4HLQA

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
molecule keywords TBC1 domain family member 20
total genus 95
structure length 280
sequence length 280
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hlqA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hlqA02
2G77A 1FKMA 2QFZA 3QYEA 4Z6YA 4HL4A 3QWLA 3HZJA 3QYBA 2QQ8A 4HLQA 4NC6A 5EJCA
chains in the Genus database with same CATH superfamily
2QBYB 4JI1M 2JA2A 4CHTB 2BKZB 3EJ1B 3MY5B 4MFEA 4P16A 3J7BA 3K1JA 2Z4RA 3KOWE 3M0EA 4I81A 3VLFB 5ITTA 2CV1A 3VKHA 4OVZA 4M0DA 4LJ7A 2K6BA 1HT1E 4OVZB 4RKUF 1OKWB 2BS3A 2AHJB 3Q8XA 3PO3S 3SMSA 3BHTB 3BOSA 2K47A 3T6PA 3ZCBB 4GEWA 3H4JA 1K3WA 1VYWB 4F70B 1IY0A 1E9RA 2CHGA 2MH8A 3J2PB 4JI0M 5ITXA 4CJ6A 2UZDB 4KRCB 1ZQ9A 2WSCF 1VEKA 1VEGA 3A8MB 4L16A 3T1HM 3PXGA 4M6VA 3WVDB 4IIWA 5IDPB 5DFLA 5L2WB 4AI6A 1GJSA 2QGSA 3HU3A 1JR3D 2RGOA 4FW9A 1ENWA 1Y8GA 1PRBA 1WXQA 3BG3A 3BLHB 4I4LA 1IN5A 1YSYA 3KXEC 3SYKA 1VINA 5FTJA 1N32M 3F5XB 5EJCA 5KPZA 1NNJA 4B3SM 2WMBB 4OB0B 4QOZC 1G71A 2D7EA 4XK8F 3TW7A 1TH4A 4G6ZA 3U6EA 2LBCA 2X4AA 4IBCA 3UZUA 4FWHA 4LJ4A 3UMMA 2KDLA 1JR3A 1JQJC 4HEOA 4PCZA 2CV2A 2QFZA 1WJ7A 1GUXB 4BCMD 5CEIB 2CYZB 3QWLA 1HJPA 4EOIB 2AHMA 1WR1B 1Z6TA 2M5ZA 2V1CA 4DV7M 4JI2M 1C1KA 1L2CA 1OKVB 4II5B 3NDQA 2DZNB 5ITRA 2PMIB 4TUWA 2CE7A 3K8ZA 3HHWA 3DDPB 3UJNA 2B9RA 1T6OA 2ZM6M 3FKEA 3BHVB 3U6PA 3HO8A 3B74A 4LF8M 1BU2A 3J27B 4XGIA 4PDIA 4ZGJB 1D2NA 4PDGA 1GL7A 2QENA 3AV0A 2DZOB 4AG5A 4CISA 4GHAA 3J80S 2UXCM 1TD6A 4EONB 2WIHB 2JP7A 2RRUA 4HNVA 4LFCM 4F2LA 1JSUB 2G8LA 4IBFA 2J7NA 1HNZM 2F2CA 1H25B 3TQSA 2O25A 3C58A 1IXSB 2QDJA 2KEBA 5EP2A 2DAMA 4CXAB 4EOKB 1LTMA 1X37A 1K82A 4BCFB 2FFJA 5HBHB 3FUUA 4DR2M 4BCQB 4CFUB 2DVWB 3GLGB 4LGYA 3GLGA 1E7PA 4ANRA 2R65A 3SMPA 5A2QS 1Q39A 2QF7A 3MJ5A 3U5ZB 4G3OA 3M6AA 2ZCFB 4G4OA 3GRRA 2UXBM 1TH2A 2ZAMA 2C4GB 3HJ8A 2UZBB 3BG5A 4RF1A 2BJVA 2BJWA 4ZPXA 5JI2E 4FM4B 2WPAB 1MN3A 5IWAM 2C9OA 1N78A 1HT2E 2XZFA 4ITQA 4EIWA 4WP2A 3U6MA 2JZ1A 4L4UA 4MGZE 2D7HA 2XEPA 2W82A 4II7A 4A3VB 3GLIE 1OL1B 3J7AS 3PVSA 2BWEA 1DO2A 2RGHA 5EXPA 2WXVB 1UGPB 2DWNA 3GLHA 3C3EA 3HHTB 5FTLA 1QZEA 4IBBA 3GLFE 2HCBA 4JV5M 2UUCM 1F5QB 4CFMB 1V34A 2C5VB 3WVEB 2LTUA 3U6CA 1DGHB 2LVAA 2ZPIB 3A8LB 1VEJA 4DV2M 2CZ1B 3DOAA 3IG5A 3HU2A 3EIEA 4B7FA 1DGBA 2G3QA 1XWIA 1XO2A 4OW0A 3KS8A 2PK9B 2K0BX 3ZQJA 3B7QA 3E4RA 2UUEB 4DV4M 3EIDB 4EOSB 2WFYB 3U61B 4MFDA 3KS4A 3PNVA 5IT9S 5FLXS 2I53A 4BY7X 1GUXA 4LJ8A 4RODA 1N36M 3A42A 1J7KA 4QSHA 5E26A 1N34M 5EQTA 4JX5A 3R9XB 5IDNB 1FNNA 2CCIB 4X62M 4DV3M 2Y21A 4ROCA 3BBZA 3D8LA 3VK7A 3L29A 2IW9B 1QUTA 1H24B 3JR5A 2ZPHB 2J7OA 2ZANA 2WZJA 1VQ1A 3LCUA 2LVQD 2CHQA 3GLHB 4NSTB 3CF0A 4BY1X 1D0LA 3FRHA 2DXIA 5DQWA 4IJFA 4QHSA 3LQRA 3A8HB 1GLNA 1DGHA 2CJMB 4JI3M 2FH0A 2KRKA 2KW0A 4DR4M 3HHZA 2R18A 1XXHA 1PJTA 1NV9A 2Q2EB 3GRUA 3K2LA 4FCWA 1YE9A 4REZA 5EP1A 5EXTA 4BB9A 3TW6A 1XB2B 4P17A 4XBOA 1FINB 3X28B 2QDYB 1HNXM 2P5TA 1HQYE 1XMOM 2FS1A 3U60B 1GVNA 2O01F 2LXEA 4MM3B 2DWLA 1IXRC 4EOQB 3W68A 3GQ3A 1SXJC 4HLQA 2ZTCA 4AKIA 4LF4M 5I5ZB 3L2AA 3QAUA 4NL4H 2VF8A 3U6SA 2FNAA 2FOIC 2CEAA 2JGZB 3QYHB 2G9XB 4EC8B 4F6WB 2XF3A 4GH9A 4LFAM 3SC3A 1UGRB 2DMEA 1YUBA 3DFZA 2PHGA 2ZZDB 3HY5A 2KMGA 2L7HA 1DO0A 1JSTB 1ZAEA 1R2ZA 2L09A 1LV7A 1SG9A 1JOWA 5IF1B 1QAMA 3DJBA 2UXDM 4LY6A 5DYGA 3SARA 2MROB 1R6BX 2KHHA 4ELLA 4EOOB 2JY7A 4L15A 5EP4A 4AW4A 1XXHB 1DGGA 3J81S 2F5SA 2C5NB 3IECA 4QOSA 4NXMM 4L6V6 2G77A 3I04M 4BXXX 1QDTA 3ZC7B 2XLJA 1TH3A 4DR5M 5ITUA 3IHPA 3MHVC 4X65M 5F3WA 2F5PA 1R4GA 2WIPB 4F7SB 1QQWA 4BCNB 3PNYA 1GL6A 3GQ5A 3FUVA 2HL7A 4F7JB 3HHXA 4GIPA 4NSOB 1OTRA 2D7GA 3UGJA 1H6UA 3GLIA 1L8QA 1NV8A 2HWJA 2VQFM 1FKMA 4W5WA 2UU9M 4DV1M 4BLCA 1R5LA 4QHTA 3FUWA 2L4FA 1PJIA 2BPMB 1C9BA 2I40B 3GLHE 3KOYE 3NBXX 1URCB 4KRDB 1JB0F 3FTFA 4EORB 1E94E 3HJSA 3GPYA 1D3UB 3CGWA 3FTCA 1T3TA 4M9XA 4RNAA 2EA0A 2R4EA 1XNRM 4MIMA 3TNIB 2XSZA 1CUKA 1KYIA 2DAIA 3FUTA 5C1BA 5LMUM 4PD2A 8CATA 3NBIA 2HHHM 3B57A 5IZ7D 4NRWA 1Q3BA 3QHWB 5CYIB 2C99A 2LH0A 1G3NC 2CCHB 1QYRA 1N4MA 1QANA 4OR5B 1UGSB 2DHRA 4BCIB 3L28A 3RGPA 3CTWB 3EIHA 3WHKA 3CF6E 4BBAA 3DOGB 2F4VM 4DR7M 1GKIA 3SATA 4EC9B 5ICPB 3B7NA 4GMQA 4WW0A 4Z8XA 4CRLB 3R8FA 2L6OA 4OB2B 3U6DA 3T15A 3VYGB 2V22B 2C5XB 2BWBA 2W9FA 5EP3A 4BCGB 3GPXA 4FWDA 2C9CA 1XNQM 4LFBM 4OB3B 2R62A 2L2DA 3LQ5B 3KVWA 2O5RA 3A45A 4LRTA 4MB7A 1QZMA 3I51A 5IHYA 4LCBA 3DDQB 4MGIE 4B3TM 3M7GA 2CV0A 