3X25B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 700 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x25B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x25B02
2ZZDB 2CZ0B 2WSEE 3QZ9B 2CYZB 4KT0E 5L8RE 2PVOB 2DPPB 3VYGB 1QP3A 2DXBB 3LW5E 2ZPIB 1AHJB 1UGSB 3WVDB 2O01E 2ZPEB 2ZPFB 3X24B 1IREB 4FM4B 4ZGJB 3QXEB 3HHTB 2DXBA 1JB0E 1DJ7B 1V29B 2DD4A 2ZZDA 3X28B 2WSFE 1UGQB 4RKUE 2ZPHB 2CZ1B 1GXIE 1PSFA 1QP2A 2PU9B 3WVEB 2DD5A 3X20B 4Y28E 2DD4B 3A8OB 4OB0B 3A8MB 3A8HB 3X25B 4OB3B 4OB1B 2QDYB 1PSEA 2CZ7B 3VYHB 3A8LB 2PUKB 4XK8E 4L6V5 2ZPBB 2ZPGB 4OB2B 2PUOB 2ZCFB 2CZ6B 2D0QB 2AHJB 1UGPB 3VYGA 4ZGDB 2PVDB 2PVGB 3QZ5B 1UGRB 2DXCA 2WSCE 2DXCB 3A8GB 3QYHB 3X26B 3QYGB 2DD5B 4ZGEB
chains in the Genus database with same CATH superfamily
2A08A 3JCMJ 3H0FA 2QG9B 2CUBA 1O9KB 4G6LB 4II1A 2QI2A 1NEBA 1JJ2P 4E7ZA 4J9BA 2A0FB 1YIJA 3JCMf 4MFEA 3G71T 1N8RR 2DO3A 4XTZA 4LUDA 1JXMA 1GCQA 5CQYA 4PFZA 5GAOp 4JRIA 3CC4T 2K3XA 3X24B 3G1JA 4JRQA 1UECA 1EZZB 5LJ5h 4F14A 1NEGA 3OBWA 1AD5A 4DQ2A 3S3MA 4ZNXA 1NJIU 4AMCA 5LJ3e 3V7SA 2DTIA 2DEUA 1K8AU 1N8RU 1VA7A 3RR6A 3OYNA 5GMKm 3KUFA 1H8KA 2A37A 2GQVA 4M7DF 2COZA 1YJWQ 1YHQQ 2FG0A 4FU6A 4NOYA 1D1AA 4JDSA 2RB6A 4KBMB 2K79A 2R5MA 3I55Q 2BPMB 3KXTA 1MV0B 4OB0B 4BE0A 4FW2A 1WXTA 1ENWA 2LQNA 4A53A 4ZN1A 3BG5A 3CCQT 4FYWB 2JVVA 4Y91A 2VXFA 2RHYA 1M3AA 2YUPA 4LUEA 3A5ZB 3ZFJA 3DOGB 5A0LA 3JCMc 2ATCB 2LJ1A 2HQHA 3MP6A 1CKBA 1UGPB 2EVRA 2XMFA 1O9SA 4C0DB 2OTLA 2JT4A 2DXCB 1W98B 2PTKA 2B86A 3OSSC 2IPOB 4Z88A 1VUBA 5DLQE 2DRMA 2E6ZA 2KDSA 2RHIA 2WSEE 2X3XD 2QTXA 4KT0E 3CCVA 2MOXA 2KROA 4A63B 1VQ7Q 2MYSA 1H27B 2DFUA 3UT1A 3VS5A 4M7DA 2LNVA 2CSQA 1GBRA 3VS1A 1W2BP 4HA8A 2FZGB 3LLRA 1M5Q1 2BUDA 4PFPA 1RAHB 3OYHA 2DTHA 2QF7A 3HHTB 1WLPB 1X2KA 1YNZA 3FLGA 1MNDA 1GUXA 4EMKB 4PJOE 1RI9A 3SHWA 1Q81R 2QAZA 2HCKA 3CBOA 2ZZDA 2LRQA 2QASA 2C5VB 3NTHA 2QGGA 4DA4A 3MIAB 4CFWB 3NTKA 3FIFA 3OQ5A 2DILA 4OGEA 2VGMA 2LQKA 5GAN6 4EMKC 1WX6A 1QP2A 3QIIA 4M7AE 1FMKA 1M90C 4X1VA 1K73C 4RTTA 2BIVA 1IGUA 2X9HA 1GUXB 4EMKA 3EH1A 1GCQC 3SDZA 3GP8A 2GFAA 1LOJA 3EHRA 1Y7XA 3JCMV 3CCJQ 3UWNA 2DRKA 1I07A 3M56A 3M0TA 2PZ1A 2AZVA 2FZKB 3TNHB 4MIMA 4BUGA 1MMAA 4M77G 4A4KA 3CC7T 5AYFA 1UUEA 2EQUA 2JTEA 4XU0A 4IUTA 4BDZA 1X75C 1VQ8T 2CH4W 4HVUA 4CRIA 4M75G 4AFZC 1W70A 2RQRA 4BD3A 1LVKA 1VQ4T 1C0MA 1RLQC 2EWNA 3SFMA 3OS0A 2KRNA 3OMGA 3E1SA 1KIKA 3MP8A 1F5QB 4OMPA 3H4CA 3CXCP 4BE2A 3G71A 1ZQ1A 2HKQB 2PMIB 1YCSB 3MHXA 1GY3B 4OMOA 1RACB 4CFUB 4BCND 4M7AA 4F6UB 1C9BA 1ZLMA 2OI3A 4BCQB 2WEVB 4AT1B 1NYGA 5GAOl 1M30A 3HRUA 3Q1JA 3CCRQ 2XDPA 2E3IA 1VQ6T 5I2SA 9ATCB 2MK5A 1BU1A 3CEYA 3LX7A 2EBPA 2YLBA 4KGZB 4QQ6A 1VQ4Q 1OPLA 2C5XB 3JCMb 3L2RA 1YWPA 1S72T 3CCLT 3VJPA 2MWOA 5LMKB 1JOWA 4Z89A 5LJ3d 2VV5A 2YUOA 2DD4B 3OW2P 2FRYA 5IF1B 3L2WA 3G6EQ 4CC7A 3QYEA 1QLBA 3HKSA 4EONB 2HDAA 2YUQA 1WHMA 3DTOA 3P8HA 3VYHB 3FB9A 1UTIA 2NUZA 1QKXA 1HSQA 3BG9A 2JMAA 1FX7A 1WHKA 3L2VA 4F6WB 3VU3C 3DDPB 4JJDA 1N5ZA 5LQFB 2ZPGB 1WJQA 4F6SB 2HNIA 4YOSA 1OZ3A 1H3HA 1H1PB 3DLMA 3EHQA 4WF2A 4RCBA 4QVDA 2ED0A 4OF1A 2PUOB 3BW1A 2HBWA 3OW2A 1EX4A 1QCFA 3QSUA 4CC3A 2AHJB 2E65A 3JCMW 4PJOG 3JB9G 1VYUA 1ZSGA 1SHFA 2PVDB 1PKSA 2L0AA 3CD6T 1LJOA 5KYNA 1KQSS 3A8GB 1B3QA 2NWMA 1VIEA 3BLRB 2ZAEA 4HCBA 2ZGWA 2CUDA 4FYYB 4DBFA 5IDNB 1R0CB 4J9CA 2EGAA 4ZTFA 2DA9A 3M53A 2P4RA 1Y57A 4FT2A 2OTJA 3J81E 2IVWA 4J7FA 1D1CA 2DXBB 1KK7A 2CREA 1J3TA 3CXCA 2FHDA 1QWEA 2EQIA 3CCMT 1VQ6Q 3WVDB 5KE3A 1XJWB 2E64A 3NGPA 1VINA 5C6SA 1KHCA 4L59A 1PWTA 1X6GA 4FYXB 4M77E 4ZGJB 1I5OB 5ECAA 4J8OA 2CJMB 2I40B 1WHJA 3EG0A 5FRNA 2RPNA 1UEBA 5D7UA 1JB0E 4AG1C 1DJ7B 1YITQ 2LP5A 3MY1B 2EIFA 2DD4A 5GAMe 1S72Q 1BCMA 2AIRB 3WXMB 1Y96A 1UGQB 1BI3A 2R57A 4RTUA 2JUFA 3CCST 4QSHA 1U1SA 3LWIA 3CC2Q 3KHIA 3CCVQ 3OA6A 3QPHA 2XD0A 3NHNA 1JXOA 3KBGA 4GY5A 1R0BG 4JJBA 3QG1A 3RIRA 3C0CA 2KNBB 2BTTA 2M02A 5CK9A 2DNUA 1W1FA 2HSEB 2XDDA 2LJ3A 1HD3A 4DOVA 2W2HA 3MY5B 3CPWS 2RK2A 2WIHB 2AZSA 3HBLA 2LCSA 2CDTA 3NTIA 3FJ5A 1O9KA 3GOXA 2L3RA 4RODA 5IN1A 2XI9A 3OS2A 1NLOC 3EGXB 3CCUT 1K73U 1QVPA 1TOVA 3EG3A 3O5ZA 1XOVA 3OMCA 1W2BA 2P0KA 1GL5A 4UC4A 1UGRB 4AKIA 1PNJA 1GFDA 1YJNA 2HEQA 3SEMA 4BE1A 3QYGB 2DETA 4BCFB 1RAIB 2OTJT 1VQ8A 4BCQD 2KI7A 3DB4A 3O0GD 4EMGA 5EFQB 1AD6A 1W4SA 4JZ4A 5LJ5g 2E4HA 4PJNA 2FPDA 2VXEA 1QCOA 4JS4A 1QVGS 4HVWA 1AWOA 5CQXA 4C8QE 2EYWA 4BI3A 4ELYC 4OP0A 3S6WA 2KEAA 4QT7A 2RQWA 4IKFA 4O6JA 1D3UB 1VYVA 4EPCA 2FL7A 3F5XB 3EFSA 2P84A 1JQQA 3EG2A 4LXCA 2F1LA 3OYGA 2DVJA 3JB9I 3V8LA 3BY7A 4CC4B 1WDXA 2KMTA 4BCOB 1R77A 3L42A 3QJYA 5CVIA 2ZPHB 1BU2A 3NDQA 4LOCA 1PKDB 1QVFS 4XTUA 5C0MA 4EOJB 1UHCA 3A8OB 1SSHA 1ZUKA 3QDRB 1X69A 4M7DG 1SSFA 4QQDA 3RKWA 5KCOA 2AKKA 4AG2C 2HQXA 4HXJA 4NL2A 3CMEQ 3CD6Q 2RI5A 2RM4A 3VS2A 3META 5GAN7 3EFRA 4R55A 2RN8A 2CP0A 2CKKA 5GAN5 1QVFA 2HZYA 2RHXA 3QBYA 2O2OA 1KJWA 1KSWA 4HNTA 3LH5A 4C92B 4QQGA 3SWNC 2ROTA 4EORB 6AT1B 2M9UA 4EOMB 3JCMX 2CZ6B 5FW9A 1Q82C 2MIOA 3MKDA 4MDXA 5FWCA 4CFUD 5IH2A 4B9WA 3HSBA 2IG0A 3BHVB 2GTJA 2MMPA 4FCYA 2P4TA 4J83A 1F1BB 2DD5B 1QW1A 3THKA 1M90U 4IMYB 4M75F 5IAYA 3JB9J 4N4HA 1Q86U 4BCGB 3L1AA 4XU2A 2X4WA 1JBMA 3CCMA 3EGDB 3SWNB 1PHTA 1H1SB 3E9GA 1U8RA 2KAFA 3OS1A 4QVZA 2E3HA 1UE9A 1M2OA 3GTMS 1VQ5Q 2QXFA 2F2XA 1VQNA 3LQ5B 3N5BB 2XHCA 3VRZA 2DJQA 4EOIB 2JJ9A 1IHWA 3BDLA 2ZPEB 4BY7X 1GH6B 3MP1A 4RG2A 4PJOA 2ABLA 2IIMA 5IDPB 2KMGA 2FZCB 1TTHB 5GAOr 2NUPB 4C0DC 2V26A 2OAUA 2DXBA 3CCRA 2K6DA 1RAFB 2L3QA 4V2SA 1VQOT 4Q5WA 2KT1A 2X4JA 4M77F 1M3BA 1B34B 3X28B 1Q95G 3M03A 1G8XA 2SEMA 1M1KC 1OGUB 2C4GB 1XQHA 3OYAA 3UA7A 4JRKA 1EIFA 1HXDA 4RG8A 3OYEA 1EFNA 1LNXA 2J06A 5CKEA 1Q82R 1VQ5T 2XICA 3I55T 3CCUQ 3C4SA 3GNGA 2LZ6B 4DBQA 2IN3A 2JXBA 4X9CA 2HD0A 4HCZA 4C8QG 5KYYB 1Y71A 1WHGA 2I0NA 1PRMC 2DL8A 1QMCA 4I3ZB 2QYZA 4PNOA 4IUVA 3I35A 2JS2A 4NSTB 1TU0B 1Y0MA 2E6NA 1OU8A 2D0QB 5IHYA 1AWJA 1VQKA 5J3BA 2PVGB 4M7AB 3P8DA 2DXCA 2DYBA 2DF6A 2X51A 2RHUA 3X26B 2UZEB 4A4FA 2HL5C 1OU9A 2BZYA 4ZN3A 4C92D 1N9SA 3MEUA 2DL4A 1YI2A 3BLHB 1K9MR 3M58A 4RCCA 4L5GA 1Y07A 1WXUA 5AT1B 2V22B 3CPWP 2DPPB 1XNIA 2JTFA 1Q7YR 2CCIB 1JSTB 2E70A 4BY6B 1YI2Q 3I56Q 2NUPA 1OQKA 4M7AG 5GJWB 4FT4A 1B07A 3CCQQ 2VYTA 2LX7A 3IQLA 1T3SA 5HBJB 1WNLA 1HYOA 3CMET 4PFOA 4J6WA 2J6KA 1E6HA 1KC8R 4A4HA 2FVUA 3HRTA 2LMJA 3HO8A 3V8JA 4YOZA 5GAOq 2EGEA 2CZ1B 2KE9A 2K57A 1H641 5A0DA 3HRSA 2L5QA 3CCET 5FLXE 2CP3A 1KD1C 2G77A 3RGFB 2P0QA 3QWXX 2PNIA 2K5LA 2QQ8A 1BI1A 3G4ST 2CP2A 1Q7YU 4C92G 7AT1B 2NLUA 1LCKA 4EOLB 2WPAB 2CP7A 4ESRA 4CI0C 4M75A 4A4EA 5DLOA 4E2FB 3VUZA 4RUGA 5HKCA 4DBRA 2RF0A 1IRXA 1KQSP 1KC8U 4KUIA 2HAXA 2KBTA 3MPUB 1U1TA 2L3SA 2LVMA 2B9RA 2RD1A 1PC0A 4M7AC 2HMAA 1YIJT 5GAN8 1KXUA 2M0OA 2YUNA 3JCMP 4GLMA 1MNEA 4JS5A 2CYZB 2IW8B 1VQOQ 4D8KA 1VYTA 4RTVA 4KH1B 2C5NB 4M75B 2RNAA 3I5RA 2DEQA 4E7KA 4XU3A 2RHZA 2D9TA 3QUIA 2ECZA 4IIMA 2DAQA 1KFZA 1G3TA 1I0CA 4MFDA 1N8RC 3CCVT 4KH0B 2O01E 1P5EB 1BIBA 1WXBA 3CBMA 1ACMB 2YT6A 5FRMA 2RA2A 2IW6B 4TTHA 2COYA 4LN2A 3UF4A 1QVGP 2KR3A 