1O9KB

Crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
144
structure length
144
Chain Sequence
STSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RETINOBLASTOMA-ASSOCIATED PROTEIN
publication title Crystal Structure of the Retinoblastoma Tumor Suppressor Protein Bound to E2F and the Molecular Basis of its Regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 46
structure length 144
sequence length 144
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1o9kB00
2QDJA 2WIPB 1H24B 4BCNB 4BCGB 4EOIB 1UNGD 1F5QB 3MI9B 2PMIB 4F7NB 3M03A 3EOCB 3TNWB 1AD6A 2BPMB 5EFQB 4KRDB 2C5NB 4F6WB 2UZBB 2JGZB 2CCIB 3QHRB 1JKWA 1G3NC 2WPAB 4F70B 1N4MA 4EOJB 3MY5B 1H4LD 1BU2A 5IDPB 5L2WB 1C9BA 2X1NB 2W99A 5I5ZB 4EOKB 3DDQB 2UZEB 1H1QB 3BLRB 1GUXB 1ZP2A 3BLHB 4EOOB 5ACBA 3G33B 2WXVB 4EONB 1VINA 4EORB 2IW9B 1FINB 3BHVB 5IF1B 2WFYB 4F6UB 4F7LB 3TN8B 4ELLA 2C5VB 4BCPB 1JSTB 1O9KA 2I53A 1H27B 1FVVB 2C6TB 3BHTB 4EC9B 3MY1B 4CXAB 4BCFB 1D3UB 4KRCB 2W9ZA 4G6LB 1JSUB 4YOZA 3EIDB 5FGKB 1P5EB 3BHUB 1OI9B 2W2HA 2PHGA 4BCMD 4CFUD 1AISB 5IDNB 2WEVB 4NSTB 1H1SB 5HQ0B 2V22B 1URCB 5HNBB 5CYIB 4EOQB 4IMYB 3DDPB 3MIAB 4I3ZB 4BCHB 2WMAB 2PK2A 4FX3B 1OKVB 5HBHB 2C4GB 2WIHB 4CFVB 4EOPB 4BCOB 1VYWB 1W98B 3K7AM 4YOSA 1H1PB 4OGRB 4BCQD 1KXUA 2R7GA 1UNLD 4F7JB 4BCIB 4F7SB 1OIYB 4CFWB 2CCHB 1O9KB 5LMKB 2UZLB 4BCMB 4CFUB 4CRLB 4YOOA 4RODA 5CEIB 2IW6B 4Y72B 5ICPB 1H25B 1JOWA 1OGUB 1OKWB 1TFBA 5HBEB 2B9RA 2UZDB 4UN0A 3TNHB 1PKDB 2WHBB 2WMBB 3F5XB 4BCKB 2EUFA 4OR5B 4ELJA 1H26B 4EOSB 4CFXB 2G9XB 1E9HB 2W9FA 4EC8B 3POMA 4BCQB 4BCND 3H4CA 2IW8B 1QMZB 3LQ5B 2C5OB 1UNHD 1OIUB 1OL2B 1XO2A 2F2CA 3O0GD 1VOLA 4YC3B 2W96A 2PK9B 1GH6B 4CFNB 3BLQB 3DOGB 4EOLB 4CFMB 1H1RB 1GUXA 4EOMB 4TTHA 5BNJB 4ROCA 3TNIB 1OL1B 2CJMB 3EJ1B 4II5B 1GY3B 1H28B 4F6SB 4ROEA 2UUEB 2C5XB 5LQFB 2IVXA 4BCJB 3QHWB 5HBJB 5HVYB 3RGFB 2BKZB 2I40B
chains in the Genus database with same CATH superfamily
