4JRK A;  3JCM X;  4AG1 C;  3G4S Q;  1CKB A;  4XU3 A;  3JCM c;  3M56 A;  4N4I A;  3QPH A;  4M78 C;  2JS2 A;  3LYI A;  4HKE A;  2RD1 A;  5GMK e;  4Z88 A;  1ZQ1 A;  2LZ6 B;  2W9F A;  2RPN A;  1LPL A;  4EC8 B;  2AK5 A;  3EFS A;  3CMA Q;  2PK2 A;  2CP3 A;  2VC8 A;  3OYA A;  2LCL A;  3RMS A;  1UEC A;  4JRQ A;  1V76 A;  2QTX A;  1OQK A;  1YIT A;  2KEA A;  3QZ9 B;  2QEX Q;  1WHK A;  1CSK A;  5IXB A;  4HCK A;  2LTO A;  2QA4 Q;  2O88 A;  2UZL B;  1ZHI A;  5GAM g;  4JJC A;  1W1F A;  1VQM Q;  1CKA A;  4N4G A;  4A4F A;  2QQA A;  2QQS A;  2CYZ B;  2MWO A;  3P8B B;  2EVR A;  4JDS A;  3HRS A;  1S1N A;  4XU1 A;  2RHU A;  4ESR A;  1H92 A;  2KR3 A;  3DB4 A;  2VXE A;  4C5G A;  5IT9 E;  3OYM A;  2RJE A;  4AKH A;  2JGZ B;  2YUO A;  2DBM A;  2RH2 A;  1Y7X A;  4HCB A;  1C9B A;  2DXB A;  4F7U E;  4P5N A;  1ZUY A;  3PIP A;  2D6F A;  3VV0 A;  4Z6Y A;  2ED0 A;  1UNH D;  3OS0 A;  2I0N A;  1I4K 1;  1PD1 A;  1TS9 A;  4M78 G;  1N27 A;  3I55 A;  3CXC A;  2K3X A;  4M7A E;  4BCP B;  4C92 A;  5GMK m;  4RTX A;  1C6V X;  1GCP A;  2LQK A;  2L3P A;  4ROE A;  3L2U A;  2JT4 A;  1H8K A;  1YP5 A;  2LNV A;  3EG9 B;  4PLI A;  2EYY A;  1W2B A;  5LJ5 g;  2I53 A;  4CFM B;  1XNI A;  3KUF A;  4E7L A;  1VA7 A;  2HCK A;  3JCM h;  2JMC A;  3CPW S;  1U3O A;  2P0P A;  3BY7 A;  2O9S A;  3C95 A;  2ZCF B;  4M77 A;  1O9K A;  4II5 B;  3OYI A;  3RGF B;  3OW2 P;  4RG2 A;  3JB9 D;  2K6D A;  5A2Q E;  5EG2 A;  1QWE A;  3SWN A;  1AWX A;  2LX9 A;  2PVG B;  4PKC C;  3MP8 A;  4MZT A;  4BXX X;  2NYS A;  4KRD B;  3V7C A;  4PJO B;  1VQ4 T;  3I56 A;  1ARK A;  4AI6 A;  1VYT A;  2GQI A;  2DET A;  3T9N A;  2EIF A;  2AT1 B;  4FT4 A;  4ZGD B;  2NUT A;  1KHC A;  1M2V A;  2M9U A;  3CCJ A;  4ZGE B;  5IHN A;  4JS5 A;  1QKW A;  1D3B B;  3QZ5 B;  3RKX A;  2HSP A;  1MMN A;  2B86 A;  1HYO A;  3EHQ A;  1K4U S;  2ROL A;  2XI9 A;  1WXB A;  2YLC A;  5FU6 B;  1M90 R;  4CFU D;  3CPF A;  3EG2 A;  1OPL A;  4M77 C;  2VYT A;  3A98 A;  3EG1 A;  1GH6 B;  4AFZ C;  2V22 B;  1X43 A;  5FWC A;  1OL2 B;  2DL4 A;  2X4X A;  4FIB A;  4AT1 B;  3RUX A;  3PO3 S;  2A3L A;  4BY7 X;  4KRC B;  5CKH A;  5KCH A;  1SKU B;  4EPC A;  2L0A A;  3LH0 A;  2FRY A;  2F5K A;  3UWN A;  2JOY A;  1H25 B;  1SPK A;  2MIO A;  2VWF A;  4RKU E;  5L23 A;  4CFV B;  3H8Z A;  4EC9 B;  3NDQ A;  1R0B G;  1G3Y A;  3JB9 I;  3R6N A;  2OX7 A;  2K2M A;  2WEV B;  4F6S B;  6AT1 B;  2W10 A;  2KMT A;  2CSI A;  3L2W A;  4BI3 A;  3A8O B;  3THK A;  1VIF A;  3RIR A;  1UGQ B;  2DD5 A;  3VYH B;  4F7N B;  2EQJ A;  2J7I A;  2C06 A;  3Q1J A;  3GNG A;  2F1L A;  3G1J A;  2KRS A;  2DVJ A;  3QSU A;  3EGU A;  4EOR B;  5D6X A;  2ROT A;  2NUZ A;  2EJF A;  2V26 A;  1QMZ B;  4KRT A;  1I81 A;  1NEB A;  1Y96 B;  4IUT A;  5FRM A;  2RJF A;  4DBQ A;  4KGV B;  2J6K A;  4CI0 C;  1K0S A;  2RQV A;  3CCR Q;  4KGX B;  3G71 T;  1H1R B;  4CC3 A;  3PMT A;  3RDV A;  2VV5 A;  3FC3 A;  2DA9 A;  4DEY A;  