1KD1R 1WIEA 2K2VA 4FL6A 4F16A 4GLKA 2W0ZA 3ZL7C 2P0PA 4JZ3A 4OMQA 3TNWB 4J9HA 3H6ZA 4CFXB 5GANe 1SRMA 3TREA 2JN0A 5FROA 1VQ7T 8ATCB 5A2QE 1NJIC 2VASA 4BCJB 3QYBA 3M55A 4Z8AA 2FRWA 3V7CA 4E7JA 3CCEQ 1MV3A 4ME7A 1GXIE 2MAMA 2AK5A 4XU1A 1K8AR 4Z6YA 4XQ3A 3EGXA 4M77B 1VQLA 3M0UA 5I21A 2KSSA 3NPFA 1OIUB 4M78F 1TUCA 1QQJA 2WJ9A 2LDMA 1MMGA 1WJSA 4M77C 1WPYA 4PJMA 4PJOB 5CKBA 4R56A 4C5IA 1FYNA 2DERA 3A1PA 5LJ3f 1M2VA 4WTOB 2G9XB 3M5AA 3CCRT 1G3SA 2VKNA 4JJNK 1K9MC 2MWPA 3O8VA 4ANJA 2ZCFB 4OGRB 4JX6A 5CIUA 1D0ZA 2GNCA 5KH6A 1N9RA 2C0IA 1C6VX 4C8QD 4OMLA 1YWOA 5CEIB 3GF5A 2BS3A 2R5AA 3BDUA 1OX9A 1P92A 3FEOA 2K3BA 1I81A 1VQNQ 1RL2A 4RMOA 2UUEB 1OIYB 5GJVB 3G7ZA 1M90R 2E10A 2VB6A 2PVOB 3CBPA 3R6OA 1BKBA 4LDVA 4M75C 4PL6A 2RH2A 3TEEA 2MPXC 3EH2A 1GCPA 1Q86R 1JU5C 1BB9A 3JCMg 1PD1A 2DKGA 2ROLA 3PO3S 2HKNA 2K9GA 1TFBA 1H24B 1YBYA 1MMDA 2LQ8A 2QA4Q 3PTAA 1IREB 1H25B 2W99A 2H8HA 1YJNT 4F7SB 4PLLA 1ABQA 5LJ3g 2XG8D 3PVQA 2H3JA 1UNLD 2LC4A 4M75D 3GBQA 2I53A 3G4SQ 1YJ9A 5A0GA 4BCMB 4BCIB 4E47A 2JM8A 4C0GA 4C5EA 4HL4A 1BI0A 5J39A 1B34A 1VQPQ 5CKHA 1BBZA 1TWBA 5KYXA 1VQ9T 4ATOA 3AHUA 5HY6A 2E5QA 3MEAA 4FYVB 2DL3A 3RERA 3CCSQ 4J6XA 3REBB 2OTLT 3E9FA 2F5KA 2QTVA 1AOJA 1JJ2S 3TCJA 2WXVB 1IO6A 1WJRA 1AZEA 3PVLA 2QDYB 3SB2A 2XDBA 1VQ5A 1PSEA 4D8DA 4CXAB 2CZ7B 4BCHB 1IZ6A 2JOYA 3OYFA 1K9MU 3UPUA 2DZ9A 4KRDB 1T3LA 4L6V5 3FC3A 1XO2A 1TH7A 4C92E 1IGQA 5FWBA 3CCLQ 5M9OA 3P8BB 5DY9A 3QWYA 3JCMd 2BZ8A 2V8KA 1VQPT 3VYGA 4CC2A 4F7UB 2JM9A 2QEXA 3QHWB 2CGHA 2KR6A 3DL1A 2HSPA 5GMKh 2DK3A 2WIPB 1VQPA 1AWWA 3TQ7P 4ZGEB 1GRIA 2QK0A 5D6WA 3U23A 3ASKA 3EAEA 3L2QA 2FEIA 2OTJQ 2EYZA 2J6FA 4QVCA 2DBKA 4DEYA 1U06A 5HVYB 3TU4K 5DQWA 4M78C 2A3LA 4M7DE 4J5YA 4DOWA 4ELLA 3HP9A 1GBQA 2EQJA 2YXYA 3OW2S 2RJFA 1X6BA 3M9QA 2YDLA 4M78A 2K3YA 2L3PA 2FB7A 1Z9ZA 3CMAA 3AT1B 1GFCA 4EC9B 4M7DB 4EC8B 3TSZA 5CYIB 3SD4A 1RADB 2EFIA 3CCEA 1Q81C 1WHHA 4CFMB 3LWHA 1M8VA 1SF9A 1Q7YC 2VC8A 1IB8A 2GBQA 3EGDA 4FX3B 4R0KA 1G3YA 4MMKA 2VVKA 1YITA 5LJ3h 4J9IA 4KGXB 1V76A 1X2QA 1PG5B 5CAIA 1AWXA 4M7DD 4HLQA 1OV3A 3S3NA 3EGUA 1K4US 2NYSA 4C8QA 4HNUA 3GLXA 1UDLA 1G83A 4M75E 2LJ0A 1K73R 1VQ6A 1QKWA 3BG3A 1SRLA 1V1CA 3BLQB 1HJDA 1K9AA 1FMWA 3I5SA 4M78B 3CC2A 2DIGA 2YWWA 4F70B 4EDUA 1UHFA 3JB9H 1ZA1B 4M7AD 2HL3A 1UNGD 3ZBDA 1AVZC 2F2VA 3E2UA 2O9SA 1S72A 1NZ9A 1CSKA 3I56A 2EYQA 2KQWA 3QWLA 4E7HA 2V8JA 5LL6S 1RAAB 2RK1A 1JEGA 3V7RA 4RTYA 2KXCA 3EIDB 2KXDA 4F7UE 1FVVB 2PK9B 3EG1A 3EG9A 3PIPA 1UJYA 4BB7A 1UGVA 2PK2A 5GAMf 2E5KA 3M57A 3QYHB 3VUBA 5GAMd 3H8ZA 1ZSZB 1NPRA 1Z9QA 2IW9B 1X43A 2LNHB 1ZUUA 4PJOC 2BKZB 2E1HA 2EJ9A 4RTWA 5J26A 3CC7Q 1I1JA 5L2WB 2FPEA 1C1AA 5EC7A 5IXFA 2X1NB 3H0HA 5CO7A 1UNHD 1H92A 4X34A 1QP3A 3LYIA 2UZLB 4IIOA 2A36A 1D0YA 2ZPIB 3RKXA 3CMAT 2X3WD 1M4ZA 3OYIA 4XTWA 5L23A 3VRYA 3LGLA 4CFNB 2DXUA 5GAMh 3QXEB 2DL5A 4BI4A 5KYUA 4BI8B 4Y72B 4II5B 4MMLA 1PRLC 1NYFA 4PJJA 4AKHA 1V29B 2QQ9A 3G33B 4YTLA 3PNWC 2RJDA 2R58A 5IHNA 1FWZA 2VUBA 3PMTA 4IUUA 2W96A 2C06A 1ZP2A 2O4XB 1NBEB 5KYWA 2JMCA 2QQAA 2V8IA 5D6XA 1MGQA 3PFSA 3CMAQ 1I5LA 4M78E 1ZBXA 2IVXA 5IHIA 1RABB 3OYDA 2M0YA 3CC4Q 1A0NB 4EOQB 1M2VB 1WQ7A 1K8AC 1BCOA 2Y4XA 1RAGB 3OS5A 2C0TA 4ELZC 2EYYA 1U3OA 3OYCA 3MEWA 2J6OA 2VGNA 2RI3A 2FYKA 3JAME 1ZSZA 2W9ZA 1OKVB 4M6VA 1UG1A 3RBBB 3CXCS 2MF2A 3PIOA 4M78D 3DDQB 3REAB 4C8QC 5GANd 5DQVA 2XU8A 2C0OA 2MCNA 2CT3A 2F2WA 3QO3A 4ROCA 2ZZDB 2CZ0B 1OYXA 3EFOA 3C95A 2GF7A 3OYMA 2JS0A 2I2LA 4EIKA 2EUFA 4OMMA 1H4LD 4PKCC 4FIBA 4N4IA 3G71Q 2JNGA 1YJ9T 1YFNA 4E6RA 4CRLB 3BFMA 5IXBA 5HQ0B 3TW6A 3LW5E 1BYMA 2YHTA 2FPFA 1O75A 1TS9A 4BY1X 2Z0WA 2ZPFB 1RUWA 5GANh 1X01A 5GMKe 3L2ZA 4A54A 3UDCA 4GBQA 3FRNA 4C8QB 3C94A 2COWA 3CC7A 5EG2A 2X35A 1ARKA 4HNVA 3DLLA 1RI0A 3GIBA 4A4GA 2M16A 2WSFE 5KYWB 1PCXA 2LX9A 1FXXA 2G6FX 1E9HB 2DL7A 2DYIA 1N6AA 3VKIA 4LE9A 1QWFA 1D3BA 3WVEB 2RQVA 2DD5A 4N0AA 4NS5A 1OZ2A 3M59A 2DIQA 3OYYA 4FW1A 1YJ9Q 2YSQA 1TD6A 3D7SB 5CKFA 3X25B 3M0RA 2DTOA 2EJFA 3S3OA 4LD6A 3ZEHA 4OMNA 3I56T 3PT9A 1WI7A 4HVVA 1VQ7A 2YRVA 3M0QA 3ME9A 4C0ZA 3TVTA 3MJXA 3CCLA 4EOOB 2Y4YA 2EQKA 4MZMA 2X4XA 4M7AF 4XAXB 1TG0A 3M4YA 2HBPA 4JX5A 3QDFA 1I4K1 1OULA 3H0IA 1G5VA 4BACA 5HK0A 4ZGDB 2WACA 1D3BB 3PE0A 1WYXA 5HK3A 1YP5A 5LJ5f 2QA4T 3OSVA 5ACBA 3CQTA 3VS4A 3BHTB 3OBYA 4J9FA 1WHLA 1SHGA 2DMEA 3VKHA 3DJBA 5LJ5j 1YIJQ 3CCSA 2RQUA 2ENMA 3GPLA 4ORZA 3JCMh 2K5IA 1Q81U 4HKEA 1G2BA 5L8RE 4PLIA 1KQ2A 3CCJA 4BBRM 4BXXX 4RTZA 3CCJT 2CS7A 2LTOA 4QKUA 1T0JA 2AT1B 3POMA 5GAN2 1M27C 1URCB 1ZSZC 2OTLQ 5GAOn 4J9GA 4PK4A 1OI1A 3I55A 4EOPB 1UB4A 2QA4A 4C5GA 5EJCA 4BDYA 4AFUC 3EJ1B 1JSUB 3INZA 1QVGA 2MI6A 2EKOA 2EAYA 1G3NC 5LJ5e 4RTXA 1PKTA 2LT4A 4RKUE 1KD1U 1OKWB 4AFQC 2WMAB 4KGVB 1VQOA 3OB9A 1K0XA 2PU9B 4F7UA 2OJ2A 3B57A 4Y28E 2CCHB 2PJQA 4NL3A 2E41A 2XIDA 3A8MB 2EGCA 5GAN3 1OX8A 4IUPA 4P5NA 4OVAA 1G3WA 1MMNA 1IHVA 2XK0A 2F5TX 2W9FA 1WFWA 3HTRA 1NPPA 1ZUYA 4E7SA 3K7AM 1AZGB 1M1GA 3VS3A 2BE9B 3GNFB 1YJWA 1YHQA 2QQSA 1TSFA 5LJ3j 1BIAA 2O4XA 4K11A 3JCMe 1VQ8Q 2DJZA 4IURA 3VS6A 1M3CA 5HCKA 4MZPA 1JKWA 1FMVA 1YN8A 2OX7A 2LT1A 4OR5B 3HFOA 2JTMA 1NG2A 2SRCA 3CC4A 4F7LB 1OEBA 2K2MA 5CKDA 3JB9F 1D09B 4JUVA 4N0AC 2BE7D 2QEXT 3FJPA 1T0HA 1OPKA 2L89A 2J05A 1TUDA 2R7GA 2KYMA 1U5SA 3JB9D 5IT9E 4AKGA 1VQLQ 4DBHA 1JO8A 2RO0A 3VYGB 3C12A 4BCPB 2NUTB 2J7IA 3CMEA 3BE3A 1RLPC 1SG5A 3A98A 3DKMA 1VQKT 2CT4A 4BBSM 4LDXA 5HBHB 1XTDA 1X6OA 5D6YA 3PMIA 2D8HA 1B7TA 4FM4B 4LNPA 3T9NA 5KYYA 1SKUB 2QGSA 1OI9B 2RI2A 2K4YA 2NUTA 3DB3A 4JLGA 2DLPA 2DE0X 3RUXA 3HFNA 1VYWB 4C8QF 1CKAA 1VQMA 5IHKA 1OL2B 4HT8A 1ZHIA 2KT8A 2LW4A 3LGFA 4EOKB 2DX1A 1MHNA 2DMOA 1KHIA 4C92C 4EMHA 3H9NA 1PD0A 2F2CA 5ICPB 3X20B 1FKMA 4BCNB 2JGZB 2D8JA 2X4YA 3EG9B 1N27A 3MO8A 1VQ4A 1UFFA 4LDWA 3OYJA 1ZBJA 4MZTA 5FU7B 4PJOD 4J7IA 4B6MA 4C92A 1AEYA 2A7YA 1Q86C 2QDLA 2Y90A 8AT1B 1VQKQ 4FSXA 2LQWA 3H41A 5KE2A 3VS7A 4OMFB 2C6TB 2DZCA 2KYBA 3E19A 4C5HA 1Q82U 2CP6A 2RMOA 5DM7R 1QLYA 3J7AF 1ZA2B 3ER0A 2K5FA 4AFSC 1KQ1A 2GTOA 5BNJB 5FU7C 1WGSA 2E12A 5GANf 5KYXB 1NM7A 1AISB 4M77A 2ESWA 2EYXA 2DXTA 3EOCB 1VQLT 3VV0A 1VQ9Q 4KRTA 4D6WA 4TVRA 3HB9A 2W10A 3M4GA 3VS0A 4KRCB 2WFYB 1ABOA 3BHUB 5KYUB 2GCXA 2M51A 2LCLA 5GANg 2XKOC 3NMZC 3TN8B 3JCMQ 4OGCA 1TXQA 2QDJA 3TNIB 3RNJA 1K0SA 1D0XA 4XTYA 3CPWA 1QCNA 1JJ2A 1AHJB 5FGKB 4JRPA 4F04B 5HNBB 2DM1A 5GAN4 3G6EA 3QKJA 2WHBB 3L2UA 1OL1B 3QHSA 2F69A 2KRSA 1K76A 1PM3A 4YC3B 4O5VA 1N4MA 3CCUA 1VQNT 3RKYA 2PHGA 4F17A 1R8OB 4J6YA 4X9DA 4B9XA 4F7JB 1NJIR 3UATA 1WZOA 3OYBA 2D0NA 2DVEA 1KC8C 2RQTA 4JLIA 1VOLA 5LJ5d 4XTXA 5CR2A 3LH0A 4XTVA 1PSFA 4WCIA 3SWNA 1TUGB 4NC6A 3M0SA 4EOSB 2UZBB 4HT9A 3URGA 2GFUA 4F7UG 3M0PA 1SPKA 3ULRB 4N4GA 2CP5A 2WMBB 1HK9A 2A28A 2GQIA 3JRZA 1K1ZA 2QQBA 3QJ6A 1FINB 1H3ZA 3HL8A 5KCHA 4OB3B 3J80E 1H1RB 1MUZA 3VKGA 2QEXQ 4ELJA 5CCAA 4KUDK 3V8KA 2YRCA 3TW7A 2C5OB 1VOMA 4UN0A 2D1XA 5GMKj 2H3EB 1VQMQ 4Z02A 4LDYA 1H28B 3KFVA 2V1RA 3RDVA 3MCAB 4PJOF 3RMQA 2KY9A 4F7UF 4OB2B 5GANj 2KRMA 1WA7A 3PGGA 4J9EA 1QVFP 1VIFA 