1UNGD 4AKIA 3M03A 3EOCB 3QZ9B 3TNWB 2C5NB 1UGPB 3GTMS 3MY5B 5I5ZB 2ZCFB 3BLRB 1GUXB 1ZP2A 5ACBA 4EORB 4HNVA 3BHVB 2KMGA 3BHTB 4OB0B 2D0QB 3NDQA 5FGKB 3QZ5B 4HL4A 4BCMD 2WEVB 3QYGB 5DQVA 4Z6YA 2BS4A 3DL1A 4EOQB 4FM4B 4IMYB 3DDPB 4BCHB 2PK2A 2BS2A 4CFVB 3TW7A 4OGRB 4F7SB 2QGSA 4CFWB 2CCHB 4MIMA 4CFUB 4YOOA 5CEIB 2IW6B 4Y72B 1H25B 5IHYA 2ZPEB 5HBEB 2B9RA 1QLBA 4AKGA 3F5XB 4OR5B 4EOSB 4HLQA 4CFXB 3BG3A 4EC8B 2QDYB 1OIUB 2DXBB 2W96A 3A8GB 1UGRB 4EOMB 3TNIB 1GY3B 4BXXX 2C5XB 5HBJB 4LOCA 3RGFB 2I40B 2QDJA 1H24B 4BCGB 4EOIB 4BY7X 3MI9B 4BBRM 4F6WB 2DMEA 2CCIB 2DXCB 1N4MA 5L2WB 1BU2A 1C9BA 4MFDA 1UGSB 4EOKB 2UZEB 2QF7A 1H1QB 5DQWA 2KR6A 4AKHA 4F6UB 2C5VB 2LW4A 1H27B 4EC9B 4OB2B 1E7PA 3HZJA 2CZ0B 3EIDB 3BHUB 1OI9B 4CFUD 5HQ0B 3HB9A 2V22B 1URCB 1UGQB 3HBLA 2ZPFB 4I3ZB 2WMAB 2CZ6B 4BCOB 1KXUA 1UNLD 4F7JB 2UZLB 2QQ8A 4AI6A 1TFBA 2UZDB 4UN0A 4ELJA 1PKDB 3X24B 1E9HB 2ZPIB 3H4CA 1QMZB 1XO2A 1GH6B 4CFNB 4EOLB 4ZGEB 4TTHA 2CJMB 2BKZB 4RODA 3B57A 4F7NB 1AD6A 2BPMB 3A8OB 2DD4B 2UZBB 2JGZB 1JKWA 2WPAB 4F70B 5EJCA 2ZPHB 3BLHB 4OB3B 4HNUA 3G33B 2WXVB 1VINA 2AHJB 2IW9B 1FINB 3WVEB 3PO3S 4F7LB 3BG9A 4BCPB 1JSTB 2C6TB 2ZPBB 3MY1B 4CXAB 1D3UB 3VYGB 2ZPGB 3VYHB 1AISB 2CYZB 5CYIB 2DD5B 2QFZA 4BY1X 2PJQA 3MIAB 3A8LB 4FX3B 1OKVB 5HBHB 1W98B 1TD6A 4ZGJB 4JX5A 1OIYB 5LMKB 2G77A 3VKHA 5ICPB 4OB1B 4BBSM 3HO8A 1OKWB 3TNHB 2WHBB 2WMBB 4BCKB 3X20B 1H26B 2W9FA 4BCQB 3O0GD 3LQ5B 1UNHD 1OL2B 2F2CA 3VKGA 4CFMB 1H1RB 3EJ1B 4F6SB 4ROEA 3DTOA 2UUEB 2IVXA 3QHWB 4JX4A 5HVYB 2WIPB 2IN3A 4BCNB 3A8MB 1F5QB 2PMIB 3QYEA 5EFQB 4KRDB 3DJBA 3QHRB 1G3NC 4EOJB 4M6VA 1H4LD 5IDPB 2X1NB 2W99A 2ZZDB 3DDQB 4EOOB 3KHIA 4EONB 5IF1B 2WFYB 3TN8B 4ELLA 3A8HB 1O9KA 2I53A 1AHJB 1FVVB 2CZ7B 4BCFB 3X26B 2BS3A 4KRCB 2W9ZA 2CZ1B 1JSUB 4G6LB 4YOZA 1V29B 1P5EB 2W2HA 2PHGA 5IDNB 4NSTB 1H1SB 4JX6A 3X28B 1FKMA 5HNBB 3QXEB 1ENWA 4EOPB 2C4GB 2WIHB 1VYWB 3K7AM 4YOSA 1H1PB 4BCQD 2R7GA 4MFEA 4BCIB 3X25B 3BG5A 3WVDB 1O9KB 4NC6A 4BCMB 4CRLB 3HHTB 1JOWA 3TW6A 1OGUB 2EUFA 4ZGDB 2G9XB 3QYHB 2WJ9A 3POMA 4BCND 2IW8B 2C5OB 1VOLA 4YC3B 2PK9B 4HNTA 3BLQB 3DOGB 1GUXA 4QSHA 5BNJB 3QYBA 4ROCA 1OL1B 4II5B 1H28B 5LQFB 4BCJB 3QWLA 2DPPB 1IREB
chains in the Genus database with same CATH topology