4RTV A;  2NUP B;  2DMO A;  4M77 G;  1FVV B;  3JCM f;  2BTT A;  3X24 B;  3CXC P;  2IPO B;  2QQB A;  5KYY B;  1Q86 C;  3E9F A;  2LCC A;  1ZBX A;  4BE2 A;  1T0H A;  1W2B P;  3CC4 A;  2W9Z A;  5EFQ B;  3WVD B;  1URC B;  4FSS A;  1NJI R;  7AT1 B;  3GLX A;  3H41 A;  3PTA A;  1AOJ A;  4E7I A;  4IUQ A;  2H8H A;  2KSS A;  4BD3 A;  1PWT A;  2HKN A;  2CRE A;  3FDR A;  4UN0 A;  2PTK A;  3VS6 A;  3JV3 A;  2E65 A;  5GAM e;  4X1V A;  5A0L A;  1HSQ A;  3QWX X;  1UGS B;  4RCC A;  2XHC A;  4XTZ A;  2EAY A;  3VKG A;  3TSW A;  3OYN A;  3BDL A;  5GAN d;  2CZ1 B;  2R5A A;  4HL4 A;  1RAA B;  4A54 A;  1VQ8 A;  3OS5 A;  2GNC A;  1MHN A;  3OYY A;  1VQ9 Q;  2P0K A;  8AT1 B;  4O6J A;  5D6Y A;  1D0Z A;  4MDX A;  4BCH B;  1YHQ A;  3CCQ Q;  1RL2 A;  3TQ7 P;  2EYZ A;  4X9C A;  2M51 A;  2O9V A;  2RHZ A;  1BYM A;  5IXF A;  4BB7 A;  3OQ5 A;  1BIA A;  2LQN A;  4LUD A;  2J6F A;  1M90 U;  1OL1 B;  8ATC B;  2KRO A;  2M0Y A;  1RAI B;  2OAU A;  3CD6 Q;  1G3N C;  5ECA A;  1M4Z A;  4FYY B;  4L59 A;  2DL5 A;  2DXC A;  4M7D E;  1VQK Q;  3QG1 A;  5CVI A;  3RMQ A;  2MOX A;  2YHT A;  5LJ5 e;  4BCF B;  2W2H A;  1MNE A;  2R7G A;  2JZ2 A;  3CME T;  1RAF B;  2CDT A;  5HK0 A;  3TW6 A;  2P4T A;  5LJ3 h;  2XD0 A;  3I56 T;  4E7J A;  4F7J B;  2DZ9 A;  2FZK B;  1PNJ A;  2DTH A;  3HO8 A;  2Y4Y A;  4EDU A;  4DBR A;  3CCM Q;  2ZPB B;  2EKO A;  4QW2 A;  1UUE A;  4A53 A;  3EFO B;  1S72 A;  2CZ7 B;  2BZX A;  2OI3 A;  2QI2 A;  3CCL A;  1M3A A;  2DL8 A;  1JEG A;  1WQ7 A;  4Y28 E;  2FB7 A;  4F7U B;  3UPU A;  5CYI B;  4PFP A;  1TTH B;  1FX7 A;  5FRO A;  4ZN3 A;  1BCO A;  4J9G A;  1XQH A;  2DD4 B;  4GLK A;  2PNI A;  4BI8 B;  4HT9 A;  1VOL A;  2H3J A;  1H24 B;  4M7A B;  2KYM A;  1X75 C;  4DBF A;  3VS4 A;  1VIN A;  2KVQ G;  2HL3 A;  4XAX B;  2VB6 A;  4JUV A;  2LCS A;  5KYU B;  2FHD A;  4LE9 A;  4AG2 C;  3M03 A;  1KC8 R;  2GBQ A;  4C8Q A;  3V7S A;  1NJI U;  3PT9 A;  1YCS B;  4J83 A;  1YJW T;  1KFZ A;  1PRM C;  1UGV A;  1WA7 A;  2V8J A;  2JTF A;  2B9R A;  2EPD A;  4FSX A;  4D8K A;  2HQE A;  3V8L A;  4A4E A;  2K4Y A;  3JB9 F;  3EGD B;  1I8F A;  4DEX A;  3DB3 A;  2WAC A;  1BK2 A;  2A0F B;  3GTM S;  4FT2 A;  2QGF B;  5GJW B;  2PJQ A;  1H1P B;  1BIB A;  2BE7 D;  4F6W B;  4RUG A;  4KBM B;  3VYG A;  2DXT A;  1AD5 A;  5KE2 A;  2DME A;  4BCN B;  4QQD A;  5FU7 C;  2CSQ A;  3WVE B;  2C0I A;  2EYX A;  2LW4 A;  5DQW A;  1RI9 A;  2EGE A;  4M78 E;  4C0D C;  2K79 A;  4HVW A;  3QDR B;  3MEU A;  4X9D A;  4EOK B;  3OS1 A;  1WXU A;  2C5O B;  2QXF A;  3FJ5 A;  3H0F A;  2C0T A;  1M1G A;  2RK2 A;  4B9X A;  2L3R A;  1OI9 B;  4C92 D;  1H28 B;  4DBH A;  4F7S B;  5LJ3 f;  1H27 B;  4XTV A;  1OI1 A;  1YI2 A;  1FYN A;  5DLO A;  5GAN 3;  2EJG A;  2IW9 B;  1VQ4 Q;  5CK9 A;  3D7S B;  3JB9 G;  1UHF A;  1QVF A;  1OOT A;  4BCM D;  4JX6 A;  1M90 C;  5I5Z B;  1M27 C;  3GF5 A;  4XQ3 A;  4AFU C;  5C6S A;  1YHQ T;  5KYW A;  3SDZ A;  