1O9KB

Crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
144
structure length
144
Chain Sequence
STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords RETINOBLASTOMA-ASSOCIATED PROTEIN
publication title Crystal Structure of the Retinoblastoma Tumor Suppressor Protein Bound to E2F and the Molecular Basis of its Regulation
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 144
sequence length 144
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1o9kB00
4OGRB 1QMZB 4EC8B 4BCFB 2B9RA 4II5B 4CFNB 4KRCB 2WHBB 4FX3B 3EOCB 2C6TB 2W99A 4EOSB 1OI9B 5BNJB 5LQFB 1N4MA 1H1RB 1H1QB 5HNBB 4ROEA 2W96A 4EOLB 1OKWB 4TTHA 1TFBA 2C5NB 4I3ZB 1P5EB 1UNHD 2IW6B 2UZBB 4YOZA 1JSUB 4CRLB 2C5OB 2IVXA 1OIUB 3DOGB 4F7LB 5IDNB 2WMBB 2PK2A 2UZLB 4F7NB 4NSTB 4BCMD 5EFQB 2X1NB 2BKZB 2PHGA 3POMA 3BHUB 4KRDB 3TNIB 2WIHB 4EC9B 1C9BA 2UZDB 1VYWB 2IW8B 2IW9B 4EORB 3H4CA 1JOWA 1JSTB 1OL2B 2PMIB 3MI9B 4F6SB 4EOIB 4BCQB 5I5ZB 4YOOA 3QHWB 2CJMB 3MIAB 4EOPB 3K7AM 3DDQB 4F6WB 3QHRB 1E9HB 1O9KB 4BCIB 1O9KA 1H28B 2F2CA 5HBJB 3MY1B 2WIPB 2WXVB 3MY5B 3M03A 2C5XB 4EONB 3TNWB 2W2HA 4BCND 2PK9B 3O0GD 4BCJB 1FINB 4ELLA 2C4GB 4IMYB 1OGUB 2CCHB 1GUXB 1H1PB 4EOOB 1GUXA 2WEVB 2WMAB 3EJ1B 4EOQB 2QDJA 4EOJB 4EOKB 1GH6B 2JGZB 3BLHB 2C5VB 1H27B 3TNHB 1JKWA 4UN0A 4BCPB 1UNLD 3F5XB 5HVYB 4CFUD 5FGKB 4F7SB 4BCMB 5CEIB 3BLQB 3BLRB 4F70B 4ROCA 3BHTB 4CFWB 3LQ5B 1H4LD 1H24B 2EUFA 3G33B 4YC3B 2I53A 3TN8B 4BCGB 1XO2A 4F6UB 5HBEB 4YOSA 1D3UB 2V22B 1PKDB 1GY3B 5ACBA 2CCIB 1OKVB 1OIYB 1BU2A 4OR5B 5HQ0B 1UNGD 4EOMB 5IF1B 5LMKB 4CXAB 4CFVB 1FVVB 1VOLA 4BCKB 3DDPB 3BHVB 1F5QB 2G9XB 5IDPB 1W98B 1VINA 3RGFB 4BCOB 4BCHB 4RODA 4G6LB 5L2WB 5HBHB 2W9ZA 1H25B 2UZEB 5CYIB 1H1SB 4BCNB 4CFXB 2I40B 2UUEB 2BPMB 2R7GA 4Y72B 1ZP2A 5ICPB 4CFMB 1AISB 1KXUA 3EIDB 1URCB 2W9FA 4ELJA 2WFYB 1H26B 1G3NC 4BCQD 1OL1B 2WPAB 4CFUB 1AD6A 4F7JB
chains in the Genus database with same CATH superfamily
