3X25B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 700 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x25B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x25B02
2ZPHB 3WVEB 3X20B 4OB1B 2PVDB 3A8LB 1UGSB 1PSEA 2CZ0B 3HHTB 3X28B 3A8OB 2ZPGB 1JB0E 2ZPFB 3LW5E 1UGPB 2PUKB 2QDYB 3VYGA 2ZZDA 3VYGB 2ZZDB 2DD4A 2DD4B 2ZPIB 5L8RE 1DJ7B 1AHJB 1GXIE 3QYHB 1UGRB 4FM4B 3X26B 1QP2A 2DPPB 2DD5A 2DD5B 4Y28E 2CYZB 2DXCB 3A8MB 3X25B 4XK8E 3QZ9B 4ZGDB 2PU9B 4ZGEB 2PVGB 2DXBA 2WSCE 2DXBB 4OB0B 3A8HB 2CZ6B 1QP3A 3A8GB 2WSEE 3QZ5B 2O01E 1IREB 2PVOB 2ZCFB 3X24B 3QXEB 3VYHB 2ZPEB 1PSFA 2WSFE 1UGQB 4OB3B 2DXCA 3WVDB 2AHJB 3QYGB 2CZ1B 4ZGJB 4KT0E 2PUOB 4L6V5 2D0QB 1V29B 2ZPBB 4OB2B 4RKUE 2CZ7B
chains in the Genus database with same CATH superfamily
2FRYA 4D6WA 1FMVA 1N27A 1Z9QA 4M7AC 3UATA 1A0NB 2QEXQ 1RAAB 4LXCA 3SWNC 2LNVA 2QK0A 2HSPA 3LQ5B 3DLLA 1Q82R 4F6WB 1KQSP 1O9SA 1BYMA 2I40B 1TS9A 1VUBA 4QVZA 4FL6A 1O9KA 2KR3A 2QASA 4KH1B 5A2QE 1H3ZA 2QQ9A 1H28B 1RI0A 2DJZA 3R6OA 4WF2A 2JVVA 2PMIB 3CQTA 4QVDA 5IH2A 4B6MA 4FT2A 3QJ6A 4HXJA 3OA6A 1QP2A 3G1JA 3M55A 1PD1A 2CH4W 1VQ9T 4Z8AA 1QMCA 4XTWA 3JCMd 2C5OB 2KRSA 1YJWA 3TREA 1RAHB 3V8KA 3JCMV 4C0ZA 5EJCA 3SB2A 3CCRQ 4ZGEB 1JSTB 4J9EA 2FHDA 4ZNXA 1YJ9Q 5A0DA 5D6XA 2DTIA 3CCST 5A0LA 1VOLA 4HCBA 1ZUUA 2EQMA 2GNCA 5KYXB 3EG1A 1VQMA 5J26A 3VUBA 4BI8B 2ZCFB 1M9SA 2RB6A 1NYFA 5HQ0B 3C0CA 5LJ5h 3OS0A 4I3ZB 4A4HA 2UZBB 3SDZA 2RQVA 1OIYB 1YFNA 1NYGA 1PRLC 4IIOA 5HVYB 3HL8A 4C8QE 4OGEA 3KFVA 4E6RA 3FB9A 2FPFA 4C0GA 3G33B 4JS5A 3EG2A 1WHGA 3OYJA 4CI0C 3OSSC 3CPFA 3C4SA 3REAB 3G6ET 3B57A 4HT9A 4L59A 3ME9A 2K3XA 1VYWB 5GANe 4BE2A 1AD5A 1PSEA 4E7SA 1KHCA 3CCJA 1SEMA 4A53A 1X6OA 2H8HA 2COYA 1PG5B 4ANJA 4G6LB 4LN2A 4C92G 5GAMg 2FZGB 4BCOB 2YLCA 4M77E 1CKAA 2DTOA 4QSHA 2DMOA 1K8AU 2JW4A 3EJ1B 4M77D 3QO3A 4ELLA 3LGLA 4BE1A 3TNHB 5L8RE 1JQQA 1X43A 3V7SA 2MF2A 2IIMA 4J6WA 4LDVA 2HKNA 1LJOA 3MEAA 1AHJB 5GJVB 2A37A 2HKQB 1YITT 1YJNQ 1PRMC 2V8JA 4M78A 4CFNB 2JNGA 4AKHA 4MZMA 1MHNA 2DD5A 3NTKA 3MI9B 4M7DF 1KQ2A 2KT1A 3CCQQ 2WEVB 3OS1A 1S1NA 5KYYB 2J7IA 2XICA 3H9NA 5DLQE 1BI1A 2ZGWA 4MMLA 3CC4T 3QBYA 2EYYA 4AG2C 1IGUA 5GAN5 4ELYC 4F7UF 2KMGA 4J6YA 4JLGA 3GPLA 2CP0A 1HK9A 2FZCB 2G6FX 2ESWA 4BACA 3LLRA 2O01E 1KC8U 1UTIA 1RUWA 4DOVA 1RL2A 3HFOA 2RI5A 4J9GA 2KMTA 2L0AA 2RI3A 2BS4A 3WVDB 1PNJA 2IN3A 1VQ5A 3JCMc 5LJ3d 4OMNA 4A4FA 5DQVA 2MYSA 3BE3A 3CCMA 1VQPT 4ZGJB 1JJ2A 3E9FA 1KXUA 3DL1A 1K8AR 4FW1A 4HNVA 5LJ5e 1U5SA 2JJ9A 2C5NB 2LT4A 4J9CA 2KVQG 1GBRA 3OS2A 5LJ3f 1ZSZC 1D1CA 1QCNA 5KCOA 1VQ7T 3L42A 3CC2Q 3OYLA 1O9KB 3CCLT 5GAN6 1F5QB 3RKYA 1M1KU 3FLGA 1HYOA 3M5AA 5IDPB 4Q5WA 1YI2Q 2LP5A 5GMKh 1F1BB 1GFDA 2OTLT 1N9RA 4DBFA 5KYUA 5HBHB 1LNXA 2CH4A 1M8MA 1VQ8Q 2MCNA 4EOKB 2MOXA 4Z89A 5I2SA 3EHRA 1VQKA 4B9WA 1W70A 2ZPIB 1PCXA 2X51A 3VKHA 3DKMA 2J06A 2KR6A 2LQWA 2JMAA 4RTVA 4ROEA 4F14A 1G3TA 5EC7A 1YCYA 3EAEA 2EYXA 2R58A 2DRKA 4JX6A 2KSSA 4IUTA 1I0CA 3BG5A 3CCET 4GY5A 1I5OB 3TN8B 3OS5A 4CFMB 2KEAA 3RMQA 3RGFB 3S6WA 1G5VA 1LVKA 1WHJA 4O5VA 3QZ9B 5CQYA 3OYGA 1OPKA 4LE9A 3BG3A 1JKWA 1YCSB 1TUGB 2WSCE 3LH0A 1OKVB 1GCPA 3M53A 4CXAB 1SSHA 2NUTA 2EIFA 3F70A 1QQJA 1TU0B 4M75A 1M1KR 2DL4A 5IXFA 1D3BB 2DK3A 1VQ4Q 4C5EA 4ESRA 4F7LB 3EG9A 4CFVB 1AWXA 3CCUQ 4XTYA 2K7AA 4PKCC 3CCSQ 1VQ9A 3RKXA 1X01A 4EOLB 1JU5C 1W6XA 3H8ZA 1QWEA 4M7AA 1MMGA 3OYBA 2CP5A 3EH2A 2WIHB 3Q1JA 3EFOA 3SWNA 2X9HA 2E65A 1R8OB 1OZ3A 4JDSA 2HQEA 4RKUE 5D6YA 2Y4XA 5GAMh 4BCGB 2A3LA 3LWIA 1Q81U 2LZ6B 2X3XD 3TSZA 2HQXA 3ZL7C 1E9HB 2KAFA 4OB1B 3TQ7P 1W2BA 2JGZB 2BIVA 3REBB 1K73U 2KGTA 3FRNA 3L1AA 4JRQA 1D09B 2QGGA 3CXCS 3IQLA 4HVVA 1T3SA 1AOJA 3VS6A 1NLOC 4JPBW 2QDYB 3QJYA 2XDPA 2PJQA 4DQ2A 2KY9A 5GMKe 5DM7R 4F04B 3PIOA 3OYEA 3JCMP 5I21A 4C92D 2Z0WA 2EQUA 1DJ7B 3QKJA 1OI1A 1RLQC 3G6EA 1UHCA 4FT4A 5LJ3j 2JXBA 1YJWT 1PD0A 1G83A 5GMKi 4M78E 2DYBA 5GAOq 3L2UA 2XI9A 5CKHA 5HK0A 5HKCA 3GOXA 4Y28E 4CFUD 2VYTA 2W96A 3PIPA 1QVFP 4J9FA 4A4GA 1BI0A 4BY6B 2LJ0A 4E7HA 1AZEA 1VQMT 3AHUA 4M7DC 4N4IA 1OL1B 1WXBA 3A8HB 3V7RA 3VV0A 2FG0A 3OW2S 1GUXA 3TSWA 5GAMf 4C92C 1Q81R 1VQNQ 4IKFA 2H3EB 3A8GB 1BI3A 4HVUA 1N8RC 1RAIB 2C6TB 3X24B 4EOQB 1YNZA 3GP8A 3CC4Q 1YITA 3H0IA 1K73R 2K9GA 3CMAA 1EFNA 3RMSA 4LDYA 3M4YA 3S3MA 3EOCB 1H26B 4BCKB 1OOTA 1R0BG 2HBPA 2K79A 2CJMB 3CMEA 4BCQB 5L23A 3OMGA 3KBGA 2RJEA 3JSCA 1E6HA 1QMZB 3HO8A 4J7IA 2M1HA 2JN0A 2H3JA 3NHNA 3CBMA 3P8HA 3HFNA 2IVXA 4KRTA 3PMTA 4JLIA 1X6BA 2EJ9A 3PMIA 3JB9G 4NL2A 3BLQB 1UE9A 4LD9K 3CC7Q 5GAOn 3L2RA 2IW6B 4MDWA 3D7SB 2EW3A 3J81E 2M0OA 5GAMe 4R56A 2EKHA 1BI2A 1M90U 1Q82C 2ZPFB 1OKWB 1I5LA 4F6UB 2O4XA 1BIAA 4BXXX 2ED0A 3CCLQ 2JMCA 4DEXA 1X6GA 4ZTFA 2EJFA 3L2ZA 1H27B 1GY3B 4YOOA 1B07A 4ZN3A 1OIUB 1H1PB 4OMFB 2AKKA 2ED1A 3NGPA 4QQ6A 4EOJB 4JJCA 1S72A 1VQ7A 1YBYA 4PFZA 2OTLQ 3VS5A 2E3IA 4JX5A 3S3OA 1NG2A 2CCIB 1K9AA 1K76A 1AD6A 4N4HA 2XDBA 3JB9F 3P8DA 5FRNA 2G77A 1VQOA 4WTOB 4XU0A 2ROLA 4EORB 1NPPA 4M75B 4RMOA 2R7GA 3C94A 1TSFA 1VYTA 1AWJA 2RQTA 3CD6A 3X25B 1LPLA 3NFCA 2QDJA 2PU9B 1M3BA 3URGA 3JAME 1B3QA 4M7AB 3J80E 1YHQQ 2C0OA 5GAOp 2C4GB 1N5ZA 4C8QF 3MEVA 3CCVA 2YUPA 3CCEQ 1AWWA 2F2CA 1X2QA 1TH7A 3G4SA 1BCMA 2GQIA 2XHCA 4BCMD 4M75E 4J7FA 1VQ5T 2RJFA 1UHFA 5LJ3g 3CCMT 4PJOB 5CYIB 2A0FB 2VXEA 1U1SA 1ZSZA 2GFUA 5CKBA 4RTTA 5EFQB 5FU6B 1LCKA 1Q95G 4MMKA 1ENWA 4ME7A 1G2BA 5D6WA 4RTWA 3EH1A 1V29B 4DOWA 1TWBA 3VS0A 5FU7B 3BFMA 4EMHA 2W9ZA 1H24B 2A7YA 2YUOA 4KRDB 1VYVA 1N6AA 2A36A 1WNLA 2RK1A 4EOMB 2LX9A 2B9RA 3M59A 1I81A 3LX7A 1VIEA 2ZPGB 3RIRA 1VQKT 2BS2A 2W10A 4O6JA 1UGPB 2FEIA 5ICPB 5AYFA 2FO0A 3VYGA 2ZZDA 1XTDA 3G71Q 4HCCA 2RQWA 2G3RA 3SD4A 1U06A 2KQWA 4CC2A 3CPWA 1Y96B 1JXMA 4KRCB 2YXYA 4RG2A 4AFUC 3OYNA 1H25B 1SG5A 3L2VA 5IF1B 2NWMA 4BI3A 1UB4A 2D8HA 2KBTA 1Y7XA 3EHQA 3MHXA 1YN8A 2D0NA 2DZ9A 4HL4A 4HVWA 2HAXA 3QDFA 1HD3A 1NM7A 3MPUB 5ACBA 2CT4A 1KQ1A 2DXBB 1I07A 1YJWQ 1H641 1NBEB 2MI6A 4MDXA 2CSIA 2WSEE 2QEXA 2BS3A 3RUXA 1H1SB 1PSFA 2GCXA 2DIGA 2LX7A 1G3YA 2VC8A 1KSWA 1ARKA 4K11A 5FWBA 3M58A 1UNGD 2DBKA 3OYFA 5GAOm 5CKFA 3H4CA 4C8QB 2V1RA 2E1HA 1K8AC 2M02A 3MIAB 1OU8A 4IURA 1K0XA 4F7JB 1TTHB 3JCMf 2MWPA 3OB9A 3M56A 3GLXA 1QW1A 1K0SA 1KHIA 1WXTA 4OMPA 2DIQA 4DBQA 1Y0MA 1XNIA 2DXTA 4HLQA 3TVTA 4GLMA 1KQSA 2O88A 5CIUA 1MUZA 1NZ9A 1NEBA 3M03A 2PHGA 4F70B 1I4K1 4M77B 3CCJQ 3LW5E 3ZEHA 2BKZB 3WXMB 2K6DA 2PQWA 5FGKB 1IHVA 2YUNA 1YJ9A 2DBMA 5HK3A 1VQLA 2A28A 1TFBA 2RJDA 2DD4A 3CBOA 4JUVA 1VOMA 3TNWB 2J6KA 2X4WA 1Q7YU 1IGQA 4F6SB 1PM3A 4M7DG 2EQJA 1M2VA 1GXIE 2JZ2A 1VQ6Q 1WHKA 4M7DA 1JO8A 3ZFJA 2HMAA 2V8IA 2XK0A 4F7UG 2YRVA 3FJPA 4C92A 2CYZB 2RM4A 4E2FB 1C6VX 1QLYA 4BBRM 5LJ3h 1ZSZB 1ZHIA 2QQSA 2QA4A 2XD0A 1I1JA 1D1AA 4XQ3A 5KE3A 2K5FA 2KE9A 1FKMA 1QCOA 2WXVB 1OQKA 3QYBA 2L3RA 4PJLA 4BCIB 3QHSA 3CMAT 2HDAA 1M1KC 1WXUA 3PNWC 1EX4A 2EQIA 4FYXB 1BU1A 1G3SA 3VS7A 5I22A 1RACB 1QCFA 3UDCA 4TTHA 3CMET 4BI4A 5LJ5d 2IVWA 4FX3B 1ZUYA 2DZCA 4E7ZA 4NOYA 1JJ2S 4HT8A 1FYNA 1K9MU 3EFRA 2F2WA 2PUOB 1VQ5Q 4FSXA 3O5ZA 3MP8A 