1KQ1 A;  2A36 A;  4LDY A;  1PG5 B;  3OY9 A;  2RI2 A;  2LT1 A;  4OGC A;  4YOO A;  4E7S A;  2CCI B;  2HDA A;  4F14 A;  3MET A;  1RAD B;  1HXD A;  2ESW A;  2LQ8 A;  4XU0 A;  2BPM B;  3I5S A;  3MKD A;  4EOI B;  3J81 E;  3JAM E;  1WIE A;  2DIL A;  3M4Y A;  4EIK A;  2A28 A;  1VYW B;  1LOJ A;  2JTE A;  2Z0W A;  1WX6 A;  1NYF A;  1Q81 C;  2O4X B;  1D3U B;  3GBQ A;  5FU7 B;  1XJW B;  1UFF A;  4BUG A;  4E6R A;  2QGG A;  4GBQ A;  4BCO B;  1FXX A;  2DK3 A;  2DEU A;  4J9F A;  4WCI A;  1NBE B;  2HQX A;  1JJ2 S;  2HEQ A;  5DLQ E;  2KNB B;  4F17 A;  4M75 A;  2F69 A;  1S72 T;  3LGF A;  4MZP A;  5GMK l;  4CFU B;  1PM3 A;  2L89 A;  1GFD A;  3A1P A;  4J6W A;  3QJY A;  2NLU A;  4J9B A;  1JBM A;  1YJ9 T;  3CCU A;  1SG5 A;  3OYF A;  3G71 Q;  2VUB A;  2MK5 A;  2SEM A;  2LDM A;  2QQ8 A;  2QDL A;  3CCS A;  5HNB B;  5GAN 5;  2GCX A;  2IIM A;  2GFU A;  1OV3 A;  4JLI A;  2DRK A;  2MPX C;  4IIO A;  1W98 B;  1NJI C;  1SHF A;  4O5V A;  3L2V A;  4PJL A;  1JST B;  2WMB B;  2CP0 A;  4KGZ B;  1K9M U;  3AHU A;  2RB6 A;  4FL6 A;  2ATC B;  2OTJ T;  2OTL A;  4M77 E;  2YXY A;  3EGX B;  1X2Q A;  1G5V A;  2KR6 A;  1HK9 A;  3OMG A;  1ZSZ A;  4OGE A;  2PK9 B;  3U23 A;  5IDN B;  1F1B B;  3E19 A;  2VKN A;  4M75 C;  2UZD B;  1M1K U;  4M7D B;  1QCF A;  2KE9 A;  5KYN A;  2QAS A;  3OYJ A;  1Z9Z A;  4BY1 X;  4BDZ A;  3V8K A;  2PUK B;  1AD6 A;  5CKB A;  1E7O A;  3OS2 A;  2EBP A;  5CO7 A;  4HA8 A;  3M9Q A;  5KH6 A;  3I9Q A;  3GNF B;  2KGT A;  4M78 F;  4BE1 A;  4LDV A;  4PJO A;  1QLY A;  3CQT A;  4MML A;  5GAM d;  1U8R A;  1EFN A;  2X3X D;  2P4R A;  2XDB A;  5GAN 8;  1QVF P;  3HRT A;  1VQP T;  3TNI B;  1MMA A;  1TUG B;  1Q82 R;  3HL8 A;  2BZ8 A;  1W6X A;  1D3B A;  1TSF A;  1ZBJ A;  5CKF A;  3OSV A;  4J8O A;  1QVG S;  1FIN B;  2ZZD B;  1IHV A;  3C12 A;  3CCV A;  4V2S A;  2VGN A;  4RTY A;  2D8J A;  1ZSZ C;  2CP5 A;  2LVM A;  4CFN B;  2CUB A;  5DM7 R;  1OIY B;  5M9O A;  3N5B B;  4DQ2 A;  1D1B A;  3HTR A;  3C0C A;  3M0R A;  4IIM A;  4M75 G;  3CME Q;  2YUP A;  2P0Q A;  3UDC A;  4N4H A;  4HVU A;  1MUZ A;  2B8A A;  1ABO A;  4RTU A;  3I56 Q;  2COZ A;  2JJ9 A;  5IHK A;  5LJ5 d;  5IH2 A;  1K76 A;  3JCM Q;  4OB0 B;  2BZY A;  5I2S A;  1Y57 A;  4J6X A;  4QVD A;  1G3T A;  2W96 A;  1D1C A;  5A0G A;  1XO2 A;  3P8H A;  4IUU A;  1OGU B;  2E6N A;  2RJD A;  2PUO B;  2CS7 A;  4YOS A;  5CKD A;  5HBH B;  5EC7 A;  3VS5 A;  4C0F A;  1Y96 A;  3M0U A;  2GTJ A;  1VYU A;  1X6O A;  1O75 A;  5GAO q;  1QCN A;  1YIJ T;  3P8D A;  3TNH B;  4LOC A;  1RUW A;  2NUP A;  1KC8 C;  2YRC A;  1TXQ A;  3G4S A;  4MIM A;  4M78 B;  3MP1 A;  3S3M A;  4RCB A;  1TUC A;  2DJZ A;  5FRN A;  5KYY A;  2MF2 A;  3DTO A;  3QXE B;  2EQU A;  5CKE A;  3VKH A;  2GFA A;  1D0Y A;  3CMA A;  3OYH A;  1YJW Q;  2AIR B;  3TEE A;  1QP2 A;  1W4S A;  2HSE B;  1JOW A;  4EOS B;  1Y71 A;  2HL5 C;  4C92 F;  4OR5 B;  4OB1 B;  2HMA A;  4ZTJ A;  2QA4 A;  