3X25B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 700 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x25B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x25B02
2CZ6B 2CYZB 4RKUE 2ZZDB 2DXCB 2PUOB 4L6V5 2PVDB 3QYGB 3VYGA 1UGRB 3X24B 4ZGEB 3VYHB 4ZGJB 3A8OB 2ZPBB 2O01E 3X25B 1PSEA 2ZZDA 2DXCA 1IREB 2DD4B 3X20B 2CZ1B 1PSFA 2PVGB 2CZ7B 1DJ7B 1UGPB 2WSFE 2D0QB 2DD4A 2ZPGB 2ZCFB 1GXIE 1UGSB 4XK8E 1UGQB 2ZPEB 2ZPHB 1QP3A 2PVOB 4ZGDB 4FM4B 3QZ5B 3QYHB 5L8RE 1AHJB 2DD5B 2AHJB 4OB1B 2CZ0B 3A8HB 3X26B 2DD5A 4OB3B 3WVEB 4OB0B 2QDYB 3A8GB 2DXBB 2WSEE 3HHTB 3LW5E 1JB0E 1QP2A 3QZ9B 2DPPB 1V29B 3QXEB 2PUKB 3A8LB 2DXBA 4KT0E 2ZPFB 2WSCE 4OB2B 2ZPIB 3VYGB 2PU9B 3X28B 3A8MB 4Y28E 3WVDB
chains in the Genus database with same CATH superfamily
2HZYA 2OAWA 5GAN2 4IUQA 4BE1A 4BY6C 1NLPC 1TG0A 4B9WA 2V8JA 3QYBA 1AZGB 1D0XA 1X6GA 4LNPA 3ER0A 2DXCB 4KBMB 4D8KA 1VQ4T 4O5VA 5I21A 2IG0A 2HBPA 1G8XA 4M75A 1MV0B 3H9NA 1W2BA 3CQTA 2X3WD 5GMKh 1UEBA 4CFMB 2CP0A 1S1NA 2CCHB 4KGVB 1UNLD 4PFPA 3JV3A 1ZQ1A 4YC3B 2FPDA 4OF1A 2NYSA 2PJQA 2WJ9A 2DL8A 2EYXA 1YCSB 2ZGWA 3KFVA 1TWBA 4PLLA 2KDSA 3OYKA 4EMKC 2LW4A 2HQHA 1VQKQ 1UGSB 3PIPA 2RHYA 4XU1A 4PNOA 4LDXA 2JS0A 4ROEA 3OYYA 4BCJB 1WFWA 1NE8A 4IIOA 1IRXA 1GUXA 5CYIB 3EGXB 2BS4A 1VQ8A 3FB9A 4XTXA 3RR6A 3ZEHA 1WA7A 2RJFA 2V8IA 2LNHB 3QG1A 5J26A 1WNLA 4A63B 3NMZC 4R0KA 1R0BG 3GBQA 3OYEA 5LJ5f 4J6XA 1G2BA 1U1TA 3MIAB 4UN0A 2WSEE 1KSWA 1VQ5T 5IN1A 3JCMb 2DERA 4M75G 2C5OB 2O9SA 1QVGS 4BCGB 4OMQA 1Y96A 2J6OA 3OSVA 3I56A 2K2VA 3HSBA 3HB9A 4BCQB 3HKSA 2M0OA 3A98A 4QT7A 3UDCA 3MO8A 1N8RC 2QA4A 4ZN3A 2E41A 1YI2Q 3JSCA 4AT1B 4M7DC 2DEQA 1QWEA 2BTTA 1Q86C 2I53A 1ZA1B 2Y4YA 4A54A 2K79A 2OTLQ 1UFFA 4M7DE 5FU7B 2RJDA 2DMOA 2DZ9A 2F2XA 2BUDA 1OEBA 1B07A 3CC2T 5CIUA 1H27B 2F1LA 4M78C 4JDSA 2LJ1A 2EWNA 3CCEA 2E10A 3I5RA 1PM3A 2AKKA 4M77F 5GAN6 2JTMA 3LWIA 1H28B 4CFVB 1JJ2P 3M0PA 1VYVA 3RBBB 2VB6A 5KYNA 2IW9B 1OKWB 4C92F 1YWPA 4YTLA 1AWWA 3CPWA 1H1QB 1NG2A 3V8LA 1K1ZA 5C0MA 3G6EQ 1ZSGA 2X4YA 5I22A 1G83A 2LTOA 3CXCA 1W2BP 1I1JA 2LT4A 5FWCA 1KD1C 2GCXA 4CFNB 5LJ5e 4MDXA 1UGQB 2ZPHB 4AKHA 2LQNA 4CFUB 3CCSQ 3LX7A 4ZTJA 2H8HA 5EG2A 1OL2B 3JAME 3BDLA 4F7UE 1SSHA 1K73U 3EAEA 3BHVB 2F2WA 3PMTA 3DLMA 1C1AA 1IB8A 4J9FA 2W2HA 2DYBA 4IUUA 1FWZA 3CMAT 1MHNA 4M77D 1M27C 2DM1A 5LL6S 1TUDA 4OB3B 2YRCA 3CC4Q 1OPKA 2QDYB 1VQMT 1QVFA 1W70A 2EUFA 1WJRA 3URGA 5ACBA 4C0DB 2C0TA 4C92D 4JX4A 1KQSS 1JEGA 1OI9B 3HTRA 1XJWB 6AT1B 3BY7A 4F14A 1GBRA 2RM4A 1VQ6T 2K7AA 3HFNA 5GANf 1U8RA 1ABOA 4BXXX 4Z02A 1BB9A 1ZX6A 2O88A 4MIMA 1RLPC 1YITA 1OZ3A 1NEBA 2MYSA 1D3BB 1H4LD 4QQDA 2B8AA 2RD1A 2RN8A 1YHQQ 5GAMh 4ELZC 2E3HA 2M9UA 3WVDB 1RL2A 2VXFA 3G4SQ 3SWNC 1ZSZA 4OMNA 5KYXA 1VQNQ 2L0AA 3RERA 1VQOT 3JCMX 1ZHIA 4MMKA 4N4GA 1RACB 2DA9A 4A4FA 2O01E 5HVYB 2CJMB 3BDUA 5KE3A 5GANj 4X34A 2XHCA 1GCPA 5EJCA 2CZ1B 1B3QA 5L23A 2PHGA 4C8QB 2P4RA 4D6WA 1ABQA 1IHWA 4HL4A 2ZCFB 2DRMA 3I9QA 2J06A 2EFIA 1BCMA 1M3AA 3RKWA 2IW6B 3GNFB 3TEEA 2EQMA 3CCQT 4M4ZA 3UPUA 1VA7A 3MP6A 3TN8B 5LJ3j 1KC8R 3I35A 2LP5A 3OW2A 4M7AG 1JO8A 3CCRA 3CPWP 1Q7YR 1QVPA 5GANe 3CCMQ 2QI2A 1BU1A 2FB7A 5M9OA 1VQ9Q 2KROA 2E4HA 2DD5A 4CRLB 4F7LB 4GY5A 4N0AC 4AI6A 3RKYA 2RQUA 3CXCP 1JXMA 1OIUB 5GMKi 2VUBA 5FU7C 3CC7Q 2W10A 2SRCA 2WACA 3V8KA 1Z9QA 2PUKB 4HNUA 2G6FX 3ME9A 2P0QA 3JB9J 4NL2A 2LT1A 2JMCA 1YP5A 4EIKA 2VGMA 2JOYA 4JRQA 1SHGA 5KCHA 3AHUA 2L5QA 3EGXA 2BKDN 2L89A 3VKHA 5ICPB 2YLCA 3O0GD 1QVFP 4DQ2A 3QSUA 1KD1U 3NPFA 4M75B 1QMZB 4CRIA 1JQQA 3MI9B 3VUZA 4CC7A 3TNIB 4CXAB 1OPLA 3JCMd 2CT4A 1KJWA 3KHIA 1K76A 4L6V5 2QQBA 1YJWA 4CC2A 2I40B 2JVVA 3NFCA 2NWMA 1TXQA 1GL5A 5GAOl 4FYWB 3CD6A 3JB9H 4HCKA 1E6GA 3CCUQ 3PT9A 1OX9A 2JM8A 1UB4A 1XO2A 1B34A 5HK3A 3X20B 2R5MA 4NOYA 4C0ZA 4FT2A 3NTHA 1VQLT 1E6HA 4J6YA 4RTYA 3ULRB 3MEWA 5I2MA 5FRMA 2YRDA 2EKHA 1GUXB 2DVEA 2WSFE 2YSQA 2HCKA 5HBEB 2WXVB 4J6WA 4XK8E 1KQ2A 4O6JA 1BU2A 3SFMA 3T9NA 2CP7A 2C4GB 3REBB 5KH6A 5GAOr 1NYFA 4C0FA 2QEXQ 4M77A 2P0KA 2CZ0B 2GFUA 4DBRA 3EIDB 2VVKA 3AT1B 3RNJA 1WX6A 5I2SA 4EC8B 4HA8A 2IN3A 4C92A 2RJCA 2XKOC 5IT9E 3M57A 1JKWA 2RQRA 2G3RA 1YJ9T 2HSEB 1VQ4Q 2R58A 4EOJB 4MDWA 3RKXA 2O2OA 3OW2P 1FXXA 1XNIA 1WI7A 3VU3C 4X1VA 4A53A 2MWPA 3GIBA 2WIPB 1YIJT 5J39A 1M4ZA 1VQKA 3QO3A 2FPFA 2DIGA 2A08A 1EX4A 2BE9B 3A8MB 2FL7A 1YBYA 4C8QC 1WGSA 5ECAA 4HCCA 1RAEB 2YLBA 2EGEA 2K5LA 4FYYB 1NJIR 2H3JA 3CPFA 4C8QE 4DBHA 2W9ZA 1UGRB 3HRSA 1IGUA 3VYHB 4BI3A 1Q82C 4M77G 1C9BA 4JRKA 2BZ8A 4J7FA 4LN2A 2HEQA 4UC4A 2A0FB 4BACA 1WXBA 4DEXA 4LE9A 1EIFA 1W4SA 2L2PA 2JNGA 2LC4A 4Y92A 3I56T 2V1QA 3EHRA 5GAN3 1X43A 1VQ5Q 2XDPA 4XQ3A 1YI2A 2WIHB 1W98B 2ZPEB 1ARKA 2HDAA 4OR5B 1BKBA 2YUQA 3G71T 3C94A 3CCLT 3MEUA 2K57A 2OTLA 4BY7X 2MPXC 2L3SA 3QHSA 1GCQC 3F5XB 2G9XB 2M51A 1FKMA 2KBTA 4RCCA 2CCIB 2KSSA 4PKCC 2FRWA 3REAB 2L3PA 2CH4W 1TTHB 3CC2Q 2KNBB 4M75C 3PVLA 3M4GA 2VASA 1X6BA 4IURA 4M7AF 3QZ9B 4M7AB 1RI0A 2R5AA 3A8LB 2KE9A 2MI6A 1G3WA 4M75E 5FW9A 1N5ZA 3OYJA 2ROTA 3G6EA 4P5NA 2HAXA 3TW7A 1WJSA 4DA4A 4AMCA 5DQVA 5GAOm 4QVDA 4JRPA 1KC8U 2VYTA 5KYXB 3OQ5A 7AT1B 3OYDA 1Q7YU 3EG2A 3HRTA 1M8MA 4A4GA 3GOXA 3X28B 1UNGD 1E7PA 1SEMA 2C0OA 4X9DA 5HY6A 2QDJA 2DL4A 2DMEA 1AEYA 3EG0A 1H26B 4KGZB 4M7DD 3OS0A 3MHXA 3X24B 3IQLA 3V7RA 3H6ZA 1K8AC 4JZ3A 3J80E 3CC4A 3M5AA 3I55A 1BI1A 2RK1A 3DL1A 3CMAQ 2E5KA 3VRZA 1OKVB 1N8RR 2OTJT 4C5EA 3DOGB 1NYGA 4XTVA 4DOVA 1X2QA 1VQMQ 4PJNA 4FT4A 1PKTA 2F69A 1Q86R 2QAZA 4EOIB 3LH5A 2YUOA 1RLQC 1X69A 3LGLA 1I4K1 2J6KA 2ESWA 3TU4K 1YITT 1VQ6Q 3QDFA 4RTUA 2GQIA 8AT1B 3L2UA 1YHQA 2KMGA 4ORZA 1RAFB 3CCVA 2QXFA 2DD5B 4RMOA 5D6YA 3G4SA 4OB1B 1D1BA 2EYZA 4DBQA 2C5NB 1D1CA 4EOQB 1LOJA 4CC3A 2KXCA 1VQNA 1ZBJA 5GANh 3B57A 2FHDA 2MMPA 1S72T 4ZNXA 3JCMc 3TREA 2FRYA 5GAN8 1M2OA 2LMJA 1RUWA 3A1PA 3VV0A 3V7SA 5HCKA 1EZZB 1MV3A 1VQOQ 3V8JA 1W6XA 4E7KA 1M90C 4OGCA 4MMLA 2O9VA 3OBYA 3PMIA 2DBKA 5EC7A 2W99A 1KD1R 2DRKA 3R6OA 1AWJA 1PHTA 2ENMA 5LJ3h 1QCFA 2X9HA 4X9CA 1H1RB 1LCKA 2HMAA 3EGUA 4Y28E 4FYVB 3M58A 3Q1JA 2FO0A 2X1NB 1URCB 1ZUYA 2PVDB 3QYGB 1B34B 4II5B 3M59A 5KYUB 2P4TA 4BCOB 3CCQQ 1JSTB 1VQ9A 4QVCA 4AFZC 3M4YA 2GNCA 4GLMA 3OYAA 1V76A 2E12A 4WTOB 3DJBA 5CKBA 4F6UB 5DQWA 3L2VA 1RADB 2IPOB 3MKDA 3UA7A 4R56A 1GFCA 3CC7A 1M30A 2K4YA 1D09B 1UJYA 3RMSA 1RAHB 3SDZA 4EORB 1G3YA 2LCCA 5GMKl 4PJMA 4R55A 1DJ7B 4DOWA 2XIDA 3M53A 4BB7A 2DD4A 3BE3A 1AOJA 4M78E 1KXUA 1UJ0A 4M77B 4QQ6A 3NGPA 3VUBA 2A37A 2D9TA 2EYQA 5FRNA 4KH1B 3R6NA 3BLRB 1NJIU 4BDZA 1Y57A 4JX5A 3LYIA 4LDWA 3FDRA 2GQVA 4C92B 2E5QA 1M1GA 4PJOG 4EOPB 4NSTB 3A8HB 4AFUC 2BS3A 2DLPA 3EG1A 4XTUA 1WHGA 3E19A 1MMAA 2K2MA 1ZSZC 4IUTA 4M6VA 2CREA 3PO3S 2E3IA 1UECA 5LJ5d 3ASKA 2ROLA 4RUGA 3V7CA 3CD6T 1ZUUA 1VQPT 1QP2A 5GAN5 1YNZA 1UHFA 3HL8A 3O8VA 2DO3A 3H41A 1Q81C 1WIEA 4ESRA 1TFBA 2KXDA 4QW2A 1PKDB 1VQLQ 3JCMJ 4IIMA 2X4JA 4YOSA 2BPMB 1FMVA 5GAOq 3CCJQ 4BBRM 2QGFB 4N4IA 2KY9A 4OGEA 4FW1A 1TUGB 2ABLA 2VC8A 2QEXA 1BIBA 4BDYA 1M8VA 1YFNA 3EG9A 4MZPA 2KRNA 2MIOA 5IHNA 3DB3A 3HZJA 2JW4A 