4IUPA 3CCMQ 4II5B 4E7IA 3TW6A 5GMKl 1ZQ1A 1EIFA 2DL7A 3WVEB 1Q7YR 1N4MA 5HBEB 1WDXA 1KIKA 2DE0X 1YJNA 2M9UA 5LQFB 3MJXA 2IW8B 3THKA 2JS0A 2CZ0B 2C06A 1G3NC 2VUBA 2J6OA 2OTJA 1ABOA 4E7JA 3CCQA 4HA8A 5FWCA 4AFSC 2DMEA 1OYXA 2CCHB 4OMLA 1S72T 4II1A 1D3UB 4J9DA 4BCPB 4HKEA 3KXTA 2M0YA 3VS4A 2C0TA 5HBJB 1BCOA 3I55A 1VQOT 4BCND 4JZ3A 1AVZC 4PFOA 1B34A 4MIMA 2VKNA 1H4LD 3OY9A 1JXOA 1PHTA 2UZEB 3CD6T 3X26B 2GTOA 4E47A 4ZN1A 1YWOA 1KFZA 1UGVA 4PL6A 1AEYA 2EUFA 2LCSA 2XDDA 3JCMW 1IXDA 4AT1B 1JSUB 3HBLA 2QTVA 4EC8B 3CCVT 2QQBA 3I35A 3A1PA 2RHUA 4ZGDB 4LUEA 2K4YA 3G4ST 1HSQA 1GH6B 2FL7A 2BKDN 1PKSA 4C5HA 3CC2A 3BW1A 3JB9I 1YIJT 1KC8R 1Q81C 2YUQA 3DOGB 1NPRA 2QDLA 3I56T 2LW4A 3EGDA 1JRIA 2F2VA 2PVOB 1MNEA 1BIBA 5LJ3e 2AZSA 3DJBA 3ASKA 1YI2A 3SHWA 1H92A 2QQAA 3RERA 3HP9A 1K73C 1SHGA 2HNIA 3G7ZA 4N0AC 2WFYB 1Q86U 2K57A 1JEGA 4M4ZA 1VQ8A 2JM9A 2D9TA 3J7AF 2CZ1B 2VXFA 4XU1A 4KT0E 2DERA 2W99A 3L2QA 2D0QB 1VQ9Q 4F7SB 1W2BS 2C0IA 3GNGA 4BE0A 1U3OA 3LYIA 4XTZA 4C0DC 1M3CA 5GAN3 5CVIA 2XIDA 3KUFA 5A0GA 3PE0A 1M3AA 2F2XA 3X28B 2DL5A 2DO3A 3AT1B 2SRCA 4Y72B 1AWOA 2E6ZA 1OZ2A 1WFWA 1YP5A 2R5AA 3NDQA 2E5QA 5GAN7 1WJRA 1QLBA 5C6SA 3LH5A 3OMCA 3OSVA 5GJWB 3PVQA 5GAN2 3CXCP 4LNPA 1UEBA 1GBQA 3QWXX 2DEQA 1TOVA 1VQ4A 4PJOG 3QYHB 1MGQA 4BUGA 4BCFB 2UZLB 2XKOC 4QQDA 1SSFA 3CCUA 3HRTA 2Y4YA 4M78B 4M7DE 2VVKA 2X4XA 2C5XB 3T9NA 2DD5B 1Q86R 3G6EQ 4M75F 4RCCA 3EGXA 1X75C 2KDSA 4PK4A 3FJ5A 1RAEB 4C92E 2XU8A 3MO8A 2CP7A 5IT9E 4M7DD 1XJWB 2VGMA 1MMNA 2QEXT 3FEOA 2L8DA 4M7AF 1QVPA 5GAN8 2DKGA 2E70A 3JCMg 2MAMA 2MMPA 3C95A 3VYHB 4Y92A 1PWTA 4BD3A 1P92A 2WSFE 2UUEB 5J3BA 2L89A 2QAZA 5I2MA 4PJOF 2RH2A 2QTXA 4J9BA 3OW2P 1M90C 2P4RA 2WACA 4QVCA 1BK2A 2AHJB 3QPHA 4PLLA 2HD0A 1ABQA 3S3NA 1YITQ 1RAFB 3H41A 4A63B 1ZP2A 2BZ8A 2E4HA 2D8JA 3BDUA 2HBWA 1TUCA 2DVJA 4QKUA 2W0ZA 3O0GD 1UJYA 3BHVB 4OR5B 4FIBA 2EBPA 5KCHA 3X20B 4E7LA 2NUZA 3UF4A 2GFAA 3RDVA 2RQUA 3A8LB 4C0FA 1CSKA 2LTOA 1D0XA 2CREA 2RHIA 3NTHA 4EDUA 4B9XA 3CCRT 4BCHB 1ZBXA 2QI2A 1YJ9T 1RAGB 3EIDB 4QQGA 1G8XA 1VQLT 1M5Q1 1FVVB 1WA7A 1D0ZA 1SRLA 5KYUB 1SHFA 5CO7A 2XMFA 2IW9B 3TU4K 1H1QB 2RJCA 1WJSA 2DM1A 3RNJA 1VA7A 2HSEB 1OEBA 2RPNA 1VQNA 5CKEA 3META 2O2OA 3BLRB 1VQPQ 3E1SA 5HNBB 1N9SA 1NE8A 2F69A 2EYWA 1HJDA 2LJ1A 5IXBA 2DFUA 2BZXA 2HL5C 2YHTA 3RKWA 2E41A 2QA4T 5L2WB 2DYIA 1VQ7Q 2FVUA 2J05A 1E7PA 4EMKC 1T0JA 3FDRA 4OGCA 1FXXA 2G9XB 4XU2A 4KULA 3L2WA 3OQ5A 4C8QG 4LDWA 2AK5A 5KYWA 3V8JA 4BCMB 2RMOA 3OYKA 1UUEA 1KG1A 1PC0A 3VKIA 3M0RA 2M16A 3UPUA 2NUTB 4AFZC 5KYXA 1Y71A 4BY6C 1IHWA 3CC7A 1TD6A 3M0PA 3H0HA 2OAUA 4OMOA 7AT1B 2K5IA 2GF7A 2HL3A 1M27C 3EG9B 3OYDA 3G4SQ 2JTFA 3DLMA 1BB9A 1WYXA 4C5IA 4AFQC 2KYMA 1RLPC 2F5TX 1OX8A 1X69A 3CBPA 4X34A 4DA4A 1NLPC 1WGSA 3MY5B 1TUDA 3BY7A 1PKDB 3EFOB 3SWNB 4Z88A 1YJNT 2ZPBB 3UWNA 4KGVB 1V76A 4FSSA 4AKIA 4DBRA 2DILA 4A4KA 3LWHA 2OTJT 1YIJA 4KGXB 2JTMA 3CCQT 4C5GA 1QVGA 3VKGA 3F5XB 3I56A 4V2SA 1ACMB 1M90R 3K7AM 1R0CB 2QGFB 3VS1A 4PFPA 3A8OB 1V1CA 1SKUB 2NUPA 2FRWA 4DEYA 2KI7A 1BKBA 3BDLA 5LL6S 3I55T 2YT6A 4M77F 2AKLA 1FWZA 3PT9A 2KXCA 3EGUA 4RCBA 1WHHA 3C12A 5EG2A 3GBQA 3I5SA 5AT1B 3CPWS 2VGNA 2E6NA 1I8FA 3RESA 5M9OA 1UECA 3R6NA 3TW7A 2DL3A 2FB7A 1H3HA 3JB9H 1R77A 1UGRB 4CRIA 1UNHD 3M0QA 2HEQA 4PLIA 2LDMA 4UC4A 2QQ8A 1ZA2B 3JCMh 2RI2A 5KYYA 3CC2T 4JX4A 4BBSM 3A8MB 2WJ9A 2EFIA 3HRUA 3O8VA 2HQHA 2CP6A 1OX9A 4RTXA 3OYHA 2YLBA 1O75A 4Z02A 2ECZA 4EMGA 3VS2A 2BUDA 2A08A 1IRXA 1YI2T 3HRSA 2CGHA 4N0AA 2LVMA 3QWYA 1GUXB 1KD1U 4F16A 4IIMA 2BTTA 4MZPA 3CEYA 2NLUA 4JZ4A 1VQ8T 2UZDB 5FLXE 1IB8A 1NJIU 4OB3B 5FW9A 2P0PA 2LJ3A 4AG1C 3G71A 5FROA 3H0FA 1VYUA 4PJOC 1WQ7A 4HCKA 2OX7A 2YWWA 2GQVA 3JCMb 4PJMA 3GTMS 1M1FA 1Q7YC 2K2VA 1WX6A 2COWA 2LNHB 4X9DA 5FU6C 1KQSS 2NYSA 1WHMA 3ZBDA 1VQMQ 3QIIA 4JS4A 4NS5A 1J3TA 4RTUA 2RHXA 3HHTB 2BZYA 2DJQA 5GANd 5FU7C 2AT1B 2O4XB 3POMA 5IN1A 2YDLA 1OPLA 2GBQA 1OGUB 2EPDA 4LD6A 4A54A 1VQ4T 1WI7A 5GANf 1GL5A 2IPOB 4QW2A 5KYWB 1WQWA 2YRCA 1UG1A 3CCUT 1KD1R 1K4US 3HPWA 3OYCA 2K2MA 2R57A 2X4YA 1VQLQ 2P0KA 2RF0A 2RHZA 3MY1B 4R0KA 2L2PA 4ELZC 2OAWA 2YRDA 1RADB 1NJIR 4BY1X 2E64A 3INZA 2QFZA 3CCRA 1C1AA 6AT1B 3JB9D 1K9MC 1BBZA 2AIRB 2QGSA 4PNOA 1WLPB 2F1LA 4J5YA 2C5VB 4XK8E 2PK9B 4J6XA 2DTHA 2OI3A 1KC8C 3PFSA 2RQRA 2SEMA 2QA4Q 3JCMe 1M30A 2LQNA 2ZAEA 3VJPA 2CZ6B 3OYAA 2D6FA 1PKTA 4C8QD 1D3BA 4XAXB 4MFEA 2DX1A 4OP0A 4EPCA 1IZ6A 1Z9ZA 1W98B 1G3WA 4A4EA 4F7UA 4ZTJA 3MKDA 4LOCA 4AKGA 4YOZA 2B8AA 2NUPB 2QG9B 3OYMA 4PJJA 4UN0A 5HY6A 5IHKA 5KYNA 1JJ2P 5DY9A 4CRLB 2MIOA 4FW2A 1E6GA 5ECAA 2HCKA 1M4ZA 4C8QC 2PZ1A 1XOVA 2ROTA 1VQ6A 1UNLD 3GNFB 3OBYA 2MK5A 3JCMJ 4M78G 4FYWB 4QT7A 4XTXA 5LMKB 5I5ZB 1ZSGA 2F5KA 2QXFA 1P5EB 1JB0E 3HSBA 2VB6A 3OBWA 1VQNT 5LJ5f 1ZUKA 4EOIB 3MEWA 4BCNB 2RA2A 3LGFA 2OTJQ 2RHYA 3JB9J 1MMDA 2L3SA 3VYGB 2ZZDB 2CS7A 2JT4A 4C92F 4AMCA 3I5RA 1URCB 2LCCA 1WJQA 4M77C 2KRNA 4EMKA 4KH0B 1WHLA 4BDZA 1XO2A 4YC3B 4RUGA 3M0SA 3E9GA 4FU6A 2Y90A 1AZGB 3I55Q 3FC3A 4OGRB 4F17A 1Q86C 4M78F 2RO0A 2W9FA 1D1BA 1EZZB 2FYKA 2DVEA 1WZOA 2EGEA 4RG8A 4KUIA 1YWPA 4IUVA 2JS2A 4C0DB 2RNAA 4P5NA 3CC7T 4BY7X 4KGZB 1VQKQ 2VWFA 2LQ8A 1IREB 5GANj 1GCQC 2V1QA 2EYQA 3E2UA 5FRMA 1UGQB 2EVRA 2DAQA 1SF9A 2L3PA 1K9MR 1T3LA 3ER0A 2DXCA 2MPXC 9ATCB 3TCJA 1HXDA 2DETA 2MWOA 5BNJB 4RTYA 2DF6A 1GFCA 2I53A 4RODA 1OI9B 2LQKA 3M57A 3QWLA 2V22B 2CP2A 3M4GA 2LC4A 3I9QA 5GMKm 5IAYA 1AT1B 2QQRA 3UT1A 1RABB 3UA7A 4AI6A 1ZA1B 3VS3A 2VV5A 3HTRA 4KBMB 1W2BP 4Z6YA 5CAIA 1TXQA 4FYVB 1YHQT 5IHIA 2WMAB 2JTEA 2RD1A 1ZLMA 2BE9B 1OL2B 4BDYA 2LT1A 3HKSA 4CC7A 2WPAB 3QHWB 1FMKA 4IUQA 2DD4B 2I0NA 3JV3A 2L5QA 1LOJA 1U8RA 2RN8A 4M75G 3DTOA 3SFMA 4IMYB 1M2VB 2WIPB 1NEGA 2CKKA 2KRMA 1UFFA 5HCKA 4FM4B 3M9QA 2ENMA 4M7DB 2CUBA 3OYIA 3PVLA 1CKBA 4LDUA 4C92B 4M7AG 4FYYB 2E5KA 2GGRA 1OU9A 2PTKA 4F7UB 4Y91A 2COZA 2PVGB 1SRMA 2DA9A 5LJ5j 3MP1A 4FCYA 4CC3A 3P8BB 4RTZA 3QDRB 2JUFA 4IUUA 4CFUB 1QP3A 4CFXB 4NC6A 3PGGA 4JRKA 1XQHA 2B86A 2ZPEB 3QYEA 2CT3A 3CCSA 4PJOA 4DBHA 4XTUA 1E7OA 2FPDA 2JOYA 2O9SA 3M54A 3G71T 2DLPA 2J6FA 2ATCB 4MZTA 3RBBB 8AT1B 4EOSB 1FINB 1MV0B 4F7UE 2GTJA 2BE7D 2X35A 3GF5A 4ORZA 2P4TA 1QWFA 4CC4B 1H1RB 2CZ7B 2O9VA 4D8KA 2ZPHB 2EJGA 2M51A 3ULRB 2CDTA 5CEIB 4F7NB 5CK9A 2PVDB 4NL3A 5GANg 4X1VA 2PNIA 2LCLA 3HZJA 1Y57A 2AZVA 2EQKA 2FZKB 4EMKB 2X4JA 1BU2A 4WCIA 2DL8A 3EG0A 1VINA 2WMBB 2K3YA 2I2LA 1X27A 3CMAQ 2KNBB 1U1TA 1AISB 3M0UA 8ATCB 4LDXA 2E12A 3FIFA 1IO6A 4J83A 3MP6A 4JJBA 2YSQA 1MMAA 4EOPB 3CXCA 5GAMd 3CMEQ 2KXDA 5D7UA 5KH6A 2PK2A 2XG8D 3V8LA 4X9CA 4NSTB 4JJDA 4M78D 2CSQA 2HZYA 3JCMQ 2X1NB 1B34B 1Y96A 2WHBB 1QVFS 3A5ZB 1K1ZA 4MFDA 1MV3A 1FMWA 4J8OA 2DRMA 4OMMA 2EAYA 3DB3A 5CQXA 5GAN4 1B7TA 4HNTA 5CKDA 3H6ZA 4ROCA 4L5GA 3EG3A 3EFSA 2DXCB 5IHYA 2EKOA 4EONB 3UA6A 3BG9A 4BCJB 1OV3A 1D0YA 2KYBA 4M78C 2DXBA 1VIFA 1TG0A 1QKXA 2OJ2A 4BB7A 3VU3C 3CC4A 3OYYA 5KE2A 2K3BA 1S72Q 3QZ5B 1QVFA 1C0MA 1X2KA 2BPMB 3EGDB 3CCJT 3OW2A 3QXEB 4CFWB 2E10A 3DB4A 1RI9A 1VQOQ 2P84A 1W1FA 1C9BA 4E7KA 2X3WD 