3X25B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 700 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x25B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x25B02
4OB2B 2PU9B 1DJ7B 2CZ7B 3QXEB 2ZPFB 3A8MB 2ZPHB 1V29B 4ZGDB 2CZ0B 3X24B 2DXBA 2ZZDA 1UGPB 4OB3B 2WSEE 3LW5E 2CZ6B 1PSFA 1PSEA 2DXCB 4L6V5 4KT0E 3X25B 3VYHB 1JB0E 3X20B 4OB1B 2WSFE 2PVGB 4XK8E 3QZ9B 4RKUE 1IREB 3X28B 3A8GB 3X26B 2ZPEB 2DXCA 4OB0B 3WVDB 2DD5B 2QDYB 2PVOB 3A8HB 2PUOB 2CYZB 2O01E 2ZPIB 2PVDB 2DD4B 2AHJB 2WSCE 3QZ5B 2D0QB 4FM4B 3VYGA 3VYGB 1QP3A 2DD5A 3HHTB 4Y28E 2DPPB 1UGRB 1UGQB 3WVEB 4ZGEB 1AHJB 2ZCFB 2DD4A 1UGSB 2DXBB 4ZGJB 1QP2A 3QYGB 2ZZDB 2PUKB 3A8OB 3A8LB 5L8RE 3QYHB 2CZ1B 2ZPBB 1GXIE 2ZPGB
chains in the Genus database with same CATH superfamily
5IAYA 2NUTB 3LQ5B 4BCQB 1I0CA 3H41A 2KY9A 4V2SA 3TQ7P 1MUZA 2V1RA 1MMDA 4K11A 5D6XA 5LJ5g 4TVRA 3BDLA 1X6BA 4QQ6A 5D6YA 1XQHA 4J6WA 4IKFA 2DNUA 3TN8B 2DO3A 1V29B 4L5GA 4ZGDB 3META 2GFAA 2L3SA 1MMGA 1MV0B 1Y96B 1SG5A 1VYWB 4KH0B 1K73U 3BLHB 2AZVA 1NEBA 2A08A 1E7OA 4EOMB 3KFVA 2QI2A 3OMCA 4OMOA 5LJ3d 3RERA 1D09B 1RAIB 1Q81R 1VQ9A 1RI0A 2QGFB 3FDRA 4M78D 4A4KA 4A63B 1IRXA 1OI1A 4J9BA 2DEUA 4XTZA 2XU8A 2RJEA 4RKUE 4II1A 1WHMA 5LL6S 4IURA 3SDZA 3P8DA 1PKDB 4RODA 1RACB 2DM1A 3HTRA 1IZ6A 3LYIA 4YOSA 1M8MA 2W9ZA 5IF1B 2DD5B 1QKXA 4C92B 4BCMD 8ATCB 2WFYB 3OYIA 2CYZB 4C8QF 3TW7A 3QPHA 2YRVA 2DILA 3HP9A 1KJWA 3CC7A 2KRMA 5GANj 3GNGA 4IUVA 8AT1B 2OTLA 3GOXA 5GANe 3L2VA 1HSQA 3VS1A 5LJ3h 3FIFA 1W2BS 4HT8A 1AT1B 5CO7A 2JMCA 3OW2A 1UGQB 5A2QE 5GAOm 3CCSA 2A36A 1P5EB 4OMLA 4M75D 2RK2A 4EMHA 5CR2A 3OS1A 1RADB 2LX9A 2WIHB 2CCHB 2DD4A 3NTKA 1JJ2A 2RF0A 2QEXQ 1QP2A 1GY3B 1VQMT 1IO6A 2NUPA 1KQ1A 3CBMA 4YOZA 1N8RC 1TD6A 1Q7YU 3H8ZA 3ZEHA 2RO0A 4E7IA 2WMAB 3EFSA 4YC3B 3K7AM 2ZAEA 7AT1B 1TUDA 1ABQA 1YJNQ 5LJ3j 4BCIB 5FU6C 2X4YA 2E6ZA 1FMVA 1QVFS 2F2CA 3JB9H 4E7ZA 1RAAB 2HKNA 2W0ZA 2LTOA 2FYKA 1PKTA 4M7AG 3C4SA 4BXXX 4EOKB 4EOPB 4PFPA 2NUTA 3BHVB 5KE3A 4JRPA 3CCET 4EOOB 2FRYA 5CK9A 3M03A 3X25B 1IHWA 2WXVB 3E9FA 1KD1U 3RBBB 3JCMd 2HL5C 4RCCA 1PWTA 2HMAA 2O9VA 3TREA 1WI7A 2R5MA 2LQKA 3L2QA 4HA8A 5CKBA 2DMOA 1M90U 1SPKA 2OTJA 3SB2A 2C5NB 3PIOA 1ZBJA 4QQDA 2RPNA 1WDXA 3FLGA 4FL6A 1WIEA 4JS4A 4ELYC 2JTFA 4IUQA 1AOJA 2KRSA 4C5EA 4OVAA 1NLOC 3MHXA 1GFDA 2BIVA 2E10A 4EOJB 5J26A 1TFBA 3CC4Q 3A98A 4NL3A 1JEGA 4JDSA 4M7AE 5IHYA 3VYGA 4C92C 2IW9B 2OAUA 2DD5A 3BDUA 2CREA 4JPBW 3JCMh 1G3TA 4M75F 2D1XA 4CC2A 4JX4A 3ZFJA 2ZCFB 1N8RR 2I2LA 3UF4A 1UGSB 1YN8A 2DAQA 3QYGB 4XU0A 4KBMB 1UNHD 3OW2S 4F16A 1K4US 3A8OB 2JMAA 2EJGA 2CZ1B 1YJWT 2NWMA 1K9AA 1VQ6A 2FZCB 4MDWA 3NDQA 3UA6A 1BIBA 1D3BA 1JJ2S 3JCMV 4C0DC 2QQ8A 3VS5A 1KQSA 3J81E 3QXEB 2FL7A 3V7SA 3EJ1B 2HZYA 2ZPHB 5HBEB 3U23A 1YITA 4HKEA 1R77A 5HBJB 3HL8A 5I22A 3OYYA 3CCMA 1YIJA 3G6ET 2QYZA 3CCVT 2DXCB 1B34B 3CCUQ 2OX7A 2GF7A 3CCLQ 1Q82U 4M7DC 2W9FA 3EH1A 1I81A 1D3UB 4JRIA 5GMKj 3JCMb 1WHKA 2C5OB 1XOVA 2GTJA 5IT9E 5GAMg 5GMKe 1ZA2B 5GJVB 4PJOA 1QCFA 3X28B 5EC7A 2KSSA 4HCCA 3RMQA 1KFZA 2E65A 2VASA 3VS3A 1PRMC 1GRIA 1I1JA 4HVWA 4A4EA 3CXCS 4C5IA 2D8JA 1S72A 1R8OB 4FYVB 1AWOA 1OI9B 4AT1B 1YCYA 4RTXA 4CFMB 3HRUA 4AG2C 2LQWA 4TTHA 3HBLA 1VYTA 1NG2A 2L0AA 4HL4A 5D6WA 4M7AD 2QTXA 2JM8A 2WJ9A 3FJPA 4M78B 3VUZA 1E6GA 1IB8A 3QZ5B 3L2ZA 2YRCA 4LNPA 4F17A 2B86A 1M3BA 4WTOB 1HXDA 3H0HA 1VQLT 2RI5A 2X4WA 1K73C 4RG8A 4OP0A 2RHZA 2L5QA 2JVVA 1VOLA 3VKHA 3TSWA 4LDUA 3OSSC 1WX6A 3M58A 2M0YA 3GTMS 3OSVA 5EFQB 1C0MA 2EYWA 4F70B 4BY7X 5HKCA 1VQKA 3TNHB 2CGHA 4EOLB 1N6AA 2C4GB 2PU9B 3JV3A 1VINA 2XG8D 4XTYA 1VYVA 3VKGA 2KI7A 4C5GA 2J6OA 1YHQA 4JX5A 4UC4A 1W6XA 1ZHIA 2O9SA 4DBHA 3S3OA 4AKGA 4FSSA 4XTUA 4Q5WA 4M75B 2K3BA 1KQSS 4C0FA 1WNLA 3CBOA 4B9XA 2QGSA 4KGVB 1TG0A 3VRZA 2RQTA 3VS7A 1OYXA 3B57A 3DLMA 1JB0E 3OW2P 4ATOA 2XDPA 4FYWB 1M1KU 4HCBA 1NJIU 1X6OA 4QT7A 4NSTB 4C8QG 2BKDN 3CPFA 1QVGA 2FB7A 2K9GA 3V7CA 5CCAA 2DXCA 4BDYA 4M77C 1RLPC 1N27A 3CBPA 3TSZA 1RAEB 1Q7YC 2LT4A 4QKUA 1ZSGA 1NBEB 5CEIB 2PMIB 4WCIA 3FEOA 4DBRA 1RUWA 1M27C 2BUDA 4F7UB 3KUFA 4M7AF 1WGSA 1WYXA 1O9KB 1E6HA 3JCMc 2GTOA 1H641 1OZ3A 3CD6Q 2LCCA 3QYEA 1YI2A 1BI0A 5M9OA 3QG1A 3GPLA 1K73R 4QSHA 3RDVA 1G3YA 2EFIA 2H3JA 2E6NA 3CMEA 3EG3A 2KMGA 1MMAA 4DOVA 3I56Q 4BCKB 1NLPC 1KD1C 2Y90A 1GCQA 2L3QA 4M78A 1VQ5Q 1WZOA 4C8QE 2K5LA 1FKMA 2BZ8A 1D0YA 2MWOA 2DJZA 2QASA 1ZLMA 1Z9QA 1M90C 1BIAA 3G4ST 3CC2Q 2ZPFB 5GANg 2DA9A 2AZSA 2QDJA 5L2WB 1G8XA 1MNEA 2JTMA 2RH2A 3O0GD 4B6MA 1VQNA 1ZP2A 4NC6A 1XNIA 3REBB 3CCRQ 4F04B 3CCJQ 2CZ6B 5IHKA 2V8IA 4E7JA 4PK4A 4F6UB 3N5BB 2PTKA 3P8BB 2BZXA 3CCQQ 2ECZA 4MFDA 4HLQA 3QO3A 1JSTB 2J06A 4M4ZA 5L23A 2FPEA 3LGLA 1SF9A 5DQVA 2WACA 4M75A 2JNGA 2QQBA 2VWFA 4YTLA 1Q7YR 2E4HA 5KYXA 5LJ3g 1U1SA 3WVDB 5FGKB 4ANJA 1PCXA 1TU0B 4ZNXA 1VQ9Q 3A8HB 1QVGS 3VS0A 4FT2A 3MY5B 2RI3A 4CXAB 1H4LD 5I2SA 4F6SB 4F7JB 3QHRB 3CCVA 1MNDA 3H0FA 3L2WA 4CFNB 2DE0X 2D0QB 4CFXB 2RQVA 4OGCA 4EMGA 1S1NA 3DLLA 2YUPA 3JRZA 2RHYA 2XKOC 3REAB 1UGRB 4KULA 1VQ6T 1W4SA 1KD1R 1Q82C 1EFNA 3HO8A 3EFOA 4E6RA 5A0GA 1SKUB 2G77A 3CC7Q 2DTHA 1BI2A 1G3NC 2KR3A 4C8QD 4LOCA 1K8AU 3SFMA 2AKKA 2GQIA 1JSUB 2KR6A 2AIRB 3QWXX 2OTLQ 2NUPB 2I53A 4A4GA 4M7AB 2PZ1A 1M90R 4CRLB 2F69A 3CCMT 1YIJT 3CCSQ 4DEXA 2RI2A 4BY1X 1TXQA 2W96A 1OZ2A 3G1JA 1QLBA 2KXDA 1UFFA 3G71T 1UGVA 2CZ0B 2YHTA 4KGZB 5KCHA 5GANd 2O31A 2B8AA 4PL6A 4M7DF 1UGPB 2K5FA 1NYGA 3HZJA 1SHFA 1UTIA 1QVFA 1JRIA 2QG9B 3V8KA 1NYFA 1H28B 4RTWA 2K3YA 1S72T 4KH1B 1G3WA 4OB1B 3PIPA 1I5LA 1WJRA 1Y0MA 2HSPA 4VUBA 2EQIA 1H24B 1QMZB 4MMKA 5EJCA 1LCKA 4I3ZB 2WIPB 1VQOA 4BD3A 5IDPB 2W2HA 3OYNA 2XICA 3EHQA 2ESWA 3JCMg 1VQ8A 4ME7A 3CMAQ 2DTIA 4BCGB 4JRKA 2C5XB 5GJWB 4XTVA 4PJNA 5GANh 1KG1A 2X4XA 3I55Q 2QQAA 2JM9A 1OQKA 2K4YA 4PLIA 2K57A 3DTOA 3DB3A 2OTJQ 3F70A 2UZEB 3VYGB 1WFWA 3HHTB 1VQKT 4F6WB 5CKDA 1Q82R 2EJ9A 2YRDA 3OS5A 2BE7D 2L3PA 3OYHA 4BUGA 5GAN6 5GAN8 4BACA 2JXBA 4ORZA 1M1KC 4XU3A 1NJIC 1YHQT 3JSCA 3A8LB 2V26A 4BCJB 4FW1A 1MGQA 2ED0A 1OL1B 2JW4A 1Q86U 2FEIA 3BG5A 1D3BB 4BCND 2IIMA 1JO8A 3GIBA 2LCSA 3QJYA 2NUZA 3OYMA 2H8HA 5LJ5f 2WMBB 1GBQA 2L89A 2BE9B 1EX4A 1QCNA 4DQ2A 2QA4Q 1AZEA 1VQ4Q 3EH2A 4ELJA 3RNJA 4C0GA 2A3LA 2X35A 4M7AA 4J83A 1OEBA 3VYHB 1UE9A 4J9DA 1OL2B 2KQWA 1HJDA 1RL2A 2KYBA 4MZTA 5FU7B 3NFCA 1P92A 1I4K1 3OBYA 2DL5A 2WSFE 3EGXA 1PM3A 1YITQ 4D8KA 1BBZA 4AKIA 3MKDA 1H1PB 4PJOB 2RQWA 2DX1A 3QYBA 2X3WD 3X26B 3PGGA 1FYNA 1SEMA 4CFVB 4PFOA 3G4SA 2Y4YA 1LNXA 3C95A 1YI2T 4N4HA 1VQPQ 3M57A 1H8KA 3H4CA 1IGUA 1O75A 4JJDA 3SEMA 4BY6B 1SRMA 3TCJA 1BCOA 3CMET 1RI9A 3CXCA 1IHVA 3JCMW 1AISB 2LC4A 2LQ8A 2DXUA 4HNTA 4KRCB 3J80E 1SHGA 2DL4A 3TEEA 9ATCB 4FM4B 2DVEA 2W10A 2IW6B 3LGFA 4AMCA 4J9GA 4ZN3A 3PMTA 4IMYB 2D9TA 4X9DA 4J9EA 2O4XA 2DYIA 1M1KR 3S3MA 1QWFA 5KYUA 1NJIR 1WXUA 1H25B 2CUBA 3ME9A 3MEUA 3F5XB 4BI3A 2ZPGB 1E7PA 3OYLA 2FHDA 1X6GA 1NPRA 4JJBA 3AHUA 1PHTA 1VQNT 3VU3C 3M0RA 2LQNA 4IIMA 5CKHA 4ELZC 2EQJA 4B9WA 2KRNA 2DLPA 2M0OA 4LUEA 1UDLA 1GBRA 3E1SA 3M0QA 3ZBDA 4XAXB 5I11A 1OV3A 