2DJZA 4RG2A 3SB2A 4M7AA 1P5EB 3X25B 3EHQA 4LUEA 2ZZDA 2Y90A 2QGGA 2KT1A 1VQ4A 5I11A 3EGDA 3PE0A 3QDRB 1Z9ZA 4QVZA 3SHWA 4CI0C 2C06A 4F70B 3HPWA 2LJ0A 1UTIA 4PK4A 1SF9A 2YUNA 1TSFA 3RGFB 1QMCA 1YJ9Q 5LJ3f 2GGRA 2DTIA 2DL3A 1QCOA 1JJ2S 3OYNA 3BLQB 2CP2A 1CKAA 4J7IA 4BCMD 1I8FA 5CKFA 2LZ6B 4JJBA 5HKCA 2IVWA 3LLRA 4J9BA 4DBFA 1RI9A 1D3UB 3M0TA 1YIJQ 4I3ZB 1I5OB 2VV5A 1AWOA 3POMA 2DZCA 1MMDA 1H1PB 2EGAA 1W2BS 1VQ7A 1X01A 4M7DG 4NC6A 5A2QE 2GTOA 3VS1A 1N8RU 5CAIA 3OS1A 2WMBB 4EPCA 3JB9D 3HO8A 1BCOA 3JCMf 5IXBA 2K5IA 4EMGA 5CKEA 3DDPB 5LJ5g 1Q86U 2DBMA 3QIIA 5DY9A 2DPPB 1UHCA 4GLKA 2ED0A 2QQSA 1QKWA 2DXBA 5FU6B 3QPHA 5GAOp 4KT0E 3GTMS 1MMGA 4KGXB 1VQ5A 2D8HA 5LMKB 5HQ0B 2RJEA 2WSCE 1WJQA 2NUTA 2C5VB 1VUBA 1O75A 1YN8A 2QTXA 1J3TA 2RNAA 4BE2A 2HKQB 4HCZA 2KI7A 3JB9I 3I56Q 3EFRA 5GJVB 2CS7A 3QJ6A 2WPAB 3QWYA 2LJ3A 5GMKm 2JTFA 3QKJA 1O9KA 1YJNT 3JCMW 1HK9A 3VYGA 1GRIA 4JZ4A 2HKNA 2KEAA 3M9QA 3G71Q 5LJ3e 3CCLQ 2WMAB 3LWHA 2CUBA 1E9HB 3BHUB 4M77C 4F7UG 5HNBB 1WPYA 4F16A 3CC2A 1XOVA 3EOCB 3CMET 1KFZA 3TNHB 4NL3A 2GF7A 2B9RA 1IZ6A 2K6DA 3UF4A 4C92C 4JLIA 3EFSA 2G77A 4PL6A 1HJDA 4RTVA 5KYWB 4LDYA 2DTHA 3EH2A 1OU8A 1UGPB 4QQGA 4C92E 4AKIA 2RHIA 2DX1A 1GXIE 3BG9A 5CKHA 1QP3A 1FMWA 3BFMA 3CBPA 4XU0A 3JCMe 1H92A 3OYGA 1QWFA 2HBWA 3QYHB 5KYUA 2BZXA 1AHJB 2OI3A 2QFZA 4OMMA 1T3LA 4HVUA 1WXTA 5DLQE 1FMKA 3J81E 1ACMB 1RABB 4XU2A 2M1HA 4RG8A 4CFWB 2FZKB 1R8OB 4LDUA 1M1KC 4HT8A 4YOOA 2K3YA 4E47A 1D0ZA 2M0YA 5IAYA 2R57A 1JSUB 4F7NB 2BZYA 5CEIB 2D6FA 4II1A 4BCND 1WHMA 3PNWC 1WLPB 1LVKA 2JM9A 4C0DC 3EFOA 2Z0WA 5IDNB 3CMAA 2XICA 3I55T 1FINB 2QQAA 2L3QA 5AYFA 3CPWS 4PJOF 1AISB 5CR2A 5D7UA 3FJPA 2HD0A 1P92A 3MY5B 2PZ1A 1BIAA 2ZPFB 2UZBB 3OS2A 3CXCS 1NBEB 5GANg 3S6WA 2JS2A 2OTJQ 2M02A 4HNTA 4QKUA 4KH0B 1VYUA 2JT4A 1NZ9A 9ATCB 1T0JA 4HVWA 1WHJA 4FX3B 1OOTA 2RPNA 3CCVT 2LX9A 2E70A 2LX7A 4BCFB 2COWA 1WHKA 1YITQ 1K9MC 2DXTA 3A8OB 2V26A 4OGRB 2ZPBB 2DTOA 3FEOA 1IXDA 5CVIA 1ZUKA 1QVFS 2BS2A 2L8DA 4C5IA 2EYWA 1I81A 1IO6A 5GAN4 2DD4B 3P8DA 4J9EA 1FYNA 4HLQA 1VQOA 4PJOD 4BE0A 1PRMC 2PVGB 2RI5A 1S72Q 3TNWB 1BK2A 2PMIB 3TW6A 1H1SB 1VOMA 1VQ8T 1U1SA 2ATCB 2FG0A 2ED1A 2JTEA 1QCNA 1AZEA 4PJJA 4A4KA 3C0CA 2JUFA 1N9RA 4FM4B 3MEAA 1VIEA 2AT1B 4E7HA 1BYMA 5GAOn 1PG5B 5GAMd 4E6RA 2EQJA 4EOOB 2NLUA 2UZDB 3C4SA 4G6LB 3MPUB 5FU6C 1K8AR 3N5BB 2KK4A 1QLBA 3NHNA 4OP0A 2QTVA 2MCNA 4C5HA 1OU9A 1WZOA 3RESA 3CCQA 3P8HA 5FLXE 3L2WA 2QA4T 3P8BB 2DVJA 4Z6YA 2V1RA 2J05A 3FLGA 1H3ZA 2XDDA 2AK5A 4JRIA 1JB0E 1RAGB 1IGQA 2HQXA 2EAYA 2NUPA 3CBOA 1HXDA 2K9GA 3CC7T 1UNHD 3OYBA 3OYIA 3L2RA 4M7DF 5DM7R 2BIVA 4M7DB 4KRDB 3GF5A 1T0HA 2COZA 4HVVA 3CCET 4EOLB 1C0MA 3EG9B 1XTDA 2E6NA 3RDVA 3A5ZB 5CQXA 4Z89A 4ZN1A 4M78F 4WF2A 3OW2S 3H0FA 2JXBA 4RKUE 5A0GA 1VYTA 2CT3A 2ZZDB 5FROA 2RK2A 1NPRA 3EGDB 3VS4A 4Y72B 4ZGEB 2RF0A 1WYXA 4OMOA 2DKGA 2MF2A 1PD1A 2RQTA 1ENWA 1PSEA 2KR6A 1HYOA 1M90R 3CCSA 2EW3A 1K0XA 1IREB 3JCMQ 2GBQA 5KE2A 3JB9G 1PSFA 4AFSC 2PTKA 2A36A 5HK0A 2PNIA 2LDMA 4B9XA 2CZ7B 1W1FA 2CH4A 4IUPA 3OYMA 4HKEA 2LQWA 3H4CA 3HP9A 1GFDA 2JJ9A 2D0QB 2ZPGB 1D0YA 2FPEA 3TQ7P 4F7UF 3CD6Q 2QK0A 1OQKA 1VQPQ 4F7UB 2DF6A 4ELYC 1FX7A 2KYMA 4XTWA 1PRLC 1BI3A 2GTJA 4F17A 1TUCA 4M78D 1RAIB 3CCJA 1QVGP 3H8ZA 4V2SA 2DIQA 4ANJA 1WHHA 5EFQB 4ELJA 5BNJB 2CP6A 5GAMg 3OMCA 3THKA 1BI2A 1M5Q1 2QEXT 3H0HA 5IF1B 2DK3A 4JJDA 3X26B 2HQEA 1SRMA 1R0CB 2FVUA 4PFZA 4RCBA 4FL6A 1K73C 2A7YA 2DXBB 3HHTB 2AKLA 4FU6A 5KYWA 3JRZA 2F5KA 2XMFA 1WDXA 2LVMA 2YRVA 2P0PA 4C8QG 1SKUB 2NUTB 4PJLA 3MCAB 5CCAA 3NTKA 5FGKB 2E65A 2LNVA 2IW8B 2F2VA 2DE0X 3C12A 3L42A 3M0SA 1Y07A 4Z88A 2CSIA 1YJ9A 5AT1B 2DEUA 3GP8A 4F6WB 1AD5A 2IIMA 1Y0MA 1O9KB 3L2QA 1G3SA 3VYGB 1U3OA 3C95A 4JPBW 2D1XA 2NUZA 1Q82U 1VIFA 2XU8A 3SWNB 4MZMA 1YIJA 4EC9B 2EJ9A 4KRCB 2X4WA 2FZCB 1A0NB 4TVRA 3QHRB 2COYA 1KK7A 2XK0A 4AKGA 5IH2A 1VQ7T 4PJOA 3ZL7C 2PK2A 4HCBA 4K11A 3BLHB 2QF7A 5CQYA 5IXFA 5DLOA 3OYCA 1Q81R 1UUEA 4Y91A 2FYKA 3KXTA 1MNEA 3M0QA 1M2VB 3CEYA 3CCMA 2EIFA 3CCRT 5IDPB 1YCYA 4VUBA 1GY3B 1B7TA 2W96A 1CSKA 3MEVA 4BD3A 4JJCA 1CKBA 1N6AA 1KQ1A 1D1AA 2HNIA 3I5SA 3QUIA 1ZBXA 2D8JA 3JCMh 1KQSP 5IHIA 3FJ5A 1NEGA 5A0DA 1T3SA 3NDQA 3PGGA 3JCMV 4JLGA 1G5VA 2FZGB 3EFOB 1Y7XA 2C6TB 3G71A 1JBMA 5CK9A 3CCLA 2I0NA 1JXOA 1H8KA 3WVEB 4MZTA 3MY1B 3RMQA 1PC0A 2KT8A 3H0IA 1WQWA 1E7OA 1YJNQ 4GBQA 2LQ8A 3G1JA 3GPLA 4BCIB 2X4XA 3BHTB 3K7AM 4EMKA 1V29B 4IUVA 2RH2A 4M7AC 2EJGA 5LJ5j 1XQHA 2VWFA 2W9FA 5CKDA 3OS5A 2KRSA 2KR3A 4M7AE 1H25B 1MMNA 3CMEQ 4F7SB 3OB9A 2XD0A 1YJWT 2P84A 3VS0A 3VKGA 4BBSM 3HBLA 2UZEB 2VXEA 3CCUA 4RODA 1MGQA 1K8AU 4BCQD 1N9SA 2CZ6B 1LPLA 3OYHA 3META 1IHVA 4RTZA 4TTHA 5C6SA 3M55A 3FIFA 1OIYB 3VKIA 1X27A 2DILA 4RTWA 2YUPA 4BI4A 3ZFJA 1N4MA 4BY1X 2YXYA 1TD6A 2OX7A 2F2CA 2QASA 2H3EB 3O5ZA 4BCMB 5KYYA 4M7DA 4OMPA 1VYWB 4LXCA 1EFNA 1F1BB 2RI2A 2IVXA 3GNGA 4ATOA 5A0LA 3I55Q 2WFYB 4ZGDB 4M78A 2KAFA 3EH1A 1NPPA 2I2LA 2OTJA 4FCYA 2O4XB 1OX8A 3JB9F 3BW1A 3OBWA 2E64A 3D7SB 4E7SA 2M16A 4IKFA 4BI8B 2DL7A 1WQ7A 3E1SA 1TOVA 2RI3A 2W0ZA 1M90U 1M3CA 2KYBA 1X6OA 2RO0A 2BE7D 4CFUD 3VS6A 1ZA2B 2K3XA 2NUPB 1V1CA 1JOWA 2LCLA 3QHWB 3DB4A 4FIBA 3TSWA 2UZLB 5CO7A 2KRMA 1M3BA 1HD3A 1K9AA 2KQWA 1OI1A 3E2UA 3G7ZA 4WCIA 3CCVQ 1VQKT 3LW5E 2DNUA 5GJWB 2WEVB 5KCOA 5GMKj 3PFSA 4XTYA 4J8OA 3DLLA 2RHZA 2A3LA 2EQIA 4F7UA 1S72A 1LJOA 2EBPA 4YOZA 2JMAA 4JS5A 4PFOA 2EPDA 2MAMA 1H3HA 3BG5A 1NLOC 4E7JA 1SSFA 4F04B 4QSHA 2EGCA 1ZP2A 4OB2B 2RA2A 2CGHA 1AVZC 5FWBA 3DTOA 3F70A 4J5YA 4XTZA 4RTXA 4C8QF 1VQ8Q 1OULA 2L3RA 1SHFA 1M1KR 4M78G 2ZAEA 2XG8D 3OY9A 1AWXA 5GMKe 3UATA 5GANd 3MP1A 4ZGJB 2CSQA 2DETA 4ROCA 2CP3A 3J7AF 2DXCA 1YI2T 4KUDK 1WXUA 3KUFA 1SG5A 2DAQA 3LQ5B 2EJFA 4LDVA 4BUGA 4EOMB 1I5LA 2OTLT 4EONB 3E9GA 2QA4Q 5IHKA 1PD0A 1H24B 3OMGA 3U23A 8ATCB 1QW1A 5LJ3d 3DDQB 3SWNA 3G33B 1JRIA 4C8QD 4LD6A 1M1FA 3NTIA 4MFEA 4BCNB 4M77E 2DFUA 4C5GA 2HL3A 2SEMA 1TU0B 2DYIA 2QQ9A 1K9MR 4L5GA 2RHXA 3CCEQ 2D0NA 3EG3A 1AT1B 1R77A 1KG1A 4AFQC 2PK9B 1X2KA 3QWLA 3FC3A 2KVQG 3G6ET 3EJ1B 4OB0B 1Q81U 4M75F 3M56A 4KULA 2RQVA 3VRYA 4LD9K 4FSXA 1M2VA 4RTTA 2MOXA 2PQWA 2MWOA 1BBZA 3M0UA 5LQFB 3CCST 3TSZA 4HNVA 2VGNA 2OAUA 3HFOA 2EQKA 3GLXA 4A4EA 1Q82R 2CUDA 1TH7A 4EOKB 3PTAA 3BG3A 1U06A 2AZSA 1VQPA 1SRLA 2LRQA 3VJPA 3MP8A 2ZPIB 2PU9B 3KBGA 3RIRA 4KRTA 3VS5A 1X75C 1VINA 2QQRA 1KHIA 3CC4T 1M9SA 3DKMA 3TVTA 3TCJA 2JN0A 4OMLA 4N0AA 1TS9A 1G3TA 4DEYA 4F6SB 3CCJT 4PJOB 1KC8C 1K4US 3OYFA 1VQMA 2YDLA 1I0CA 1PNJA 1Q7YC 1FVVB 5HBJB 4M75D 2MK5A 5GAMf 4EOSB 4A4HA 5I5ZB 3PVQA 3M03A 1VQ6A 3LGFA 1K0SA 3UA6A 4BY6B 2KMTA 1UGVA 2J6FA 1YHQT 4E7ZA 2ECZA 1QQJA 1Y96B 3VS2A 4EDUA 3G4ST 3CBMA 1WHLA 3WXMB 1VQNT 2CKKA 2V22B 1OYXA 2CP5A 1VOLA 3S3MA 1O9SA 3QJYA 1OL1B 4LOCA 3M0RA 3QZ5B 5LJ3g 4LUDA 1QVGA 3SD4A 2X51A 5L8RE 2HSPA 3LH0A 2RB6A 4IMYB 4B6MA 1OZ2A 2O31A 3VS7A 4CFXB 4XU3A 4J9CA 5GAMj 1KHCA 2OJ2A 2XDBA 2K3BA 2GFAA 1SPKA 1PCXA 1NM7A 2C0IA 4EMKB 2YT6A 1ZLMA 2QQ8A 4Z8AA 1C6VX 1YWOA 4HXJA 4HT9A 3A8GB 1GBQA 2KGTA 4E7IA 3L2ZA 