2AKLA 4LD9K 5I5ZB 4JJCA 3I9QA 2K7AA 3G6ET 4C92F 1M1KR 1KQSA 3CD6A 3QZ5B 2O31A 1M8MA 3F70A 2WSCE 2VWFA 3MI9B 2DBMA 4DEXA 4JPBW 2QGFB 3RESA 4C0FA 1OOTA 4IUQA 4E7LA 3MEVA 1Y96B 3QZ9B 2D6FA 1BI2A 5GAMg 1IXDA 4CFVB 2RJEA 2QQRA 5I2MA 2EKHA 2CH4A 4FSSA 2BS4A 2BZXA 4BCMD 4BY6C 2JZ2A 2OAWA 3CCQA 4M4ZA 1UGSB 1BK2A 3G4SA 2GGRA 2G3RA 1RAEB 2M1HA 4QW2A 2CSIA 3RMSA 4M78G 3M54A 3NFCA 3OYLA 4AI6A 2KK4A 2B8AA 3UA6A 4ROEA 2YLCA 4HCCA 1H26B 1UJ0A 1M1FA 1M1KU 3CPFA 3FDRA 2EQMA 3EFOB 1E7PA 5FU6C 1NE8A 1AT1B 1ZX6A 4LDUA 3QHRB 2KVQG 1S1NA 3HZJA 2EJGA 2PQWA 2UZDB 2L8DA 3TSWA 4Y92A 3CCMQ 4BCKB 2FO0A 5I22A 1YHQT 2HQEA 4M77D 1YJWT 1QMZB 4PJLA 1H1QB 1W2BS 4ZTJA 1JRIA 1D1BA 4HCKA 3A8HB 4MDWA 2LCCA 2EW3A 4OB1B 2BS2A 1VQMT 2ED1A 1YITT 1W6XA 3R6NA 3A8LB 2PUKB 2V1QA 2YRDA 2BKDN 4M7DC 1KG1A 2RJCA 2KGTA 1YCYA 5GAOm 4XK8E 5GAMj 2ZPBB 3JSCA 3HPWA 2JW4A 5HBEB 1WQWA 4F7NB 4VUBA 1VQ9A 3CC2T 5FU6B 1YI2T 1E6GA 4J9DA 3JV3A 4KULA 5GMKl 5I11A 4E7IA 3OY9A 1I8FA 1M9SA 4YOOA 1E7OA 2O88A 1LPLA 1NLPC 3OYKA 2L2PA 5GMKi 1X27A 4JX4A 1SEMA 2QFZA 2EPDA 2O9VA 1YJNQ
chains in the Genus database with same CATH topology
5LJ5j 2OTJT 1VQ8A 3CCSA 1I81A 3JCMJ 1RL2A 3DB4A 4EMGA 4RMOA 3GPLA 3JCMh 4II1A 1W4SA 2QI2A 5LJ5g 2K5IA 1Q81U 4HKEA 3G7ZA 5L8RE 2E10A 2VXEA 4PLIA 4JS4A 2PVOB 3CBPA 4BBRM 1BKBA 3R6OA 4LDVA 4M75C 2RH2A 4PL6A 3TEEA 3CCJA 3CCJT 1QVGS 2CS7A 2LTOA 5CQXA 4C8QE 4BI3A 1YIJA 3JCMf 4ELYC 4OP0A 4MFEA 3G71T 3S6WA 3JCMg 2DO3A 2DKGA 4XTZA 5GAN2 5CQYA 5GAOp 4IKFA 4O6JA 1YBYA 4JRIA 3CC4T 2LQ8A 2K3XA 3X24B 5GAOn 3PTAA 4JRQA 1OI1A 4EPCA 1IREB 3I55A 2FL7A 3EFSA 1YJNT 1UB4A 5LJ5h 2QA4A 4PLLA 4C5GA 5LJ3g 2XG8D 3OBWA 5EJCA 4DQ2A 4BDYA 3S3MA 2H3JA 2LC4A 4M75D 3INZA 1NJIU 3OYGA 5LJ3e 3JB9I 2MI6A 2EKOA 1QVGA 3V8LA 2EAYA 1YJ9A 3BY7A 3V7SA 2DTIA 5A0GA 2KMTA 1K8AU 5LJ5e 4E47A 1N8RU 3L42A 3QJYA 2LT4A 3OYNA 4C0GA 4C5EA 4HL4A 1BI0A 5J39A 1B34A 5CVIA 3KUFA 5CKHA 4RKUE 5GMKm 1VQ9T 2GQVA 1KD1U 2ZPHB 4ATOA 4M7DF 4FU6A 4NOYA 3AHUA 5HY6A 2E5QA 3MEAA 4LOCA 1QVFS 4JDSA 2RB6A 4KBMB 3OB9A 4XTUA 2PU9B 4F7UA 2R5MA 5C0MA 1VQOA 3RERA 3KXTA 4J6XA 4Y28E 2OTLT 3E9FA 3A8OB 2F5KA 3QDRB 4M7DG 4OB0B 4NL3A 2E41A 2XIDA 3A8MB 1SSFA 4QQDA 3RKWA 5KCOA 5GAN3 1JJ2S 4IUPA 4BE0A 3TCJA 4P5NA 4OVAA 1G3WA 1WJRA 2HQXA 2XK0A 2F5TX 4NL2A 2QDYB 3SB2A 4A53A 4ZN1A 1VQ5A 2XDBA 1PSEA 2RI5A 2RM4A 3BG5A 2CZ7B 1NPPA 3EFRA 3META 5GAN7 1IZ6A 2JOYA 4R55A 3CCQT 3OYFA 1M1GA 2CKKA 3GNFB 1YJWA 1YHQA 1K9MU 5GAN5 2QQSA 2JVVA 3UPUA 1QVFA 2DZ9A 1BIAA 5LJ3j 2O4XA 2RHXA 3QBYA 4L6V5 4Y91A 2VXFA 1TH7A 2RHYA 3FC3A 4C92E 3JCMe 2DJZA 4HNTA 4IURA 5M9OA 3P8BB 4QQGA 4C92B 3A5ZB 3SWNC 3ZFJA 5DY9A 4MZPA 5A0LA 3JCMc 3JCMd 2M9UA 2LT1A 3HFOA 2JTMA 3JCMX 2CZ6B 3CC4A 3MP6A 2V8KA 1Q82C 5CKDA 1UGPB 1VQPT 3VYGA 4MDXA 3JB9F 4F7UB 1O9SA 4JUVA 4B9WA 4C0DB 2QEXA 3HSBA 4N0AC 2IG0A 2CGHA 2KR6A 2OTLA 3DL1A 2QEXT 2DXCB 5GMKh 2MMPA 3FJPA 3OSSC 2P4TA 4J83A 1VQPA 2DD5B 1QW1A 1M90U 1VUBA 4ZGEB 4M75F 5IAYA 2L89A 4N4HA 2E6ZA 5D6WA 2KDSA 2RHIA 3ASKA 5DLQE 3JB9J 3L1AA 4XU2A 3JCMW 2WSEE 1Q86U 2X4WA 1JBMA 2QTXA 3JB9D 5IT9E 3EAEA 4AKGA 4KT0E 3CCVA 3SWNB 3L2QA 3CCMA 3E9GA 1U8RA 2KAFA 2RO0A 3OS1A 4QVCA 3UT1A 4QVZA 4M7DA 2LNVA 3VYGB 3C12A 2QXFA 1VQNA 3N5BB 2XHCA 3CMEA 3TU4K 4M78C 4HA8A 3BDLA 2A3LA 3LLRA 2ZPEB 3DKMA 1VQKT 3MP1A 4RG2A 4BBSM 4LDXA 4M7DE 4PJOA 4J5YA 1XTDA 1X6OA 1M5Q1 5D6YA 4DOWA 3HP9A 2EQJA 2BUDA 3PMIA 3OW2S 2RJFA 4FM4B 2KMGA 3M9QA 4M78A 3T9NA 2K3YA 5GAOr 2FB7A 3OYHA 2DTHA 2QF7A 4C0DC 3CMAA 3HHTB 2OAUA 4M7DB 2DXBA 3CCRA 3SD4A 2EFIA 3CCEA 1Q81C 4V2SA 3FLGA 1VQOT 4Q5WA 2RI2A 3LWHA 2K4YA 4EMKB 1M8VA 4PJOE 3DB3A 1Q7YC 2X4JA 4JLGA 4M77F 2VC8A 1B34B 3CBOA 3HFNA 3RUXA 3X28B 2LRQA 2ZZDA 1G3YA 4MMKA 4C8QF 3NTHA 4DA4A 1YITA 5LJ3h 3NTKA 1M1KC 3FIFA 3OQ5A 1VQMA 4OGEA 2VGMA 2LQKA 1XQHA 5GAN6 4EMKC 5CAIA 3OYAA 4HT8A 4M7DD 4HLQA 1QP2A 1ZHIA 3QIIA 4JRKA 1EIFA 3S3NA 3LGFA 4M7AE 1HXDA 1MHNA 4RG8A 1KHIA 4C8QA 4C92C 4HNUA 4EMHA 3OYEA 1M90C 1K73C 3X20B 1FKMA 2X4YA 1LNXA 1N27A 5CKEA 2BIVA 3MO8A 1VQ4A 3GLXA 4LDWA 1VQ5T 3OYJA 2XICA 4M75E 3I55T 4EMKA 1VQ6A 4MZTA 3C4SA 3BG3A 3GNGA 5FU7B 4PJOD 4J7IA 3SDZA 4C92A 3GP8A 2A7YA 1LOJA 2GFAA 4X9CA 1Q86C 2HD0A 4HCZA 1Y7XA 3JCMV 4M78B 2Y90A 4C8QG 3UWNA 2DIGA 3CC2A 1Y71A 3M56A 4FSXA 4EDUA 3JB9H 5KE2A 4MIMA 4OMFB 4PNOA 4BUGA 4IUVA 4M7AD 2DZCA 4M77G 3ZBDA 4A4KA 3CC7T 5AYFA 2EQUA 1S72A 1NZ9A 3E19A 4C5HA 3I56A 1Q82U 2EYQA 4XU0A 2KQWA 3QWLA 5DM7R 4E7HA 4IUTA 2V8JA 2E6NA 5LL6S 1X75C 4BDZA 3J7AF 1VQ8T 2RK1A 3ER0A 2K5FA 3V7RA 1KQ1A 2D0QB 5FU7C 1WGSA 2E12A 4CRIA 4M75G 4F7UE 1VQKA 5GANf 3PIPA 5J3BA 4BD3A 4M77A 2PVGB 4M7AB 4BB7A 3P8DA 1VQ4T 2EWNA 2DXCA 3SFMA 5GAMf 3OS0A 2RHUA 3M57A 2DXTA 3QYHB 3X26B 3VUBA 5GAMd 3H8ZA 1VQLT 3OMGA 3VV0A 4A4FA 3E1SA 4D6WA 1NPRA 4TVRA 3HB9A 3MP8A 4C92D 4ZN3A 1N9SA 3MEUA 3H4CA 3M4GA 4PJOC 1YI2A 2E1HA 3M58A 4RCCA 4L5GA 2EJ9A 5J26A 3G71A 1ZQ1A 4BE2A 1Y07A 5CO7A 3MHXA 2GCXA 5GANg 2LCLA 2XKOC 4X34A 3JCMQ 2DPPB 1XNIA 4OGCA 2JTFA 1QP3A 3LYIA 2QDJA 2E70A 4BY6B 4M7AA 4XTYA 3CPWA 2ZPIB 3RKXA 3CMAT 4M7AG 1JJ2A 1M4ZA 1AHJB 3OYIA 4JRPA 1KC8C 4FT4A 4XTWA 5GAN4 3G6EA 3QKJA 5GAOl 2VYTA 3HRUA 3Q1JA 3LGLA 2XDPA 2DXUA 3L2UA 1VQ6T 5I2SA 3QHSA 2F69A 5GAMh 3QXEB 4BI4A 4BI8B 1WNLA 3CEYA 4MMLA 3LX7A 4O5VA 3CMET 4AKHA 3CCUA 2YLBA 1V29B 2QQ9A 4J6WA 3RKYA 1VQNT 1R8OB 4QQ6A 4J6YA 3JCMb 4X9DA 3L2RA 4A4HA 2FVUA 4YTLA 3HRTA 4B9XA 3PNWC 2RJDA 2R58A 3OYBA 3HO8A 2DVEA 3V8JA 4JLIA 5LJ5d 5CR2A 1S72T 4XTXA 5GAOq 3LH0A 3CCLT 4XTVA 2CZ1B 2MWOA 3VJPA 1FWZA 2K57A 1H641 1PSFA 5A0DA 3HRSA 2VUBA 3SWNA 2L5QA 3PMTA 3CCET 4NC6A 4IUUA 5LJ3d 5FLXE 1KD1C 2C06A 2VV5A 4HT9A 2O4XB 2DD4B 2G77A 2GFUA 3URGA 4F7UG 2P0QA 3L2WA 4N4GA 3QYEA 1HK9A 1QLBA 3HKSA 3JRZA 2QQBA 2K5LA 2QQAA 3QJ6A 2V8IA 5D6XA 1MGQA 1H3ZA 3HL8A 3PFSA 5KCHA 4OB3B 1I5LA 3J80E 2QQ8A 1BI1A 3VKGA 4M78E 1ZBXA 3G4ST 4ELJA 3P8HA 4C92G 2NLUA 5CCAA 1Q7YU 4KUDK 3V8KA 3TW7A 3VYHB 3FB9A 5GMKj 3OYDA 4Z02A 3BG9A 1WQ7A 4LDYA 4M75A 4CI0C 4A4EA 1K8AC 1FX7A 5DLOA 3L2VA 3MCAB 2Y4XA 3VU3C 4PJOF 3RMQA 3VUZA 3OS5A 2KY9A 5HKCA 2ZPGB 4OB2B 1WJQA 4F7UF 5GANj 2HNIA 4ELZC 3OYCA 1OZ3A 2VGNA 3MEWA 3DLMA 2RI3A 4WF2A 3PGGA 2FYKA 4RCBA 4QVDA 3JAME 4OF1A 2PUOB 3BW1A 3OW2A 1VIFA 4LD9K 1KC8U 4M6VA 3QSUA 3CXCS 2AHJB 2E65A 4KUIA 2MF2A 4PJOG 3PIOA 3G6ET 4M78D 1U1TA 4C92F 3JB9G 2HAXA 4C8QC 2PVDB 1KQSA 3CD6A 3QZ5B 2LVMA 2RD1A 5GANd 4M7AC 2XU8A 2WSCE 3F70A 5GAN8 1LJOA 1YIJT 3CD6T 1KQSS 3A8GB 2M0OA 3RESA 4C0FA 3QO3A 1VIEA 4IUQA 2ZZDB 4E7LA 3JCMP 3MEVA 2CZ0B 1Y96B 4HCBA 2ZGWA 4JS5A 1OYXA 3QZ9B 2D6FA 3C95A 2CYZB 1BI2A 5GAMg 2GF7A 4ZTFA 2RJEA 3OYMA 3M53A 2QQRA 5I2MA 2I2LA 4FT2A 2OTJA 4PKCC 3J81E 4FIBA 2IVWA 4J7FA 4M75B 2JNGA 4N4IA 1YJ9T 2DEQA 4E7KA 3BFMA 2DXBB 4XU3A 2BS4A 3TW6A 3CXCA 3LW5E 1BYMA 2FHDA 2RHZA 2D9TA 2YHTA 3QUIA 4BY6C 2DAQA 1G3TA 1O75A 4MFDA 2JZ2A 3CCQA 1N8RC 3CCMT 1UGSB 3CCVT 3WVDB 2O01E 5KE3A 1BIBA 3CBMA 3G4SA 5FRMA 2RA2A 2G3RA 2ZPFB 2E64A 5GANh 1X01A 5GMKe 2K2VA 1KHCA 4FL6A 5C6SA 4L59A 3L2ZA 4GLKA 4M77E 4ZGJB 4A54A 2M1HA 2P0PA 