3X25B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 700 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x25B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x25B02
4ZGJB 1DJ7B 1UGRB 2CZ7B 4OB3B 3QZ9B 3VYGA 3LW5E 3A8LB 4OB0B 1AHJB 4OB2B 2CYZB 3QXEB 3QZ5B 3QYGB 3A8HB 3A8OB 2WSEE 2PVOB 1UGSB 3A8GB 2ZPEB 4OB1B 3QYHB 3VYGB 2D0QB 2DD4A 1PSEA 4ZGDB 2DXCB 2DD5B 2CZ0B 4RKUE 3HHTB 1QP2A 1JB0E 3X24B 2PVGB 2ZPIB 3X20B 3A8MB 1PSFA 2DXBB 2DXCA 2PUOB 4ZGEB 2PVDB 2DXBA 2ZZDB 1IREB 2PU9B 3VYHB 2DD5A 2PUKB 2DD4B 2ZPGB 4KT0E 4Y28E 2CZ1B 2QDYB 3WVDB 3X25B 3WVEB 1V29B 2WSFE 2WSCE 4XK8E 2ZZDA 1GXIE 2AHJB 2ZPFB 2CZ6B 2ZPHB 2O01E 3X26B 4FM4B 4L6V5 1QP3A 1UGQB 2ZPBB 3X28B 1UGPB 5L8RE 2DPPB 2ZCFB
chains in the Genus database with same CATH superfamily
1YCYA 4EMKB 3CCUQ 2DMOA 2K7AA 1F5QB 2MWOA 3CCJA 3OW2A 1QVGP 4MZTA 1S72Q 1QW1A 4TVRA 4XU2A 3H6ZA 1CKAA 1TD6A 1OEBA 1I4K1 2FPEA 1VQPA 3L42A 1EZZB 5GANf 4M77G 2IIMA 2JS0A 3JB9J 2WMBB 1UDLA 2EJ9A 4FT2A 2A08A 1G3NC 2LRQA 8AT1B 5LMKB 2XICA 5GMKi 2EBPA 2YRDA 4GLMA 1RAEB 1X2KA 4WF2A 2L2PA 1W98B 4EOQB 4MZMA 2K3BA 2MIOA 2CP7A 2EQJA 1NJIC 2DVJA 4NSTB 3QHRB 2I0NA 3CD6T 3BHUB 2M51A 1Q82U 1M3AA 2HKNA 1KXUA 1SF9A 5KYWB 2FHDA 5GAMe 4E7SA 3R6OA 4QW2A 1E9HB 3CCLT 1Z9ZA 3EGXB 1I07A 4MMKA 1JJ2A 3C0CA 3GNFB 2RQUA 4PJOC 1I1JA 2OTLT 1U5SA 5KYUA 2ZZDB 1UTIA 4M75B 3H4CA 3HRUA 1KIKA 3AT1B 4BDZA 2OTLA 3OBWA 1VQ7A 4J9DA 3J80E 2M02A 3CCMT 1VQ4Q 9ATCB 1YI2T 2DTOA 1BU1A 4M7AB 4AKIA 3HFOA 2QDYB 3EJ1B 1GL5A 4GLKA 2V22B 2KYMA 2DZCA 4HNTA 4LNPA 2EJFA 5LJ5d 4PJOE 1SRLA 1KJWA 3L2ZA 1KC8C 2HD0A 4ME7A 1T0HA 1WJRA 3MJXA 1VQ6T 1ZUYA 3BE3A 5LJ3j 3JB9I 1ZBXA 3REBB 1M2OA 2DETA 4PJOF 3DOGB 1M8MA 5HCKA 1W4SA 3TW7A 2DBMA 4JJDA 1U1TA 1YBYA 2K2VA 4KUIA 1DJ7B 2XKOC 2CDTA 1NEBA 2QFZA 1M9SA 3FB9A 2HBPA 5HBHB 4F7JB 1MMDA 3F5XB 4JX6A 4Y72B 2PMIB 1M1KC 1D1CA 5FRNA 2BPMB 5KH6A 5GJVB 1YJ9Q 1IRXA 2OAWA 4JRIA 2K3XA 1YHQT 1M2VB 2DAQA 3RERA 1TFBA 2ROTA 3PVLA 5GAOl 1M90U 4XU3A 2E6ZA 1WLPB 4PJJA 1JRIA 4M75G 2PVOB 5L2WB 1PKDB 3CCST 2KBTA 2LJ1A 2KAFA 3A8GB 2ROLA 3DDQB 1K9AA 4J8OA 5GAN7 1YJWT 1IHWA 3BLQB 3M5AA 2DK3A 2DD5B 1N8RR 1MMAA 3CCUT 4HT8A 4JJNK 1OIYB 4XTWA 5GAN6 1P5EB 2G6FX 1YNZA 3H0FA 4J9BA 2YSQA 1VOMA 1T3SA 4FYXB 2CJMB 1U8RA 2LQKA 3CCVA 1X6OA 2K5IA 2PUOB 4EMHA 4CFUD 2GGRA 1RI0A 3NDQA 2L3PA 2LC4A 1OU9A 2BIVA 4M77F 2DRKA 4A53A 5LL6S 4ROCA 2EGAA 3RESA 5GAOm 4E6RA 4HVUA 3CCQT 4EMKC 4OMQA 3AHUA 1WHJA 5J3BA 2O9SA 1BB9A 2UZEB 3OY9A 2BS4A 2A36A 2DYIA 1VQPQ 1YFNA 4C8QE 2LW4A 2XK0A 1VQOQ 1F1BB 3CCSQ 3BHVB 3SDZA 3FLGA 2YRVA 3EH1A 3TNIB 3X26B 3CCJQ 2R57A 1XO2A 2RPNA 3RIRA 2C5XB 4NC6A 4DBFA 1BI2A 4QSHA 1VQNQ 3PMTA 1E7PA 2DTHA 3OYMA 3M56A 2HZYA 2GTOA 2QK0A 3T9NA 1WJQA 3BDLA 4BI3A 5HQ0B 1W1FA 2CYZB 4LDVA 4BCMD 3BG9A 1JXMA 2EYQA 3H0IA 1VQ5Q 4M75C 2FRYA 1UB4A 4ZNXA 2KMGA 3A8HB 1H24B 2IN3A 2HSEB 2LCCA 3OYDA 1UGSB 2UUEB 3I5SA 3U23A 1FX7A 3CXCS 1WHLA 1ZP2A 1B34B 2AT1B 1YJ9A 1Q81R 2VVKA 4DBQA 4R0KA 2DJQA 1Q81C 4M77D 2XDBA 1PSEA 1YJNT 1EIFA 3GBQA 2DXCB 1D3UB 1OL1B 1AOJA 3JCMg 2GFUA 2L0AA 2QA4Q 1JB0E 2DEUA 3VS3A 2E5KA 1BI0A 1C0MA 2UZLB 1GFDA 3EHQA 2ZPIB 2KY9A 2EWNA 3CPFA 3MIAB 1M1GA 4A54A 4F7NB 1K8AU 1XOVA 1ZHIA 2DVEA 4MFEA 1LNXA 2DXBB 2KMTA 3JCMV 4C8QD 3NHNA 4KH1B 5GAN4 3G71T 3RR6A 4N4IA 3NPFA 3JB9F 2VWFA 3M0TA 1B7TA 3M54A 1TXQA 3LWIA 5KYNA 2K57A 4Y28E 1KD1R 3P8BB 1M5Q1 4ZTJA 5L23A 2Y90A 1JSUB 1N6AA 2OTLQ 3VRYA 2VXEA 3QWLA 4TTHA 4RTZA 1AWXA 1HXDA 4FM4B 2R5AA 1GUXB 2XD0A 2JM9A 1G3YA 2H3EB 2QTVA 4RTWA 5EC7A 3CCRT 4OMOA 3HBLA 1PD1A 3QSUA 1N4MA 3A5ZB 1URCB 1PKSA 2IVWA 3BW1A 4F7UB 2L89A 5LJ3g 3TNHB 3QZ9B 3O5ZA 2XMFA 1G83A 2FB7A 1WXBA 3VS6A 1R8OB 3ZEHA 2P0KA 2WFYB 1CSKA 3OW2S 1FWZA 5LJ3d 3CC7T 1ZUKA 4FSXA 3JB9D 3QYGB 2YT6A 3OYKA 2Y4XA 2QG9B 3HL8A 3MP6A 5HVYB 3PMIA 4ORZA 1IB8A 1KQSS 1WXUA 5FGKB 2ED0A 2VKNA 2A3LA 2LJ0A 1QMCA 5CKEA 4M7DF 1SHGA 3OBYA 4JLGA 3L2RA 2KRSA 1K76A 3EHRA 5IHNA 1OQKA 4DBRA 4A4KA 2CT3A 2KSSA 3VS1A 2E70A 1TTHB 2LCLA 1JEGA 3VUZA 5EFQB 1RLPC 5I2SA 4DQ2A 5AT1B 3LX7A 1O9KB 4CFUB 1C9BA 1H3ZA 5HBEB 2PUKB 1ZLMA 1X6BA 1RADB 1VQNA 2CT4A 4ATOA 4C5HA 2RHUA 3CQTA 4IIMA 5LJ3f 3KHIA 2DL8A 2LNVA 2RM4A 4M75D 5I22A 4BY1X 4J6WA 3CCSA 3L2QA 2LDMA 1MV3A 4B6MA 4M7AD 4M77C 2KNBB 3LGLA 3CXCA 3X28B 3JV3A 2RNAA 3RNJA 4BCGB 2L3SA 2PK9B 2LMJA 2LT1A 4Z89A 2D1XA 4EONB 1KQ2A 3V8KA 1VYVA 1BI3A 5D6WA 2VV5A 3P8DA 4HCCA 5KYYB 3VS7A 3HPWA 4M75A 3DTOA 3OYAA 1VQNT 4BCFB 3BLHB 2K5LA 2V26A 1I0CA 2WXVB 2EYYA 4BCPB 4C0DC 4BACA 2RD1A 3EGXA 5D6YA 5GAOn 3CCJT 4BCMB 5LQFB 2QGGA 2DL7A 3M0PA 2LZ6B 1Y0MA 1AD6A 3ZFJA 4KGZB 4YTLA 1TS9A 2LX7A 3DL1A 4BD3A 2A37A 5FU7B 1UHFA 1XQHA 1YWOA 3QBYA 2JNGA 5CVIA 4PFOA 1UUEA 2JN0A 1G8XA 2CCHB 1G5VA 1PSFA 4RMOA 1OZ2A 4EC8B 2YXYA 5KYWA 4EPCA 3UA6A 4N0AC 2BS2A 3I56T 2YUQA 1YN8A 5GMKe 2X3XD 5DLOA 4YOOA 1KQ1A 2O9VA 1K73U 2OI3A 1AZGB 1X75C 2RHXA 3CMEA 2JMCA 2B86A 1ZSGA 3MKDA 1VQ6Q 2HCKA 2CH4A 1AISB 1UECA 4F6UB 1OX9A 4LDWA 4QVZA 3JCMQ 3CCQQ 1VQLT 1I8FA 1XNIA 4KH0B 2KXCA 3UDCA 1VQ9Q 2GBQA 2MMPA 2DIGA 5EJCA 1ZA2B 2X4YA 4B9WA 1M3CA 1NEGA 5LJ5h 2VGMA 2AHJB 5CYIB 1YI2Q 4KRCB 4HL4A 2MOXA 4IMYB 4AT1B 4CFMB 1WHHA 1QCNA 2BKZB 1PHTA 3VKGA 3UWNA 2QEXA 1NYGA 4LD9K 3DJBA 4Q5WA 3M0QA 4M4ZA 4ZGJB 1QKXA 3TNWB 4MFDA 2NUPB 4MMLA 4C5GA 4F7UF 2YDLA 3VYGA 2K5FA 3G4SQ 2ENMA 3OW2P 1QVGA 4HVWA 4F6WB 4N4GA 2KXDA 2AKKA 3JCMf 1YIJA 4RCBA 4CI0C 4X9DA 3VS5A 3QXEB 3OMCA 3BLRB 2K6DA 3OYYA 2EAYA 1W2BS 3QIIA 1OKVB 1I81A 3OYIA 4LDYA 4BI8B 1KHCA 3TU4K 2KDSA 2V1RA 2AKLA 4XU1A 1WI7A 3QPHA 4CFNB 2P0QA 2HDAA 1D0ZA 1UFFA 1ZQ1A 1LVKA 2A7YA 4RKUE 3M4GA 3PIOA 2HL5C 3HFNA 2VB6A 5AYFA 3CC7Q 2QEXT 4QQGA 4V2SA 2RI3A 3CCRA 1AWOA 2QXFA 2XDDA 1S72A 1WXTA 5IF1B 1ABQA 4M77B 2G9XB 1ZSZC 4HVVA 4M7DA 3I55T 2DXBA 3G33B 3QG1A 3QO3A 3PFSA 1RABB 2DD5A 2J06A 5GMKl 3OYGA 1U3OA 1G3WA 2DD4B 3L1AA 3CEYA 4BY7X 2HSPA 1VQMA 3ASKA 2W96A 3CCMQ 1VQ4T 1VIFA 5J26A 3IQLA 3I55Q 1BCMA 3WVEB 3EIDB 1I5OB 3TSWA 3VRZA 4R55A 4C0DB 5DQVA 2X1NB 1V29B 3JCMh 5CR2A 5GAN8 5CCAA 3GNGA 3P8HA 1MHNA 1ZUUA 3M0RA 4QVDA 2ZPBB 2OTJA 5C0MA 2IVXA 3INZA 2E6NA 2DZ9A 1Q86R 3UF4A 3S3NA 4J9IA 3ZL7C 1ENWA 3JSCA 2VUBA 3C94A 1X43A 2M0YA 1RLQC 1FXXA 1UNHD 1UGRB 4PJOA 1O9KA 2DE0X 5KE3A 3A8LB 4XTZA 4M75E 2JJ9A 1YJ9T 1H641 4OB2B 1RAGB 2O4XB 4CC2A 5GMKh 2ABLA 4JLIA 4XAXB 3PIPA 2JS2A 3CC2A 2GTJA 2RB6A 2NUZA 3M58A 2E41A 1M90C 5IT9E 1OULA 4AFSC 4C8QA 2FG0A 4KUDK 2EGEA 3QWXX 4OB1B 2KQWA 3VYGB 2DL5A 2C5OB 1VYTA 2V8IA 2DFUA 3R6NA 4Z8AA 4FU6A 4PFZA 4AMCA 2J6FA 5IHKA 4QQDA 2C5NB 1QMZB 2DERA 2PJQA 1KK7A 4QVCA 3SD4A 3DDPB 1N27A 2AZSA 2KT8A 4M7DD 2D0NA 3DLMA 4J9EA 4CC4B 3CC4Q 1GH6B 4G6LB 4F7UA 1YJNQ 3CCVQ 1OU8A 2W2HA 4M7DG 4MDWA 5HBJB 3S3MA 2BZXA 4M77E 3I56A 1OGUB 4GY5A 5KCHA 3MY5B 1M3BA 1NPPA 1JQQA 3OYLA 1W6XA 1UJ0A 3QJYA 4C8QB 4JS5A 5FLXE 4XTYA 1VQ5T 3O8VA 2XG8D 3I56Q 2F2WA 1D1AA 3SWNC 4DOWA 2V8JA 1QQJA 1M1KR 1K73C 2SEMA 3PVQA 1H27B 3N5BB 4DEXA 2ED1A 1OI9B 2E5QA 3EAEA 3EG3A 5LJ3h 2CZ6B 3RBBB 4C5IA 4PKCC 3JCMb 3QYBA 3C95A 3NGPA 4C92C 1NLPC 2BUDA 1NJIR 