3TEEA 3BHTB 4EC9B 4HCZA 1QVGP 3PO3S 3QUIA 4C8QA 4YTLA 4XU3A 3JRZA 2R5MA 1H8KA 2V8KA 3CD6Q 3M0TA 4L6V5 1VQ6T 1GRIA 4OB2B 2O31A 2JM8A 4N4GA 5LJ5g 5DQWA 1VQPA 1QVGS 3QSUA 3BHUB 4XTVA 4BCQD 5GMKj 4PJNA 4TVRA 3SEMA 3CCVQ 3MEUA 1N8RU 3TNIB 1UGSB 2KK4A 4M77G 4YOSA 5IHNA 1T0HA 1YIJQ 3CCLA 3DDPB 4GBQA 3U23A 3NPFA 3I56Q 4M77A 2K5LA 4J9HA 1OULA 2CUDA 2PUKB 3VUZA 2LRQA 2OTLA 2KROA 3GIBA 3NTIA 4R55A 2L3QA 1KK7A 2DXUA 2QYZA 2D1XA 3NMZC 2DEUA 1KD1C 4ELJA 3VRZA 4OMQA 4LUDA 2LMJA 4HNUA 1WIEA 1KJWA 2VASA 5IDNB 1JBMA 3HB9A 1NJIC 4J9IA 1ZBJA 2CP3A 3CPWP 5GAOr 3BLHB 2DPPB 1FX7A 5CCAA 1M8VA 2EWNA 4EIKA 1Q82U 3EGXB 2EYZA 4JJNK 3JCMX 1YHQA 4OVAA 2KT8A 4VUBA 3V7CA 4M75D 3CCEA 1GCQA 2QF7A 2ABLA 1M2OA 1WPYA 2EGCA 4M7AE 1W4SA 4OB0B 1Y07A 1ZX6A 3N5BB 4OF1A 3VRYA 5I11A 1UDLA 4JRPA 3DDQB 1MNDA 1N8RR 4M7AD 2EGAA 1SPKA 2P0QA 5CR2A 2RK2A 5J39A 4PJOE 1UJ0A 2W2HA 2E3HA 5DLOA 3E19A 3PTAA 5C0MA 3MCAB 2IG0A 4GLKA 5GAOl 3A98A 4ATOA 5GAMj 4D8DA 4M6VA 4JRIA 3QYGB 5GANh 4PJOD 4M75C 3QHRB 3QG1A 3KHIA 1JOWA 2V26A 4EOOB 1M1GA 3RR6A 2DNUA 2FPEA 4KUDK 1QKWA
chains in the Genus database with same CATH topology
3HFNA 3LYIA 4XTZA 4C0DC 3PMTA 4D6WA 4JLIA 1N27A 2EJ9A 1M4ZA 3PMIA 2H3JA 5GAN3 4M7AC 5CVIA 4NL2A 2XIDA 4C8QC 3JB9G 1XOVA 1VQ6A 3P8HA 4LD9K 3KUFA 5GAOn 3L2RA 3GNFB 3OBYA 3SWNC 4MDWA 5A0GA 2LNVA 3JCMJ 3J81E 4M78G 3X28B 4XTXA 2M0OA 2DO3A 5GAMe 4R56A 1BI2A 2F5KA 2QXFA 1M90U 1JB0E 1Q82C 2ZPFB 1OZ2A 2E6ZA 3DLLA 3HSBA 3OBWA 1I5LA 1O9SA 2O4XA 1VQNT 2R5AA 5LJ5f 1BYMA 1BIAA 2E5QA 3MEWA 2RA2A 3LGFA 1VUBA 2RHYA 4QVZA 5GAN7 3JB9J 4FL6A 4ZTFA 1WJRA 3VYGB 2ZZDB 1QLBA 2EJFA 3L2ZA 2CS7A 5C6SA 5A2QE 1VQ5T 3OMCA 4C92F 4ZN3A 4OMFB 2QQ9A 3OSVA 1H3ZA 1RI0A 2DJZA 2LCCA 4QQ6A 1WJQA 3R6OA 4M77C 5GAN2 1S72A 4EMKA 4WF2A 2JVVA 4BDZA 1UEBA 4QVDA 1VQ7A 1YBYA 2DEQA 4FT2A 4JX5A 3S3OA 3QJ6A 4PJOG 3QYHB 1MGQA 3E9GA 2Y90A 4FU6A 4BUGA 1VQ4A 4N4HA 3JB9F 2XDBA 2XKOC 3P8DA 5FRNA 2G77A 4QQDA 1SSFA 3OA6A 1QP2A 1VQOA 3M55A 4XU0A 3FC3A 3CCUA 1NPPA 2Y4YA 3HRTA 4M75B 4M78B 4M7DE 2X4XA 1VQ9T 1Q86C 3T9NA 4RMOA 2DD5B 3C94A 4M75F 4M78F 4RCCA 1X75C 2KDSA 2RO0A 4XTWA 4C92E 2XU8A 3MO8A 2FYKA 3JCMd 1YJWA 2DVEA 3CD6A 3TREA 3X25B 3NFCA 3V8KA 3JCMV 5IT9E 4RG8A 2VGMA 2QDJA 4KUIA 4M7DD 4C0ZA 5EJCA 3SB2A 2PU9B 4IUVA 4ZGEB 4P5NA 4C0DB 2QEXT 3CC7T 2FHDA 3URGA 3JAME 4M7AB 5A0DA 5D6XA 2DTIA 3FEOA 5A0LA 3J80E 3CCST 2L8DA 5GAOp 4M7AF 4C8QF 5GAOl 3MEVA 3CCVA 4HCBA 1QVPA 2EQMA 5GAN8 2DKGA 4ATOA 1VQMA 2LQ8A 2E70A 5J26A 1IREB 2MAMA 3JCMg 2ZCFB 1M9SA 1TH7A 2MMPA 2RB6A 2XHCA 3C95A 4J7FA 3VYHB 4M75E 5GANj 2EYQA 2RJFA 4BD3A 5LJ3g 3CCMT 1P92A 2WSFE 5FRMA 4PJOB 1UGQB 5LJ5h 2DAQA 5J3BA 3OS0A 2L89A 5I2MA 3ER0A 4PJOF 2DXCA 2RH2A 4A4HA 2QTXA 3TCJA 2VXEA 1M90C 1HXDA 1U1SA 2WACA 3SDZA 4QVCA 2GFUA 5CKBA 2AHJB 3QPHA 4PLLA 2HD0A 2MWOA 5FU6B 3S3NA 3HL8A 4C8QE 4MMKA 4OGEA 4ME7A 3BDUA 3FB9A 2LQKA 3M57A 5D6WA 3QWLA 1V29B 3M4GA 4C0GA 4DOWA 2LC4A 4JS5A 4FIBA 3OYJA 5FU7B 3BFMA 3OSSC 3CPFA 4EMHA 3C4SA 3X20B 4CI0C 5KCHA 3G6ET 4E7LA 5GMKm 4L59A 4HT9A 2A7YA 3ME9A 2K3XA 5GANe 2GFAA 5IAYA 4BE2A 1N6AA 2QQRA 3UT1A 3A8LB 4C0FA 2LTOA 4AI6A 1PSEA 1WNLA 2RHIA 1KHCA 3NTHA 4EDUA 3CCJA 2VV5A 2RK1A 4B9XA 2LX9A 3CCRT 3M59A 4KBMB 4A53A 1X6OA 1ZBXA 2QI2A 1YJ9T 4Z6YA 1I81A 1VIEA 3LX7A 4QQGA 2ZPGB 5CAIA 1YHQT 3RIRA 1M5Q1 4C92G 5GAMg 1VQLT 1VQKT 2YLCA 2BS2A 4M77E 2DTOA 4O6JA 4QSHA 2RD1A 5CO7A 1UGPB 3TU4K 2RJCA 4BDYA 1WJSA 2LT1A 3HKSA 5AYFA 3VYGA 1K8AU 2ZZDA 1XTDA 4HCCA 2G3RA 3SD4A 4M77D 4IUQA 2DD4B 3QO3A 1VQNA 3LGLA 2KQWA 5CKEA 4BE1A 5L8RE 3V7SA 3META 2L5QA 2MF2A 3E1SA 4J6WA 1LOJA 1N9SA 4LDVA 1U8RA 3CPWA 4M75G 1LJOA 3MEAA 1Y96B 1AHJB 3SFMA 1NE8A 2F69A 4RG2A 1YITT 3OYNA 2CKKA 3L2VA 4FM4B 2YHTA 3M9QA 2V8JA 3RKWA 4KUDK 2E41A 4M78A 4M7DB 2QA4T 3CC2A 4BI3A 2JNGA 4AKHA 1UB4A 4MZMA 1MHNA 2DD5A 2FVUA 3OYIA 3NTKA 1Y7XA 4M7DF 1E7PA 1KQ2A 4EMKC 3MHXA 4OGCA 2DZ9A 4HL4A 1FXXA 3FDRA 4LDUA 4XU2A 4KULA 4C92B 2XICA 3OQ5A 3OS1A 3L2WA 4M7AG 5DLQE 4C8QG 4LDWA 1BI1A 2ZGWA 4MMLA 3CC4T 3QBYA 2HAXA 3V8JA 4F7UB 4Y91A 2PVGB 5GAN5 4ELYC 4F7UF 1KQ1A 2DXBB 2KMGA 4J6YA 5LJ5j 3MP1A 4JLGA 3OYKA 3GPLA 1KG1A 3P8BB 1H641 1HK9A 3VKIA 3QDRB 2JUFA 2MI6A 4IUUA 4MDXA 2M16A 3UPUA 1QP3A 4BACA 1Y71A 2WSEE 3LLRA 4BY6C 2QEXA 4NC6A 2O01E 2BS3A 3PGGA 4JRKA 3RUXA 3CC7A 1KC8U 1XQHA 2ZPEB 3QYEA 4DOVA 1PSFA 2GCXA 3CCSA 4PJOA 2DIGA 2OAUA 4XTUA 1RL2A 1G3YA 2JOYA 3M54A 3G71T 2VC8A 2RI5A 3HFOA 2K5IA 2GF7A 2KMTA 4MZTA 2RI3A 3OYDA 2BS4A 3WVDB 2JTFA 3DLMA 1VQ5A 3JCMc 3M58A 5LJ3d 4A4FA 4F7UE 4C5IA 3OYFA 5GAOm 2X35A 3CCMA 1VQPT 5CKFA 3H4CA 4ZGJB 2F5TX 4C8QB 1JJ2A 3E9FA 2E1HA 3CBPA 1K8AC 4X34A 4DA4A 3DL1A 4IURA 1WGSA 3GF5A 3BY7A 2P4TA 4HNVA 3SWNB 3JCMf 5LJ5e 1YJNT 2ZPBB 3UWNA 2LT4A 2MWPA 2CZ7B 2KVQG 3M56A 3OB9A 3OS2A 3GLXA 5LJ3f 1QW1A 2ZPHB 4AKIA 5KCOA 2EJGA 3L42A 3OYLA 1KHIA 4A4KA 1VQ7T 3LWHA 3CCLT 5GAN6 2OTJT 1YIJA 2DIQA 2JTMA 3CCQT 4C5GA 1XNIA 3RKYA 2DXTA 2PVDB 4HLQA 5CK9A 4NL3A 1QVGA 1KC8C 3VKGA 3FLGA 1M1KU 5GANg 3I56A 2LCLA 3HZJA 2EQKA 3M5AA 4V2SA 4EMKB 1KQSA 5CIUA 2X4JA 4Q5WA 1NZ9A 4BI8B 3A8OB 5GMKh 5C0MA 2K3YA 2I2LA 2OTLT 1I4K1 1N9RA 1U1TA 1BKBA 4M77B 3BDLA 4LDXA 2E12A 5LL6S 1LNXA 3LW5E 3FIFA 3ZEHA 3I55T 4J83A 3MP6A 4M77F 3WXMB 1FWZA 3PT9A 2PQWA 5I2SA 1YJ9A 3CXCA 4RCBA 5GAMd 5KH6A 5HK3A 2XG8D 3C12A 1VQLA 3V8LA 2RJDA 2DD4A 4X9CA 3CBOA 5EG2A 4JUVA 1VQKA 3CPWS 4B9WA 4M78D 2VGNA 2ZPIB 2E6NA 1I8FA 3RESA 5M9OA 2X4WA 3VKHA 3DKMA 2KR6A 3JCMQ 1Q7YU 3TW7A 2FB7A 1B34B 4M7DG 1G3TA 1Y96A 1QVFS 3A5ZB 2EQJA 3JB9H 1GXIE 1YCYA 4MFDA 2JZ2A 3EAEA 1UGRB 2R58A 4CRIA 4JX6A 2KSSA 4J8OA 4IUTA 4PLIA 4M7DA 2LDMA 2EAYA 3CCET 3BG5A 4GY5A 3DB3A 4UC4A 3ZFJA 2V8IA 5CQXA 2XK0A 3OS5A 5GAN4 4HNTA 2QQ8A 3RMQA 5CKDA 4F7UG 3H6ZA 2YRVA 3FJPA 3S6WA 3JCMh 2RI2A 4C92A 1G5VA 2CYZB 3CC2T 4L5GA 4JX4A 2RM4A 3EFSA 2DXCB 3A8MB 4BBRM 4BBSM 5LJ3h 2EKOA 4O5VA 3QZ9B 2WJ9A 2EFIA 3HRUA 3O8VA 1ZHIA 2QQSA 5CQYA 3OYGA 3BG9A 2QA4A 2XD0A 3OYHA 2YLBA 1O75A 3BG3A 4XQ3A 4Z02A 4EMGA 5KE3A 4M78C 2DXBA 2BUDA 2WSCE 2K5FA 3LH0A 1FKMA 1YI2T 1VIFA 3HRSA 2CGHA 4N0AA 3QYBA 2L3RA 2LVMA 3M53A 3QHSA 3VU3C 4BB7A 3CC4A 3OYYA 4BE0A 5KE2A 1KD1U 2EIFA 3CMAT 3F70A 1M1KC 4MZPA 3QZ5B 1QVFA 4M75A 3PNWC 3CCJT 3CEYA 2NLUA 3QXEB 1G3SA 3OW2A 1VQ8T 2E10A 1D3BB 5FLXE 2DK3A 3UDCA 1NJIU 3DB4A 4C5EA 3G4SA 3CMET 4OB3B 4BI4A 5LJ5d 2IVWA 2DZCA 4NOYA 1JJ2S 4XTYA 4E7KA 3TEEA 4HT8A 4PKCC 2P0PA 1VQ9A 3RKXA 1K9MU 1X01A 4HCZA 3EFRA 3H8ZA 4M7AA 3QUIA 4C8QA 4YTLA 3OYBA 4XU3A 3JRZA 1Q86U 2R5MA 3Q1JA 3G71A 2V8KA 5FROA 4PJOC 1WQ7A 2PUOB 3SWNA 4FSXA 2GQVA 4L6V5 2E65A 3MP8A 1R8OB 1OZ3A 4JDSA 3JCMb 1VQ6T 2HQEA 4OB2B 4IUPA 2Y4XA 4RKUE 5D6YA 4N4GA 5LJ5g 5GAMh 4E7IA 3TW6A 1VQPA 1QVGS 5GMKl 2A3LA 3LWIA 1M1FA 1ZQ1A 1EIFA 1Q81U 4XTVA 1Q7YC 5GMKj 3QSUA 3WVEB 2K2VA 2HQXA 4TVRA 4X9DA 5FU6C 2KAFA 4OB1B 3MEUA 1W2BA 1KQSS 1N8RU 1YJNA 2BIVA 3ZBDA 2M9UA 1UGSB 2KK4A 3QIIA 4JS4A 4NS5A 4M77G 2CZ0B 2C06A 2RHXA 3HHTB 3VUBA 2VUBA 1K73U 3CCLA 2OTJA 4E7JA 3FRNA 3CCQA 5GANd 4HA8A 5FU7C 3L1AA 4JRQA 4M77A 2K5LA 3CXCS 2O4XB 1OYXA 