1YJN T;  1TOV A;  1YN8 A;  2RN8 A;  4NS5 A;  3MCA B;  4C92 C;  3TW7 A;  5IHI A;  3CC2 T;  2E6Z A;  2QQ9 A;  3REA B;  4N0A A;  3G6E T;  4JJB A;  1KJW A;  5GAN h;  1YWO A;  1WI7 A;  4F16 A;  2CUD A;  2K3B A;  4NL2 A;  4C8Q D;  2D9T A;  2RI3 A;  1RLP C;  4MZM A;  2JVV A;  2DE0 X;  2EGC A;  3MY5 B;  3KXT A;  4M77 F;  2K9G A;  2MI6 A;  5IDP B;  2P84 A;  3EH1 A;  1T0J A;  3PGG A;  2FRW A;  2V1Q A;  4QVZ A;  3KBG A;  1Q82 U;  3ER0 A;  3I35 A;  4HLQ A;  2MWP A;  3BHU B;  2Y4X A;  4QVC A;  2ZPI B;  2PVO B;  4Z89 A;  2RO0 A;  2OTL T;  3ZBD A;  4C5I A;  1TUD A;  1BBZ A;  2IG0 A;  3SWN C;  3GIB A;  2ABL A;  1X01 A;  2PU9 B;  4ORZ A;  4EMK A;  3M0P A;  1QLB A;  2ZPG B;  2M1H A;  1VQN A;  2DYI A;  2MYS A;  1KQS A;  1TWB A;  3E1S A;  4B6M A;  2YUQ A;  3QO3 A;  2YUN A;  4BAC A;  1AZG B;  3SB2 A;  4J9H A;  3INZ A;  1VQO T;  3CCE A;  2QF7 A;  1PC0 A;  4NOY A;  4QQ6 A;  4C92 G;  1QCO A;  1PCX A;  1H1S B;  1IRX A;  1UEB A;  3REB B;  5GAN j;  2E4H A;  1B34 B;  3QBY A;  4HNU A;  1IXD A;  2SRC A;  1SSH A;  3H4C A;  3QDF A;  1YHQ Q;  1OU8 A;  4QT7 A;  3HB9 A;  2O31 A;  1MMD A;  3HHT B;  3VS0 A;  1UNG D;  3EFO A;  2DFU A;  3VU3 C;  1M9S A;  1YIT T;  4F7U A;  5I22 A;  4PJN A;  1OZ3 A;  9ATC B;  2RM4 A;  3KFV A;  2KXC A;  1TH7 A;  2WIH B;  1GXI E;  3TN8 B;  1RLQ C;  5GMK h;  1FMK A;  2RK1 A;  2GGR A;  3OYB A;  2CT3 A;  2LJ0 A;  4M7A A;  4BCI B;  1TD6 A;  1NG2 A;  2UZE B;  1XOV A;  4J7F A;  3A8H B;  2ZGW A;  3SHW A;  2HNI A;  2RQW A;  4M77 B;  4JX4 A;  1F5Q B;  5KYU A;  4GLM A;  3JB9 J;  3I5R A;  2HQH A;  3NFC A;  1O9K B;  2E70 A;  2D0N A;  1WHJ A;  3X20 B;  1M3B A;  1ZX6 A;  1UJY A;  2MCN A;  4R0K A;  2FEI A;  2XKO C;  1WHG A;  3M5A A;  1U1T A;  5GAN f;  3OYG A;  1WHL A;  4JRI A;  4E7K A;  1PSE A;  1RAG B;  1S72 Q;  1AWW A;  2COY A;  4Y92 A;  1KK7 A;  2KQW A;  1I0C A;  3I55 T;  3EGD A;  3GPL A;  1N9S A;  5FGK B;  1YJ9 Q;  3JCM g;  2WIP B;  4WTO B;  3CEY A;  1R8O B;  4E7Z A;  3JRZ A;  4J9E A;  2IVW A;  1M2V B;  1AIS B;  3OYL A;  5HKC A;  2DYB A;  1P92 A;  4M75 D;  1X6G A;  5HY6 A;  1YCY A;  4QSH A;  2CH4 A;  2QG9 B;  2O2O A;  2OTJ Q;  4RG8 A;  3LQ5 B;  2G3R A;  3CCR A;  1PRL C;  4ZNX A;  3OW2 S;  4AFS C;  4M4Z A;  4XU2 A;  3OSS C;  4RMO A;  2FVU A;  3PVQ A;  1UNL D;  1Q7Y R;  1KQS P;  1K8A R;  2BS2 A;  1YFN A;  4LD6 A;  1PKT A;  1YWP A;  1SF9 A;  3CCJ T;  1Q82 C;  1U5S A;  3SEM A;  1OU9 A;  1RAB B;  5I21 A;  3RR6 A;  2EUF A;  2E64 A;  3O5Z A;  2QDJ A;  1VQP Q;  2KY9 A;  2BS3 A;  5ACB A;  2DX1 A;  2GQV A;  2L3Q A;  2DPP B;  2LQW A;  3EID B;  4FCY A;  2L3S A;  4JS4 A;  4ME7 A;  4LDU A;  2K5F A;  3MEA A;  3HBL A;  4PJO D;  3M59 A;  2RQU A;  5L2W B;  1VQN T;  1EX4 A;  3CPW A;  3QWY A;  1FKM A;  1MMG A;  4NL3 A;  3A5Z B;  5IAY A;  3LWH A;  2EFI A;  4OP0 A;  3CCQ A;  4OMO A;  3CC7 A;  1GUX A;  3UAT A;  3TNW B;  1EIF A;  3BLR B;  4LDW A;  4II1 A;  5KYX B;  