4QW2A 4J8OA 3UDCA 3RMSA 3FRNA 3H6ZA 4M78G 3C94A 3M54A 4C8QB 1UEBA 5FRNA 3NFCA 1JB0E 5GANe 3OYLA 4AI6A 2KK4A 1DJ7B 2B8AA 5EG2A 2X35A 3TREA 4HNVA 2JN0A 2YLCA 3DLLA 1RI0A 3CC7A 4HCCA 5FROA 3GIBA 1M1FA 1M1KU 2EIFA 3CPFA 2DD4A 3FDRA 4A4GA 2EQMA 5GAMe 1VQ7T 3WXMB 1Y96A 1E7PA 5FU6C 5A2QE 2M16A 1KQ2A 1NE8A 1UGQB 2WSFE 1NJIC 3QYBA 1BI3A 3M55A 2R57A 2LX9A 4LDUA 3V7CA 4E7JA 2JUFA 2KVQG 3CCST 4QSHA 1FXXA 1U1SA 3HZJA 4ME7A 2MAMA 2EJGA 2PQWA 4XU1A 1N6AA 1GXIE 3LWIA 4Z6YA 4XQ3A 2L8DA 3VKIA 4M77B 3KHIA 1VQLA 5I21A 2KSSA 1D3BA 3WVEB 2HQEA 4M77D 2DD5A 4N0AA 3QPHA 3OA6A 1YHQT 1YJWT 2XD0A 4NS5A 1OZ2A 4M78F 3M59A 2DIQA 4ZTJA 1W2BS 1JRIA 3KBGA 3OYYA 4GY5A 3A8HB 2WJ9A 2LDMA 1WJSA 3QG1A 5CKFA 3X25B 4MDWA 3RIRA 2LCCA 4M77C 1WPYA 4OB1B 2DTOA 5CK9A 2BS2A 2EJFA 5CKBA 4R56A 1VQMT 4PJOB 2XDDA 4C5IA 1YITT 3S3OA 4LD6A 5LJ3f 3A8LB 3ZEHA 2PUKB 3I56T 4DOVA 3PT9A 2BKDN 3CPWS 4M7DC 1KG1A 1VQ7A 2RJCA 2RK2A 2YRVA 3HBLA 1YCYA 5GAOm 4XK8E 4C0ZA 2ZPBB 3JSCA 3M5AA 3HPWA 3ME9A 5GAMj 3CCLA 3CCRT 2Y4YA 1G3SA 1WQWA 4JJNK 2EQKA 4MZMA 1VQ9A 4VUBA 1K9MC 2X4XA 3NTIA 3CC2T 2MWPA 4XAXB 4M7AF 3O8VA 5FU6B 1YI2T 4KULA 3M4YA 2HBPA 4JX5A 3GOXA 2ZCFB 2L3RA 5GMKl 5IN1A 4E7IA 2XI9A 3OS2A 4JX6A 5CIUA 1I8FA 1I4K1 3OY9A 1G5VA 1M9SA 5KH6A 1N9RA 3CCUT 1K73U 1QVPA 4BACA 5HK0A 4ZGDB 2WACA 4C8QD 1D3BB 1XOVA 3OMCA 2P0KA 1W2BA 4UC4A 5HK3A 5LJ5f 1UGRB 4AKIA 3OYKA 2QA4T 1YJNA 3OSVA 5GMKi 3GF5A 4JX4A 2BS3A 2R5AA 3BDUA 4BE1A 3QYGB 3OBYA 2QFZA 1P92A 2DK3A 3FEOA 3VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZD B;  2CZ0 B;  2WSE E;  3QZ9 B;  2CYZ B;  4KT0 E;  5L8R E;  2PVO B;  2DPP B;  3VYG B;  1QP3 A;  2DXB B;  3LW5 E;  2ZPI B;  1AHJ B;  1UGS B;  3WVD B;  2O01 E;  2ZPE B;  2ZPF B;  3X24 B;  1IRE B;  4FM4 B;  4ZGJ B;  3QXE B;  3HHT B;  2DXB A;  1JB0 E;  1DJ7 B;  1V29 B;  2DD4 A;  2ZZD A;  3X28 B;  2WSF E;  1UGQ B;  4RKU E;  2ZPH B;  2CZ1 B;  1GXI E;  1PSF A;  1QP2 A;  2PU9 B;  3WVE B;  2DD5 A;  3X20 B;  4Y28 E;  2DD4 B;  3A8O B;  4OB0 B;  3A8M B;  3A8H B;  3X25 B;  4OB3 B;  4OB1 B;  2QDY B;  1PSE A;  2CZ7 B;  3VYH B;  3A8L B;  2PUK B;  4XK8 E;  4L6V 5;  2ZPB B;  2ZPG B;  4OB2 B;  2PUO B;  2ZCF B;  2CZ6 B;  2D0Q B;  2AHJ B;  1UGP B;  3VYG A;  4ZGD B;  2PVD B;  2PVG B;  3QZ5 B;  1UGR B;  2DXC A;  2WSC E;  2DXC B;  3A8G B;  3QYH B;  3X26 B;  3QYG B;  2DD5 B;  4ZGE B; 
#chains in the Genus database with same CATH topology
 2A08 A;  3JCM J;  3H0F A;  2QG9 B;  2CUB A;  1O9K B;  4G6L B;  4II1 A;  2QI2 A;  1NEB A;  1JJ2 P;  4E7Z A;  4J9B A;  2A0F B;  1YIJ A;  3JCM f;  4MFE A;  3G71 T;  1N8R R;  2DO3 A;  4XTZ A;  4LUD A;  1JXM A;  1GCQ A;  5CQY A;  4PFZ A;  5GAO p;  4JRI A;  3CC4 T;  2K3X A;  3X24 B;  3G1J A;  4JRQ A;  1UEC A;  1EZZ B;  5LJ5 h;  4F14 A;  1NEG A;  3OBW A;  1AD5 A;  4DQ2 A;  3S3M A;  4ZNX A;  1NJI U;  4AMC A;  5LJ3 e;  3V7S A;  2DTI A;  2DEU A;  1K8A U;  1N8R U;  1VA7 A;  3RR6 A;  3OYN A;  5GMK m;  3KUF A;  1H8K A;  2A37 A;  2GQV A;  4M7D F;  2COZ A;  1YJW Q;  1YHQ Q;  2FG0 A;  4FU6 A;  4NOY A;  1D1A A;  4JDS A;  2RB6 A;  4KBM B;  2K79 A;  2R5M A;  3I55 Q;  2BPM B;  3KXT A;  1MV0 B;  4OB0 B;  4BE0 A;  4FW2 A;  1WXT A;  1ENW A;  2LQN A;  4A53 A;  4ZN1 A;  3BG5 A;  3CCQ T;  4FYW B;  2JVV A;  4Y91 A;  2VXF A;  2RHY A;  1M3A A;  2YUP A;  4LUE A;  3A5Z B;  3ZFJ A;  3DOG B;  5A0L A;  3JCM c;  2ATC B;  2LJ1 A;  2HQH A;  3MP6 A;  1CKB A;  1UGP B;  2EVR A;  2XMF A;  1O9S A;  4C0D B;  2OTL A;  2JT4 A;  2DXC B;  1W98 B;  2PTK A;  2B86 A;  3OSS C;  2IPO B;  4Z88 A;  1VUB A;  5DLQ E;  2DRM A;  2E6Z A;  2KDS A;  2RHI A;  2WSE E;  2X3X D;  2QTX A;  4KT0 E;  3CCV A;  2MOX A;  2KRO A;  4A63 B;  1VQ7 Q;  2MYS A;  1H27 B;  2DFU A;  3UT1 A;  3VS5 A;  4M7D A;  2LNV A;  2CSQ A;  1GBR A;  3VS1 A;  1W2B P;  4HA8 A;  2FZG B;  3LLR A;  1M5Q 1;  2BUD A;  4PFP A;  1RAH B;  3OYH A;  2DTH A;  2QF7 A;  3HHT B;  1WLP B;  1X2K A;  1YNZ A;  3FLG A;  1MND A;  1GUX A;  4EMK B;  4PJO E;  1RI9 A;  3SHW A;  1Q81 R;  2QAZ A;  2HCK A;  3CBO A;  2ZZD A;  2LRQ A;  2QAS A;  2C5V B;  3NTH A;  2QGG A;  4DA4 A;  3MIA B;  4CFW B;  3NTK A;  3FIF A;  3OQ5 A;  2DIL A;  4OGE A;  2VGM A;  2LQK A;  5GAN 6;  4EMK C;  1WX6 A;  1QP2 A;  3QII A;  4M7A E;  1FMK A;  1M90 C;  4X1V A;  1K73 C;  4RTT A;  2BIV A;  1IGU A;  2X9H A;  1GUX B;  4EMK A;  3EH1 A;  1GCQ C;  3SDZ A;  3GP8 A;  2GFA A;  1LOJ A;  3EHR A;  1Y7X A;  3JCM V;  3CCJ Q;  3UWN A;  2DRK A;  1I07 A;  3M56 A;  3M0T A;  2PZ1 A;  2AZV A;  2FZK B;  3TNH B;  4MIM A;  4BUG A;  1MMA A;  4M77 G;  4A4K A;  3CC7 T;  5AYF A;  1UUE A;  2EQU A;  2JTE A;  4XU0 A;  4IUT A;  4BDZ A;  1X75 C;  1VQ8 T;  2CH4 W;  4HVU A;  4CRI A;  4M75 G;  4AFZ C;  1W70 A;  2RQR A;  4BD3 A;  1LVK A;  1VQ4 T;  1C0M A;  1RLQ C;  2EWN A;  3SFM A;  3OS0 A;  2KRN A;  3OMG A;  3E1S A;  1KIK A;  3MP8 A;  1F5Q B;  4OMP A;  3H4C A;  3CXC P;  4BE2 A;  3G71 A;  1ZQ1 A;  2HKQ B;  2PMI B;  1YCS B;  3MHX A;  1GY3 B;  4OMO A;  1RAC B;  4CFU B;  4BCN D;  4M7A A;  4F6U B;  1C9B A;  1ZLM A;  2OI3 A;  4BCQ B;  2WEV B;  4AT1 B;  1NYG A;  5GAO l;  1M30 A;  3HRU A;  3Q1J A;  3CCR Q;  2XDP A;  2E3I A;  1VQ6 T;  5I2S A;  9ATC B;  2MK5 A;  1BU1 A;  3CEY A;  3LX7 A;  2EBP A;  2YLB A;  4KGZ B;  4QQ6 A;  1VQ4 Q;  1OPL A;  2C5X B;  3JCM b;  3L2R A;  1YWP A;  1S72 T;  3CCL T;  3VJP A;  2MWO A;  5LMK B;  1JOW A;  4Z89 A;  5LJ3 d;  2VV5 A;  2YUO A;  2DD4 B;  3OW2 P;  2FRY A;  5IF1 B;  3L2W A;  3G6E Q;  4CC7 A;  3QYE A;  1QLB A;  3HKS A;  4EON B;  2HDA A;  2YUQ A;  1WHM A;  3DTO A;  3P8H A;  3VYH B;  3FB9 A;  1UTI A;  2NUZ A;  1QKX A;  1HSQ A;  3BG9 A;  2JMA A;  1FX7 A;  1WHK A;  3L2V A;  4F6W B;  3VU3 C;  3DDP B;  4JJD A;  1N5Z A;  5LQF B;  2ZPG B;  1WJQ A;  4F6S B;  2HNI A;  4YOS A;  1OZ3 A;  1H3H A;  1H1P B;  3DLM A;  3EHQ A;  4WF2 A;  4RCB A;  4QVD A;  2ED0 A;  4OF1 A;  2PUO B;  3BW1 A;  2HBW A;  3OW2 A;  1EX4 A;  1QCF A;  3QSU A;  4CC3 A;  2AHJ B;  2E65 A;  3JCM W;  4PJO G;  3JB9 G;  1VYU A;  1ZSG A;  1SHF A;  2PVD B;  1PKS A;  2L0A A;  3CD6 T;  1LJO A;  5KYN A;  1KQS S;  3A8G B;  1B3Q A;  2NWM A;  1VIE A;  3BLR B;  2ZAE A;  4HCB A;  2ZGW A;  2CUD A;  4FYY B;  4DBF A;  5IDN B;  1R0C B;  4J9C A;  2EGA A;  4ZTF A;  2DA9 A;  3M53 A;  2P4R A;  1Y57 A;  4FT2 A;  2OTJ A;  3J81 E;  2IVW A;  4J7F A;  1D1C A;  2DXB B;  1KK7 A;  2CRE A;  1J3T A;  3CXC A;  2FHD A;  1QWE A;  2EQI A;  3CCM T;  1VQ6 Q;  3WVD B;  5KE3 A;  1XJW B;  2E64 A;  3NGP A;  1VIN A;  5C6S A;  1KHC A;  4L59 A;  1PWT A;  1X6G A;  4FYX B;  4M77 E;  4ZGJ B;  1I5O B;  5ECA A;  4J8O A;  2CJM B;  2I40 B;  1WHJ A;  3EG0 A;  5FRN A;  2RPN A;  1UEB A;  5D7U A;  1JB0 E;  4AG1 C;  1DJ7 B;  1YIT Q;  2LP5 A;  3MY1 B;  2EIF A;  2DD4 A;  5GAM e;  1S72 Q;  1BCM A;  2AIR B;  3WXM B;  1Y96 A;  1UGQ B;  1BI3 A;  2R57 A;  4RTU A;  2JUF A;  3CCS T;  4QSH A;  1U1S A;  3LWI A;  3CC2 Q;  3KHI A;  3CCV Q;  3OA6 A;  3QPH A;  2XD0 A;  3NHN A;  1JXO A;  3KBG A;  4GY5 A;  1R0B G;  