1AUAA 4F7NB 5ACBA 5FSWA 1Z5AA 2UUAM 4JI5M 1ZMWA 4YOOA 1SXJA 3L26A 4JI8M 5JI3E 2N35A 1XXHE 4FD2A 4UN2B 2FE8A 1TFBA 3GQ4A 2QZ4A 1XC8A 3OTOM 4FVMA 2ZPGB 3E9SA 3T38A 3RE8A 2QPAA 3KHIA 2DD4B 1HR0M 1NVMA 4BCND 2VF7A 4LZJA 4HNTA 2WHBB 3NWLA 4DR3M 3HU1A 2LNHC 2Z3XA 2JWSA 4JI6M 3HX3A 4DV6M 2BS2A 3DL1A 5H37D 1D0MA 4DUYM 3AL0C 2DWZB 1ZP2A 1AIPC 4WURA 4LJ5A 5FTMA 2KNZA 2QBYA 2CRUA 4NC6A 2V1UA 2BS4A 4B08A 3FTDA 1OKSA 2KNVA 1W5SA 2ZAOA 4IBDA 3SAVA 1OIPA 2W99A 2XSZD 3KSJA 4JX6A 4BBRM 2LW4A 1PKDB 1Z5CA 2OOBA 2R46A 5IREB 2DAGA 1DGFA 2PK2A 3HB9A 3DTOA 4G6LB 2EUCA 2Y0TA 4B7GA 4L8RC 2PJQA 3TE6A 1H4LD 3X25B 2I7NA 3TN8B 1V33A 1Q02A 2CUZA 2VDBB 3VDPA 5HQ0B 2YQZA 3AOGA 1XMQM 1MU5A 2Y0QA 4S12A 5KO3A 2J5YA 3KDSE 2WMAB 4GHLA 3PFIA 4LGMA 1UFZA 3BG9A 3KP0E 5GKNA 1G59A 3WHLA 2OOAA 2E5LM 1IXZA 4BCMB 4KLNA 2QP9X 5HVYB 3IG8A 3A8OB 4IBKA 1PGYA 2QHOB 2XFSA 2CP8A 1ZV1A 3LQQA 2R44A 3C9PA 3L25A 2DKLA 2OPFA 1HNWM 4GRIA 2MR9A 1TGUA 4LJAA 5KQ8A 3A46A 1OGUB 3U6QA 2UZLB 3POMA 2JXNA 3M03A 2X8AA 2IW6B 5BNJB 1HQCA 2JY8A 3LVVA 2CZ0B 2C96A 1IBLM 1SXJD 2WSEF 4Z6YA 1WGNA 3U6OA 3TNHB 3HZJA 2K9DA 4EOJB 1OL2B 4CIZA 4JI4M 4G4QA 2CZ7B 4YHHM 1G41A 3GRVA 3H4CA 1C7YA 4OGRB 1WHCA 4OU7A 5ITQA 5KPTA 4HNUA 2NQ8C 1EFUB 2DZLA 4HL4A 1A5TA 1L1TA 2W96A 4CFVB 4MGYE 2KA6B 3I01M 3QXEB 4BBSM 2LVNC 4GC9A 3QYGB 5FTNA 4IBGA 2R0IA 2APLA 4YY3M 1R2YA 4NXNM 1IREB 4CFUD 2R6FA 4M9SA 1UGQB 1H26B 4DUZM 1O9KA 3HKPA 3I4YA 4L78A 2F5OA 3SBJA 3ZH9B 3GLFB 3KFUG 1OIUB 2I7PA 2HKJA 3FRIA 3FUXA 2R7GA 2KXEA 4LF9M 1G8PA 3BLRB 3X20B 1IFYA 2QCUA 4FCTA 4CGYB 5BR8M 3FTEA 2IVXA 4I3ZB 2R4JA 1MX0A 1XHBA 3TNWB 2XFTA 3K7AM 1UNLD 2R45A 3QHRB 1IY1A 1E32A 7CATA 3Q8GA 2CZ6B 2GNOA 1Z5BA 2M60A 2MJ5B 3KSXA 2C6TB 2Y20A 3GPUA 1DV0A 2QNJA 4F6UB 2C5OB 3A98B 4ZGEB 2JZ0A 1QLBA 1KFVA 1OFHA 1TTEA 1GO5A 4DR1M 2OQ4A 1TDHA 1TDZA 5FTKA 3C3DA 4K0KM 2C5RA 3SASA 5LQFB 2YNMD 3GP1A 2F5QA 4EOLB 1QUSA 1PJSA 1W5TA 4JI7M 5ITXE 1AISB 1SXJB 1QAQA 1WGLA 2ZTDA 3JAMS 4JYAM 3W67A 2H1RA 2HAKA 2ZBKB 2VQEM 4GC5A 1NNUC 2B3TA 4I8OA 1OIYB 2YR0A 3E21A 3LMMA 2EKFA 2YFQA 3W0LB 4KHPM 2UZEB 2G5GX 3SHFA 3AOEC 3F92A 5HNBB 3HJQA 1KSFX 1RU3A 2XGNA 4CFXB 5EXSA 1GH6B 1E9HB 2ZPBB 3QZ9B 4MGKE 3EOCB 1PJQA 1TR8A 2DAEA 2W2HA 1NJFA 4D81A 5BPVA 4F1IA 4YC3B 2WSFF 3K92A 3U6LA 1YLAA 3VYHB 2KR6A 2KRUA 1J5EM 5DYIA 3TWKA 4GITA 5E6JA 2ERCA 3SAWA 1N33M 3SFZA 3RGFB 2H5XA 3TWLA 3E46A 4X64M 2MGWA 3DZDA 4Q7JA 4ZGDB 3FYDA 3HWSA 1L2BA 1EE8A 4GKJM 3X26B 3H4MA 4KO8A 5L8RF 3MY1B 1NHWC 1TF0B 1WIVA 4F7LB 4DV0M 1OFIA 2EO2A 4LF7M 1SXJE 4AG6A 3UK6A 1V29B 2LHCA 3TL4X 1D0KA 4KT0F 4AZFA 3GO8A 3AKZA 3VKGA 1Q3CA 2JUJA 1IN8A 1V92A 2KZUA 3DA1A 1N77A 1UNGD 1OI9B 2Z7JA 4LF6M 3MMPA 2DXBB 4DR6M 4NOOB 2WEVB 1H1RB 3GPPA 2Z4SA 2LVOC 4JN6A 2X49A 2DD5B 2C98A 2W9ZA 3HBLA 3FE3A 4IBEA 5LMKB 5ITYA 3LW5F 3W0FA 2OO9A 2UUBM 2QSFX 2IW8B 3A8GB 4NSRA 1NY5A 3FYCA 4FCVA 4LJ9A 2JY5A 4R3DA 1F4IA 1H27B 1KXUA 1I94M 2V6ZM 5EXXA 4B7HA 4LZZA 3RFWA 3SAUA 3U61A 4M9ZA 1IY2A 3KW6A 2VIIA 4YOSA 1QVRA 1AD6A 2WJ9A 3TWMA 4I5SA 1OAIA 3AJIB 3QZ5B 1IQPA 1L1ZA 4RF0A 2ZPFB 4LOCA 1K3XA 4IJEA 1QDRA 1VDDA 3MK6A 4MH0E 2DAKA 3K9OA 4LG2A 3QYEA 1NJGA 1NY6A 4FWGA 4JX4A 3MIAB 3U5ZA 4D80A 2EKKA 1OJLA 3HGIA 3KOXE 1H28B 2CWBA 4D82A 4LF5M 2JY6B 1GABA 4BCKB 3BXWA 2LHGA 1P3QQ 4FX3B 3GLIB 2IN3A 4AKGA 2DWMA 1OIZA 4IMYB 4M0WA 2JNHA 2RKOA 3AFHA 1IBKM 4F6SB 5DQVA 3VFDA 2DXCB 4GKKM 2DNAA 1FJGM 3HHYA 3V76A 2DENA 3GLFA 5HBEB 1FVVB 5DNYA 3T1YM 1PJJA 2ZPEB 4BCJB 4ROEA 1QMZB 4EOMB 4DBGB 2F5NA 2KZSA 2EUFA 1VDLA 2DI0A 3CF2A 4LJ6A 4NRVA 1IM2A 3RGSA 2L7IA 3L27A 4AQYM 1J09A 3K9PA 2KNAA 1PM5A 1ORYB 3U60A 1O9KB 3X24B 4JXJA 4IBJA 1G4AE 1ZMUA 5KPRA 1OAOC 4AKHA 2D0QB 1IXSA 3THGA 3GRYA 3QYBA 4BCOB 3AOEA 1H1SB 1VG5A 1ZMVA 3JR4A 1H1PB 2CFOA 3VK8A 4TTHA 1UNHD 2Z8YM 4YOZA 1VOLA 3B89A 3SHGB 3TPZA 5EFQB 4KODA 4MGHA 1UM8A 1G3IA 1T43A 1BVSA 3FD9A 1E9SA 1GJTA 1N75A 2EJSA 5KQDA 4B3MM 1P5EB 2CHVA 2XZUA 4R71A 4OX9M 3GTMS 1R7RA 3ILKA 3SYLA 3LVWA 4BCHB 2DPPB 4OB1B 1IN6A 4LRSA 4Y28F 5LMNM 1H1QB 3MI9B 4BCQD 4G4RA 1QAOA 1IN4A 2XH9A 4R7GA 1AHJB 3KOZE 3G33B 4UN0A 1NO1A 4QNMA 2X1NB 1Z59A 1IBMM 4CFNB 2BNKA 1I4WA 3KP1E 3GLGE 3I4VA 3BHUB 5FGKB 4QNRA 4EOPB 3D8BA 3LCVB 4PT5A 4G4NA 1NHGC 2GQFA 1EIJA 1L2DA 4Y72B 3VDUA 4BCPB 3B7ZA 3O0GD 4ELJA 3BLQB 2DHYA 4B3RM 1IN7A 4CFWB 2LWXA 4DV5M 1S3SA 5HBJB 5C18A 1JKWA 4X66M 2QQ8A 1JR3E 1OQYA 4IBIA 1W98B 1MJGM 3B9PA 2L4EA 1NSFA 2A5YB 1GY3B 2LVPC