5IN1A 1S72T 2PUKB 4II1A 2QDYB 3VUZA 4HKEA 3QJYA 2LRQA 2XDPA 4LD6A 4A54A 3KXTA 2OTLA 3GIBA 1VQ4T 5GANf 3NTIA 4DQ2A 4R55A 2KY9A 4QW2A 5GMKe 2DXUA 1WQWA 5DM7R 3I55A 1VQOT 1KD1C 4ELJA 3PIOA 3OYEA 3CCUT 3JCMP 5I21A 3HPWA 3OYCA 1B34A 4C92D 4MIMA 2EQUA 2R57A 1DJ7B 3QKJA 1OI1A 2X4YA 4HNUA 3G6EA 2P0KA 1JBMA 3OY9A 3HB9A 4FT4A 5LJ3j 2RHZA 1YJWT 1NJIC 3CD6T 4ELZC 3X26B 5GMKi 4ZN1A 4E47A 5GAOr 2E64A 2DPPB 4M78E 1FX7A 3INZA 5CCAA 4PL6A 5GAOq 2QFZA 3L2UA 3CCRA 1M8VA 2XI9A 5CKHA 5HK0A 5HKCA 3JB9D 2EWNA 2XDDA 4Y28E 3GOXA 3JCMW 1Q82U 4JJNK 3JCMX 1K9MC 2VYTA 3PIPA 4PNOA 4A4GA 3HBLA 1YHQA 1BI0A 4OVAA 4BY6B 4J5YA 4XK8E 3CCVT 4VUBA 2QQBA 3V7CA 4M75D 3CCEA 4E7HA 2QF7A 2RHUA 4ZGDB 1VQMT 3AHUA 2K4YA 3G4ST 4M7DC 4J6XA 2DTHA 1WPYA 4M7AE 2FL7A 4N4IA 1W4SA 2BKDN 3PFSA 4OB0B 3A8HB 4C5HA 3V7RA 1Y07A 3BW1A 3VV0A 3JB9I 3N5BB 1YIJT 4OF1A 1Q81C 3OW2S 5GAMf 4C92C 3JCMe 4IKFA 3VJPA 4JRPA 2CZ6B 3A8GB 1BI3A 1NPRA 3OYAA 3I56T 1N8RC 2D6FA 1JRIA 2PVOB 5LJ3e 1BIBA 3X24B 4M7AD 4C8QD 2P0QA 1D3BA 3ASKA 5CR2A 2RK2A 1YI2A 5J39A 4PJOE 3GP8A 2QQAA 4XAXB 3RERA 4MFEA 3HP9A 1YITA 5DLOA 1K73C 4OP0A 2HNIA 3E19A 3G7ZA 4N0AC 4EPCA 3CMAA 3PTAA 1IZ6A 3MCAB 2IG0A 2K57A 4GLKA 4LDYA 1G3WA 3M4YA 3RMSA 4A4EA 4F7UA 5GAMj 4M6VA 4JRIA 3S3MA 4ZTJA 4LOCA 1VQ8A 3QYGB 5GANh 4AKGA 2D9TA 4PJOD 2B8AA 4M75C 3J7AF 2CZ1B 2HBPA 2VXFA 3QG1A 4XU1A 3KHIA 4KT0E 3CMEA 3OMGA 3OYMA 3KBGA 1M1GA 2RJEA 3L2QA 3JSCA 2D0QB 5HY6A 3HO8A 4J7IA 2M1HA 2JN0A 1W2BS 3GNGA 3CBMA 5DY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPH B;  3WVE B;  3X20 B;  4OB1 B;  2PVD B;  3A8L B;  1UGS B;  1PSE A;  2CZ0 B;  3HHT B;  3X28 B;  3A8O B;  2ZPG B;  1JB0 E;  2ZPF B;  3LW5 E;  1UGP B;  2PUK B;  2QDY B;  3VYG A;  2ZZD A;  3VYG B;  2ZZD B;  2DD4 A;  2DD4 B;  2ZPI B;  5L8R E;  1DJ7 B;  1AHJ B;  1GXI E;  3QYH B;  1UGR B;  4FM4 B;  3X26 B;  1QP2 A;  2DPP B;  2DD5 A;  2DD5 B;  4Y28 E;  2CYZ B;  2DXC B;  3A8M B;  3X25 B;  4XK8 E;  3QZ9 B;  4ZGD B;  2PU9 B;  4ZGE B;  2PVG B;  2DXB A;  2WSC E;  2DXB B;  4OB0 B;  3A8H B;  2CZ6 B;  1QP3 A;  3A8G B;  2WSE E;  3QZ5 B;  2O01 E;  1IRE B;  2PVO B;  2ZCF B;  3X24 B;  3QXE B;  3VYH B;  2ZPE B;  1PSF A;  2WSF E;  1UGQ B;  4OB3 B;  2DXC A;  3WVD B;  2AHJ B;  3QYG B;  2CZ1 B;  4ZGJ B;  4KT0 E;  2PUO B;  4L6V 5;  2D0Q B;  1V29 B;  2ZPB B;  4OB2 B;  4RKU E;  2CZ7 B; 
#chains in the Genus database with same CATH topology
 2FRY A;  4D6W A;  1FMV A;  1N27 A;  1Z9Q A;  4M7A C;  3UAT A;  1A0N B;  2QEX Q;  1RAA B;  4LXC A;  3SWN C;  2LNV A;  2QK0 A;  2HSP A;  3LQ5 B;  3DLL A;  1Q82 R;  4F6W B;  1KQS P;  1O9S A;  1BYM A;  2I40 B;  1TS9 A;  1VUB A;  4QVZ A;  4FL6 A;  1O9K A;  2KR3 A;  2QAS A;  4KH1 B;  5A2Q E;  1H3Z A;  2QQ9 A;  1H28 B;  1RI0 A;  2DJZ A;  3R6O A;  4WF2 A;  2JVV A;  2PMI B;  3CQT A;  4QVD A;  5IH2 A;  4B6M A;  4FT2 A;  3QJ6 A;  4HXJ A;  3OA6 A;  1QP2 A;  3G1J A;  3M55 A;  1PD1 A;  2CH4 W;  1VQ9 T;  4Z8A A;  1QMC A;  4XTW A;  3JCM d;  2C5O B;  2KRS A;  1YJW A;  3TRE A;  1RAH B;  3V8K A;  3JCM V;  4C0Z A;  5EJC A;  3SB2 A;  3CCR Q;  4ZGE B;  1JST B;  4J9E A;  2FHD A;  4ZNX A;  1YJ9 Q;  5A0D A;  5D6X A;  2DTI A;  3CCS T;  5A0L A;  1VOL A;  4HCB A;  1ZUU A;  2EQM A;  2GNC A;  5KYX B;  3EG1 A;  1VQM A;  5J26 A;  3VUB A;  4BI8 B;  2ZCF B;  1M9S A;  2RB6 A;  1NYF A;  5HQ0 B;  3C0C A;  5LJ5 h;  3OS0 A;  4I3Z B;  4A4H A;  2UZB B;  3SDZ A;  2RQV A;  1OIY B;  1YFN A;  1NYG A;  1PRL C;  4IIO A;  5HVY B;  3HL8 A;  4C8Q E;  4OGE A;  3KFV A;  4E6R A;  3FB9 A;  2FPF A;  4C0G A;  3G33 B;  4JS5 A;  3EG2 A;  1WHG A;  3OYJ A;  4CI0 C;  3OSS C;  3CPF A;  3C4S A;  3REA B;  3G6E T;  3B57 A;  4HT9 A;  4L59 A;  3ME9 A;  2K3X A;  1VYW B;  5GAN e;  4BE2 A;  1AD5 A;  1PSE A;  4E7S A;  1KHC A;  3CCJ A;  1SEM A;  4A53 A;  1X6O A;  2H8H A;  2COY A;  1PG5 B;  4ANJ A;  4G6L B;  4LN2 A;  4C92 G;  5GAM g;  2FZG B;  4BCO B;  2YLC A;  4M77 E;  1CKA A;  2DTO A;  4QSH A;  2DMO A;  1K8A U;  2JW4 A;  3EJ1 B;  4M77 D;  3QO3 A;  4ELL A;  3LGL A;  4BE1 A;  3TNH B;  5L8R E;  1JQQ A;  1X43 A;  3V7S A;  2MF2 A;  2IIM A;  4J6W A;  4LDV A;  2HKN A;  1LJO A;  3MEA A;  1AHJ B;  5GJV B;  2A37 A;  2HKQ B;  1YIT T;  1YJN Q;  1PRM C;  2V8J A;  4M78 A;  4CFN B;  2JNG A;  4AKH A;  4MZM A;  1MHN A;  2DD5 A;  3NTK A;  3MI9 B;  4M7D F;  1KQ2 A;  2KT1 A;  3CCQ Q;  2WEV B;  3OS1 A;  1S1N A;  5KYY B;  2J7I A;  2XIC A;  3H9N A;  5DLQ E;  1BI1 A;  2ZGW A;  4MML A;  3CC4 T;  3QBY A;  2EYY A;  4AG2 C;  1IGU A;  5GAN 5;  4ELY C;  4F7U F;  2KMG A;  4J6Y A;  4JLG A;  3GPL A;  2CP0 A;  1HK9 A;  2FZC B;  2G6F X;  2ESW A;  4BAC A;  3LLR A;  2O01 E;  1KC8 U;  1UTI A;  1RUW A;  4DOV A;  1RL2 A;  3HFO A;  2RI5 A;  4J9G A;  2KMT A;  2L0A A;  2RI3 A;  2BS4 A;  3WVD B;  1PNJ A;  2IN3 A;  1VQ5 A;  3JCM c;  5LJ3 d;  4OMN A;  4A4F A;  5DQV A;  2MYS A;  3BE3 A;  3CCM A;  1VQP T;  4ZGJ B;  1JJ2 A;  3E9F A;  1KXU A;  3DL1 A;  1K8A R;  4FW1 A;  4HNV A;  5LJ5 e;  1U5S A;  2JJ9 A;  2C5N B;  2LT4 A;  4J9C A;  2KVQ G;  1GBR A;  3OS2 A;  5LJ3 f;  1ZSZ C;  1D1C A;  1QCN A;  5KCO A;  1VQ7 T;  3L42 A;  3CC2 Q;  3OYL A;  1O9K B;  3CCL T;  5GAN 6;  1F5Q B;  3RKY A;  1M1K U;  3FLG A;  1HYO A;  3M5A A;  5IDP B;  4Q5W A;  1YI2 Q;  2LP5 A;  5GMK h;  1F1B B;  1GFD A;  2OTL T;  1N9R A;  4DBF A;  5KYU A;  5HBH B;  1LNX A;  2CH4 A;  1M8M A;  1VQ8 Q;  2MCN A;  4EOK B;  2MOX A;  4Z89 A;  5I2S A;  3EHR A;  1VQK A;  4B9W A;  1W70 A;  2ZPI B;  1PCX A;  2X51 A;  3VKH A;  3DKM A;  2J06 A;  2KR6 A;  2LQW A;  2JMA A;  4RTV A;  4ROE A;  4F14 A;  1G3T A;  5EC7 A;  1YCY A;  3EAE A;  2EYX A;  2R58 A;  2DRK A;  4JX6 A;  2KSS A;  4IUT A;  1I0C A;  3BG5 A;  3CCE T;  4GY5 A;  1I5O B;  3TN8 B;  3OS5 A;  4CFM B;  2KEA A;  3RMQ A;  3RGF B;  3S6W A;  1G5V A;  1LVK A;  1WHJ A;  4O5V A;  3QZ9 B;  5CQY A;  3OYG A;  1OPK A;  4LE9 A;  3BG3 A;  1JKW A;  1YCS B;  1TUG B;  2WSC E;  3LH0 A;  1OKV B;  1GCP A;  3M53 A;  4CXA B;  1SSH A;  2NUT A;  2EIF A;  3F70 A;  1QQJ A;  1TU0 B;  4M75 A;  1M1K R;  2DL4 A;  5IXF A;  1D3B B;  2DK3 A;  1VQ4 Q;  4C5E A;  4ESR A;  4F7L B;  3EG9 A;  4CFV B;  1AWX A;  3CCU Q;  4XTY A;  2K7A A;  4PKC C;  3CCS Q;  1VQ9 A;  3RKX A;  1X01 A;  4EOL B;  1JU5 C;  1W6X A;  3H8Z A;  1QWE A;  4M7A A;  1MMG A;  3OYB A;  2CP5 A;  3EH2 A;  2WIH B;  3Q1J A;  3EFO A;  3SWN A;  2X9H A;  2E65 A;  1R8O B;  1OZ3 A;  4JDS A;  2HQE A;  4RKU E;  5D6Y A;  2Y4X A;  5GAM h;  4BCG B;  2A3L A;  3LWI A;  1Q81 U;  2LZ6 B;  2X3X D;  3TSZ A;  2HQX A;  3ZL7 C;  1E9H B;  2KAF A;  4OB1 B;  3TQ7 P;  1W2B A;  2JGZ B;  2BIV A;  3REB B;  1K73 U;  2KGT A;  3FRN A;  3L1A A;  4JRQ A;  1D09 B;  2QGG A;  3CXC S;  3IQL A;  4HVV A;  1T3S A;  1AOJ A;  3VS6 A;  1NLO C;  4JPB W;  2QDY B;  3QJY A;  2XDP A;  2PJQ A;  4DQ2 A;  2KY9 A;  5GMK e;  5DM7 R;  4F04 B;  3PIO A;  3OYE A;  3JCM P;  5I21 A;  4C92 D;  2Z0W A;  2EQU A;  1DJ7 B;  3QKJ A;  1OI1 A;  1RLQ C;  3G6E A;  1UHC A;  4FT4 A;  5LJ3 j;  2JXB A;  