1AZEA 4BUGA 2CP3A 1BYMA 2EQIA 3CCEA 2KGTA 4E7LA 2KEAA 3OYBA 1BIBA 1VINA 1X69A 4BY6C 2DJZA 1YITA 2CREA 2RF0A 2QQ8A 4OGEA 4RTVA 4EOKB 2B9RA 1YHQQ 2BTTA 1FYNA 1MMGA 4IIOA 5A0DA 2FL7A 2E12A 4DBHA 1P92A 4JUVA 5IDPB 4J9GA 3CC2Q 2EGCA 5KYXB 1E6HA 1BU2A 3WXMB 1VQ8Q 3M9QA 3OQ5A 2J7IA 2KR6A 4HCZA 1Q82C 1OPLA 4X1VA 1H1PB 4LUDA 3EH2A 3G6EA 2DMEA 4OGCA 3POMA 1O75A 4KBMB 1AWJA 4BCKB 2H8HA 3VS0A 1PC0A 2KE9A 1E6GA 4FW2A 3CXCP 1VUBA 3X24B 1FMVA 2OTJQ 1NM7A 4NS5A 1QLYA 1WNLA 3MO8A 3FC3A 1JBMA 1BIAA 1K1ZA 4VUBA 4M75F 3NTIA 2RQTA 4E47A 2BZ8A 1WDXA 1WYXA 3E9FA 2D8JA 5I21A 3V8JA 5KYXA 2QGSA 1G3TA 2HQHA 2NUPA 5DY9A 3JCMc 4HCKA 3MEWA 2EJGA 4MIMA 1KC8U 1R77A 2EKHA 4KGVB 3JB9G 3BG3A 1PNJA 4X34A 4M6VA 4RTXA 2DXUA 2CCIB 2PNIA 4OMMA 5GAMg 4BCQB 2J6KA 2DKGA 1TG0A 5KYYA 3H8ZA 3RDVA 2WSFE 4XK8E 2IW9B 3OS0A 1YJWA 4BDYA 4L6V5 5CKBA 2RN8A 1OKWB 4BCOB 5GAN5 1H25B 4OGRB 5CIUA 2DPPB 2LJ3A 2QQSA 2RJFA 2VC8A 4KRDB 4HA8A 2EKOA 3DB4A 1WHKA 4ROEA 5KCOA 1VQKQ 3GLXA 1VQ9T 4EOIB 2K9GA 2VYTA 1D1BA 1NBEB 1QWFA 3D7SB 1Q86C 2RQWA 3GOXA 4O6JA 1M90R 5FU6B 1V76A 3A8OB 1Y96B 2DILA 3EOCB 1YIJQ 2BE9B 1IGUA 1QCFA 4ELLA 2DRMA 4CXAB 4Z02A 4C8QC 4M7AC 2O31A 2P84A 4EC9B 3C12A 4C92F 2HQXA 3CBPA 1W2BA 4OVAA 2QTXA 1M2VA 3HHTB 2RI5A 4II1A 4X9CA 3HKSA 3EFOB 3G1JA 2CKKA 4OF1A 3X20B 1UJYA 2PK2A 3FEOA 3LYIA 4M78F 2I2LA 1U1SA 1QVGS 1MNDA 3REAB 1YI2A 1VOLA 1K9MC 1OL2B 3I5RA 4F7UE 5CO7A 3G71A 1JJ2S 5HNBB 1WX6A 1XJWB 2IG0A 4M7AE 5DLQE 2RHIA 2LP5A 4BE2A 3CCLA 2EYXA 1AD5A 3A98A 4OMLA 4C8QF 2RQRA 1YHQA 4LDXA 3Q1JA 1X6GA 2O2OA 1S72T 2XI9A 2ECZA 4D8KA 3EGDB 3MY1B 2QGFB 2GFAA 1U06A 1UNLD 4XU0A 1WIEA 2X4WA 3CCEQ 2HAXA 4BXXX 2LCSA 4AG2C 5HK0A 2X4JA 2DA9A 2EIFA 1RAIB 4J5YA 1H28B 2BS3A 1QCOA 5GANe 3QHWB 4JX4A 3MHXA 1WHGA 1T3LA 3EGDA 5GANg 3RKWA 3MP1A 4IURA 1X2QA 4OB0B 5GAOq 2HBWA 4B9XA 1YJWQ 4QT7A 2GQIA 2M1HA 2DL3A 1N8RU 4FX3B 5GAN2 1D0XA 1WA7A 1Y7XA 2M0OA 4JRKA 1GRIA 4A4GA 4AI6A 2RK2A 1N5ZA 4PLLA 2JTEA 4FYWB 1WPYA 2L5QA 5CKHA 4NOYA 4OP0A 4IUTA 1Y57A 3NFCA 1VIEA 4JZ4A 3KXTA 2F2CA 3QHSA 4EOLB 2DD4A 2QYZA 1WQWA 4IKFA 4EOSB 2E10A 4JJBA 2D6FA 4M7AA 2LVMA 3VS2A 2CZ0B 1YITT 2MAMA 5LJ5j 3FRNA 4JPBW 4M78B 2W10A 1IO6A 3A8MB 4HNUA 5HY6A 3VUBA 2R58A 5KYUB 3HRSA 2DXCA 2CP2A 4LDUA 3NTHA 2PVDB 1Q95G 1R0CB 2COYA 4CRIA 1K9MR 3JB9H 3BY7A 1YP5A 3SHWA 4M7DC 2CP5A 3G6ET 2KRNA 4QQ6A 4F04B 1LPLA 4BBSM 4C5EA 1VQLA 5GAMj 1H8KA 1J3TA 3G6EQ 2P4RA 1VQLQ 2V8KA 4F7LB 1UEBA 2ZAEA 3HTRA 3CD6Q 3UT1A 4ZN1A 2IPOB 4C92E 3MPUB 3LH5A 1M27C 1K73R 3LLRA 5FRMA 1KFZA 4A63B 1GXIE 3VKHA 2FEIA 2JUFA 3V7CA 1GFCA 1WHMA 1NLOC 2QQRA 3FIFA 2C4GB 4F16A 1PRMC 4M78A 2RK1A 3UA7A 1YITQ 2NWMA 1TUDA 5D6XA 4LOCA 3UATA 5I11A 4J9CA 2OTJT 2C0IA 1OV3A 1PCXA 4FT4A 3RKXA 4N0AA 3GP8A 4PJMA 2EYZA 1UNGD 2W9ZA 3TCJA 1JOWA 4RTUA 3I55A 1HYOA 2KRMA 3NTKA 5I5ZB 2DM1A 4UN0A 1TH7A 4HLQA 3OYNA 2L8DA 1HK9A 2COWA 2LT4A 2WSEE 2VXFA 3OS1A 1VQMT 4EIKA 4E7KA 3L2WA 4EORB 2JVVA 4XTUA 5I2MA 3QYHB 4YOZA 1H1RB 2M16A 3EG1A 1N8RC 1M4ZA 3MP8A 1K4US 1N9RA 1QLBA 1RAAB 4F7SB 5CK9A 4F14A 2LX9A 2BE7D 4WCIA 3VU3C 1WQ7A 1EFNA 2F5KA 2FYKA 1RACB 2UZBB 3HZJA 1BKBA 4I3ZB 5FWBA 3QDRB 4CRLB 1KD1C 3E19A 2CP0A 1T0JA 3J81E 1RI9A 1AVZC 2J6OA 4LUEA 5LJ5g 2D9TA 4BCJB 2YUPA 3QWYA 1ZSZA 3VYHB 2JMAA 2OAUA 4CC3A 2P4TA 4Y92A 4ZTFA 3OYJA 3JCMJ 3FJ5A 2MF2A 1FMWA 3L2VA 5GANh 1A0NB 1SKUB 1M1FA 3SEMA 5CKDA 3DLLA 2ZPGB 1GCQC 1OX8A 3DB3A 1QKWA 1Q81U 3G4SA 1RUWA 1Q7YR 3V7SA 1RL2A 2MK5A 3CCLQ 2DL4A 2DX1A 2PTKA 1JJ2P 4IUUA 2Y4YA 4OMNA 5GANj 3G71Q 4BE0A 2E1HA 3M4YA 1QP3A 5ECAA 2FZCB 2E65A 2COZA 4BE1A 3SWNA 1K8AR 2I53A 4PLIA 3H0HA 2PQWA 3EFOA 4JX5A 4XTXA 2GCXA 1FKMA 2C6TB 1QWEA 4M78C 2QA4T 2FPFA 2QQAA 2DNUA 1MGQA 4RTTA 3LW5E 3OB9A 1E7OA 1OYXA 1AHJB 3M0SA 3JCMW 3CMET 4JDSA 3QZ5B 4KRTA 3CMAT 1NYFA 1D3BB 3ME9A 4AFUC 2F2VA 2W99A 3EFSA 2RMOA 4M7DB 1YWPA 2CSQA 2WHBB 1QVPA 2JTFA 1VA7A 1NG2A 2G3RA 1LJOA 2YHTA 4ANJA 3RGFB 2VASA 2QASA 4F70B 1VQMQ 5CQXA 1H3HA 4ZGDB 1Y96A 4C0ZA 1M1KU 3FDRA 1QVFP 4RUGA 2LQ8A 2DO3A 2ATCB 4M78G 1QP2A 1AEYA 1LOJA 3CCET 1YJNA 3CBMA 4A4HA 1G3SA 2AIRB 1V1CA 4JRPA 3CC4A 4MZPA 2CGHA 2FPDA 3CCVT 4FIBA 3CCRQ 4CFXB 2WEVB 4ELJA 4BCNB 3GPLA 3CC4T 2F2XA 4YOSA 1PG5B 1SSFA 2W9FA 5IHIA 4AFQC 1RAHB 3QDFA 3OMGA 1BCOA 4ELZC 2CS7A 1TOVA 3TREA 2DEQA 2JTMA 2UZDB 8ATCB 4II5B 2CZ1B 3HP9A 3EFRA 2WIPB 2XIDA 2L3RA 2LQWA 1PRLC 1Q7YU 1SG5A 3B57A 2WSCE 2NUTB 1BBZA 1TU0B 1HJDA 3OSVA 3CD6A 4PJNA 2ZPFB 2ZPHB 5A2QE 1VQ8T 3VV0A 1GBRA 5CAIA 2SRCA 2JT4A 2QI2A 4K11A 1WFWA 2MYSA 5L8RE 4HKEA 4A4EA 4M78E 2EVRA 4M7AG 2XDPA 1WJSA 1YIJT 2JM8A 2QEXQ 4MDXA 1UG1A 4J6XA 2CZ7B 4OB3B 3NMZC 2C5VB 1OIUB 4IUQA 5GAN3 2YWWA 3JCMd 1R0BG 1NPRA 4LXCA 4LE9A 3ZBDA 4BCHB 1GY3B 3LQ5B 2CH4W 2HMAA 3CC2T 3HB9A 3HRTA 4J9FA 4IUPA 4C92A 3GF5A 1PD0A 2RO0A 2OJ2A 1C6VX 4BCND 4RODA 4L59A 1MV0B 4OMPA 2D0QB 2X9HA 3TW6A 1JO8A 1PM3A 2YUOA 3OYHA 1UE9A 3JRZA 1VQKA 1Y71A 3GIBA 3PT9A 4OMFB 3URGA 1H26B 4CFWB 2EQKA 4XQ3A 5FW9A 3MI9B 1PWTA 4CC7A 5LJ5e 2FZGB 2MCNA 4L5GA 1OI1A 1B34A 3H41A 2RI2A 4HNVA 4D8DA 3CPWA 3OS2A 3QJ6A 3DKMA 1IREB 1TWBA 3TEEA 1ABOA 2BKDN 2R7GA 1ZBJA 4EMKA 1W70A 1Y07A 2A28A 2IW8B 1FMKA 2EUFA 2EPDA 1AT1B 5IHYA 3PTAA 3CPWS 2K2MA 3I35A 5FU7C 1NZ9A 1VQ4A 2I40B 3E2UA 1VQ7Q 4LD6A 2WJ9A 4PFPA 1JKWA 2RJEA 1SRMA 5LJ5f 1ZX6A 2KROA 3GTMS 2ZZDA 1W2BP 1WGSA 1BK2A 1D09B 5FROA 3JCMP 3V7RA 5GMKj 2O88A 2DBKA 2R5MA 2KR3A 1Q7YC 1HD3A 1JU5C 2AZVA 1UGPB 3PGGA 1Q82R 5CKFA 4QKUA 1TSFA 4DA4A 2P0PA 2JGZB 3JAME 4EOJB 4ELYC 3BDUA 2JOYA 4C92G 3TSZA 1B07A 1PKTA 2E3IA 2HNIA 1MUZA 3TQ7P 5IH2A 1KQSP 3EG9A 2XU8A 5GAOp 3ER0A 2CUDA 1Q86U 3KFVA 1S1NA 2DIQA 4Z6YA 4J6YA 4PJOD 2EFIA 2JW4A 1QVFS 1SSHA 5LJ3e 3MCAB 2EQMA 4HT9A 1VQPT 1KHIA 1I5LA 2K4YA 2X4XA 4DEYA 4XTVA 2C0TA 2KVQG 2RH2A 4P5NA 3THKA 3VS4A 5GAMf 4LN2A 3CMAQ 4GBQA 2HKQB 1EX4A 2B8AA 4UC4A 3OYEA 5CQYA 1KD1U 2JXBA 1OPKA 3SB2A 3C4SA 4PK4A 4J7IA 4PL6A 1FINB 1K9MU 1ACMB 2PZ1A 1D3BA 4RTYA 3VKIA 3A1PA 1H4LD 3S3OA 4JRQA 2X3WD 1C1AA 3L2UA 4M7AF 2CP6A 3ULRB 1X27A 4KT0E 2EW3A 1M30A 2BZYA 7AT1B 1IZ6A 4Y91A 3X25B 2F1LA 2FO0A 2QQBA 2WIHB 2NUTA 3CCMA 1TUGB 1SPKA 2DLPA 1MMNA 1Z9QA 4AKHA 2DTIA 3TN8B 2ZGWA 4J83A 3MEVA 4O5VA 3KUFA 2L3QA 2O01E 3OA6A 2Z0WA 4FCYA 5ICPB 3HSBA 5J39A 1CKBA 2CUBA 2KK4A 4NL2A 4M78D 1ZSZB 2F5TX 2QAZA 3OYCA 1H1QB 4FYVB 4BB7A 3LWHA 4EOMB 2EQUA 2LQNA 2JZ2A 2RQVA 3RMQA 2DF6A 1AWWA 2ZCFB 1IGQA 1VQOA 4IUVA 3CC7A 2YLBA 2NYSA 5GAMd 1H1SB 4BI4A 4J7FA 2DYBA 3PE0A 5IDNB 2RHYA 5KE2A 3EG0A 4EDUA 5GAMh 4HXJA 2QF7A 1VYWB 4F17A 4F6SB 3QKJA 3M59A 1B3QA 1UGVA 3M57A 5ACBA 5DQWA 1KQSA 5IXFA 4PNOA 2CSIA 2YRCA 5M9OA 3OYFA 4C0GA 3RKYA 4AFZC 2E4HA 3LGFA 4JS4A 2MPXC 1IHVA 3FJPA 2ZPEB 1IXDA 5HKCA 4DOVA 5C6SA 5A0GA 1MNEA 4BCIB 3VJPA 1K0XA 2C06A 3M0UA 3MEUA 3META 4EOPB 2KYBA 4JJCA 1VQ8A 4NL3A 3E1SA 2WMAB 2OX7A 2G77A 4FL6A 5A0LA 2V1QA 4WTOB 4YC3B 4RCCA 3G7ZA 4ZGEB 2RJDA 1VQ7T 2VGNA 3E9GA 4RG8A 2PU9B 4E7ZA 3KBGA 2QA4A 3SFMA 2FRWA 1GCPA 4C0FA 1VYUA 2NLUA 4D6WA 4KGXB 1GBQA 2X51A 3S6WA 2F69A 1O9SA 2LTOA 1RAFB 3O0GD 3EG9B 4PJLA 5EG2A 