chains in the Genus database with same CATH topology
2QBYB 4JI1M 2JA2A 4CHTB 4MFEA 4P16A 3J7BA 3K1JA 2Z4RA 3KOWE 3M0EA 4I81A 3VLFB 5ITTA 2CV1A 3VKHA 4OVZA 4M0DA 4LJ7A 2BS3A 1HT1E 4OVZB 2ZPEB 2AHJB 3Q8XA 3SMSA 3BOSA 2K47A 3ZCBB 1K3WA 1IY0A 1E9RA 2CHGA 3J2PB 4JI0M 5ITXA 1ZQ9A 3A8MB 4L16A 3T1HM 3PXGA 4M6VA 3WVDB 4IIWA 4AI6A 3HU3A 1JR3D 2RGOA 4FW9A 1WXQA 3BG3A 4I4LA 1IN5A 1YSYA 3KXEC 3SYKA 5FTJA 1N32M 5EJCA 5KPZA 1NNJA 4B3SM 4OB0B 4QOZC 3TW7A 2D7EA 1TH4A 4G6ZA 3U6EA 4IBCA 2X4AA 3UZUA 4FWHA 4LJ4A 3UMMA 1JR3A 1JQJC 4PCZA 2QFZA 2CV2A 2CYZB 3QWLA 2AHMA 2V1CA 1Z6TA 2M5ZA 4DV7M 4JI2M 1C1KA 1L2CA 2DZNB 5ITRA 4TUWA 2CE7A 3K8ZA 3HHWA 3UJNA 2ZM6M 3FKEA 3HO8A 3U6PA 4ZGJB 4LF8M 3J27B 4XGIA 4PDIA 1D2NA 4PDGA 1GL7A 2QENA 3AV0A 2DZOB 4AG5A 4CISA 4GHAA 3J80S 2UXCM 4HNVA 4LFCM 2G8LA 4IBFA 2J7NA 1HNZM 2QDJA 3TQSA 3C58A 1IXSB 2KEBA 5EP2A 1X37A 1K82A 2FFJA 3FUUA 4DR2M 2DVWB 3GLGB 4LGYA 3GLGA 1E7PA 2R65A 3SMPA 5A2QS 1Q39A 2QF7A 3MJ5A 3U5ZB 3M6AA 3BG5A 4G4OA 3GRRA 2UXBM 1TH2A 2ZAMA 3HJ8A 4RF1A 2BJVA 2BJWA 4ZPXA 5JI2E 5IWAM 2C9OA 1N78A 1HT2E 2XZFA 4ITQA 4EIWA 3U6MA 4L4UA 4MGZE 2D7HA 2XEPA 2W82A 4II7A 4A3VB 3J7AS 3PVSA 1DO2A 2RGHA 5EXPA 1UGPB 2DWNA 3GLHA 3HHTB 5FTLA 4IBBA 2HCBA 4JV5M 2UUCM 3WVEB 3U6CA 1DGHB 2ZPIB 3A8LB 2CZ1B 4DV2M 3DOAA 3IG5A 3HU2A 3EIEA 4B7FA 1DGBA 1XWIA 4OW0A 3KS8A 3E4RA 4DV4M 3U61B 4MFDA 3KS4A 3PNVA 5IT9S 5FLXS 4LJ8A 1N36M 3A42A 1J7KA 5E26A 1N34M 5EQTA 4JX5A 3R9XB 1FNNA 2A5YB 4X62M 4DV3M 2Y21A 3D8LA 3VK7A 3L29A 2ZPHB 3JR5A 2J7OA 2ZANA 2CHQA 3GLHB 3CF0A 2DXIA 4IJFA 4QHSA 3LQRA 3A8HB 1GLNA 1DGHA 4JI3M 2KRKA 2KW0A 4DR4M 3HHZA 2R18A 1XXHA 3K2LA 2Q2EB 3GRUA 4REZA 5EXTA 4FCWA 1YE9A 5EP1A 4BB9A 3TW6A 4XBOA 3X28B 2QDYB 1HNXM 2P5TA 1HQYE 1XMOM 3U60B 1GVNA 2DWLA 2LXEA 4MM3B 1IXRC 3GQ3A 1SXJC 4HLQA 4AKIA 4LF4M 3L2AA 3QAUA 4NL4H 3U6SA 3QYHB 2FNAA 2FOIC 2CEAA 2XF3A 4GH9A 4LFAM 3SC3A 1UGRB 1YUBA 3DFZA 2KMGA 2L7HA 1DO0A 1ZAEA 1R2ZA 2L09A 1LV7A 1QAMA 2UXDM 4LY6A 5DYGA 1R6BX 5EP4A 4L15A 2F5SA 4AW4A 1XXHB 1DGGA 3J81S 4QOSA 4NXMM 2G77A 3ZC7B 2XLJA 1TH3A 4DR5M 5ITUA 3MHVC 4X65M 5F3WA 2F5PA 1QQWA 3PNYA 1GL6A 3GQ5A 3FUVA 2HL7A 3HHXA 4GIPA 4NSOB 2D7GA 3UGJA 1H6UA 3GLIA 1L8QA 2VQFM 1FKMA 4W5WA 2UU9M 4DV1M 4BLCA 4QHTA 3FUWA 1PJIA 3KOYE 3FTFA 1E94E 3HJSA 3GPYA 4M9XA 3FTCA 1T3TA 4RNAA 4MIMA 2EA0A 2R4EA 1XNRM 2XSZA 1KYIA 5C1BA 3FUTA 5LMUM 4PD2A 8CATA 3NBIA 2HHHM 5IZ7D 4NRWA 1Q3BA 2C99A 2LH0A 1QYRA 1QANA 1UGSB 2DHRA 3L28A 3RGPA 3CTWB 3EIHA 3WHKA 3CF6E 4BBAA 2F4VM 4DR7M 1GKIA 3SATA 4GMQA 4WW0A 4Z8XA 3R8FA 2L6OA 4OB2B 3U6DA 3T15A 3VYGB 5EP3A 3GPXA 4FWDA 2C9CA 1XNQM 4LFBM 4OB3B 2R62A 3KVWA 2O5RA 3A45A 4LRTA 4MB7A 1QZMA 3I51A 4LCBA 4MGIE 4B3TM 3M7GA 2CV0A 5FSWA 1Z5AA 2UUAM 4JI5M 1SXJA 3L26A 4JI8M 5JI3E 4FD2A 2FE8A 3GQ4A 2QZ4A 1XC8A 3OTOM 4FVMA 2ZPGB 3E9SA 3T38A 3RE8A 2QPAA 3KHIA 2DD4B 1HR0M 1NVMA 4LZJA 3NWLA 4DR3M 3HU1A 2LNHC 2Z3XA 4JI6M 3DL1A 4DV6M 2BS2A 5H37D 4DUYM 3AL0C 2DWZB 4WURA 4LJ5A 5FTMA 2QBYA 2BS4A 2V1UA 4NC6A 4B08A 3FTDA 1W5SA 2ZAOA 4IBDA 3SAVA 4JX6A 4BBRM 2XSZD 3KSJA 1Z5CA 2R46A 5IREB 3HB9A 1DGFA 2EUCA 2Y0TA 4B7GA 4L8RC 3TE6A 3X25B 2I7NA 2CUZA 3VDPA 2YQZA 3AOGA 1XMQM 1MU5A 2Y0QA 4S12A 5KO3A 3KDSE 4GHLA 3PFIA 4LGMA 3BG9A 3KP0E 5GKNA 1G59A 3WHLA 2E5LM 1IXZA 4KLNA 2QP9X 3IG8A 3A8OB 4IBKA 3LQQA 2XFSA 3L25A 2OPFA 1HNWM 4GRIA 1TGUA 4LJAA 5KQ8A 3A46A 3U6QA 2X8AA 1HQCA 3LVVA 2CZ0B 2C96A 1IBLM 1SXJD 4Z6YA 3U6OA 3HZJA 4JI4M 4G4QA 2CZ7B 4YHHM 1G41A 3GRVA 3H4CA 4OU7A 5ITQA 5KPTA 4HNUA 2NQ8C 4HL4A 1L1TA 4MGYE 2KA6B 3QXEB 4BBSM 4GC9A 3QYGB 5FTNA 4IBGA 4YY3M 1IREB 1R2YA 4NXNM 4M9SA 1UGQB 4DUZM 3HKPA 3I4YA 4L78A 2F5OA 3SBJA 3ZH9B 3GLFB 3KFUG 2I7PA 2HKJA 3FUXA 2KXEA 4LF9M 1G8PA 3X20B 2QCUA 4FCTA 4CGYB 5BR8M 3FTEA 2R4JA 1MX0A 1XHBA 2XFTA 2R45A 1IY1A 1E32A 7CATA 2CZ6B 1Z5BA 2M60A 3KSXA 2Y20A 3GPUA 3A98B 4ZGEB 1QLBA 1KFVA 1OFHA 4DR1M 2OQ4A 1TDHA 1TDZA 5FTKA 4K0KM 2C5RA 3SASA 2YNMD 3GP1A 2F5QA 1W5TA 4JI7M 5ITXE 1SXJB 1QAQA 3JAMS 4JYAM 2H1RA 2VQEM 2ZBKB 4GC5A 1NNUC 4I8OA 2YR0A 3LMMA 2YFQA 4KHPM 3W0LB 2G5GX 3SHFA 3AOEC 3HJQA 1KSFX 2XGNA 5EXSA 2ZPBB 3QZ9B 4MGKE 1NJFA 4D81A 5BPVA 3K92A 3U6LA 3VYHB 2KR6A 2KRUA 1J5EM 5DYIA 3TWKA 4GITA 5E6JA 2ERCA 3SAWA 1N33M 3SFZA 3TWLA 4X64M 3DZDA 4ZGDB 3FYDA 3HWSA 1L2BA 1EE8A 4GKJM 3X26B 3H4MA 4KO8A 1NHWC 4DV0M 1OFIA 2EO2A 4LF7M 1SXJE 4AG6A 3UK6A 1V29B 3TL4X 4AZFA 3GO8A 3AKZA 3VKGA 1Q3CA 1IN8A 2KZUA 1N77A 3DA1A 4QSHA 2Z7JA 4LF6M 2DXBB 4DR6M 