4JJB A;  3QG1 A;  3RIR A;  3C0C A;  2KNB B;  2BTT A;  2M02 A;  5CK9 A;  2DNU A;  1W1F A;  2HSE B;  2XDD A;  2LJ3 A;  1HD3 A;  4DOV A;  2W2H A;  3MY5 B;  3CPW S;  2RK2 A;  2WIH B;  2AZS A;  3HBL A;  2LCS A;  2CDT A;  3NTI A;  3FJ5 A;  1O9K A;  3GOX A;  2L3R A;  4ROD A;  5IN1 A;  2XI9 A;  3OS2 A;  1NLO C;  3EGX B;  3CCU T;  1K73 U;  1QVP A;  1TOV A;  3EG3 A;  3O5Z A;  1XOV A;  3OMC A;  1W2B A;  2P0K A;  1GL5 A;  4UC4 A;  1UGR B;  4AKI A;  1PNJ A;  1GFD A;  1YJN A;  2HEQ A;  3SEM A;  4BE1 A;  3QYG B;  2DET A;  4BCF B;  1RAI B;  2OTJ T;  1VQ8 A;  4BCQ D;  2KI7 A;  3DB4 A;  3O0G D;  4EMG A;  5EFQ B;  1AD6 A;  1W4S A;  4JZ4 A;  5LJ5 g;  2E4H A;  4PJN A;  2FPD A;  2VXE A;  1QCO A;  4JS4 A;  1QVG S;  4HVW A;  1AWO A;  5CQX A;  4C8Q E;  2EYW A;  4BI3 A;  4ELY C;  4OP0 A;  3S6W A;  2KEA A;  4QT7 A;  2RQW A;  4IKF A;  4O6J A;  1D3U B;  1VYV A;  4EPC A;  2FL7 A;  3F5X B;  3EFS A;  2P84 A;  1JQQ A;  3EG2 A;  4LXC A;  2F1L A;  3OYG A;  2DVJ A;  3JB9 I;  3V8L A;  3BY7 A;  4CC4 B;  1WDX A;  2KMT A;  4BCO B;  1R77 A;  3L42 A;  3QJY A;  5CVI A;  2ZPH B;  1BU2 A;  3NDQ A;  4LOC A;  1PKD B;  1QVF S;  4XTU A;  5C0M A;  4EOJ B;  1UHC A;  3A8O B;  1SSH A;  1ZUK A;  3QDR B;  1X69 A;  4M7D G;  1SSF A;  4QQD A;  3RKW A;  5KCO A;  2AKK A;  4AG2 C;  2HQX A;  4HXJ A;  4NL2 A;  3CME Q;  3CD6 Q;  2RI5 A;  2RM4 A;  3VS2 A;  3MET A;  5GAN 7;  3EFR A;  4R55 A;  2RN8 A;  2CP0 A;  2CKK A;  5GAN 5;  1QVF A;  2HZY A;  2RHX A;  3QBY A;  2O2O A;  1KJW A;  1KSW A;  4HNT A;  3LH5 A;  4C92 B;  4QQG A;  3SWN C;  2ROT A;  4EOR B;  6AT1 B;  2M9U A;  4EOM B;  3JCM X;  2CZ6 B;  5FW9 A;  1Q82 C;  2MIO A;  3MKD A;  4MDX A;  5FWC A;  4CFU D;  5IH2 A;  4B9W A;  3HSB A;  2IG0 A;  3BHV B;  2GTJ A;  2MMP A;  4FCY A;  2P4T A;  4J83 A;  1F1B B;  2DD5 B;  1QW1 A;  3THK A;  1M90 U;  4IMY B;  4M75 F;  5IAY A;  3JB9 J;  4N4H A;  1Q86 U;  4BCG B;  3L1A A;  4XU2 A;  2X4W A;  1JBM A;  3CCM A;  3EGD B;  3SWN B;  1PHT A;  1H1S B;  3E9G A;  1U8R A;  2KAF A;  3OS1 A;  4QVZ A;  2E3H A;  1UE9 A;  1M2O A;  3GTM S;  1VQ5 Q;  2QXF A;  2F2X A;  1VQN A;  3LQ5 B;  3N5B B;  2XHC A;  3VRZ A;  2DJQ A;  4EOI B;  2JJ9 A;  1IHW A;  3BDL A;  2ZPE B;  4BY7 X;  1GH6 B;  3MP1 A;  4RG2 A;  4PJO A;  2ABL A;  2IIM A;  5IDP B;  2KMG A;  2FZC B;  1TTH B;  5GAO r;  2NUP B;  4C0D C;  2V26 A;  2OAU A;  2DXB A;  3CCR A;  2K6D A;  1RAF B;  2L3Q A;  4V2S A;  1VQO T;  4Q5W A;  2KT1 A;  2X4J A;  4M77 F;  1M3B A;  1B34 B;  3X28 B;  1Q95 G;  3M03 A;  1G8X A;  2SEM A;  1M1K C;  1OGU B;  2C4G B;  1XQH A;  3OYA A;  3UA7 A;  4JRK A;  1EIF A;  1HXD A;  4RG8 A;  3OYE A;  1EFN A;  1LNX A;  2J06 A;  5CKE A;  1Q82 R;  1VQ5 T;  2XIC A;  3I55 T;  3CCU Q;  3C4S A;  3GNG A;  2LZ6 B;  4DBQ A;  2IN3 A;  2JXB A;  4X9C A;  2HD0 A;  4HCZ A;  4C8Q G;  5KYY B;  1Y71 A;  1WHG A;  2I0N A;  1PRM C;  2DL8 A;  1QMC A;  4I3Z B;  2QYZ A;  4PNO A;  4IUV A;  3I35 A;  2JS2 A;  4NST B;  1TU0 B;  1Y0M A;  2E6N A;  1OU8 A;  2D0Q B;  5IHY A;  1AWJ A;  1VQK A;  5J3B A;  2PVG B;  4M7A B;  3P8D A;  2DXC A;  2DYB A;  2DF6 A;  2X51 A;  2RHU A;  3X26 B;  2UZE B;  4A4F A;  2HL5 C;  1OU9 A;  2BZY A;  4ZN3 A;  4C92 D;  1N9S A;  3MEU A;  2DL4 A;  1YI2 A;  3BLH B;  1K9M R;  3M58 A;  4RCC A;  4L5G A;  1Y07 A;  1WXU A;  5AT1 B;  2V22 B;  3CPW P;  2DPP B;  1XNI A;  2JTF A;  1Q7Y R;  2CCI B;  1JST B;  2E70 A;  4BY6 B;  1YI2 Q;  3I56 Q;  2NUP A;  1OQK A;  4M7A G;  5GJW B;  4FT4 A;  1B07 A;  3CCQ Q;  2VYT A;  2LX7 A;  3IQL A;  1T3S A;  5HBJ B;  1WNL A;  1HYO A;  3CME T;  4PFO A;  4J6W A;  2J6K A;  1E6H A;  1KC8 R;  4A4H A;  2FVU A;  3HRT A;  2LMJ A;  3HO8 A;  3V8J A;  4YOZ A;  5GAO q;  2EGE A;  2CZ1 B;  2KE9 A;  2K57 A;  1H64 1;  5A0D A;  3HRS A;  2L5Q A;  3CCE T;  5FLX E;  2CP3 A;  1KD1 C;  2G77 A;  3RGF B;  2P0Q A;  3QWX X;  2PNI A;  2K5L A;  2QQ8 A;  1BI1 A;  3G4S T;  2CP2 A;  1Q7Y U;  4C92 G;  7AT1 B;  2NLU A;  1LCK A;  4EOL B;  2WPA B;  2CP7 A;  4ESR A;  4CI0 C;  4M75 A;  4A4E A;  5DLO A;  4E2F B;  3VUZ A;  4RUG A;  5HKC A;  4DBR A;  2RF0 A;  1IRX A;  1KQS P;  1KC8 U;  4KUI A;  2HAX A;  2KBT A;  3MPU B;  1U1T A;  2L3S A;  2LVM A;  2B9R A;  2RD1 A;  1PC0 A;  4M7A C;  2HMA A;  1YIJ T;  5GAN 8;  1KXU A;  2M0O A;  2YUN A;  3JCM P;  4GLM A;  1MNE A;  4JS5 A;  2CYZ B;  2IW8 B;  1VQO Q;  4D8K A;  1VYT A;  4RTV A;  4KH1 B;  2C5N B;  4M75 B;  2RNA A;  3I5R A;  2DEQ A;  4E7K A;  4XU3 A;  2RHZ A;  2D9T A;  3QUI A;  2ECZ A;  4IIM A;  2DAQ A;  1KFZ A;  1G3T A;  1I0C A;  4MFD A;  1N8R C;  3CCV T;  4KH0 B;  2O01 E;  1P5E B;  1BIB A;  1WXB A;  3CBM A;  1ACM B;  2YT6 A;  5FRM A;  2RA2 A;  2IW6 B;  4TTH A;  2COY A;  4LN2 A;  3UF4 A;  1QVG P;  2KR3 A;  1KD1 R;  1WIE A;  2K2V A;  4FL6 A;  4F16 A;  4GLK A;  2W0Z A;  3ZL7 C;  2P0P A;  4JZ3 A;  4OMQ A;  3TNW B;  4J9H A;  3H6Z A;  4CFX B;  5GAN e;  1SRM A;  3TRE A;  2JN0 A;  5FRO A;  1VQ7 T;  8ATC B;  5A2Q E;  1NJI C;  2VAS A;  4BCJ B;  3QYB A;  3M55 A;  4Z8A A;  2FRW A;  3V7C A;  4E7J A;  3CCE Q;  1MV3 A;  4ME7 A;  1GXI E;  2MAM A;  2AK5 A;  4XU1 A;  1K8A R;  4Z6Y A;  4XQ3 A;  3EGX A;  4M77 B;  1VQL A;  3M0U A;  5I21 A;  2KSS A;  3NPF A;  1OIU B;  4M78 F;  1TUC A;  1QQJ A;  2WJ9 A;  2LDM A;  1MMG A;  1WJS A;  4M77 C;  1WPY A;  4PJM A;  4PJO B;  5CKB A;  4R56 A;  4C5I A;  1FYN A;  2DER A;  3A1P A;  5LJ3 f;  1M2V A;  4WTO B;  2G9X B;  3M5A A;  3CCR T;  1G3S A;  2VKN A;  4JJN K;  1K9M C;  2MWP A;  3O8V A;  4ANJ A;  2ZCF B;  4OGR B;  4JX6 A;  5CIU A;  1D0Z A;  2GNC A;  5KH6 A;  1N9R A;  2C0I A;  1C6V X;  4C8Q D;  4OML A;  1YWO A;  5CEI B;  3GF5 A;  2BS3 A;  2R5A A;  3BDU A;  1OX9 A;  1P92 A;  3FEO A;  2K3B A;  1I81 A;  1VQN Q;  1RL2 A;  4RMO A;  2UUE B;  1OIY B;  5GJV B;  3G7Z A;  1M90 R;  2E10 A;  2VB6 A;  2PVO B;  3CBP A;  3R6O A;  1BKB A;  4LDV A;  4M75 C;  4PL6 A;  2RH2 A;  3TEE A;  2MPX C;  3EH2 A;  1GCP A;  1Q86 R;  1JU5 C;  1BB9 A;  3JCM g;  1PD1 A;  2DKG A;  2ROL A;  3PO3 S;  2HKN A;  2K9G A;  1TFB A;  1H24 B;  1YBY A;  1MMD A;  2LQ8 A;  2QA4 Q;  3PTA A;  1IRE B;  1H25 B;  2W99 A;  2H8H A;  1YJN T;  4F7S B;  4PLL A;  1ABQ A;  5LJ3 g;  2XG8 D;  3PVQ A;  2H3J A;  1UNL D;  2LC4 A;  4M75 D;  3GBQ A;  2I53 A;  3G4S Q;  1YJ9 A;  5A0G A;  4BCM B;  4BCI B;  4E47 A;  2JM8 A;  4C0G A;  4C5E A;  4HL4 A;  1BI0 A;  5J39 A;  1B34 A;  1VQP Q;  5CKH A;  1BBZ A;  1TWB A;  5KYX A;  1VQ9 T;  4ATO A;  3AHU A;  5HY6 A;  2E5Q A;  3MEA A;  4FYV B;  2DL3 A;  3RER A;  3CCS Q;  4J6X A;  3REB B;  2OTL T;  3E9F A;  2F5K A;  2QTV A;  1AOJ A;  1JJ2 S;  3TCJ A;  2WXV B;  1IO6 A;  1WJR A;  1AZE A;  3PVL A;  2QDY B;  3SB2 A;  2XDB A;  1VQ5 A;  1PSE A;  4D8D A;  4CXA B;  2CZ7 B;  4BCH B;  1IZ6 A;  2JOY A;  3OYF A;  1K9M U;  3UPU A;  2DZ9 A;  4KRD B;  1T3L A;  4L6V 5;  3FC3 A;  1XO2 A;  1TH7 A;  4C92 E;  1IGQ A;  5FWB A;  3CCL Q;  5M9O A;  3P8B B;  5DY9 A;  3QWY A;  3JCM d;  2BZ8 A;  2V8K A;  1VQP T;  3VYG A;  4CC2 A;  4F7U B;  2JM9 A;  