1G3S A;  4BCQ D;  1H4L D;  2E5K A;  4FM4 B;  5LJ3 j;  1SSF A;  1YNZ A;  2A37 A;  2CZ0 B;  1U06 A;  3M57 A;  3CCE T;  1AEY A;  1UTI A;  5J3B A;  4LNP A;  5HVY B;  3CD6 A;  4J9I A;  1VQ5 A;  1RAH B;  1UGP B;  1GCQ A;  3VS1 A;  3TU4 K;  1KQ2 A;  1VQK A;  1OIU B;  1ENW A;  2E3I A;  4EOJ B;  2CH4 W;  3OYE A;  1C1A A;  3VS7 A;  1UE9 A;  3JCM V;  1NLP C;  1OKV B;  3DKM A;  1AWO A;  2XDP A;  4M6V A;  3URG A;  2HKQ B;  4KH0 B;  2UZB B;  3MO8 A;  4OMQ A;  3JB9 H;  3H0H A;  2PQW A;  3PMI A;  2WSE E;  1YIJ Q;  2VAS A;  4C8Q F;  1K9M R;  3FJP A;  2DTI A;  3CXC S; 
#chains in the Genus database with same CATH homology
 3CC4 T;  5KE3 A;  1G5V A;  2D0Q B;  1PSF A;  2LX9 A;  3OB9 A;  4C8Q C;  3X26 B;  2KR6 A;  1HK9 A;  3HZJ A;  2DIQ A;  3ME9 A;  3OMG A;  3QJ6 A;  4M7A C;  4OGE A;  2PVG B;  4PKC C;  3G4S T;  3MP8 A;  4MZT A;  3E19 A;  3V7C A;  4M75 C;  4PJO B;  5GMK j;  1VQ4 T;  1M1K U;  5CQY A;  4M7D B;  3I56 A;  3LWH A;  4AI6 A;  1NZ9 A;  3FLG A;  3CCQ A;  1W2B S;  3OYJ A;  1QVG A;  4BDZ A;  3V8K A;  2PUK B;  3T9N A;  2EIF A;  4FT4 A;  5CKB A;  3M58 A;  3JCM P;  5A0D A;  3OS2 A;  4ZGD B;  4ELJ A;  3CMA T;  5CO7 A;  1KHC A;  2M9U A;  4HA8 A;  3CCJ A;  3M9Q A;  3NTI A;  4JRP A;  4ZGE B;  1NPR A;  4A4G A;  5KH6 A;  4JS5 A;  2QQR A;  1D3B B;  4L5G A;  3GNF B;  5HK3 A;  2M0O A;  4M78 F;  3QZ5 B;  3RKX A;  3PIO A;  4BE1 A;  1BI2 A;  4LDV A;  3QYG B;  5CCA A;  3DL1 A;  4GY5 A;  2XI9 A;  2QEX T;  4PJO A;  3C4S A;  1Q7Y U;  2AHJ B;  2YLC A;  5FU6 B;  4HCC A;  4MML A;  4M7D A;  4Z02 A;  3HKS A;  4EMK B;  1VQ8 T;  5GAM d;  5GAN g;  4ZTF A;  3QWL A;  1U8R A;  1K8A U;  4MDX A;  2KMG A;  3CPF A;  2QA4 T;  2XDB A;  5GAN 8;  4M77 C;  2VYT A;  3HRT A;  1VQP T;  1KD1 U;  3R6O A;  2CKK A;  3J80 E;  2X4X A;  4FIB A;  1WJS A;  3HL8 A;  3MEW A;  3RUX A;  4KT0 E;  2A3L A;  2RHX A;  1D3B A;  2QFZ A;  3BG9 A;  1NE8 A;  2K5L A;  3M55 A;  5CKF A;  1VQM T;  5CKH A;  3OSV A;  5GAM h;  2DD5 B;  4J8O A;  2E5Q A;  5KCH A;  4EPC A;  2Y90 A;  4F7U G;  1O9S A;  1QVG S;  3LH0 A;  2ZZD B;  1BKB A;  2F5K A;  3UWN A;  3C12 A;  3PNW C;  3CCV A;  2JOY A;  4M78 D;  2MAM A;  2MMP A;  2VGN A;  1K73 U;  2X4W A;  1UGR B;  4V2S A;  4ZGJ B;  4RKU E;  2DO3 A;  1VQL A;  3H8Z A;  4DOV A;  1M8V A;  2LVM A;  1N8R C;  2JTM A;  1G3Y A;  3JB9 I;  2DAQ A;  3FB9 A;  4IUV A;  3SFM A;  5DM7 R;  4C8Q G;  5M9O A;  3O8V A;  1QW1 A;  1Q81 U;  4M7A G;  2KMT A;  3JCM e;  5GAO l;  3N5B B;  3L2W A;  4BI3 A;  1NPP A;  3A8O B;  4DQ2 A;  1VIF A;  3RIR A;  1UGQ B;  2DD5 A;  3VYH B;  3C94 A;  2O01 E;  4M75 G;  2EQJ A;  2EYQ A;  2X4Y A;  3M53 A;  2EJ9 A;  2ZZD A;  2C06 A;  3Q1J A;  3QUI A;  3GNG A;  2P0Q A;  3UDC A;  3S3N A;  2E1H A;  4N4H A;  5GAO p;  2B8A A;  2FYK A;  3QSU A;  5D6X A;  1IZ6 A;  2EQK A;  3FIF A;  1FWZ A;  1VQ9 A;  2EJF A;  4PL6 A;  4C0D B;  1YJ9 A;  5LJ5 d;  3QHS A;  1I81 A;  1Y96 B;  4OB0 B;  