3CCQA 2K3YA 1QVFA 2HEQA 1VQ6A 4M7DE 2MI6A 4F7UG 1ARKA 1X01A 2O4XA 5CEIB 2KI7A 3BHTB 4JZ3A 5IAYA 3UPUA 2GF7A 2D8HA 4FSSA 1YCSB 1KC8R 1LCKA 1BI1A 4Z88A 2MWPA 4PJOB 3M03A 2QDLA 3OS5A 4A4FA 4EMGA 2ESWA 2WACA 4BBRM 5DM7R 1JSTB 4C8QG 2C0OA 4FYYB 1WZOA 2M9UA 3CPWP 3OSSC 2DXTA 1TUCA 1G2BA 3SWNB 2HQEA 2AK5A 3F70A 4C92D 1GUXA 6AT1B 5GMKm 1JXOA 3G4ST 4AG1C 2J05A 2LNHB 2GQVA 2IW6B 3QUIA 1GCQA 4PJOG 2XHCA 4BCQD 4C92B 5GAOr 2YLCA 3PO3S 1SHFA 2E64A 4E7JA 1ZA1B 2KT1A 5GANd 1M8VA 2YUNA 5HK3A 2GNCA 4CFVB 3BG5A 1OZ3A 4BY6B 2FZKB 5IXBA 2PVGB 3K7AM 3JCMe 4EOOB 4AKGA 4E2FB 3TVTA 3MEAA 2RA2A 2W0ZA 1K8AC 1NE8A 5GJWB 2FVUA 3QYEA 3M55A 1KG1A 2EYWA 1XTDA 2QDJA 4N4HA 4E7HA 1KSWA 1N9SA 3H9NA 4ZN3A 1D0YA 2RJCA 3PNWC 4KULA 3EGUA 1VQOT 3BFMA 3CBOA 3JCMX 1VQ9A 2RHZA 3V8LA 1H92A 3EG2A 5D7UA 1SEMA 2A0FB 4HCBA 3WVDB 4R56A 1K0SA 3LH0A 3I9QA 3CCUA 2X35A 2K79A 1UHCA 4E7IA 4J9HA 5FU6C 1VQ5A 3CMEQ 3HO8A 5IN1A 1FVVB 2H3JA 4M77A 1OOTA 2WPAB 2QQ9A 4RG2A 3J7AF 4OR5B 4ESRA 1UGQB 1VQKT 4FW1A 3RUXA 2E3HA 3M53A 2PHGA 1HSQA 1NJIU 3RMSA 5BNJB 2HL3A 3CMAA 5FWCA
chains in the Genus database with same CATH topology
2RJFA 1YIJT 1BI3A 2VC8A 4HA8A 4MDXA 1YCYA 5D6WA 2VV5A 4EMKB 3P8DA 2EKOA 4J6XA 4HCCA 2CZ7B 4OB3B 3DB4A 4IUQA 5KCOA 3HPWA 2MWOA 3GLXA 4M75A 5GAN3 3CCJA 1VQ9T 3JCMd 3OYAA 3OW2A 4MZTA 1VQNT 1NPRA 2K5LA 2VYTA 1QW1A 4TVRA 4XU2A 4C0DC 4BACA 1Q86C 3ZBDA 3GOXA 3H6ZA 2RD1A 5D6YA 4O6JA 5GAOn 3CCJT 1VQ9A 3CC2T 5FU6B 1I4K1 3HB9A 1VQPA 3HRTA 3A8OB 3L42A 5GANf 1Y96B 4M77G 4IUPA 3ZFJA 4C92A 3GF5A 4YTLA 2RO0A 3JB9J 2EJ9A 4L59A 3DL1A 4FT2A 4Z02A 4BD3A 4C8QC 2D0QB 5FU7B 2LRQA 3TW6A 2XICA 5GMKi 4M7AC 1XQHA 3OYHA 3C12A 3QBYA 4WF2A 2JNGA 3JRZA 5CVIA 1Y71A 4C92F 1VQKA 4MZMA 2HQXA 3CBPA 1W2BA 1NJIC 4OVAA 2EQJA 2QTXA 3GIBA 3PT9A 3HHTB 2JN0A 2RI5A 4II1A 4OMFB 4X9CA 1G5VA 3URGA 3CD6T 3HKSA 1Q82U 2CKKA 4OF1A 2EQKA 4XQ3A 3X20B 3FEOA 5LJ5e 2FHDA 3LYIA 1PSFA 4L5GA 4M78F 2I2LA 1U1SA 1OI1A 1B34A 1OZ2A 3R6OA 4QW2A 5GAMe 4MMKA 3CCLT 1YI2A 1QVGS 1JJ2A 4EPCA 3GNFB 2RI2A 4N0AC 4PJOC 4HNVA 2BS2A 3I56T 3OS2A 3CPWA 1K9MC 3QJ6A 2OTLT 3DKMA 2ZZDB 5GMKe 1IREB 4F7UE 3TEEA 5DLOA 4M75B 3H4CA 1KQ1A 2BKDN 5CO7A 3G71A 1K73U 3HRUA 1JJ2S 1X75C 2RHXA 2IG0A 4BDZA 3CMEA 4M7AE 2OTLA 5DLQE 3OBWA 4EMKA 2RHIA 1Y07A 1VQ7A 3J80E 4BE2A 3CCLA 3CCMT 1YI2T 3PTAA 3CPWS 2DTOA 5FU7C 4M7AB 1NZ9A 4AKIA 4LDWA 3JCMQ 4QVZA 1VQ4A 3HFOA 1VQLT 2QDYB 1I8FA 4LD6A 4C8QF 2WJ9A 1YHQA 4LDXA 3Q1JA 4GLKA 1XNIA 2RJEA 3UDCA 1S72T 2XI9A 2DZCA 5LJ5f 4HNTA 2MMPA 2GFAA 2DIGA 2EJFA 5EJCA 5LJ5d 4PJOE 3L2ZA 1KC8C 2X4YA 2HD0A 2ZZDA 4XU0A 4ME7A 4B9WA 1WGSA 5LJ5h 2X4WA 1WJRA 2VGMA 2HAXA 2AHJB 5FROA 3JCMP 1VQ6T 3V7RA 5GMKj 4HL4A 5HK0A 5LJ3j 3JB9I 2X4JA 1ZBXA 2R5MA 1Q7YC 4PJOF 1UGPB 3UWNA 3VKGA 2QEXA 3PGGA 1W4SA 5CKFA 4LD9K 3TW7A 4Q5WA 2EIFA 4J5YA 1U1TA 1YBYA 2BS3A 4DA4A 5GANe 2P0PA 4JX4A 2K2VA 4ZGJB 3JAME 3MHXA 4KUIA 1DJ7B 4MFDA 2XKOC 4MMLA 4C5GA 4ELYC 4F7UF 3BDUA 2JOYA 4C92G 5GANg 3RKWA 3VYGA 2QFZA 1M9SA 2K5FA 2HBPA 3FB9A 3MP1A 4IURA 1QVGA 2HNIA 4N4GA 4JX6A 4OB0B 1YIJA 5GAOq 3JCMf 1M1KC 4RCBA 5FRNA 4B9XA 2XU8A 4X9DA 4CI0C 3ER0A 5KH6A 5GAOp 3QXEB 2M1HA 1N8RU 1Q86U 5GAN2 2DIQA 4JRIA 2K3XA 3OMCA 1YHQT 4Z6YA 1Y7XA 2M0OA 4J6YA 4JRKA 3OYYA 2DAQA 3RERA 2EFIA 2EAYA 1M90U 4A4GA 5GAOl 4AI6A 1W2BS 4XU3A 2E6ZA 3QIIA 1JRIA 2RK2A 4M75G 5LJ3e 1QVFS 2PVOB 4PLLA 3CCST 3MCAB 1I81A 1WPYA 3A8GB 2KAFA 2L5QA 4NOYA 4LDYA 4OP0A 2EQMA 5CKHA 1KHCA 4IUTA 4BI8B 3TU4K 4HT9A 3NFCA 1VIEA 3KXTA 2KDSA 4J8OA 5GAN7 3QHSA 4XU1A 1KHIA 1YJWT 1VQPT 2DD4A 3QPHA 2P0QA 1I5LA 2K4YA 1WQWA 4IKFA 3M5AA 2E10A 4ATOA 2X4XA 2D6FA 4M7AA 1ZQ1A 4XTVA 2DK3A 2DD5B 2LVMA 2CZ0B 2A7YA 2KVQG 2RH2A 4RKUE 4P5NA 1YITT 2MAMA 3M4GA 5GAMf 3PIOA 3CCUT 3HFNA 4HT8A 5LJ5j 3FRNA 5AYFA 4M78B 2QEXT 4QQGA 4JJNK 4V2SA 2RI3A 4XTWA 5GAN6 3A8MB 3CCRA 4HNUA 5HY6A 2B8AA 4UC4A 3OYEA 2QXFA 5CQYA 1U8RA 1KD1U 2XDDA 3VUBA 2R58A 1S72A 2LQKA 3HRSA 3CCVA 1X6OA 2DXCA 4LDUA 3SB2A 2K5IA 2PUOB 3NTHA 4M77B 3C4SA 4EMHA 4M7DA 1RI0A 2PVDB 4J7IA 3I55T 2DXBA 2LC4A 3QG1A 3QO3A 4PL6A 1K9MU 2BIVA 3PFSA 4M77F 4CRIA 3JB9H 1D3BA 2DD5A 3BY7A 3VKIA 5GMKl 3OYGA 4A53A 1G3WA 4M7DC 5LL6S 3S3OA 3G6ET 4JRQA 3CC7T 2DD4B 3L1AA 3RESA 5GAOm 4QQ6A 3L2UA 4M7AF 3CEYA 4EMKC 3CCQT 3AHUA 4KT0E 5J3BA 1VQMA 3ASKA 4BBSM 4C5EA 1VQ4T 1VIFA 5J26A 1VQLA 5GAMj 3OY9A 1IZ6A 4Y91A 3X25B 2QQBA 2BS4A 3WVEB 2V8KA 4R55A 3CCMA 1UEBA 4C0DB 3UT1A 4ZN1A 4C92E 4C8QE 2XK0A 4AKHA 2DTIA 2ZGWA 1V29B 3LLRA 5FRMA 3JCMh 5CR2A 4J83A 5CCAA 3SDZA 5GAN8 3FLGA 2YRVA 3MEVA 3GNGA 4O5VA 3KUFA 3P8HA 1GXIE 3VKHA 2O01E 1MHNA 3OA6A 3X26B 2JUFA 3V7CA 3HSBA 5J39A 2R57A 4NL2A 2KK4A 2QQRA 4M78D 3RIRA 4QVDA 2ZPBB 2F5TX 3FIFA 5C0MA 4NC6A 3OYCA 4BB7A 2OTJA 3LWHA 1BI2A 3INZA 4M78A 4QSHA 2E6NA 2DZ9A 2EQUA 3PMTA 2RK1A 2JZ2A 3RMQA 1E7PA 4LOCA 5D6XA 3S3NA 2DTHA 2OTJT 3JSCA 2ZCFB 2VUBA 3C94A 3OYMA 1VQOA 3M56A 4IUVA 3CC7A 4FT4A 2YLBA 1FXXA 3RKXA 4N0AA 1UGRB 4BI4A 5GAMd 3GP8A 4J7FA 4PJOA 5KE3A 2RHYA 3T9NA 1WJQA 3BDLA 4BI3A 4EDUA 5KE2A 5GAMh 3A8LB 4XTZA 3TCJA 3I55A 4M75E 1YJ9T 2QF7A 1H641 4OB2B 2CYZB 3NTKA 3QKJA 2O4XB 3M59A 4LDVA 1TH7A 3BG9A 2EYQA 5GMKh 4HLQA 3M57A 4JLIA 4XAXB 3PIPA 4M75C 3OYNA 1UB4A 2L8DA 1KQSA 3CC2A 1HK9A 4PNOA 2KMGA 3A8HB 2LT4A 2RB6A 3M58A 5M9OA 2E41A 3OYFA 2WSEE 4C0GA 2VXFA 3RKYA 3OS1A 1VQMT 2LCCA 3LGFA 1UGSB 3OYDA 4JS4A 4E7KA 3L2WA 5IT9E 4C8QA 1FX7A 3FJPA 2JVVA 3CXCS 4XTUA 2ZPEB 4KUDK 5HKCA 5I2MA 1B34B 4OB1B 4DOVA 5C6SA 1YJ9A 3QYHB 2KQWA 5A0GA 3VYGB 3VJPA 1Q81C 2M16A 4M77D 2XDBA 1PSEA 2C06A 1N8RC 1M4ZA 2V8IA 3MP8A 1EIFA 1N9RA 1YJNT 1QLBA 2DXCB 4FU6A 5CK9A 3MEUA 3META 3JCMg 2GFUA 2LX9A 1JB0E 4QQDA 1VQ8A 4NL3A 1BI0A 3E1SA 3VU3C 2ZPIB 1WQ7A 4QVCA 2KY9A 2F5KA 2FYKA 2EWNA 3CPFA 2G77A 1M1GA 4FL6A 3SD4A 4A54A 5A0LA 1BKBA 3HZJA 1N27A 1K8AU 1ZHIA 1XOVA 2DVEA 4M7DD 4MFEA 1LNXA 2DXBB 3DLMA 3QDRB 1KD1C 2KMTA 3E19A 4RCCA 3JCMV 3G7ZA 3J81E 4C8QD 4ZGEB 2RJDA 5LJ5g 2VGNA 3E9GA 2D9TA 1VQ7T 4F7UA 4RG8A 2PU9B 3VYHB 4M7DG 5GAN4 3G71T 2OAUA 2P4TA 3KBGA 4MDWA 4N4IA 3SFMA 3OYJA 2QA4A 3S3MA 4M77E 4ZTFA 3JB9F 3JCMJ 3M54A 2MF2A 4C0FA 3I56A 3L2VA 5GANh 3LWIA 1M1FA 4GY5A 5KCHA 5CKDA 2NLUA 1NPPA 4D6WA 3OYLA 3DLLA 2ZPGB 2K57A 3QJYA 4Y28E 4C8QB 4JS5A 3S6WA 2F69A 3P8BB 3DB3A 5FLXE 4XTYA 1O9SA 1VQ5T 2LTOA 3O8VA 1Q81U 5EG2A 1M5Q1 4ZTJA 3G4SA 2XG8D 3CCQA 2K3YA 3SWNC 1QVFA 4DOWA 5A0DA 3V7SA 1RL2A 2V8JA 1M90C 1VQ6A 4M7DE 2MI6A 4F7UG 1X01A 2Y90A 1K73C 4PJOD 2O4XA 1N6AA 3N5BB 2VXEA 2E5QA 3EAEA 5IAYA 3QWLA 2GF7A 5LJ3h 3UPUA 2CZ6B 4IUUA 4C5IA 2Y4YA 1HXDA 4FM4B 2R5AA 4BE0A 5GANj 2E1HA 3M4YA 1BI1A 4PKCC 2XD0A 1QP3A 1G3YA 2MWPA 4PJOB 2E65A 3JCMb 4BE1A 3SWNA 3QYBA 3C95A 4PLIA 4C92C 3CCRT 4RMOA 3HBLA 2BUDA 3OS5A 4BUGA 2PQWA 1BYMA 4A4FA 4EMGA 3CCEA 4JX5A 4E7LA 4XTXA 3QSUA 3OYBA 1BIBA 2GCXA 2WACA 4BY6C 2DJZA 4BBRM 1YITA 1FKMA 3A5ZB 3BW1A 4F7UB 2IVWA 2L89A 5LJ3g 4M78C 2QA4T 5DM7R 2QQAA 3QZ9B 4C8QG 2QQ8A 4OGEA 1MGQA 2M9UA 2FB7A 3LW5E 3OB9A 1OYXA 1R8OB 3ZEHA 1AHJB 2P0KA 2DXTA 3OSSC 2FL7A 1FWZA 2E12A 5LJ3d 3SWNB 1P92A 2HQEA 