4HLQA

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
280
structure length
280
Chain Sequence
b'FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
total genus 95
structure length 280
sequence length 280
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hlqA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hlqA02
4NC6A 3QYBA 3QYEA 5EJCA 4Z6YA 3HZJA 4HLQA 2QQ8A 3QWLA 2G77A 1FKMA 4HL4A 2QFZA
chains in the Genus database with same CATH superfamily
5IF1B 4DR3M 3U6CA 2KZUA 5DQWA 2HHHM 1F5QB 2WHBB 3KXEC 3A46A 3M6AA 2R7GA 3TL4X 1QDTA 2HL7A 3VFDA 3QZ9B 3PNVA 4NSOB 3J7BA 3GLFA 4LF8M 4DV2M 3QHRB 1IBMM 3WVDB 1SXJC 4OB1B 1DGBA 1H1SB 3DDQB 2AHJB 1WGLA 5H37D 1IN7A 2DWZB 3T1HM 1C1KA 1PJJA 3KS4A 4P16A 3GLFB 1V33A 2R18A 2ZPBB 4DR7M 4G4OA 3DOGB 4FX3B 3TWMA 4MGZE 1IXRC 4AG6A 2EKKA 4ZGJB 2Z8YM 2G77A 2XZFA 3TNHB 1OGUB 1QQWA 2X1NB 1GY3B 3U6MA 2LWXA 3VKHA 2O5RA 4MFDA 2UZBB 1HT2E 1QUTA 2WJ9A 2D7EA 1BVSA 2QDYB 1D0LA 2LHCA 2UUEB 1E94E 2WSCF 3SFZA 2XZUA 1WIVA 3CTWB 4L4UA 5KPZA 3KW6A 3ILKA 4I4LA 4NSTB 2WZJA 2PK2A 3K8ZA 4BCFB 2I7PA 3B7QA 3QYGB 4MGYE 2A5YB 5L8RF 1AISB 1NJFA 1OL1B 5EP4A 4WP2A 4F7LB 5FTLA 1DGGA 4CHTB 1N33M 3SYKA 2W9FA 1I4WA 1XWIA 1HNWM 3DTOA 4JV5M 2BPMB 3W0FA 4LF7M 3L26A 2JY7A 3E9SA 1QAQA 2EUFA 3GPXA 1JQJC 2APLA 2ZPEB 3AV0A 1HNXM 1FINB 3A45A 3BXWA 1P3QQ 3AOGA 3SARA 3C3EA 5FTNA 2EA0A 2LNHC 4DV0M 4FWHA 1SXJE 2Y21A 5E26A 2VF7A 3M03A 3PVSA 4MM3B 4YHHM 4M0DA 3FYDA 3HU2A 2BWBA 3AOEC 2X8AA 2VDBB 4QOZC 4F2LA 1D2NA 3WVEB 3Q8GA 4OB2B 2P5TA 2FOIC 3U6SA 5IHYA 1ENWA 3U6OA 2GNOA 1KFVA 4JYAM 1H4LD 4ELJA 3PNYA 4QNRA 3U60A 1YSYA 2UU9M 2QBYB 3PXGA 4BCMB 2BJVA 4F6UB 1H6UA 4RF0A 3HO8A 4BXXX 3PO3S 4EOQB 3L28A 4MGKE 4LJ7A 2IW8B 3LVWA 2W99A 2L09A 2J5YA 1GLNA 4FD2A 4REZA 4FVMA 3TW6A 3U60B 3TWKA 5ITXA 1MX0A 3GRVA 3LQQA 5KQ8A 4AKIA 3GO8A 