1YJW T;  1PD0 A;  1G83 A;  5GMK i;  4M78 E;  2DYB A;  5GAO q;  3L2U A;  2XI9 A;  5CKH A;  5HK0 A;  5HKC A;  3GOX A;  4Y28 E;  4CFU D;  2VYT A;  2W96 A;  3PIP A;  1QVF P;  4J9F A;  4A4G A;  1BI0 A;  4BY6 B;  2LJ0 A;  4E7H A;  1AZE A;  1VQM T;  3AHU A;  4M7D C;  4N4I A;  1OL1 B;  1WXB A;  3A8H B;  3V7R A;  3VV0 A;  2FG0 A;  3OW2 S;  1GUX A;  3TSW A;  5GAM f;  4C92 C;  1Q81 R;  1VQN Q;  4IKF A;  2H3E B;  3A8G B;  1BI3 A;  4HVU A;  1N8R C;  1RAI B;  2C6T B;  3X24 B;  4EOQ B;  1YNZ A;  3GP8 A;  3CC4 Q;  1YIT A;  3H0I A;  1K73 R;  2K9G A;  3CMA A;  1EFN A;  3RMS A;  4LDY A;  3M4Y A;  3S3M A;  3EOC B;  1H26 B;  4BCK B;  1OOT A;  1R0B G;  2HBP A;  2K79 A;  2CJM B;  3CME A;  4BCQ B;  5L23 A;  3OMG A;  3KBG A;  2RJE A;  3JSC A;  1E6H A;  1QMZ B;  3HO8 A;  4J7I A;  2M1H A;  2JN0 A;  2H3J A;  3NHN A;  3CBM A;  3P8H A;  3HFN A;  2IVX A;  4KRT A;  3PMT A;  4JLI A;  1X6B A;  2EJ9 A;  3PMI A;  3JB9 G;  4NL2 A;  3BLQ B;  1UE9 A;  4LD9 K;  3CC7 Q;  5GAO n;  3L2R A;  2IW6 B;  4MDW A;  3D7S B;  2EW3 A;  3J81 E;  2M0O A;  5GAM e;  4R56 A;  2EKH A;  1BI2 A;  1M90 U;  1Q82 C;  2ZPF B;  1OKW B;  1I5L A;  4F6U B;  2O4X A;  1BIA A;  4BXX X;  2ED0 A;  3CCL Q;  2JMC A;  4DEX A;  1X6G A;  4ZTF A;  2EJF A;  3L2Z A;  1H27 B;  1GY3 B;  4YOO A;  1B07 A;  4ZN3 A;  1OIU B;  1H1P B;  4OMF B;  2AKK A;  2ED1 A;  3NGP A;  4QQ6 A;  4EOJ B;  4JJC A;  1S72 A;  1VQ7 A;  1YBY A;  4PFZ A;  2OTL Q;  3VS5 A;  2E3I A;  4JX5 A;  3S3O A;  1NG2 A;  2CCI B;  1K9A A;  1K76 A;  1AD6 A;  4N4H A;  2XDB A;  3JB9 F;  3P8D A;  5FRN A;  2G77 A;  1VQO A;  4WTO B;  4XU0 A;  2ROL A;  4EOR B;  1NPP A;  4M75 B;  4RMO A;  2R7G A;  3C94 A;  1TSF A;  1VYT A;  1AWJ A;  2RQT A;  3CD6 A;  3X25 B;  1LPL A;  3NFC A;  2QDJ A;  2PU9 B;  1M3B A;  3URG A;  3JAM E;  1B3Q A;  4M7A B;  3J80 E;  1YHQ Q;  2C0O A;  5GAO p;  2C4G B;  1N5Z A;  4C8Q F;  3MEV A;  3CCV A;  2YUP A;  3CCE Q;  1AWW A;  2F2C A;  1X2Q A;  1TH7 A;  3G4S A;  1BCM A;  2GQI A;  2XHC A;  4BCM D;  4M75 E;  4J7F A;  1VQ5 T;  2RJF A;  1UHF A;  5LJ3 g;  3CCM T;  4PJO B;  5CYI B;  2A0F B;  2VXE A;  1U1S A;  1ZSZ A;  2GFU A;  5CKB A;  4RTT A;  5EFQ B;  5FU6 B;  1LCK A;  1Q95 G;  4MMK A;  1ENW A;  4ME7 A;  1G2B A;  5D6W A;  4RTW A;  3EH1 A;  1V29 B;  4DOW A;  1TWB A;  3VS0 A;  5FU7 B;  3BFM A;  4EMH A;  2W9Z A;  1H24 B;  2A7Y A;  2YUO A;  4KRD B;  1VYV A;  1N6A A;  2A36 A;  1WNL A;  2RK1 A;  4EOM B;  2LX9 A;  2B9R A;  3M59 A;  1I81 A;  3LX7 A;  1VIE A;  2ZPG B;  3RIR A;  1VQK T;  2BS2 A;  2W10 A;  4O6J A;  1UGP B;  2FEI A;  5ICP B;  5AYF A;  2FO0 A;  3VYG A;  2ZZD A;  1XTD A;  3G71 Q;  4HCC A;  2RQW A;  2G3R A;  3SD4 A;  1U06 A;  2KQW A;  4CC2 A;  3CPW A;  1Y96 B;  1JXM A;  4KRC B;  2YXY A;  4RG2 A;  4AFU C;  3OYN A;  1H25 B;  1SG5 A;  3L2V A;  5IF1 B;  2NWM A;  4BI3 A;  1UB4 A;  2D8H A;  2KBT A;  1Y7X A;  3EHQ A;  3MHX A;  1YN8 A;  2D0N A;  2DZ9 A;  4HL4 A;  4HVW A;  2HAX A;  3QDF A;  1HD3 A;  1NM7 A;  3MPU B;  5ACB A;  2CT4 A;  1KQ1 A;  2DXB B;  1I07 A;  1YJW Q;  1H64 1;  1NBE B;  2MI6 A;  4MDX A;  2CSI A;  2WSE E;  2QEX A;  2BS3 A;  3RUX A;  1H1S B;  1PSF A;  2GCX A;  2DIG A;  2LX7 A;  1G3Y A;  2VC8 A;  1KSW A;  1ARK A;  4K11 A;  5FWB A;  3M58 A;  1UNG D;  2DBK A;  3OYF A;  5GAO m;  5CKF A;  3H4C A;  4C8Q B;  2V1R A;  2E1H A;  1K8A C;  2M02 A;  3MIA B;  1OU8 A;  4IUR A;  1K0X A;  4F7J B;  1TTH B;  3JCM f;  2MWP A;  3OB9 A;  3M56 A;  3GLX A;  1QW1 A;  1K0S A;  1KHI A;  1WXT A;  4OMP A;  2DIQ A;  4DBQ A;  1Y0M A;  1XNI A;  2DXT A;  4HLQ A;  3TVT A;  4GLM A;  1KQS A;  2O88 A;  5CIU A;  1MUZ A;  1NZ9 A;  1NEB A;  3M03 A;  2PHG A;  4F70 B;  1I4K 1;  4M77 B;  3CCJ Q;  3LW5 E;  3ZEH A;  2BKZ B;  3WXM B;  2K6D A;  2PQW A;  5FGK B;  1IHV A;  2YUN A;  1YJ9 A;  2DBM A;  5HK3 A;  1VQL A;  2A28 A;  1TFB A;  2RJD A;  2DD4 A;  3CBO A;  4JUV A;  1VOM A;  3TNW B;  2J6K A;  2X4W A;  1Q7Y U;  1IGQ A;  4F6S B;  1PM3 A;  4M7D G;  2EQJ A;  1M2V A;  1GXI E;  2JZ2 A;  1VQ6 Q;  1WHK A;  4M7D A;  1JO8 A;  3ZFJ A;  2HMA A;  2V8I A;  2XK0 A;  4F7U G;  2YRV A;  3FJP A;  4C92 A;  2CYZ B;  2RM4 A;  4E2F B;  1C6V X;  1QLY A;  4BBR M;  5LJ3 h;  1ZSZ B;  1ZHI A;  2QQS A;  2QA4 A;  2XD0 A;  1I1J A;  1D1A A;  4XQ3 A;  5KE3 A;  2K5F A;  2KE9 A;  1FKM A;  1QCO A;  2WXV B;  1OQK A;  3QYB A;  2L3R A;  4PJL A;  4BCI B;  3QHS A;  3CMA T;  2HDA A;  1M1K C;  1WXU A;  3PNW C;  1EX4 A;  2EQI A;  4FYX B;  1BU1 A;  1G3S A;  3VS7 A;  5I22 A;  1RAC B;  1QCF A;  3UDC A;  4TTH A;  3CME T;  4BI4 A;  5LJ5 d;  2IVW A;  4FX3 B;  1ZUY A;  2DZC A;  4E7Z A;  4NOY A;  1JJ2 S;  4HT8 A;  1FYN A;  1K9M U;  3EFR A;  2F2W A;  2PUO B;  1VQ5 Q;  4FSX A;  3O5Z A;  3MP8 A;  4IUP A;  3CCM Q;  4II5 B;  4E7I A;  3TW6 A;  5GMK l;  1ZQ1 A;  1EIF A;  2DL7 A;  3WVE B;  1Q7Y R;  1N4M A;  5HBE B;  1WDX A;  1KIK A;  2DE0 X;  1YJN A;  2M9U A;  5LQF B;  3MJX A;  2IW8 B;  3THK A;  2JS0 A;  2CZ0 B;  2C06 A;  1G3N C;  2VUB A;  2J6O A;  2OTJ A;  1ABO A;  4E7J A;  3CCQ A;  4HA8 A;  5FWC A;  4AFS C;  2DME A;  1OYX A;  2CCH B;  4OML A;  1S72 T;  4II1 A;  1D3U B;  4J9D A;  4BCP B;  4HKE A;  3KXT A;  2M0Y A;  3VS4 A;  2C0T A;  5HBJ B;  1BCO A;  3I55 A;  1VQO T;  4BCN D;  4JZ3 A;  1AVZ C;  4PFO A;  1B34 A;  4MIM A;  2VKN A;  1H4L D;  3OY9 A;  1JXO A;  1PHT A;  2UZE B;  3CD6 T;  3X26 B;  2GTO A;  4E47 A;  4ZN1 A;  1YWO A;  1KFZ A;  1UGV A;  4PL6 A;  1AEY A;  2EUF A;  2LCS A;  2XDD A;  3JCM W;  1IXD A;  4AT1 B;  1JSU B;  3HBL A;  2QTV A;  4EC8 B;  3CCV T;  2QQB A;  3I35 A;  3A1P A;  2RHU A;  4ZGD B;  4LUE A;  2K4Y A;  3G4S T;  1HSQ A;  1GH6 B;  2FL7 A;  2BKD N;  1PKS A;  4C5H A;  3CC2 A;  3BW1 A;  3JB9 I;  1YIJ T;  1KC8 R;  1Q81 C;  2YUQ A;  3DOG B;  1NPR A;  2QDL A;  3I56 T;  2LW4 A;  3EGD A;  1JRI A;  2F2V A;  2PVO B;  1MNE A;  1BIB A;  5LJ3 e;  2AZS A;  3DJB A;  3ASK A;  1YI2 A;  3SHW A;  1H92 A;  2QQA A;  3RER A;  3HP9 A;  1K73 C;  1SHG A;  2HNI A;  3G7Z A;  4N0A C;  2WFY B;  1Q86 U;  2K57 A;  1JEG A;  4M4Z A;  1VQ8 A;  2JM9 A;  2D9T A;  3J7A F;  2CZ1 B;  2VXF A;  4XU1 A;  4KT0 E;  2DER A;  2W99 A;  3L2Q A;  2D0Q B;  1VQ9 Q;  4F7S B;  1W2B S;  2C0I A;  3GNG A;  4BE0 A;  1U3O A;  3LYI A;  4XTZ A;  4C0D C;  1M3C A;  5GAN 3;  5CVI A;  2XID A;  3KUF A;  5A0G A;  3PE0 A;  1M3A A;  2F2X A;  3X28 B;  2DL5 A;  2DO3 A;  3AT1 B;  2SRC A;  4Y72 B;  1AWO A;  2E6Z A;  1OZ2 A;  1WFW A;  1YP5 A;  2R5A A;  3NDQ A;  2E5Q A;  5GAN 7;  1WJR A;  1QLB A;  5C6S A;  3LH5 A;  3OMC A;  3OSV A;  5GJW B;  3PVQ A;  5GAN 2;  3CXC P;  4LNP A;  1UEB A;  1GBQ A;  3QWX X;  2DEQ A;  1TOV A;  1VQ4 A;  4PJO G;  3QYH B;  1MGQ A;  4BUG A;  4BCF B;  2UZL B;  2XKO C;  4QQD A;  1SSF A;  3CCU A;  3HRT A;  2Y4Y A;  4M78 B;  4M7D E;  2VVK A;  2X4X A;  2C5X B;  3T9N A;  2DD5 B;  1Q86 R;  3G6E Q;  4M75 F;  4RCC A;  3EGX A;  1X75 C;  2KDS A;  4PK4 A;  3FJ5 A;  1RAE B;  4C92 E;  2XU8 A;  3MO8 A;  2CP7 A;  5IT9 E;  4M7D D;  1XJW B;  2VGM A;  