4JUVA 3OW2S 3JCMW 3F70A 4C92D 3CMET 4JDSA 3QZ5B 4FSXA 5GMKm 3JB9D 3CMAT 3QYGB 1D3BB 3ME9A 3WXMB 3G4ST 3OYKA 2Y4XA 3M9QA 3HL8A 3EFSA 3OQ5A 3MP6A 4M7DB 2GQVA 2KR6A 3PMIA 3QUIA 4HCZA 1Q82C 1KQSS 1QVPA 2JTFA 3G6EA 2A3LA 4PJOG 2G3RA 4OGCA 1LJOA 2YHTA 5CKEA 4M7DF 3OBYA 2XHCA 4JLGA 3L2RA 2XDPA 4C92B 5GAOr 1O75A 2YLCA 4KBMB 5CQXA 4ZGDB 1Y96A 2E64A 4E7JA 5GANd 4C0ZA 4A4KA 2KSSA 3FDRA 1M1KU 1M8VA 5HK3A 2DO3A 2E70A 2LQ8A 4M78G 3BG5A 1OZ3A 2LCLA 1QP2A 4BY6B 1VUBA 1LOJA 3X24B 3CCET 2PVGB 3VUZA 1YJNA 3CBMA 3JCMe 4A4HA 1G3SA 4AKGA 4NS5A 4JRPA 3CC4A 5I2SA 4MZPA 4DQ2A 1WNLA 3MEAA 3MO8A 2RA2A 3FC3A 1JBMA 1BIAA 2CGHA 4VUBA 1K8AC 3LX7A 3CCVT 4FIBA 4M75F 1NE8A 2FVUA 3NTIA 4ELJA 3QYEA 4E47A 3M55A 3GPLA 3CC4T 1KG1A 1H3ZA 1SSFA 3E9FA 1XTDA 5I21A 2QDJA 4N4HA 4E7HA 1N9SA 3V8JA 1G3TA 5DY9A 2PUKB 4ZN3A 3OMGA 3JCMc 2RJCA 3MEWA 3PNWC 2EJGA 4ELZC 2CS7A 4KULA 1VQNA 1VQOT 3BFMA 3CBOA 3JCMX 4MIMA 1KC8U 2RHZA 3TREA 3V8LA 4C5HA 2DEQA 2RHUA 2JTMA 2CZ1B 3JB9G 3BG3A 5LJ3f 3KHIA 4X34A 4HCBA 3WVDB 4R56A 4M6VA 3HP9A 3EFRA 2XIDA 2DXUA 2LNVA 3LH0A 2RM4A 2L3RA 4M75D 3CCUA 2X35A 5GAMg 1Q7YU 4J6WA 3CCSA 3L2QA 2DKGA 3H8ZA 4E7IA 5FU6C 2WSFE 2WSCE 4XK8E 3OS0A 1VQ5A 3HO8A 5IN1A 1YJWA 2H3JA 2LDMA 3OSVA 4BDYA 3CD6A 2ZPFB 2ZPHB 4M77A 5A2QE 3OYIA 1VQ8T 2QQ9A 3VV0A 5CAIA 4RG2A 3J7AF 4L6V5 1UGQB 5CKBA 1VQKT 4M7AD 4M77C 3LGLA 3RUXA 3CXCA 2QI2A 3X28B 3M53A 5GAN5 5L8RE 4HKEA 4A4EA 5CIUA 4M78E 3RMSA 1NJIU 2DPPB 2LT1A 4M7AG 3CMAA 2QQSA 1WJSA 1KQ2A 3V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGJ B;  1DJ7 B;  1UGR B;  2CZ7 B;  4OB3 B;  3QZ9 B;  3VYG A;  3LW5 E;  3A8L B;  4OB0 B;  1AHJ B;  4OB2 B;  2CYZ B;  3QXE B;  3QZ5 B;  3QYG B;  3A8H B;  3A8O B;  2WSE E;  2PVO B;  1UGS B;  3A8G B;  2ZPE B;  4OB1 B;  3QYH B;  3VYG B;  2D0Q B;  2DD4 A;  1PSE A;  4ZGD B;  2DXC B;  2DD5 B;  2CZ0 B;  4RKU E;  3HHT B;  1QP2 A;  1JB0 E;  3X24 B;  2PVG B;  2ZPI B;  3X20 B;  3A8M B;  1PSF A;  2DXB B;  2DXC A;  2PUO B;  4ZGE B;  2PVD B;  2DXB A;  2ZZD B;  1IRE B;  2PU9 B;  3VYH B;  2DD5 A;  2PUK B;  2DD4 B;  2ZPG B;  4KT0 E;  4Y28 E;  2CZ1 B;  2QDY B;  3WVD B;  3X25 B;  3WVE B;  1V29 B;  2WSF E;  2WSC E;  4XK8 E;  2ZZD A;  1GXI E;  2AHJ B;  2ZPF B;  2CZ6 B;  2ZPH B;  2O01 E;  3X26 B;  4FM4 B;  4L6V 5;  1QP3 A;  1UGQ B;  2ZPB B;  3X28 B;  1UGP B;  5L8R E;  2DPP B;  2ZCF B; 
#chains in the Genus database with same CATH topology
 1YCY A;  4EMK B;  3CCU Q;  2DMO A;  2K7A A;  1F5Q B;  2MWO A;  3CCJ A;  3OW2 A;  1QVG P;  4MZT A;  1S72 Q;  1QW1 A;  4TVR A;  4XU2 A;  3H6Z A;  1CKA A;  1TD6 A;  1OEB A;  1I4K 1;  2FPE A;  1VQP A;  3L42 A;  1EZZ B;  5GAN f;  4M77 G;  2IIM A;  2JS0 A;  3JB9 J;  2WMB B;  1UDL A;  2EJ9 A;  4FT2 A;  2A08 A;  1G3N C;  2LRQ A;  8AT1 B;  5LMK B;  2XIC A;  5GMK i;  2EBP A;  2YRD A;  4GLM A;  1RAE B;  1X2K A;  4WF2 A;  2L2P A;  1W98 B;  4EOQ B;  4MZM A;  2K3B A;  2MIO A;  2CP7 A;  2EQJ A;  1NJI C;  2DVJ A;  4NST B;  3QHR B;  2I0N A;  3CD6 T;  3BHU B;  2M51 A;  1Q82 U;  1M3A A;  2HKN A;  1KXU A;  1SF9 A;  5KYW B;  2FHD A;  5GAM e;  4E7S A;  3R6O A;  4QW2 A;  1E9H B;  3CCL T;  1Z9Z A;  3EGX B;  1I07 A;  4MMK A;  1JJ2 A;  3C0C A;  3GNF B;  2RQU A;  4PJO C;  1I1J A;  2OTL T;  1U5S A;  5KYU A;  2ZZD B;  1UTI A;  4M75 B;  3H4C A;  3HRU A;  1KIK A;  3AT1 B;  4BDZ A;  2OTL A;  3OBW A;  1VQ7 A;  4J9D A;  3J80 E;  2M02 A;  3CCM T;  1VQ4 Q;  9ATC B;  1YI2 T;  2DTO A;  1BU1 A;  4M7A B;  4AKI A;  3HFO A;  2QDY B;  3EJ1 B;  1GL5 A;  4GLK A;  2V22 B;  2KYM A;  2DZC A;  4HNT A;  4LNP A;  2EJF A;  5LJ5 d;  4PJO E;  1SRL A;  1KJW A;  3L2Z A;  1KC8 C;  2HD0 A;  4ME7 A;  1T0H A;  1WJR A;  3MJX A;  1VQ6 T;  1ZUY A;  3BE3 A;  5LJ3 j;  3JB9 I;  1ZBX A;  3REB B;  1M2O A;  2DET A;  4PJO F;  3DOG B;  1M8M A;  5HCK A;  1W4S A;  3TW7 A;  2DBM A;  4JJD A;  1U1T A;  1YBY A;  2K2V A;  4KUI A;  1DJ7 B;  2XKO C;  2CDT A;  1NEB A;  2QFZ A;  1M9S A;  3FB9 A;  2HBP A;  5HBH B;  4F7J B;  1MMD A;  3F5X B;  4JX6 A;  4Y72 B;  2PMI B;  1M1K C;  1D1C A;  5FRN A;  2BPM B;  5KH6 A;  5GJV B;  1YJ9 Q;  1IRX A;  2OAW A;  4JRI A;  2K3X A;  1YHQ T;  1M2V B;  2DAQ A;  3RER A;  1TFB A;  2ROT A;  3PVL A;  5GAO l;  1M90 U;  4XU3 A;  2E6Z A;  1WLP B;  4PJJ A;  1JRI A;  4M75 G;  2PVO B;  5L2W B;  1PKD B;  3CCS T;  2KBT A;  2LJ1 A;  2KAF A;  3A8G B;  2ROL A;  3DDQ B;  1K9A A;  4J8O A;  5GAN 7;  1YJW T;  1IHW A;  3BLQ B;  3M5A A;  2DK3 A;  2DD5 B;  1N8R R;  1MMA A;  3CCU T;  4HT8 A;  4JJN K;  1OIY B;  4XTW A;  5GAN 6;  1P5E B;  2G6F X;  1YNZ A;  3H0F A;  4J9B A;  2YSQ A;  1VOM A;  1T3S A;  4FYX B;  2CJM B;  1U8R A;  2LQK A;  3CCV A;  1X6O A;  2K5I A;  2PUO B;  4EMH A;  4CFU D;  2GGR A;  1RI0 A;  3NDQ A;  2L3P A;  2LC4 A;  1OU9 A;  2BIV A;  4M77 F;  2DRK A;  4A53 A;  5LL6 S;  4ROC A;  2EGA A;  3RES A;  5GAO m;  4E6R A;  4HVU A;  3CCQ T;  4EMK C;  4OMQ A;  3AHU A;  1WHJ A;  5J3B A;  2O9S A;  1BB9 A;  2UZE B;  3OY9 A;  2BS4 A;  2A36 A;  2DYI A;  1VQP Q;  1YFN A;  4C8Q E;  2LW4 A;  2XK0 A;  1VQO Q;  1F1B B;  3CCS Q;  3BHV B;  3SDZ A;  3FLG A;  2YRV A;  3EH1 A;  3TNI B;  3X26 B;  3CCJ Q;  2R57 A;  1XO2 A;  2RPN A;  3RIR A;  2C5X B;  4NC6 A;  4DBF A;  1BI2 A;  4QSH A;  1VQN Q;  3PMT A;  1E7P A;  2DTH A;  3OYM A;  3M56 A;  2HZY A;  2GTO A;  2QK0 A;  3T9N A;  1WJQ A;  3BDL A;  4BI3 A;  5HQ0 B;  1W1F A;  2CYZ B;  4LDV A;  4BCM D;  3BG9 A;  1JXM A;  2EYQ A;  3H0I A;  1VQ5 Q;  4M75 C;  2FRY A;  1UB4 A;  4ZNX A;  2KMG A;  3A8H B;  1H24 B;  2IN3 A;  2HSE B;  2LCC A;  3OYD A;  1UGS B;  2UUE B;  3I5S A;  3U23 A;  1FX7 A;  3CXC S;  1WHL A;  1ZP2 A;  1B34 B;  2AT1 B;  1YJ9 A;  1Q81 R;  2VVK A;  4DBQ A;  4R0K A;  2DJQ A;  1Q81 C;  4M77 D;  2XDB A;  1PSE A;  1YJN T;  1EIF A;  3GBQ A;  2DXC B;  1D3U B;  1OL1 B;  1AOJ A;  3JCM g;  2GFU A;  2L0A A;  2QA4 Q;  1JB0 E;  2DEU A;  3VS3 A;  2E5K A;  1BI0 A;  1C0M A;  2UZL B;  1GFD A;  3EHQ A;  2ZPI B;  2KY9 A;  2EWN A;  3CPF A;  3MIA B;  1M1G A;  4A54 A;  4F7N B;  1K8A U;  1XOV A;  1ZHI A;  2DVE A;  4MFE A;  1LNX A;  2DXB B;  2KMT A;  3JCM V;  4C8Q D;  3NHN A;  4KH1 B;  5GAN 4;  3G71 T;  3RR6 A;  4N4I A;  3NPF A;  3JB9 F;  2VWF A;  3M0T A;  1B7T A;  3M54 A;  1TXQ A;  3LWI A;  5KYN A;  2K57 A;  4Y28 E;  1KD1 R;  3P8B B;  1M5Q 1;  4ZTJ A;  5L23 A;  2Y90 A;  1JSU B;  1N6A A;  2OTL Q;  3VRY A;  2VXE A;  3QWL A;  4TTH A;  4RTZ A;  1AWX A;  1HXD A;  4FM4 B;  2R5A A;  1GUX B;  2XD0 A;  2JM9 A;  1G3Y A;  2H3E B;  2QTV A;  4RTW A;  5EC7 A;  3CCR T;  4OMO A;  3HBL A;  1PD1 A;  3QSU A;  1N4M A;  3A5Z B;  1URC B;  1PKS A;  2IVW A;  3BW1 A;  4F7U B;  2L89 A;  5LJ3 g;  3TNH B;  3QZ9 B;  3O5Z A;  2XMF A;  1G83 A;  2FB7 A;  1WXB A;  3VS6 A;  1R8O B;  3ZEH A;  2P0K A;  2WFY B;  1CSK A;  3OW2 S;  1FWZ A;  5LJ3 d;  3CC7 T;  1ZUK A;  4FSX A;  3JB9 D;  3QYG B;  2YT6 A;  3OYK A;  2Y4X A;  2QG9 B;  3HL8 A;  3MP6 A;  5HVY B;  3PMI A;  4ORZ A;  1IB8 A;  1KQS S;  1WXU A;  5FGK B;  2ED0 A;  2VKN A;  2A3L A;  