3JCM Q;  4IUT A;  4A4K A;  2DTO A;  5I2S A;  2RJF A;  4L6V 5;  5FRM A;  4J6X A;  4QVD A;  1KHI A;  4CI0 C;  3NTK A;  4IUP A;  1G3T A;  4C5H A;  3G71 T;  2ZPE B;  5A0G A;  3J7A F;  3PMT A;  2VV5 A;  3FC3 A;  2HBP A;  3KHI A;  3P8H A;  4IUU A;  3VUZ A;  1KG1 A;  2E6N A;  2O4X A;  2RJD A;  2PUO B;  2CS7 A;  4M77 G;  5CKD A;  3JCM f;  1LNX A;  3RKW A;  5LJ5 h;  3CCL T;  3X24 B;  5CQX A;  2QQB A;  4NC6 A;  3BFM A;  4XTY A;  5C0M A;  4C0F A;  1VIE A;  1Y96 A;  4M75 E;  2OTJ A;  1Q86 C;  2XID A;  5GAM j;  3E9F A;  4ZN1 A;  4JX5 A;  1X6O A;  2G77 A;  1O75 A;  2LCC A;  4EMG A;  5GAO q;  1YIJ T;  1VQ7 A;  5J26 A;  4C92 E;  1ZBX A;  3P8D A;  3OYK A;  4BE2 A;  2V8K A;  3CC4 A;  3BDU A;  3VJP A;  3WVD B;  4BDY A;  4LOC A;  3A8L B;  4C5E A;  1KC8 C;  4M7D G;  3GLX A;  3G4S A;  2BIV A;  3DLL A;  4OB2 B;  4D6W A;  3BW1 A;  2K5I A;  4MIM A;  3VYG B;  3FRN A;  3PTA A;  4E7I A;  4M78 B;  4IUQ A;  3OYC A;  2I2L A;  3MP1 A;  2KSS A;  4RCB A;  2DJZ A;  3S3M A;  4BD3 A;  4XTU A;  5FRN A;  1V29 B;  2MF2 A;  2GF7 A;  3UT1 A;  3QXE B;  3FDR A;  2EQU A;  3GP8 A;  5CKE A;  3VKH A;  2GFA A;  3CMA A;  2WJ9 A;  3HFO A;  2E65 A;  4OVA A;  5GAM e;  5A0L A;  3OYH A;  2BS4 A;  3CCM A;  3CC7 T;  1UGS B;  3TEE A;  3L42 A;  4RCC A;  4WF2 A;  2DEQ A;  1QP2 A;  2XHC A;  2F5T X;  4XTZ A;  4M75 F;  2EAY A;  3VKG A;  3WXM B;  3HFN A;  3OYN A;  1W4S A;  2YRV A;  3BDL A;  5GAN d;  2CZ1 B;  2K3Y A;  2R5A A;  3M54 A;  3QKJ A;  4HL4 A;  1Y71 A;  4CRI A;  5J39 A;  4C92 F;  3VKI A;  4TVR A;  4A54 A;  1VQ8 A;  4OB1 B;  3OS5 A;  2E12 A;  1MHN A;  3H6Z A;  5GAN 2;  4ZTJ A;  3OYY A;  2QA4 A;  4JJN K;  1YJN T;  1LJO A;  4NS5 A;  1VQP A;  2P0K A;  3MCA B;  2X4J A;  3OA6 A;  1XTD A;  2XG8 D;  4C92 C;  4O6J A;  3E9G A;  3TW7 A;  5D6Y A;  1VQ5 T;  4XTX A;  2E6Z A;  2QQ9 A;  3G6E T;  4N0A A;  1YHQ A;  3CC2 T;  2KK4 A;  1RL2 A;  2DXC B;  3DLM A;  5GAN h;  3LLR A;  4X9C A;  2FL7 A;  5LJ5 j;  4NL2 A;  4C8Q D;  2RHZ A;  2D9T A;  2RI3 A;  1BYM A;  1BI3 A;  2VGM A;  4BB7 A;  4M7A D;  3OQ5 A;  1BIA A;  4MZM A;  2JVV A;  1M90 U;  1AHJ B;  3KXT A;  5GAM f;  4M77 F;  2MI6 A;  3CBP A;  4BY6 C;  1N9R A;  4XTW A;  2OAU A;  3F70 A;  3LX7 A;  3A8G B;  3PGG A;  2EQM A;  4QVZ A;  1WNL A;  3CBM A;  2LC4 A;  1M4Z A;  1QVP A;  3EAE A;  4L59 A;  3V7R A;  3KBG A;  3MEV A;  1Q82 U;  2DXC A;  3ER0 A;  3QII A;  3TCJ A;  4HLQ A;  4PJO E;  2MWP A;  2Y4X A;  4M7D E;  1VUB A;  4QVC A;  2ZPI B;  2PVO B;  5LJ3 d;  2RO0 A;  3QG1 A;  5CVI A;  3RMQ A;  5GAN 7;  2OTL T;  3ZBD A;  2YHT A;  5AYF A;  3ZEH A;  3OMC A;  4C5I A;  2KAF A;  2IG0 A;  2LT4 A;  4BI4 A;  1DJ7 B;  5LJ5 e;  3SWN C;  3GIB A;  2JZ2 A;  5FLX E;  1X01 A;  2PU9 B;  3CME T;  5KCO A;  4EMK A;  1BI0 A;  1QLB A;  2ZPG B;  2M1H A;  5HK0 A;  1VQN A;  3TW6 A;  2P4T A;  1KQS A;  4M77 D;  5LJ3 h;  4C0Z A;  4E47 A;  2XD0 A;  3I56 T;  1JRI A;  4E7J A;  3E1S A;  