4OGRB 1QMZB 2IN3A 4II5B 2ZPEB 2WHBB 1OI9B 2CZ6B 1H1QB 4JX6A 4ROEA 1OKWB 2QDYB 1UNHD 2IW6B 4MFEA 4CRLB 2C5OB 4BBRM 2IVXA 1OIUB 2BS2A 4F7NB 4BCMD 2BKZB 2PHGA 1C9BA 3A8MB 3DTOA 1JSTB 2QFZA 2CJMB 5EJCA 3A8LB 3MIAB 3DDQB 3QHRB 4BCIB 2F2CA 3MY1B 2WIPB 4EONB 2DMEA 2PK9B 4HLQA 2BS3A 2C4GB 4IMYB 1GUXB 2QGSA 4M6VA 4EOKB 2C5VB 3F5XB 5HVYB 4BCMB 3BG3A 4CFWB 3KHIA 3BG9A 3QYGB 4BY7X 2EUFA 4BCGB 2I53A 2V22B 1PKDB 1BU2A 2KMGA 4CFVB 3GTMS 4BCKB 3DDPB 1ENWA 3RGFB 2PJQA 4G6LB 5HBHB 1H1SB 1UGPB 2CYZB 2R7GA 4ZGDB 5ICPB 4NC6A 4ELJA 2WFYB 4BCQD 3QZ9B 4F7JB 4BCFB 5DQVA 4FX3B 3EOCB 2W99A 4EOSB 5LQFB 5BNJB 5HNBB 4EOLB 2W96A 4TTHA 1UGRB 3HHTB 2DD4B 1QLBA 2UZBB 4BY1X 3DOGB 5IDNB 2PK2A 2UZLB 5EFQB 3POMA 4JX5A 4EC9B 4AKIA 4AKGA 4BCQB 4ZGEB 3VYHB 4F6WB 3X26B 2DD5B 1O9KB 1H28B 2DXCB 3A8HB 2W2HA 3O0GD 4BCJB 1FINB 4ELLA 1OGUB 2CCHB 1H1PB 3QYEA 2WMAB 4EOQB 2QDJA 3X24B 3BLHB 4HNTA 4HNVA 4UN0A 5FGKB 4F70B 3NDQA 2QQ8A 4ROCA 2LW4A 3PO3S 4YOSA 1D3UB 2CCIB 4MIMA 1OIYB 5HQ0B 3A8OB 5LMKB 2G9XB 5IDPB 1W98B 4BCOB 2KR6A 2CZ7B 2UUEB 3VYGB 1V29B 4Y72B 1ZP2A 4CFMB 3BG5A 1UGQB 2W9FA 3A8GB 3QXEB 3WVEB 1AD6A 4EC8B 2ZPHB 2ZZDB 4CFNB 2WJ9A 2C5NB 4I3ZB 4QSHA 4BBSM 5DQWA 4YOZA 3X28B 4Z6YA 2CZ1B 4KRDB 3TNIB 4OB2B 4LOCA 4EORB 2PMIB 3MI9B 4EOIB 4HNUA 4YOOA 3QHWB 4EOPB 3K7AM 5HBJB 3MY5B 4OB0B 4JX4A 4BCND 3HBLA 4AKHA 1GUXA 2WEVB 3EJ1B 3QYHB 3QYBA 1GH6B 1AHJB 3X25B 2G77A 3TNHB 1JKWA 3VKGA 4BCPB 1UNLD 4F7SB 3BLQB 3BLRB 3BHTB 3LQ5B 3TW6A 2QF7A 3TN8B 4YC3B 1XO2A 3DL1A 3WVDB 1GY3B 1OKVB 4OR5B 4EOMB 1FVVB 1VOLA 3B57A 1F5QB 4BCHB 1VINA 4RODA 5L2WB 2W9ZA 2UZEB 5CYIB 4BCNB 2ZCFB 4OB3B 4FM4B 1KXUA 3QZ5B 1UGSB 1H26B 3HO8A 2D0QB 1OL1B 2WPAB 2ZPBB 2B9RA 4KRCB 2C6TB 2ZPGB 1N4MA 1H1RB 4AI6A 1TFBA 1P5EB 1JSUB 1IREB 2ZPFB 4F7LB 1TD6A 2WMBB 4NSTB 2X1NB 3BHUB 2WIHB 2UZDB 1VYWB 2IW8B 2IW9B 3H4CA 1JOWA 1OL2B 4F6SB 5I5ZB 1FKMA 1E9HB 1O9KA 2WXVB 3M03A 2C5XB 3TNWB 4OB1B 3QWLA 3TW7A 4EOOB 4ZGJB 4EOJB 3X20B 2JGZB 1H27B 2BS4A 3HZJA 4HL4A 4CFUD 5IHYA 5CEIB 3DJBA 1H4LD 1H24B 3G33B 5HBEB 4F6UB 2ZPIB 5ACBA 5IF1B 1UNGD 4CXAB 3BHVB 2DPPB 3VKHA 1H25B 4BXXX 4MFDA 3HB9A 4CFXB 2AHJB 2I40B 2BPMB 1E7PA 1AISB 3EIDB 1URCB 2CZ0B 2DXBB 1G3NC 4CFUB
chains in the Genus database with same CATH topology