2LJ0 A;  1QMC A;  5CKE A;  4M7D F;  1SHG A;  3OBY A;  4JLG A;  3L2R A;  2KRS A;  1K76 A;  3EHR A;  5IHN A;  1OQK A;  4DBR A;  4A4K A;  2CT3 A;  2KSS A;  3VS1 A;  2E70 A;  1TTH B;  2LCL A;  1JEG A;  3VUZ A;  5EFQ B;  1RLP C;  5I2S A;  4DQ2 A;  5AT1 B;  3LX7 A;  1O9K B;  4CFU B;  1C9B A;  1H3Z A;  5HBE B;  2PUK B;  1ZLM A;  1X6B A;  1RAD B;  1VQN A;  2CT4 A;  4ATO A;  4C5H A;  2RHU A;  3CQT A;  4IIM A;  5LJ3 f;  3KHI A;  2DL8 A;  2LNV A;  2RM4 A;  4M75 D;  5I22 A;  4BY1 X;  4J6W A;  3CCS A;  3L2Q A;  2LDM A;  1MV3 A;  4B6M A;  4M7A D;  4M77 C;  2KNB B;  3LGL A;  3CXC A;  3X28 B;  3JV3 A;  2RNA A;  3RNJ A;  4BCG B;  2L3S A;  2PK9 B;  2LMJ A;  2LT1 A;  4Z89 A;  2D1X A;  4EON B;  1KQ2 A;  3V8K A;  1VYV A;  1BI3 A;  5D6W A;  2VV5 A;  3P8D A;  4HCC A;  5KYY B;  3VS7 A;  3HPW A;  4M75 A;  3DTO A;  3OYA A;  1VQN T;  4BCF B;  3BLH B;  2K5L A;  2V26 A;  1I0C A;  2WXV B;  2EYY A;  4BCP B;  4C0D C;  4BAC A;  2RD1 A;  3EGX A;  5D6Y A;  5GAO n;  3CCJ T;  4BCM B;  5LQF B;  2QGG A;  2DL7 A;  3M0P A;  2LZ6 B;  1Y0M A;  1AD6 A;  3ZFJ A;  4KGZ B;  4YTL A;  1TS9 A;  2LX7 A;  3DL1 A;  4BD3 A;  2A37 A;  5FU7 B;  1UHF A;  1XQH A;  1YWO A;  3QBY A;  2JNG A;  5CVI A;  4PFO A;  1UUE A;  2JN0 A;  1G8X A;  2CCH B;  1G5V A;  1PSF A;  4RMO A;  1OZ2 A;  4EC8 B;  2YXY A;  5KYW A;  4EPC A;  3UA6 A;  4N0A C;  2BS2 A;  3I56 T;  2YUQ A;  1YN8 A;  5GMK e;  2X3X D;  5DLO A;  4YOO A;  1KQ1 A;  2O9V A;  1K73 U;  2OI3 A;  1AZG B;  1X75 C;  2RHX A;  3CME A;  2JMC A;  2B86 A;  1ZSG A;  3MKD A;  1VQ6 Q;  2HCK A;  2CH4 A;  1AIS B;  1UEC A;  4F6U B;  1OX9 A;  4LDW A;  4QVZ A;  3JCM Q;  3CCQ Q;  1VQL T;  1I8F A;  1XNI A;  4KH0 B;  2KXC A;  3UDC A;  1VQ9 Q;  2GBQ A;  2MMP A;  2DIG A;  5EJC A;  1ZA2 B;  2X4Y A;  4B9W A;  1M3C A;  1NEG A;  5LJ5 h;  2VGM A;  2AHJ B;  5CYI B;  1YI2 Q;  4KRC B;  4HL4 A;  2MOX A;  4IMY B;  4AT1 B;  4CFM B;  1WHH A;  1QCN A;  2BKZ B;  1PHT A;  3VKG A;  3UWN A;  2QEX A;  1NYG A;  4LD9 K;  3DJB A;  4Q5W A;  3M0Q A;  4M4Z A;  4ZGJ B;  1QKX A;  3TNW B;  4MFD A;  2NUP B;  4MML A;  4C5G A;  4F7U F;  2YDL A;  3VYG A;  2K5F A;  3G4S Q;  2ENM A;  3OW2 P;  1QVG A;  4HVW A;  4F6W B;  4N4G A;  2KXD A;  2AKK A;  3JCM f;  1YIJ A;  4RCB A;  4CI0 C;  4X9D A;  3VS5 A;  3QXE B;  3OMC A;  3BLR B;  2K6D A;  3OYY A;  2EAY A;  1W2B S;  3QII A;  1OKV B;  1I81 A;  3OYI A;  4LDY A;  4BI8 B;  1KHC A;  3TU4 K;  2KDS A;  2V1R A;  2AKL A;  4XU1 A;  1WI7 A;  3QPH A;  4CFN B;  2P0Q A;  2HDA A;  1D0Z A;  1UFF A;  1ZQ1 A;  1LVK A;  2A7Y A;  4RKU E;  3M4G A;  3PIO A;  2HL5 C;  3HFN A;  2VB6 A;  5AYF A;  3CC7 Q;  2QEX T;  4QQG A;  4V2S A;  2RI3 A;  3CCR A;  1AWO A;  2QXF A;  2XDD A;  1S72 A;  1WXT A;  5IF1 B;  1ABQ A;  4M77 B;  2G9X B;  1ZSZ C;  4HVV A;  4M7D A;  3I55 T;  2DXB A;  3G33 B;  3QG1 A;  3QO3 A;  3PFS A;  1RAB B;  2DD5 A;  2J06 A;  5GMK l;  3OYG A;  1U3O A;  1G3W A;  2DD4 B;  3L1A A;  3CEY A;  4BY7 X;  2HSP A;  1VQM A;  3ASK A;  2W96 A;  3CCM Q;  1VQ4 T;  1VIF A;  5J26 A;  3IQL A;  3I55 Q;  1BCM A;  3WVE B;  3EID B;  1I5O B;  3TSW A;  3VRZ A;  4R55 A;  4C0D B;  5DQV A;  2X1N B;  1V29 B;  3JCM h;  5CR2 A;  5GAN 8;  5CCA A;  3GNG A;  3P8H A;  1MHN A;  1ZUU A;  3M0R A;  4QVD A;  2ZPB B;  2OTJ A;  5C0M A;  2IVX A;  3INZ A;  2E6N A;  2DZ9 A;  1Q86 R;  3UF4 A;  3S3N A;  4J9I A;  3ZL7 C;  1ENW A;  3JSC A;  2VUB A;  3C94 A;  1X43 A;  2M0Y A;  1RLQ C;  1FXX A;  1UNH D;  1UGR B;  4PJO A;  1O9K A;  2DE0 X;  5KE3 A;  3A8L B;  4XTZ A;  4M75 E;  2JJ9 A;  1YJ9 T;  1H64 1;  4OB2 B;  1RAG B;  2O4X B;  4CC2 A;  5GMK h;  2ABL A;  4JLI A;  4XAX B;  3PIP A;  2JS2 A;  3CC2 A;  2GTJ A;  2RB6 A;  2NUZ A;  3M58 A;  2E41 A;  1M90 C;  5IT9 E;  1OUL A;  4AFS C;  4C8Q A;  2FG0 A;  4KUD K;  2EGE A;  3QWX X;  4OB1 B;  2KQW A;  3VYG B;  2DL5 A;  2C5O B;  1VYT A;  2V8I A;  2DFU A;  3R6N A;  4Z8A A;  4FU6 A;  4PFZ A;  4AMC A;  2J6F A;  5IHK A;  4QQD A;  2C5N B;  1QMZ B;  2DER A;  2PJQ A;  1KK7 A;  4QVC A;  3SD4 A;  3DDP B;  1N27 A;  2AZS A;  2KT8 A;  4M7D D;  2D0N A;  3DLM A;  4J9E A;  4CC4 B;  3CC4 Q;  1GH6 B;  4G6L B;  4F7U A;  1YJN Q;  3CCV Q;  1OU8 A;  2W2H A;  4M7D G;  4MDW A;  5HBJ B;  3S3M A;  2BZX A;  4M77 E;  3I56 A;  1OGU B;  4GY5 A;  5KCH A;  3MY5 B;  1M3B A;  1NPP A;  1JQQ A;  3OYL A;  1W6X A;  1UJ0 A;  3QJY A;  4C8Q B;  4JS5 A;  5FLX E;  4XTY A;  1VQ5 T;  3O8V A;  2XG8 D;  3I56 Q;  2F2W A;  1D1A A;  3SWN C;  4DOW A;  2V8J A;  1QQJ A;  1M1K R;  1K73 C;  2SEM A;  3PVQ A;  1H27 B;  3N5B B;  4DEX A;  2ED1 A;  1OI9 B;  2E5Q A;  3EAE A;  3EG3 A;  5LJ3 h;  2CZ6 B;  3RBB B;  4C5I A;  4PKC C;  3JCM b;  3QYB A;  3C95 A;  3NGP A;  4C92 C;  1NLP C;  2BUD A;  1NJI R;  1AZE A;  4BUG A;  2CP3 A;  1BYM A;  2EQI A;  3CCE A;  2KGT A;  4E7L A;  2KEA A;  3OYB A;  1BIB A;  1VIN A;  1X69 A;  4BY6 C;  2DJZ A;  1YIT A;  2CRE A;  2RF0 A;  2QQ8 A;  4OGE A;  4RTV A;  4EOK B;  2B9R A;  1YHQ Q;  2BTT A;  1FYN A;  1MMG A;  4IIO A;  5A0D A;  2FL7 A;  2E12 A;  4DBH A;  1P92 A;  4JUV A;  5IDP B;  4J9G A;  3CC2 Q;  2EGC A;  5KYX B;  1E6H A;  1BU2 A;  3WXM B;  1VQ8 Q;  3M9Q A;  3OQ5 A;  2J7I A;  2KR6 A;  4HCZ A;  1Q82 C;  1OPL A;  4X1V A;  1H1P B;  4LUD A;  3EH2 A;  3G6E A;  2DME A;  4OGC A;  3POM A;  1O75 A;  4KBM B;  1AWJ A;  4BCK B;  2H8H A;  3VS0 A;  1PC0 A;  2KE9 A;  1E6G A;  4FW2 A;  3CXC P;  1VUB A;  3X24 B;  1FMV A;  2OTJ Q;  1NM7 A;  4NS5 A;  1QLY A;  1WNL A;  3MO8 A;  3FC3 A;  1JBM A;  1BIA A;  1K1Z A;  4VUB A;  4M75 F;  3NTI A;  2RQT A;  4E47 A;  2BZ8 A;  1WDX A;  1WYX A;  3E9F A;  2D8J A;  5I21 A;  3V8J A;  5KYX A;  2QGS A;  1G3T A;  2HQH A;  2NUP A;  5DY9 A;  3JCM c;  4HCK A;  3MEW A;  2EJG A;  4MIM A;  1KC8 U;  1R77 A;  2EKH A;  4KGV B;  3JB9 G;  3BG3 A;  1PNJ A;  4X34 A;  4M6V A;  4RTX A;  2DXU A;  2CCI B;  2PNI A;  4OMM A;  5GAM g;  4BCQ B;  2J6K A;  2DKG A;  1TG0 A;  5KYY A;  3H8Z A;  3RDV A;  2WSF E;  4XK8 E;  2IW9 B;  3OS0 A;  1YJW A;  4BDY A;  4L6V 5;  5CKB A;  2RN8 A;  1OKW B;  4BCO B;  5GAN 5;  1H25 B;  4OGR B;  5CIU A;  2DPP B;  2LJ3 A;  2QQS A;  2RJF A;  2VC8 A;  4KRD B;  4HA8 A;  2EKO A;  3DB4 A;  1WHK A;  4ROE A;  5KCO A;  1VQK Q;  3GLX A;  1VQ9 T;  4EOI B;  2K9G A;  2VYT A;  1D1B A;  1NBE B;  1QWF A;  3D7S B;  1Q86 C;  2RQW A;  3GOX A;  4O6J A;  1M90 R;  5FU6 B;  1V76 A;  3A8O B;  1Y96 B;  2DIL A;  3EOC B;  1YIJ Q;  2BE9 B;  1IGU A;  1QCF A;  4ELL A;  2DRM A;  4CXA B;  4Z02 A;  4C8Q C;  4M7A C;  2O31 A;  2P84 A;  4EC9 B;  3C12 A;  4C92 F;  2HQX A;  3CBP A;  1W2B A;  4OVA A;  2QTX A;  1M2V A;  3HHT B;  2RI5 A;  4II1 A;  4X9C A;  3HKS A;  3EFO B;  3G1J A;  2CKK A;  4OF1 A;  3X20 B;  1UJY A;  2PK2 A;  3FEO A;  3LYI A;  4M78 F;  2I2L A;  1U1S A;  1QVG S;  1MND A;  3REA B;  1YI2 A;  1VOL A;  1K9M C;  1OL2 B;  3I5R A;  4F7U E;  5CO7 A;  3G71 A;  1JJ2 S;  5HNB B;  1WX6 A;  1XJW B;  2IG0 A;  4M7A E;  5DLQ E;  2RHI A;  2LP5 A;  4BE2 A;  3CCL A;  2EYX A;  1AD5 A;  3A98 A;  