4MFDA 5L2WB 2K5FA 4XAXB 3JCMg 4BCHB 2DXUA 1VQ7Q 2CDTA 2O4XA 1HSQA 4ELLA 1KIKA 3OYLA 2JZ2A 4OMFB 5GAMe 3CCMT 1N27A 2JGZB 4J83A 1VQ9T 2QGSA 3UWNA 2YHTA 2CYZB 4C92G 4AG2C 4JX6A 2VKNA 2FEIA 3CCRQ 3JCMP 1D3BA 2DL5A 4JJNK 3OA6A 2PUOB 4FSSA 4C0GA 1K73R 4D8DA 3HRUA 5KYYB 5D6XA 4PLIA 1PKSA 2QDLA 1F5QB 3RUXA 5LJ5h 1BI0A 5IHYA 2Y4XA 1MUZA 1OV3A 4FW2A 1PWTA 1Q95G 2J7IA 1YJNA 3OSSC 4ME7A 4OVAA 4M78B 2BKZB 5J3BA 2X3XD 4CC4B 1I07A 3CMEA 2AZVA 3INZA 4C8QA 3QWXX 2UUEB 1LNXA 2PVOB 3UT1A 2EVRA 1M1KU 2LCSA 2C5XB 3SEMA 3PIOA 4Q5WA 2WHBB 2R7GA 3QYEA 3MJXA 1H641 4J9DA 1KQSA 1U5SA 4J9HA 2QG9B 3L1AA 1JU5C 2AHJB 4N4HA 3CCUT 4JUVA 1QLYA 2RHUA 2E6ZA 4J9GA 1YJWQ 1MNDA 2LQKA 1UE9A 1RAAB 2X35A 4NS5A 4ZTFA 1NJIC 1ZSZB 2EYYA 4BCKB 2A28A 2YWWA 3FRNA 3S3NA 3ZBDA 2EQUA 1Y71A 2HL5C 1VQLA 2AIRB 5GAN7 2RMOA 2EKOA 3VS3A 4J9IA 5HBHB 4BCPB 2E1HA 2XI9A 1OGUB 4E2FB 4E7LA 4JS4A 3QXEB 2V8KA 4AG1C 4PJOC 1GH6B 2QYZA 2RQWA 3QBYA 5D6WA 4EMHA 4L59A 3E9FA 1AD6A 1QKXA 4FYXB 3S3OA 4PJOE 1JJ2A 2DJQA 2F5TX 1K9MU 1GCQA 1G3NC 1UDLA 4KUIA 4M7AD 4F7JB 2B86A 1UG1A 3M54A
chains in the Genus database with same CATH topology
3QJ6A 2CZ6B 4C8QC 1WGSA 5GAN2 3OYHA 4IUQA 3JCMX 3META 4BE1A 4BY6C 4HCCA 2YLBA 4B9WA 2JTFA 5GMKm 2V8JA 2K5LA 3QYBA 3QKJA 3ER0A 2DXCB 4KBMB 3JCMW 2H3JA 3CPFA 4O5VA 5C6SA 5I21A 1VQ4T 1YJNT 1HK9A 2IG0A 2HBPA 3M55A 3VYGA 3FIFA 4M75A 3M9QA 4C8QE 3VKIA 5LJ3e 1W2BA 1UGRB 3HRSA 3LWHA 3VYHB 4BI3A 5GMKh 1UEBA 4M77C 1Q82C 4M77G 4F7UG 4JRKA 4BI4A 4J7FA 1WPYA 3ZFJA 3CC2A 1XOVA 1ZQ1A 3CMET 4UC4A 4BACA 4NL3A 2GF7A 1IZ6A 4C92C 4JLIA 1EIFA 4OF1A 4M7DA 3EFSA 2G77A 2WJ9A 1W4SA 4PL6A 2JNGA 4LDYA 2LC4A 2ZGWA 2RI2A 3I56T 2DTHA 4PLLA 1UGPB 4QQGA 4C92E 4AKIA 5GAN3 2RHIA 2XDPA 4XQ3A 2KDSA 3OYKA 4EMKC 1YI2A 1GXIE 3BG9A 1UGSB 3PIPA 3GNGA 2ZPEB 4ATOA 2RHYA 5CKHA 5A0LA 1QP3A 4XU1A 4ZGDB 4M78A 2KAFA 4PNOA 3BFMA 1BKBA 4LDXA 2I2LA 1NPPA 3CBPA 4XU0A 3JCMe 3G71T 3C94A 3OYYA 2OTJA 3CCLT 3MEUA 2O4XB 3OYGA 2K57A 1NE8A 2OTLA 3JB9F 3BW1A 3OBWA 3QYHB 2BS4A 1VQ8A 1AHJB 2QFZA 2E64A 3FB9A 4XTXA 3QHSA 3ZEHA 2RJFA 2M16A 5DLQE 4IKFA 4BI8B 3J81E 4XU2A 2M1HA 2V8IA 4RG8A 1WQ7A 3E1SA 1FKMA 3QG1A 5J26A 1WNLA 1R8OB 2RI3A 4LDUA 2KSSA 4RCCA 4PKCC 1M1KC 4HT8A 1M90U 2K3YA 4E47A 1X6OA 2RO0A 5IAYA 2R57A 2K3XA 3OYEA 5LJ5f 2LCLA 2D6FA 4J6XA 4II1A 3DB4A 4FIBA 3PNWC 5CO7A 1U1TA 2WSEE 2KQWA 4M75C 1OI1A 5IN1A 3G7ZA 3JCMb 4M75G 3M4GA 1VQ5T 4C0DC 1QVGS 1VQKT 3LW5E 5KCOA 1Y96A 4IURA 5GMKj 3OSVA 3CMAA 2XICA 3I55T 3PFSA 4XTYA 3QZ9B 2QQAA 4J8OA 3I56A 4M7AB 5AYFA 2K2VA 3CPWS 3HB9A 2RHZA 1RI0A 2R5AA 4PJOF 3A8LB 2MI6A 2A3LA 1G3WA 3HKSA 4M75E 2M0OA 3OYJA 4F7UA 3G6EA 1S72A 4P5NA 5CR2A 3UDCA 2HAXA 3MO8A 3TW7A 1LJOA 1WJSA 4DA4A 1N8RC 2QA4A 4JS5A 3FJPA 4ZN3A 2HD0A 2E41A 1P92A 2MAMA 5GAOm 3JSCA 3BG5A 1BIAA 4E7JA 2ZPFB 4M7DC 1SSFA 4QVDA 2DEQA 3OS2A 4QSHA 2VYTA 3CXCS 4JRPA 1KC8U 5GANg 3OQ5A 4OB2B 2RA2A 2CGHA 3S6WA 1Q86C 3OYDA 1Q7YU 3HRTA 2Y4YA 3F70A 4A4GA 3GOXA 4HNTA 4J5YA 3X28B 4XTZA 4A54A 4M7DE 5FU7B 4C8QF 2RJDA 2DZ9A 2BUDA 1E7PA 4X9DA 1NZ9A 5HY6A 2QDJA 2L3RA 3CC2T 5CIUA 4M78C 4JDSA 4M78G 2EWNA 2XG8D 3CCVT 3OY9A 3CCEA 4M7DD 2LX9A 2E70A 3OS0A 5GMKe 2E10A 1K9MC 5GANd 2DXTA 3LWIA 3MHXA 3MP1A 4M77F 3X24B 2JTMA 5GAN6 4ZGJB 3V7RA 3A8OB 3H6ZA 1K8AC 3FEOA 2ZPBB 2DTOA 3J80E 3CC4A 3M5AA 5CVIA 1QVFS 2BS2A 2L8DA 3I55A 1BI1A 3J7AF 4C5IA 1I81A 2RK1A 2DXCA 3DL1A 1YI2T 4KUDK 5GAN4 3KUFA 2DD4B 3P8DA 4C92F 2DAQA 4HLQA 4YTLA 1VQOA 4PJOD 3CPWA 4BE0A 2OTJT 4C5EA 2PVGB 2EJFA 2RI5A 4LDVA 4BUGA 3V8LA 5C0MA 4XTVA 1I5LA 2OTLT 4DOVA 3TW6A 3E9GA 1VQ8T 4FT4A 1U1SA 2F69A 3OMGA 2X4YA 2LTOA 3CXCA 1KD1C 2LT4A 1QW1A 2GCXA 5LJ5e 4MDXA 1UGQB 5LJ3d 2ZPHB 4M7AF 3LGLA 3SWNA 4A4KA 4AKHA 1I4K1 2JUFA 1N9RA 4FM4B 3MEAA 3LX7A 1VIEA 4E7HA 3TU4K 4ZTJA 1JRIA 1YITT 5GAOn 1BYMA 5EG2A 4C8QD 3JAME 4LD6A 1M1FA 3L2UA 1YHQA 2KMGA 4MFEA 3NTIA 5GAMd 3BDLA 4M77E 4F7UE 2QXFA 2DD5B 4RMOA 5D6YA 2EQJA 4C5GA 3CCVA 1K73U 3G4SA 3EAEA 4OB1B 2NLUA 2QQ9A 3PMTA 3C4SA 3DLMA 2RHXA 4L5GA 1LOJA 1VQNA 4IUUA 5FU6C 3N5BB 1FWZA 2KK4A 1QLBA 3CMAT 1MHNA 4OP0A 4M77D 5GANh 4C5HA 1KG1A 5LL6S 3FC3A 3QWLA 2FHDA 2MMPA 2KVQG 3RESA 3CCQA 3P8HA 4OB3B 3G6ET 4OB0B 1S72T 3JCMc 2QDYB 1VQMT 1Q81U 5FLXE 3TREA 3L2WA 2QA4T 1QVFA 4M75F 3M56A 3P8BB 4KULA 1WJRA 4Z6YA 3URGA 5GAN8 3FLGA 1H3ZA 4C0DB 2XDDA 3VV0A 4FSXA 4JX4A 3V7SA 4JRIA 4C92D 1KQSS 4LD9K 1JB0E 2PQWA 2MWOA 3V8JA 4E7KA 1M90C 2HQXA 2EAYA 3CCST 3BY7A 3CBOA 4OGCA 4HNVA 2RM4A 4MMLA 1HXDA 1VQ6T 3OBYA 2VGNA 2OAUA 3HFNA 3PMIA 5GANf 3CC7T 3OYBA 3HFOA 2EQKA 3GLXA 3R6OA 3OYIA 4A4EA 1U8RA 3L2RA 4M7DF 5DM7R 4Z02A 2BIVA 4MIMA 1YITA 4M7DB 5LJ3h 1TH7A 3GF5A 3PTAA 1OZ3A 3CCET 3BG3A 1D3BB 1VQPA 4QQDA 2B8AA 2LRQA 3VJPA 3MP8A 4X9CA 1XTDA 2ZPIB 2PU9B 2RD1A 3KBGA 3RIRA 1X75C 2E6NA 5GAMh 2QQRA 4ELZC 1KHIA 2M9UA 4Y28E 1M9SA 3WVDB 1RL2A 3A5ZB 5CQXA 3CC4T 3DKMA 2VXFA 4ZN1A 4M78F 3TCJA 2JN0A 3SWNC 4WF2A 3OW2S 3M58A 3Q1JA 4N0AA 4RKUE 1G3TA 5A0GA 3CCJT 4PJOB 1KC8C 2ZZDB 3RERA 3OYFA 1VQOT 2PVDB 3QYGB 1B34B 1ZHIA 2RK2A 3M59A 4MMKA 4N4GA 1NPRA 5FROA 1VQMA 1Q7YC 2P4TA 1YBYA 4ZGEB 1VQ9A 4QVCA 3M4YA 3OYAA 4A4FA 2E12A 2O01E 4M75D 2DKGA 2MF2A 5CKBA 5GAMf 3BDUA 4A4HA 5KE3A 3L2VA 1PSEA 2KR6A 5GANj 3CCSA 4R56A 4X34A 1IREB 1VQ6A 2XHCA 3LGFA 5EJCA 3JCMQ 3CC7A 2CZ1B 2K4YA 5KE2A 3RMSA 3JB9G 1PSFA 4C8QB 4BY6B 5HK0A 3SDZA 1G3YA 2LDMA 2KMTA 4B9XA 2LCCA 2CZ7B 5GMKl 1YHQT 4R55A 4IUPA 4D6WA 1DJ7B 3OYMA 4HKEA 1Y96B 4EDUA 3H4CA 3HP9A 4DOWA 3G4ST 3CBMA 2XIDA 2D0QB 4HL4A 3M53A 3WXMB 2DD4A 2ZPGB 4BB7A 2ZCFB 4M78E 4F7UF 1VQNT 4M77B 4QQ6A 4F7UB 2CKKA 4ELYC 3VUBA 2D9TA 1FX7A 1OYXA 2EYQA 2EFIA 1O9SA 4XTWA 3S3MA 3QJYA 3RKWA 3GNFB 5FRNA 4LOCA 1BI3A 2EQMA 3TEEA 3QZ5B 5LJ3g 1NJIU 3CCQT 4BDZA 3UPUA 1QVGA 3SD4A 4M78D 3MP6A 4JX5A 3LYIA 3H8ZA 4LDWA 2DIQA 5L8RE 5LJ3j 3CCJA 4V2SA 3FDRA 3OW2A 2GQVA 3LH0A 4C92B 2RB6A 4M7AG 4ELJA 3CCRA 2E5QA 5GAMg 1QVPA 1M1GA 1OZ2A 4PJOG 5GANe 3OMCA 4XU3A 1BI2A 1M5Q1 3A8HB 5GAMj 2BS3A 1KHCA 2XDBA 2QI2A 4XTUA 2QEXT 3E19A 2DK3A 2FB7A 2GFAA 5M9OA 3X26B 2HQEA 2DD5A 4EMKB 4N0AC 4GY5A 4M6VA 4IUTA 4AI6A 2QQ8A 3RKYA 2FVUA 4HT9A 4RCBA 4FL6A 1K73C 3A8GB 2A7YA 2DXBB 5LJ5d 3HHTB 3ASKA 5GMKi 4FU6A 3JRZA 3V7CA 2VUBA 2F5KA 5FU7C 4E7IA 3CD6T 3L2ZA 2LVMA 4MFDA 2YRVA 1VQPT 2P0PA 4C8QG 1QP2A 2WACA 5GAN5 3V8KA 2K5FA 3MCAB 2PUKB 5CCAA 4XAXB 3HL8A 4HNUA 3O8VA 3JCMg 3ME9A 2P0QA 3NTKA 3JB9J 2E65A 2DO3A 2LNVA 2LT1A 3C12A 3L42A 4NL2A 1Q81C 1Y07A 2DXUA 2VGMA 2JOYA 1YJ9A 4JRQA 2O4XA 5KCHA 3GP8A 3AHUA 2L5QA 4QW2A 3OYLA 2BKDN 2L89A 3VKHA 2YLCA 2JZ2A 4OMFB 5GAMe 2X4JA 1N27A 3L2QA 3CCMT 3JCMJ 1G3SA 4DQ2A 3VYGB 1KD1U 3C95A 4J83A 4M75B 4CRIA 1VQ9T 3QSUA 3UWNA 2YHTA 5GAOq 4BBRM 3VUZA 1Q82U 4N4IA 1VIFA 2XU8A 3JCMd 2KY9A 2CYZB 4OGEA 3SWNB 4C92G 4JX6A 2VC8A 2QEXA 3JCMP 1BIBA 4MZMA 4BDYA 1M8VA 1D3BA 1YIJA 4MZPA 4JJNK 3OA6A 3KHIA 2EJ9A 2PUOB 4L6V5 2QQBA 1YJWA 3DB3A 2X4WA 4C0GA 2JVVA 4TVRA 3NFCA 3HRUA 3HZJA 5D6XA 5GAOl 2DJZA 4PLIA 2XK0A 4RG2A 4AKGA 3SB2A 3CD6A 3JB9H 4M7AA 3RUXA 5LJ5h 3PT9A 1BI0A 1VQ7T 3X25B 4PJOA 2Y4XA 2ZZDA 