4OGRB 1QMZB 4EC8B 4BCFB 2B9RA 4II5B 4CFNB 4KRCB 2WHBB 4FX3B 3EOCB 2C6TB 2W99A 4EOSB 1OI9B 5BNJB 5LQFB 1N4MA 1H1RB 1H1QB 5HNBB 4ROEA 2W96A 4EOLB 1OKWB 4TTHA 1TFBA 2C5NB 4I3ZB 1P5EB 1UNHD 2IW6B 2UZBB 4YOZA 1JSUB 4CRLB 2C5OB 2IVXA 1OIUB 3DOGB 4F7LB 5IDNB 2WMBB 2PK2A 2UZLB 4F7NB 4NSTB 4BCMD 5EFQB 2X1NB 2BKZB 2PHGA 3POMA 3BHUB 4KRDB 3TNIB 2WIHB 4EC9B 1C9BA 2UZDB 1VYWB 2IW8B 2IW9B 4EORB 3H4CA 1JOWA 1JSTB 1OL2B 2PMIB 3MI9B 4F6SB 4EOIB 4BCQB 5I5ZB 4YOOA 3QHWB 2CJMB 3MIAB 4EOPB 3K7AM 3DDQB 4F6WB 3QHRB 1E9HB 1O9KB 4BCIB 1O9KA 1H28B 2F2CA 5HBJB 3MY1B 2WIPB 2WXVB 3MY5B 3M03A 2C5XB 4EONB 3TNWB 2W2HA 4BCND 2PK9B 3O0GD 4BCJB 1FINB 4ELLA 2C4GB 4IMYB 1OGUB 2CCHB 1GUXB 1H1PB 4EOOB 1GUXA 2WEVB 2WMAB 3EJ1B 4EOQB 2QDJA 4EOJB 4EOKB 1GH6B 2JGZB 3BLHB 2C5VB 1H27B 3TNHB 1JKWA 4UN0A 4BCPB 1UNLD 3F5XB 5HVYB 4CFUD 5FGKB 4F7SB 4BCMB 5CEIB 3BLQB 3BLRB 4F70B 4ROCA 3BHTB 4CFWB 3LQ5B 1H4LD 1H24B 2EUFA 3G33B 4YC3B 2I53A 3TN8B 4BCGB 1XO2A 4F6UB 5HBEB 4YOSA 1D3UB 2V22B 1PKDB 1GY3B 5ACBA 2CCIB 1OKVB 1OIYB 1BU2A 4OR5B 5HQ0B 1UNGD 4EOMB 5IF1B 5LMKB 4CXAB 4CFVB 1FVVB 1VOLA 4BCKB 3DDPB 3BHVB 1F5QB 2G9XB 5IDPB 1W98B 1VINA 3RGFB 4BCOB 4BCHB 4RODA 4G6LB 5L2WB 5HBHB 2W9ZA 1H25B 2UZEB 5CYIB 1H1SB 4BCNB 4CFXB 2I40B 2UUEB 2BPMB 2R7GA 4Y72B 1ZP2A 5ICPB 4CFMB 1AISB 1KXUA 3EIDB 1URCB 2W9FA 4ELJA 2WFYB 1H26B 1G3NC 4BCQD 1OL1B 2WPAB 4CFUB 1AD6A 4F7JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGR B;  1QMZ B;  4EC8 B;  4BCF B;  2B9R A;  4II5 B;  4CFN B;  4KRC B;  2WHB B;  4FX3 B;  3EOC B;  2C6T B;  2W99 A;  4EOS B;  1OI9 B;  5BNJ B;  5LQF B;  1N4M A;  1H1R B;  1H1Q B;  5HNB B;  4ROE A;  2W96 A;  4EOL B;  1OKW B;  4TTH A;  1TFB A;  2C5N B;  4I3Z B;  1P5E B;  1UNH D;  2IW6 B;  2UZB B;  4YOZ A;  1JSU B;  4CRL B;  2C5O B;  2IVX A;  1OIU B;  3DOG B;  4F7L B;  5IDN B;  2WMB B;  2PK2 A;  2UZL B;  4F7N B;  4NST B;  4BCM D;  5EFQ B;  2X1N B;  2BKZ B;  2PHG A;  3POM A;  3BHU B;  4KRD B;  3TNI B;  2WIH B;  4EC9 B;  1C9B A;  2UZD B;  1VYW B;  2IW8 B;  2IW9 B;  4EOR B;  3H4C A;  1JOW A;  1JST B;  1OL2 B;  2PMI B;  3MI9 B;  4F6S B;  4EOI B;  4BCQ B;  5I5Z B;  4YOO A;  3QHW B;  2CJM B;  3MIA B;  4EOP B;  3K7A M;  3DDQ B;  4F6W B;  3QHR B;  1E9H B;  1O9K B;  4BCI B;  1O9K A;  1H28 B;  2F2C A;  5HBJ B;  3MY1 B;  2WIP B;  2WXV B;  3MY5 B;  3M03 A;  2C5X B;  4EON B;  3TNW B;  2W2H A;  4BCN D;  2PK9 B;  3O0G D;  4BCJ B;  1FIN B;  4ELL A;  