2QDJA 2WIPB 1H24B 4BCNB 4BCGB 4EOIB 1UNGD 1F5QB 3MI9B 2PMIB 4F7NB 3M03A 3EOCB 3TNWB 1AD6A 2BPMB 5EFQB 4KRDB 2C5NB 4F6WB 2UZBB 2JGZB 2CCIB 3QHRB 1JKWA 1G3NC 2WPAB 4F70B 1N4MA 4EOJB 3MY5B 1H4LD 1BU2A 5IDPB 5L2WB 1C9BA 2X1NB 2W99A 5I5ZB 4EOKB 3DDQB 2UZEB 1H1QB 3BLRB 1GUXB 1ZP2A 3BLHB 4EOOB 5ACBA 3G33B 2WXVB 4EONB 1VINA 4EORB 2IW9B 1FINB 3BHVB 5IF1B 2WFYB 4F6UB 4F7LB 3TN8B 4ELLA 2C5VB 4BCPB 1JSTB 1O9KA 2I53A 1H27B 1FVVB 2C6TB 3BHTB 4EC9B 3MY1B 4CXAB 4BCFB 1D3UB 4KRCB 2W9ZA 4G6LB 1JSUB 4YOZA 3EIDB 5FGKB 1P5EB 3BHUB 1OI9B 2W2HA 2PHGA 4BCMD 4CFUD 1AISB 5IDNB 2WEVB 4NSTB 1H1SB 5HQ0B 2V22B 1URCB 5HNBB 5CYIB 4EOQB 4IMYB 3DDPB 3MIAB 4I3ZB 4BCHB 2WMAB 2PK2A 4FX3B 1OKVB 5HBHB 2C4GB 2WIHB 4CFVB 4EOPB 4BCOB 1VYWB 1W98B 3K7AM 4YOSA 1H1PB 4OGRB 4BCQD 1KXUA 2R7GA 1UNLD 4F7JB 4BCIB 4F7SB 1OIYB 4CFWB 2CCHB 1O9KB 5LMKB 2UZLB 4BCMB 4CFUB 4CRLB 4YOOA 4RODA 5CEIB 2IW6B 4Y72B 5ICPB 1H25B 1JOWA 1OGUB 1OKWB 1TFBA 5HBEB 2B9RA 2UZDB 4UN0A 3TNHB 1PKDB 2WHBB 2WMBB 3F5XB 4BCKB 2EUFA 4OR5B 4ELJA 1H26B 4EOSB 4CFXB 2G9XB 1E9HB 2W9FA 4EC8B 3POMA 4BCQB 4BCND 3H4CA 2IW8B 1QMZB 3LQ5B 2C5OB 1UNHD 1OIUB 1OL2B 1XO2A 2F2CA 3O0GD 1VOLA 4YC3B 2W96A 2PK9B 1GH6B 4CFNB 3BLQB 3DOGB 4EOLB 4CFMB 1H1RB 1GUXA 4EOMB 4TTHA 5BNJB 4ROCA 3TNIB 1OL1B 2CJMB 3EJ1B 4II5B 1GY3B 1H28B 4F6SB 4ROEA 2UUEB 2C5XB 5LQFB 2IVXA 4BCJB 3QHWB 5HBJB 5HVYB 3RGFB 2BKZB 2I40B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDJ A;  2WIP B;  1H24 B;  4BCN B;  4BCG B;  4EOI B;  1UNG D;  1F5Q B;  3MI9 B;  2PMI B;  4F7N B;  3M03 A;  3EOC B;  3TNW B;  1AD6 A;  2BPM B;  5EFQ B;  4KRD B;  2C5N B;  4F6W B;  2UZB B;  2JGZ B;  2CCI B;  3QHR B;  1JKW A;  1G3N C;  2WPA B;  4F70 B;  1N4M A;  4EOJ B;  3MY5 B;  1H4L D;  1BU2 A;  5IDP B;  5L2W B;  1C9B A;  2X1N B;  2W99 A;  5I5Z B;  4EOK B;  3DDQ B;  2UZE B;  1H1Q B;  3BLR B;  1GUX B;  1ZP2 A;  3BLH B;  4EOO B;  5ACB A;  3G33 B;  2WXV B;  4EON B;  1VIN A;  4EOR B;  2IW9 B;  1FIN B;  3BHV B;  5IF1 B;  2WFY B;  4F6U B;  4F7L B;  3TN8 B;  4ELL A;  2C5V B;  4BCP B;  1JST B;  1O9K A;  2I53 A;  1H27 B;  1FVV B;  2C6T B;  3BHT B;  4EC9 B;  3MY1 B;  4CXA B;  4BCF B;  1D3U B;  4KRC B;  2W9Z A;  4G6L B;  1JSU B;  4YOZ A;  3EID B;  5FGK B;  1P5E B;  3BHU B;  1OI9 B;  2W2H A;  2PHG A;  4BCM D;  4CFU D;  1AIS B;  5IDN B;  2WEV B;  4NST B;  1H1S B;  5HQ0 B;  2V22 B;  1URC B;  5HNB B;  5CYI B;  4EOQ B;  4IMY B;  3DDP B;  3MIA