4NOOB 3GPPA 2Z4SA 4JN6A 2DD5B 2X49A 2C98A 3HBLA 4IBEA 5ITYA 3W0FA 2UUBM 3A8GB 4NSRA 1NY5A 3FYCA 4FCVA 4LJ9A 4R3DA 1I94M 2V6ZM 5EXXA 4B7HA 4LZZA 3RFWA 3SAUA 3U61A 4M9ZA 1IY2A 3KW6A 2VIIA 1QVRA 2WJ9A 3TWMA 4I5SA 3AJIB 3QZ5B 1IQPA 1L1ZA 4RF0A 2ZPFB 4LOCA 1K3XA 4IJEA 1VDDA 2ZZDB 3MK6A 4MH0E 4LG2A 4JX4A 3QYEA 1NJGA 1NY6A 4FWGA 3U5ZA 4D80A 3KOXE 1OJLA 3HGIA 4LF5M 4D82A 3GLIB 4AKGA 2DWMA 4M0WA 2RKOA 1IBKM 3VFDA 2DXCB 4GKKM 1FJGM 3HHYA 3GLFA 5DNYA 3T1YM 1PJJA 2F5NA 2KZSA 4LJ6A 3CF2A 4NRVA 3RGSA 1IM2A 4AQYM 2L7IA 3L27A 1PM5A 1J09A 1ORYB 3U60A 3X24B 4JXJA 4IBJA 1G4AE 5KPRA 4AKHA 2D0QB 3THGA 3GRYA 3QYBA 3AOEA 3JR4A 2CFOA 3VK8A 3SHGB 3TPZA 4KODA 4MGHA 1UM8A 1G3IA 3SARA 3FD9A 4B3MM 1E9SA 1N75A 5KQDA 4FM4B 4HNTA 2CHVA 2XZUA 4OX9M 1R7RA 3ILKA 3SYLA 3LVWA 2DPPB 4OB1B 1IN6A 4LRSA 5LMNM 4G4RA 1QAOA 1IN4A 2XH9A 4R7GA 1AHJB 3KOZE 4QNMA 1Z59A 1IBMM 2BNKA 1I4WA 3KP1E 3I4VA 4QNRA 3D8BA 4PT5A 4G4NA 1NHGC 1L2DA 3VDUA 4ELJA 4B3RM 1IN7A 2LWXA 4DV5M 1S3SA 5C18A 4X66M 2QQ8A 4IBIA 3B9PA 1NSFA 3AFHA 2ZCFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G77 A;  1FKM A;  2QFZ A;  3QYE A;  4Z6Y A;  4HL4 A;  3QWL A;  3HZJ A;  3QYB A;  2QQ8 A;  4HLQ A;  4NC6 A;  5EJC A; 
#chains in the Genus database with same CATH topology
 2QBY B;  4JI1 M;  2JA2 A;  4CHT B;  2BKZ B;  3EJ1 B;  3MY5 B;  4MFE A;  4P16 A;  3J7B A;  3K1J A;  2Z4R A;  3KOW E;  3M0E A;  4I81 A;  3VLF B;  5ITT A;  2CV1 A;  3VKH A;  4OVZ A;  4M0D A;  4LJ7 A;  2K6B A;  1HT1 E;  4OVZ B;  4RKU F;  1OKW B;  2BS3 A;  2AHJ B;  3Q8X A;  3PO3 S;  3SMS A;  3BHT B;  3BOS A;  2K47 A;  3T6P A;  3ZCB B;  4GEW A;  3H4J A;  1K3W A;  1VYW B;  4F70 B;  1IY0 A;  1E9R A;  2CHG A;  2MH8 A;  3J2P B;  4JI0 M;  5ITX A;  4CJ6 A;  2UZD B;  4KRC B;  1ZQ9 A;  2WSC F;  1VEK A;  1VEG A;  3A8M B;  4L16 A;  3T1H M;  3PXG A;  4M6V A;  3WVD B;  4IIW A;  5IDP B;  5DFL A;  5L2W B;  4AI6 A;  1GJS A;  2QGS A;  3HU3 A;  1JR3 D;  2RGO A;  4FW9 A;  1ENW A;  1Y8G A;  1PRB A;  1WXQ A;  3BG3 A;  3BLH B;  4I4L A;  1IN5 A;  1YSY A;  3KXE C;  3SYK A;  1VIN A;  5FTJ A;  1N32 M;  3F5X B;  5EJC A;  5KPZ A;  1NNJ A;  4B3S M;  2WMB B;  4OB0 B;  4QOZ C;  1G71 A;  2D7E A;  4XK8 F;  3TW7 A;  1TH4 A;  4G6Z A;  3U6E A;  2LBC A;  2X4A A;  4IBC A;  3UZU A;  4FWH A;  4LJ4 A;  3UMM A;  2KDL A;  1JR3 A;  1JQJ C;  4HEO A;  4PCZ A;  2CV2 A;  2QFZ A;  1WJ7 A;  1GUX B;  4BCM D;  5CEI B;  2CYZ B;  3QWL A;  1HJP A;  4EOI B;  2AHM A;  1WR1 B;  1Z6T A;  2M5Z A;  2V1C A;  4DV7 M;  4JI2 M;  1C1K A;  1L2C A;  1OKV B;  4II5 B;  3NDQ A;  2DZN B;  5ITR A;  2PMI B;  4TUW A;  2CE7 A;  3K8Z A;  3HHW A;  3DDP B;  3UJN A;  2B9R A;  1T6O A;  2ZM6 M;  3FKE A;  3BHV B;  3U6P A;  3HO8 A;  3B74 A;  4LF8 M;  1BU2 A;  3J27 B;  4XGI A;  4PDI A;  4ZGJ B;  1D2N A;  4PDG A;  1GL7 A;  2QEN A;  3AV0 A;  2DZO B;  4AG5 A;  4CIS A;  4GHA A;  3J80 S;  2UXC M;  1TD6 A;  4EON B;  2WIH B;  2JP7 A;  2RRU A;  4HNV A;  4LFC M;  4F2L A;  1JSU B;  2G8L A;  4IBF A;  2J7N A;  1HNZ M;  2F2C A;  1H25 B;  3TQS A;  2O25 A;  3C58 A;  1IXS B;  2QDJ A;  2KEB A;  5EP2 A;  2DAM A;  4CXA B;  4EOK B;  1LTM A;  1X37 A;  1K82 A;  4BCF B;  2FFJ A;  5HBH B;  3FUU A;  4DR2 M;  4BCQ B;  4CFU B;  2DVW B;  3GLG B;  4LGY A;  3GLG A;  1E7P A;  4ANR A;  2R65 A;  3SMP A;  5A2Q S;  1Q39 A;  2QF7 A;  3MJ5 A;  3U5Z B;  4G3O A;  3M6A A;  2ZCF B;  4G4O A;  3GRR A;  2UXB M;  1TH2 A;  2ZAM A;  2C4G B;  3HJ8 A;  2UZB B;  3BG5 A;  4RF1 A;  2BJV A;  2BJW A;  4ZPX A;  5JI2 E;  4FM4 B;  2WPA B;  1MN3 A;  5IWA M;  2C9O A;  1N78 A;  1HT2 E;  2XZF A;  4ITQ A;  4EIW A;  4WP2 A;  3U6M A;  2JZ1 A;  4L4U A;  4MGZ E;  2D7H A;  2XEP A;  2W82 A;  4II7 A;  4A3V B;  3GLI E;  1OL1 B;  3J7A S;  3PVS A;  2BWE A;  1DO2 A;  2RGH A;  5EXP A;  2WXV B;  1UGP B;  2DWN A;  3GLH A;  3C3E A;  3HHT B;  5FTL A;  1QZE A;  4IBB A;  3GLF E;  2HCB A;  4JV5 M;  2UUC M;  1F5Q B;  4CFM B;  1V34 A;  2C5V B;  3WVE B;  2LTU A;  3U6C A;  1DGH B;  2LVA A;  2ZPI B;  3A8L B;  1VEJ A;  4DV2 M;  2CZ1 B;  3DOA A;  3IG5 A;  3HU2 A;  3EIE A;  4B7F A;  1DGB A;  2G3Q A;  1XWI A;  1XO2 A;  4OW0 A;  3KS8 A;  2PK9 B;  2K0B X;  3ZQJ A;  3B7Q A;  3E4R A;  2UUE B;  4DV4 M;  3EID B;  4EOS B;  2WFY B;  3U61 B;  4MFD A;  3KS4 A;  3PNV A;  5IT9 S;  5FLX S;  2I53 A;  4BY7 X;  1GUX A;  4LJ8 A;  4ROD A;  1N36 M;  3A42 A;  1J7K A;  4QSH A;  5E26 A;  1N34 M;  5EQT A;  4JX5 A;  3R9X B;  