3OQ5A 4HCZA 2YDLA 3LW5E 3FC3A 4C8QB 1KQ2A 3PNWC 2RQRA 3MIAB 1YFNA 1VQ7T 3PVLA 4FSXA 5GMKm 4OMMA 4KT0E 5GMKh 2F5TX 2D8HA 5J39A 4IIOA 1M9SA 1N9RA 3G7ZA 3UWNA 1BI1A 3V8LA 2F2XA 4EMKB 2P0PA 4XK8E 1N5ZA 4PJMA 3QUIA 2QEXA 3I35A 1W2BP 3A8GB 4AFQC 1U8RA 4Z6YA 1B07A 1K8AC 4C92G 4ZN1A 2X3XD 3M0UA 2R58A 5FLXE 4JZ4A 4MMLA 1H26B 2KVQG 2VGNA 1I8FA 2F2WA 2UZLB 3MI9B 5IXFA 1YJNA 4EC9B 3GF5A 5KYNA 3LWIA 3E9GA 4E7HA 4PJJA 1GH6B 3G71A 1VQMQ 2XD0A 3VS6A 4PJOC 3A1PA 1JQQA 5I21A 3URGA 2DL7A 4NOYA 4AFUC 1W1FA 2K6DA 4DBQA 2X9HA 2RA2A 1T0JA 2HQEA 2BKZB 3CPWS 1QVFP 4GY5A 5GAN2 2X1NB 3G33B 1C6VX 3NTHA 2J6KA 2V22B 4HNUA 2DTOA 3QJ6A 2VUBA 3M55A 3QDRB 1E9HB 2RN8A 4LDVA 4O6JA 4XTWA 3CCEQ 2OJ2A 5L8RE 2LDMA 4C92E 1NEGA 2K3XA 2X4JA 4M7DG 3CQTA 4ROEA 3JCMJ 4LD9K 4MZMA 1T3SA 1D0ZA 2JT4A 2LZ6B 3SD4A 5GAOq 1UNGD 1M8VA 5HQ0B 2C0OA 4RTYA 4BCMB 2KROA 1WJQA 5CKFA 3CC4A 4QVDA 2RQUA 1SSHA 4JLIA 4RG2A 4ESRA 1YBYA 1K76A 2LCLA 3M56A 1A0NB 4HVUA 1YP5A 2UZDB 2L8DA 2KEAA 2VVKA 2LT1A 3LLRA 3H6ZA 1KHIA 4CRIA 1VQOT 4Z8AA 6AT1B 4NL2A 2COYA 5C6SA 3J7AF 1H92A 5IN1A 3V8JA 2D6FA 1ZSZA 1VQ8T 2ROTA 2PVGB 4BCNB 2DF6A 5GAMf 2HD0A 3ZL7C 1YJ9T 1K8AR 3THKA 3KHIA 3TVTA 1ZA1B 4CC7A 3RUXA 3PFSA 4C8QA 4QQGA 2PQWA 1C1AA 2DFUA 2F1LA 4N4GA 2VV5A 5KYXB 2HCKA 4E7SA 1M3AA 4M7DE 2H3EB 2ATCB 3SWNA 1B3QA 5A0LA 1FXXA 1Q86C 2CDTA 4GLMA 2ZPIB 1F1BB 2G3RA 4EMKA 2HAXA 2MAMA 1U1TA 1YJWQ 2XMFA 2GBQA 1N4MA 4IUUA 1BU1A 1JJ2P 1IXDA 2KMTA 5I2MA 3EGDB 5ACBA 2LW4A 4GBQA 4LE9A 3CCUA 2EAYA 3QHSA 3CCLA 4Y92A 2LJ3A 4KUIA 2R57A 3VS2A 3UDCA 1AEYA 2FZKB 3EFOB 4XQ3A 1JXOA 1X27A 5IDNB 3G6EQ 4ZGJB 1B7TA 2DXTA 3CCVQ 1K0SA 2ZZDB 1I07A 1Y71A 3M9QA 4C92D 1MV3A 1GXIE 2CH4W 2YUNA 4MZPA 1Y57A 3MP6A 2JJ9A 1DJ7B 2BZYA 1G3SA 4BCOB 4F7LB 2F5KA 4C5HA 3TNIB 1XO2A 1GCQC 3HRTA 1GUXB 3S6WA 1X2QA 4M78C 2YLBA 3CXCP 4OMFB 2EYZA 3QHWB 3OYFA 2EGCA 3TU4K 4NS5A 3LWHA 2YSQA 1CKBA 1LJOA 1LVKA 2DK3A 4M77G 2LP5A 2SRCA 1Y07A 4JS5A 3OYGA 5KYYA 1WJSA 1JU5C 3VJPA 5HBHB 5CYIB 2QQSA 2DJQA 2QFZA 1UHCA 2KAFA 1CSKA 2JN0A 1JKWA 1GL5A 1VQLQ 2E64A 3NHNA 4X9CA 2YXYA 5CQXA 4BI4A 2R7GA 4M7DD 2EQUA 3OYAA 2CP6A 3DL1A 2YWWA 4BE2A 4LDYA 1AWXA 1Q86R 2E5QA 1K9MU 2GFUA 2KE9A 3GP8A 1ABOA 2R5AA 4OMNA 4M75C 4Y91A 1AWJA 4II5B 2E5KA 1WXTA 1W98B 2A0FB 1VQ7A 4MFEA 5FRMA 4BCFB 5GAMe 2LMJA 4M77E 2CP3A 3HFNA 2JUFA 4HVVA 2DBMA 2BS4A 4N0AC 2QDLA 2P0QA 2CKKA 2JGZB 3WVEB 3PO3S 2CUDA 1KQSP 4P5NA 1IGQA 5FWCA 4R56A 1H3HA 1QVPA 2A28A 2KYMA 3ULRB 4C92F 3OYEA 5CKEA 1WQ7A 3MP8A 4JLGA 1ZUKA 3NMZC 2QF7A 3EGDA 4DEYA 1OX8A 3TNWB 5LQFB 5DQWA 2BS3A 1U3OA 3BW1A 3BG9A 4R0KA 1EIFA 4N4IA 1I5OB 2L2PA 2AKLA 2CZ7B 2CP5A 2FPFA 4AFSC 5HY6A 1M1FA 5FWBA 2IW8B 1ZBXA 5GANf 4FCYA 3NTIA 1BYMA 3X24B 4UN0A 2L3RA 2ZZDA 2OAWA 2CSIA 1PRLC 2HEQA 5HNBB 5ICPB 4O5VA 1PKSA 3RGFB 2QEXT 5GAOn 2V8JA 2FG0A 2EBPA 4EOSB 2DMEA 5EG2A 2ZGWA 3DKMA 3MCAB 3OYKA 3FRNA 3QDFA 1GUXA 1YJNT 2LVMA 5J3BA 3MP1A 3EGXB 4A4FA 1GCPA 1VQ5A 4QW2A 3EG0A 2ED1A 2ZPEB 2VC8A 5IHNA 4EIKA 1X01A 2GNCA 5LJ3f 4F7UG 1AD5A 1HD3A 2DYBA 3DJBA 1ZX6A 4LUDA 1FX7A 2BPMB 3CC2A 3UT1A 4AKHA 4BDZA 4EDUA 5FU6B 2MIOA 1PNJA 5FRNA 4J9HA 1PD1A 2LRQA 1QQJA 2AHJB 2C6TB 2RNAA 3EG1A 1WHGA 5CQYA 4JUVA 1TUCA 3H0IA 4M77D 3RKYA 2EQMA 2EIFA 3G4SQ 2PHGA 1M2OA 2E1HA 4YOOA 1CKAA 4Y28E 1FWZA 4ZTJA 3GBQA 4X1VA 3CCQA 4WF2A 1YJ9A 4EOIB 4LN2A 3OB9A 2O4XB 5AT1B 3M0SA 5KYUB 1WLPB 2GQVA 3EFRA 3M0PA 1M30A 1OIUB 2E12A 1HYOA 2BS2A 2MPXC 1UUEA 2K79A 2LNVA 2M51A 4J9FA 3M0TA 3VV0A 4FIBA 3CC4T 1ZQ1A 2E3HA 3EG9B 4F7UE 2YLCA 3M4GA 5DLQE 3FJ5A 1T3LA 2CS7A 2C5VB 1BKBA 4JZ3A 4CFUD 3MEWA 2WSEE 1V1CA 2F2VA 1KC8U 1X69A 3QBYA 3POMA 3GNFB 1UHFA 1QVGP 4XU1A 1MMNA 2QAZA 2I0NA 4E2FB 3X20B 3O8VA 1QCOA 4CFWB 2DIGA 3O5ZA 1VUBA 3EAEA 1OIYB 5AYFA 4A4HA 5IXBA 3QZ9B 3DB4A 1V76A 5GMKl 2Y4XA 1ENWA 4J7IA 4M7AC 5A0DA 2HNIA 1VQ6Q 4ZTFA 5KH6A 1JBMA 3BLRB 2QDYB 4GLKA 1H1RB 2PVOB 4BE0A 3JCMf 3KBGA 4HXJA 3CCUT 1BI3A 4C0DB 4EPCA 2GCXA 3CCLT 5BNJB 1WHHA 4E7KA 2PVDB 2WSCE 4M77F 2DL8A 1UB4A 2G6FX 4J7FA 5DY9A 1M4ZA 1MHNA 3CCMQ 1YIJQ 1QWEA 1VYUA 3RMSA 4DOWA 1H1SB 1WHLA 1QP3A 2FPDA 3DDQB 4OGRB 4M7DB 2PJQA 1FMWA 3G71Q 2MK5A 2EKOA 1TUGB 5LJ3e 5LJ5d 1AHJB 4DBFA 3CPWA 2IVWA 3PT9A 3UATA 1PD0A 3OYCA 4FX3B 3DDPB 3QYHB 3QKJA 1FVVB 2NLUA 1S72Q 2JTEA 5IH2A 4M78F 3MEVA 1UNLD 5GMKi 1YWPA 1UECA 3CMAA 2MYSA 1TOVA 5ECAA 2FZGB 4PJLA 3JB9G 2K7AA 3A8MB 3PMIA 2HBWA 4DA4A 1K9MC 3I55A 4E47A 2CP2A 2ENMA 2EWNA 1SSFA 3R6NA 1Y96A 2X51A 2DIQA 2O2OA 3C94A 2AK5A 2M9UA 2M1HA 1PSEA 1M5Q1 2V1QA 2VB6A 4RTZA 2M02A 3EG9A 3HSBA 1G2BA 5FROA 2CP0A 3E19A 4D8DA 5LJ5h 5GAN4 1G83A 3JB9I 1ZSZB 1PC0A 3EG2A 5I5ZB 3T9NA 1IREB 4RCBA 4FYXB 3VKIA 2O88A 1N9SA 3NGPA 1H3ZA 1RLQC 2DRKA 4OMPA 2HSEB 3L1AA 1VQKQ 1EZZB 2EJFA 3HFOA 2Z0WA 1G5VA 2LJ1A 1KK7A 4C92A 3ASKA 1KSWA 2MMPA 1OKVB 3I9QA 2DETA 3SWNB 1F5QB 2ABLA 2O01E 2EKHA 4LD6A 1YNZA 1UG1A 1YHQQ 5LJ5j 4PLLA 2QA4A 2IVXA 2JOYA 3EHRA 1VQ4A 5LJ5e 2UZBB 2DRMA 4ROCA 2AT1B 2RM4A 3OYDA 2RK1A 3VS4A 3BFMA 1C9BA 2COZA 2KT1A 2DPPB 4KGXB 1Q81U 1NE8A 2QGGA 5FU7C 2RHXA 4RUGA 4MDXA 4EOQB 4F7SB 1OPLA 2J05A 2MI6A 1KHCA 1H27B 2E70A 1OU9A 3JCMe 4JX6A 2XK0A 1KIKA 3RKXA 2DXBB 4EORB 3VUBA 2P0KA 2XDDA 1LOJA 2HQHA 5HK0A 4Z02A 4F7UF 1GFCA 2BTTA 2J6FA 4OB2B 2K2MA 3CD6T 5GAN7 2QQRA 4M77B 2XIDA 3Q1JA 4BY6C 3OS2A 1OULA 1VQPA 1RAHB 4J5YA 4M7DA 1X43A 1WA7A 1TWBA 1BCMA 1K9MR 3ER0A 2LX7A 5KCOA 1LPLA 1OU8A 3RESA 2RB6A 4OGEA 4Z89A 2HDAA 2J7IA 2MOXA 3I56T 5LMKB 1YI2Q 2CH4A 4IUTA 1VQ5T 4BCPB 4L6V5 3CMEQ 3FB9A 3DOGB 1YCSB 1NM7A 3OS0A 2EYXA 5KYYB 4HNVA 2EUFA 4PJOG 4EC8B 2JS0A 2IPOB 4PKCC 3MY1B 2RHIA 1M3CA 3JCMX 1R0CB 4KRDB 3P8HA 3INZA 1U5SA 3OMGA 3CC2T 3R6OA 3HKSA 2K2VA 3JCMP 1UJYA 2DZCA 2XHCA 2NYSA 3M5AA 2I40B 1Q95G 4Z88A 1AWWA 3M53A 2P84A 3SHWA 2XDBA 3RR6A 4OB0B 4MIMA 1D0XA 4EONB 4CFUB 3CCRT 3BY7A 1TSFA 3MO8A 3CCJT 2PUOB 2KBTA 3JB9D 2KNBB 1ZSZC 2YUQA 3LH0A 2DEQA 2FVUA 1OGUB 3M4YA 3HPWA 3M59A 2EYQA 3V7RA 4IUPA 5HK3A 3L2UA 3LH5A 4OMQA 4J6YA 3CCQT 2DERA 4BCQD 4RTTA 1VA7A 1VQNQ 4C8QC 2G9XB 3MPUB 5DLOA 5C0MA 2LJ0A 5GAOr 2HBPA 2V8KA 1FINB 3SWNC 3S3NA 4HCKA 2RJDA 1KC8C 3BHTB 4OR5B 2MCNA 4ZGEB 2HL3A 4EMKC 4F7NB 4RMOA 1D1BA 4PJOE 1VQ9T 2YT6A 2KK4A 1OX9A 1VQ7Q 2ZPBB 4J9CA 4BE1A 3HB9A 3CEYA 1UEBA 1U06A 1W70A 3L2RA 4CC3A 4M6VA 3I5SA 4F14A 3JAME 4BB7A 5GAOp 4C0ZA 1VQMA 4FT4A 4BBRM 4A54A 4QVZA 3BE3A 2DBKA 1HK9A 1QKWA 3AT1B 2OI3A 2DXBA 3C12A 5GAMd 4CC4B 2ROLA 4FU6A 1NZ9A 5CAIA 4XTXA 3CC7T 4PNOA 3EOCB 1B34A 3RIRA 2OTLT 2P4TA 1H1QB 3UA7A 1M2VB 1OPKA 4M77A 3QWYA 4A53A 3JB9J 1SRLA 1AVZC 3H9NA 3LX7A 5HCKA 1X75C 1N8RU 2DL3A 3M54A 3CCST 4D6WA 2MWPA 1AD6A 4LDXA 2C0IA 2HKQB 2DKGA 1FMKA 2VXFA 1XJWB 3VRYA 3CPWP 1M1GA 2WEVB 3CCEA 2EQKA 2E41A 4BI8B 1OKWB 3IQLA 3QSUA 3I5RA 2CSQA 3JB9F 2VGMA 4L59A 2RJFA 2RD1A 4JJNK 4AFZC 5KYWB 4AG1C 5GAMh 1D1CA 1NPPA 4BBSM 5KE2A 4KUDK 1KC8R 1R0BG 4PJOD 3GLXA 1BK2A 3PE0A 1JOWA 1UJ0A 4ELLA 2FO0A 4M78G 2VXEA 3CMAT 2VYTA 3OA6A 2KT8A 1WPYA 5GAMj 5GAN3 3TW6A 1VQOQ 3I55T 4RTVA 2P4RA 2CP7A 5IHIA 3HRSA 1ACMB 4J6XA 4R55A 1D1AA 2EPDA 2GGRA 