2CZ6 B;  2DZ9 A;  3JCM J;  3QO3 A;  2DTH A;  4BAC A;  1Q7Y C;  4OB3 B;  3HO8 A;  2Y4Y A;  2YLB A;  4EDU A;  2VXF A;  3SB2 A;  2ZPB B;  3VUB A;  1RI0 A;  3G71 A;  1K8A C;  3INZ A;  3BG3 A;  5GAO m;  4VUB A;  3CCR T;  1YI2 T;  2EKO A;  4QW2 A;  5LJ3 g;  3MP6 A;  4A53 A;  1KD1 C;  4PJO F;  1S72 A;  1VQO T;  2CZ7 B;  5GAO n;  2QI2 A;  3CCE A;  3CCL A;  3HSB A;  2QF7 A;  3EFR A;  4M7D F;  4NOY A;  4QQ6 A;  4C92 G;  1WQ7 A;  3X28 B;  4Y28 E;  2FB7 A;  1UEB A;  4F7U B;  3UPU A;  1I5L A;  5GAN j;  2XDD A;  4PJO C;  5LJ5 f;  1B34 B;  1OYX A;  3QBY A;  5GAO r;  4M7D C;  4HNU A;  1FX7 A;  5FRO A;  4KUI A;  4ZN3 A;  3H4C A;  3CBO A;  5DY9 A;  1YIJ A;  3OBY A;  4UC4 A;  4C0G A;  1K73 C;  1JB0 E;  1XQH A;  2DD4 B;  3HB9 A;  4GLK A;  2DXU A;  2WSC E;  4ATO A;  2L5Q A;  3HHT B;  4BI8 B;  4HT9 A;  2H3J A;  3JSC A;  3S6W A;  3TRE A;  4C8Q B;  4EMH A;  1BI1 A;  1VQ6 A;  4M7A B;  1KQS S;  1X75 C;  3VU3 C;  1M9S A;  4QQG A;  1YIT T;  1Q86 U;  4M75 B;  2KVQ G;  4F7U A;  4E7H A;  1WGS A;  1OZ3 A;  1B34 A;  2RM4 A;  4XAX B;  5FU6 C;  4ELY C;  5GMK i;  2JNG A;  5GAN 6;  1VQL T;  1TH7 A;  4JUV A;  5GAN e;  1KC8 U;  2RHY A;  2FHD A;  1GXI E;  2RI5 A;  5GMK h;  4KUL A;  2DIG A;  2RK1 A;  4X34 A;  3OYB A;  4C8Q A;  1WJR A;  3V7S A;  3RER A;  1NJI U;  4KUD K;  3PT9 A;  4J83 A;  1YJW T;  4M7A A;  2LRQ A;  5D6W A;  2V8J A;  4MMK A;  2JTF A;  1U1S A;  1H64 1;  1XOV A;  4IUR A;  3FEO A;  3A8H B;  4FSX A;  4J7F A;  2ZGW A;  3MHX A;  4BY6 B;  2HQE A;  1M1F A;  2HNI A;  1VQ4 A;  4Q5W A;  3V8L A;  4A4E A;  2K4Y A;  1YJN A;  5IN1 A;  5GAN 4;  4M77 B;  2CGH A;  3JB9 F;  4JX4 A;  3NTH A;  1I8F A;  2EWN A;  3L2Q A;  3JB9 J;  3CC2 A;  1VQ9 T;  3DB3 A;  3QYE A;  2WAC A;  4MDW A;  3NFC A;  3V8J A;  3G6E A;  2E70 A;  2XIC A;  3M4G A;  3CCQ T;  3X20 B;  4FT2 A;  4R55 A;  2XKO C;  3M5A A;  1MGQ A;  1U1T A;  5GAN f;  3OYG A;  4JRI A;  1BIB A;  1OZ2 A;  4E7K A;  1PSE A;  4PJO G;  3GOX A;  4J7I A;  4KBM B;  3VYG A;  4MFE A;  1YBY A;  2DXT A;  4M78 A;  2QEX A;  2ZPH B;  2KQW A;  3L2Z A;  5LJ3 e;  2BKD N;  2X35 A;  3LGL A;  4XK8 E;  3RKY A;  3I55 T;  4HNT A;  4A4H A;  5KE2 A;  4QQD A;  4BBS M;  4JLG A;  5FU7 C;  3GPL A;  3CD6 T;  1N9S A;  3PFS A;  1WPY A;  3WVE B;  3OW2 A;  4ELZ C;  4M78 E;  4C0D C;  3JCM g;  3CEY A;  1VQ7 T;  1R8O B;  3CCU T;  3ZFJ A;  5CR2 A;  3QDR B;  3JRZ A;  2JN0 A;  1VQM A;  2IVW A;  1VQK T;  5I2M A;  2R58 A;  3MEU A;  4AKG A;  4X9D A;  3OYD A;  3OYL A;  5HKC A;  2RJC A;  3OS1 A;  1K9M C;  3RES A;  3CME A;  4BE0 A;  4FU6 A;  2QXF A;  3L2R A;  3CCS T;  1P92 A;  5CAI A;  3LWI A;  4M75 D;  1M1G A;  3G7Z A;  1Y07 A;  2RK2 A;  4B9X A;  3X25 B;  2L3R A;  5HY6 A;  1H3Z A;  2XK0 A;  2K2V A;  1YCY A;  4QSH A;  4C92 D;  2DVE A;  2R5M A;  4R56 A;  4HCZ A;  1N6A A;  3OBW A;  5LJ3 f;  4RG8 A;  4PLL A;  4LDX A;  4DOW A;  2RA2 A;  2G3R A;  2WSF E;  4XTV A;  1OI1 A;  