1MMN A;  2QEX T;  3FEO A;  2L8D A;  4M7A F;  1QVP A;  5GAN 8;  2DKG A;  2E70 A;  3JCM g;  2MAM A;  2MMP A;  3C95 A;  3VYH B;  4Y92 A;  1PWT A;  4BD3 A;  1P92 A;  2WSF E;  2UUE B;  5J3B A;  2L89 A;  2QAZ A;  5I2M A;  4PJO F;  2RH2 A;  2QTX A;  4J9B A;  3OW2 P;  1M90 C;  2P4R A;  2WAC A;  4QVC A;  1BK2 A;  2AHJ B;  3QPH A;  4PLL A;  2HD0 A;  1ABQ A;  3S3N A;  1YIT Q;  1RAF B;  3H41 A;  4A63 B;  1ZP2 A;  2BZ8 A;  2E4H A;  2D8J A;  3BDU A;  2HBW A;  1TUC A;  2DVJ A;  4QKU A;  2W0Z A;  3O0G D;  1UJY A;  3BHV B;  4OR5 B;  4FIB A;  2EBP A;  5KCH A;  3X20 B;  4E7L A;  2NUZ A;  3UF4 A;  2GFA A;  3RDV A;  2RQU A;  3A8L B;  4C0F A;  1CSK A;  2LTO A;  1D0X A;  2CRE A;  2RHI A;  3NTH A;  4EDU A;  4B9X A;  3CCR T;  4BCH B;  1ZBX A;  2QI2 A;  1YJ9 T;  1RAG B;  3EID B;  4QQG A;  1G8X A;  1VQL T;  1M5Q 1;  1FVV B;  1WA7 A;  1D0Z A;  1SRL A;  5KYU B;  1SHF A;  5CO7 A;  2XMF A;  2IW9 B;  3TU4 K;  1H1Q B;  2RJC A;  1WJS A;  2DM1 A;  3RNJ A;  1VA7 A;  2HSE B;  1OEB A;  2RPN A;  1VQN A;  5CKE A;  3MET A;  2O2O A;  3BLR B;  1VQP Q;  3E1S A;  5HNB B;  1N9S A;  1NE8 A;  2F69 A;  2EYW A;  1HJD A;  2LJ1 A;  5IXB A;  2DFU A;  2BZX A;  2HL5 C;  2YHT A;  3RKW A;  2E41 A;  2QA4 T;  5L2W B;  2DYI A;  1VQ7 Q;  2FVU A;  2J05 A;  1E7P A;  4EMK C;  1T0J A;  3FDR A;  4OGC A;  1FXX A;  2G9X B;  4XU2 A;  4KUL A;  3L2W A;  3OQ5 A;  4C8Q G;  4LDW A;  2AK5 A;  5KYW A;  3V8J A;  4BCM B;  2RMO A;  3OYK A;  1UUE A;  1KG1 A;  1PC0 A;  3VKI A;  3M0R A;  2M16 A;  3UPU A;  2NUT B;  4AFZ C;  5KYX A;  1Y71 A;  4BY6 C;  1IHW A;  3CC7 A;  1TD6 A;  3M0P A;  3H0H A;  2OAU A;  4OMO A;  7AT1 B;  2K5I A;  2GF7 A;  2HL3 A;  1M27 C;  3EG9 B;  3OYD A;  3G4S Q;  2JTF A;  3DLM A;  1BB9 A;  1WYX A;  4C5I A;  4AFQ C;  2KYM A;  1RLP C;  2F5T X;  1OX8 A;  1X69 A;  3CBP A;  4X34 A;  4DA4 A;  1NLP C;  1WGS A;  3MY5 B;  1TUD A;  3BY7 A;  1PKD B;  3EFO B;  3SWN B;  4Z88 A;  1YJN T;  2ZPB B;  3UWN A;  4KGV B;  1V76 A;  4FSS A;  4AKI A;  4DBR A;  2DIL A;  4A4K A;  3LWH A;  2OTJ T;  1YIJ A;  4KGX B;  2JTM A;  3CCQ T;  4C5G A;  1QVG A;  3VKG A;  3F5X B;  3I56 A;  4V2S A;  1ACM B;  1M90 R;  3K7A M;  1R0C B;  2QGF B;  3VS1 A;  4PFP A;  3A8O B;  1V1C A;  1SKU B;  2NUP A;  2FRW A;  4DEY A;  2KI7 A;  1BKB A;  3BDL A;  5LL6 S;  3I55 T;  2YT6 A;  4M77 F;  2AKL A;  1FWZ A;  3PT9 A;  2KXC A;  3EGU A;  4RCB A;  1WHH A;  3C12 A;  5EG2 A;  3GBQ A;  3I5S A;  5AT1 B;  3CPW S;  2VGN A;  2E6N A;  1I8F A;  3RES A;  5M9O A;  1UEC A;  3R6N A;  3TW7 A;  2DL3 A;  2FB7 A;  1H3H A;  3JB9 H;  1R77 A;  1UGR B;  4CRI A;  1UNH D;  3M0Q A;  2HEQ A;  4PLI A;  2LDM A;  4UC4 A;  2QQ8 A;  1ZA2 B;  3JCM h;  2RI2 A;  5KYY A;  3CC2 T;  4JX4 A;  4BBS M;  3A8M B;  2WJ9 A;  2EFI A;  3HRU A;  3O8V A;  2HQH A;  2CP6 A;  1OX9 A;  4RTX A;  3OYH A;  2YLB A;  1O75 A;  4Z02 A;  2ECZ A;  4EMG A;  3VS2 A;  2BUD A;  2A08 A;  1IRX A;  1YI2 T;  3HRS A;  2CGH A;  4N0A A;  2LVM A;  3QWY A;  1GUX B;  1KD1 U;  4F16 A;  4IIM A;  2BTT A;  4MZP A;  3CEY A;  2NLU A;  4JZ4 A;  1VQ8 T;  2UZD B;  5FLX E;  1IB8 A;  1NJI U;  4OB3 B;  5FW9 A;  2P0P A;  2LJ3 A;  4AG1 C;  3G71 A;  5FRO A;  3H0F A;  1VYU A;  4PJO C;  1WQ7 A;  4HCK A;  2OX7 A;  2YWW A;  2GQV A;  3JCM b;  4PJM A;  3GTM S;  1M1F A;  1Q7Y C;  2K2V A;  1WX6 A;  2COW A;  2LNH B;  4X9D A;  5FU6 C;  1KQS S;  2NYS A;  1WHM A;  3ZBD A;  1VQM Q;  3QII A;  4JS4 A;  4NS5 A;  1J3T A;  4RTU A;  2RHX A;  3HHT B;  2BZY A;  2DJQ A;  5GAN d;  5FU7 C;  2AT1 B;  2O4X B;  3POM A;  5IN1 A;  2YDL A;  1OPL A;  2GBQ A;  1OGU B;  2EPD A;  4LD6 A;  4A54 A;  1VQ4 T;  1WI7 A;  5GAN f;  1GL5 A;  2IPO B;  4QW2 A;  5KYW B;  1WQW A;  2YRC A;  1UG1 A;  3CCU T;  1KD1 R;  1K4U S;  3HPW A;  3OYC A;  2K2M A;  2R57 A;  2X4Y A;  1VQL Q;  2P0K A;  2RF0 A;  2RHZ A;  3MY1 B;  4R0K A;  2L2P A;  4ELZ C;  2OAW A;  2YRD A;  1RAD B;  1NJI R;  4BY1 X;  2E64 A;  3INZ A;  2QFZ A;  3CCR A;  1C1A A;  6AT1 B;  3JB9 D;  1K9M C;  1BBZ A;  2AIR B;  2QGS A;  4PNO A;  1WLP B;  2F1L A;  4J5Y A;  2C5V B;  4XK8 E;  2PK9 B;  4J6X A;  2DTH A;  2OI3 A;  1KC8 C;  3PFS A;  2RQR A;  2SEM A;  2QA4 Q;  3JCM e;  1M30 A;  2LQN A;  2ZAE A;  3VJP A;  2CZ6 B;  3OYA A;  2D6F A;  1PKT A;  4C8Q D;  1D3B A;  4XAX B;  4MFE A;  2DX1 A;  4OP0 A;  4EPC A;  1IZ6 A;  1Z9Z A;  1W98 B;  1G3W A;  4A4E A;  4F7U A;  4ZTJ A;  3MKD A;  4LOC A;  4AKG A;  4YOZ A;  2B8A A;  2NUP B;  2QG9 B;  3OYM A;  4PJJ A;  4UN0 A;  5HY6 A;  5IHK A;  5KYN A;  1JJ2 P;  5DY9 A;  4CRL B;  2MIO A;  4FW2 A;  1E6G A;  5ECA A;  2HCK A;  1M4Z A;  4C8Q C;  2PZ1 A;  1XOV A;  2ROT A;  1VQ6 A;  1UNL D;  3GNF B;  3OBY A;  2MK5 A;  3JCM J;  4M78 G;  4FYW B;  4QT7 A;  4XTX A;  5LMK B;  5I5Z B;  1ZSG A;  2F5K A;  2QXF A;  1P5E B;  1JB0 E;  3HSB A;  2VB6 A;  3OBW A;  1VQN T;  5LJ5 f;  1ZUK A;  4EOI B;  3MEW A;  4BCN B;  2RA2 A;  3LGF A;  2OTJ Q;  2RHY A;  3JB9 J;  1MMD A;  2L3S A;  3VYG B;  2ZZD B;  2CS7 A;  2JT4 A;  4C92 F;  4AMC A;  3I5R A;  1URC B;  2LCC A;  1WJQ A;  4M77 C;  2KRN A;  4EMK A;  4KH0 B;  1WHL A;  4BDZ A;  1XO2 A;  4YC3 B;  4RUG A;  3M0S A;  3E9G A;  4FU6 A;  2Y90 A;  1AZG B;  3I55 Q;  3FC3 A;  4OGR B;  4F17 A;  1Q86 C;  4M78 F;  2RO0 A;  2W9F A;  1D1B A;  1EZZ B;  2FYK A;  2DVE A;  1WZO A;  2EGE A;  4RG8 A;  4KUI A;  1YWP A;  4IUV A;  2JS2 A;  4C0D B;  2RNA A;  4P5N A;  3CC7 T;  4BY7 X;  4KGZ B;  1VQK Q;  2VWF A;  2LQ8 A;  1IRE B;  5GAN j;  1GCQ C;  2V1Q A;  2EYQ A;  3E2U A;  5FRM A;  1UGQ B;  2EVR A;  2DAQ A;  1SF9 A;  2L3P A;  1K9M R;  1T3L A;  3ER0 A;  2DXC A;  2MPX C;  9ATC B;  3TCJ A;  1HXD A;  2DET A;  2MWO A;  5BNJ B;  4RTY A;  2DF6 A;  1GFC A;  2I53 A;  4ROD A;  1OI9 B;  2LQK A;  3M57 A;  3QWL A;  2V22 B;  2CP2 A;  3M4G A;  2LC4 A;  3I9Q A;  5GMK m;  5IAY A;  1AT1 B;  2QQR A;  3UT1 A;  1RAB B;  3UA7 A;  4AI6 A;  1ZA1 B;  3VS3 A;  2VV5 A;  3HTR A;  4KBM B;  1W2B P;  4Z6Y A;  5CAI A;  1TXQ A;  4FYV B;  1YHQ T;  5IHI A;  2WMA B;  2JTE A;  2RD1 A;  1ZLM A;  2BE9 B;  1OL2 B;  4BDY A;  2LT1 A;  3HKS A;  4CC7 A;  2WPA B;  3QHW B;  1FMK A;  4IUQ A;  2DD4 B;  2I0N A;  3JV3 A;  2L5Q A;  1LOJ A;  1U8R A;  2RN8 A;  4M75 G;  3DTO A;  3SFM A;  4IMY B;  1M2V B;  2WIP B;  1NEG A;  2CKK A;  2KRM A;  1UFF A;  5HCK A;  4FM4 B;  3M9Q A;  2ENM A;  4M7D B;  2CUB A;  3OYI A;  3PVL A;  1CKB A;  4LDU A;  4C92 B;  4M7A G;  4FYY B;  2E5K A;  2GGR A;  1OU9 A;  2PTK A;  4F7U B;  4Y91 A;  2COZ A;  2PVG B;  1SRM A;  2DA9 A;  5LJ5 j;  3MP1 A;  4FCY A;  4CC3 A;  3P8B B;  4RTZ A;  3QDR B;  2JUF A;  4IUU A;  4CFU B;  1QP3 A;  4CFX B;  4NC6 A;  3PGG A;  4JRK A;  1XQH A;  2B86 A;  2ZPE B;  3QYE A;  2CT3 A;  3CCS A;  4PJO A;  4DBH A;  4XTU A;  1E7O A;  2FPD A;  2JOY A;  2O9S A;  3M54 A;  3G71 T;  2DLP A;  2J6F A;  2ATC B;  4MZT A;  3RBB B;  8AT1 B;  4EOS B;  1FIN B;  1MV0 B;  4F7U E;  2GTJ A;  2BE7 D;  2X35 A;  3GF5 A;  4ORZ A;  2P4T A;  1QWF A;  4CC4 B;  1H1R B;  2CZ7 B;  2O9V A;  4D8K A;  2ZPH