2CT4A 2QK0A 4CI0C 5FW9A 2OTJT 1VQ8Q 1RAFB 2SEMA 2CCIB 3BHUB 3RKWA 1Z9ZA 2HQXA 1K1ZA 1T0HA 3D7SB 1YJ9Q 2IN3A 1O9SA 4QVCA 3MJXA 3KXTA 1TH7A 2M16A 2B9RA 1PG5B 1WQWA 3NPFA 5CIUA 2PK2A 1YJWA 3JCMQ 2CT3A 4J9IA 4Y72B 1VIFA 2EGAA 4AI6A 2QQ9A 2RJCA 5DM7R 4OB3B 3EIDB 2KGTA 1ARKA 1OOTA 1BB9A 1VIEA 1WXBA 2C06A 1PSFA 1ZUUA 4LXCA 1AZGB 2JZ2A 4FW2A 2E3IA 2KXCA 2QTVA 1WHJA 4J8OA 2A37A 4N0AA 2DZ9A 2EVRA 3OY9A 1XTDA 3A5ZB 2QXFA 1Q81C 1BU2A 3WXMB 4M75G 1QMCA 2LNHB 2JS2A 4M78E 2W99A 3OBWA 3G6EA 1K0XA 3OYBA 2WHBB 4BCHB 3CD6A 4E7LA 2EYYA 4HT9A 1KXUA 1X2KA 2QA4T 1VQ4T 3OYJA 1M2VA 4JJCA 2DVJA 2RHUA 4RTUA 2COWA 3QIIA 1JXMA 2XI9A 4F7UA 4JRQA 2PNIA 2PK9B 3L42A 2VKNA 3EGUA 3I56A 1O9KA 1URCB 1YWOA 2A7YA 2YUOA 2DD4B 1VOMA 3PVQA 1W2BA 2IG0A 1ZUYA 2D0NA 4PFZA 5GAOl 1YITT 3QWLA 5HVYB 4XU2A 4LDWA 2K5IA 4FYYB 3MEAA 3UPUA 4G6LB 2MF2A 2UUEB 4PJOF 1Y7XA 2EW3A 3E2UA 5CVIA 1TS9A 5D7UA 4X34A 1TTHB 2WPAB 2KDSA 2C0TA 5GAN5 3C0CA 5KYWA 3BLQB 2RMOA 1VQPT 4M75E 1QW1A 1QLYA 1RAGB 1RABB 2PUKB 1VQLA 2CJMB 2EGEA 4OF1A 3PTAA 1J3TA 3CCRA 2FRWA 4KRTA 3BG3A 3CCJA
chains in the Genus database with same CATH topology
2LDMA 5IAYA 2NLUA 4C92E 4V2SA 2KY9A 2X4JA 2K3XA 4M7DG 4M78F 3JCMJ 4LD9K 3MEVA 1M90C 1BIAA 4MZMA 5GMKi 3G4ST 5D6XA 5LJ5g 3CMAA 4TVRA 3BDLA 3SD4A 2ZPFB 5GAOq 3JB9G 5GANg 4QQ6A 1M8VA 5D6YA 3A8MB 1XQHA 3PMIA 2QDJA 4J6WA 4IKFA 4DA4A 2RH2A 2DO3A 2JTMA 1V29B 4L5GA 4ZGDB 3I55A 1K9MC 3META 4E47A 2GFAA 2EWNA 1WJQA 1SSFA 1VQNA 5CKFA 3CC4A 1XNIA 4NC6A 1Y96A 2DIQA 4JLIA 4RG2A 4QVDA 1Y96B 1YBYA 3C94A 1K73U 2M9UA 2CZ6B 2M1HA 2V8IA 2LCLA 3M56A 4E7JA 1PSEA 2L8DA 1M5Q1 2QI2A 3OMCA 2LT1A 3LLRA 3N5BB 3H6ZA 1KHIA 5LJ3d 4CRIA 1VQOT 3RERA 3HSBA 5FROA 3P8BB 1VQ9A 4NL2A 1RI0A 4M78D 3E19A 3FDRA 4MFDA 4A4KA 5C6SA 4HLQA 5LJ5h 3J7AF 3QO3A 5IN1A 1OI1A 3V8JA 5GAN4 2D6FA 1VQ8T 4XTZA 3JB9I 2XU8A 2PVGB 2RJEA 5GAMf 2HD0A 4RKUE 4II1A 3LGLA 3T9NA 1IREB 1YJ9T 5LL6S 2WACA 4M75A 4IURA 4RCBA 3KHIA 3P8DA 3SDZA 3VKIA 3RUXA 1N9SA 2JNGA 2QQBA 1H3ZA 3PFSA 1IZ6A 3LYIA 4YTLA 4C8QA 3L1AA 4HT8A 4QQGA 2EJFA 2PQWA 3HFOA 1G5VA 5LJ3g 1U1SA 3WVDB 4N4GA 2DD5B 2VV5A 4C92A 4M7DE 3ASKA 4C92B 2MMPA 3SWNA 3A8HB 5A0LA 3OYIA 3SWNB 1QVGS 2CYZB 1FXXA 2O01E 4C8QF 3TW7A 3QPHA 1Q86C 4LD6A 2ZPIB 4FT2A 2G3RA 2RI3A 2YRVA 4EMKA 3HP9A 5LJ5j 3CC7A 2MAMA 1U1TA 2HAXA 5I2SA 4PLLA 5GANj 2QA4A 3CCVA 2JOYA 3GNGA 4IUUA 1VQ4A 5LJ5e 3OY9A 3L2WA 4IUVA 2KMTA 2OTLA 2D0QB 4OGCA 3GOXA 5I2MA 4EMGA 5GANe 3DLLA 3L2VA 2RM4A 3OYDA 2RK1A 3CCUA 3BFMA 2EAYA 5LJ3h 3FIFA 3JRZA 2RHYA 2XKOC 3QHSA 5CO7A 2DPPB 1W2BS 1Q81U 1UGRB 1NE8A 3CCLA 5FU7C 3OW2A 2RHXA 4KULA 1UGQB 5A2QE 5GAOm 3CCSA 4KUIA 1VQ6T 2R57A 4MDXA 1W4SA 4M75D 2MI6A 1Q82C 3UDCA 3HO8A 1KHCA 2RK2A 4EMHA 5A0GA 5CR2A 2E70A 2G77A 2LX9A 2DTHA 1BI2A 4XQ3A 3OS1A 4C8QD 3JCMe 4JX6A 4LOCA 2DD4A 2XK0A 3NTKA 3SFMA 3RKXA 1K8AU 2DXBB 4ZGJB 1JJ2A 1QP2A 2DXTA 3VUBA 1VQMT 2ZZDB 1Y71A 2P0KA 2KR6A 3CBMA 1KQ1A 1LOJA 3M9QA 4C92D 5HK0A 2XDDA 1Q7YU 1N8RC 3CCJA 4Z02A 4F7UF 1GXIE 3H8ZA 3ZEHA 4A4GA 4OB2B 2RO0A 4MZPA 4M7AB 4E7IA 3MP6A 3EFSA 1DJ7B 3CD6T 5GAN7 2QQRA 2F69A 4M77B 2XIDA 1G3SA 3Q1JA 4BY6C 3OS2A 3CCMT 1VQPA 1YIJT 2F5KA 4J5YA 4M7DA 5LJ3j 2RI2A 5FU6C 2X4YA 4C5HA 2E6ZA 1OZ2A 3ER0A 1QVFS 1QLBA 3HRTA 5KCOA 3S6WA 4M78C 2YLBA 3RESA 3G71T 3JB9H 4OMFB 2CZ0B 2RB6A 2YHTA 4OGEA 5KCHA 5GANd 2B8AA 4PL6A 4M7DF 3OYFA 2LTOA 1UGPB 4NS5A 3I56T 3TU4K 2K5FA 3LWHA 2FYKA 4M7AG 3C4SA 3HZJA 1LJOA 2DK3A 4M77G 1QVFA 1JRIA 5KE3A 4IUTA 1VQ5T 4L6V5 4JRPA 3CCET 5CK9A 3X25B 3V8KA 3FB9A 1Y07A 3E9FA 4JS5A 3OYGA 1KD1U 2K3YA 3JCMd 4RCCA 1WJSA 1S72T 3OS0A 4HNVA 1G3WA 4PJOG 4OB1B 3VJPA 2QQSA 4PKCC 3PIPA 3TREA 2RHIA 1I5LA 3JCMX 2QFZA 2R5MA 2KAFA 1WJRA 2JN0A 3INZA 3OMGA 3P8HA 4VUBA 2LQKA 4MMKA 3L2QA 4HA8A 3CC2T 3R6OA 5EJCA 2E64A 4X9CA 3HKSA 2K2VA 5CKBA 5CQXA 4BI4A 2DZCA 2XHCA 3JCMP 3M5AA 1VQOA 4BD3A 1M90U 4M7DD 2EQUA 3OYNA 3M53A 2XICA 2XDBA 2OTJA 3OYAA 4OB0B 4MIMA 3DL1A 4BE2A 3SB2A 3CCRT 4LDYA 3PIOA 3BY7A 3JCMg 3MO8A 3CCJT 4QQDA 2E5QA 1VQ8A 2PUOB 3FLGA 3JB9D 4FL6A 4ME7A 2GFUA 2DTIA 3GP8A 4JRKA 4ELYC 4JS4A 1K9MU 2JTFA 3LH0A 2R5AA 4IUQA 2DEQA 2FVUA 3M4YA 3HPWA 3M59A 2EYQA 4XTVA 4IUPA 3V7RA 4OVAA 4C5EA 5HK3A 3L2UA 3MHXA 4M75C 4Y91A 2X4XA 4J6YA 2BIVA 5GANh 3CCQT 1KG1A 2E10A 2QQAA 5J26A 4C8QC 4NL3A 1VQ7A 4MFEA 4JDSA 5FRMA 2K4YA 4M7AE 4PLIA 5C0MA 2K57A 5GAMe 5DLOA 3DB3A 3F70A 3VYGA 5GAOr 4C92C 2HBPA 3VYGB 2OAUA 4M77E 2V8KA 2DD5A 3HFNA 3BDUA 3SWNC 2JUFA 3HHTB 3S3NA 2RJDA 1KC8C 1VQKT 3JCMh 1G3TA 4M75F 2BS4A 2EJ9A 4N0AC 5CKDA 3OS5A 2P0QA 2CKKA 3WVEB 4ZGEB 4JX4A 4EMKC 4RMOA 3OYHA 3ZFJA 4BUGA 2ZCFB 4P5NA 4PJOE 1VQ9T 5GAN6 5GAN8 2I2LA 4R56A 1UGSB 1QVPA 2DAQA 4BACA 4C92F 3OYEA 3QYGB 4XU0A 4KBMB 2KK4A 1M1KC 3OW2S 5CKEA 3A8OB 4XU3A 1NJIC 1YHQT 1WQ7A 3JSCA 3A8LB 3MP8A 4JLGA 2EJGA 2CZ1B 2ZPBB 1YJWT 4BE1A 2QF7A 3HB9A 3CEYA 1UEBA 1VQ6A 4MDWA 1MGQA 3L2RA 1Q86U 2BS3A 1BIBA 1D3BA 3BW1A 1JJ2S 3BG9A 3BG5A 1D3BB 1EIFA 3JCMV 4C0DC 2QQ8A 4M6VA 4N4IA 3GIBA 1KQSA 3JAME 3QJYA 4BB7A 3J81E 2CZ7B 3QXEB 4C0ZA 5GAOp 3OYMA 1VQMA 4FT4A 5LJ5f 4BBRM 1M1FA 5HY6A 2FL7A 3V7SA 2L89A 4A54A 4QVZA 1ZBXA 2ZPHB 5GANf 3NTIA 1HK9A 1BYMA 5GAMd 3X24B 2DXBA 3C12A 4HKEA 1YITA 4DQ2A 2L3RA 2ZZDA 4FU6A 1NZ9A 5CAIA 4XTXA 3CC7T 3HL8A 4PNOA 4O5VA 3OYYA 3CCMA 4ELJA 1YIJA 3G6ET 4C0GA 2QEXT 1B34A 2A3LA 2X35A 3RIRA 5GAOn 2DXCB 1B34B 2V8JA 3CCVT 4M7AA 4J83A 2OTLT 2GF7A 2P4TA 5EG2A 2ZGWA 3VYHB 3JB9J 4M77A 4A53A 2KQWA 1Q82U 4M7DC 1RL2A 1I81A 3DKMA 3LX7A 3MCAB 4MZTA 4JRIA 5GMKj 3JCMb 5FU7B 1X75C 3OYKA 3NFCA 1P92A 1I4K1 1XOVA 3OBYA 5IT9E 5GAMg 1N8RU 2WSFE 3FRNA 3M54A 3CCST 4D6WA 5GMKe 2LVMA 5J3BA 2MWPA 3MP1A 1YJNT 4LDXA 2DKGA 4PJOA 4AKIA 3X28B 4A4FA 4PJOB 2VXFA 2KSSA 4HCCA 3RMQA 1VQ5A 3QYBA 1M1GA 3X26B 4QW2A 3CCEA 2E65A 3PGGA 2EQKA 4A4EA 3CXCS 2ZPEB 2E41A 4BI8B 4C5IA 3QSUA 2VC8A 3G4SA 1S72A 2Y4YA 1LNXA 1R8OB 3C95A 1X01A 5LJ3f 4F7UG 3JB9F 2VGMA 4L59A 1YI2T 2RJFA 1YCYA 4N4HA 3M57A 1O75A 3H4CA 4BY6B 1FX7A 2RD1A 3HRUA 3TCJA 4JJNK 3UT1A 4AKHA 4BDZA 4EDUA 3CMET 3CC2A 5FU6B 3CXCA 3HBLA 5FRNA 4HL4A 5D6WA 2LRQA 5GAMh 3JCMW 2AHJB 4M7AD 2LC4A 2QTXA 1NPPA 2WJ9A 2LQ8A 3FJPA 4JUVA 4M78B 5CQYA 3VUZA 2DXUA 4HNTA 4M77D 3J80E 3RKYA 2EQMA 3QZ5B 3L2ZA 3TEEA 2EIFA 4FM4B 2DVEA 3LGFA 4BBSM 5KE2A 4KUDK 1HXDA 2E1HA 1VQLT 4ZN3A 2RI5A 4Y28E 2X4WA 1K73C 1FWZA 4RG8A 4ZTJA 3PMTA 4OP0A 4PJOD 2D9TA 3CCQA 4WF2A 3GLXA 4X9DA 2RHZA 2L5QA 2JVVA 3VKHA 4LDUA 3OSSC 1YJ9A 2O4XA 4M78G 3OB9A 2O4XB 3S3MA 2VXEA 3CMAT 2VYTA 3OA6A 2GQVA 3M58A 3EFRA 3OSVA 1WPYA 5GAMj 2E12A 3ME9A 2BS2A 3MEUA 5GAN3 3TW6A 5HKCA 2LNVA 4BI3A 1E7PA 2ZPGB 2CGHA 2FHDA 3OYLA 1NPRA 1N6AA 3I55T 1VQKA 3AHUA 3HRSA 4J6XA 3VV0A 4R55A 1VQNT 4FIBA 3VU3C 3CC4T 2PU9B 1ZQ1A 5CKHA 2XG8D 4ELZC 2EQJA 4XTYA 4B9WA 4CI0C 4F7UE 2OTJT 2YLCA 3M4GA 3VKGA 4C5GA 3RKWA 2HQXA 2M0OA 5DLQE 1O9SA 4QVCA 3KXTA 1TH7A 2M16A 3E1SA 2CS7A 1YHQA 4JX5A 1WQWA 4UC4A 1ZHIA 5CIUA 3S3OA 1YJWA 3JCMQ 1BKBA 4AKGA 3ZBDA 4XTUA 4Q5WA 4XAXB 5DM7R 1VIFA 4M75B 4AI6A 2QQ9A 2RJCA 3OQ5A 3MEWA 4OB3B 4HCZA 2WSEE 1KQSS 4C0FA 