2C4G B;  4IMY B;  1OGU B;  2CCH B;  1GUX B;  1H1P B;  4EOO B;  1GUX A;  2WEV B;  2WMA B;  3EJ1 B;  4EOQ B;  2QDJ A;  4EOJ B;  4EOK B;  1GH6 B;  2JGZ B;  3BLH B;  2C5V B;  1H27 B;  3TNH B;  1JKW A;  4UN0 A;  4BCP B;  1UNL D;  3F5X B;  5HVY B;  4CFU D;  5FGK B;  4F7S B;  4BCM B;  5CEI B;  3BLQ B;  3BLR B;  4F70 B;  4ROC A;  3BHT B;  4CFW B;  3LQ5 B;  1H4L D;  1H24 B;  2EUF A;  3G33 B;  4YC3 B;  2I53 A;  3TN8 B;  4BCG B;  1XO2 A;  4F6U B;  5HBE B;  4YOS A;  1D3U B;  2V22 B;  1PKD B;  1GY3 B;  5ACB A;  2CCI B;  1OKV B;  1OIY B;  1BU2 A;  4OR5 B;  5HQ0 B;  1UNG D;  4EOM B;  5IF1 B;  5LMK B;  4CXA B;  4CFV B;  1FVV B;  1VOL A;  4BCK B;  3DDP B;  3BHV B;  1F5Q B;  2G9X B;  5IDP B;  1W98 B;  1VIN A;  3RGF B;  4BCO B;  4BCH B;  4ROD A;  4G6L B;  5L2W B;  5HBH B;  2W9Z A;  1H25 B;  2UZE B;  5CYI B;  1H1S B;  4BCN B;  4CFX B;  2I40 B;  2UUE B;  2BPM B;  2R7G A;  4Y72 B;  1ZP2 A;  5ICP B;  4CFM B;  1AIS B;  1KXU A;  3EID B;  1URC B;  2W9F A;  4ELJ A;  2WFY B;  1H26 B;  1G3N C;  4BCQ D;  1OL1 B;  2WPA B;  4CFU B;  1AD6 A;  4F7J B; 
#chains in the Genus database with same CATH topology
 4OGR B;  1QMZ B;  2IN3 A;  4II5 B;  2ZPE B;  2WHB B;  1OI9 B;  2CZ6 B;  1H1Q B;  4JX6 A;  4ROE A;  1OKW B;  2QDY B;  1UNH D;  2IW6 B;  4MFE A;  4CRL B;  2C5O B;  4BBR M;  2IVX A;  1OIU B;  2BS2 A;  4F7N B;  4BCM D;  2BKZ B;  2PHG A;  1C9B A;  3A8M B;  3DTO A;  1JST B;  2QFZ A;  2CJM B;  5EJC A;  3A8L B;  3MIA B;  3DDQ B;  3QHR B;  4BCI B;  2F2C A;  3MY1 B;  2WIP B;  4EON B;  2DME A;  2PK9 B;  4HLQ A;  2BS3 A;  2C4G B;  4IMY B;  1GUX B;  2QGS A;  4M6V A;  4EOK B;  2C5V B;  3F5X B;  5HVY B;  4BCM B;  3BG3 A;  4CFW B;  3KHI A;  3BG9 A;  3QYG B;  4BY7 X;  2EUF A;  4BCG B;  2I53 A;  2V22 B;  1PKD B;  1BU2 A;  2KMG A;  4CFV B;  3GTM S;  4BCK B;  3DDP B;  1ENW A;  3RGF B;  2PJQ A;  4G6L B;  5HBH B;  1H1S B;  1UGP B;  2CYZ B;  2R7G A;  4ZGD B;  5ICP B;  4NC6 A;  4ELJ A;  2WFY B;  4BCQ D;  3QZ9 B;  4F7J B;  4BCF B;  5DQV A;  4FX3 B;  3EOC B;  2W99 A;  4EOS B;  5LQF B;  5BNJ B;  5HNB B;  4EOL B;  2W96 A;  4TTH A;  1UGR B;  3HHT B;  2DD4 B;  1QLB A;  2UZB B;  4BY1 X;  3DOG B;  5IDN B;  2PK2 A;  2UZL B;  