5IDN B;  1FNN A;  2CCI B;  4X62 M;  4DV3 M;  2Y21 A;  4ROC A;  3BBZ A;  3D8L A;  3VK7 A;  3L29 A;  2IW9 B;  1QUT A;  1H24 B;  3JR5 A;  2ZPH B;  2J7O A;  2ZAN A;  2WZJ A;  1VQ1 A;  3LCU A;  2LVQ D;  2CHQ A;  3GLH B;  4NST B;  3CF0 A;  4BY1 X;  1D0L A;  3FRH A;  2DXI A;  5DQW A;  4IJF A;  4QHS A;  3LQR A;  3A8H B;  1GLN A;  1DGH A;  2CJM B;  4JI3 M;  2FH0 A;  2KRK A;  2KW0 A;  4DR4 M;  3HHZ A;  2R18 A;  1XXH A;  1PJT A;  1NV9 A;  2Q2E B;  3GRU A;  3K2L A;  4FCW A;  1YE9 A;  4REZ A;  5EP1 A;  5EXT A;  4BB9 A;  3TW6 A;  1XB2 B;  4P17 A;  4XBO A;  1FIN B;  3X28 B;  2QDY B;  1HNX M;  2P5T A;  1HQY E;  1XMO M;  2FS1 A;  3U60 B;  1GVN A;  2O01 F;  2LXE A;  4MM3 B;  2DWL A;  1IXR C;  4EOQ B;  3W68 A;  3GQ3 A;  1SXJ C;  4HLQ A;  2ZTC A;  4AKI A;  4LF4 M;  5I5Z B;  3L2A A;  3QAU A;  4NL4 H;  2VF8 A;  3U6S A;  2FNA A;  2FOI C;  2CEA A;  2JGZ B;  3QYH B;  2G9X B;  4EC8 B;  4F6W B;  2XF3 A;  4GH9 A;  4LFA M;  3SC3 A;  1UGR B;  2DME A;  1YUB A;  3DFZ A;  2PHG A;  2ZZD B;  3HY5 A;  2KMG A;  2L7H A;  1DO0 A;  1JST B;  1ZAE A;  1R2Z A;  2L09 A;  1LV7 A;  1SG9 A;  1JOW A;  5IF1 B;  1QAM A;  3DJB A;  2UXD M;  4LY6 A;  5DYG A;  3SAR A;  2MRO B;  1R6B X;  2KHH A;  4ELL A;  4EOO B;  2JY7 A;  4L15 A;  5EP4 A;  4AW4 A;  1XXH B;  1DGG A;  3J81 S;  2F5S A;  2C5N B;  3IEC A;  4QOS A;  4NXM M;  4L6V 6;  2G77 A;  3I04 M;  4BXX X;  1QDT A;  3ZC7 B;  2XLJ A;  1TH3 A;  4DR5 M;  5ITU A;  3IHP A;  3MHV C;  4X65 M;  5F3W A;  2F5P A;  1R4G A;  2WIP B;  4F7S B;  1QQW A;  4BCN B;  3PNY A;  1GL6 A;  3GQ5 A;  3FUV A;  2HL7 A;  4F7J B;  3HHX A;  4GIP A;  4NSO B;  1OTR A;  2D7G A;  3UGJ A;  1H6U A;  3GLI A;  1L8Q A;  1NV8 A;  2HWJ A;  2VQF M;  1FKM A;  4W5W A;  2UU9 M;  4DV1 M;  4BLC A;  1R5L A;  4QHT A;  3FUW A;  2L4F A;  1PJI A;  2BPM B;  1C9B A;  2I40 B;  3GLH E;  3KOY E;  3NBX X;  1URC B;  4KRD B;  1JB0 F;  3FTF A;  4EOR B;  1E94 E;  3HJS A;  3GPY A;  1D3U B;  3CGW A;  3FTC A;  1T3T A;  4M9X A;  4RNA A;  2EA0 A;  2R4E A;  1XNR M;  4MIM A;  3TNI B;  2XSZ A;  1CUK A;  1KYI A;  2DAI A;  3FUT A;  5C1B A;  5LMU M;  4PD2 A;  8CAT A;  3NBI A;  2HHH M;  3B57 A;  5IZ7 D;  4NRW A;  1Q3B A;  3QHW B;  5CYI B;  2C99 A;  2LH0 A;  1G3N C;  2CCH B;  1QYR A;  1N4M A;  1QAN A;  4OR5 B;  1UGS B;  2DHR A;  4BCI B;  3L28 A;  3RGP A;  3CTW B;  3EIH A;  3WHK A;  3CF6 E;  4BBA A;  3DOG B;  2F4V M;  4DR7 M;  1GKI A;  3SAT A;  4EC9 B;  5ICP B;  3B7N A;  4GMQ A;  4WW0 A;  4Z8X A;  4CRL B;  3R8F A;  2L6O A;  4OB2 B;  3U6D A;  3T15 A;  3VYG B;  2V22 B;  2C5X B;  2BWB A;  2W9F A;  5EP3 A;  4BCG B;  3GPX A;  4FWD A;  2C9C A;  1XNQ M;  4LFB M;  4OB3 B;  2R62 A;  2L2D A;  3LQ5 B;  3KVW A;  2O5R A;  3A45 A;  4LRT A;  4MB7 A;  1QZM A;  3I51 A;  5IHY A;  4LCB A;  3DDQ B;  4MGI E;  4B3T M;  3M7G A;  2CV0 A;  1AUA A;  4F7N B;  5ACB A;  5FSW A;  1Z5A A;  2UUA M;  4JI5 M;  1ZMW A;  4YOO A;  1SXJ A;  3L26 A;  4JI8 M;  5JI3 E;  2N35 A;  1XXH E;  4FD2 A;  4UN2 B;  2FE8 A;  1TFB A;  3GQ4 A;  2QZ4 A;  1XC8 A;  3OTO M;  4FVM A;  2ZPG B;  3E9S A;  3T38 A;  3RE8 A;  2QPA A;  3KHI A;  2DD4 B;  1HR0 M;  1NVM A;  4BCN D;  2VF7 A;  4LZJ A;  4HNT A;  2WHB B;  3NWL A;  4DR3 M;  3HU1 A;  2LNH C;  2Z3X A;  2JWS A;  4JI6 M;  3HX3 A;  4DV6 M;  2BS2 A;  3DL1 A;  5H37 D;  1D0M A;  4DUY M;  3AL0 C;  2DWZ B;  1ZP2 A;  1AIP C;  4WUR A;  4LJ5 A;  5FTM A;  2KNZ A;  2QBY A;  2CRU A;  4NC6 A;  2V1U A;  2BS4 A;  4B08 A;  3FTD A;  1OKS A;  2KNV A;  1W5S A;  2ZAO A;  4IBD A;  3SAV A;  1OIP A;  2W99 A;  2XSZ D;  3KSJ A;  4JX6 A;  4BBR M;  2LW4 A;  1PKD B;  1Z5C A;  2OOB A;  2R46 A;  5IRE B;  2DAG A;  1DGF A;  2PK2 A;  3HB9 A;  3DTO A;  4G6L B;  2EUC A;  2Y0T A;  4B7G A;  4L8R C;  2PJQ A;  3TE6 A;  1H4L D;  3X25 B;  2I7N A;  3TN8 B;  1V33 A;  1Q02 A;  2CUZ A;  2VDB B;  3VDP A;  5HQ0 B;  2YQZ A;  3AOG A;  1XMQ M;  1MU5 A;  2Y0Q A;  4S12 A;  5KO3 A;  2J5Y A;  3KDS E;  2WMA B;  4GHL A;  3PFI A;  4LGM A;  1UFZ A;  3BG9 A;  3KP0 E;  5GKN A;  1G59 A;  3WHL A;  2OOA A;  2E5L M;  1IXZ A;  4BCM B;  4KLN A;  2QP9 X;  5HVY B;  3IG8 A;  3A8O B;  4IBK A;  1PGY A;  2QHO B;  2XFS A;  2CP8 A;  1ZV1 A;  3LQQ A;  2R44 A;  3C9P A;  3L25 A;  2DKL A;  2OPF A;  1HNW M;  4GRI A;  2MR9 A;  1TGU A;  4LJA A;  5KQ8 A;  3A46 A;  1OGU B;  3U6Q A;  2UZL B;  3POM A;  2JXN A;  3M03 A;  2X8A A;  2IW6 B;  5BNJ B;  1HQC A;  2JY8 A;  3LVV A;  2CZ0 B;  