1WNLA 3LW5E 3FC3A 3CBOA 4B9XA 4C8QB 1VIEA 3QBYA 3GNFB 1PSFA 1KC8U 3PNWC 2C06A 1KQ2A 1VQ7T 2JZ2A 4XU1A 4FSXA 5GMKm 4KT0E 5GMKh 2F5TX 1OYXA 3DLMA 1JB0E 4J8OA 4N0AA 5J39A 2DZ9A 1M9SA 3X20B 1XTDA 1N9RA 2XDPA 3A5ZB 3G7ZA 3O8VA 2DIGA 3UWNA 1BI1A 2QXFA 1Q81C 1M1KU 3V8LA 1VUBA 4HCBA 3WXMB 1NJIU 4M75G 3EAEA 1X6OA 4EMKB 5AYFA 4A4HA 2P0PA 4M78E 4XK8E 3QZ9B 3DB4A 3OBWA 3QUIA 3G6EA 2QEXA 4C8QG 3OYBA 2BKDN 3A8GB 3CPFA 5GMKl 1U8RA 1QVGA 4Z6YA 2Y4XA 2FB7A 4J7IA 4M7AC 3CD6A 4E7LA 1K8AC 3V7CA 4C92G 4ZN1A 5A0DA 2HNIA 5FLXE 2R58A 5CCAA 4HT9A 2DXCA 4BDYA 4M77C 2QA4T 3CBPA 1N27A 4ZTFA 4MMLA 1VQ4T 5KH6A 1Q7YC 1JBMA 2LT4A 2QDYB 3OYJA 2KVQG 2VGNA 4GLKA 2RHUA 2PVOB 4BE0A 1I8FA 3JCMf 3FEOA 3GF5A 3KBGA 3QIIA 1YJNA 3LWIA 3CCUT 2XI9A 1BI3A 3E9GA 4C0DB 2GCXA 4EPCA 4F7UA 2BUDA 3L42A 4F7UB 3G71A 3CCLT 4JRQA 3KUFA 2XD0A 4E7KA 4PJOC 4M7AF 2PVDB 3I56A 1WGSA 2A7YA 5I21A 2DD4B 1W2BA 2WSCE 3URGA 2IG0A 3JCMc 4M77F 1UB4A 4NOYA 1H641 4J7FA 5DY9A 1OZ3A 4E7HA 2LCCA 1M4ZA 3QYEA 1MHNA 5GAOl 1YITT 1YI2A 1BI0A 3RMSA 2RA2A 4DOWA 5M9OA 3QG1A 3QWLA 2HQEA 3GPLA 4XU2A 4QSHA 1QP3A 2K5IA 4LDWA 1G3YA 3MEAA 3CPWS 3UPUA 4GY5A 2EFIA 2H3JA 2E6NA 2MF2A 4PJOF 1Y7XA 5GAN2 3CMEA 5CVIA 4M7DB 2KMGA 4X34A 2KDSA 3NTHA 5GAN5 4ATOA 2EKOA 4HNUA 2DTOA 4DOVA 3QJ6A 5LJ3e 5LJ5d 2VUBA 1AHJB 3M55A 3QDRB 1VQPT 1KD1C 4M75E 2Y90A 1QW1A 3CPWA 4LDVA 2IVWA 3PT9A 4O6JA 4M78A 4XTWA 2PUKB 1VQLA 4OF1A 4C8QE 3OYCA 2K5LA 3PTAA 1FKMA 5L8RE 3CCRA 3QYHB 3QKJA 2MWOA 3BG3A 2DJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB2 B;  2PU9 B;  1DJ7 B;  2CZ7 B;  3QXE B;  2ZPF B;  3A8M B;  2ZPH B;  1V29 B;  4ZGD B;  2CZ0 B;  3X24 B;  2DXB A;  2ZZD A;  1UGP B;  4OB3 B;  2WSE E;  3LW5 E;  2CZ6 B;  1PSF A;  1PSE A;  2DXC B;  4L6V 5;  4KT0 E;  3X25 B;  3VYH B;  1JB0 E;  3X20 B;  4OB1 B;  2WSF E;  2PVG B;  4XK8 E;  3QZ9 B;  4RKU E;  1IRE B;  3X28 B;  3A8G B;  3X26 B;  2ZPE B;  2DXC A;  4OB0 B;  3WVD B;  2DD5 B;  2QDY B;  2PVO B;  3A8H B;  2PUO B;  2CYZ B;  2O01 E;  2ZPI B;  2PVD B;  2DD4 B;  2AHJ B;  2WSC E;  3QZ5 B;  2D0Q B;  4FM4 B;  3VYG A;  3VYG B;  1QP3 A;  2DD5 A;  3HHT B;  4Y28 E;  2DPP B;  1UGR B;  1UGQ B;  3WVE B;  4ZGE B;  1AHJ B;  2ZCF B;  2DD4 A;  1UGS B;  2DXB B;  4ZGJ B;  1QP2 A;  3QYG B;  2ZZD B;  2PUK B;  3A8O B;  3A8L B;  5L8R E;  3QYH B;  2CZ1 B;  2ZPB B;  1GXI E;  2ZPG B; 
#chains in the Genus database with same CATH topology
 5IAY A;  2NUT B;  3LQ5 B;  4BCQ B;  1I0C A;  3H41 A;  2KY9 A;  4V2S A;  3TQ7 P;  1MUZ A;  2V1R A;  1MMD A;  4K11 A;  5D6X A;  5LJ5 g;  4TVR A;  3BDL A;  1X6B A;  4QQ6 A;  5D6Y A;  1XQH A;  4J6W A;  4IKF A;  2DNU A;  3TN8 B;  2DO3 A;  1V29 B;  4L5G A;  4ZGD B;  3MET A;  2GFA A;  2L3S A;  1MMG A;  1MV0 B;  1Y96 B;  1SG5 A;  1VYW B;  4KH0 B;  1K73 U;  3BLH B;  2AZV A;  1NEB A;  2A08 A;  1E7O A;  4EOM B;  3KFV A;  2QI2 A;  3OMC A;  4OMO A;  5LJ3 d;  3RER A;  1D09 B;  1RAI B;  1Q81 R;  1VQ9 A;  1RI0 A;  2QGF B;  3FDR A;  4M78 D;  4A4K A;  4A63 B;  1IRX A;  1OI1 A;  4J9B A;  2DEU A;  4XTZ A;  2XU8 A;  2RJE A;  4RKU E;  4II1 A;  1WHM A;  5LL6 S;  4IUR A;  3SDZ A;  3P8D A;  1PKD B;  4ROD A;  1RAC B;  2DM1 A;  3HTR A;  1IZ6 A;  3LYI A;  4YOS A;  1M8M A;  2W9Z A;  5IF1 B;  2DD5 B;  1QKX A;  4C92 B;  4BCM D;  8ATC B;  2WFY B;  3OYI A;  2CYZ B;  4C8Q F;  3TW7 A;  3QPH A;  2YRV A;  2DIL A;  3HP9 A;  1KJW A;  3CC7 A;  2KRM A;  5GAN j;  3GNG A;  4IUV A;  8AT1 B;  2OTL A;  3GOX A;  5GAN e;  3L2V A;  1HSQ A;  3VS1 A;  5LJ3 h;  3FIF A;  1W2B S;  4HT8 A;  1AT1 B;  5CO7 A;  2JMC A;  3OW2 A;  1UGQ B;  5A2Q E;  5GAO m;  3CCS A;  2A36 A;  1P5E B;  4OML A;  4M75 D;  2RK2 A;  4EMH A;  5CR2 A;  3OS1 A;  1RAD B;  2LX9 A;  2WIH B;  2CCH B;  2DD4 A;  3NTK A;  1JJ2 A;  2RF0 A;  2QEX Q;  1QP2 A;  1GY3 B;  1VQM T;  1IO6 A;  2NUP A;  1KQ1 A;  3CBM A;  4YOZ A;  1N8R C;  1TD6 A;  1Q7Y U;  3H8Z A;  3ZEH A;  2RO0 A;  4E7I A;  2WMA B;  3EFS A;  4YC3 B;  3K7A M;  2ZAE A;  7AT1 B;  1TUD A;  1ABQ A;  1YJN Q;  5LJ3 j;  4BCI B;  5FU6 C;  2X4Y A;  2E6Z A;  1FMV A;  1QVF S;  2F2C A;  3JB9 H;  4E7Z A;  1RAA B;  2HKN A;  2W0Z A;  2LTO A;  2FYK A;  1PKT A;  4M7A G;  3C4S A;  4BXX X;  4EOK B;  4EOP B;  4PFP A;  2NUT A;  3BHV B;  5KE3 A;  4JRP A;  3CCE T;  4EOO B;  2FRY A;  5CK9 A;  3M03 A;  3X25 B;  1IHW A;  2WXV B;  3E9F A;  1KD1 U;  3RBB B;  3JCM d;  2HL5 C;  4RCC A;  1PWT A;  2HMA A;  2O9V A;  3TRE A;  1WI7 A;  2R5M A;  2LQK A;  3L2Q A;  4HA8 A;  5CKB A;  2DMO A;  1M90 U;  1SPK A;  2OTJ A;  3SB2 A;  2C5N B;  3PIO A;  1ZBJ A;  4QQD A;  2RPN A;  1WDX A;  3FLG A;  4FL6 A;  1WIE A;  4JS4 A;  4ELY C;  2JTF A;  4IUQ A;  1AOJ A;  2KRS A;  4C5E A;  4OVA A;  1NLO C;  3MHX A;  1GFD A;  2BIV A;  2E10 A;  4EOJ B;  5J26 A;  1TFB A;  3CC4 Q;  3A98 A;  4NL3 A;  1JEG A;  4JDS A;  4M7A E;  5IHY A;  3VYG A;  4C92 C;  2IW9 B;  2OAU A;  2DD5 A;  3BDU A;  2CRE A;  4JPB W;  3JCM h;  1G3T A;  4M75 F;  2D1X A;  4CC2 A;  4JX4 A;  3ZFJ A;  2ZCF B;  1N8R R;  2I2L A;  3UF4 A;  1UGS B;  1YN8 A;  2DAQ A;  3QYG B;  4XU0 A;  4KBM B;  1UNH D;  3OW2 S;  4F16 A;  1K4U S;  3A8O B;  2JMA A;  2EJG A;  2CZ1 B;  1YJW T;  2NWM A;  1K9A A;  1VQ6 A;  2FZC B;  4MDW A;  3NDQ A;  3UA6 A;  1BIB A;  1D3B A;  1JJ2 S;  3JCM V;  4C0D C;  2QQ8 A;  3VS5 A;  1KQS A;  3J81 E;  3QXE B;  2FL7 A;  3V7S A;  3EJ1 B;  2HZY A;  2ZPH B;  5HBE B;  3U23 A;  1YIT A;  4HKE A;  1R77 A;  5HBJ B;  3HL8 A;  5I22 A;  3OYY A;  3CCM A;  1YIJ A;  3G6E T;  2QYZ A;  3CCV T;  2DXC B;  1B34 B;  3CCU Q;  2OX7 A;  2GF7 A;  3CCL Q;  1Q82 U;  4M7D C;  2W9F A;  3EH1 A;  1I81 A;  1D3U B;  4JRI A;  5GMK j;  3JCM b;  1WHK A;  2C5O B;  1XOV A;  2GTJ A;  5IT9 E;  5GAM g;  5GMK e;  1ZA2 B;  5GJV B;  4PJO A;  1QCF A;  3X28 B;  5EC7 A;  2KSS A;  4HCC A;  3RMQ A;  1KFZ A;  2E65 A;  2VAS A;  3VS3 A;  1PRM C;  1GRI A;  1I1J A;  4HVW A;  4A4E A;  3CXC S;  4C5I A;  2D8J A;  1S72 A;  1R8O B;  4FYV B;  1AWO A;  1OI9 B;  4AT1 B;  1YCY A;  4RTX A;  4CFM B;  3HRU A;  4AG2 C;  2LQW A;  4TTH A;  3HBL A;  1VYT A;  1NG2 A;  2L0A A;  4HL4 A;  5D6W A;  4M7A D;  2QTX A;  2JM8 A;  2WJ9 A;  3FJP A;  4M78 B;  3VUZ A;  1E6G A;  1IB8 A;  3QZ5 B;  3L2Z A;  2YRC A;  4LNP A;  4F17 A;  2B86 A;  1M3B A;  4WTO B;  1HXD A;  3H0H A;  1VQL T;  2RI5 A;  2X4W A;  1K73 C;  4RG8 A;  4OP0 A;  2RHZ A;  2L5Q A;  2JVV A;  1VOL A;  3VKH A;  3TSW A;  4LDU A;  3OSS C;  1WX6 A;  3M58 A;  2M0Y A;  3GTM S;  3OSV A;  5EFQ B;  1C0M A;  2EYW A;  4F70 B;  4BY7 X;  5HKC A;  1VQK A;  3TNH B;  2CGH A;  4EOL B;  1N6A A;  2C4G B;  2PU9 B;  3JV3 A;  1VIN A;  2XG8 D;  4XTY A;  1VYV A;  3VKG A;  2KI7 A;  4C5G A;  2J6O A;  1YHQ A;  4JX5 A;  4UC4 A;  1W6X A;  1ZHI A;  2O9S A;  4DBH A;  3S3O A;  4AKG A;  4FSS A;  4XTU A;  4Q5W A;  4M75 B;  2K3B A;  1KQS S;  4C0F A;  1WNL A;  3CBO A;  4B9X A;  2QGS A;  4KGV B;  1TG0 A;  3VRZ A;  2RQT A;  3VS7 A;  1OYX A;  3B57 A;  3DLM A;  1JB0 E;  3OW2 P;  4ATO A;  2XDP A;  4FYW B;  1M1K U;  4HCB A;  