B;  4I3Z B;  4BCH B;  2WMA B;  2PK2 A;  4FX3 B;  1OKV B;  5HBH B;  2C4G B;  2WIH B;  4CFV B;  4EOP B;  4BCO B;  1VYW B;  1W98 B;  3K7A M;  4YOS A;  1H1P B;  4OGR B;  4BCQ D;  1KXU A;  2R7G A;  1UNL D;  4F7J B;  4BCI B;  4F7S B;  1OIY B;  4CFW B;  2CCH B;  1O9K B;  5LMK B;  2UZL B;  4BCM B;  4CFU B;  4CRL B;  4YOO A;  4ROD A;  5CEI B;  2IW6 B;  4Y72 B;  5ICP B;  1H25 B;  1JOW A;  1OGU B;  1OKW B;  1TFB A;  5HBE B;  2B9R A;  2UZD B;  4UN0 A;  3TNH B;  1PKD B;  2WHB B;  2WMB B;  3F5X B;  4BCK B;  2EUF A;  4OR5 B;  4ELJ A;  1H26 B;  4EOS B;  4CFX B;  2G9X B;  1E9H B;  2W9F A;  4EC8 B;  3POM A;  4BCQ B;  4BCN D;  3H4C A;  2IW8 B;  1QMZ B;  3LQ5 B;  2C5O B;  1UNH D;  1OIU B;  1OL2 B;  1XO2 A;  2F2C A;  3O0G D;  1VOL A;  4YC3 B;  2W96 A;  2PK9 B;  1GH6 B;  4CFN B;  3BLQ B;  3DOG B;  4EOL B;  4CFM B;  1H1R B;  1GUX A;  4EOM B;  4TTH A;  5BNJ B;  4ROC A;  3TNI B;  1OL1 B;  2CJM B;  3EJ1 B;  4II5 B;  1GY3 B;  1H28 B;  4F6S B;  4ROE A;  2UUE B;  2C5X B;  5LQF B;  2IVX A;  4BCJ B;  3QHW B;  5HBJ B;  5HVY B;  3RGF B;  2BKZ B;  2I40 B; 
#chains in the Genus database with same CATH topology
 1UNG D;  4AKI A;  3M03 A;  3EOC B;  3QZ9 B;  3TNW B;  2C5N B;  1UGP B;  3GTM S;  3MY5 B;  5I5Z B;  2ZCF B;  3BLR B;  1GUX B;  1ZP2 A;  5ACB A;  4EOR B;  4HNV A;  3BHV B;  2KMG A;  3BHT B;  4OB0 B;  2D0Q B;  3NDQ A;  5FGK B;  3QZ5 B;  4HL4 A;  4BCM D;  2WEV B;  3QYG B;  5DQV A;  4Z6Y A;  2BS4 A;  3DL1 A;  4EOQ B;  4FM4 B;  4IMY B;  3DDP B;  4BCH B;  2PK2 A;  2BS2 A;  4CFV B;  3TW7 A;  4OGR B;  4F7S B;  2QGS A;  4CFW B;  2CCH B;  4MIM A;  4CFU B;  4YOO A;  5CEI B;  2IW6 B;  4Y72 B;  1H25 B;  5IHY A;  2ZPE B;  5HBE B;  2B9R A;  1QLB A;  4AKG A;  3F5X B;  4OR5 B;  4EOS B;  4HLQ A;  4CFX B;  3BG3 A;  4EC8 B;  2QDY B;  1OIU B;  2DXB B;  2W96 A;  3A8G B;  1UGR B;  4EOM B;  3TNI B;  1GY3 B;  4BXX X;  2C5X B;  5HBJ B;  4LOC A;  3RGF B;  2I40 B;  2QDJ A;  1H24 B;  4BCG B;  4EOI B;  4BY7 X;  3MI9 B;  4BBR M;  4F6W B;  2DME A;  2CCI B;  2DXC B;  1N4M A;  5L2W B;  1BU2 A;  1C9B A;  4MFD A;  1UGS B;  4EOK B;  2UZE B;  2QF7 A;  1H1Q B;  5DQW A;  2KR6 A;  4AKH A;  4F6U B;  2C5V B;  2LW4 A;  1H27 B;  4EC9 B;  