2C96 A;  1IBL M;  1SXJ D;  2WSE F;  4Z6Y A;  1WGN A;  3U6O A;  3TNH B;  3HZJ A;  2K9D A;  4EOJ B;  1OL2 B;  4CIZ A;  4JI4 M;  4G4Q A;  2CZ7 B;  4YHH M;  1G41 A;  3GRV A;  3H4C A;  1C7Y A;  4OGR B;  1WHC A;  4OU7 A;  5ITQ A;  5KPT A;  4HNU A;  2NQ8 C;  1EFU B;  2DZL A;  4HL4 A;  1A5T A;  1L1T A;  2W96 A;  4CFV B;  4MGY E;  2KA6 B;  3I01 M;  3QXE B;  4BBS M;  2LVN C;  4GC9 A;  3QYG B;  5FTN A;  4IBG A;  2R0I A;  2APL A;  4YY3 M;  1R2Y A;  4NXN M;  1IRE B;  4CFU D;  2R6F A;  4M9S A;  1UGQ B;  1H26 B;  4DUZ M;  1O9K A;  3HKP A;  3I4Y A;  4L78 A;  2F5O A;  3SBJ A;  3ZH9 B;  3GLF B;  3KFU G;  1OIU B;  2I7P A;  2HKJ A;  3FRI A;  3FUX A;  2R7G A;  2KXE A;  4LF9 M;  1G8P A;  3BLR B;  3X20 B;  1IFY A;  2QCU A;  4FCT A;  4CGY B;  5BR8 M;  3FTE A;  2IVX A;  4I3Z B;  2R4J A;  1MX0 A;  1XHB A;  3TNW B;  2XFT A;  3K7A M;  1UNL D;  2R45 A;  3QHR B;  1IY1 A;  1E32 A;  7CAT A;  3Q8G A;  2CZ6 B;  2GNO A;  1Z5B A;  2M60 A;  2MJ5 B;  3KSX A;  2C6T B;  2Y20 A;  3GPU A;  1DV0 A;  2QNJ A;  4F6U B;  2C5O B;  3A98 B;  4ZGE B;  2JZ0 A;  1QLB A;  1KFV A;  1OFH A;  1TTE A;  1GO5 A;  4DR1 M;  2OQ4 A;  1TDH A;  1TDZ A;  5FTK A;  3C3D A;  4K0K M;  2C5R A;  3SAS A;  5LQF B;  2YNM D;  3GP1 A;  2F5Q A;  4EOL B;  1QUS A;  1PJS A;  1W5T A;  4JI7 M;  5ITX E;  1AIS B;  1SXJ B;  1QAQ A;  1WGL A;  2ZTD A;  3JAM S;  4JYA M;  3W67 A;  2H1R A;  2HAK A;  2ZBK B;  2VQE M;  4GC5 A;  1NNU C;  2B3T A;  4I8O A;  1OIY B;  2YR0 A;  3E21 A;  3LMM A;  2EKF A;  2YFQ A;  3W0L B;  4KHP M;  2UZE B;  2G5G X;  3SHF A;  3AOE C;  3F92 A;  5HNB B;  3HJQ A;  1KSF X;  1RU3 A;  2XGN A;  4CFX B;  5EXS A;  1GH6 B;  1E9H B;  2ZPB B;  3QZ9 B;  4MGK E;  3EOC B;  1PJQ A;  1TR8 A;  2DAE A;  2W2H A;  1NJF A;  4D81 A;  5BPV A;  4F1I A;  4YC3 B;  2WSF F;  3K92 A;  3U6L A;  1YLA A;  3VYH B;  2KR6 A;  2KRU A;  1J5E M;  5DYI A;  3TWK A;  4GIT A;  5E6J A;  2ERC A;  3SAW A;  1N33 M;  3SFZ A;  3RGF B;  2H5X A;  3TWL A;  3E46 A;  4X64 M;  2MGW A;  3DZD A;  4Q7J A;  4ZGD B;  3FYD A;  3HWS A;  1L2B A;  1EE8 A;  4GKJ M;  3X26 B;  3H4M A;  4KO8 A;  5L8R F;  3MY1 B;  1NHW C;  1TF0 B;  1WIV A;  4F7L B;  4DV0 M;  1OFI A;  2EO2 A;  4LF7 M;  1SXJ E;  4AG6 A;  3UK6 A;  1V29 B;  2LHC A;  3TL4 X;  1D0K A;  4KT0 F;  4AZF A;  3GO8 A;  3AKZ A;  3VKG A;  1Q3C A;  2JUJ A;  1IN8 A;  1V92 A;  2KZU A;  3DA1 A;  1N77 A;  1UNG D;  1OI9 B;  2Z7J A;  4LF6 M;  3MMP A;  2DXB B;  4DR6 M;  4NOO B;  2WEV B;  1H1R B;  3GPP A;  2Z4S A;  2LVO C;  4JN6 A;  2X49 A;  2DD5 B;  2C98 A;  2W9Z A;  3HBL A;  3FE3 A;  4IBE A;  5LMK B;  5ITY A;  3LW5 F;  3W0F A;  2OO9 A;  2UUB M;  2QSF X;  2IW8 B;  3A8G B;  4NSR A;  1NY5 A;  3FYC A;  4FCV A;  4LJ9 A;  2JY5 A;  4R3D A;  1F4I A;  1H27 B;  1KXU A;  1I94 M;  2V6Z M;  5EXX A;  4B7H A;  4LZZ A;  3RFW A;  3SAU A;  3U61 A;  4M9Z A;  1IY2 A;  3KW6 A;  2VII A;  4YOS A;  1QVR A;  1AD6 A;  2WJ9 A;  3TWM A;  4I5S A;  1OAI A;  3AJI B;  3QZ5 B;  1IQP A;  1L1Z A;  4RF0 A;  2ZPF B;  4LOC A;  1K3X A;  4IJE A;  1QDR A;  1VDD A;  3MK6 A;  4MH0 E;  2DAK A;  3K9O A;  4LG2 A;  3QYE A;  1NJG A;  1NY6 A;  4FWG A;  4JX4 A;  3MIA B;  3U5Z A;  4D80 A;  2EKK A;  1OJL A;  3HGI A;  3KOX E;  1H28 B;  2CWB A;  4D82 A;  4LF5 M;  2JY6 B;  1GAB A;  4BCK B;  3BXW A;  2LHG A;  1P3Q Q;  4FX3 B;  3GLI B;  2IN3 A;  4AKG A;  2DWM A;  1OIZ A;  4IMY B;  4M0W A;  2JNH A;  2RKO A;  3AFH A;  1IBK M;  4F6S B;  5DQV A;  3VFD A;  2DXC B;  4GKK M;  2DNA A;  1FJG M;  3HHY A;  3V76 A;  2DEN A;  3GLF A;  5HBE B;  1FVV B;  5DNY A;  3T1Y M;  1PJJ A;  2ZPE B;  4BCJ B;  4ROE A;  1QMZ B;  4EOM B;  4DBG B;  2F5N A;  2KZS A;  2EUF A;  1VDL A;  2DI0 A;  3CF2 A;  4LJ6 A;  4NRV A;  1IM2 A;  3RGS A;  2L7I A;  3L27 A;  4AQY M;  1J09 A;  3K9P A;  2KNA A;  1PM5 A;  1ORY B;  3U60 A;  1O9K B;  3X24 B;  4JXJ A;  4IBJ A;  1G4A E;  1ZMU A;  5KPR A;  1OAO C;  4AKH A;  2D0Q B;  1IXS A;  3THG A;  3GRY A;  3QYB A;  4BCO B;  3AOE A;  1H1S B;  1VG5 A;  1ZMV A;  3JR4 A;  1H1P B;  2CFO A;  3VK8 A;  4TTH A;  1UNH D;  2Z8Y M;  4YOZ A;  1VOL A;  3B89 A;  3SHG B;  3TPZ A;  5EFQ B;  4KOD A;  4MGH A;  1UM8 A;  1G3I A;  1T43 A;  1BVS A;  3FD9 A;  1E9S A;  1GJT A;  1N75 A;  2EJS A;  5KQD A;  4B3M M;  1P5E B;  2CHV A;  2XZU A;  4R71 A;  4OX9 M;  3GTM S;  1R7R A;  3ILK A;  3SYL A;  3LVW A;  4BCH B;  2DPP B;  4OB1 B;  1IN6 A;  4LRS A;  4Y28 F;  5LMN M;  1H1Q B;  3MI9 B;  4BCQ D;  4G4R A;  1QAO A;  1IN4 A;  2XH9 A;  4R7G A;  1AHJ B;  3KOZ E;  3G33 B;  4UN0 A;  1NO1 A;  4QNM A;  2X1N B;  1Z59 A;  1IBM M;  4CFN B;  2BNK A;  1I4W A;  3KP1 E;  3GLG E;  3I4V A;  3BHU B;  5FGK B;  4QNR A;  4EOP B;  3D8B A;  3LCV B;  4PT5 A;  4G4N A;  1NHG C;  2GQF A;  1EIJ A;  1L2D A;  4Y72 B;  3VDU A;  4BCP B;  3B7Z A;  3O0G D;  4ELJ A;  3BLQ B;  2DHY A;  4B3R M;  1IN7 A;  4CFW B;  2LWX A;  4DV5 M;  1S3S A;  5HBJ B;  5C18 A;  1JKW A;  4X66 M;  2QQ8 A;  1JR3 E;  1OQY A;  4IBI A;  1W98 B;  1MJG M;  3B9P A;  2L4E A;  1NSF A;  2A5Y B;  1GY3 B;  2LVP C; 