2QEX A;  3QHW B;  2CGH A;  2KR6 A;  3DL1 A;  2HSP A;  5GMK h;  2DK3 A;  2WIP B;  1VQP A;  1AWW A;  3TQ7 P;  4ZGE B;  1GRI A;  2QK0 A;  5D6W A;  3U23 A;  3ASK A;  3EAE A;  3L2Q A;  2FEI A;  2OTJ Q;  2EYZ A;  2J6F A;  4QVC A;  2DBK A;  4DEY A;  1U06 A;  5HVY B;  3TU4 K;  5DQW A;  4M78 C;  2A3L A;  4M7D E;  4J5Y A;  4DOW A;  4ELL A;  3HP9 A;  1GBQ A;  2EQJ A;  2YXY A;  3OW2 S;  2RJF A;  1X6B A;  3M9Q A;  2YDL A;  4M78 A;  2K3Y A;  2L3P A;  2FB7 A;  1Z9Z A;  3CMA A;  3AT1 B;  1GFC A;  4EC9 B;  4M7D B;  4EC8 B;  3TSZ A;  5CYI B;  3SD4 A;  1RAD B;  2EFI A;  3CCE A;  1Q81 C;  1WHH A;  4CFM B;  3LWH A;  1M8V A;  1SF9 A;  1Q7Y C;  2VC8 A;  1IB8 A;  2GBQ A;  3EGD A;  4FX3 B;  4R0K A;  1G3Y A;  4MMK A;  2VVK A;  1YIT A;  5LJ3 h;  4J9I A;  4KGX B;  1V76 A;  1X2Q A;  1PG5 B;  5CAI A;  1AWX A;  4M7D D;  4HLQ A;  1OV3 A;  3S3N A;  3EGU A;  1K4U S;  2NYS A;  4C8Q A;  4HNU A;  3GLX A;  1UDL A;  1G83 A;  4M75 E;  2LJ0 A;  1K73 R;  1VQ6 A;  1QKW A;  3BG3 A;  1SRL A;  1V1C A;  3BLQ B;  1HJD A;  1K9A A;  1FMW A;  3I5S A;  4M78 B;  3CC2 A;  2DIG A;  2YWW A;  4F70 B;  4EDU A;  1UHF A;  3JB9 H;  1ZA1 B;  4M7A D;  2HL3 A;  1UNG D;  3ZBD A;  1AVZ C;  2F2V A;  3E2U A;  2O9S A;  1S72 A;  1NZ9 A;  1CSK A;  3I56 A;  2EYQ A;  2KQW A;  3QWL A;  4E7H A;  2V8J A;  5LL6 S;  1RAA B;  2RK1 A;  1JEG A;  3V7R A;  4RTY A;  2KXC A;  3EID B;  2KXD A;  4F7U E;  1FVV B;  2PK9 B;  3EG1 A;  3EG9 A;  3PIP A;  1UJY A;  4BB7 A;  1UGV A;  2PK2 A;  5GAM f;  2E5K A;  3M57 A;  3QYH B;  3VUB A;  5GAM d;  3H8Z A;  1ZSZ B;  1NPR A;  1Z9Q A;  2IW9 B;  1X43 A;  2LNH B;  1ZUU A;  4PJO C;  2BKZ B;  2E1H A;  2EJ9 A;  4RTW A;  5J26 A;  3CC7 Q;  1I1J A;  5L2W B;  2FPE A;  1C1A A;  5EC7 A;  5IXF A;  2X1N B;  3H0H A;  5CO7 A;  1UNH D;  1H92 A;  4X34 A;  1QP3 A;  3LYI A;  2UZL B;  4IIO A;  2A36 A;  1D0Y A;  2ZPI B;  3RKX A;  3CMA T;  2X3W D;  1M4Z A;  3OYI A;  4XTW A;  5L23 A;  3VRY A;  3LGL A;  4CFN B;  2DXU A;  5GAM h;  3QXE B;  2DL5 A;  4BI4 A;  5KYU A;  4BI8 B;  4Y72 B;  4II5 B;  4MML A;  1PRL C;  1NYF A;  4PJJ A;  4AKH A;  1V29 B;  2QQ9 A;  3G33 B;  4YTL A;  3PNW C;  2RJD A;  2R58 A;  5IHN A;  1FWZ A;  2VUB A;  3PMT A;  4IUU A;  2W96 A;  2C06 A;  1ZP2 A;  2O4X B;  1NBE B;  5KYW A;  2JMC A;  2QQA A;  2V8I A;  5D6X A;  1MGQ A;  3PFS A;  3CMA Q;  1I5L A;  4M78 E;  1ZBX A;  2IVX A;  5IHI A;  1RAB B;  3OYD A;  2M0Y A;  3CC4 Q;  1A0N B;  4EOQ B;  1M2V B;  1WQ7 A;  1K8A C;  1BCO A;  2Y4X A;  1RAG B;  3OS5 A;  2C0T A;  4ELZ C;  2EYY A;  1U3O A;  3OYC A;  3MEW A;  2J6O A;  2VGN A;  2RI3 A;  2FYK A;  3JAM E;  1ZSZ A;  2W9Z A;  1OKV B;  4M6V A;  1UG1 A;  3RBB B;  3CXC S;  2MF2 A;  3PIO A;  4M78 D;  3DDQ B;  3REA B;  4C8Q C;  5GAN d;  5DQV A;  2XU8 A;  2C0O A;  2MCN A;  2CT3 A;  2F2W A;  3QO3 A;  4ROC A;  2ZZD B;  2CZ0 B;  1OYX A;  3EFO A;  3C95 A;  2GF7 A;  3OYM A;  2JS0 A;  2I2L A;  4EIK A;  2EUF A;  4OMM A;  1H4L D;  4PKC C;  4FIB A;  4N4I A;  3G71 Q;  2JNG A;  1YJ9 T;  1YFN A;  4E6R A;  4CRL B;  3BFM A;  5IXB A;  5HQ0 B;  3TW6 A;  3LW5 E;  1BYM A;  2YHT A;  2FPF A;  1O75 A;  1TS9 A;  4BY1 X;  2Z0W A;  2ZPF B;  1RUW A;  5GAN h;  1X01 A;  5GMK e;  3L2Z A;  4A54 A;  3UDC A;  4GBQ A;  3FRN A;  4C8Q B;  3C94 A;  2COW A;  3CC7 A;  5EG2 A;  2X35 A;  1ARK A;  4HNV A;  3DLL A;  1RI0 A;  3GIB A;  4A4G A;  2M16 A;  2WSF E;  5KYW B;  1PCX A;  2LX9 A;  1FXX A;  2G6F X;  1E9H B;  2DL7 A;  2DYI A;  1N6A A;  3VKI A;  4LE9 A;  1QWF A;  1D3B A;  3WVE B;  2RQV A;  2DD5 A;  4N0A A;  4NS5 A;  1OZ2 A;  3M59 A;  2DIQ A;  3OYY A;  4FW1 A;  1YJ9 Q;  2YSQ A;  1TD6 A;  3D7S B;  5CKF A;  3X25 B;  3M0R A;  2DTO A;  2EJF A;  3S3O A;  4LD6 A;  3ZEH A;  4OMN A;  3I56 T;  3PT9 A;  1WI7 A;  4HVV A;  1VQ7 A;  2YRV A;  3M0Q A;  3ME9 A;  4C0Z A;  3TVT A;  3MJX A;  3CCL A;  4EOO B;  2Y4Y A;  2EQK A;  4MZM A;  2X4X A;  4M7A F;  4XAX B;  1TG0 A;  3M4Y A;  2HBP A;  4JX5 A;  3QDF A;  1I4K 1;  1OUL A;  3H0I A;  1G5V A;  4BAC A;  5HK0 A;  4ZGD B;  2WAC A;  1D3B B;  3PE0 A;  1WYX A;  5HK3 A;  1YP5 A;  5LJ5 f;  2QA4 T;  3OSV A;  5ACB A;  3CQT A;  3VS4 A;  3BHT B;  3OBY A;  4J9F A;  1WHL A;  1SHG A;  2DME A;  3VKH A;  3DJB A;  5LJ5 j;  1YIJ Q;  3CCS A;  2RQU A;  2ENM A;  3GPL A;  4ORZ A;  3JCM h;  2K5I A;  1Q81 U;  4HKE A;  1G2B A;  5L8R E;  4PLI A;  1KQ2 A;  3CCJ A;  4BBR M;  4BXX X;  4RTZ A;  3CCJ T;  2CS7 A;  2LTO A;  4QKU A;  1T0J A;  2AT1 B;  3POM A;  5GAN 2;  1M27 C;  1URC B;  1ZSZ C;  2OTL Q;  5GAO n;  4J9G A;  4PK4 A;  1OI1 A;  3I55 A;  4EOP B;  1UB4 A;  2QA4 A;  4C5G A;  5EJC A;  4BDY A;  4AFU C;  3EJ1 B;  1JSU B;  3INZ A;  1QVG A;  2MI6 A;  2EKO A;  2EAY A;  1G3N C;  5LJ5 e;  4RTX A;  1PKT A;  2LT4 A;  4RKU E;  1KD1 U;  1OKW B;  4AFQ C;  2WMA B;  4KGV B;  1VQO A;  3OB9 A;  1K0X A;  2PU9 B;  4F7U A;  2OJ2 A;  3B57 A;  4Y28 E;  2CCH B;  2PJQ A;  4NL3 A;  2E41 A;  2XID A;  3A8M B;  2EGC A;  5GAN 3;  1OX8 A;  4IUP A;  4P5N A;  4OVA A;  1G3W A;  1MMN A;  1IHV A;  2XK0 A;  2F5T X;  2W9F A;  1WFW A;  3HTR A;  1NPP A;  1ZUY A;  4E7S A;  3K7A M;  1AZG B;  1M1G A;  3VS3 A;  2BE9 B;  3GNF B;  1YJW A;  1YHQ A;  2QQS A;  1TSF A;  5LJ3 j;  1BIA A;  2O4X A;  4K11 A;  3JCM e;  1VQ8 Q;  2DJZ A;  4IUR A;  3VS6 A;  1M3C A;  5HCK A;  4MZP A;  1JKW A;  1FMV A;  1YN8 A;  2OX7 A;  2LT1 A;  4OR5 B;  3HFO A;  2JTM A;  1NG2 A;  2SRC A;  3CC4 A;  4F7L B;  1OEB A;  2K2M A;  5CKD A;  3JB9 F;  1D09 B;  4JUV A;  4N0A C;  2BE7 D;  2QEX T;  3FJP A;  1T0H A;  1OPK A;  2L89 A;  2J05 A;  1TUD A;  2R7G A;  2KYM A;  1U5S A;  3JB9 D;  5IT9 E;  4AKG A;  1VQL Q;  4DBH A;  1JO8 A;  2RO0 A;  3VYG B;  3C12 A;  4BCP B;  2NUT B;  2J7I A;  3CME A;  3BE3 A;  1RLP C;  1SG5 A;  3A98 A;  3DKM A;  1VQK T;  2CT4 A;  4BBS M;  4LDX A;  5HBH B;  1XTD A;  1X6O A;  5D6Y A;  3PMI A;  2D8H A;  1B7T A;  4FM4 B;  4LNP A;  3T9N A;  5KYY A;  1SKU B;  2QGS A;  1OI9 B;  2RI2 A;  2K4Y A;  2NUT A;  3DB3 A;  4JLG A;  2DLP A;  2DE0 X;  3RUX A;  3HFN A;  1VYW B;  4C8Q F;  1CKA A;  1VQM A;  5IHK A;  1OL2 B;  4HT8 A;  1ZHI A;  2KT8 A;  2LW4 A;  3LGF A;  4EOK B;  2DX1 A;  1MHN A;  2DMO A;  1KHI A;  4C92 C;  4EMH A;  3H9N A;  1PD0 A;  2F2C A;  5ICP B;  3X20 B;  1FKM A;  4BCN B;  2JGZ B;  2D8J A;  2X4Y A;  3EG9 B;  1N27 A;  3MO8 A;  1VQ4 A;  1UFF A;  4LDW A;  3OYJ A;  1ZBJ A;  4MZT A;  5FU7 B;  4PJO D;  4J7I A;  4B6M A;  4C92 A;  1AEY A;  2A7Y A;  1Q86 C;  2QDL A;  2Y90 A;  8AT1 B;  1VQK Q;  4FSX A;  2LQW A;  3H41 A;  5KE2 A;  3VS7 A;  4OMF B;  2C6T B;  2DZC A;  2KYB A;  3E19 A;  4C5H A;  1Q82 U;  2CP6 A;  2RMO A;  5DM7 R;  1QLY A;  3J7A F;  1ZA2 B;  3ER0 A;  2K5F A;  4AFS C;  1KQ1 A;  2GTO A;  5BNJ B;  5FU7 C;  1WGS A;  2E12 A;  5GAN f;  5KYX B;  1NM7 A;  1AIS B;  4M77 A;  2ESW A;  2EYX A;  2DXT A;  3EOC B;  1VQL T;  3VV0 A;  1VQ9 Q;  4KRT A;  4D6W A;  4TVR A;  3HB9 A;  2W10 A;  3M4G A;  3VS0 A;  4KRC B;  2WFY B;  1ABO A;  3BHU B;  5KYU B;  2GCX A;  2M51 A;  2LCL