4OML A;  4C8Q F;  2RQR A;  1YHQ A;  4LDX A;  3Q1J A;  1X6G A;  2O2O A;  1S72 T;  2XI9 A;  2ECZ A;  4D8K A;  3EGD B;  3MY1 B;  2QGF B;  2GFA A;  1U06 A;  1UNL D;  4XU0 A;  1WIE A;  2X4W A;  3CCE Q;  2HAX A;  4BXX X;  2LCS A;  4AG2 C;  5HK0 A;  2X4J A;  2DA9 A;  2EIF A;  1RAI B;  4J5Y A;  1H28 B;  2BS3 A;  1QCO A;  5GAN e;  3QHW B;  4JX4 A;  3MHX A;  1WHG A;  1T3L A;  3EGD A;  5GAN g;  3RKW A;  3MP1 A;  4IUR A;  1X2Q A;  4OB0 B;  5GAO q;  2HBW A;  4B9X A;  1YJW Q;  4QT7 A;  2GQI A;  2M1H A;  2DL3 A;  1N8R U;  4FX3 B;  5GAN 2;  1D0X A;  1WA7 A;  1Y7X A;  2M0O A;  4JRK A;  1GRI A;  4A4G A;  4AI6 A;  2RK2 A;  1N5Z A;  4PLL A;  2JTE A;  4FYW B;  1WPY A;  2L5Q A;  5CKH A;  4NOY A;  4OP0 A;  4IUT A;  1Y57 A;  3NFC A;  1VIE A;  4JZ4 A;  3KXT A;  2F2C A;  3QHS A;  4EOL B;  2DD4 A;  2QYZ A;  1WQW A;  4IKF A;  4EOS B;  2E10 A;  4JJB A;  2D6F A;  4M7A A;  2LVM A;  3VS2 A;  2CZ0 B;  1YIT T;  2MAM A;  5LJ5 j;  3FRN A;  4JPB W;  4M78 B;  2W10 A;  1IO6 A;  3A8M B;  4HNU A;  5HY6 A;  3VUB A;  2R58 A;  5KYU B;  3HRS A;  2DXC A;  2CP2 A;  4LDU A;  3NTH A;  2PVD B;  1Q95 G;  1R0C B;  2COY A;  4CRI A;  1K9M R;  3JB9 H;  3BY7 A;  1YP5 A;  3SHW A;  4M7D C;  2CP5 A;  3G6E T;  2KRN A;  4QQ6 A;  4F04 B;  1LPL A;  4BBS M;  4C5E A;  1VQL A;  5GAM j;  1H8K A;  1J3T A;  3G6E Q;  2P4R A;  1VQL Q;  2V8K A;  4F7L B;  1UEB A;  2ZAE A;  3HTR A;  3CD6 Q;  3UT1 A;  4ZN1 A;  2IPO B;  4C92 E;  3MPU B;  3LH5 A;  1M27 C;  1K73 R;  3LLR A;  5FRM A;  1KFZ A;  4A63 B;  1GXI E;  3VKH A;  2FEI A;  2JUF A;  3V7C A;  1GFC A;  1WHM A;  1NLO C;  2QQR A;  3FIF A;  2C4G B;  4F16 A;  1PRM C;  4M78 A;  2RK1 A;  3UA7 A;  1YIT Q;  2NWM A;  1TUD A;  5D6X A;  4LOC A;  3UAT A;  5I11 A;  4J9C A;  2OTJ T;  2C0I A;  1OV3 A;  1PCX A;  4FT4 A;  3RKX A;  4N0A A;  3GP8 A;  4PJM A;  2EYZ A;  1UNG D;  2W9Z A;  3TCJ A;  1JOW A;  4RTU A;  3I55 A;  1HYO A;  2KRM A;  3NTK A;  5I5Z B;  2DM1 A;  4UN0 A;  1TH7 A;  4HLQ A;  3OYN A;  2L8D A;  1HK9 A;  2COW A;  2LT4 A;  2WSE E;  2VXF A;  3OS1 A;  1VQM T;  4EIK A;  4E7K A;  3L2W A;  4EOR B;  2JVV A;  4XTU A;  5I2M A;  3QYH B;  4YOZ A;  1H1R B;  2M16 A;  3EG1 A;  1N8R C;  1M4Z A;  3MP8 A;  1K4U S;  1N9R A;  1QLB A;  1RAA B;  4F7S B;  5CK9 A;  4F14 A;  2LX9 A;  2BE7 D;  4WCI A;  3VU3 C;  1WQ7 A;  1EFN A;  2F5K A;  2FYK A;  1RAC B;  2UZB B;  3HZJ A;  1BKB A;  4I3Z B;  5FWB A;  3QDR B;  4CRL B;  1KD1 C;  3E19 A;  2CP0 A;  1T0J A;  3J81 E;  1RI9 A;  1AVZ C;  2J6O A;  4LUE A;  5LJ5 g;  2D9T A;  4BCJ B;  2YUP A;  3QWY A;  1ZSZ A;  3VYH B;  2JMA A;  2OAU A;  4CC3 A;  2P4T A;  4Y92 A;  4ZTF A;  3OYJ A;  3JCM J;  3FJ5 A;  2MF2 A;  1FMW A;  3L2V A;  5GAN h;  1A0N B;  1SKU B;  1M1F A;  3SEM A;  5CKD A;  3DLL A;  2ZPG B;  1GCQ C;  1OX8 A;  3DB3 A;  1QKW A;  1Q81 U;  3G4S A;  1RUW A;  1Q7Y R;  3V7S A;  1RL2 A;  2MK5 A;  3CCL Q;  2DL4 A;  2DX1 A;  2PTK A;  1JJ2 P;  4IUU A;  2Y4Y A;  4OMN A;  5GAN j;  3G71 Q;  4BE0 A;  2E1H A;  3M4Y A;  1QP3 A;  5ECA A;  2FZC B;  2E65 A;  2COZ A;  4BE1 A;  3SWN A;  1K8A R;  2I53 A;  4PLI A;  3H0H A;  2PQW A;  3EFO A;  4JX5 A;  4XTX A;  2GCX A;  1FKM A;  2C6T B;  1QWE A;  4M78 C;  2QA4 T;  2FPF A;  2QQA A;  2DNU A;  1MGQ A;  4RTT A;  3LW5 E;  3OB9 A;  1E7O A;  1OYX A;  1AHJ B;  3M0S A;  3JCM W;  3CME T;  4JDS A;  3QZ5 B;  4KRT A;  3CMA T;  1NYF A;  1D3B B;  3ME9 A;  4AFU C;  2F2V A;  2W99 A;  3EFS A;  2RMO A;  4M7D B;  1YWP A;  2CSQ A;  2WHB B;  1QVP A;  2JTF A;  1VA7 A;  1NG2 A;  2G3R A;  1LJO A;  2YHT A;  4ANJ A;  3RGF B;  2VAS A;  2QAS A;  4F70 B;  1VQM Q;  5CQX A;  1H3H A;  4ZGD B;  1Y96 A;  4C0Z A;  1M1K U;  3FDR A;  1QVF P;  4RUG A;  2LQ8 A;  2DO3 A;  2ATC B;  4M78 G;  1QP2 A;  1AEY A;  1LOJ A;  3CCE T;  1YJN A;  3CBM A;  4A4H A;  1G3S A;  2AIR B;  1V1C A;  4JRP A;  3CC4 A;  4MZP A;  2CGH A;  2FPD A;  3CCV T;  4FIB A;  3CCR Q;  4CFX B;  2WEV B;  4ELJ A;  4BCN B;  3GPL A;  3CC4 T;  2F2X A;  4YOS A;  1PG5 B;  1SSF A;  2W9F A;  5IHI A;  4AFQ C;  1RAH B;  3QDF A;  3OMG A;  1BCO A;  4ELZ C;  2CS7 A;  1TOV A;  3TRE A;  2DEQ A;  2JTM A;  2UZD B;  8ATC B;  4II5 B;  2CZ1 B;  3HP9 A;  3EFR A;  2WIP B;  2XID A;  2L3R A;  2LQW A;  1PRL C;  1Q7Y U;  1SG5 A;  3B57 A;  2WSC E;  2NUT B;  1BBZ A;  1TU0 B;  1HJD A;  3OSV A;  3CD6 A;  4PJN A;  2ZPF B;  2ZPH B;  5A2Q E;  1VQ8 T;  3VV0 A;  1GBR A;  5CAI A;  2SRC A;  2JT4 A;  2QI2 A;  4K11 A;  1WFW A;  2MYS A;  5L8R E;  4HKE A;  4A4E A;  4M78 E;  2EVR A;  4M7A G;  2XDP A;  1WJS A;  1YIJ T;  2JM8 A;  2QEX Q;  4MDX A;  1UG1 A;  4J6X A;  2CZ7 B;  4OB3 B;  3NMZ C;  2C5V B;  1OIU B;  4IUQ A;  5GAN 3;  2YWW A;  3JCM d;  1R0B G;  1NPR A;  4LXC A;  4LE9 A;  3ZBD A;  4BCH B;  1GY3 B;  3LQ5 B;  2CH4 W;  2HMA A;  3CC2 T;  3HB9 A;  3HRT A;  4J9F A;  4IUP A;  4C92 A;  3GF5 A;  1PD0 A;  2RO0 A;  2OJ2 A;  1C6V X;  4BCN D;  4ROD A;  4L59 A;  1MV0 B;  4OMP A;  2D0Q B;  2X9H A;  3TW6 A;  1JO8 A;  1PM3 A;  2YUO A;  3OYH A;  1UE9 A;  3JRZ A;  1VQK A;  1Y71 A;  3GIB A;  3PT9 A;  4OMF B;  3URG A;  1H26 B;  4CFW B;  2EQK A;  4XQ3 A;  5FW9 A;  3MI9 B;  1PWT A;  4CC7 A;  5LJ5 e;  2FZG B;  2MCN A;  4L5G A;  1OI1 A;  1B34 A;  3H41 A;  2RI2 A;  4HNV A;  4D8D A;  3CPW A;  3OS2 A;  3QJ6 A;  3DKM A;  1IRE B;  1TWB A;  3TEE A;  1ABO A;  2BKD N;  2R7G A;  1ZBJ A;  4EMK A;  1W70 A;  1Y07 A;  2A28 A;  2IW8 B;  1FMK A;  2EUF A;  2EPD A;  1AT1 B;  5IHY A;  3PTA A;  3CPW S;  2K2M A;  3I35 A;  5FU7 C;  1NZ9 A;  1VQ4 A;  2I40 B;  3E2U A;  1VQ7 Q;  4LD6 A;  2WJ9 A;  4PFP A;  1JKW A;  2RJE A;  1SRM A;  5LJ5 f;  1ZX6 A;  2KRO A;  3GTM S;  2ZZD A;  1W2B P;  1WGS A;  1BK2 A;  1D09 B;  5FRO A;  3JCM P;  3V7R A;  5GMK j;  2O88 A;  2DBK A;  2R5M A;  2KR3 A;  1Q7Y C;  1HD3 A;  1JU5 C;  2AZV A;  1UGP B;  3PGG A;  1Q82 R;  5CKF A;  4QKU A;  1TSF A;  4DA4 A;  2P0P A;  2JGZ B;  3JAM E;  4EOJ B;  4ELY C;  3BDU A;  2JOY A;  4C92 G;  3TSZ A;  1B07 A;  1PKT A;  2E3I A;  2HNI A;  1MUZ A;  3TQ7 P;  5IH2 A;  1KQS P;  3EG9 A;  2XU8 A;  5GAO p;  3ER0 A;  2CUD A;  1Q86 U;  3KFV A;  1S1N A;  2DIQ A;  4Z6Y A;  4J6Y A;  4PJO D;  2EFI A;  2JW4 A;  1QVF S;  1SSH A;  5LJ3 e;  3MCA B;  2EQM A;  4HT9 A;  1VQP T;  1KHI A;  1I5L A;  2K4Y A;  2X4X A;  4DEY A;  4XTV A;  2C0T A;  2KVQ G;  2RH2 A;  4P5N A;  3THK A;  3VS4 A;  5GAM f;  4LN2 A;  3CMA Q;  4GBQ A;  2HKQ B;  1EX4 A;  2B8A A;  4UC4 A;  3OYE A;  5CQY A;  1KD1 U;  2JXB A;  1OPK A;  3SB2 A;  3C4S A;  4PK4 A;  4J7I A;  4PL6 A;  1FIN B;  1K9M U;  1ACM B;  2PZ1 A;  1D3B A;  4RTY A;  3VKI A;  3A1P A;  1H4L D;  3S3O A;  4JRQ A;  2X3W D;  1C1A A;  3L2U A;  4M7A F;  2CP6 A;  3ULR B;  1X27 A;  4KT0 E;  2EW3 A;  1M30 A;  2BZY A;  7AT1 B;  1IZ6 A;  4Y91 A;  3X25 B;  2F1L A;  2FO0 A;  2QQB A;  2WIH B;  2NUT A;  3CCM A;  1TUG B;  1SPK A;  2DLP A;  1MMN A;  1Z9Q A;  4AKH A;  2DTI A;  3TN8 B;  2ZGW A;  4J83 A;  3MEV A;  4O5V A;  3KUF A;  2L3Q A;  2O01 E;  3OA6 A;  2Z0W A;  4FCY A;  5ICP B;  3HSB