#chains in the Genus database with same CATH homology
 2QBY B;  4JI1 M;  2JA2 A;  4CHT B;  4MFE A;  4P16 A;  3J7B A;  3K1J A;  2Z4R A;  3KOW E;  3M0E A;  4I81 A;  3VLF B;  5ITT A;  2CV1 A;  3VKH A;  4OVZ A;  4M0D A;  4LJ7 A;  2BS3 A;  1HT1 E;  4OVZ B;  2ZPE B;  2AHJ B;  3Q8X A;  3SMS A;  3BOS A;  2K47 A;  3ZCB B;  1K3W A;  1IY0 A;  1E9R A;  2CHG A;  3J2P B;  4JI0 M;  5ITX A;  1ZQ9 A;  3A8M B;  4L16 A;  3T1H M;  3PXG A;  4M6V A;  3WVD B;  4IIW A;  4AI6 A;  3HU3 A;  1JR3 D;  2RGO A;  4FW9 A;  1WXQ A;  3BG3 A;  4I4L A;  1IN5 A;  1YSY A;  3KXE C;  3SYK A;  5FTJ A;  1N32 M;  5EJC A;  5KPZ A;  1NNJ A;  4B3S M;  4OB0 B;  4QOZ C;  3TW7 A;  2D7E A;  1TH4 A;  4G6Z A;  3U6E A;  4IBC A;  2X4A A;  3UZU A;  4FWH A;  4LJ4 A;  3UMM A;  1JR3 A;  1JQJ C;  4PCZ A;  2QFZ A;  2CV2 A;  2CYZ B;  3QWL A;  2AHM A;  2V1C A;  1Z6T A;  2M5Z A;  4DV7 M;  4JI2 M;  1C1K A;  1L2C A;  2DZN B;  5ITR A;  4TUW A;  2CE7 A;  3K8Z A;  3HHW A;  3UJN A;  2ZM6 M;  3FKE A;  3HO8 A;  3U6P A;  4ZGJ B;  4LF8 M;  3J27 B;  4XGI A;  4PDI A;  1D2N A;  4PDG A;  1GL7 A;  2QEN A;  3AV0 A;  2DZO B;  4AG5 A;  4CIS A;  4GHA A;  3J80 S;  2UXC M;  4HNV A;  4LFC M;  2G8L A;  4IBF A;  2J7N A;  1HNZ M;  2QDJ A;  3TQS A;  3C58 A;  1IXS B;  2KEB A;  5EP2 A;  1X37 A;  1K82 A;  2FFJ A;  3FUU A;  4DR2 M;  2DVW B;  3GLG B;  4LGY A;  3GLG A;  1E7P A;  2R65 A;  3SMP A;  5A2Q S;  1Q39 A;  2QF7 A;  3MJ5 A;  3U5Z B;  3M6A A;  3BG5 A;  4G4O A;  3GRR A;  2UXB M;  1TH2 A;  2ZAM A;  3HJ8 A;  4RF1 A;  2BJV A;  2BJW A;  4ZPX A;  5JI2 E;  5IWA M;  2C9O A;  1N78 A;  1HT2 E;  2XZF A;  4ITQ A;  4EIW A;  3U6M A;  4L4U A;  4MGZ E;  2D7H A;  2XEP A;  2W82 A;  4II7 A;  4A3V B;  3J7A S;  3PVS A;  1DO2 A;  2RGH A;  5EXP A;  1UGP B;  2DWN A;  3GLH A;  3HHT B;  5FTL A;  4IBB A;  2HCB A;  4JV5 M;  2UUC M;  3WVE B;  3U6C A;  1DGH B;  2ZPI B;  3A8L B;  2CZ1 B;  4DV2 M;  3DOA A;  3IG5 A;  3HU2 A;  3EIE A;  4B7F A;  1DGB A;  1XWI A;  4OW0 A;  3KS8 A;  3E4R A;  4DV4 M;  3U61 B;  4MFD A;  3KS4 A;  3PNV A;  5IT9 S;  5FLX S;  4LJ8 A;  1N36 M;  3A42 A;  1J7K A;  5E26 A;  1N34 M;  5EQT A;  4JX5 A;  3R9X B;  1FNN A;  2A5Y B;  4X62 M;  4DV3 M;  2Y21 A;  3D8L A;  3VK7 A;  3L29 A;  2ZPH B;  3JR5 A;  2J7O A;  2ZAN A;  2CHQ A;  3GLH B;  3CF0 A;  2DXI A;  4IJF A;  4QHS A;  3LQR A;  3A8H B;  1GLN A;  1DGH A;  4JI3 M;  2KRK A;  2KW0 A;  4DR4 M;  3HHZ A;  2R18 A;  1XXH A;  3K2L A;  2Q2E B;  3GRU A;  4REZ A;  5EXT A;  4FCW A;  1YE9 A;  5EP1 A;  4BB9 A;  3TW6 A;  4XBO A;  3X28 B;  2QDY B;  1HNX M;  2P5T A;  1HQY E;  1XMO M;  3U60 B;  1GVN A;  2DWL A;  2LXE A;  4MM3 B;  1IXR C;  3GQ3 A;  1SXJ C;  4HLQ A;  4AKI A;  4LF4 M;  3L2A A;  3QAU A;  4NL4 H;  3U6S A;  3QYH B;  2FNA A;  2FOI C;  2CEA A;  2XF3 A;  4GH9 A;  4LFA M;  3SC3 A;  1UGR B;  1YUB A;  3DFZ A;  2KMG A;  2L7H A;  1DO0 A;  1ZAE A;  1R2Z A;  2L09 A;  1LV7 A;  1QAM A;  2UXD M;  4LY6 A;  5DYG A;  1R6B X;  5EP4 A;  4L15 A;  2F5S A;  4AW4 A;  1XXH B;  1DGG A;  3J81 S;  4QOS A;  4NXM M;  2G77 A;  3ZC7 B;  2XLJ A;  1TH3 A;  4DR5 M;  5ITU A;  3MHV C;  4X65 M;  5F3W A;  2F5P A;  1QQW A;  3PNY A;  1GL6 A;  3GQ5 A;  3FUV A;  2HL7 A;  3HHX A;  4GIP A;  4NSO B;  2D7G A;  3UGJ A;  1H6U A;  3GLI A;  1L8Q A;  2VQF M;  1FKM A;  4W5W A;  2UU9 M;  4DV1 M;  4BLC A;  4QHT A;  3FUW A;  1PJI A;  3KOY E;  3FTF A;  1E94 E;  3HJS A;  3GPY A;  4M9X A;  3FTC A;  1T3T A;  4RNA A;  4MIM A;  2EA0 A;  2R4E A;  1XNR M;  2XSZ A;  1KYI A;  5C1B A;  3FUT A;  5LMU M;  4PD2 A;  8CAT A;  3NBI A;  2HHH M;  5IZ7 D;  4NRW A;  1Q3B A;  2C99 A;  2LH0 A;  1QYR A;  1QAN A;  1UGS B;  2DHR A;  3L28 A;  3RGP A;  3CTW B;  3EIH A;  3WHK A;  3CF6 E;  4BBA A;  2F4V M;  4DR7 M;  1GKI A;  3SAT A;  4GMQ A;  4WW0 A;  4Z8X A;  3R8F A;  2L6O A;  4OB2 B;  3U6D A;  3T15 