1M1K C;  3CCM T;  3CCR A;  1YI2 A;  2QDY B;  2E41 A;  5DLO A;  1N8R U;  1VQO A;  4AKI A;  4JRK A;  5GAN 3;  2EJG A;  3JCM X;  3OW2 S;  4XU3 A;  3JCM c;  2V8I A;  3M56 A;  4N4I A;  2R57 A;  3QPH A;  4PNO A;  3S3O A;  4XU2 A;  3OSS C;  4M78 C;  5CK9 A;  2FVU A;  4RMO A;  2KDS A;  3LYI A;  4HKE A;  2RD1 A;  4J6Y A;  5GMK e;  3JB9 G;  1QVF A;  3ASK A;  1ZQ1 A;  4LD9 K;  4JX6 A;  2BS2 A;  1WQW A;  3EFS A;  4XQ3 A;  3GF5 A;  1M90 C;  5C6S A;  4LD6 A;  2VC8 A;  1YHQ T;  3OYA A;  2DZC A;  2LCL A;  4YTL A;  3SDZ A;  1KQ1 A;  4N0A C;  3RMS A;  4LDY A;  2DKG A;  3CCJ T;  4JRQ A;  2ZPF B;  3OY9 A;  2QTX A;  1YIT A;  1Q82 C;  2XU8 A;  3QZ9 B;  4HNV A;  2RI2 A;  2LT1 A;  4OMF B;  4OGC A;  3BG5 A;  1JJ2 A;  5I21 A;  3MET A;  2E64 A;  2LTO A;  1HXD A;  1UB4 A;  2QDJ A;  2LQ8 A;  4XU0 A;  2KY9 A;  3L1A A;  2BS3 A;  1ZHI A;  5GAM g;  2GQV A;  3JAM E;  3J81 E;  5L8R E;  3QYH B;  1IRE B;  2DXB B;  3M4Y A;  2DPP B;  1LOJ A;  1YJW A;  4OF1 A;  3HRU A;  4N4G A;  4A4F A;  2QQA A;  2QQS A;  2CYZ B;  2MWO A;  3P8B B;  4JDS A;  3HRS A;  4XU1 A;  2HD0 A;  2RHU A;  4JS4 A;  4ME7 A;  1QVF S;  2M16 A;  4LDU A;  5CIU A;  2K5F A;  2VXE A;  3DB4 A;  3HP9 A;  3MEA A;  4C5G A;  4MFD A;  2O4X B;  3OYM A;  5IT9 E;  3HBL A;  1Q81 C;  2RJE A;  4PJO D;  3M59 A;  5FU7 B;  3CCV T;  4DA4 A;  4M7D D;  4EMK C;  4AKH A;  4BUG A;  4C92 B;  3HPW A;  1VQN T;  3CPW A;  1FKM A;  2HAX A;  2RH2 A;  1Y7X A;  4NL3 A;  4HCB A;  3A5Z B;  2DXB A;  4F7U E;  2EFI A;  4OP0 A;  1FXX A;  4P5N A;  4B9W A;  2DD4 A;  5IAY A;  3PIP A;  2DK3 A;  3LW5 E;  3CC7 A;  2K57 A;  2D6F A;  1E7P A;  1EIF A;  3VV0 A;  2HQX A;  4Z6Y A;  4II1 A;  4LDW A;  4BBR M;  5DLQ E;  3OS0 A;  1G3S A;  1JJ2 S;  1I4K 1;  4FM4 B;  4M78 G;  5LJ3 j;  1SSF A;  3A8M B;  4M75 A;  2JUF A;  2CZ0 B;  1N27 A;  2F69 A;  1QP3 A;  1S72 T;  3LGF A;  3M57 A;  5EJC A;  4MZP A;  3I55 A;  3CCE T;  5J3B A;  4C8Q E;  5GMK l;  3CXC A;  2K3X A;  2L89 A;  4HT8 A;  4M7A E;  2A7Y A;  4C92 A;  3CD6 A;  5GMK m;  3JCM d;  4J6W A;  3QJY A;  1VQ5 A;  2LQK A;  2NLU A;  4Y91 A;  3L2U A;  1UGP B;  1JBM A;  1WJQ A;  1YJ9 T;  3TU4 K;  3CCU A;  1KQ2 A;  1VQK A;  2LNV A;  3OYF A;  4PLI A;  2L8D A;  1W2B A;  5LJ5 g;  3OYE A;  2VUB A;  1XNI A;  3JCM b;  2PVD B;  2LDM A;  3SWN B;  3KUF A;  4E7L A;  3JCM V;  2QQ8 A;  1VQ6 T;  3JCM W;  3JCM h;  4F7U F;  3CCS A;  3DKM A;  3CPW S;  2XDP A;  5GAN 5;  2P0P A;  4M6V A;  3BY7 A;  2GCX A;  3URG A;  2GFU A;  2RHI A;  3C95 A;  4JLI A;  2ZCF B;  3MO8 A;  4M77 A;  1NJI C;  3JB9 H;  5LL6 S;  4O5V A;  3L2V A;  4J5Y A;  4IKF A;  3OYI A;  2PQW A;  3PMI A;  1G3W A;  2WSE E;  4RG2 A;  2RB6 A;  4FL6 A;  1K9M U;  1M5Q 1;  3JB9 D;  3AHU A;  2BUD A;  2OTJ T;  3QYB A;  3SD4 A;  4C8Q F;  2OTL A;  4M77 E;  2E10 A;  5A2Q E;  4M7A F;  3FJP A;  5EG2 A;  2DTI A;  3SWN A;  3CXC S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...