A;  5J39 A;  1CKB A;  2CUB A;  2KK4 A;  4NL2 A;  4M78 D;  1ZSZ B;  2F5T X;  2QAZ A;  3OYC A;  1H1Q B;  4FYV B;  4BB7 A;  3LWH A;  4EOM B;  2EQU A;  2LQN A;  2JZ2 A;  2RQV A;  3RMQ A;  2DF6 A;  1AWW A;  2ZCF B;  1IGQ A;  1VQO A;  4IUV A;  3CC7 A;  2YLB A;  2NYS A;  5GAM d;  1H1S B;  4BI4 A;  4J7F A;  2DYB A;  3PE0 A;  5IDN B;  2RHY A;  5KE2 A;  3EG0 A;  4EDU A;  5GAM h;  4HXJ A;  2QF7 A;  1VYW B;  4F17 A;  4F6S B;  3QKJ A;  3M59 A;  1B3Q A;  1UGV A;  3M57 A;  5ACB A;  5DQW A;  1KQS A;  5IXF A;  4PNO A;  2CSI A;  2YRC A;  5M9O A;  3OYF A;  4C0G A;  3RKY A;  4AFZ C;  2E4H A;  3LGF A;  4JS4 A;  2MPX C;  1IHV A;  3FJP A;  2ZPE B;  1IXD A;  5HKC A;  4DOV A;  5C6S A;  5A0G A;  1MNE A;  4BCI B;  3VJP A;  1K0X A;  2C06 A;  3M0U A;  3MEU A;  3MET A;  4EOP B;  2KYB A;  4JJC A;  1VQ8 A;  4NL3 A;  3E1S A;  2WMA B;  2OX7 A;  2G77 A;  4FL6 A;  5A0L A;  2V1Q A;  4WTO B;  4YC3 B;  4RCC A;  3G7Z A;  4ZGE B;  2RJD A;  1VQ7 T;  2VGN A;  3E9G A;  4RG8 A;  2PU9 B;  4E7Z A;  3KBG A;  2QA4 A;  3SFM A;  2FRW A;  1GCP A;  4C0F A;  1VYU A;  2NLU A;  4D6W A;  4KGX B;  1GBQ A;  2X51 A;  3S6W A;  2F69 A;  1O9S A;  2LTO A;  1RAF B;  3O0G D;  3EG9 B;  4PJL A;  5EG2 A;  3CCQ A;  2K3Y A;  1QVF A;  2HEQ A;  1VQ6 A;  4M7D E;  2MI6 A;  4F7U G;  1ARK A;  1X01 A;  2O4X A;  5CEI B;  2KI7 A;  3BHT B;  4JZ3 A;  5IAY A;  3UPU A;  2GF7 A;  2D8H A;  4FSS A;  1YCS B;  1KC8 R;  1LCK A;  1BI1 A;  4Z88 A;  2MWP A;  4PJO B;  3M03 A;  2QDL A;  3OS5 A;  4A4F A;  4EMG A;  2ESW A;  2WAC A;  4BBR M;  5DM7 R;  1JST B;  4C8Q G;  2C0O A;  4FYY B;  1WZO A;  2M9U A;  3CPW P;  3OSS C;  2DXT A;  1TUC A;  1G2B A;  3SWN B;  2HQE A;  2AK5 A;  3F70 A;  4C92 D;  1GUX A;  6AT1 B;  5GMK m;  1JXO A;  3G4S T;  4AG1 C;  2J05 A;  2LNH B;  2GQV A;  2IW6 B;  3QUI A;  1GCQ A;  4PJO G;  2XHC A;  4BCQ D;  4C92 B;  5GAO r;  2YLC A;  3PO3 S;  1SHF A;  2E64 A;  4E7J A;  1ZA1 B;  2KT1 A;  5GAN d;  1M8V A;  2YUN A;  5HK3 A;  2GNC A;  4CFV B;  3BG5 A;  1OZ3 A;  4BY6 B;  2FZK B;  5IXB A;  2PVG B;  3K7A M;  3JCM e;  4EOO B;  4AKG A;  4E2F B;  3TVT A;  3MEA A;  2RA2 A;  2W0Z A;  1K8A C;  1NE8 A;  5GJW B;  2FVU A;  3QYE A;  3M55 A;  1KG1 A;  2EYW A;  1XTD A;  2QDJ A;  4N4H A;  4E7H A;  1KSW A;  1N9S A;  3H9N A;  4ZN3 A;  1D0Y A;  2RJC A;  3PNW C;  4KUL A;  3EGU A;  1VQO T;  3BFM A;  3CBO A;  3JCM X;  1VQ9 A;  2RHZ A;  3V8L A;  1H92 A;  3EG2 A;  5D7U A;  1SEM A;  2A0F B;  4HCB A;  3WVD B;  4R56 A;  1K0S A;  3LH0 A;  3I9Q A;  3CCU A;  2X35 A;  2K79 A;  1UHC A;  4E7I A;  4J9H A;  5FU6 C;  1VQ5 A;  3CME Q;  3HO8 A;  5IN1 A;  1FVV B;  2H3J A;  4M77 A;  1OOT A;  2WPA B;  2QQ9 A;  4RG2 A;  3J7A F;  4OR5 B;  4ESR A;  1UGQ B;  1VQK T;  4FW1 A;  3RUX A;  2E3H A;  3M53 A;  2PHG A;  1HSQ A;  1NJI U;  3RMS A;  5BNJ B;  2HL3 A;  3CMA A;  5FWC A; 
#chains in the Genus database with same CATH homology
 2RJF A;  1YIJ T;  1BI3 A;  2VC8 A;  4HA8 A;  4MDX A;  1YCY A;  5D6W A;  2VV5 A;  4EMK B;  3P8D A;  2EKO A;  4J6X A;  4HCC A;  2CZ7 B;  4OB3 B;  3DB4 A;  4IUQ A;  5KCO A;  3HPW A;  2MWO A;  3GLX A;  4M75 A;  5GAN 3;  3CCJ A;  1VQ9 T;  3JCM d;  3OYA A;  3OW2 A;  4MZT A;  1VQN T;  1NPR A;  2K5L A;  2VYT A;  1QW1 A;  4TVR A;  4XU2 A;  4C0D C;  4BAC A;  1Q86 C;  3ZBD A;  3GOX A;  3H6Z A;  2RD1 A;  5D6Y A;  4O6J A;  5GAO n;  3CCJ T;  1VQ9 A;  3CC2 T;  5FU6 B;  1I4K 1;  3HB9 A;  1VQP A;  3HRT A;  3A8O B;  3L42 A;  5GAN f;  1Y96 B;  4M77 G;  4IUP A;  3ZFJ A;  4C92 A;  3GF5 A;  4YTL A;  2RO0 A;  3JB9 J;  2EJ9 A;  4L59 A;  3DL1 A;  4FT2 A;  4Z02 A;  4BD3 A;  4C8Q C;  2D0Q B;  5FU7 B;  2LRQ A;  3TW6 A;  2XIC A;  5GMK i;  4M7A C;  1XQH A;  3OYH A;  3C12 A;  3QBY A;  4WF2 A;  2JNG A;  3JRZ A;  5CVI A;  1Y71 A;  4C92 F;  1VQK A;  4MZM A;  2HQX A;  3CBP A;  1W2B A;  1NJI C;  4OVA A;  2EQJ A;  2QTX A;  3GIB A;  3PT9 A;  3HHT B;  2JN0 A;  2RI5 A;  4II1 A;  4OMF B;  4X9C A;  1G5V A;  3URG A;  3CD6 T;  3HKS A;  1Q82 U;  2CKK A;  4OF1 A;  2EQK A;  4XQ3 A;  3X20 B;  3FEO A;  5LJ5 e;  2FHD A;  3LYI A;  1PSF A;  4L5G A;  4M78 F;  2I2L A;  1U1S A;  1OI1 A;  1B34 A;  1OZ2 A;  3R6O A;  4QW2 A;  5GAM e;  4MMK A;  3CCL T;  1YI2 A;  1QVG S;  1JJ2 A;  4EPC A;  3GNF B;  2RI2 A;  4N0A C;  4PJO C;  4HNV A;  2BS2 A;  3I56 T;  3OS2 A;  3CPW A;  1K9M C;  3QJ6 A;  2OTL T;  3DKM A;  2ZZD B;  5GMK e;  1IRE B;  4F7U E;  3TEE A;  5DLO A;  4M75 B;  3H4C A;  1KQ1 A;  2BKD N;  5CO7 A;  3G71 A;  1K73 U;  3HRU A;  1JJ2 S;  1X75 C;  2RHX A;  2IG0 A;  4BDZ A;  3CME A;  4M7A E;  2OTL A;  5DLQ E;  3OBW A;  4EMK A;  2RHI A;  1Y07 A;  1VQ7 A;  3J80 E;  4BE2 A;  3CCL A;  3CCM T;  1YI2 T;  3PTA A;  3CPW S;  2DTO A;  5FU7 C;  4M7A B;  1NZ9 A;  4AKI A;  4LDW A;  3JCM Q;  4QVZ A;  1VQ4 A;  3HFO A;  1VQL T;  2QDY B;  1I8F A;  4LD6 A;  4C8Q F;  2WJ9 A;  1YHQ A;  4LDX A;  3Q1J A;  4GLK A;  1XNI A;  2RJE A;  3UDC A;  1S72 T;  2XI9 A;  2DZC A;  5LJ5 f;  4HNT A;  2MMP A;  2GFA A;  2DIG A;  2EJF A;  5EJC A;  5LJ5 d;  4PJO E;  3L2Z A;  1KC8 C;  2X4Y A;  2HD0 A;  2ZZD A;  4XU0 A;  4ME7 A;  4B9W A;  1WGS A;  5LJ5 h;  2X4W A;  1WJR A;  2VGM A;  2HAX A;  2AHJ B;  5FRO A;  3JCM P;  1VQ6 T;  3V7R A;  5GMK j;  4HL4 A;  5HK0 A;  5LJ3 j;  3JB9 I;  2X4J A;  1ZBX A;  2R5M A;  1Q7Y C;  4PJO F;  1UGP B;  3UWN A;  3VKG A;  2QEX A;  3PGG A;  1W4S A;  5CKF A;  4LD9 K;  3TW7 A;  4Q5W A;  2EIF A;  4J5Y A;  1U1T A;  1YBY A;  2BS3 A;  4DA4 A;  5GAN e;  2P0P A;  4JX4 A;  2K2V A;  4ZGJ B;  3JAM E;  3MHX A;  4KUI A;  1DJ7 B;  4MFD A;  2XKO C;  4MML A;  4C5G A;  4ELY C;  4F7U F;  3BDU A;  2JOY A;  4C92 G;  5GAN g;  3RKW A;  3VYG A;  2QFZ A;  1M9S A;  2K5F A;  2HBP A;  3FB9 A;  3MP1 A;  4IUR A;  1QVG A;  2HNI A;  4N4G A;  4JX6 A;  4OB0 B;  1YIJ A;  5GAO q;  3JCM f;  1M1K C;  4RCB A;  5FRN A;  4B9X A;  2XU8 A;  4X9D A;  4CI0 C;  3ER0 A;  5KH6 A;  5GAO p;  3QXE B;  2M1H A;  1N8R U;  1Q86 U;  5GAN 2;  2DIQ A;  4JRI A;  2K3X A;  3OMC A;  1YHQ T;  4Z6Y A;  1Y7X A;  2M0O A;  4J6Y A;  4JRK A;  3OYY A;  2DAQ A;  3RER A;  2EFI A;  2EAY A;  1M90 U;  4A4G A;  5GAO l;  4AI6 A;  1W2B S;  4XU3 A;  2E6Z A;  3QII A;  1JRI A;  2RK2 A;  4M75 G;  5LJ3 e;  1QVF S;  2PVO B;  4PLL A;  3CCS T;  3MCA B;  1I81 A;  1WPY A;  3A8G B;  2KAF A;  2L5Q A;  4NOY A;  4LDY A;  4OP0 A;  2EQM A;  5CKH A;  1KHC A;  4IUT A;  4BI8 B;  3TU4 K;  4HT9 A;  3NFC A;  1VIE A;  3KXT A;  2KDS A;  4J8O A;  5GAN 7;  3QHS A;  4XU1 A;  1KHI A;  1YJW T;  1VQP T;  2DD4 A;  3QPH A;  2P0Q A;  1I5L A;  2K4Y A;  1WQW A;  4IKF A;  3M5A A;  2E10 A;  4ATO A;  2X4X A;  2D6F A;  4M7A A;  1ZQ1 A;  4XTV A;  2DK3 A;  2DD5 B;  2LVM A;  2CZ0 B;  2A7Y A;  2KVQ G;  2RH2 A;  4RKU E;  4P5N A;  1YIT T;  2MAM A;  3M4G A;  5GAM f;  3PIO A;  3CCU T;  3HFN A;  4HT8 A;  5LJ5 j;  3FRN A;  5AYF A;  4M78 B;  2QEX T;  4QQG A;  4JJN K;  4V2S A;  2RI3 A;  4XTW A;  5GAN 6;  3A8M B;  3CCR A;  4HNU A;  5HY6 A;  2B8A A;  4UC4 A;  3OYE A;  2QXF A;  5CQY A;  1U8R A;  