1NJI U;  1X6O A;  4QT7 A;  4NST B;  4C8Q G;  2BKD N;  3CPF A;  1QVG A;  2FB7 A;  2K9G A;  3V7C A;  5CCA A;  2DXC A;  4BDY A;  4M77 C;  1RLP C;  1N27 A;  3CBP A;  3TSZ A;  1RAE B;  1Q7Y C;  2LT4 A;  4QKU A;  1ZSG A;  1NBE B;  5CEI B;  2PMI B;  4WCI A;  3FEO A;  4DBR A;  1RUW A;  1M27 C;  2BUD A;  4F7U B;  3KUF A;  4M7A F;  1WGS A;  1WYX A;  1O9K B;  1E6H A;  3JCM c;  2GTO A;  1H64 1;  1OZ3 A;  3CD6 Q;  2LCC A;  3QYE A;  1YI2 A;  1BI0 A;  5M9O A;  3QG1 A;  3GPL A;  1K73 R;  4QSH A;  3RDV A;  1G3Y A;  2EFI A;  2H3J A;  2E6N A;  3CME A;  3EG3 A;  2KMG A;  1MMA A;  4DOV A;  3I56 Q;  4BCK B;  1NLP C;  1KD1 C;  2Y90 A;  1GCQ A;  2L3Q A;  4M78 A;  1VQ5 Q;  1WZO A;  4C8Q E;  2K5L A;  1FKM A;  2BZ8 A;  1D0Y A;  2MWO A;  2DJZ A;  2QAS A;  1ZLM A;  1Z9Q A;  1M90 C;  1BIA A;  3G4S T;  3CC2 Q;  2ZPF B;  5GAN g;  2DA9 A;  2AZS A;  2QDJ A;  5L2W B;  1G8X A;  1MNE A;  2JTM A;  2RH2 A;  3O0G D;  4B6M A;  1VQN A;  1ZP2 A;  4NC6 A;  1XNI A;  3REB B;  3CCR Q;  4F04 B;  3CCJ Q;  2CZ6 B;  5IHK A;  2V8I A;  4E7J A;  4PK4 A;  4F6U B;  3N5B B;  2PTK A;  3P8B B;  2BZX A;  3CCQ Q;  2ECZ A;  4MFD A;  4HLQ A;  3QO3 A;  1JST B;  2J06 A;  4M4Z A;  5L23 A;  2FPE A;  3LGL A;  1SF9 A;  5DQV A;  2WAC A;  4M75 A;  2JNG A;  2QQB A;  2VWF A;  4YTL A;  1Q7Y R;  2E4H A;  5KYX A;  5LJ3 g;  1U1S A;  3WVD B;  5FGK B;  4ANJ A;  1PCX A;  1TU0 B;  4ZNX A;  1VQ9 Q;  3A8H B;  1QVG S;  3VS0 A;  4FT2 A;  3MY5 B;  2RI3 A;  4CXA B;  1H4L D;  5I2S A;  4F6S B;  4F7J B;  3QHR B;  3CCV A;  1MND A;  3H0F A;  3L2W A;  4CFN B;  2DE0 X;  2D0Q B;  4CFX B;  2RQV A;  4OGC A;  4EMG A;  1S1N A;  3DLL A;  2YUP A;  3JRZ A;  2RHY A;  2XKO C;  3REA B;  1UGR B;  4KUL A;  1VQ6 T;  1W4S A;  1KD1 R;  1Q82 C;  1EFN A;  3HO8 A;  3EFO A;  4E6R A;  5A0G A;  1SKU B;  2G77 A;  3CC7 Q;  2DTH A;  1BI2 A;  1G3N C;  2KR3 A;  4C8Q D;  4LOC A;  1K8A U;  3SFM A;  2AKK A;  2GQI A;  1JSU B;  2KR6 A;  2AIR B;  3QWX X;  2OTL Q;  2NUP B;  2I53 A;  4A4G A;  4M7A B;  2PZ1 A;  1M90 R;  4CRL B;  2F69 A;  3CCM T;  1YIJ T;  3CCS Q;  4DEX A;  2RI2 A;  4BY1 X;  1TXQ A;  2W96 A;  1OZ2 A;  3G1J A;  1QLB A;  2KXD A;  1UFF A;  3G71 T;  1UGV A;  2CZ0 B;  2YHT A;  4KGZ B;  5KCH A;  5GAN d;  2O31 A;  2B8A A;  4PL6 A;  4M7D F;  1UGP B;  2K5F A;  1NYG A;  3HZJ A;  1SHF A;  1UTI A;  1QVF A;  1JRI A;  2QG9 B;  3V8K A;  1NYF A;  1H28 B;  4RTW A;  2K3Y A;  1S72 T;  4KH1 B;  1G3W A;  4OB1 B;  3PIP A;  1I5L A;  1WJR A;  1Y0M A;  2HSP A;  4VUB A;  2EQI A;  1H24 B;  1QMZ B;  4MMK A;  5EJC A;  1LCK A;  4I3Z B;  2WIP B;  1VQO A;  4BD3 A;  5IDP B;  2W2H A;  3OYN A;  2XIC A;  3EHQ A;  2ESW A;  3JCM g;  1VQ8 A;  4ME7 A;  3CMA Q;  2DTI A;  4BCG B;  4JRK A;  2C5X B;  5GJW B;  4XTV A;  4PJN A;  5GAN h;  1KG1 A;  2X4X A;  3I55 Q;  2QQA A;  2JM9 A;  1OQK A;  2K4Y A;  4PLI A;  2K57 A;  3DTO A;  3DB3 A;  2OTJ Q;  3F70 A;  2UZE B;  3VYG B;  1WFW A;  3HHT B;  1VQK T;  4F6W B;  5CKD A;  1Q82 R;  2EJ9 A;  2YRD A;  3OS5 A;  2BE7 D;  2L3P A;  3OYH A;  4BUG A;  5GAN 6;  5GAN 8;  4BAC A;  2JXB A;  4ORZ A;  1M1K C;  4XU3 A;  1NJI C;  1YHQ T;  3JSC A;  3A8L B;  2V26 A;  4BCJ B;  4FW1 A;  1MGQ A;  2ED0 A;  1OL1 B;  2JW4 A;  1Q86 U;  2FEI A;  3BG5 A;  1D3B B;  4BCN D;  2IIM A;  1JO8 A;  3GIB A;  2LCS A;  3QJY A;  2NUZ A;  3OYM A;  2H8H A;  5LJ5 f;  2WMB B;  1GBQ A;  2L89 A;  2BE9 B;  1EX4 A;  1QCN A;  4DQ2 A;  2QA4 Q;  1AZE A;  1VQ4 Q;  3EH2 A;  4ELJ A;  3RNJ A;  4C0G A;  2A3L A;  2X35 A;  4M7A A;  4J83 A;  1OEB A;  3VYH B;  1UE9 A;  4J9D A;  1OL2 B;  2KQW A;  1HJD A;  1RL2 A;  2KYB A;  4MZT A;  5FU7 B;  3NFC A;  1P92 A;  1I4K 1;  3OBY A;  2DL5 A;  2WSF E;  3EGX A;  1PM3 A;  1YIT Q;  4D8K A;  1BBZ A;  4AKI A;  3MKD A;  1H1P B;  4PJO B;  2RQW A;  2DX1 A;  3QYB A;  2X3W D;  3X26 B;  3PGG A;  1FYN A;  1SEM A;  4CFV B;  4PFO A;  3G4S A;  2Y4Y A;  1LNX A;  3C95 A;  1YI2 T;  4N4H A;  1VQP Q;  3M57 A;  1H8K A;  3H4C A;  1IGU A;  1O75 A;  4JJD A;  3SEM A;  4BY6 B;  1SRM A;  3TCJ A;  1BCO A;  3CME T;  1RI9 A;  3CXC A;  1IHV A;  3JCM W;  1AIS B;  2LC4 A;  2LQ8 A;  2DXU A;  4HNT A;  4KRC B;  3J80 E;  1SHG A;  2DL4 A;  3TEE A;  9ATC B;  4FM4 B;  2DVE A;  2W10 A;  2IW6 B;  3LGF A;  4AMC A;  4J9G A;  4ZN3 A;  3PMT A;  4IMY B;  2D9T A;  4X9D A;  4J9E A;  2O4X A;  2DYI A;  1M1K R;  3S3M A;  1QWF A;  5KYU A;  1NJI R;  1WXU A;  1H25 B;  2CUB A;  3ME9 A;  3MEU A;  3F5X B;  4BI3 A;  2ZPG B;  1E7P A;  3OYL A;  2FHD A;  1X6G A;  1NPR A;  4JJB A;  3AHU A;  1PHT A;  1VQN T;  3VU3 C;  3M0R A;  2LQN A;  4IIM A;  5CKH A;  4ELZ C;  2EQJ A;  4B9W A;  2KRN A;  2DLP A;  2M0O A;  4LUE A;  1UDL A;  1GBR A;  3E1S A;  3M0Q A;  3ZBD A;  4XAX B;  5I11 A;  1OV3 A;  3OQ5 A;  4HCZ A;  2YDL A;  3LW5 E;  3FC3 A;  4C8Q B;  1KQ2 A;  3PNW C;  2RQR A;  3MIA B;  1YFN A;  1VQ7 T;  3PVL A;  4FSX A;  5GMK m;  4OMM A;  4KT0 E;  5GMK h;  2F5T X;  2D8H A;  5J39 A;  4IIO A;  1M9S A;  1N9R A;  3G7Z A;  3UWN A;  1BI1 A;  3V8L A;  2F2X A;  4EMK B;  2P0P A;  4XK8 E;  1N5Z A;  4PJM A;  3QUI A;  2QEX A;  3I35 A;  1W2B P;  3A8G B;  4AFQ C;  1U8R A;  4Z6Y A;  1B07 A;  1K8A C;  4C92 G;  4ZN1 A;  2X3X D;  3M0U A;  2R58 A;  5FLX E;  4JZ4 A;  4MML A;  1H26 B;  2KVQ G;  2VGN A;  1I8F A;  2F2W A;  2UZL B;  3MI9 B;  5IXF A;  1YJN A;  4EC9 B;  3GF5 A;  5KYN A;  3LWI A;  3E9G A;  4E7H A;  4PJJ A;  1GH6 B;  3G71 A;  1VQM Q;  2XD0 A;  3VS6 A;  4PJO C;  3A1P A;  1JQQ A;  5I21 A;  3URG A;  2DL7 A;  4NOY A;  4AFU C;  1W1F A;  2K6D A;  4DBQ A;  2X9H A;  2RA2 A;  1T0J A;  2HQE A;  2BKZ B;  3CPW S;  1QVF P;  4GY5 A;  5GAN 2;  2X1N B;  3G33 B;  1C6V X;  3NTH A;  2J6K A;  2V22 B;  4HNU A;  2DTO A;  3QJ6 A;  2VUB A;  3M55 A;  3QDR B;  1E9H B;  2RN8 A;  4LDV A;  4O6J A;  4XTW A;  3CCE Q;  2OJ2 A;  5L8R E;  2LDM A;  4C92 E;  1NEG A;  2K3X A;  2X4J A;  4M7D G;  3CQT A;  4ROE A;  3JCM J;  4LD9 K;  4MZM A;  1T3S A;  1D0Z A;  2JT4 A;  2LZ6 B;  3SD4 A;  5GAO q;  1UNG D;  1M8V A;  5HQ0 B;  2C0O A;  4RTY A;  4BCM B;  2KRO A;  1WJQ A;  5CKF A;  3CC4 A;  4QVD A;  2RQU A;  1SSH A;  4JLI A;  4RG2 A;  4ESR A;  1YBY A;  1K76 A;  2LCL A;  3M56 A;  1A0N B;  4HVU A;  1YP5 A;  2UZD B;  2L8D A;  2KEA A;  2VVK A;  2LT1 A;  3LLR A;  3H6Z A;  1KHI A;  4CRI A;  1VQO T;  4Z8A A;  6AT1 B;  4NL2 A;  2COY A;  5C6S A;  3J7A F;  1H92 A;  5IN1 A;  3V8J A;  2D6F A;  1ZSZ A;  1VQ8 T;  2ROT A;  2PVG B;  4BCN B;  2DF6 A;  5GAM f;  2HD0 A;  3ZL7 C;  1YJ9 T;  1K8A R;  3THK A;  3KHI A;  3TVT A;  1ZA1 B;  4CC7 A;  3RUX A;  3PFS A;  4C8Q A;  4QQG A;  2PQW A;  1C1A A;  2DFU A;  2F1L A;  4N4G A;  2VV5 A;  5KYX B;  2HCK A;  4E7S A;  1M3A A;  4M7D E;  2H3E B;  2ATC B;  3SWN A;  1B3Q A;  5A0L A;  1FXX A;  1Q86 C;  2CDT A;  4GLM A;  2ZPI B;  1F1B B;  2G3R A;  4EMK A;  2HAX A;  2MAM A;  1U1T A;  1YJW Q;  2XMF A;  2GBQ A;  1N4M A;  4IUU A;  1BU1 A;  1JJ2 P;  1IXD A;  2KMT A;  5I2M A;  3EGD B;  5ACB A;  2LW4 A;  4GBQ A;  4LE9 A;  3CCU A;  2EAY A;  3QHS A;  