2Y90A 4HCBA 1UB4A 1B34A 5HK3A 2QF7A 5CQYA 3X20B 2R5MA 4NOYA 3OSSC 4C0ZA 5DLOA 4FT2A 1VQ4A 1YJNA 3QDRB 3OYCA 3NTHA 1VQLT 4ME7A 4J6YA 4OVAA 4QVZA 4Y91A 4CI0C 4M78B 3HPWA 3MEWA 5J3BA 2FYKA 2C06A 5I2MA 3KXTA 5FRMA 3CEYA 2DVEA 2WSFE 3CCMA 2EIFA 3CCRT 5LJ3f 1YCYA 3CMEA 2DTIA 3INZA 4J6WA 4VUBA 4XK8E 4C8QA 1JJ2S 3HSBA 3MEVA 1KQ2A 4BD3A 1LNXA 2PVOB 4O6JA 3UT1A 1M1KU 3SFMA 3OYNA 1N6AA 1KQ1A 3PIOA 2HNIA 4Q5WA 3QYEA 1H641 1I8FA 4J7IA 3T9NA 5CKFA 1KQSA 3QUIA 1ZBXA 3L1AA 3JCMh 5KH6A 5GAOr 2AHJB 5HKCA 4C0FA 2IVWA 4N4HA 3CCUT 3LLRA 5A0DA 4JUVA 4M77A 2P0KA 2CZ0B 2RHUA 3PGGA 2VV5A 3JCMV 2E6ZA 4JLGA 1G5VA 2GFUA 2DZCA 2LQKA 1Y7XA 5I2SA 2X35A 4NS5A 3G71A 1JBMA 4HA8A 4ZTFA 1W2BS 5CK9A 1VQ7A 1X01A 3CCLA 1NJIC 4M7DG 4NC6A 5A2QE 4MZTA 3WVEB 4C92A 2RJCA 1N8RU 2XKOC 5CAIA 5IT9E 3M57A 3RMQA 3FRNA 2G3RA 3OS1A 3ZBDA 3S3NA 4EPCA 1YJ9T 2EQUA 1Y71A 3JB9D 3HO8A 3JCMf 1VQLA 5GAN7 2EKOA 1WQWA 2K5IA 3DLLA 2E1HA 4EMGA 2LQ8A 2R58A 2XI9A 4MDWA 5CKEA 3RKXA 5LJ5g 3GPLA 4E7LA 3QIIA 2X4XA 5DY9A 1Q86U 2DPPB 4JS4A 4EMKA 1V29B 4GLKA 3QXEB 2RH2A 4IUVA 2EJGA 5LJ5j 4M7AC 2V8KA 1XQHA 1FXXA 4PJOC 5CKDA 1XNIA 2QQSA 3OS5A 2DXBA 3VU3C 5FU6B 3QPHA 5GAOp 4KT0E 3QBYA 4A53A 2MWPA 3GIBA 4M7AE 5D6WA 4EMHA 4L59A 3E9FA 1VQ5A 1YIJT 5J39A 2RJEA 2WSCE 1WJQA 1M4ZA 3OB9A 3S3OA 1JJ2A 1VQKA 2XD0A 4PJOE 1YJWT 1VUBA 3QO3A 1O75A 3VKGA 4BBSM 2F5TX 1K9MU 3HBLA 2DIGA 2QTXA 3CCUA 2VXEA 4KUIA 4BE2A 3A8MB 4M7AD 1MGQA 4HCZA 1K8AU 3JB9I 1N9SA 3M54A 3EFRA 2FL7A 2CS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ6 B;  2CYZ B;  4RKU E;  2ZZD B;  2DXC B;  2PUO B;  4L6V 5;  2PVD B;  3QYG B;  3VYG A;  1UGR B;  3X24 B;  4ZGE B;  3VYH B;  4ZGJ B;  3A8O B;  2ZPB B;  2O01 E;  3X25 B;  1PSE A;  2ZZD A;  2DXC A;  1IRE B;  2DD4 B;  3X20 B;  2CZ1 B;  1PSF A;  2PVG B;  2CZ7 B;  1DJ7 B;  1UGP B;  2WSF E;  2D0Q B;  2DD4 A;  2ZPG B;  2ZCF B;  1GXI E;  1UGS B;  4XK8 E;  1UGQ B;  2ZPE B;  2ZPH B;  1QP3 A;  2PVO B;  4ZGD B;  4FM4 B;  3QZ5 B;  3QYH B;  5L8R E;  1AHJ B;  2DD5 B;  2AHJ B;  4OB1 B;  2CZ0 B;  3A8H B;  3X26 B;  2DD5 A;  4OB3 B;  3WVE B;  4OB0 B;  2QDY B;  3A8G B;  2DXB B;  2WSE E;  3HHT B;  3LW5 E;  1JB0 E;  1QP2 A;  3QZ9 B;  2DPP B;  1V29 B;  3QXE B;  2PUK B;  3A8L B;  2DXB A;  4KT0 E;  2ZPF B;  2WSC E;  4OB2 B;  2ZPI B;  3VYG B;  2PU9 B;  3X28 B;  3A8M B;  4Y28 E;  3WVD B; 
#chains in the Genus database with same CATH topology
 2HZY A;  2OAW A;  5GAN 2;  4IUQ A;  4BE1 A;  4BY6 C;  1NLP C;  1TG0 A;  4B9W A;  2V8J A;  3QYB A;  1AZG B;  1D0X A;  1X6G A;  4LNP A;  3ER0 A;  2DXC B;  4KBM B;  4D8K A;  1VQ4 T;  4O5V A;  5I21 A;  2IG0 A;  2HBP A;  1G8X A;  4M75 A;  1MV0 B;  3H9N A;  1W2B A;  3CQT A;  2X3W D;  5GMK h;  1UEB A;  4CFM B;  2CP0 A;  1S1N A;  2CCH B;  4KGV B;  1UNL D;  4PFP A;  3JV3 A;  1ZQ1 A;  4YC3 B;  2FPD A;  4OF1 A;  2NYS A;  2PJQ A;  2WJ9 A;  2DL8 A;  2EYX A;  1YCS B;  2ZGW A;  3KFV A;  1TWB A;  4PLL A;  2KDS A;  3OYK A;  4EMK C;  2LW4 A;  2HQH A;  1VQK Q;  1UGS B;  3PIP A;  2RHY A;  4XU1 A;  4PNO A;  4LDX A;  2JS0 A;  4ROE A;  3OYY A;  4BCJ B;  1WFW A;  1NE8 A;  4IIO A;  1IRX A;  1GUX A;  5CYI B;  3EGX B;  2BS4 A;  1VQ8 A;  3FB9 A;  4XTX A;  3RR6 A;  3ZEH A;  1WA7 A;  2RJF A;  2V8I A;  2LNH B;  3QG1 A;  5J26 A;  1WNL A;  4A63 B;  3NMZ C;  4R0K A;  1R0B G;  3GBQ A;  3OYE A;  5LJ5 f;  4J6X A;  1G2B A;  1U1T A;  3MIA B;  4UN0 A;  2WSE E;  1KSW A;  1VQ5 T;  5IN1 A;  3JCM b;  2DER A;  4M75 G;  2C5O B;  2O9S A;  1QVG S;  4BCG B;  4OMQ A;  1Y96 A;  2J6O A;  3OSV A;  3I56 A;  2K2V A;  3HSB A;  3HB9 A;  4BCQ B;  3HKS A;  2M0O A;  3A98 A;  4QT7 A;  3UDC A;  3MO8 A;  1N8R C;  2QA4 A;  4ZN3 A;  2E41 A;  1YI2 Q;  3JSC A;  4AT1 B;  4M7D C;  2DEQ A;  1QWE A;  2BTT A;  1Q86 C;  2I53 A;  1ZA1 B;  2Y4Y A;  4A54 A;  2K79 A;  2OTL Q;  1UFF A;  4M7D E;  5FU7 B;  2RJD A;  2DMO A;  2DZ9 A;  2F2X A;  2BUD A;  1OEB A;  1B07 A;  3CC2 T;  5CIU A;  1H27 B;  2F1L A;  4M78 C;  4JDS A;  2LJ1 A;  2EWN A;  3CCE A;  2E10 A;  3I5R A;  1PM3 A;  2AKK A;  4M77 F;  5GAN 6;  2JTM A;  3LWI A;  1H28 B;  4CFV B;  1JJ2 P;  3M0P A;  1VYV A;  3RBB B;  2VB6 A;  5KYN A;  2IW9 B;  1OKW B;  4C92 F;  1YWP A;  4YTL A;  1AWW A;  3CPW A;  1H1Q B;  1NG2 A;  3V8L A;  1K1Z A;  5C0M A;  3G6E Q;  1ZSG A;  2X4Y A;  5I22 A;  1G83 A;  2LTO A;  3CXC A;  1W2B P;  1I1J A;  2LT4 A;  5FWC A;  1KD1 C;  2GCX A;  4CFN B;  5LJ5 e;  4MDX A;  1UGQ B;  2ZPH B;  4AKH A;  2LQN A;  4CFU B;  3CCS Q;  3LX7 A;  4ZTJ A;  2H8H A;  5EG2 A;  1OL2 B;  3JAM E;  3BDL A;  4F7U E;  1SSH A;  1K73 U;  3EAE A;  3BHV B;  2F2W A;  3PMT A;  3DLM A;  1C1A A;  1IB8 A;  4J9F A;  2W2H A;  2DYB A;  4IUU A;  1FWZ A;  3CMA T;  1MHN A;  4M77 D;  1M27 C;  2DM1 A;  5LL6 S;  1TUD A;  4OB3 B;  2YRC A;  3CC4 Q;  1OPK A;  2QDY B;  1VQM T;  1QVF A;  1W70 A;  2EUF A;  1WJR A;  3URG A;  5ACB A;  4C0D B;  2C0T A;  4C92 D;  4JX4 A;  1KQS S;  1JEG A;  1OI9 B;  3HTR A;  1XJW B;  6AT1 B;  3BY7 A;  4F14 A;  1GBR A;  2RM4 A;  1VQ6 T;  2K7A A;  3HFN A;  5GAN f;  1U8R A;  1ABO A;  4BXX X;  4Z02 A;  1BB9 A;  1ZX6 A;  2O88 A;  4MIM A;  1RLP C;  1YIT A;  1OZ3 A;  1NEB A;  2MYS A;  1D3B B;  1H4L D;  4QQD A;  2B8A A;  2RD1 A;  2RN8 A;  1YHQ Q;  5GAM h;  4ELZ C;  2E3H A;  2M9U A;  3WVD B;  1RL2 A;  2VXF A;  3G4S Q;  3SWN C;  1ZSZ A;  4OMN A;  5KYX A;  1VQN Q;  2L0A A;  3RER A;  1VQO T;  3JCM X;  1ZHI A;  4MMK A;  4N4G A;  1RAC B;  2DA9 A;  4A4F A;  2O01 E;  5HVY B;  2CJM B;  3BDU A;  5KE3 A;  5GAN j;  4X34 A;  2XHC A;  1GCP A;  5EJC A;  2CZ1 B;  1B3Q A;  5L23 A;  2PHG A;  4C8Q B;  2P4R A;  4D6W A;  1ABQ A;  1IHW A;  4HL4 A;  2ZCF B;  2DRM A;  3I9Q A;  2J06 A;  2EFI A;  1BCM A;  1M3A A;  3RKW A;  2IW6 B;  3GNF B;  3TEE A;  2EQM A;  3CCQ T;  4M4Z A;  3UPU A;  1VA7 A;  3MP6 A;  3TN8 B;  5LJ3 j;  1KC8 R;  3I35 A;  2LP5 A;  3OW2 A;  4M7A G;  1JO8 A;  3CCR A;  3CPW P;  1Q7Y R;  1QVP A;  5GAN e;  3CCM Q;  2QI2 A;  1BU1 A;  2FB7 A;  5M9O A;  1VQ9 Q;  2KRO A;  2E4H A;  2DD5 A;  4CRL B;  4F7L B;  4GY5 A;  4N0A C;  4AI6 A;  3RKY A;  2RQU A;  3CXC P;  1JXM A;  1OIU B;  5GMK i;  2VUB A;  5FU7 C;  3CC7 Q;  2W10 A;  2SRC A;  2WAC A;  3V8K A;  1Z9Q A;  2PUK B;  4HNU A;  2G6F X;  3ME9 A;  2P0Q A;  3JB9 J;  4NL2 A;  2LT1 A;  2JMC A;  1YP5 A;  4EIK A;  2VGM A;  2JOY A;  4JRQ A;  1SHG A;  5KCH A;  3AHU A;  2L5Q A;  3EGX A;  2BKD N;  2L89 A;  3VKH A;  5ICP B;  2YLC A;  3O0G D;  1QVF P;  4DQ2 A;  3QSU A;  1KD1 U;  3NPF A;  4M75 B;  1QMZ B;  4CRI A;  1JQQ A;  3MI9 B;  3VUZ A;  4CC7 A;  3TNI B;  4CXA B;  1OPL A;  3JCM d;  2CT4 A;  1KJW A;  3KHI A;  1K76 A;  4L6V 5;  2QQB A;  1YJW A;  4CC2 A;  2I40 B;  2JVV A;  3NFC A;  2NWM A;  1TXQ A;  1GL5 A;  5GAO l;  4FYW B;  3CD6 A;  3JB9 H;  4HCK A;  1E6G A;  3CCU Q;  3PT9 A;  1OX9 A;  2JM8 A;  1UB4 A;  1XO2 A;  1B34 A;  5HK3 A;  3X20 B;  2R5M A;  4NOY A;  4C0Z A;  4FT2 A;  3NTH A;  1VQL T;  1E6H A;  4J6Y A;  4RTY A;  3ULR B;  3MEW A;  5I2M A;  5FRM A;  2YRD A;  