B;  2EJG A;  2M51 A;  3ULR B;  2CDT A;  5CEI B;  4F7N B;  5CK9 A;  2PVD B;  4NL3 A;  5GAN g;  4X1V A;  2PNI A;  2LCL A;  3HZJ A;  1Y57 A;  2AZV A;  2EQK A;  2FZK B;  4EMK B;  2X4J A;  1BU2 A;  4WCI A;  2DL8 A;  3EG0 A;  1VIN A;  2WMB B;  2K3Y A;  2I2L A;  1X27 A;  3CMA Q;  2KNB B;  1U1T A;  1AIS B;  3M0U A;  8ATC B;  4LDX A;  2E12 A;  3FIF A;  1IO6 A;  4J83 A;  3MP6 A;  4JJB A;  2YSQ A;  1MMA A;  4EOP B;  3CXC A;  5GAM d;  3CME Q;  2KXD A;  5D7U A;  5KH6 A;  2PK2 A;  2XG8 D;  3V8L A;  4X9C A;  4NST B;  4JJD A;  4M78 D;  2CSQ A;  2HZY A;  3JCM Q;  2X1N B;  1B34 B;  1Y96 A;  2WHB B;  1QVF S;  3A5Z B;  1K1Z A;  4MFD A;  1MV3 A;  1FMW A;  4J8O A;  2DRM A;  4OMM A;  2EAY A;  3DB3 A;  5CQX A;  5GAN 4;  1B7T A;  4HNT A;  5CKD A;  3H6Z A;  4ROC A;  4L5G A;  3EG3 A;  3EFS A;  2DXC B;  5IHY A;  2EKO A;  4EON B;  3UA6 A;  3BG9 A;  4BCJ B;  1OV3 A;  1D0Y A;  2KYB A;  4M78 C;  2DXB A;  1VIF A;  1TG0 A;  1QKX A;  2OJ2 A;  4BB7 A;  3VU3 C;  3CC4 A;  3OYY A;  5KE2 A;  2K3B A;  1S72 Q;  3QZ5 B;  1QVF A;  1C0M A;  1X2K A;  2BPM B;  3EGD B;  3CCJ T;  3OW2 A;  3QXE B;  4CFW B;  2E10 A;  3DB4 A;  1RI9 A;  1VQO Q;  2P84 A;  1W1F A;  1C9B A;  4E7K A;  2X3W D;  3TEE A;  3BHT B;  4EC9 B;  4HCZ A;  1QVG P;  3PO3 S;  3QUI A;  4C8Q A;  4YTL A;  4XU3 A;  3JRZ A;  2R5M A;  1H8K A;  2V8K A;  3CD6 Q;  3M0T A;  4L6V 5;  1VQ6 T;  1GRI A;  4OB2 B;  2O31 A;  2JM8 A;  4N4G A;  5LJ5 g;  5DQW A;  1VQP A;  1QVG S;  3QSU A;  3BHU B;  4XTV A;  4BCQ D;  5GMK j;  4PJN A;  4TVR A;  3SEM A;  3CCV Q;  3MEU A;  1N8R U;  3TNI B;  1UGS B;  2KK4 A;  4M77 G;  4YOS A;  5IHN A;  1T0H A;  1YIJ Q;  3CCL A;  3DDP B;  4GBQ A;  3U23 A;  3NPF A;  3I56 Q;  4M77 A;  2K5L A;  4J9H A;  1OUL A;  2CUD A;  2PUK B;  3VUZ A;  2LRQ A;  2OTL A;  2KRO A;  3GIB A;  3NTI A;  4R55 A;  2L3Q A;  1KK7 A;  2DXU A;  2QYZ A;  2D1X A;  3NMZ C;  2DEU A;  1KD1 C;  4ELJ A;  3VRZ A;  4OMQ A;  4LUD A;  2LMJ A;  4HNU A;  1WIE A;  1KJW A;  2VAS A;  5IDN B;  1JBM A;  3HB9 A;  1NJI C;  4J9I A;  1ZBJ A;  2CP3 A;  3CPW P;  5GAO r;  3BLH B;  2DPP B;  1FX7 A;  5CCA A;  1M8V A;  2EWN A;  4EIK A;  1Q82 U;  3EGX B;  2EYZ A;  4JJN K;  3JCM X;  1YHQ A;  4OVA A;  2KT8 A;  4VUB A;  3V7C A;  4M75 D;  3CCE A;  1GCQ A;  2QF7 A;  2ABL A;  1M2O A;  1WPY A;  2EGC A;  4M7A E;  1W4S A;  4OB0 B;  1Y07 A;  1ZX6 A;  3N5B B;  4OF1 A;  3VRY A;  5I11 A;  1UDL A;  4JRP A;  3DDQ B;  1MND A;  1N8R R;  4M7A D;  2EGA A;  1SPK A;  2P0Q A;  5CR2 A;  2RK2 A;  5J39 A;  4PJO E;  1UJ0 A;  2W2H A;  2E3H A;  5DLO A;  3E19 A;  3PTA A;  5C0M A;  3MCA B;  2IG0 A;  4GLK A;  5GAO l;  3A98 A;  4ATO A;  5GAM j;  4D8D A;  4M6V A;  4JRI A;  3QYG B;  5GAN h;  4PJO D;  4M75 C;  3QHR B;  3QG1 A;  3KHI A;  1JOW A;  2V26 A;  4EOO B;  1M1G A;  3RR6 A;  2DNU A;  2FPE A;  4KUD K;  1QKW A; 
#chains in the Genus database with same CATH homology
 3HFN A;  3LYI A;  4XTZ A;  4C0D C;  3PMT A;  4D6W A;  4JLI A;  1N27 A;  2EJ9 A;  1M4Z A;  3PMI A;  2H3J A;  5GAN 3;  4M7A C;  5CVI A;  4NL2 A;  2XID A;  4C8Q C;  3JB9 G;  1XOV A;  1VQ6 A;  3P8H A;  4LD9 K;  3KUF A;  5GAO n;  3L2R A;  3GNF B;  3OBY A;  3SWN C;  4MDW A;  5A0G A;  2LNV A;  3JCM J;  3J81 E;  4M78 G;  3X28 B;  4XTX A;  2M0O A;  2DO3 A;  5GAM e;  4R56 A;  1BI2 A;  2F5K A;  2QXF A;  1M90 U;  1JB0 E;  1Q82 C;  2ZPF B;  1OZ2 A;  2E6Z A;  3DLL A;  3HSB A;  3OBW A;  1I5L A;  1O9S A;  2O4X A;  1VQN T;  2R5A A;  5LJ5 f;  1BYM A;  1BIA A;  2E5Q A;  3MEW A;  2RA2 A;  3LGF A;  1VUB A;  2RHY A;  4QVZ A;  5GAN 7;  3JB9 J;  4FL6 A;  4ZTF A;  1WJR A;  3VYG B;  2ZZD B;  1QLB A;  2EJF A;  3L2Z A;  2CS7 A;  5C6S A;  5A2Q E;  1VQ5 T;  3OMC A;  4C92 F;  4ZN3 A;  4OMF B;  2QQ9 A;  3OSV A;  1H3Z A;  1RI0 A;  2DJZ A;  2LCC A;  4QQ6 A;  1WJQ A;  3R6O A;  4M77 C;  5GAN 2;  1S72 A;  4EMK A;  4WF2 A;  2JVV A;  4BDZ A;  1UEB A;  4QVD A;  1VQ7 A;  1YBY A;  2DEQ A;  4FT2 A;  4JX5 A;  3S3O A;  3QJ6 A;  4PJO G;  3QYH B;  1MGQ A;  3E9G A;  2Y90 A;  4FU6 A;  4BUG A;  1VQ4 A;  4N4H A;  3JB9 F;  2XDB A;  2XKO C;  3P8D A;  5FRN A;  2G77 A;  4QQD A;  1SSF A;  3OA6 A;  1QP2 A;  1VQO A;  3M55 A;  4XU0 A;  3FC3 A;  3CCU A;  1NPP A;  2Y4Y A;  3HRT A;  4M75 B;  4M78 B;  4M7D E;  2X4X A;  1VQ9 T;  1Q86 C;  3T9N A;  4RMO A;  2DD5 B;  3C94 A;  4M75 F;  4M78 F;  4RCC A;  1X75 C;  2KDS A;  2RO0 A;  4XTW A;  4C92 E;  2XU8 A;  3MO8 A;  2FYK A;  3JCM d;  1YJW A;  2DVE A;  3CD6 A;  3TRE A;  3X25 B;  3NFC A;  3V8K A;  3JCM V;  5IT9 E;  4RG8 A;  2VGM A;  2QDJ A;  4KUI A;  4M7D D;  4C0Z A;  5EJC A;  3SB2 A;  2PU9 B;  4IUV A;  4ZGE B;  4P5N A;  4C0D B;  2QEX T;  3CC7 T;  2FHD A;  3URG A;  3JAM E;  4M7A B;  5A0D A;  5D6X A;  2DTI A;  3FEO A;  5A0L A;  3J80 E;  3CCS T;  2L8D A;  5GAO p;  4M7A F;  4C8Q F;  5GAO l;  3MEV A;  3CCV A;  4HCB A;  1QVP A;  2EQM A;  5GAN 8;  2DKG A;  4ATO A;  1VQM A;  2LQ8 A;  2E70 A;  5J26 A;  1IRE B;  2MAM A;  3JCM g;  2ZCF B;  1M9S A;  1TH7 A;  2MMP A;  2RB6 A;  2XHC A;  3C95 A;  4J7F A;  3VYH B;  4M75 E;  5GAN j;  2EYQ A;  2RJF A;  4BD3 A;  5LJ3 g;  3CCM T;  1P92 A;  2WSF E;  5FRM A;  4PJO B;  1UGQ B;  5LJ5 h;  2DAQ A;  5J3B A;  3OS0 A;  2L89 A;  5I2M A;  3ER0 A;  4PJO F;  2DXC A;  2RH2 A;  4A4H A;  2QTX A;  3TCJ A;  2VXE A;  1M90 C;  1HXD A;  1U1S A;  2WAC A;  3SDZ A;  4QVC A;  2GFU A;  5CKB A;  2AHJ B;  3QPH A;  4PLL A;  2HD0 A;  2MWO A;  5FU6 B;  3S3N A;  3HL8 A;  4C8Q E;  4MMK A;  4OGE A;  4ME7 A;  3BDU A;  3FB9 A;  2LQK A;  3M57 A;  5D6W A;  3QWL A;  1V29 B;  3M4G A;  4C0G A;  4DOW A;  2LC4 A;  4JS5 A;  4FIB A;  3OYJ A;  5FU7 B;  3BFM A;  3OSS C;  3CPF A;  4EMH A;  3C4S A;  3X20 B;  4CI0 C;  5KCH A;  3G6E T;  4E7L A;  5GMK m;  4L59 A;  4HT9 A;  2A7Y A;  3ME9 A;  2K3X A;  5GAN e;  2GFA A;  5IAY A;  4BE2 A;  1N6A A;  2QQR A;  3UT1 A;  3A8L B;  4C0F A;  2LTO A;  4AI6 A;  1PSE A;  1WNL A;  2RHI A;  1KHC A;  3NTH A;  4EDU A;  3CCJ A;  2VV5 A;  2RK1 A;  4B9X A;  2LX9 A;  3CCR T;  3M59 A;  4KBM B;  4A53 A;  1X6O A;  1ZBX A;  2QI2 A;  1YJ9 T;  4Z6Y A;  1I81 A;  1VIE A;  3LX7 A;  4QQG A;  2ZPG B;  5CAI A;  1YHQ T;  3RIR A;  1M5Q 1;  4C92 G;  5GAM g;  1VQL T;  1VQK T;  2YLC A;  2BS2 A;  4M77 E;  2DTO A;  4O6J A;  4QSH A;  2RD1 A;  5CO7 A;  1UGP B;  3TU4 K;  2RJC A;  4BDY A;  1WJS A;  2LT1 A;  3HKS A;  5AYF A;  3VYG A;  1K8A U;  2ZZD A;  1XTD A;  4HCC A;  2G3R A;  3SD4 A;  4M77 D;  4IUQ A;  2DD4 B;  3QO3 A;  1VQN A;  3LGL A;  2KQW A;  5CKE A;  4BE1 A;  5L8R E;  3V7S A;  3MET A;  2L5Q A;  2MF2 A;  3E1S A;  4J6W A;  1LOJ A;  1N9S A;  4LDV A;  1U8R A;  3CPW A;  4M75 G;  1LJO A;  3MEA A;  1Y96 B;  1AHJ B;  3SFM A;  1NE8 A;  2F69 A;  4RG2 A;  1YIT T;  3OYN A;  2CKK A;  3L2V A;  4FM4 B;  2YHT A;  3M9Q A;  2V8J A;  3RKW A;  4KUD K;  2E41 A;  4M78 A;  4M7D B;  2QA4 T;  3CC2 A;  4BI3 A;  2JNG A;  4AKH A;  1UB4 A;  4MZM A;  1MHN A;  2DD5 A;  2FVU A;  3OYI A;  3NTK A;  1Y7X A;  4M7D F;  1E7P A;  1KQ2 A;  4EMK C;  3MHX A;  