4OB2 B;  1E7P A;  3HZJ A;  2CZ0 B;  3EID B;  3BHU B;  1OI9 B;  4CFU D;  5HQ0 B;  3HB9 A;  2V22 B;  1URC B;  1UGQ B;  3HBL A;  2ZPF B;  4I3Z B;  2WMA B;  2CZ6 B;  4BCO B;  1KXU A;  1UNL D;  4F7J B;  2UZL B;  2QQ8 A;  4AI6 A;  1TFB A;  2UZD B;  4UN0 A;  4ELJ A;  1PKD B;  3X24 B;  1E9H B;  2ZPI B;  3H4C A;  1QMZ B;  1XO2 A;  1GH6 B;  4CFN B;  4EOL B;  4ZGE B;  4TTH A;  2CJM B;  2BKZ B;  4ROD A;  3B57 A;  4F7N B;  1AD6 A;  2BPM B;  3A8O B;  2DD4 B;  2UZB B;  2JGZ B;  1JKW A;  2WPA B;  4F70 B;  5EJC A;  2ZPH B;  3BLH B;  4OB3 B;  4HNU A;  3G33 B;  2WXV B;  1VIN A;  2AHJ B;  2IW9 B;  1FIN B;  3WVE B;  3PO3 S;  4F7L B;  3BG9 A;  4BCP B;  1JST B;  2C6T B;  2ZPB B;  3MY1 B;  4CXA B;  1D3U B;  3VYG B;  2ZPG B;  3VYH B;  1AIS B;  2CYZ B;  5CYI B;  2DD5 B;  2QFZ A;  4BY1 X;  2PJQ A;  3MIA B;  3A8L B;  4FX3 B;  1OKV B;  5HBH B;  1W98 B;  1TD6 A;  4ZGJ B;  4JX5 A;  1OIY B;  5LMK B;  2G77 A;  3VKH A;  5ICP B;  4OB1 B;  4BBS M;  3HO8 A;  1OKW B;  3TNH B;  2WHB B;  2WMB B;  4BCK B;  3X20 B;  1H26 B;  2W9F A;  4BCQ B;  3O0G D;  3LQ5 B;  1UNH D;  1OL2 B;  2F2C A;  3VKG A;  4CFM B;  1H1R B;  3EJ1 B;  4F6S B;  4ROE A;  3DTO A;  2UUE B;  2IVX A;  3QHW B;  4JX4 A;  5HVY B;  2WIP B;  2IN3 A;  4BCN B;  3A8M B;  1F5Q B;  2PMI B;  3QYE A;  5EFQ B;  4KRD B;  3DJB A;  3QHR B;  1G3N C;  4EOJ B;  4M6V A;  1H4L D;  5IDP B;  2X1N B;  2W99 A;  2ZZD B;  3DDQ B;  4EOO B;  3KHI A;  4EON B;  5IF1 B;  2WFY B;  3TN8 B;  4ELL A;  3A8H B;  1O9K A;  2I53 A;  1AHJ B;  1FVV B;  2CZ7 B;  4BCF B;  3X26 B;  2BS3 A;  4KRC B;  2W9Z A;  2CZ1 B;  1JSU B;  4G6L B;  4YOZ A;  1V29 B;  1P5E B;  2W2H A;  2PHG A;  5IDN B;  4NST B;  1H1S B;  4JX6 A;  3X28 B;  1FKM A;  5HNB B;  3QXE B;  1ENW A;  4EOP B;  2C4G B;  2WIH B;  1VYW B;  3K7A M;  4YOS A;  1H1P B;  4BCQ D;  2R7G A;  4MFE A;  4BCI B;  3X25 B;  3BG5 A;  3WVD B;  1O9K B;  4NC6 A;  4BCM B;  4CRL B;  3HHT B;  1JOW A;  3TW6 A;  1OGU B;  2EUF A;  4ZGD B;  2G9X B;  3QYH B;  2WJ9 A;  3POM A;  4BCN D;  2IW8 B;  2C5O B;  1VOL A;  4YC3 B;  2PK9 B;  4HNT A;  3BLQ B;  3DOG B;  1GUX A;  4QSH A;  5BNJ B;  3QYB A;  4ROC A;  1OL1 B;  4II5 B;  1H28 B;  5LQF B;  4BCJ B;  3QWL A;  2DPP B;  1IRE B; 