2EKH A;  1GUX B;  2DVE A;  2WSF E;  2YSQ A;  2HCK A;  5HBE B;  2WXV B;  4J6W A;  4XK8 E;  1KQ2 A;  4O6J A;  1BU2 A;  3SFM A;  3T9N A;  2CP7 A;  2C4G B;  3REB B;  5KH6 A;  5GAO r;  1NYF A;  4C0F A;  2QEX Q;  4M77 A;  2P0K A;  2CZ0 B;  2GFU A;  4DBR A;  3EID B;  2VVK A;  3AT1 B;  3RNJ A;  1WX6 A;  5I2S A;  4EC8 B;  4HA8 A;  2IN3 A;  4C92 A;  2RJC A;  2XKO C;  5IT9 E;  3M57 A;  1JKW A;  2RQR A;  2G3R A;  1YJ9 T;  2HSE B;  1VQ4 Q;  2R58 A;  4EOJ B;  4MDW A;  3RKX A;  2O2O A;  3OW2 P;  1FXX A;  1XNI A;  1WI7 A;  3VU3 C;  4X1V A;  4A53 A;  2MWP A;  3GIB A;  2WIP B;  1YIJ T;  5J39 A;  1M4Z A;  1VQK A;  3QO3 A;  2FPF A;  2DIG A;  2A08 A;  1EX4 A;  2BE9 B;  3A8M B;  2FL7 A;  1YBY A;  4C8Q C;  1WGS A;  5ECA A;  4HCC A;  1RAE B;  2YLB A;  2EGE A;  2K5L A;  4FYY B;  1NJI R;  2H3J A;  3CPF A;  4C8Q E;  4DBH A;  2W9Z A;  1UGR B;  3HRS A;  1IGU A;  3VYH B;  4BI3 A;  1Q82 C;  4M77 G;  1C9B A;  4JRK A;  2BZ8 A;  4J7F A;  4LN2 A;  2HEQ A;  4UC4 A;  2A0F B;  4BAC A;  1WXB A;  4DEX A;  4LE9 A;  1EIF A;  1W4S A;  2L2P A;  2JNG A;  2LC4 A;  4Y92 A;  3I56 T;  2V1Q A;  3EHR A;  5GAN 3;  1X43 A;  1VQ5 Q;  2XDP A;  4XQ3 A;  1YI2 A;  2WIH B;  1W98 B;  2ZPE B;  1ARK A;  2HDA A;  4OR5 B;  1BKB A;  2YUQ A;  3G71 T;  3C94 A;  3CCL T;  3MEU A;  2K57 A;  2OTL A;  4BY7 X;  2MPX C;  2L3S A;  3QHS A;  1GCQ C;  3F5X B;  2G9X B;  2M51 A;  1FKM A;  2KBT A;  4RCC A;  2CCI B;  2KSS A;  4PKC C;  2FRW A;  3REA B;  2L3P A;  2CH4 W;  1TTH B;  3CC2 Q;  2KNB B;  4M75 C;  3PVL A;  3M4G A;  2VAS A;  1X6B A;  4IUR A;  4M7A F;  3QZ9 B;  4M7A B;  1RI0 A;  2R5A A;  3A8L B;  2KE9 A;  2MI6 A;  1G3W A;  4M75 E;  5FW9 A;  1N5Z A;  3OYJ A;  2ROT A;  3G6E A;  4P5N A;  2HAX A;  3TW7 A;  1WJS A;  4DA4 A;  4AMC A;  5DQV A;  5GAO m;  4QVD A;  4JRP A;  1KC8 U;  2VYT A;  5KYX B;  3OQ5 A;  7AT1 B;  3OYD A;  1Q7Y U;  3EG2 A;  3HRT A;  1M8M A;  4A4G A;  3GOX A;  3X28 B;  1UNG D;  1E7P A;  1SEM A;  2C0O A;  4X9D A;  5HY6 A;  2QDJ A;  2DL4 A;  2DME A;  1AEY A;  3EG0 A;  1H26 B;  4KGZ B;  4M7D D;  3OS0 A;  3MHX A;  3X24 B;  3IQL A;  3V7R A;  3H6Z A;  1K8A C;  4JZ3 A;  3J80 E;  3CC4 A;  3M5A A;  3I55 A;  1BI1 A;  2RK1 A;  3DL1 A;  3CMA Q;  2E5K A;  3VRZ A;  1OKV B;  1N8R R;  2OTJ T;  4C5E A;  3DOG B;  1NYG A;  4XTV A;  4DOV A;  1X2Q A;  1VQM Q;  4PJN A;  4FT4 A;  1PKT A;  2F69 A;  1Q86 R;  2QAZ A;  4EOI B;  3LH5 A;  2YUO A;  1RLQ C;  1X69 A;  3LGL A;  1I4K 1;  2J6K A;  2ESW A;  3TU4 K;  1YIT T;  1VQ6 Q;  3QDF A;  4RTU A;  2GQI A;  8AT1 B;  3L2U A;  1YHQ A;  2KMG A;  4ORZ A;  1RAF B;  3CCV A;  2QXF A;  2DD5 B;  4RMO A;  5D6Y A;  3G4S A;  4OB1 B;  1D1B A;  2EYZ A;  4DBQ A;  2C5N B;  1D1C A;  4EOQ B;  1LOJ A;  4CC3 A;  2KXC A;  1VQN A;  1ZBJ A;  5GAN h;  3B57 A;  2FHD A;  2MMP A;  1S72 T;  4ZNX A;  3JCM c;  3TRE A;  2FRY A;  5GAN 8;  1M2O A;  2LMJ A;  1RUW A;  3A1P A;  3VV0 A;  3V7S A;  5HCK A;  1EZZ B;  1MV3 A;  1VQO Q;  3V8J A;  1W6X A;  4E7K A;  1M90 C;  4OGC A;  4MML A;  2O9V A;  3OBY A;  3PMI A;  2DBK A;  5EC7 A;  2W99 A;  1KD1 R;  2DRK A;  3R6O A;  1AWJ A;  1PHT A;  2ENM A;  5LJ3 h;  1QCF A;  2X9H A;  4X9C A;  1H1R B;  1LCK A;  2HMA A;  3EGU A;  4Y28 E;  4FYV B;  3M58 A;  3Q1J A;  2FO0 A;  2X1N B;  1URC B;  1ZUY A;  2PVD B;  3QYG B;  1B34 B;  4II5 B;  3M59 A;  5KYU B;  2P4T A;  4BCO B;  3CCQ Q;  1JST B;  1VQ9 A;  4QVC A;  4AFZ C;  3M4Y A;  2GNC A;  4GLM A;  3OYA A;  1V76 A;  2E12 A;  4WTO B;  3DJB A;  5CKB A;  4F6U B;  5DQW A;  3L2V A;  1RAD B;  2IPO B;  3MKD A;  3UA7 A;  4R56 A;  1GFC A;  3CC7 A;  1M30 A;  2K4Y A;  1D09 B;  1UJY A;  3RMS A;  1RAH B;  3SDZ A;  4EOR B;  1G3Y A;  2LCC A;  5GMK l;  4PJM A;  4R55 A;  1DJ7 B;  4DOW A;  2XID A;  3M53 A;  4BB7 A;  2DD4 A;  3BE3 A;  1AOJ A;  4M78 E;  1KXU A;  1UJ0 A;  4M77 B;  4QQ6 A;  3NGP A;  3VUB A;  2A37 A;  2D9T A;  2EYQ A;  5FRN A;  4KH1 B;  3R6N A;  3BLR B;  1NJI U;  4BDZ A;  1Y57 A;  4JX5 A;  3LYI A;  4LDW A;  3FDR A;  2GQV A;  4C92 B;  2E5Q A;  1M1G A;  4PJO G;  4EOP B;  4NST B;  3A8H B;  4AFU C;  2BS3 A;  2DLP A;  3EG1 A;  4XTU A;  1WHG A;  3E19 A;  1MMA A;  2K2M A;  1ZSZ C;  4IUT A;  4M6V A;  2CRE A;  3PO3 S;  2E3I A;  1UEC A;  5LJ5 d;  3ASK A;  2ROL A;  4RUG A;  3V7C A;  3CD6 T;  1ZUU A;  1VQP T;  1QP2 A;  5GAN 5;  1YNZ A;  1UHF A;  3HL8 A;  3O8V A;  2DO3 A;  3H41 A;  1Q81 C;  1WIE A;  4ESR A;  1TFB A;  2KXD A;  4QW2 A;  1PKD B;  1VQL Q;  3JCM J;  4IIM A;  2X4J A;  4YOS A;  2BPM B;  1FMV A;  5GAO q;  3CCJ Q;  4BBR M;  2QGF B;  4N4I A;  2KY9 A;  4OGE A;  4FW1 A;  1TUG B;  2ABL A;  2VC8 A;  2QEX A;  1BIB A;  4BDY A;  1M8V A;  1YFN A;  3EG9 A;  4MZP A;  2KRN A;  2MIO A;  5IHN A;  3DB3 A;  3HZJ A;  2JW4 A;  2DJZ A;  4RG2 A;  3SB2 A;  4M7A A;  1P5E B;  3X25 B;  3EHQ A;  4LUE A;  2ZZD A;  2Y90 A;  2QGG A;  2KT1 A;  1VQ4 A;  5I11 A;  3EGD A;  3PE0 A;  3QDR B;  1Z9Z A;  4QVZ A;  3SHW A;  4CI0 C;  2C06 A;  4F70 B;  3HPW A;  2LJ0 A;  1UTI A;  4PK4 A;  1SF9 A;  2YUN A;  1TSF A;  3RGF B;  1QMC A;  1YJ9 Q;  5LJ3 f;  2GGR A;  2DTI A;  2DL3 A;  1QCO A;  1JJ2 S;  3OYN A;  3BLQ B;  2CP2 A;  1CKA A;  4J7I A;  4BCM D;  1I8F A;  5CKF A;  2LZ6 B;  4JJB A;  5HKC A;  2IVW A;  3LLR A;  4J9B A;  4DBF A;  1RI9 A;  1D3U B;  3M0T A;  1YIJ Q;  4I3Z B;  1I5O B;  2VV5 A;  1AWO A;  3POM A;  2DZC A;  1MMD A;  1H1P B;  2EGA A;  1W2B S;  1VQ7 A;  1X01 A;  4M7D G;  4NC6 A;  5A2Q E;  2GTO A;  3VS1 A;  1N8R U;  5CAI A;  3OS1 A;  2WMB B;  4EPC A;  3JB9 D;  3HO8 A;  1BCO A;  3JCM f;  5IXB A;  2K5I A;  4EMG A;  5CKE A;  3DDP B;  5LJ5 g;  1Q86 U;  2DBM A;  3QII A;  5DY9 A;  2DPP B;  1UHC A;  4GLK A;  2ED0 A;  2QQS A;  1QKW A;  2DXB A;  5FU6 B;  3QPH A;  5GAO p;  4KT0 E;  3GTM S;  1MMG A;  4KGX B;  1VQ5 A;  2D8H A;  5LMK B;  5HQ0 B;  2RJE A;  2WSC E;  1WJQ A;  2NUT A;  2C5V B;  1VUB A;  1O75 A;  1YN8 A;  2QTX A;  1J3T A;  2RNA A;  4BE2 A;  2HKQ B;  4HCZ A;  2KI7 A;  3JB9 I;  3I56 Q;  3EFR A;  5GJV B;  2CS7 A;  3QJ6 A;  2WPA B;  3QWY A;  2LJ3 A;  5GMK m;  2JTF A;  3QKJ A;  1O9K A;  1YJN T;  3JCM W;  1HK9 A;  3VYG A;  1GRI A;  4JZ4 A;  2HKN A;  2KEA A;  3M9Q A;  3G71 Q;  5LJ3 e;  3CCL Q;  2WMA B;  3LWH A;  2CUB A;  1E9H B;  3BHU B;  4M77 C;  4F7U G;  5HNB B;  1WPY A;  4F16 A;  3CC2 A;  1XOV A;  3EOC B;  3CME T;  1KFZ A;  3TNH B;  4NL3 A;  2GF7 A;  2B9R A;  1IZ6 A;  2K6D A;  3UF4 A;  4C92 C;  4JLI A;  3EFS A;  2G77 A;  4PL6 A;  1HJD A;  4RTV A;  5KYW B;  4LDY A;  2DTH A;  3EH2 A;  1OU8 A;  1UGP B;  4QQG A;  4C92 E;  4AKI A;  2RHI A;  2DX1 A;  1GXI E;  3BG9 A;  5CKH A;  1QP3 A;  1FMW A;  3BFM A;  3CBP A;  4XU0 A;  3JCM e;  1H92 A;  3OYG A;  1QWF A;  2HBW A;  3QYH B;  5KYU A;  2BZX A;  1AHJ B;  2OI3 A;  2QFZ A;  4OMM A;  1T3L A;  4HVU A;  1WXT A;  5DLQ E;  1FMK A;  3J81 E;  1ACM B;  1RAB B;  4XU2 A;  2M1H A;  4RG8 A;  4CFW B;  2FZK B;  1R8O B;  4LDU A;  1M1K C;  4HT8 A;  4YOO A;  2K3Y A;  4E47 A;  1D0Z A;  2M0Y A;  5IAY A;  2R57 A;  1JSU B;  4F7N B;  