A;  3VYG B;  5EP3 A;  3GPX A;  4FWD A;  2C9C A;  1XNQ M;  4LFB M;  4OB3 B;  2R62 A;  3KVW A;  2O5R A;  3A45 A;  4LRT A;  4MB7 A;  1QZM A;  3I51 A;  4LCB A;  4MGI E;  4B3T M;  3M7G A;  2CV0 A;  5FSW A;  1Z5A A;  2UUA M;  4JI5 M;  1SXJ A;  3L26 A;  4JI8 M;  5JI3 E;  4FD2 A;  2FE8 A;  3GQ4 A;  2QZ4 A;  1XC8 A;  3OTO M;  4FVM A;  2ZPG B;  3E9S A;  3T38 A;  3RE8 A;  2QPA A;  3KHI A;  2DD4 B;  1HR0 M;  1NVM A;  4LZJ A;  3NWL A;  4DR3 M;  3HU1 A;  2LNH C;  2Z3X A;  4JI6 M;  3DL1 A;  4DV6 M;  2BS2 A;  5H37 D;  4DUY M;  3AL0 C;  2DWZ B;  4WUR A;  4LJ5 A;  5FTM A;  2QBY A;  2BS4 A;  2V1U A;  4NC6 A;  4B08 A;  3FTD A;  1W5S A;  2ZAO A;  4IBD A;  3SAV A;  4JX6 A;  4BBR M;  2XSZ D;  3KSJ A;  1Z5C A;  2R46 A;  5IRE B;  3HB9 A;  1DGF A;  2EUC A;  2Y0T A;  4B7G A;  4L8R C;  3TE6 A;  3X25 B;  2I7N A;  2CUZ A;  3VDP A;  2YQZ A;  3AOG A;  1XMQ M;  1MU5 A;  2Y0Q A;  4S12 A;  5KO3 A;  3KDS E;  4GHL A;  3PFI A;  4LGM A;  3BG9 A;  3KP0 E;  5GKN A;  1G59 A;  3WHL A;  2E5L M;  1IXZ A;  4KLN A;  2QP9 X;  3IG8 A;  3A8O B;  4IBK A;  3LQQ A;  2XFS A;  3L25 A;  2OPF A;  1HNW M;  4GRI A;  1TGU A;  4LJA A;  5KQ8 A;  3A46 A;  3U6Q A;  2X8A A;  1HQC A;  3LVV A;  2CZ0 B;  2C96 A;  1IBL M;  1SXJ D;  4Z6Y A;  3U6O A;  3HZJ A;  4JI4 M;  4G4Q A;  2CZ7 B;  4YHH M;  1G41 A;  3GRV A;  3H4C A;  4OU7 A;  5ITQ A;  5KPT A;  4HNU A;  2NQ8 C;  4HL4 A;  1L1T A;  4MGY E;  2KA6 B;  3QXE B;  4BBS M;  4GC9 A;  3QYG B;  5FTN A;  4IBG A;  4YY3 M;  1IRE B;  1R2Y A;  4NXN M;  4M9S A;  1UGQ B;  4DUZ M;  3HKP A;  3I4Y A;  4L78 A;  2F5O A;  3SBJ A;  3ZH9 B;  3GLF B;  3KFU G;  2I7P A;  2HKJ A;  3FUX A;  2KXE A;  4LF9 M;  1G8P A;  3X20 B;  2QCU A;  4FCT A;  4CGY B;  5BR8 M;  3FTE A;  2R4J A;  1MX0 A;  1XHB A;  2XFT A;  2R45 A;  1IY1 A;  1E32 A;  7CAT A;  2CZ6 B;  1Z5B A;  2M60 A;  3KSX A;  2Y20 A;  3GPU A;  3A98 B;  4ZGE B;  1QLB A;  1KFV A;  1OFH A;  4DR1 M;  2OQ4 A;  1TDH A;  1TDZ A;  5FTK A;  4K0K M;  2C5R A;  3SAS A;  2YNM D;  3GP1 A;  2F5Q A;  1W5T A;  4JI7 M;  5ITX E;  1SXJ B;  1QAQ A;  3JAM S;  4JYA M;  2H1R A;  2VQE M;  2ZBK B;  4GC5 A;  1NNU C;  4I8O A;  2YR0 A;  3LMM A;  2YFQ A;  4KHP M;  3W0L B;  2G5G X;  3SHF A;  3AOE C;  3HJQ A;  1KSF X;  2XGN A;  5EXS A;  2ZPB B;  3QZ9 B;  4MGK E;  1NJF A;  4D81 A;  5BPV A;  3K92 A;  3U6L A;  3VYH B;  2KR6 A;  2KRU A;  1J5E M;  5DYI A;  3TWK A;  4GIT A;  5E6J A;  2ERC A;  3SAW A;  1N33 M;  3SFZ A;  3TWL A;  4X64 M;  3DZD A;  4ZGD B;  3FYD A;  3HWS A;  1L2B A;  1EE8 A;  4GKJ M;  3X26 B;  3H4M A;  4KO8 A;  1NHW C;  4DV0 M;  1OFI A;  2EO2 A;  4LF7 M;  1SXJ E;  4AG6 A;  3UK6 A;  1V29 B;  3TL4 X;  4AZF A;  3GO8 A;  3AKZ A;  3VKG A;  1Q3C A;  1IN8 A;  2KZU A;  1N77 A;  3DA1 A;  4QSH A;  2Z7J A;  4LF6 M;  2DXB B;  4DR6 M;  4NOO B;  3GPP A;  2Z4S A;  4JN6 A;  2DD5 B;  2X49 A;  2C98 A;  3HBL A;  4IBE A;  5ITY A;  3W0F A;  2UUB M;  3A8G B;  4NSR A;  1NY5 A;  3FYC A;  4FCV A;  4LJ9 A;  4R3D A;  1I94 M;  2V6Z M;  5EXX A;  4B7H A;  4LZZ A;  3RFW A;  3SAU A;  3U61 A;  4M9Z A;  1IY2 A;  3KW6 A;  2VII A;  1QVR A;  2WJ9 A;  3TWM A;  4I5S A;  3AJI B;  3QZ5 B;  1IQP A;  1L1Z A;  4RF0 A;  2ZPF B;  4LOC A;  1K3X A;  4IJE A;  1VDD A;  2ZZD B;  3MK6 A;  4MH0 E;  4LG2 A;  4JX4 A;  3QYE A;  1NJG A;  1NY6 A;  4FWG A;  3U5Z A;  4D80 A;  3KOX E;  1OJL A;  3HGI A;  4LF5 M;  4D82 A;  3GLI B;  4AKG A;  2DWM A;  4M0W A;  2RKO A;  1IBK M;  3VFD A;  2DXC B;  4GKK M;  1FJG M;  3HHY A;  3GLF A;  5DNY A;  3T1Y M;  1PJJ A;  2F5N A;  2KZS A;  4LJ6 A;  3CF2 A;  4NRV A;  3RGS A;  1IM2 A;  4AQY M;  2L7I A;  3L27 A;  1PM5 A;  1J09 A;  1ORY B;  3U60 A;  3X24 B;  4JXJ A;  4IBJ A;  1G4A E;  5KPR A;  4AKH A;  2D0Q B;  3THG A;  3GRY A;  3QYB A;  3AOE A;  3JR4 A;  2CFO A;  3VK8 A;  3SHG B;  3TPZ A;  4KOD A;  4MGH A;  1UM8 A;  1G3I A;  3SAR A;  3FD9 A;  4B3M M;  1E9S A;  1N75 A;  5KQD A;  4FM4 B;  4HNT A;  2CHV A;  2XZU A;  4OX9 M;  1R7R A;  3ILK A;  3SYL A;  3LVW A;  2DPP B;  4OB1 B;  1IN6 A;  4LRS A;  5LMN M;  4G4R A;  1QAO A;  1IN4 A;  2XH9 A;  4R7G A;  1AHJ B;  3KOZ E;  4QNM A;  1Z59 A;  1IBM M;  2BNK A;  1I4W A;  3KP1 E;  3I4V A;  4QNR A;  3D8B A;  4PT5 A;  4G4N A;  1NHG C;  1L2D A;  3VDU A;  4ELJ A;  4B3R M;  1IN7 A;  2LWX A;  4DV5 M;  1S3S A;  5C18 A;  4X66 M;  2QQ8 A;  4IBI A;  3B9P A;  1NSF A;  3AFH A;  2ZCF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...