3CCL A;  4Y92 A;  2LJ3 A;  4KUI A;  2R57 A;  3VS2 A;  3UDC A;  1AEY A;  2FZK B;  3EFO B;  4XQ3 A;  1JXO A;  1X27 A;  5IDN B;  3G6E Q;  4ZGJ B;  1B7T A;  2DXT A;  3CCV Q;  1K0S A;  2ZZD B;  1I07 A;  1Y71 A;  3M9Q A;  4C92 D;  1MV3 A;  1GXI E;  2CH4 W;  2YUN A;  4MZP A;  1Y57 A;  3MP6 A;  2JJ9 A;  1DJ7 B;  2BZY A;  1G3S A;  4BCO B;  4F7L B;  2F5K A;  4C5H A;  3TNI B;  1XO2 A;  1GCQ C;  3HRT A;  1GUX B;  3S6W A;  1X2Q A;  4M78 C;  2YLB A;  3CXC P;  4OMF B;  2EYZ A;  3QHW B;  3OYF A;  2EGC A;  3TU4 K;  4NS5 A;  3LWH A;  2YSQ A;  1CKB A;  1LJO A;  1LVK A;  2DK3 A;  4M77 G;  2LP5 A;  2SRC A;  1Y07 A;  4JS5 A;  3OYG A;  5KYY A;  1WJS A;  1JU5 C;  3VJP A;  5HBH B;  5CYI B;  2QQS A;  2DJQ A;  2QFZ A;  1UHC A;  2KAF A;  1CSK A;  2JN0 A;  1JKW A;  1GL5 A;  1VQL Q;  2E64 A;  3NHN A;  4X9C A;  2YXY A;  5CQX A;  4BI4 A;  2R7G A;  4M7D D;  2EQU A;  3OYA A;  2CP6 A;  3DL1 A;  2YWW A;  4BE2 A;  4LDY A;  1AWX A;  1Q86 R;  2E5Q A;  1K9M U;  2GFU A;  2KE9 A;  3GP8 A;  1ABO A;  2R5A A;  4OMN A;  4M75 C;  4Y91 A;  1AWJ A;  4II5 B;  2E5K A;  1WXT A;  1W98 B;  2A0F B;  1VQ7 A;  4MFE A;  5FRM A;  4BCF B;  5GAM e;  2LMJ A;  4M77 E;  2CP3 A;  3HFN A;  2JUF A;  4HVV A;  2DBM A;  2BS4 A;  4N0A C;  2QDL A;  2P0Q A;  2CKK A;  2JGZ B;  3WVE B;  3PO3 S;  2CUD A;  1KQS P;  4P5N A;  1IGQ A;  5FWC A;  4R56 A;  1H3H A;  1QVP A;  2A28 A;  2KYM A;  3ULR B;  4C92 F;  3OYE A;  5CKE A;  1WQ7 A;  3MP8 A;  4JLG A;  1ZUK A;  3NMZ C;  2QF7 A;  3EGD A;  4DEY A;  1OX8 A;  3TNW B;  5LQF B;  5DQW A;  2BS3 A;  1U3O A;  3BW1 A;  3BG9 A;  4R0K A;  1EIF A;  4N4I A;  1I5O B;  2L2P A;  2AKL A;  2CZ7 B;  2CP5 A;  2FPF A;  4AFS C;  5HY6 A;  1M1F A;  5FWB A;  2IW8 B;  1ZBX A;  5GAN f;  4FCY A;  3NTI A;  1BYM A;  3X24 B;  4UN0 A;  2L3R A;  2ZZD A;  2OAW A;  2CSI A;  1PRL C;  2HEQ A;  5HNB B;  5ICP B;  4O5V A;  1PKS A;  3RGF B;  2QEX T;  5GAO n;  2V8J A;  2FG0 A;  2EBP A;  4EOS B;  2DME A;  5EG2 A;  2ZGW A;  3DKM A;  3MCA B;  3OYK A;  3FRN A;  3QDF A;  1GUX A;  1YJN T;  2LVM A;  5J3B A;  3MP1 A;  3EGX B;  4A4F A;  1GCP A;  1VQ5 A;  4QW2 A;  3EG0 A;  2ED1 A;  2ZPE B;  2VC8 A;  5IHN A;  4EIK A;  1X01 A;  2GNC A;  5LJ3 f;  4F7U G;  1AD5 A;  1HD3 A;  2DYB A;  3DJB A;  1ZX6 A;  4LUD A;  1FX7 A;  2BPM B;  3CC2 A;  3UT1 A;  4AKH A;  4BDZ A;  4EDU A;  5FU6 B;  2MIO A;  1PNJ A;  5FRN A;  4J9H A;  1PD1 A;  2LRQ A;  1QQJ A;  2AHJ B;  2C6T B;  2RNA A;  3EG1 A;  1WHG A;  5CQY A;  4JUV A;  1TUC A;  3H0I A;  4M77 D;  3RKY A;  2EQM A;  2EIF A;  3G4S Q;  2PHG A;  1M2O A;  2E1H A;  4YOO A;  1CKA A;  4Y28 E;  1FWZ A;  4ZTJ A;  3GBQ A;  4X1V A;  3CCQ A;  4WF2 A;  1YJ9 A;  4EOI B;  4LN2 A;  3OB9 A;  2O4X B;  5AT1 B;  3M0S A;  5KYU B;  1WLP B;  2GQV A;  3EFR A;  3M0P A;  1M30 A;  1OIU B;  2E12 A;  1HYO A;  2BS2 A;  2MPX C;  1UUE A;  2K79 A;  2LNV A;  2M51 A;  4J9F A;  3M0T A;  3VV0 A;  4FIB A;  3CC4 T;  1ZQ1 A;  2E3H A;  3EG9 B;  4F7U E;  2YLC A;  3M4G A;  5DLQ E;  3FJ5 A;  1T3L A;  2CS7 A;  2C5V B;  1BKB A;  4JZ3 A;  4CFU D;  3MEW A;  2WSE E;  1V1C A;  2F2V A;  1KC8 U;  1X69 A;  3QBY A;  3POM A;  3GNF B;  1UHF A;  1QVG P;  4XU1 A;  1MMN A;  2QAZ A;  2I0N A;  4E2F B;  3X20 B;  3O8V A;  1QCO A;  4CFW B;  2DIG A;  3O5Z A;  1VUB A;  3EAE A;  1OIY B;  5AYF A;  4A4H A;  5IXB A;  3QZ9 B;  3DB4 A;  1V76 A;  5GMK l;  2Y4X A;  1ENW A;  4J7I A;  4M7A C;  5A0D A;  2HNI A;  1VQ6 Q;  4ZTF A;  5KH6 A;  1JBM A;  3BLR B;  2QDY B;  4GLK A;  1H1R B;  2PVO B;  4BE0 A;  3JCM f;  3KBG A;  4HXJ A;  3CCU T;  1BI3 A;  4C0D B;  4EPC A;  2GCX A;  3CCL T;  5BNJ B;  1WHH A;  4E7K A;  2PVD B;  2WSC E;  4M77 F;  2DL8 A;  1UB4 A;  2G6F X;  4J7F A;  5DY9 A;  1M4Z A;  1MHN A;  3CCM Q;  1YIJ Q;  1QWE A;  1VYU A;  3RMS A;  4DOW A;  1H1S B;  1WHL A;  1QP3 A;  2FPD A;  3DDQ B;  4OGR B;  4M7D B;  2PJQ A;  1FMW A;  3G71 Q;  2MK5 A;  2EKO A;  1TUG B;  5LJ3 e;  5LJ5 d;  1AHJ B;  4DBF A;  3CPW A;  2IVW A;  3PT9 A;  3UAT A;  1PD0 A;  3OYC A;  4FX3 B;  3DDP B;  3QYH B;  3QKJ A;  1FVV B;  2NLU A;  1S72 Q;  2JTE A;  5IH2 A;  4M78 F;  3MEV A;  1UNL D;  5GMK i;  1YWP A;  1UEC A;  3CMA A;  2MYS A;  1TOV A;  5ECA A;  2FZG B;  4PJL A;  3JB9 G;  2K7A A;  3A8M B;  3PMI A;  2HBW A;  4DA4 A;  1K9M C;  3I55 A;  4E47 A;  2CP2 A;  2ENM A;  2EWN A;  1SSF A;  3R6N A;  1Y96 A;  2X51 A;  2DIQ A;  2O2O A;  3C94 A;  2AK5 A;  2M9U A;  2M1H A;  1PSE A;  1M5Q 1;  2V1Q A;  2VB6 A;  4RTZ A;  2M02 A;  3EG9 A;  3HSB A;  1G2B A;  5FRO A;  2CP0 A;  3E19 A;  4D8D A;  5LJ5 h;  5GAN 4;  1G83 A;  3JB9 I;  1ZSZ B;  1PC0 A;  3EG2 A;  5I5Z B;  3T9N A;  1IRE B;  4RCB A;  4FYX B;  3VKI A;  2O88 A;  1N9S A;  3NGP A;  1H3Z A;  1RLQ C;  2DRK A;  4OMP A;  2HSE B;  3L1A A;  1VQK Q;  1EZZ B;  2EJF A;  3HFO A;  2Z0W A;  1G5V A;  2LJ1 A;  1KK7 A;  4C92 A;  3ASK A;  1KSW A;  2MMP A;  1OKV B;  3I9Q A;  2DET A;  3SWN B;  1F5Q B;  2ABL A;  2O01 E;  2EKH A;  4LD6 A;  1YNZ A;  1UG1 A;  1YHQ Q;  5LJ5 j;  4PLL A;  2QA4 A;  2IVX A;  2JOY A;  3EHR A;  1VQ4 A;  5LJ5 e;  2UZB B;  2DRM A;  4ROC A;  2AT1 B;  2RM4 A;  3OYD A;  2RK1 A;  3VS4 A;  3BFM A;  1C9B A;  2COZ A;  2KT1 A;  2DPP B;  4KGX B;  1Q81 U;  1NE8 A;  2QGG A;  5FU7 C;  2RHX A;  4RUG A;  4MDX A;  4EOQ B;  4F7S B;  1OPL A;  2J05 A;  2MI6 A;  1KHC A;  1H27 B;  2E70 A;  1OU9 A;  3JCM e;  4JX6 A;  2XK0 A;  1KIK A;  3RKX A;  2DXB B;  4EOR B;  3VUB A;  2P0K A;  2XDD A;  1LOJ A;  2HQH A;  5HK0 A;  4Z02 A;  4F7U F;  1GFC A;  2BTT A;  2J6F A;  4OB2 B;  2K2M A;  3CD6 T;  5GAN 7;  2QQR A;  4M77 B;  2XID A;  3Q1J A;  4BY6 C;  3OS2 A;  1OUL A;  1VQP A;  1RAH B;  4J5Y A;  4M7D A;  1X43 A;  1WA7 A;  1TWB A;  1BCM A;  1K9M R;  3ER0 A;  2LX7 A;  5KCO A;  1LPL A;  1OU8 A;  3RES A;  2RB6 A;  4OGE A;  4Z89 A;  2HDA A;  2J7I A;  2MOX A;  3I56 T;  5LMK B;  1YI2 Q;  2CH4 A;  4IUT A;  1VQ5 T;  4BCP B;  4L6V 5;  3CME Q;  3FB9 A;  3DOG B;  1YCS B;  1NM7 A;  3OS0 A;  2EYX A;  5KYY B;  4HNV A;  2EUF A;  4PJO G;  4EC8 B;  2JS0 A;  2IPO B;  4PKC C;  3MY1 B;  2RHI A;  1M3C A;  3JCM X;  1R0C B;  4KRD B;  3P8H A;  3INZ A;  1U5S A;  3OMG A;  3CC2 T;  3R6O A;  3HKS A;  2K2V A;  3JCM P;  1UJY A;  2DZC A;  2XHC A;  2NYS A;  3M5A A;  2I40 B;  1Q95 G;  4Z88 A;  1AWW A;  3M53 A;  2P84 A;  3SHW A;  2XDB A;  3RR6 A;  4OB0 B;  4MIM A;  1D0X A;  4EON B;  4CFU B;  3CCR T;  3BY7 A;  1TSF A;  3MO8 A;  3CCJ T;  2PUO B;  2KBT A;  3JB9 D;  2KNB B;  1ZSZ C;  2YUQ A;  3LH0 A;  2DEQ A;  2FVU A;  1OGU B;  3M4Y A;  3HPW A;  3M59 A;  2EYQ A;  3V7R A;  4IUP A;  5HK3 A;  3L2U A;  3LH5 A;  4OMQ A;  4J6Y A;  3CCQ T;  2DER A;  4BCQ D;  4RTT A;  1VA7 A;  1VQN Q;  4C8Q C;  2G9X B;  3MPU B;  5DLO A;  5C0M A;  2LJ0 A;  5GAO r;  2HBP A;  2V8K A;  1FIN B;  3SWN C;  3S3N A;  4HCK A;  2RJD A;  1KC8 C;  3BHT B;  4OR5 B;  2MCN A;  4ZGE B;  2HL3 A;  4EMK C;  4F7N B;  4RMO A;  1D1B A;  4PJO E;  1VQ9 T;  2YT6 A;  2KK4 A;  1OX9 A;  1VQ7 Q;  2ZPB B;  4J9C A;  4BE1 A;  3HB9 A;  3CEY