2BZY A;  5CEI B;  2D6F A;  4II1 A;  4BCN D;  1WHM A;  3PNW C;  1WLP B;  1LVK A;  2JM9 A;  4C0D C;  3EFO A;  2Z0W A;  5IDN B;  3CMA A;  2XIC A;  3I55 T;  1FIN B;  2QQA A;  2L3Q A;  5AYF A;  3CPW S;  4PJO F;  1AIS B;  5CR2 A;  5D7U A;  3FJP A;  2HD0 A;  1P92 A;  3MY5 B;  2PZ1 A;  1BIA A;  2ZPF B;  2UZB B;  3OS2 A;  3CXC S;  1NBE B;  5GAN g;  3S6W A;  2JS2 A;  2OTJ Q;  2M02 A;  4HNT A;  4QKU A;  4KH0 B;  1VYU A;  2JT4 A;  1NZ9 A;  9ATC B;  1T0J A;  4HVW A;  1WHJ A;  4FX3 B;  1OOT A;  2RPN A;  3CCV T;  2LX9 A;  2E70 A;  2LX7 A;  4BCF B;  2COW A;  1WHK A;  1YIT Q;  1K9M C;  2DXT A;  3A8O B;  2V26 A;  4OGR B;  2ZPB B;  2DTO A;  3FEO A;  1IXD A;  5CVI A;  1ZUK A;  1QVF S;  2BS2 A;  2L8D A;  4C5I A;  2EYW A;  1I81 A;  1IO6 A;  5GAN 4;  2DD4 B;  3P8D A;  4J9E A;  1FYN A;  4HLQ A;  1VQO A;  4PJO D;  4BE0 A;  1PRM C;  2PVG B;  2RI5 A;  1S72 Q;  3TNW B;  1BK2 A;  2PMI B;  3TW6 A;  1H1S B;  1VOM A;  1VQ8 T;  1U1S A;  2ATC B;  2FG0 A;  2ED1 A;  2JTE A;  1QCN A;  1AZE A;  4PJJ A;  4A4K A;  3C0C A;  2JUF A;  1N9R A;  4FM4 B;  3MEA A;  1VIE A;  2AT1 B;  4E7H A;  1BYM A;  5GAO n;  1PG5 B;  5GAM d;  4E6R A;  2EQJ A;  4EOO B;  2NLU A;  2UZD B;  3C4S A;  4G6L B;  3MPU B;  5FU6 C;  1K8A R;  3N5B B;  2KK4 A;  1QLB A;  3NHN A;  4OP0 A;  2QTV A;  2MCN A;  4C5H A;  1OU9 A;  1WZO A;  3RES A;  3CCQ A;  3P8H A;  5FLX E;  3L2W A;  2QA4 T;  3P8B B;  2DVJ A;  4Z6Y A;  2V1R A;  2J05 A;  3FLG A;  1H3Z A;  2XDD A;  2AK5 A;  4JRI A;  1JB0 E;  1RAG B;  1IGQ A;  2HQX A;  2EAY A;  2NUP A;  3CBO A;  1HXD A;  2K9G A;  3CC7 T;  1UNH D;  3OYB A;  3OYI A;  3L2R A;  4M7D F;  5DM7 R;  2BIV A;  4M7D B;  4KRD B;  3GF5 A;  1T0H A;  2COZ A;  4HVV A;  3CCE T;  4EOL B;  1C0M A;  3EG9 B;  1XTD A;  2E6N A;  3RDV A;  3A5Z B;  5CQX A;  4Z89 A;  4ZN1 A;  4M78 F;  4WF2 A;  3OW2 S;  3H0F A;  2JXB A;  4RKU E;  5A0G A;  1VYT A;  2CT3 A;  2ZZD B;  5FRO A;  2RK2 A;  1NPR A;  3EGD B;  3VS4 A;  4Y72 B;  4ZGE B;  2RF0 A;  1WYX A;  4OMO A;  2DKG A;  2MF2 A;  1PD1 A;  2RQT A;  1ENW A;  1PSE A;  2KR6 A;  1HYO A;  1M90 R;  3CCS A;  2EW3 A;  1K0X A;  1IRE B;  3JCM Q;  2GBQ A;  5KE2 A;  3JB9 G;  1PSF A;  4AFS C;  2PTK A;  2A36 A;  5HK0 A;  2PNI A;  2LDM A;  4B9X A;  2CZ7 B;  1W1F A;  2CH4 A;  4IUP A;  3OYM A;  4HKE A;  2LQW A;  3H4C A;  3HP9 A;  1GFD A;  2JJ9 A;  2D0Q B;  2ZPG B;  1D0Y A;  2FPE A;  3TQ7 P;  4F7U F;  3CD6 Q;  2QK0 A;  1OQK A;  1VQP Q;  4F7U B;  2DF6 A;  4ELY C;  1FX7 A;  2KYM A;  4XTW A;  1PRL C;  1BI3 A;  2GTJ A;  4F17 A;  1TUC A;  4M78 D;  1RAI B;  3CCJ A;  1QVG P;  3H8Z A;  4V2S A;  2DIQ A;  4ANJ A;  1WHH A;  5EFQ B;  4ELJ A;  5BNJ B;  2CP6 A;  5GAM g;  3OMC A;  3THK A;  1BI2 A;  1M5Q 1;  2QEX T;  3H0H A;  5IF1 B;  2DK3 A;  4JJD A;  3X26 B;  2HQE A;  1SRM A;  1R0C B;  2FVU A;  4PFZ A;  4RCB A;  4FL6 A;  1K73 C;  2A7Y A;  2DXB B;  3HHT B;  2AKL A;  4FU6 A;  5KYW A;  3JRZ A;  2F5K A;  2XMF A;  1WDX A;  2LVM A;  2YRV A;  2P0P A;  4C8Q G;  1SKU B;  2NUT B;  4PJL A;  3MCA B;  5CCA A;  3NTK A;  5FGK B;  2E65 A;  2LNV A;  2IW8 B;  2F2V A;  2DE0 X;  3C12 A;  3L42 A;  3M0S A;  1Y07 A;  4Z88 A;  2CSI A;  1YJ9 A;  5AT1 B;  2DEU A;  3GP8 A;  4F6W B;  1AD5 A;  2IIM A;  1Y0M A;  1O9K B;  3L2Q A;  1G3S A;  3VYG B;  1U3O A;  3C95 A;  4JPB W;  2D1X A;  2NUZ A;  1Q82 U;  1VIF A;  2XU8 A;  3SWN B;  4MZM A;  1YIJ A;  4EC9 B;  2EJ9 A;  4KRC B;  2X4W A;  2FZC B;  1A0N B;  4TVR A;  3QHR B;  2COY A;  1KK7 A;  2XK0 A;  4AKG A;  5IH2 A;  1VQ7 T;  4PJO A;  3ZL7 C;  2PK2 A;  4HCB A;  4K11 A;  3BLH B;  2QF7 A;  5CQY A;  5IXF A;  5DLO A;  3OYC A;  1Q81 R;  1UUE A;  4Y91 A;  2FYK A;  3KXT A;  1MNE A;  3M0Q A;  1M2V B;  3CEY A;  3CCM A;  2EIF A;  3CCR T;  5IDP B;  1YCY A;  4VUB A;  1GY3 B;  1B7T A;  2W96 A;  1CSK A;  3MEV A;  4BD3 A;  4JJC A;  1CKB A;  1N6A A;  1KQ1 A;  1D1A A;  2HNI A;  3I5S A;  3QUI A;  1ZBX A;  2D8J A;  3JCM h;  1KQS P;  5IHI A;  3FJ5 A;  1NEG A;  5A0D A;  1T3S A;  3NDQ A;  3PGG A;  3JCM V;  4JLG A;  1G5V A;  2FZG B;  3EFO B;  1Y7X A;  2C6T B;  3G71 A;  1JBM A;  5CK9 A;  3CCL A;  2I0N A;  1JXO A;  1H8K A;  3WVE B;  4MZT A;  3MY1 B;  3RMQ A;  1PC0 A;  2KT8 A;  3H0I A;  1WQW A;  1E7O A;  1YJN Q;  4GBQ A;  2LQ8 A;  3G1J A;  3GPL A;  4BCI B;  2X4X A;  3BHT B;  3K7A M;  4EMK A;  1V29 B;  4IUV A;  2RH2 A;  4M7A C;  2EJG A;  5LJ5 j;  1XQH A;  2VWF A;  2W9F A;  5CKD A;  3OS5 A;  2KRS A;  2KR3 A;  4M7A E;  1H25 B;  1MMN A;  3CME Q;  4F7S B;  3OB9 A;  2XD0 A;  1YJW T;  2P84 A;  3VS0 A;  3VKG A;  4BBS M;  3HBL A;  2UZE B;  2VXE A;  3CCU A;  4ROD A;  1MGQ A;  1K8A U;  4BCQ D;  1N9S A;  2CZ6 B;  1LPL A;  3OYH A;  3MET A;  1IHV A;  4RTZ A;  4TTH A;  5C6S A;  3M55 A;  3FIF A;  1OIY B;  3VKI A;  1X27 A;  2DIL A;  4RTW A;  2YUP A;  4BI4 A;  3ZFJ A;  1N4M A;  4BY1 X;  2YXY A;  1TD6 A;  2OX7 A;  2F2C A;  2QAS A;  2H3E B;  3O5Z A;  4BCM B;  5KYY A;  4M7D A;  4OMP A;  1VYW B;  4LXC A;  1EFN A;  1F1B B;  2RI2 A;  2IVX A;  3GNG A;  4ATO A;  5A0L A;  3I55 Q;  2WFY B;  4ZGD B;  4M78 A;  2KAF A;  3EH1 A;  1NPP A;  2I2L A;  2OTJ A;  4FCY A;  2O4X B;  1OX8 A;  3JB9 F;  3BW1 A;  3OBW A;  2E64 A;  3D7S B;  4E7S A;  2M16 A;  4IKF A;  4BI8 B;  2DL7 A;  1WQ7 A;  3E1S A;  1TOV A;  2RI3 A;  2W0Z A;  1M90 U;  1M3C A;  2KYB A;  1X6O A;  2RO0 A;  2BE7 D;  4CFU D;  3VS6 A;  1ZA2 B;  2K3X A;  2NUP B;  1V1C A;  1JOW A;  2LCL A;  3QHW B;  3DB4 A;  4FIB A;  3TSW A;  2UZL B;  5CO7 A;  2KRM A;  1M3B A;  1HD3 A;  1K9A A;  2KQW A;  1OI1 A;  3E2U A;  3G7Z A;  4WCI A;  3CCV Q;  1VQK T;  3LW5 E;  2DNU A;  5GJW B;  2WEV B;  5KCO A;  5GMK j;  3PFS A;  4XTY A;  4J8O A;  3DLL A;  2RHZ A;  2A3L A;  2EQI A;  4F7U A;  1S72 A;  1LJO A;  2EBP A;  4YOZ A;  2JMA A;  4JS5 A;  4PFO A;  2EPD A;  2MAM A;  1H3H A;  3BG5 A;  1NLO C;  4E7J A;  1SSF A;  4F04 B;  4QSH A;  2EGC A;  1ZP2 A;  4OB2 B;  2RA2 A;  2CGH A;  1AVZ C;  5FWB A;  3DTO A;  3F70 A;  4J5Y A;  4XTZ A;  4RTX A;  4C8Q F;  1VQ8 Q;  1OUL A;  2L3R A;  1SHF A;  1M1K R;  4M78 G;  2ZAE A;  2XG8 D;  3OY9 A;  1AWX A;  5GMK e;  3UAT A;  5GAN d;  3MP1 A;  4ZGJ B;  2CSQ A;  2DET A;  4ROC A;  2CP3 A;  3J7A F;  2DXC A;  1YI2 T;  4KUD K;  1WXU A;  3KUF A;  1SG5 A;  2DAQ A;  3LQ5 B;  2EJF A;  4LDV A;  4BUG A;  4EOM B;  1I5L A;  2OTL T;  4EON B;  3E9G A;  2QA4 Q;  5IHK A;  1PD0 A;  1H24 B;  3OMG A;  3U23 A;  8ATC B;  1QW1 A;  5LJ3 d;  3DDQ B;  3SWN A;  3G33 B;  1JRI A;  4C8Q D;  4LD6 A;  1M1F A;  3NTI A;  4MFE A;  4BCN B;  4M77 E;  2DFU A;  4C5G A;  2HL3 A;  2SEM A;  1TU0 B;  2DYI A;  2QQ9 A;  1K9M R;  4L5G A;  2RHX A;  3CCE Q;  2D0N A;  3EG3 A;  1AT1 B;  1R77 A;  1KG1 A;  4AFQ C;  2PK9 B;  1X2K A;  3QWL A;  3FC3 A;  2KVQ G;  3G6E T;  3EJ1 B;  4OB0 B;  1Q81 U;  4M75 F;  3M56 A;  4KUL A;  2RQV A;  3VRY A;  4LD9 K;  4FSX A;  1M2V A;  4RTT A;  2MOX A;  2PQW A;  2MWO A;  1BBZ A;  3M0U A;  5LQF B;  3CCS T;  3TSZ A;  4HNV A;  2VGN A;  2OAU A;  3HFO A;  2EQK A;  3GLX A;  4A4E