1IBLM 1XC8A 1UFZA 3T6PA 1K82A 1OAOC 4NXNM 1PJTA 2DENA 1OKWB 1L8QA 5BR8M 3CGWA 3B7ZA 3FUWA 3KOYE 1GJSA 1T6OA 1ZMUA 3CF6E 4B3SM 2DZLA 1KYIA 4LFBM 3FTFA 1NO1A 5IZ7D 2RRUA 2CV2A 1TH4A 3DJBA 3HJQA 5EXTA 2QFZA 1QAMA 1N32M 4IBIA 3LW5F 3ZQJA 3HGIA 3HHXA 1NV8A 4R71A 4BY1X 4GRIA 3SYLA 5ITYA 4AI6A 4L16A 3FUXA 2XEPA 1OIUB 2YFQA 1UGPB 3GPPA 3JR4A 3GLIA 3VK7A 1JOWA 2M60A 3T15A 5KO3A 3WHKA 5KQDA 1VINA 1GJTA 2F4VM 3FYCA 2QSFX 3W0LB 2UXDM 2CHGA 4B3TM 3KP0E 1RU3A 3HB9A 5FTKA 1VEKA 4RNAA 3C3DA 1QAOA 3U61B 3UZUA 3POMA 2JP7A 4GMQA 3A8OB 3QHWB 2OPFA 3GPYA 4IMYB 4BBRM 2PJQA 2C6TB 3SBJA 1GH6B 2G3QA 4GKKM 1H1PB 2DAGA 2QHOB 3GLGA 4JI0M 1KXUA 1BU2A 1L1TA 2HKJA 1D0MA 3HHZA 4NL4H 4JX5A 3KS8A 5DYGA 1R6BX 4YOOA 3EJ1B 1NV9A 4GHAA 3KVWA 4BCOB 3WHLA 3GLGB 2I7NA 3HWSA 1NY6A 2BS2A 1LTMA 3FUTA 2XSZA 3L2AA 1O9KA 3QWLA 4EONB 1JR3E 1H24B 2BS4A 2DKLA 4QSHA 3ZCBB 2DAEA 1EFUB 3QAUA 1J5EM 2QZ4A 1E9HB 2EKFA 5FLXS 5FTJA 2IW6B 2LH0A 1VOLA 3X28B 2MROB 5CEIB 4X64M 1N4MA 3MY1B 4KRCB 3MJ5A 5ICPB 2C5XB 2CFOA 5LMKB 2R44A 1P5EB 3UK6A 1JKWA 2DVWB 3KSXA 1G3IA 3M7GA 3QZ5B 4HEOA 2ZPFB 2RGHA 3EIDB 3AKZA 4IBJA 2R62A 3FTEA 4EC9B 2DAIA 1XXHA 2LVQD 1W5SA 2ZPGB 1G4AE 4RKUF 2VIIA 1IREB 3VDPA 1UNHD 1QANA 2JZ1A 1N77A 4II5B 4LOCA 2C98A 3HX3A 1F4IA 2JA2A 2DHRA 1Q02A 2Z3XA 3C9PA 1D3UB 2CRUA 3HBLA 2K47A 1PJQA 2AHMA 1J7KA 2WIPB 4HNVA 2LXEA 2DD4B 2R4EA 3RFWA 5DNYA 1KSFX 4FWDA 2CUZA 3MIAB 2BJWA 4KHPM 3U6EA 1MU5A 3V76A 1OQYA 1L2BA 4KO8A 3B57A 2IN3A 4IIWA 2V22B 4EOJB 2IVXA 1EIJA 1CUKA 1NHGC 4MGIE 4EOSB 2WFYB 3I51A 1OFIA 4BCGB 4M6VA 2LTUA 1AUAA 3DL1A 3THGA 4CFUD 1V92A 2MJ5B 1GVNA 4FW9A 3H4JA 1K3XA 1TH2A 1Z5BA 3VYHB 4BCHB 4IBBA 2VQEM 2YQZA 3HKPA 4JX6A 2I40B 4BLCA 3I04M 4PD2A 1QYRA 1D0KA 4A3VB 2CP8A 3L25A 1IY2A 2LVPC 3U6QA 4DV3M 3J27B 5EP3A 2JXNA 4BCQD 4F70B 2QGSA 3FKEA 2G8LA 1XXHE 4ZPXA 