4OGC A;  2DZ9 A;  4HL4 A;  1FXX A;  3FDR A;  4LDU A;  4XU2 A;  4KUL A;  4C92 B;  2XIC A;  3OQ5 A;  3OS1 A;  3L2W A;  4M7A G;  5DLQ E;  4C8Q G;  4LDW A;  1BI1 A;  2ZGW A;  4MML A;  3CC4 T;  3QBY A;  2HAX A;  3V8J A;  4F7U B;  4Y91 A;  2PVG B;  5GAN 5;  4ELY C;  4F7U F;  1KQ1 A;  2DXB B;  2KMG A;  4J6Y A;  5LJ5 j;  3MP1 A;  4JLG A;  3OYK A;  3GPL A;  1KG1 A;  3P8B B;  1H64 1;  1HK9 A;  3VKI A;  3QDR B;  2JUF A;  2MI6 A;  4IUU A;  4MDX A;  2M16 A;  3UPU A;  1QP3 A;  4BAC A;  1Y71 A;  2WSE E;  3LLR A;  4BY6 C;  2QEX A;  4NC6 A;  2O01 E;  2BS3 A;  3PGG A;  4JRK A;  3RUX A;  3CC7 A;  1KC8 U;  1XQH A;  2ZPE B;  3QYE A;  4DOV A;  1PSF A;  2GCX A;  3CCS A;  4PJO A;  2DIG A;  2OAU A;  4XTU A;  1RL2 A;  1G3Y A;  2JOY A;  3M54 A;  3G71 T;  2VC8 A;  2RI5 A;  3HFO A;  2K5I A;  2GF7 A;  2KMT A;  4MZT A;  2RI3 A;  3OYD A;  2BS4 A;  3WVD B;  2JTF A;  3DLM A;  1VQ5 A;  3JCM c;  3M58 A;  5LJ3 d;  4A4F A;  4F7U E;  4C5I A;  3OYF A;  5GAO m;  2X35 A;  3CCM A;  1VQP T;  5CKF A;  3H4C A;  4ZGJ B;  2F5T X;  4C8Q B;  1JJ2 A;  3E9F A;  2E1H A;  3CBP A;  1K8A C;  4X34 A;  4DA4 A;  3DL1 A;  4IUR A;  1WGS A;  3GF5 A;  3BY7 A;  2P4T A;  4HNV A;  3SWN B;  3JCM f;  5LJ5 e;  1YJN T;  2ZPB B;  3UWN A;  2LT4 A;  2MWP A;  2CZ7 B;  2KVQ G;  3M56 A;  3OB9 A;  3OS2 A;  3GLX A;  5LJ3 f;  1QW1 A;  2ZPH B;  4AKI A;  5KCO A;  2EJG A;  3L42 A;  3OYL A;  1KHI A;  4A4K A;  1VQ7 T;  3LWH A;  3CCL T;  5GAN 6;  2OTJ T;  1YIJ A;  2DIQ A;  2JTM A;  3CCQ T;  4C5G A;  1XNI A;  3RKY A;  2DXT A;  2PVD B;  4HLQ A;  5CK9 A;  4NL3 A;  1QVG A;  1KC8 C;  3VKG A;  3FLG A;  1M1K U;  5GAN g;  3I56 A;  2LCL A;  3HZJ A;  2EQK A;  3M5A A;  4V2S A;  4EMK B;  1KQS A;  5CIU A;  2X4J A;  4Q5W A;  1NZ9 A;  4BI8 B;  3A8O B;  5GMK h;  5C0M A;  2K3Y A;  2I2L A;  2OTL T;  1I4K 1;  1N9R A;  1U1T A;  1BKB A;  4M77 B;  3BDL A;  4LDX A;  2E12 A;  5LL6 S;  1LNX A;  3LW5 E;  3FIF A;  3ZEH A;  3I55 T;  4J83 A;  3MP6 A;  4M77 F;  3WXM B;  1FWZ A;  3PT9 A;  2PQW A;  5I2S A;  1YJ9 A;  3CXC A;  4RCB A;  5GAM d;  5KH6 A;  5HK3 A;  2XG8 D;  3C12 A;  1VQL A;  3V8L A;  2RJD A;  2DD4 A;  4X9C A;  3CBO A;  5EG2 A;  4JUV A;  1VQK A;  3CPW S;  4B9W A;  4M78 D;  2VGN A;  2ZPI B;  2E6N A;  1I8F A;  3RES A;  5M9O A;  2X4W A;  3VKH A;  3DKM A;  2KR6 A;  3JCM Q;  1Q7Y U;  3TW7 A;  2FB7 A;  1B34 B;  4M7D G;  1G3T A;  1Y96 A;  1QVF S;  3A5Z B;  2EQJ A;  3JB9 H;  1GXI E;  1YCY A;  4MFD A;  2JZ2 A;  3EAE A;  1UGR B;  2R58 A;  4CRI A;  4JX6 A;  2KSS A;  4J8O A;  4IUT A;  4PLI A;  4M7D A;  2LDM A;  2EAY A;  3CCE T;  3BG5 A;  4GY5 A;  3DB3 A;  4UC4 A;  3ZFJ A;  2V8I A;  5CQX A;  2XK0 A;  3OS5 A;  5GAN 4;  4HNT A;  2QQ8 A;  3RMQ A;  5CKD A;  4F7U G;  3H6Z A;  2YRV A;  3FJP A;  3S6W A;  3JCM h;  2RI2 A;  4C92 A;  1G5V A;  2CYZ B;  3CC2 T;  4L5G A;  4JX4 A;  2RM4 A;  3EFS A;  2DXC B;  3A8M B;  4BBR M;  4BBS M;  5LJ3 h;  2EKO A;  4O5V A;  3QZ9 B;  2WJ9 A;  2EFI A;  3HRU A;  3O8V A;  1ZHI A;  2QQS A;  5CQY A;  3OYG A;  3BG9 A;  2QA4 A;  2XD0 A;  3OYH A;  2YLB A;  1O75 A;  3BG3 A;  4XQ3 A;  4Z02 A;  4EMG A;  5KE3 A;  4M78 C;  2DXB A;  2BUD A;  2WSC E;  2K5F A;  3LH0 A;  1FKM A;  1YI2 T;  1VIF A;  3HRS A;  2CGH A;  4N0A A;  3QYB A;  2L3R A;  2LVM A;  3M53 A;  3QHS A;  3VU3 C;  4BB7 A;  3CC4 A;  3OYY A;  4BE0 A;  5KE2 A;  1KD1 U;  2EIF A;  3CMA T;  3F70 A;  1M1K C;  4MZP A;  3QZ5 B;  1QVF A;  4M75 A;  3PNW C;  3CCJ T;  3CEY A;  2NLU A;  3QXE B;  1G3S A;  3OW2 A;  1VQ8 T;  2E10 A;  1D3B B;  5FLX E;  2DK3 A;  3UDC A;  1NJI U;  3DB4 A;  4C5E A;  3G4S A;  3CME T;  4OB3 B;  4BI4 A;  5LJ5 d;  2IVW A;  2DZC A;  4NOY A;  1JJ2 S;  4XTY A;  4E7K A;  3TEE A;  4HT8 A;  4PKC C;  2P0P A;  1VQ9 A;  3RKX A;  1K9M U;  1X01 A;  4HCZ A;  3EFR A;  3H8Z A;  4M7A A;  3QUI A;  4C8Q A;  4YTL A;  3OYB A;  4XU3 A;  3JRZ A;  1Q86 U;  2R5M A;  3Q1J A;  3G71 A;  2V8K A;  5FRO A;  4PJO C;  1WQ7 A;  2PUO B;  3SWN A;  4FSX A;  2GQV A;  4L6V 5;  2E65 A;  3MP8 A;  1R8O B;  1OZ3 A;  4JDS A;  3JCM b;  1VQ6 T;  2HQE A;  4OB2 B;  4IUP A;  2Y4X A;  4RKU E;  5D6Y A;  4N4G A;  5LJ5 g;  5GAM h;  4E7I A;  3TW6 A;  1VQP A;  1QVG S;  5GMK l;  2A3L A;  3LWI A;  1M1F A;  1ZQ1 A;  1EIF A;  1Q81 U;  4XTV A;  1Q7Y C;  5GMK j;  3QSU A;  3WVE B;  2K2V A;  2HQX A;  4TVR A;  4X9D A;  5FU6 C;  2KAF A;  4OB1 B;  3MEU A;  1W2B A;  1KQS S;  1N8R U;  1YJN A;  2BIV A;  3ZBD A;  2M9U A;  1UGS B;  2KK4 A;  3QII A;  4JS4 A;  4NS5 A;  4M77 G;  2CZ0 B;  2C06 A;  2RHX A;  3HHT B;  3VUB A;  2VUB A;  1K73 U;  3CCL A;  2OTJ A;  4E7J A;  3FRN A;  3CCQ A;  5GAN d;  4HA8 A;  5FU7 C;  3L1A A;  4JRQ A;  4M77 A;  2K5L A;  3CXC S;  2O4X B;  1OYX A;  5IN1 A;  1S72 T;  2PUK B;  4II1 A;  2QDY B;  3VUZ A;  4HKE A;  3QJY A;  2LRQ A;  2XDP A;  4LD6 A;  4A54 A;  3KXT A;  2OTL A;  3GIB A;  1VQ4 T;  5GAN f;  3NTI A;  4DQ2 A;  4R55 A;  2KY9 A;  4QW2 A;  5GMK e;  2DXU A;  1WQW A;  5DM7 R;  3I55 A;  1VQO T;  1KD1 C;  4ELJ A;  3PIO A;  3OYE A;  3CCU T;  3JCM P;  5I21 A;  3HPW A;  3OYC A;  1B34 A;  4C92 D;  4MIM A;  2EQU A;  2R57 A;  1DJ7 B;  3QKJ A;  1OI1 A;  2X4Y A;  4HNU A;  3G6E A;  2P0K A;  1JBM A;  3OY9 A;  3HB9 A;  4FT4 A;  5LJ3 j;  2RHZ A;  1YJW T;  1NJI C;  3CD6 T;  4ELZ C;  3X26 B;  5GMK i;  4ZN1 A;  4E47 A;  5GAO r;  2E64 A;  2DPP B;  4M78 E;  1FX7 A;  3INZ A;  5CCA A;  4PL6 A;  5GAO q;  2QFZ A;  3L2U A;  3CCR A;  1M8V A;  2XI9 A;  5CKH A;  5HK0 A;  5HKC A;  3JB9 D;  2EWN A;  2XDD A;  4Y28 E;  3GOX A;  3JCM W;  1Q82 U;  4JJN K;  3JCM X;  1K9M C;  2VYT A;  3PIP A;  4PNO A;  4A4G A;  3HBL A;  1YHQ A;  1BI0 A;  4OVA A;  4BY6 B;  4J5Y A;  4XK8 E;  3CCV T;  4VUB A;  2QQB A;  3V7C A;  4M75 D;  3CCE A;  4E7H A;  2QF7 A;  2RHU A;  4ZGD B;  1VQM T;  3AHU A;  2K4Y A;  3G4S T;  4M7D C;  4J6X A;  2DTH A;  1WPY A;  4M7A E;  2FL7 A;  4N4I A;  1W4S A;  2BKD N;  3PFS A;  4OB0 B;  3A8H B;  4C5H A;  3V7R A;  1Y07 A;  3BW1 A;  3VV0 A;  3JB9 I;  3N5B B;  1YIJ T;  4OF1 A;  1Q81 C;  3OW2 S;  5GAM f;  4C92 C;  3JCM e;  4IKF A;  3VJP A;  4JRP A;  2CZ6 B;  3A8G B;  1BI3 A;  1NPR A;  3OYA A;  3I56 T;  1N8R C;  2D6F A;  1JRI A;  2PVO B;  5LJ3 e;  1BIB A;  3X24 B;  4M7A D;  4C8Q D;  2P0Q A;  1D3B A;  3ASK A;  5CR2 A;  2RK2 A;  1YI2 A;  5J39 A;  4PJO E;  3GP8 A;  2QQA A;  4XAX B;  3RER A;  4MFE A;  3HP9 A;  1YIT A;  5DLO A;  1K73 C;  4OP0 A;  2HNI A;  3E19 A;  3G7Z A;  4N0A C;  4EPC A;  3CMA A;  3PTA A;  1IZ6 A;  3MCA B;  2IG0 A;  2K57 A;  4GLK A;  4LDY A;  1G3W A;  3M4Y A;  3RMS A;  4A4E A;  4F7U A;  5GAM j;  4M6V A;  4JRI A;  3S3M A;  4ZTJ A;  4LOC A;  1VQ8 A;  3QYG B;  5GAN h;  4AKG A;  2D9T A;  4PJO D;  2B8A A;  4M75 C;  3J7A F;  2CZ1 B;  2HBP A;  2VXF A;  3QG1 A;  4XU1 A;  3KHI A;  4KT0 E;  3CME A;  3OMG A;  3OYM A;  3KBG A;  1M1G A;  2RJE A;  3L2Q A;  3JSC A;  2D0Q B;  5HY6 A;  3HO8 A;  4J7I A;  2M1H A;  2JN0 A;  1W2B S;  3GNG A;  3CBM A;  5DY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...