A;  1Q82 R;  2CUD A;  1TH7 A;  4EOK B;  3PTA A;  3BG3 A;  1U06 A;  2AZS A;  1VQP A;  1SRL A;  2LRQ A;  3VJP A;  3MP8 A;  2ZPI B;  2PU9 B;  3KBG A;  3RIR A;  4KRT A;  3VS5 A;  1X75 C;  1VIN A;  2QQR A;  1KHI A;  3CC4 T;  1M9S A;  3DKM A;  3TVT A;  3TCJ A;  2JN0 A;  4OML A;  4N0A A;  1TS9 A;  1G3T A;  4DEY A;  4F6S B;  3CCJ T;  4PJO B;  1KC8 C;  1K4U S;  3OYF A;  1VQM A;  2YDL A;  1I0C A;  1PNJ A;  1Q7Y C;  1FVV B;  5HBJ B;  4M75 D;  2MK5 A;  5GAM f;  4EOS B;  4A4H A;  5I5Z B;  3PVQ A;  3M03 A;  1VQ6 A;  3LGF A;  1K0S A;  3UA6 A;  4BY6 B;  2KMT A;  1UGV A;  2J6F A;  1YHQ T;  4E7Z A;  2ECZ A;  1QQJ A;  1Y96 B;  3VS2 A;  4EDU A;  3G4S T;  3CBM A;  1WHL A;  3WXM B;  1VQN T;  2CKK A;  2V22 B;  1OYX A;  2CP5 A;  1VOL A;  3S3M A;  1O9S A;  3QJY A;  1OL1 B;  4LOC A;  3M0R A;  3QZ5 B;  5LJ3 g;  4LUD A;  1QVG A;  3SD4 A;  2X51 A;  5L8R E;  2HSP A;  3LH0 A;  2RB6 A;  4IMY B;  4B6M A;  1OZ2 A;  2O31 A;  3VS7 A;  4CFX B;  4XU3 A;  4J9C A;  5GAM j;  1KHC A;  2OJ2 A;  2XDB A;  2K3B A;  2GFA A;  1SPK A;  1PCX A;  1NM7 A;  2C0I A;  4EMK B;  2YT6 A;  1ZLM A;  2QQ8 A;  4Z8A A;  1C6V X;  1YWO A;  4HXJ A;  4HT9 A;  3A8G B;  1GBQ A;  2KGT A;  4E7I A;  3L2Z A;  4MFD A;  5L2W B;  2K5F A;  4XAX B;  3JCM g;  4BCH B;  2DXU A;  1VQ7 Q;  2CDT A;  2O4X A;  1HSQ A;  4ELL A;  1KIK A;  3OYL A;  2JZ2 A;  4OMF B;  5GAM e;  3CCM T;  1N27 A;  2JGZ B;  4J83 A;  1VQ9 T;  2QGS A;  3UWN A;  2YHT A;  2CYZ B;  4C92 G;  4AG2 C;  4JX6 A;  2VKN A;  2FEI A;  3CCR Q;  3JCM P;  1D3B A;  2DL5 A;  4JJN K;  3OA6 A;  2PUO B;  4FSS A;  4C0G A;  1K73 R;  4D8D A;  3HRU A;  5KYY B;  5D6X A;  4PLI A;  1PKS A;  2QDL A;  1F5Q B;  3RUX A;  5LJ5 h;  1BI0 A;  5IHY A;  2Y4X A;  1MUZ A;  1OV3 A;  4FW2 A;  1PWT A;  1Q95 G;  2J7I A;  1YJN A;  3OSS C;  4ME7 A;  4OVA A;  4M78 B;  2BKZ B;  5J3B A;  2X3X D;  4CC4 B;  1I07 A;  3CME A;  2AZV A;  3INZ A;  4C8Q A;  3QWX X;  2UUE B;  1LNX A;  2PVO B;  3UT1 A;  2EVR A;  1M1K U;  2LCS A;  2C5X B;  3SEM A;  3PIO A;  4Q5W A;  2WHB B;  2R7G A;  3QYE A;  3MJX A;  1H64 1;  4J9D A;  1KQS A;  1U5S A;  4J9H A;  2QG9 B;  3L1A A;  1JU5 C;  2AHJ B;  4N4H A;  3CCU T;  4JUV A;  1QLY A;  2RHU A;  2E6Z A;  4J9G A;  1YJW Q;  1MND A;  2LQK A;  1UE9 A;  1RAA B;  2X35 A;  4NS5 A;  4ZTF A;  1NJI C;  1ZSZ B;  2EYY A;  4BCK B;  2A28 A;  2YWW A;  3FRN A;  3S3N A;  3ZBD A;  2EQU A;  1Y71 A;  2HL5 C;  1VQL A;  2AIR B;  5GAN 7;  2RMO A;  2EKO A;  3VS3 A;  4J9I A;  5HBH B;  4BCP B;  2E1H A;  2XI9 A;  1OGU B;  4E2F B;  4E7L A;  4JS4 A;  3QXE B;  2V8K A;  4AG1 C;  4PJO C;  1GH6 B;  2QYZ A;  2RQW A;  3QBY A;  5D6W A;  4EMH A;  4L59 A;  3E9F A;  1AD6 A;  1QKX A;  4FYX B;  3S3O A;  4PJO E;  1JJ2 A;  2DJQ A;  2F5T X;  1K9M U;  1GCQ A;  1G3N C;  1UDL A;  4KUI A;  4M7A D;  4F7J B;  2B86 A;  1UG1 A;  3M54 A; 
#chains in the Genus database with same CATH homology
 3QJ6 A;  2CZ6 B;  4C8Q C;  1WGS A;  5GAN 2;  3OYH A;  4IUQ A;  3JCM X;  3MET A;  4BE1 A;  4BY6 C;  4HCC A;  2YLB A;  4B9W A;  2JTF A;  5GMK m;  2V8J A;  2K5L A;  3QYB A;  3QKJ A;  3ER0 A;  2DXC B;  4KBM B;  3JCM W;  2H3J A;  3CPF A;  4O5V A;  5C6S A;  5I21 A;  1VQ4 T;  1YJN T;  1HK9 A;  2IG0 A;  2HBP A;  3M55 A;  3VYG A;  3FIF A;  4M75 A;  3M9Q A;  4C8Q E;  3VKI A;  5LJ3 e;  1W2B A;  1UGR B;  3HRS A;  3LWH A;  3VYH B;  4BI3 A;  5GMK h;  1UEB A;  4M77 C;  1Q82 C;  4M77 G;  4F7U G;  4JRK A;  4BI4 A;  4J7F A;  1WPY A;  3ZFJ A;  3CC2 A;  1XOV A;  1ZQ1 A;  3CME T;  4UC4 A;  4BAC A;  4NL3 A;  2GF7 A;  1IZ6 A;  4C92 C;  4JLI A;  1EIF A;  4OF1 A;  4M7D A;  3EFS A;  2G77 A;  2WJ9 A;  1W4S A;  4PL6 A;  2JNG A;  4LDY A;  2LC4 A;  2ZGW A;  2RI2 A;  3I56 T;  2DTH A;  4PLL A;  1UGP B;  4QQG A;  4C92 E;  4AKI A;  5GAN 3;  2RHI A;  2XDP A;  4XQ3 A;  2KDS A;  3OYK A;  4EMK C;  1YI2 A;  1GXI E;  3BG9 A;  1UGS B;  3PIP A;  3GNG A;  2ZPE B;  4ATO A;  2RHY A;  5CKH A;  5A0L A;  1QP3 A;  4XU1 A;  4ZGD B;  4M78 A;  2KAF A;  4PNO A;  3BFM A;  1BKB A;  4LDX A;  2I2L A;  1NPP A;  3CBP A;  4XU0 A;  3JCM e;  3G71 T;  3C94 A;  3OYY A;  2OTJ A;  3CCL T;  3MEU A;  2O4X B;  3OYG A;  2K57 A;  1NE8 A;  2OTL A;  3JB9 F;  3BW1 A;  3OBW A;  3QYH B;  2BS4 A;  1VQ8 A;  1AHJ B;  2QFZ A;  2E64 A;  3FB9 A;  4XTX A;  3QHS A;  3ZEH A;  2RJF A;  2M16 A;  5DLQ E;  4IKF A;  4BI8 B;  3J81 E;  4XU2 A;  2M1H A;  2V8I A;  4RG8 A;  1WQ7 A;  3E1S A;  1FKM A;  3QG1 A;  5J26 A;  1WNL A;  1R8O B;  2RI3 A;  4LDU A;  2KSS A;  4RCC A;  4PKC C;  1M1K C;  4HT8 A;  1M90 U;  2K3Y A;  4E47 A;  1X6O A;  2RO0 A;  5IAY A;  2R57 A;  2K3X A;  3OYE A;  5LJ5 f;  2LCL A;  2D6F A;  4J6X A;  4II1 A;  3DB4 A;  4FIB A;  3PNW C;  5CO7 A;  1U1T A;  2WSE E;  2KQW A;  4M75 C;  1OI1 A;  5IN1 A;  3G7Z A;  3JCM b;  4M75 G;  3M4G A;  1VQ5 T;  4C0D C;  1QVG S;  1VQK T;  3LW5 E;  5KCO A;  1Y96 A;  4IUR A;  5GMK j;  3OSV A;  3CMA A;  2XIC A;  3I55 T;  3PFS A;  4XTY A;  3QZ9 B;  2QQA A;  4J8O A;  3I56 A;  4M7A B;  5AYF A;  2K2V A;  3CPW S;  3HB9 A;  2RHZ A;  1RI0 A;  2R5A A;  4PJO F;  3A8L B;  2MI6 A;  2A3L A;  1G3W A;  3HKS A;  4M75 E;  2M0O A;  3OYJ A;  4F7U A;  3G6E A;  1S72 A;  4P5N A;  5CR2 A;  3UDC A;  2HAX A;  3MO8 A;  3TW7 A;  1LJO A;  1WJS A;  4DA4 A;  1N8R C;  2QA4 A;  4JS5 A;  3FJP A;  4ZN3 A;  2HD0 A;  2E41 A;  1P92 A;  2MAM A;  5GAO m;  3JSC A;  3BG5 A;  1BIA A;  4E7J A;  2ZPF B;  4M7D C;  1SSF A;  4QVD A;  2DEQ A;  3OS2 A;  4QSH A;  2VYT A;  3CXC S;  4JRP A;  1KC8 U;  5GAN g;  3OQ5 A;  4OB2 B;  2RA2 A;  2CGH A;  3S6W A;  1Q86 C;  3OYD A;  1Q7Y U;  3HRT A;  2Y4Y A;  3F70 A;  4A4G A;  3GOX A;  4HNT A;  4J5Y A;  3X28 B;  4XTZ A;  4A54 A;  4M7D E;  5FU7 B;  4C8Q F;  2RJD A;  2DZ9 A;  2BUD A;  1E7P A;  4X9D A;  1NZ9 A;  5HY6 A;  2QDJ A;  2L3R A;  3CC2 T;  5CIU A;  4M78 C;  4JDS A;  4M78 G;  2EWN A;  2XG8 D;  3CCV T;  3OY9 A;  3CCE A;  4M7D D;  2LX9 A;  2E70 A;  3OS0 A;  5GMK e;  2E10 A;  1K9M C;  5GAN d;  2DXT A;  3LWI A;  3MHX A;  3MP1 A;  4M77 F;  3X24 B;  2JTM A;  5GAN 6;  4ZGJ B;  3V7R A;  3A8O B;  3H6Z A;  1K8A C;  3FEO A;  2ZPB B;  2DTO A;  3J80 E;  3CC4 A;  3M5A A;  5CVI A;  1QVF S;  2BS2 A;  2L8D A;  3I55 A;  1BI1 A;  3J7A F;  4C5I A;  1I81 A;  2RK1 A;  2DXC A;  3DL1 A;  1YI2 T;  4KUD K;  5GAN 4;  3KUF A;  2DD4 B;  3P8D A;  4C92 F;  2DAQ A;  4HLQ A;  4YTL A;  1VQO A;  4PJO D;  3CPW A;  4BE0 A;  2OTJ T;  4C5E A;  2PVG B;  2EJF A;  2RI5 A;  4LDV A;  4BUG A;  3V8L A;  5C0M A;  4XTV A;  1I5L A;  2OTL T;  4DOV A;  3TW6 A;  3E9G A;  1VQ8 T;  4FT4 A;  1U1S A;  2F69 A;  3OMG A;  2X4Y A;  2LTO A;  3CXC A;  1KD1 C;  2LT4 A;  1QW1 A;  2GCX A;  5LJ5 e;  4MDX A;  1UGQ B;  5LJ3 d;  2ZPH B;  4M7A F;  3LGL A;  3SWN A;  4A4K A;  4AKH A;  1I4K 1;  2JUF A;  1N9R A;  4FM4 B;  3MEA A;  3LX7 A;  1VIE A;  4E7H A;  3TU4 K;  4ZTJ A;  1JRI A;  1YIT T;  5GAO n;  1BYM A;  5EG2 A;  4C8Q D;  3JAM E;  4LD6 A;  1M1F A;  3L2U A;  1YHQ A;  2KMG A;  4MFE A;  3NTI A;  5GAM d;  3BDL A;  4M77 E;  