5EFQ B;  3POM A;  4JX5 A;  4EC9 B;  4AKI A;  4AKG A;  4BCQ B;  4ZGE B;  3VYH B;  4F6W B;  3X26 B;  2DD5 B;  1O9K B;  1H28 B;  2DXC B;  3A8H B;  2W2H A;  3O0G D;  4BCJ B;  1FIN B;  4ELL A;  1OGU B;  2CCH B;  1H1P B;  3QYE A;  2WMA B;  4EOQ B;  2QDJ A;  3X24 B;  3BLH B;  4HNT A;  4HNV A;  4UN0 A;  5FGK B;  4F70 B;  3NDQ A;  2QQ8 A;  4ROC A;  2LW4 A;  3PO3 S;  4YOS A;  1D3U B;  2CCI B;  4MIM A;  1OIY B;  5HQ0 B;  3A8O B;  5LMK B;  2G9X B;  5IDP B;  1W98 B;  4BCO B;  2KR6 A;  2CZ7 B;  2UUE B;  3VYG B;  1V29 B;  4Y72 B;  1ZP2 A;  4CFM B;  3BG5 A;  1UGQ B;  2W9F A;  3A8G B;  3QXE B;  3WVE B;  1AD6 A;  4EC8 B;  2ZPH B;  2ZZD B;  4CFN B;  2WJ9 A;  2C5N B;  4I3Z B;  4QSH A;  4BBS M;  5DQW A;  4YOZ A;  3X28 B;  4Z6Y A;  2CZ1 B;  4KRD B;  3TNI B;  4OB2 B;  4LOC A;  4EOR B;  2PMI B;  3MI9 B;  4EOI B;  4HNU A;  4YOO A;  3QHW B;  4EOP B;  3K7A M;  5HBJ B;  3MY5 B;  4OB0 B;  4JX4 A;  4BCN D;  3HBL A;  4AKH A;  1GUX A;  2WEV B;  3EJ1 B;  3QYH B;  3QYB A;  1GH6 B;  1AHJ B;  3X25 B;  2G77 A;  3TNH B;  1JKW A;  3VKG A;  4BCP B;  1UNL D;  4F7S B;  3BLQ B;  3BLR B;  3BHT B;  3LQ5 B;  3TW6 A;  2QF7 A;  3TN8 B;  4YC3 B;  1XO2 A;  3DL1 A;  3WVD B;  1GY3 B;  1OKV B;  4OR5 B;  4EOM B;  1FVV B;  1VOL A;  3B57 A;  1F5Q B;  4BCH B;  1VIN A;  4ROD A;  5L2W B;  2W9Z A;  2UZE B;  5CYI B;  4BCN B;  2ZCF B;  4OB3 B;  4FM4 B;  1KXU A;  3QZ5 B;  1UGS B;  1H26 B;  3HO8 A;  2D0Q B;  1OL1 B;  2WPA B;  2ZPB B;  2B9R A;  4KRC B;  2C6T B;  2ZPG B;  1N4M A;  1H1R B;  4AI6 A;  1TFB A;  1P5E B;  1JSU B;  1IRE B;  2ZPF B;  4F7L B;  1TD6 A;  2WMB B;  4NST B;  2X1N B;  3BHU B;  2WIH B;  2UZD B;  1VYW B;  2IW8 B;  2IW9 B;  3H4C A;  1JOW A;  1OL2 B;  4F6S B;  5I5Z B;  1FKM A;  1E9H B;  1O9K A;  2WXV B;  3M03 A;  2C5X B;  3TNW B;  4OB1 B;  3QWL A;  3TW7 A;  4EOO B;  4ZGJ B;  4EOJ B;  3X20 B;  2JGZ B;  1H27 B;  2BS4 A;  3HZJ A;  4HL4 A;  4CFU D;  5IHY A;  5CEI B;  3DJB A;  1H4L D;  1H24 B;  3G33 B;  5HBE B;  4F6U B;  2ZPI B;  5ACB A;  5IF1 B;  1UNG D;  4CXA B;  3BHV B;  2DPP B;  3VKH A;  1H25 B;  4BXX X;  4MFD A;  3HB9 A;  4CFX B;  2AHJ B;  2I40 B;  2BPM B;  1E7P A;  1AIS B;  3EID B;  1URC B;  2CZ0 B;  2DXB B;  1G3N C;  4CFU B; 