A;  5GAN g;  2XKO C;  3NMZ C;  3TN8 B;  3JCM Q;  4OGC A;  1TXQ A;  2QDJ A;  3TNI B;  3RNJ A;  1K0S A;  1D0X A;  4XTY A;  3CPW A;  1QCN A;  1JJ2 A;  1AHJ B;  5FGK B;  4JRP A;  4F04 B;  5HNB B;  2DM1 A;  5GAN 4;  3G6E A;  3QKJ A;  2WHB B;  3L2U A;  1OL1 B;  3QHS A;  2F69 A;  2KRS A;  1K76 A;  1PM3 A;  4YC3 B;  4O5V A;  1N4M A;  3CCU A;  1VQN T;  3RKY A;  2PHG A;  4F17 A;  1R8O B;  4J6Y A;  4X9D A;  4B9X A;  4F7J B;  1NJI R;  3UAT A;  1WZO A;  3OYB A;  2D0N A;  2DVE A;  1KC8 C;  2RQT A;  4JLI A;  1VOL A;  5LJ5 d;  4XTX A;  5CR2 A;  3LH0 A;  4XTV A;  1PSF A;  4WCI A;  3SWN A;  1TUG B;  4NC6 A;  3M0S A;  4EOS B;  2UZB B;  4HT9 A;  3URG A;  2GFU A;  4F7U G;  3M0P A;  1SPK A;  3ULR B;  4N4G A;  2CP5 A;  2WMB B;  1HK9 A;  2A28 A;  2GQI A;  3JRZ A;  1K1Z A;  2QQB A;  3QJ6 A;  1FIN B;  1H3Z A;  3HL8 A;  5KCH A;  4OB3 B;  3J80 E;  1H1R B;  1MUZ A;  3VKG A;  2QEX Q;  4ELJ A;  5CCA A;  4KUD K;  3V8K A;  2YRC A;  3TW7 A;  2C5O B;  1VOM A;  4UN0 A;  2D1X A;  5GMK j;  2H3E B;  1VQM Q;  4Z02 A;  4LDY A;  1H28 B;  3KFV A;  2V1R A;  3RDV A;  3MCA B;  4PJO F;  3RMQ A;  2KY9 A;  4F7U F;  4OB2 B;  5GAN j;  2KRM A;  1WA7 A;  3PGG A;  4J9E A;  1QVF P;  1VIF A;  2AKL A;  4LD9 K;  5I5Z B;  4JJC A;  3I9Q A;  2K7A A;  3G6E T;  4C92 F;  1M1K R;  1KQS A;  3CD6 A;  3QZ5 B;  2O31 A;  1M8M A;  3F70 A;  2WSC E;  2VWF A;  3MI9 B;  2DBM A;  4DEX A;  4JPB W;  2QGF B;  3RES A;  4C0F A;  1OOT A;  4IUQ A;  4E7L A;  3MEV A;  1Y96 B;  3QZ9 B;  2D6F A;  1BI2 A;  5GAM g;  1IXD A;  4CFV B;  2RJE A;  2QQR A;  5I2M A;  2EKH A;  2CH4 A;  4FSS A;  2BS4 A;  2BZX A;  4BCM D;  4BY6 C;  2JZ2 A;  2OAW A;  3CCQ A;  4M4Z A;  1UGS B;  1BK2 A;  3G4S A;  2GGR A;  2G3R A;  1RAE B;  2M1H A;  4QW2 A;  2CSI A;  3RMS A;  4M78 G;  3M54 A;  3NFC A;  3OYL A;  4AI6 A;  2KK4 A;  2B8A A;  3UA6 A;  4ROE A;  2YLC A;  4HCC A;  1H26 B;  1UJ0 A;  1M1F A;  1M1K U;  3CPF A;  3FDR A;  2EQM A;  3EFO B;  1E7P A;  5FU6 C;  1NE8 A;  1AT1 B;  1ZX6 A;  4LDU A;  3QHR B;  2KVQ G;  1S1N A;  3HZJ A;  2EJG A;  2PQW A;  2UZD B;  2L8D A;  3TSW A;  4Y92 A;  3CCM Q;  4BCK B;  2FO0 A;  5I22 A;  1YHQ T;  2HQE A;  4M77 D;  1YJW T;  1QMZ B;  4PJL A;  1H1Q B;  1W2B S;  4ZTJ A;  1JRI A;  1D1B A;  4HCK A;  3A8H B;  4MDW A;  2LCC A;  2EW3 A;  4OB1 B;  2BS2 A;  1VQM T;  2ED1 A;  1YIT T;  1W6X A;  3R6N A;  3A8L B;  2PUK B;  2V1Q A;  2YRD A;  2BKD N;  4M7D C;  1KG1 A;  2RJC A;  2KGT A;  1YCY A;  5GAO m;  4XK8 E;  5GAM j;  2ZPB B;  3JSC A;  3HPW A;  2JW4 A;  5HBE B;  1WQW A;  4F7N B;  4VUB A;  1VQ9 A;  3CC2 T;  5FU6 B;  1YI2 T;  1E6G A;  4J9D A;  3JV3 A;  4KUL A;  5GMK l;  5I11 A;  4E7I A;  3OY9 A;  1I8F A;  1M9S A;  4YOO A;  1E7O A;  2O88 A;  1LPL A;  1NLP C;  3OYK A;  2L2P A;  5GMK i;  1X27 A;  4JX4 A;  1SEM A;  2QFZ A;  2EPD A;  2O9V A;  1YJN Q; 
#chains in the Genus database with same CATH homology
 5LJ5 j;  2OTJ T;  1VQ8 A;  3CCS A;  1I81 A;  3JCM J;  1RL2 A;  3DB4 A;  4EMG A;  4RMO A;  3GPL A;  3JCM h;  4II1 A;  1W4S A;  2QI2 A;  5LJ5 g;  2K5I A;  1Q81 U;  4HKE A;  3G7Z A;  5L8R E;  2E10 A;  2VXE A;  4PLI A;  4JS4 A;  2PVO B;  3CBP A;  4BBR M;  1BKB A;  3R6O A;  4LDV A;  4M75 C;  2RH2 A;  4PL6 A;  3TEE A;  3CCJ A;  3CCJ T;  1QVG S;  2CS7 A;  2LTO A;  5CQX A;  4C8Q E;  4BI3 A;  1YIJ A;  3JCM f;  4ELY C;  4OP0 A;  4MFE A;  3G71 T;  3S6W A;  3JCM g;  2DO3 A;  2DKG A;  4XTZ A;  5GAN 2;  5CQY A;  5GAO p;  4IKF A;  4O6J A;  1YBY A;  4JRI A;  3CC4 T;  2LQ8 A;  2K3X A;  3X24 B;  5GAO n;  3PTA A;  4JRQ A;  1OI1 A;  4EPC A;  1IRE B;  3I55 A;  2FL7 A;  3EFS A;  1YJN T;  1UB4 A;  5LJ5 h;  2QA4 A;  4PLL A;  4C5G A;  5LJ3 g;  2XG8 D;  3OBW A;  5EJC A;  4DQ2 A;  4BDY A;  3S3M A;  2H3J A;  2LC4 A;  4M75 D;  3INZ A;  1NJI U;  3OYG A;  5LJ3 e;  3JB9 I;  2MI6 A;  2EKO A;  1QVG A;  3V8L A;  2EAY A;  1YJ9 A;  3BY7 A;  3V7S A;  2DTI A;  5A0G A;  2KMT A;  1K8A U;  5LJ5 e;  4E47 A;  1N8R U;  3L42 A;  3QJY A;  2LT4 A;  3OYN A;  4C0G A;  4C5E A;  4HL4 A;  1BI0 A;  5J39 A;  1B34 A;  5CVI A;  3KUF A;  5CKH A;  4RKU E;  5GMK m;  1VQ9 T;  2GQV A;  1KD1 U;  2ZPH B;  4ATO A;  4M7D F;  4FU6 A;  4NOY A;  3AHU A;  5HY6 A;  2E5Q A;  3MEA A;  4LOC A;  1QVF S;  4JDS A;  2RB6 A;  4KBM B;  3OB9 A;  4XTU A;  2PU9 B;  4F7U A;  2R5M A;  5C0M A;  1VQO A;  3RER A;  3KXT A;  4J6X A;  4Y28 E;  2OTL T;  3E9F A;  3A8O B;  2F5K A;  3QDR B;  4M7D G;  4OB0 B;  4NL3 A;  2E41 A;  2XID A;  3A8M B;  1SSF A;  4QQD A;  3RKW A;  5KCO A;  5GAN 3;  1JJ2 S;  4IUP A;  4BE0 A;  3TCJ A;  4P5N A;  4OVA A;  1G3W A;  1WJR A;  2HQX A;  2XK0 A;  2F5T X;  4NL2 A;  2QDY B;  3SB2 A;  4A53 A;  4ZN1 A;  1VQ5 A;  2XDB A;  1PSE A;  2RI5 A;  2RM4 A;  3BG5 A;  2CZ7 B;  1NPP A;  3EFR A;  3MET A;  5GAN 7;  1IZ6 A;  2JOY A;  4R55 A;  3CCQ T;  3OYF A;  1M1G A;  2CKK A;  3GNF B;  1YJW A;  1YHQ A;  1K9M U;  5GAN 5;  2QQS A;  2JVV A;  3UPU A;  1QVF A;  2DZ9 A;  1BIA A;  5LJ3 j;  2O4X A;  2RHX A;  3QBY A;  4L6V 5;  4Y91 A;  2VXF A;  1TH7 A;  2RHY A;  3FC3 A;  4C92 E;  3JCM e;  2DJZ A;  4HNT A;  4IUR A;  5M9O A;  3P8B B;  4QQG A;  4C92 B;  3A5Z B;  3SWN C;  3ZFJ A;  5DY9 A;  4MZP A;  5A0L A;  3JCM c;  3JCM d;  2M9U A;  2LT1 A;  3HFO A;  2JTM A;  3JCM X;  2CZ6 B;  3CC4 A;  3MP6 A;  2V8K A;  1Q82 C;  5CKD A;  1UGP B;  1VQP T;  3VYG A;  4MDX A;  3JB9 F;  4F7U B;  1O9S A;  4JUV A;  4B9W A;  4C0D B;  2QEX A;  3HSB A;  4N0A C;  2IG0 A;  2CGH A;  2KR6 A;  2OTL A;  3DL1 A;  2QEX T;  2DXC B;  5GMK h;  2MMP A;  3FJP A;  3OSS C;  2P4T A;  4J83 A;  1VQP A;  2DD5 B;  1QW1 A;  1M90 U;  1VUB A;  4ZGE B;  4M75 F;  5IAY A;  2L89 A;  4N4H A;  2E6Z A;  5D6W A;  2KDS A;  2RHI A;  3ASK A;  5DLQ E;  3JB9 J;  3L1A A;  4XU2 A;  3JCM W;  2WSE E;  1Q86 U;  2X4W A;  1JBM A;  2QTX A;  3JB9 D;  5IT9 E;  3EAE A;  4AKG A;  4KT0 E;  3CCV A;  3SWN B;  3L2Q A;  3CCM A;  3E9G A;  1U8R A;  2KAF A;  2RO0 A;  3OS1 A;  4QVC A;  3UT1 A;  4QVZ A;  4M7D A;  2LNV A;  3VYG B;  3C12 A;  2QXF A;  1VQN A;  3N5B B;  2XHC A;  3CME A;  3TU4 K;  4M78 C;  4HA8 A;  3BDL A;  2A3L A;  3LLR A;  2ZPE B;  3DKM A;  1VQK T;  3MP1 A;  4RG2 A;  4BBS M;  4LDX A;  4M7D E;  4PJO A;  4J5Y A;  1XTD A;  1X6O A;  1M5Q 1;  5D6Y A;  4DOW A;  3HP9 A;  2EQJ A;  2BUD A;  3PMI A;  3OW2 S;  2RJF A;  4FM4 B;  2KMG A;  3M9Q A;  4M78 A;  3T9N A;  2K3Y A;  5GAO r;  2FB7 A;  3OYH A;  2DTH A;  2QF7 A;  4C0D C;  3CMA A;  3HHT B;  2OAU A;  4M7D B;  2DXB A;  3CCR A;  3SD4 A;  2EFI A;  3CCE A;  1Q81 C;  4V2S A;  3FLG A;  1VQO T;  4Q5W A;  2RI2 A;  3LWH A;  2K4Y A;  4EMK B;  1M8V A;  4PJO E;  3DB3 A;  1Q7Y C;  2X4J A;  4JLG A;  4M77 F;  2VC8 A;  1B34 B;  3CBO A;  3HFN A;  3RUX A;  3X28 B;  2LRQ A;  2ZZD A;  1G3Y A;  4MMK A;  4C8Q F;  3NTH A;  4DA4 A;  1YIT A;  5LJ3 h;  3NTK A;  1M1K C;  3FIF A;  3OQ5 A;  1VQM A;  4OGE A;  2VGM A;  2LQK A;  1XQH A;  5GAN 6;  4EMK C;  5CAI A;  3OYA A;  4HT8 A;  4M7D D;  4HLQ A;  1QP2 A;  1ZHI A;  3QII A;  4JRK A;  1EIF A;  