A;  1UEB A;  1U06 A;  1W70 A;  3L2R A;  4CC3 A;  4M6V A;  3I5S A;  4F14 A;  3JAM E;  4BB7 A;  5GAO p;  4C0Z A;  1VQM A;  4FT4 A;  4BBR M;  4A54 A;  4QVZ A;  3BE3 A;  2DBK A;  1HK9 A;  1QKW A;  3AT1 B;  2OI3 A;  2DXB A;  3C12 A;  5GAM d;  4CC4 B;  2ROL A;  4FU6 A;  1NZ9 A;  5CAI A;  4XTX A;  3CC7 T;  4PNO A;  3EOC B;  1B34 A;  3RIR A;  2OTL T;  2P4T A;  1H1Q B;  3UA7 A;  1M2V B;  1OPK A;  4M77 A;  3QWY A;  4A53 A;  3JB9 J;  1SRL A;  1AVZ C;  3H9N A;  3LX7 A;  5HCK A;  1X75 C;  1N8R U;  2DL3 A;  3M54 A;  3CCS T;  4D6W A;  2MWP A;  1AD6 A;  4LDX A;  2C0I A;  2HKQ B;  2DKG A;  1FMK A;  2VXF A;  1XJW B;  3VRY A;  3CPW P;  1M1G A;  2WEV B;  3CCE A;  2EQK A;  2E41 A;  4BI8 B;  1OKW B;  3IQL A;  3QSU A;  3I5R A;  2CSQ A;  3JB9 F;  2VGM A;  4L59 A;  2RJF A;  2RD1 A;  4JJN K;  4AFZ C;  5KYW B;  4AG1 C;  5GAM h;  1D1C A;  1NPP A;  4BBS M;  5KE2 A;  4KUD K;  1KC8 R;  1R0B G;  4PJO D;  3GLX A;  1BK2 A;  3PE0 A;  1JOW A;  1UJ0 A;  4ELL A;  2FO0 A;  4M78 G;  2VXE A;  3CMA T;  2VYT A;  3OA6 A;  2KT8 A;  1WPY A;  5GAM j;  5GAN 3;  3TW6 A;  1VQO Q;  3I55 T;  4RTV A;  2P4R A;  2CP7 A;  5IHI A;  3HRS A;  1ACM B;  4J6X A;  4R55 A;  1D1A A;  2EPD A;  2GGR A;  2CT4 A;  2QK0 A;  4CI0 C;  5FW9 A;  2OTJ T;  1VQ8 Q;  1RAF B;  2SEM A;  2CCI B;  3BHU B;  3RKW A;  1Z9Z A;  2HQX A;  1K1Z A;  1T0H A;  3D7S B;  1YJ9 Q;  2IN3 A;  1O9S A;  4QVC A;  3MJX A;  3KXT A;  1TH7 A;  2M16 A;  2B9R A;  1PG5 B;  1WQW A;  3NPF A;  5CIU A;  2PK2 A;  1YJW A;  3JCM Q;  2CT3 A;  4J9I A;  4Y72 B;  1VIF A;  2EGA A;  4AI6 A;  2QQ9 A;  2RJC A;  5DM7 R;  4OB3 B;  3EID B;  2KGT A;  1ARK A;  1OOT A;  1BB9 A;  1VIE A;  1WXB A;  2C06 A;  1PSF A;  1ZUU A;  4LXC A;  1AZG B;  2JZ2 A;  4FW2 A;  2E3I A;  2KXC A;  2QTV A;  1WHJ A;  4J8O A;  2A37 A;  4N0A A;  2DZ9 A;  2EVR A;  3OY9 A;  1XTD A;  3A5Z B;  2QXF A;  1Q81 C;  1BU2 A;  3WXM B;  4M75 G;  1QMC A;  2LNH B;  2JS2 A;  4M78 E;  2W99 A;  3OBW A;  3G6E A;  1K0X A;  3OYB A;  2WHB B;  4BCH B;  3CD6 A;  4E7L A;  2EYY A;  4HT9 A;  1KXU A;  1X2K A;  2QA4 T;  1VQ4 T;  3OYJ A;  1M2V A;  4JJC A;  2DVJ A;  2RHU A;  4RTU A;  2COW A;  3QII A;  1JXM A;  2XI9 A;  4F7U A;  4JRQ A;  2PNI A;  2PK9 B;  3L42 A;  2VKN A;  3EGU A;  3I56 A;  1O9K A;  1URC B;  1YWO A;  2A7Y A;  2YUO A;  2DD4 B;  1VOM A;  3PVQ A;  1W2B A;  2IG0 A;  1ZUY A;  2D0N A;  4PFZ A;  5GAO l;  1YIT T;  3QWL A;  5HVY B;  4XU2 A;  4LDW A;  2K5I A;  4FYY B;  3MEA A;  3UPU A;  4G6L B;  2MF2 A;  2UUE B;  4PJO F;  1Y7X A;  2EW3 A;  3E2U A;  5CVI A;  1TS9 A;  5D7U A;  4X34 A;  1TTH B;  2WPA B;  2KDS A;  2C0T A;  5GAN 5;  3C0C A;  5KYW A;  3BLQ B;  2RMO A;  1VQP T;  4M75 E;  1QW1 A;  1QLY A;  1RAG B;  1RAB B;  2PUK B;  1VQL A;  2CJM B;  2EGE A;  4OF1 A;  3PTA A;  1J3T A;  3CCR A;  2FRW A;  4KRT A;  3BG3 A;  3CCJ A; 
#chains in the Genus database with same CATH homology
 2LDM A;  5IAY A;  2NLU A;  4C92 E;  4V2S A;  2KY9 A;  2X4J A;  2K3X A;  4M7D G;  4M78 F;  3JCM J;  4LD9 K;  3MEV A;  1M90 C;  1BIA A;  4MZM A;  5GMK i;  3G4S T;  5D6X A;  5LJ5 g;  3CMA A;  4TVR A;  3BDL A;  3SD4 A;  2ZPF B;  5GAO q;  3JB9 G;  5GAN g;  4QQ6 A;  1M8V A;  5D6Y A;  3A8M B;  1XQH A;  3PMI A;  2QDJ A;  4J6W A;  4IKF A;  4DA4 A;  2RH2 A;  2DO3 A;  2JTM A;  1V29 B;  4L5G A;  4ZGD B;  3I55 A;  1K9M C;  3MET A;  4E47 A;  2GFA A;  2EWN A;  1WJQ A;  1SSF A;  1VQN A;  5CKF A;  3CC4 A;  1XNI A;  4NC6 A;  1Y96 A;  2DIQ A;  4JLI A;  4RG2 A;  4QVD A;  1Y96 B;  1YBY A;  3C94 A;  1K73 U;  2M9U A;  2CZ6 B;  2M1H A;  2V8I A;  2LCL A;  3M56 A;  4E7J A;  1PSE A;  2L8D A;  1M5Q 1;  2QI2 A;  3OMC A;  2LT1 A;  3LLR A;  3N5B B;  3H6Z A;  1KHI A;  5LJ3 d;  4CRI A;  1VQO T;  3RER A;  3HSB A;  5FRO A;  3P8B B;  1VQ9 A;  4NL2 A;  1RI0 A;  4M78 D;  3E19 A;  3FDR A;  4MFD A;  4A4K A;  5C6S A;  4HLQ A;  5LJ5 h;  3J7A F;  3QO3 A;  5IN1 A;  1OI1 A;  3V8J A;  5GAN 4;  2D6F A;  1VQ8 T;  4XTZ A;  3JB9 I;  2XU8 A;  2PVG B;  2RJE A;  5GAM f;  2HD0 A;  4RKU E;  4II1 A;  3LGL A;  3T9N A;  1IRE B;  1YJ9 T;  5LL6 S;  2WAC A;  4M75 A;  4IUR A;  4RCB A;  3KHI A;  3P8D A;  3SDZ A;  3VKI A;  3RUX A;  1N9S A;  2JNG A;  2QQB A;  1H3Z A;  3PFS A;  1IZ6 A;  3LYI A;  4YTL A;  4C8Q A;  3L1A A;  4HT8 A;  4QQG A;  2EJF A;  2PQW A;  3HFO A;  1G5V A;  5LJ3 g;  1U1S A;  3WVD B;  4N4G A;  2DD5 B;  2VV5 A;  4C92 A;  4M7D E;  3ASK A;  4C92 B;  2MMP A;  3SWN A;  3A8H B;  5A0L A;  3OYI A;  3SWN B;  1QVG S;  2CYZ B;  1FXX A;  2O01 E;  4C8Q F;  3TW7 A;  3QPH A;  1Q86 C;  4LD6 A;  2ZPI B;  4FT2 A;  2G3R A;  2RI3 A;  2YRV A;  4EMK A;  3HP9 A;  5LJ5 j;  3CC7 A;  2MAM A;  1U1T A;  2HAX A;  5I2S A;  4PLL A;  5GAN j;  2QA4 A;  3CCV A;  2JOY A;  3GNG A;  4IUU A;  1VQ4 A;  5LJ5 e;  3OY9 A;  3L2W A;  4IUV A;  2KMT A;  2OTL A;  2D0Q B;  4OGC A;  3GOX A;  5I2M A;  4EMG A;  5GAN e;  3DLL A;  3L2V A;  2RM4 A;  3OYD A;  2RK1 A;  3CCU A;  3BFM A;  2EAY A;  5LJ3 h;  3FIF A;  3JRZ A;  2RHY A;  2XKO C;  3QHS A;  5CO7 A;  2DPP B;  1W2B S;  1Q81 U;  1UGR B;  1NE8 A;  3CCL A;  5FU7 C;  3OW2 A;  2RHX A;  4KUL A;  1UGQ B;  5A2Q E;  5GAO m;  3CCS A;  4KUI A;  1VQ6 T;  2R57 A;  4MDX A;  1W4S A;  4M75 D;  2MI6 A;  1Q82 C;  3UDC A;  3HO8 A;  1KHC A;  2RK2 A;  4EMH A;  5A0G A;  5CR2 A;  2E70 A;  2G77 A;  2LX9 A;  2DTH A;  1BI2 A;  4XQ3 A;  3OS1 A;  4C8Q D;  3JCM e;  4JX6 A;  4LOC A;  2DD4 A;  2XK0 A;  3NTK A;  3SFM A;  3RKX A;  1K8A U;  2DXB B;  4ZGJ B;  1JJ2 A;  1QP2 A;  2DXT A;  3VUB A;  1VQM T;  2ZZD B;  1Y71 A;  2P0K A;  2KR6 A;  3CBM A;  1KQ1 A;  1LOJ A;  3M9Q A;  4C92 D;  5HK0 A;  2XDD A;  1Q7Y U;  1N8R C;  3CCJ A;  4Z02 A;  4F7U F;  1GXI E;  3H8Z A;  3ZEH A;  4A4G A;  4OB2 B;  2RO0 A;  4MZP A;  4M7A B;  4E7I A;  3MP6 A;  3EFS A;  1DJ7 B;  3CD6 T;  5GAN 7;  2QQR A;  2F69 A;  4M77 B;  2XID A;  1G3S A;  3Q1J A;  4BY6 C;  3OS2 A;  3CCM T;  1VQP A;  1YIJ T;  2F5K A;  4J5Y A;  4M7D A;  5LJ3 j;  2RI2 A;  5FU6 C;  2X4Y A;  4C5H A;  2E6Z A;  1OZ2 A;  3ER0 A;  1QVF S;  1QLB A;  3HRT A;  5KCO A;  3S6W A;  4M78 C;  2YLB A;  3RES A;  3G71 T;  3JB9 H;  4OMF B;  2CZ0 B;  2RB6 A;  2YHT A;  4OGE A;  5KCH A;  5GAN d;  2B8A A;  4PL6 A;  4M7D F;  3OYF A;  2LTO A;  1UGP B;  4NS5 A;  3I56 T;  3TU4 K;  2K5F A;  3LWH A;  2FYK A;  4M7A G;  3C4S A;  3HZJ A;  1LJO A;  2DK3 A;  4M77 G;  1QVF A;  1JRI A;  5KE3 A;  4IUT A;  1VQ5 T;  4L6V 5;  4JRP A;  3CCE T;  5CK9 A;  3X25 B;  3V8K A;  3FB9 A;  1Y07 A;  3E9F A;  4JS5 A;  3OYG A;  1KD1 U;  2K3Y A;  3JCM d;  4RCC A;  1WJS A;  1S72 T;  3OS0 A;  4HNV A;  1G3W A;  4PJO G;  4OB1 B;  3VJP A;  2QQS A;  4PKC C;  3PIP A;  3TRE A;  2RHI A;  1I5L A;  3JCM X;  2QFZ A;  2R5M A;  2KAF A;  1WJR A;  2JN0 A;  3INZ A;  3OMG A;  3P8H A;  4VUB A;  2LQK A;  4MMK A;  3L2Q A;  4HA8 A;  3CC2 T;  3R6O A;  5EJC A;  2E64 A;  4X9C A;  3HKS A;  2K2V A;  5CKB A;  5CQX A;  4BI4 A;  2DZC A;  2XHC A;  3JCM P;  3M5A A;  1VQO A;  4BD3 A;  1M90 U;  4M7D D;  2EQU A;  3OYN A;  