#chains in the Genus database with same CATH homology
 2QDJ A;  2WIP B;  1H24 B;  4BCN B;  4BCG B;  4EOI B;  1UNG D;  1F5Q B;  3MI9 B;  2PMI B;  4F7N B;  3M03 A;  3EOC B;  3TNW B;  1AD6 A;  2BPM B;  5EFQ B;  4KRD B;  2C5N B;  4F6W B;  2UZB B;  2JGZ B;  2CCI B;  3QHR B;  1JKW A;  1G3N C;  2WPA B;  4F70 B;  1N4M A;  4EOJ B;  3MY5 B;  1H4L D;  1BU2 A;  5IDP B;  5L2W B;  1C9B A;  2X1N B;  2W99 A;  5I5Z B;  4EOK B;  3DDQ B;  2UZE B;  1H1Q B;  3BLR B;  1GUX B;  1ZP2 A;  3BLH B;  4EOO B;  5ACB A;  3G33 B;  2WXV B;  4EON B;  1VIN A;  4EOR B;  2IW9 B;  1FIN B;  3BHV B;  5IF1 B;  2WFY B;  4F6U B;  4F7L B;  3TN8 B;  4ELL A;  2C5V B;  4BCP B;  1JST B;  1O9K A;  2I53 A;  1H27 B;  1FVV B;  2C6T B;  3BHT B;  4EC9 B;  3MY1 B;  4CXA B;  4BCF B;  1D3U B;  4KRC B;  2W9Z A;  4G6L B;  1JSU B;  4YOZ A;  3EID B;  5FGK B;  1P5E B;  3BHU B;  1OI9 B;  2W2H A;  2PHG A;  4BCM D;  4CFU D;  1AIS B;  5IDN B;  2WEV B;  4NST B;  1H1S B;  5HQ0 B;  2V22 B;  1URC B;  5HNB B;  5CYI B;  4EOQ B;  4IMY B;  3DDP B;  3MIA B;  4I3Z B;  4BCH B;  2WMA B;  2PK2 A;  4FX3 B;  1OKV B;  5HBH B;  2C4G B;  2WIH B;  4CFV B;  4EOP B;  4BCO B;  1VYW B;  1W98 B;  3K7A M;  4YOS A;  1H1P B;  4OGR B;  4BCQ D;  1KXU A;  2R7G A;  1UNL D;  4F7J B;  4BCI B;  4F7S B;  1OIY B;  4CFW B;  2CCH B;  1O9K B;  5LMK B;  2UZL B;  4BCM B;  4CFU B;  4CRL B;  4YOO A;  4ROD A;  5CEI B;  2IW6 B;  4Y72 B;  5ICP B;  1H25 B;  1JOW A;  1OGU B;  1OKW B;  1TFB A;  5HBE B;  2B9R A;  2UZD B;  4UN0 A;  3TNH B;  1PKD B;  2WHB B;  2WMB B;  3F5X B;  4BCK B;  2EUF A;  4OR5 B;  4ELJ A;  1H26 B;  4EOS B;  4CFX B;  2G9X B;  1E9H B;  2W9F A;  4EC8 B;  3POM A;  4BCQ B;  4BCN D;  3H4C A;  2IW8 B;  1QMZ B;  3LQ5 B;  2C5O B;  1UNH D;  1OIU B;  1OL2 B;  1XO2 A;  2F2C A;  3O0G D;  1VOL A;  4YC3 B;  2W96 A;  2PK9 B;  1GH6 B;  4CFN B;  3BLQ B;  3DOG B;  4EOL B;  4CFM B;  1H1R B;  1GUX A;  4EOM B;  4TTH A;  5BNJ B;  4ROC A;  3TNI B;  1OL1 B;  2CJM B;  3EJ1 B;  4II5 B;  1GY3 B;  1H28 B;  4F6S B;  4ROE A;  2UUE B;  2C5X B;  5LQF B;  2IVX A;  4BCJ B;  3QHW B;  5HBJ B;  5HVY B;  3RGF B;  2BKZ B;  2I40 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...