4F7U E;  2QXF A;  2DD5 B;  4RMO A;  5D6Y A;  2EQJ A;  4C5G A;  3CCV A;  1K73 U;  3G4S A;  3EAE A;  4OB1 B;  2NLU A;  2QQ9 A;  3PMT A;  3C4S A;  3DLM A;  2RHX A;  4L5G A;  1LOJ A;  1VQN A;  4IUU A;  5FU6 C;  3N5B B;  1FWZ A;  2KK4 A;  1QLB A;  3CMA T;  1MHN A;  4OP0 A;  4M77 D;  5GAN h;  4C5H A;  1KG1 A;  5LL6 S;  3FC3 A;  3QWL A;  2FHD A;  2MMP A;  2KVQ G;  3RES A;  3CCQ A;  3P8H A;  4OB3 B;  3G6E T;  4OB0 B;  1S72 T;  3JCM c;  2QDY B;  1VQM T;  1Q81 U;  5FLX E;  3TRE A;  3L2W A;  2QA4 T;  1QVF A;  4M75 F;  3M56 A;  3P8B B;  4KUL A;  1WJR A;  4Z6Y A;  3URG A;  5GAN 8;  3FLG A;  1H3Z A;  4C0D B;  2XDD A;  3VV0 A;  4FSX A;  4JX4 A;  3V7S A;  4JRI A;  4C92 D;  1KQS S;  4LD9 K;  1JB0 E;  2PQW A;  2MWO A;  3V8J A;  4E7K A;  1M90 C;  2HQX A;  2EAY A;  3CCS T;  3BY7 A;  3CBO A;  4OGC A;  4HNV A;  2RM4 A;  4MML A;  1HXD A;  1VQ6 T;  3OBY A;  2VGN A;  2OAU A;  3HFN A;  3PMI A;  5GAN f;  3CC7 T;  3OYB A;  3HFO A;  2EQK A;  3GLX A;  3R6O A;  3OYI A;  4A4E A;  1U8R A;  3L2R A;  4M7D F;  5DM7 R;  4Z02 A;  2BIV A;  4MIM A;  1YIT A;  4M7D B;  5LJ3 h;  1TH7 A;  3GF5 A;  3PTA A;  1OZ3 A;  3CCE T;  3BG3 A;  1D3B B;  1VQP A;  4QQD A;  2B8A A;  2LRQ A;  3VJP A;  3MP8 A;  4X9C A;  1XTD A;  2ZPI B;  2PU9 B;  2RD1 A;  3KBG A;  3RIR A;  1X75 C;  2E6N A;  5GAM h;  2QQR A;  4ELZ C;  1KHI A;  2M9U A;  4Y28 E;  1M9S A;  3WVD B;  1RL2 A;  3A5Z B;  5CQX A;  3CC4 T;  3DKM A;  2VXF A;  4ZN1 A;  4M78 F;  3TCJ A;  2JN0 A;  3SWN C;  4WF2 A;  3OW2 S;  3M58 A;  3Q1J A;  4N0A A;  4RKU E;  1G3T A;  5A0G A;  3CCJ T;  4PJO B;  1KC8 C;  2ZZD B;  3RER A;  3OYF A;  1VQO T;  2PVD B;  3QYG B;  1B34 B;  1ZHI A;  2RK2 A;  3M59 A;  4MMK A;  4N4G A;  1NPR A;  5FRO A;  1VQM A;  1Q7Y C;  2P4T A;  1YBY A;  4ZGE B;  1VQ9 A;  4QVC A;  3M4Y A;  3OYA A;  4A4F A;  2E12 A;  2O01 E;  4M75 D;  2DKG A;  2MF2 A;  5CKB A;  5GAM f;  3BDU A;  4A4H A;  5KE3 A;  3L2V A;  1PSE A;  2KR6 A;  5GAN j;  3CCS A;  4R56 A;  4X34 A;  1IRE B;  1VQ6 A;  2XHC A;  3LGF A;  5EJC A;  3JCM Q;  3CC7 A;  2CZ1 B;  2K4Y A;  5KE2 A;  3RMS A;  3JB9 G;  1PSF A;  4C8Q B;  4BY6 B;  5HK0 A;  3SDZ A;  1G3Y A;  2LDM A;  2KMT A;  4B9X A;  2LCC A;  2CZ7 B;  5GMK l;  1YHQ T;  4R55 A;  4IUP A;  4D6W A;  1DJ7 B;  3OYM A;  4HKE A;  1Y96 B;  4EDU A;  3H4C A;  3HP9 A;  4DOW A;  3G4S T;  3CBM A;  2XID A;  2D0Q B;  4HL4 A;  3M53 A;  3WXM B;  2DD4 A;  2ZPG B;  4BB7 A;  2ZCF B;  4M78 E;  4F7U F;  1VQN T;  4M77 B;  4QQ6 A;  4F7U B;  2CKK A;  4ELY C;  3VUB A;  2D9T A;  1FX7 A;  1OYX A;  2EYQ A;  2EFI A;  1O9S A;  4XTW A;  3S3M A;  3QJY A;  3RKW A;  3GNF B;  5FRN A;  4LOC A;  1BI3 A;  2EQM A;  3TEE A;  3QZ5 B;  5LJ3 g;  1NJI U;  3CCQ T;  4BDZ A;  3UPU A;  1QVG A;  3SD4 A;  4M78 D;  3MP6 A;  4JX5 A;  3LYI A;  3H8Z A;  4LDW A;  2DIQ A;  5L8R E;  5LJ3 j;  3CCJ A;  4V2S A;  3FDR A;  3OW2 A;  2GQV A;  3LH0 A;  4C92 B;  2RB6 A;  4M7A G;  4ELJ A;  3CCR A;  2E5Q A;  5GAM g;  1QVP A;  1M1G A;  1OZ2 A;  4PJO G;  5GAN e;  3OMC A;  4XU3 A;  1BI2 A;  1M5Q 1;  3A8H B;  5GAM j;  2BS3 A;  1KHC A;  2XDB A;  2QI2 A;  4XTU A;  2QEX T;  3E19 A;  2DK3 A;  2FB7 A;  2GFA A;  5M9O A;  3X26 B;  2HQE A;  2DD5 A;  4EMK B;  4N0A C;  4GY5 A;  4M6V A;  4IUT A;  4AI6 A;  2QQ8 A;  3RKY A;  2FVU A;  4HT9 A;  4RCB A;  4FL6 A;  1K73 C;  3A8G B;  2A7Y A;  2DXB B;  5LJ5 d;  3HHT B;  3ASK A;  5GMK i;  4FU6 A;  3JRZ A;  3V7C A;  2VUB A;  2F5K A;  5FU7 C;  4E7I A;  3CD6 T;  3L2Z A;  2LVM A;  4MFD A;  2YRV A;  1VQP T;  2P0P A;  4C8Q G;  1QP2 A;  2WAC A;  5GAN 5;  3V8K A;  2K5F A;  3MCA B;  2PUK B;  5CCA A;  4XAX B;  3HL8 A;  4HNU A;  3O8V A;  3JCM g;  3ME9 A;  2P0Q A;  3NTK A;  3JB9 J;  2E65 A;  2DO3 A;  2LNV A;  2LT1 A;  3C12 A;  3L42 A;  4NL2 A;  1Q81 C;  1Y07 A;  2DXU A;  2VGM A;  2JOY A;  1YJ9 A;  4JRQ A;  2O4X A;  5KCH A;  3GP8 A;  3AHU A;  2L5Q A;  4QW2 A;  3OYL A;  2BKD N;  2L89 A;  3VKH A;  2YLC A;  2JZ2 A;  4OMF B;  5GAM e;  2X4J A;  1N27 A;  3L2Q A;  3CCM T;  3JCM J;  1G3S A;  4DQ2 A;  3VYG B;  1KD1 U;  3C95 A;  4J83 A;  4M75 B;  4CRI A;  1VQ9 T;  3QSU A;  3UWN A;  2YHT A;  5GAO q;  4BBR M;  3VUZ A;  1Q82 U;  4N4I A;  1VIF A;  2XU8 A;  3JCM d;  2KY9 A;  2CYZ B;  4OGE A;  3SWN B;  4C92 G;  4JX6 A;  2VC8 A;  2QEX A;  3JCM P;  1BIB A;  4MZM A;  4BDY A;  1M8V A;  1D3B A;  1YIJ A;  4MZP A;  4JJN K;  3OA6 A;  3KHI A;  2EJ9 A;  2PUO B;  4L6V 5;  2QQB A;  1YJW A;  3DB3 A;  2X4W A;  4C0G A;  2JVV A;  4TVR A;  3NFC A;  3HRU A;  3HZJ A;  5D6X A;  5GAO l;  2DJZ A;  4PLI A;  2XK0 A;  4RG2 A;  4AKG A;  3SB2 A;  3CD6 A;  3JB9 H;  4M7A A;  3RUX A;  5LJ5 h;  3PT9 A;  1BI0 A;  1VQ7 T;  3X25 B;  4PJO A;  2Y4X A;  2ZZD A;  2Y90 A;  4HCB A;  1UB4 A;  1B34 A;  5HK3 A;  2QF7 A;  5CQY A;  3X20 B;  2R5M A;  4NOY A;  3OSS C;  4C0Z A;  5DLO A;  4FT2 A;  1VQ4 A;  1YJN A;  3QDR B;  3OYC A;  3NTH A;  1VQL T;  4ME7 A;  4J6Y A;  4OVA A;  4QVZ A;  4Y91 A;  4CI0 C;  4M78 B;  3HPW A;  3MEW A;  5J3B A;  2FYK A;  2C06 A;  5I2M A;  3KXT A;  5FRM A;  3CEY A;  2DVE A;  2WSF E;  3CCM A;  2EIF A;  3CCR T;  5LJ3 f;  1YCY A;  3CME A;  2DTI A;  3INZ A;  4J6W A;  4VUB A;  4XK8 E;  4C8Q A;  1JJ2 S;  3HSB A;  3MEV A;  1KQ2 A;  4BD3 A;  1LNX A;  2PVO B;  4O6J A;  3UT1 A;  1M1K U;  3SFM A;  3OYN A;  1N6A A;  1KQ1 A;  3PIO A;  2HNI A;  4Q5W A;  3QYE A;  1H64 1;  1I8F A;  4J7I A;  3T9N A;  5CKF A;  1KQS A;  3QUI A;  1ZBX A;  3L1A A;  3JCM h;  5KH6 A;  5GAO r;  2AHJ B;  5HKC A;  4C0F A;  2IVW A;  4N4H A;  3CCU T;  3LLR A;  5A0D A;  4JUV A;  4M77 A;  2P0K A;  2CZ0 B;  2RHU A;  3PGG A;  2VV5 A;  3JCM V;  2E6Z A;  4JLG A;  1G5V A;  2GFU A;  2DZC A;  2LQK A;  1Y7X A;  5I2S A;  2X35 A;  4NS5 A;  3G71 A;  1JBM A;  4HA8 A;  4ZTF A;  1W2B S;  5CK9 A;  1VQ7 A;  1X01 A;  3CCL A;  1NJI C;  4M7D G;  4NC6 A;  5A2Q E;  4MZT A;  3WVE B;  4C92 A;  2RJC A;  1N8R U;  2XKO C;  5CAI A;  5IT9 E;  3M57 A;  3RMQ A;  3FRN A;  2G3R A;  3OS1 A;  3ZBD A;  3S3N A;  4EPC A;  1YJ9 T;  2EQU A;  1Y71 A;  3JB9 D;  3HO8 A;  3JCM f;  1VQL A;  5GAN 7;  2EKO A;  1WQW A;  2K5I A;  3DLL A;  2E1H A;  4EMG A;  2LQ8 A;  2R58 A;  2XI9 A;  4MDW A;  5CKE A;  3RKX A;  5LJ5 g;  3GPL A;  4E7L A;  3QII A;  2X4X A;  5DY9 A;  1Q86 U;  2DPP B;  4JS4 A;  4EMK A;  1V29 B;  4GLK A;  3QXE B;  2RH2 A;  4IUV A;  2EJG A;  5LJ5 j;  4M7A C;  2V8K A;  1XQH A;  1FXX A;  4PJO C;  5CKD A;  1XNI A;  2QQS A;  3OS5 A;  2DXB A;  3VU3 C;  5FU6 B;  3QPH A;  5GAO p;  4KT0 E;  3QBY A;  4A53 A;  2MWP A;  3GIB A;  4M7A E;  5D6W A;  4EMH A;  4L59 A;  3E9F A;  1VQ5 A;  1YIJ T;  5J39 A;  2RJE A;  2WSC E;  1WJQ A;  1M4Z A;  3OB9 A;  3S3O A;  1JJ2 A;  1VQK A;  2XD0 A;  4PJO E;  1YJW T;  1VUB A;  3QO3 A;  1O75 A;  3VKG A;  4BBS M;  2F5T X;  1K9M U;  3HBL A;  2DIG A;  2QTX A;  3CCU A;  2VXE A;  4KUI A;  4BE2 A;  3A8M B;  4M7A D;  1MGQ A;  4HCZ A;  1K8A U;  3JB9 I;  1N9S A;  3M54 A;  3EFR A;  2FL7 A;  2CS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...