1KD1 U;  2XDD A;  3VUB A;  2R58 A;  1S72 A;  2LQK A;  3HRS A;  3CCV A;  1X6O A;  2DXC A;  4LDU A;  3SB2 A;  2K5I A;  2PUO B;  3NTH A;  4M77 B;  3C4S A;  4EMH A;  4M7D A;  1RI0 A;  2PVD B;  4J7I A;  3I55 T;  2DXB A;  2LC4 A;  3QG1 A;  3QO3 A;  4PL6 A;  1K9M U;  2BIV A;  3PFS A;  4M77 F;  4CRI A;  3JB9 H;  1D3B A;  2DD5 A;  3BY7 A;  3VKI A;  5GMK l;  3OYG A;  4A53 A;  1G3W A;  4M7D C;  5LL6 S;  3S3O A;  3G6E T;  4JRQ A;  3CC7 T;  2DD4 B;  3L1A A;  3RES A;  5GAO m;  4QQ6 A;  3L2U A;  4M7A F;  3CEY A;  4EMK C;  3CCQ T;  3AHU A;  4KT0 E;  5J3B A;  1VQM A;  3ASK A;  4BBS M;  4C5E A;  1VQ4 T;  1VIF A;  5J26 A;  1VQL A;  5GAM j;  3OY9 A;  1IZ6 A;  4Y91 A;  3X25 B;  2QQB A;  2BS4 A;  3WVE B;  2V8K A;  4R55 A;  3CCM A;  1UEB A;  4C0D B;  3UT1 A;  4ZN1 A;  4C92 E;  4C8Q E;  2XK0 A;  4AKH A;  2DTI A;  2ZGW A;  1V29 B;  3LLR A;  5FRM A;  3JCM h;  5CR2 A;  4J83 A;  5CCA A;  3SDZ A;  5GAN 8;  3FLG A;  2YRV A;  3MEV A;  3GNG A;  4O5V A;  3KUF A;  3P8H A;  1GXI E;  3VKH A;  2O01 E;  1MHN A;  3OA6 A;  3X26 B;  2JUF A;  3V7C A;  3HSB A;  5J39 A;  2R57 A;  4NL2 A;  2KK4 A;  2QQR A;  4M78 D;  3RIR A;  4QVD A;  2ZPB B;  2F5T X;  3FIF A;  5C0M A;  4NC6 A;  3OYC A;  4BB7 A;  2OTJ A;  3LWH A;  1BI2 A;  3INZ A;  4M78 A;  4QSH A;  2E6N A;  2DZ9 A;  2EQU A;  3PMT A;  2RK1 A;  2JZ2 A;  3RMQ A;  1E7P A;  4LOC A;  5D6X A;  3S3N A;  2DTH A;  2OTJ T;  3JSC A;  2ZCF B;  2VUB A;  3C94 A;  3OYM A;  1VQO A;  3M56 A;  4IUV A;  3CC7 A;  4FT4 A;  2YLB A;  1FXX A;  3RKX A;  4N0A A;  1UGR B;  4BI4 A;  5GAM d;  3GP8 A;  4J7F A;  4PJO A;  5KE3 A;  2RHY A;  3T9N A;  1WJQ A;  3BDL A;  4BI3 A;  4EDU A;  5KE2 A;  5GAM h;  3A8L B;  4XTZ A;  3TCJ A;  3I55 A;  4M75 E;  1YJ9 T;  2QF7 A;  1H64 1;  4OB2 B;  2CYZ B;  3NTK A;  3QKJ A;  2O4X B;  3M59 A;  4LDV A;  1TH7 A;  3BG9 A;  2EYQ A;  5GMK h;  4HLQ A;  3M57 A;  4JLI A;  4XAX B;  3PIP A;  4M75 C;  3OYN A;  1UB4 A;  2L8D A;  1KQS A;  3CC2 A;  1HK9 A;  4PNO A;  2KMG A;  3A8H B;  2LT4 A;  2RB6 A;  3M58 A;  5M9O A;  2E41 A;  3OYF A;  2WSE E;  4C0G A;  2VXF A;  3RKY A;  3OS1 A;  1VQM T;  2LCC A;  3LGF A;  1UGS B;  3OYD A;  4JS4 A;  4E7K A;  3L2W A;  5IT9 E;  4C8Q A;  1FX7 A;  3FJP A;  2JVV A;  3CXC S;  4XTU A;  2ZPE B;  4KUD K;  5HKC A;  5I2M A;  1B34 B;  4OB1 B;  4DOV A;  5C6S A;  1YJ9 A;  3QYH B;  2KQW A;  5A0G A;  3VYG B;  3VJP A;  1Q81 C;  2M16 A;  4M77 D;  2XDB A;  1PSE A;  2C06 A;  1N8R C;  1M4Z A;  2V8I A;  3MP8 A;  1EIF A;  1N9R A;  1YJN T;  1QLB A;  2DXC B;  4FU6 A;  5CK9 A;  3MEU A;  3MET A;  3JCM g;  2GFU A;  2LX9 A;  1JB0 E;  4QQD A;  1VQ8 A;  4NL3 A;  1BI0 A;  3E1S A;  3VU3 C;  2ZPI B;  1WQ7 A;  4QVC A;  2KY9 A;  2F5K A;  2FYK A;  2EWN A;  3CPF A;  2G77 A;  1M1G A;  4FL6 A;  3SD4 A;  4A54 A;  5A0L A;  1BKB A;  3HZJ A;  1N27 A;  1K8A U;  1ZHI A;  1XOV A;  2DVE A;  4M7D D;  4MFE A;  1LNX A;  2DXB B;  3DLM A;  3QDR B;  1KD1 C;  2KMT A;  3E19 A;  4RCC A;  3JCM V;  3G7Z A;  3J81 E;  4C8Q D;  4ZGE B;  2RJD A;  5LJ5 g;  2VGN A;  3E9G A;  2D9T A;  1VQ7 T;  4F7U A;  4RG8 A;  2PU9 B;  3VYH B;  4M7D G;  5GAN 4;  3G71 T;  2OAU A;  2P4T A;  3KBG A;  4MDW A;  4N4I A;  3SFM A;  3OYJ A;  2QA4 A;  3S3M A;  4M77 E;  4ZTF A;  3JB9 F;  3JCM J;  3M54 A;  2MF2 A;  4C0F A;  3I56 A;  3L2V A;  5GAN h;  3LWI A;  1M1F A;  4GY5 A;  5KCH A;  5CKD A;  2NLU A;  1NPP A;  4D6W A;  3OYL A;  3DLL A;  2ZPG B;  2K57 A;  3QJY A;  4Y28 E;  4C8Q B;  4JS5 A;  3S6W A;  2F69 A;  3P8B B;  3DB3 A;  5FLX E;  4XTY A;  1O9S A;  1VQ5 T;  2LTO A;  3O8V A;  1Q81 U;  5EG2 A;  1M5Q 1;  4ZTJ A;  3G4S A;  2XG8 D;  3CCQ A;  2K3Y A;  3SWN C;  1QVF A;  4DOW A;  5A0D A;  3V7S A;  1RL2 A;  2V8J A;  1M90 C;  1VQ6 A;  4M7D E;  2MI6 A;  4F7U G;  1X01 A;  2Y90 A;  1K73 C;  4PJO D;  2O4X A;  1N6A A;  3N5B B;  2VXE A;  2E5Q A;  3EAE A;  5IAY A;  3QWL A;  2GF7 A;  5LJ3 h;  3UPU A;  2CZ6 B;  4IUU A;  4C5I A;  2Y4Y A;  1HXD A;  4FM4 B;  2R5A A;  4BE0 A;  5GAN j;  2E1H A;  3M4Y A;  1BI1 A;  4PKC C;  2XD0 A;  1QP3 A;  1G3Y A;  2MWP A;  4PJO B;  2E65 A;  3JCM b;  4BE1 A;  3SWN A;  3QYB A;  3C95 A;  4PLI A;  4C92 C;  3CCR T;  4RMO A;  3HBL A;  2BUD A;  3OS5 A;  4BUG A;  2PQW A;  1BYM A;  4A4F A;  4EMG A;  3CCE A;  4JX5 A;  4E7L A;  4XTX A;  3QSU A;  3OYB A;  1BIB A;  2GCX A;  2WAC A;  4BY6 C;  2DJZ A;  4BBR M;  1YIT A;  1FKM A;  3A5Z B;  3BW1 A;  4F7U B;  2IVW A;  2L89 A;  5LJ3 g;  4M78 C;  2QA4 T;  5DM7 R;  2QQA A;  3QZ9 B;  4C8Q G;  2QQ8 A;  4OGE A;  1MGQ A;  2M9U A;  2FB7 A;  3LW5 E;  3OB9 A;  1OYX A;  1R8O B;  3ZEH A;  1AHJ B;  2P0K A;  2DXT A;  3OSS C;  2FL7 A;  1FWZ A;  2E12 A;  5LJ3 d;  3SWN B;  1P92 A;  2HQE A;  4JUV A;  3OW2 S;  3JCM W;  3F70 A;  4C92 D;  3CME T;  4JDS A;  3QZ5 B;  4FSX A;  5GMK m;  3JB9 D;  3CMA T;  3QYG B;  1D3B B;  3ME9 A;  3WXM B;  3G4S T;  3OYK A;  2Y4X A;  3M9Q A;  3HL8 A;  3EFS A;  3OQ5 A;  3MP6 A;  4M7D B;  2GQV A;  2KR6 A;  3PMI A;  3QUI A;  4HCZ A;  1Q82 C;  1KQS S;  1QVP A;  2JTF A;  3G6E A;  2A3L A;  4PJO G;  2G3R A;  4OGC A;  1LJO A;  2YHT A;  5CKE A;  4M7D F;  3OBY A;  2XHC A;  4JLG A;  3L2R A;  2XDP A;  4C92 B;  5GAO r;  1O75 A;  2YLC A;  4KBM B;  5CQX A;  4ZGD B;  1Y96 A;  2E64 A;  4E7J A;  5GAN d;  4C0Z A;  4A4K A;  2KSS A;  3FDR A;  1M1K U;  1M8V A;  5HK3 A;  2DO3 A;  2E70 A;  2LQ8 A;  4M78 G;  3BG5 A;  1OZ3 A;  2LCL A;  1QP2 A;  4BY6 B;  1VUB A;  1LOJ A;  3X24 B;  3CCE T;  2PVG B;  3VUZ A;  1YJN A;  3CBM A;  3JCM e;  4A4H A;  1G3S A;  4AKG A;  4NS5 A;  4JRP A;  3CC4 A;  5I2S A;  4MZP A;  4DQ2 A;  1WNL A;  3MEA A;  3MO8 A;  2RA2 A;  3FC3 A;  1JBM A;  1BIA A;  2CGH A;  4VUB A;  1K8A C;  3LX7 A;  3CCV T;  4FIB A;  4M75 F;  1NE8 A;  2FVU A;  3NTI A;  4ELJ A;  3QYE A;  4E47 A;  3M55 A;  3GPL A;  3CC4 T;  1KG1 A;  1H3Z A;  1SSF A;  3E9F A;  1XTD A;  5I21 A;  2QDJ A;  4N4H A;  4E7H A;  1N9S A;  3V8J A;  1G3T A;  5DY9 A;  2PUK B;  4ZN3 A;  3OMG A;  3JCM c;  2RJC A;  3MEW A;  3PNW C;  2EJG A;  4ELZ C;  2CS7 A;  4KUL A;  1VQN A;  1VQO T;  3BFM A;  3CBO A;  3JCM X;  4MIM A;  1KC8 U;  2RHZ A;  3TRE A;  3V8L A;  4C5H A;  2DEQ A;  2RHU A;  2JTM A;  2CZ1 B;  3JB9 G;  3BG3 A;  5LJ3 f;  3KHI A;  4X34 A;  4HCB A;  3WVD B;  4R56 A;  4M6V A;  3HP9 A;  3EFR A;  2XID A;  2DXU A;  2LNV A;  3LH0 A;  2RM4 A;  2L3R A;  4M75 D;  3CCU A;  2X35 A;  5GAM g;  1Q7Y U;  4J6W A;  3CCS A;  3L2Q A;  2DKG A;  3H8Z A;  4E7I A;  5FU6 C;  2WSF E;  2WSC E;  4XK8 E;  3OS0 A;  1VQ5 A;  3HO8 A;  5IN1 A;  1YJW A;  2H3J A;  2LDM A;  3OSV A;  4BDY A;  3CD6 A;  2ZPF B;  2ZPH B;  4M77 A;  5A2Q E;  3OYI A;  1VQ8 T;  2QQ9 A;  3VV0 A;  5CAI A;  4RG2 A;  3J7A F;  4L6V 5;  1UGQ B;  5CKB A;  1VQK T;  4M7A D;  4M77 C;  3LGL A;  3RUX A;  3CXC A;  2QI2 A;  3X28 B;  3M53 A;  5GAN 5;  5L8R E;  4HKE A;  4A4E A;  5CIU A;  4M78 E;  3RMS A;  1NJI U;  2DPP B;  2LT1 A;  4M7A G;  3CMA A;  2QQS A;  1WJS A;  1KQ2 A;  3V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...