3S3N A;  3LGF A;  4M7A E;  1HXD A;  1MHN A;  4RG8 A;  1KHI A;  4C8Q A;  4C92 C;  4HNU A;  4EMH A;  3OYE A;  1M90 C;  1K73 C;  3X20 B;  1FKM A;  2X4Y A;  1LNX A;  1N27 A;  5CKE A;  2BIV A;  3MO8 A;  1VQ4 A;  3GLX A;  4LDW A;  1VQ5 T;  3OYJ A;  2XIC A;  4M75 E;  3I55 T;  4EMK A;  1VQ6 A;  4MZT A;  3C4S A;  3BG3 A;  3GNG A;  5FU7 B;  4PJO D;  4J7I A;  3SDZ A;  4C92 A;  3GP8 A;  2A7Y A;  1LOJ A;  2GFA A;  4X9C A;  1Q86 C;  2HD0 A;  4HCZ A;  1Y7X A;  3JCM V;  4M78 B;  2Y90 A;  4C8Q G;  3UWN A;  2DIG A;  3CC2 A;  1Y71 A;  3M56 A;  4FSX A;  4EDU A;  3JB9 H;  5KE2 A;  4MIM A;  4OMF B;  4PNO A;  4BUG A;  4IUV A;  4M7A D;  2DZC A;  4M77 G;  3ZBD A;  4A4K A;  3CC7 T;  5AYF A;  2EQU A;  1S72 A;  1NZ9 A;  3E19 A;  4C5H A;  3I56 A;  1Q82 U;  2EYQ A;  4XU0 A;  2KQW A;  3QWL A;  5DM7 R;  4E7H A;  4IUT A;  2V8J A;  2E6N A;  5LL6 S;  1X75 C;  4BDZ A;  3J7A F;  1VQ8 T;  2RK1 A;  3ER0 A;  2K5F A;  3V7R A;  1KQ1 A;  2D0Q B;  5FU7 C;  1WGS A;  2E12 A;  4CRI A;  4M75 G;  4F7U E;  1VQK A;  5GAN f;  3PIP A;  5J3B A;  4BD3 A;  4M77 A;  2PVG B;  4M7A B;  4BB7 A;  3P8D A;  1VQ4 T;  2EWN A;  2DXC A;  3SFM A;  5GAM f;  3OS0 A;  2RHU A;  3M57 A;  2DXT A;  3QYH B;  3X26 B;  3VUB A;  5GAM d;  3H8Z A;  1VQL T;  3OMG A;  3VV0 A;  4A4F A;  3E1S A;  4D6W A;  1NPR A;  4TVR A;  3HB9 A;  3MP8 A;  4C92 D;  4ZN3 A;  1N9S A;  3MEU A;  3H4C A;  3M4G A;  4PJO C;  1YI2 A;  2E1H A;  3M58 A;  4RCC A;  4L5G A;  2EJ9 A;  5J26 A;  3G71 A;  1ZQ1 A;  4BE2 A;  1Y07 A;  5CO7 A;  3MHX A;  2GCX A;  5GAN g;  2LCL A;  2XKO C;  4X34 A;  3JCM Q;  2DPP B;  1XNI A;  4OGC A;  2JTF A;  1QP3 A;  3LYI A;  2QDJ A;  2E70 A;  4BY6 B;  4M7A A;  4XTY A;  3CPW A;  2ZPI B;  3RKX A;  3CMA T;  4M7A G;  1JJ2 A;  1M4Z A;  1AHJ B;  3OYI A;  4JRP A;  1KC8 C;  4FT4 A;  4XTW A;  5GAN 4;  3G6E A;  3QKJ A;  5GAO l;  2VYT A;  3HRU A;  3Q1J A;  3LGL A;  2XDP A;  2DXU A;  3L2U A;  1VQ6 T;  5I2S A;  3QHS A;  2F69 A;  5GAM h;  3QXE B;  4BI4 A;  4BI8 B;  1WNL A;  3CEY A;  4MML A;  3LX7 A;  4O5V A;  3CME T;  4AKH A;  3CCU A;  2YLB A;  1V29 B;  2QQ9 A;  4J6W A;  3RKY A;  1VQN T;  1R8O B;  4QQ6 A;  4J6Y A;  3JCM b;  4X9D A;  3L2R A;  4A4H A;  2FVU A;  4YTL A;  3HRT A;  4B9X A;  3PNW C;  2RJD A;  2R58 A;  3OYB A;  3HO8 A;  2DVE A;  3V8J A;  4JLI A;  5LJ5 d;  5CR2 A;  1S72 T;  4XTX A;  5GAO q;  3LH0 A;  3CCL T;  4XTV A;  2CZ1 B;  2MWO A;  3VJP A;  1FWZ A;  2K57 A;  1H64 1;  1PSF A;  5A0D A;  3HRS A;  2VUB A;  3SWN A;  2L5Q A;  3PMT A;  3CCE T;  4NC6 A;  4IUU A;  5LJ3 d;  5FLX E;  1KD1 C;  2C06 A;  2VV5 A;  4HT9 A;  2O4X B;  2DD4 B;  2G77 A;  2GFU A;  3URG A;  4F7U G;  2P0Q A;  3L2W A;  4N4G A;  3QYE A;  1HK9 A;  1QLB A;  3HKS A;  3JRZ A;  2QQB A;  2K5L A;  2QQA A;  3QJ6 A;  2V8I A;  5D6X A;  1MGQ A;  1H3Z A;  3HL8 A;  3PFS A;  5KCH A;  4OB3 B;  1I5L A;  3J80 E;  2QQ8 A;  1BI1 A;  3VKG A;  4M78 E;  1ZBX A;  3G4S T;  4ELJ A;  3P8H A;  4C92 G;  2NLU A;  5CCA A;  1Q7Y U;  4KUD K;  3V8K A;  3TW7 A;  3VYH B;  3FB9 A;  5GMK j;  3OYD A;  4Z02 A;  3BG9 A;  1WQ7 A;  4LDY A;  4M75 A;  4CI0 C;  4A4E A;  1K8A C;  1FX7 A;  5DLO A;  3L2V A;  3MCA B;  2Y4X A;  3VU3 C;  4PJO F;  3RMQ A;  3VUZ A;  3OS5 A;  2KY9 A;  5HKC A;  2ZPG B;  4OB2 B;  1WJQ A;  4F7U F;  5GAN j;  2HNI A;  4ELZ C;  3OYC A;  1OZ3 A;  2VGN A;  3MEW A;  3DLM A;  2RI3 A;  4WF2 A;  3PGG A;  2FYK A;  4RCB A;  4QVD A;  3JAM E;  4OF1 A;  2PUO B;  3BW1 A;  3OW2 A;  1VIF A;  4LD9 K;  1KC8 U;  4M6V A;  3QSU A;  3CXC S;  2AHJ B;  2E65 A;  4KUI A;  2MF2 A;  4PJO G;  3PIO A;  3G6E T;  4M78 D;  1U1T A;  4C92 F;  3JB9 G;  2HAX A;  4C8Q C;  2PVD B;  1KQS A;  3CD6 A;  3QZ5 B;  2LVM A;  2RD1 A;  5GAN d;  4M7A C;  2XU8 A;  2WSC E;  3F70 A;  5GAN 8;  1LJO A;  1YIJ T;  3CD6 T;  1KQS S;  3A8G B;  2M0O A;  3RES A;  4C0F A;  3QO3 A;  1VIE A;  4IUQ A;  2ZZD B;  4E7L A;  3JCM P;  3MEV A;  2CZ0 B;  1Y96 B;  4HCB A;  2ZGW A;  4JS5 A;  1OYX A;  3QZ9 B;  2D6F A;  3C95 A;  2CYZ B;  1BI2 A;  5GAM g;  2GF7 A;  4ZTF A;  2RJE A;  3OYM A;  3M53 A;  2QQR A;  5I2M A;  2I2L A;  4FT2 A;  2OTJ A;  4PKC C;  3J81 E;  4FIB A;  2IVW A;  4J7F A;  4M75 B;  2JNG A;  4N4I A;  1YJ9 T;  2DEQ A;  4E7K A;  3BFM A;  2DXB B;  4XU3 A;  2BS4 A;  3TW6 A;  3CXC A;  3LW5 E;  1BYM A;  2FHD A;  2RHZ A;  2D9T A;  2YHT A;  3QUI A;  4BY6 C;  2DAQ A;  1G3T A;  1O75 A;  4MFD A;  2JZ2 A;  3CCQ A;  1N8R C;  3CCM T;  1UGS B;  3CCV T;  3WVD B;  2O01 E;  5KE3 A;  1BIB A;  3CBM A;  3G4S A;  5FRM A;  2RA2 A;  2G3R A;  2ZPF B;  2E64 A;  5GAN h;  1X01 A;  5GMK e;  2K2V A;  1KHC A;  4FL6 A;  5C6S A;  4L59 A;  3L2Z A;  4GLK A;  4M77 E;  4ZGJ B;  4A54 A;  2M1H A;  2P0P A;  4QW2 A;  4J8O A;  3UDC A;  3RMS A;  3FRN A;  3H6Z A;  4M78 G;  3C94 A;  3M54 A;  4C8Q B;  1UEB A;  5FRN A;  3NFC A;  1JB0 E;  5GAN e;  3OYL A;  4AI6 A;  2KK4 A;  1DJ7 B;  2B8A A;  5EG2 A;  2X35 A;  3TRE A;  4HNV A;  2JN0 A;  2YLC A;  3DLL A;  1RI0 A;  3CC7 A;  4HCC A;  5FRO A;  3GIB A;  1M1F A;  1M1K U;  2EIF A;  3CPF A;  2DD4 A;  3FDR A;  4A4G A;  2EQM A;  5GAM e;  1VQ7 T;  3WXM B;  1Y96 A;  1E7P A;  5FU6 C;  5A2Q E;  2M16 A;  1KQ2 A;  1NE8 A;  1UGQ B;  2WSF E;  1NJI C;  3QYB A;  1BI3 A;  3M55 A;  2R57 A;  2LX9 A;  4LDU A;  3V7C A;  4E7J A;  2JUF A;  2KVQ G;  3CCS T;  4QSH A;  1FXX A;  1U1S A;  3HZJ A;  4ME7 A;  2MAM A;  2EJG A;  2PQW A;  4XU1 A;  1N6A A;  1GXI E;  3LWI A;  4Z6Y A;  4XQ3 A;  2L8D A;  3VKI A;  4M77 B;  3KHI A;  1VQL A;  5I21 A;  2KSS A;  1D3B A;  3WVE B;  2HQE A;  4M77 D;  2DD5 A;  4N0A A;  3QPH A;  3OA6 A;  1YHQ T;  1YJW T;  2XD0 A;  4NS5 A;  1OZ2 A;  4M78 F;  3M59 A;  2DIQ A;  4ZTJ A;  1W2B S;  1JRI A;  3KBG A;  3OYY A;  4GY5 A;  3A8H B;  2WJ9 A;  2LDM A;  1WJS A;  3QG1 A;  5CKF A;  3X25 B;  4MDW A;  3RIR A;  2LCC A;  4M77 C;  1WPY A;  4OB1 B;  2DTO A;  5CK9 A;  2BS2 A;  2EJF A;  5CKB A;  4R56 A;  1VQM T;  4PJO B;  2XDD A;  4C5I A;  1YIT T;  3S3O A;  4LD6 A;  5LJ3 f;  3A8L B;  3ZEH A;  2PUK B;  3I56 T;  4DOV A;  3PT9 A;  2BKD N;  3CPW S;  4M7D C;  1KG1 A;  1VQ7 A;  2RJC A;  2RK2 A;  2YRV A;  3HBL A;  1YCY A;  5GAO m;  4XK8 E;  4C0Z A;  2ZPB B;  3JSC A;  3M5A A;  3HPW A;  3ME9 A;  5GAM j;  3CCL A;  3CCR T;  2Y4Y A;  1G3S A;  1WQW A;  4JJN K;  2EQK A;  4MZM A;  1VQ9 A;  4VUB A;  1K9M C;  2X4X A;  3NTI A;  3CC2 T;  2MWP A;  4XAX B;  4M7A F;  3O8V A;  5FU6 B;  1YI2 T;  4KUL A;  3M4Y A;  2HBP A;  4JX5 A;  3GOX A;  2ZCF B;  2L3R A;  5GMK l;  5IN1 A;  4E7I A;  2XI9 A;  3OS2 A;  4JX6 A;  5CIU A;  1I8F A;  1I4K 1;  3OY9 A;  1G5V A;  1M9S A;  5KH6 A;  1N9R A;  3CCU T;  1K73 U;  1QVP A;  4BAC A;  5HK0 A;  4ZGD B;  2WAC A;  4C8Q D;  1D3B B;  1XOV A;  3OMC A;  2P0K A;  1W2B A;  4UC4 A;  5HK3 A;  5LJ5 f;  1UGR B;  4AKI A;  3OYK A;  2QA4 T;  1YJN A;  3OSV A;  5GMK i;  3GF5 A;  4JX4 A;  2BS3 A;  2R5A A;  3BDU A;  4BE1 A;  3QYG B;  3OBY A;  2QFZ A;  1P92 A;  2DK3 A;  3FEO A;  3VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...