3M53 A;  2XIC A;  2XDB A;  2OTJ A;  3OYA A;  4OB0 B;  4MIM A;  3DL1 A;  4BE2 A;  3SB2 A;  3CCR T;  4LDY A;  3PIO A;  3BY7 A;  3JCM g;  3MO8 A;  3CCJ T;  4QQD A;  2E5Q A;  1VQ8 A;  2PUO B;  3FLG A;  3JB9 D;  4FL6 A;  4ME7 A;  2GFU A;  2DTI A;  3GP8 A;  4JRK A;  4ELY C;  4JS4 A;  1K9M U;  2JTF A;  3LH0 A;  2R5A A;  4IUQ A;  2DEQ A;  2FVU A;  3M4Y A;  3HPW A;  3M59 A;  2EYQ A;  4XTV A;  4IUP A;  3V7R A;  4OVA A;  4C5E A;  5HK3 A;  3L2U A;  3MHX A;  4M75 C;  4Y91 A;  2X4X A;  4J6Y A;  2BIV A;  5GAN h;  3CCQ T;  1KG1 A;  2E10 A;  2QQA A;  5J26 A;  4C8Q C;  4NL3 A;  1VQ7 A;  4MFE A;  4JDS A;  5FRM A;  2K4Y A;  4M7A E;  4PLI A;  5C0M A;  2K57 A;  5GAM e;  5DLO A;  3DB3 A;  3F70 A;  3VYG A;  5GAO r;  4C92 C;  2HBP A;  3VYG B;  2OAU A;  4M77 E;  2V8K A;  2DD5 A;  3HFN A;  3BDU A;  3SWN C;  2JUF A;  3HHT B;  3S3N A;  2RJD A;  1KC8 C;  1VQK T;  3JCM h;  1G3T A;  4M75 F;  2BS4 A;  2EJ9 A;  4N0A C;  5CKD A;  3OS5 A;  2P0Q A;  2CKK A;  3WVE B;  4ZGE B;  4JX4 A;  4EMK C;  4RMO A;  3OYH A;  3ZFJ A;  4BUG A;  2ZCF B;  4P5N A;  4PJO E;  1VQ9 T;  5GAN 6;  5GAN 8;  2I2L A;  4R56 A;  1UGS B;  1QVP A;  2DAQ A;  4BAC A;  4C92 F;  3OYE A;  3QYG B;  4XU0 A;  4KBM B;  2KK4 A;  1M1K C;  3OW2 S;  5CKE A;  3A8O B;  4XU3 A;  1NJI C;  1YHQ T;  1WQ7 A;  3JSC A;  3A8L B;  3MP8 A;  4JLG A;  2EJG A;  2CZ1 B;  2ZPB B;  1YJW T;  4BE1 A;  2QF7 A;  3HB9 A;  3CEY A;  1UEB A;  1VQ6 A;  4MDW A;  1MGQ A;  3L2R A;  1Q86 U;  2BS3 A;  1BIB A;  1D3B A;  3BW1 A;  1JJ2 S;  3BG9 A;  3BG5 A;  1D3B B;  1EIF A;  3JCM V;  4C0D C;  2QQ8 A;  4M6V A;  4N4I A;  3GIB A;  1KQS A;  3JAM E;  3QJY A;  4BB7 A;  3J81 E;  2CZ7 B;  3QXE B;  4C0Z A;  5GAO p;  3OYM A;  1VQM A;  4FT4 A;  5LJ5 f;  4BBR M;  1M1F A;  5HY6 A;  2FL7 A;  3V7S A;  2L89 A;  4A54 A;  4QVZ A;  1ZBX A;  2ZPH B;  5GAN f;  3NTI A;  1HK9 A;  1BYM A;  5GAM d;  3X24 B;  2DXB A;  3C12 A;  4HKE A;  1YIT A;  4DQ2 A;  2L3R A;  2ZZD A;  4FU6 A;  1NZ9 A;  5CAI A;  4XTX A;  3CC7 T;  3HL8 A;  4PNO A;  4O5V A;  3OYY A;  3CCM A;  4ELJ A;  1YIJ A;  3G6E T;  4C0G A;  2QEX T;  1B34 A;  2A3L A;  2X35 A;  3RIR A;  5GAO n;  2DXC B;  1B34 B;  2V8J A;  3CCV T;  4M7A A;  4J83 A;  2OTL T;  2GF7 A;  2P4T A;  5EG2 A;  2ZGW A;  3VYH B;  3JB9 J;  4M77 A;  4A53 A;  2KQW A;  1Q82 U;  4M7D C;  1RL2 A;  1I81 A;  3DKM A;  3LX7 A;  3MCA B;  4MZT A;  4JRI A;  5GMK j;  3JCM b;  5FU7 B;  1X75 C;  3OYK A;  3NFC A;  1P92 A;  1I4K 1;  1XOV A;  3OBY A;  5IT9 E;  5GAM g;  1N8R U;  2WSF E;  3FRN A;  3M54 A;  3CCS T;  4D6W A;  5GMK e;  2LVM A;  5J3B A;  2MWP A;  3MP1 A;  1YJN T;  4LDX A;  2DKG A;  4PJO A;  4AKI A;  3X28 B;  4A4F A;  4PJO B;  2VXF A;  2KSS A;  4HCC A;  3RMQ A;  1VQ5 A;  3QYB A;  1M1G A;  3X26 B;  4QW2 A;  3CCE A;  2E65 A;  3PGG A;  2EQK A;  4A4E A;  3CXC S;  2ZPE B;  2E41 A;  4BI8 B;  4C5I A;  3QSU A;  2VC8 A;  3G4S A;  1S72 A;  2Y4Y A;  1LNX A;  1R8O B;  3C95 A;  1X01 A;  5LJ3 f;  4F7U G;  3JB9 F;  2VGM A;  4L59 A;  1YI2 T;  2RJF A;  1YCY A;  4N4H A;  3M57 A;  1O75 A;  3H4C A;  4BY6 B;  1FX7 A;  2RD1 A;  3HRU A;  3TCJ A;  4JJN K;  3UT1 A;  4AKH A;  4BDZ A;  4EDU A;  3CME T;  3CC2 A;  5FU6 B;  3CXC A;  3HBL A;  5FRN A;  4HL4 A;  5D6W A;  2LRQ A;  5GAM h;  3JCM W;  2AHJ B;  4M7A D;  2LC4 A;  2QTX A;  1NPP A;  2WJ9 A;  2LQ8 A;  3FJP A;  4JUV A;  4M78 B;  5CQY A;  3VUZ A;  2DXU A;  4HNT A;  4M77 D;  3J80 E;  3RKY A;  2EQM A;  3QZ5 B;  3L2Z A;  3TEE A;  2EIF A;  4FM4 B;  2DVE A;  3LGF A;  4BBS M;  5KE2 A;  4KUD K;  1HXD A;  2E1H A;  1VQL T;  4ZN3 A;  2RI5 A;  4Y28 E;  2X4W A;  1K73 C;  1FWZ A;  4RG8 A;  4ZTJ A;  3PMT A;  4OP0 A;  4PJO D;  2D9T A;  3CCQ A;  4WF2 A;  3GLX A;  4X9D A;  2RHZ A;  2L5Q A;  2JVV A;  3VKH A;  4LDU A;  3OSS C;  1YJ9 A;  2O4X A;  4M78 G;  3OB9 A;  2O4X B;  3S3M A;  2VXE A;  3CMA T;  2VYT A;  3OA6 A;  2GQV A;  3M58 A;  3EFR A;  3OSV A;  1WPY A;  5GAM j;  2E12 A;  3ME9 A;  2BS2 A;  3MEU A;  5GAN 3;  3TW6 A;  5HKC A;  2LNV A;  4BI3 A;  1E7P A;  2ZPG B;  2CGH A;  2FHD A;  3OYL A;  1NPR A;  1N6A A;  3I55 T;  1VQK A;  3AHU A;  3HRS A;  4J6X A;  3VV0 A;  4R55 A;  1VQN T;  4FIB A;  3VU3 C;  3CC4 T;  2PU9 B;  1ZQ1 A;  5CKH A;  2XG8 D;  4ELZ C;  2EQJ A;  4XTY A;  4B9W A;  4CI0 C;  4F7U E;  2OTJ T;  2YLC A;  3M4G A;  3VKG A;  4C5G A;  3RKW A;  2HQX A;  2M0O A;  5DLQ E;  1O9S A;  4QVC A;  3KXT A;  1TH7 A;  2M16 A;  3E1S A;  2CS7 A;  1YHQ A;  4JX5 A;  1WQW A;  4UC4 A;  1ZHI A;  5CIU A;  3S3O A;  1YJW A;  3JCM Q;  1BKB A;  4AKG A;  3ZBD A;  4XTU A;  4Q5W A;  4XAX B;  5DM7 R;  1VIF A;  4M75 B;  4AI6 A;  2QQ9 A;  2RJC A;  3OQ5 A;  3MEW A;  4OB3 B;  4HCZ A;  2WSE E;  1KQS S;  4C0F A;  1WNL A;  3LW5 E;  3FC3 A;  3CBO A;  4B9X A;  4C8Q B;  1VIE A;  3QBY A;  3GNF B;  1PSF A;  1KC8 U;  3PNW C;  2C06 A;  1KQ2 A;  1VQ7 T;  2JZ2 A;  4XU1 A;  4FSX A;  5GMK m;  4KT0 E;  5GMK h;  2F5T X;  1OYX A;  3DLM A;  1JB0 E;  4J8O A;  4N0A A;  5J39 A;  2DZ9 A;  1M9S A;  3X20 B;  1XTD A;  1N9R A;  2XDP A;  3A5Z B;  3G7Z A;  3O8V A;  2DIG A;  3UWN A;  1BI1 A;  2QXF A;  1Q81 C;  1M1K U;  3V8L A;  1VUB A;  4HCB A;  3WXM B;  1NJI U;  4M75 G;  3EAE A;  1X6O A;  4EMK B;  5AYF A;  4A4H A;  2P0P A;  4M78 E;  4XK8 E;  3QZ9 B;  3DB4 A;  3OBW A;  3QUI A;  3G6E A;  2QEX A;  4C8Q G;  3OYB A;  2BKD N;  3A8G B;  3CPF A;  5GMK l;  1U8R A;  1QVG A;  4Z6Y A;  2Y4X A;  2FB7 A;  4J7I A;  4M7A C;  3CD6 A;  4E7L A;  1K8A C;  3V7C A;  4C92 G;  4ZN1 A;  5A0D A;  2HNI A;  5FLX E;  2R58 A;  5CCA A;  4HT9 A;  2DXC A;  4BDY A;  4M77 C;  2QA4 T;  3CBP A;  1N27 A;  4ZTF A;  4MML A;  1VQ4 T;  5KH6 A;  1Q7Y C;  1JBM A;  2LT4 A;  2QDY B;  3OYJ A;  2KVQ G;  2VGN A;  4GLK A;  2RHU A;  2PVO B;  4BE0 A;  1I8F A;  3JCM f;  3FEO A;  3GF5 A;  3KBG A;  3QII A;  1YJN A;  3LWI A;  3CCU T;  2XI9 A;  1BI3 A;  3E9G A;  4C0D B;  2GCX A;  4EPC A;  4F7U A;  2BUD A;  3L42 A;  4F7U B;  3G71 A;  3CCL T;  4JRQ A;  3KUF A;  2XD0 A;  4E7K A;  4PJO C;  4M7A F;  2PVD B;  3I56 A;  1WGS A;  2A7Y A;  5I21 A;  2DD4 B;  1W2B A;  2WSC E;  3URG A;  2IG0 A;  3JCM c;  4M77 F;  1UB4 A;  4NOY A;  1H64 1;  4J7F A;  5DY9 A;  1OZ3 A;  4E7H A;  2LCC A;  1M4Z A;  3QYE A;  1MHN A;  5GAO l;  1YIT T;  1YI2 A;  1BI0 A;  3RMS A;  2RA2 A;  4DOW A;  5M9O A;  3QG1 A;  3QWL A;  2HQE A;  3GPL A;  4XU2 A;  4QSH A;  1QP3 A;  2K5I A;  4LDW A;  1G3Y A;  3MEA A;  3CPW S;  3UPU A;  4GY5 A;  2EFI A;  2H3J A;  2E6N A;  2MF2 A;  4PJO F;  1Y7X A;  5GAN 2;  3CME A;  5CVI A;  4M7D B;  2KMG A;  4X34 A;  2KDS A;  3NTH A;  5GAN 5;  4ATO A;  2EKO A;  4HNU A;  2DTO A;  4DOV A;  3QJ6 A;  5LJ3 e;  5LJ5 d;  2VUB A;  1AHJ B;  3M55 A;  3QDR B;  1VQP T;  1KD1 C;  4M75 E;  2Y90 A;  1QW1 A;  3CPW A;  4LDV A;  2IVW A;  3PT9 A;  4O6J A;  4M78 A;  4XTW A;  2PUK B;  1VQL A;  4OF1 A;  4C8Q E;  3OYC A;  2K5L A;  3PTA A;  1FKM A;  5L8R E;  3CCR A;  3QYH B;  3QKJ A;  2MWO A;  3BG3 A;  2DJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...