#chains in the Genus database with same CATH homology
 4OGR B;  1QMZ B;  4EC8 B;  4BCF B;  2B9R A;  4II5 B;  4CFN B;  4KRC B;  2WHB B;  4FX3 B;  3EOC B;  2C6T B;  2W99 A;  4EOS B;  1OI9 B;  5BNJ B;  5LQF B;  1N4M A;  1H1R B;  1H1Q B;  5HNB B;  4ROE A;  2W96 A;  4EOL B;  1OKW B;  4TTH A;  1TFB A;  2C5N B;  4I3Z B;  1P5E B;  1UNH D;  2IW6 B;  2UZB B;  4YOZ A;  1JSU B;  4CRL B;  2C5O B;  2IVX A;  1OIU B;  3DOG B;  4F7L B;  5IDN B;  2WMB B;  2PK2 A;  2UZL B;  4F7N B;  4NST B;  4BCM D;  5EFQ B;  2X1N B;  2BKZ B;  2PHG A;  3POM A;  3BHU B;  4KRD B;  3TNI B;  2WIH B;  4EC9 B;  1C9B A;  2UZD B;  1VYW B;  2IW8 B;  2IW9 B;  4EOR B;  3H4C A;  1JOW A;  1JST B;  1OL2 B;  2PMI B;  3MI9 B;  4F6S B;  4EOI B;  4BCQ B;  5I5Z B;  4YOO A;  3QHW B;  2CJM B;  3MIA B;  4EOP B;  3K7A M;  3DDQ B;  4F6W B;  3QHR B;  1E9H B;  1O9K B;  4BCI B;  1O9K A;  1H28 B;  2F2C A;  5HBJ B;  3MY1 B;  2WIP B;  2WXV B;  3MY5 B;  3M03 A;  2C5X B;  4EON B;  3TNW B;  2W2H A;  4BCN D;  2PK9 B;  3O0G D;  4BCJ B;  1FIN B;  4ELL A;  2C4G B;  4IMY B;  1OGU B;  2CCH B;  1GUX B;  1H1P B;  4EOO B;  1GUX A;  2WEV B;  2WMA B;  3EJ1 B;  4EOQ B;  2QDJ A;  4EOJ B;  4EOK B;  1GH6 B;  2JGZ B;  3BLH B;  2C5V B;  1H27 B;  3TNH B;  1JKW A;  4UN0 A;  4BCP B;  1UNL D;  3F5X B;  5HVY B;  4CFU D;  5FGK B;  4F7S B;  4BCM B;  5CEI B;  3BLQ B;  3BLR B;  4F70 B;  4ROC A;  3BHT B;  4CFW B;  3LQ5 B;  1H4L D;  1H24 B;  2EUF A;  3G33 B;  4YC3 B;  2I53 A;  3TN8 B;  4BCG B;  1XO2 A;  4F6U B;  5HBE B;  4YOS A;  1D3U B;  2V22 B;  1PKD B;  1GY3 B;  5ACB A;  2CCI B;  1OKV B;  1OIY B;  1BU2 A;  4OR5 B;  5HQ0 B;  1UNG D;  4EOM B;  5IF1 B;  5LMK B;  4CXA B;  4CFV B;  1FVV B;  1VOL A;  4BCK B;  3DDP B;  3BHV B;  1F5Q B;  2G9X B;  5IDP B;  1W98 B;  1VIN A;  3RGF B;  4BCO B;  4BCH B;  4ROD A;  4G6L B;  5L2W B;  5HBH B;  2W9Z A;  1H25 B;  2UZE B;  5CYI B;  1H1S B;  4BCN B;  4CFX B;  2I40 B;  2UUE B;  2BPM B;  2R7G A;  4Y72 B;  1ZP2 A;  5ICP B;  4CFM B;  1AIS B;  1KXU A;  3EID B;  1URC B;  2W9F A;  4ELJ A;  2WFY B;  1H26 B;  1G3N C;  4BCQ D;  1OL1 B;  2WPA B;  4CFU B;  1AD6 A;  4F7J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...