1R2YA 3X24B 2FE8A 1GUXB 1QZEA 4EOOB 4OVZB 4JI8M 3G33B 4IJEA 4LFAM 1N36M 1ZAEA 2DZOB 1OIZA 3HHTB 1Q39A 2MGWA 3SHFA 4NC6A 1OKSA 2G9XB 4TUWA 3LCUA 4OW0A 2V1CA 3GTMS 4G4NA 2L4EA 4DBGB 4DUZM 1SG9A 3IECA 4P17A 2K9DA 4HLQA 4OU7A 1FVVB 2ZM6M 1TH3A 5KPRA 2Y0QA 2JZ0A 4G4QA 3B74A 4PT5A 3U6DA 3SC3A 2R6FA 2YR0A 4F1IA 1VDDA 5DQVA 3GLFE 4AKHA 1GL7A 2R65A 4OB3B 2CEAA 2QQ8A 2KZSA 1QZMA 1IBKM 4LJAA 2DWNA 3A8LB 2JY5A 3FUVA 4RF1A 3GQ3A 1HNZM 2CZ1B 3GQ4A 3RGFB 1XMQM 2F2CA 2WPAB 1L2CA 1T43A 5DYIA 3MI9B 4Y28F 4OGRB 1Q3CA 1Z59A 1QLBA 3K7AM 2J7OA 2UUAM 3LVVA 2QBYA 1EE8A 4B3MM 4JI6M 4B08A 1HQYE 3U6PA 4CFMB 1GABA 1Z5CA 2KRUA 4PDGA 4ROEA 3KOZE 4YY3M 1GKIA 2Z4RA 4IBKA 4LFCM 1XO2A 3AOEA 5C1BA 1W5TA 4EOPB 1X37A 2HCBA 2G5GX 1QDRA 5HQ0B 3FTDA 4G3OA 4BBSM 2VQFM 3A42A 4EOKB 1H1QB 4DV6M 4CFVB 4HNUA 1ZV1A 3BHUB 3L29A 2F5PA 4LF6M 4NRWA 1V29B 2FS1A 4JI4M 5L2WB 4BY7X 4BCJB 2XH9A 1AIPC 3A8HB 1WXQA 1URCB 2WEVB 4TTHA 2UUCM 3TQSA 2Z4SA 3AL0C 2E5LM 2CZ7B 1Y8GA 2VF8A 1ZQ9A 1YE9A 1ZMVA 2KR6A 4RODA 4BCPB 2BNKA 3IG8A 2C5RA 4Z8XA 5IREB 2FNAA 5EQTA 2C4GB 1VQ1A 4GEWA 1G59A 1ZP2A 1MJGM 1I94M 5HNBB 4CFUB 5JI2E 2K6BA 5EP2A 1K3WA 3QYBA 2ZAMA 1TDHA 7CATA 1Z5AA 2KA6B 5KPTA 4LY6A 2R46A 4F6WB 3NBIA 3U61A 1TFBA 3VDUA 4JXJA 2DD5B 3W68A 3RE8A 4CJ6A 1A5TA 2UZEB 1PRBA 2I53A 4EC8B 2UXCM 2Y0TA 4LCBA 1V34A 4PCZA 4BCQB 2W2HA 3IG5A 1SXJD 5EXXA 3IHPA 4YOZA 3HHYA 5FTMA 1XNRM 1R4GA 4MIMA 3DDPB 1OIYB 1VEGA 4GKJM 3GRYA 3VLFB 4B3RM 5A2QS 3MHVC 4IBGA 5EJCA 3K9PA 2KRKA 3BLRB 4LJ6A 4BB9A 2CZ6B 5ITXE 1L1ZA 2HAKA 4ITQA 3GLHA 3DA1A 3X20B 2BWEA 3SAVA 2XFSA 1N34M 2ZBKB 2C9OA 3ZH9B 3F92A 4AZFA 3TNIB 1FJGM 3U6LA 4ELLA 4GC9A 2RKOA 1NVMA 4B7FA 2O01F 3RGSA 3GLHB 1IN8A 4GITA 2CHVA 4EOLB 4JI5M 1YLAA 5HBEB 1TDZA 3BLHB 2D0QB 2ZCFB 4GH9A 5LMNM 4F6SB 3J81S 5C18A 2L7IA 3PFIA 2DXIA 3HJSA 2QF7A 2CYZB 4NOOB 4LJ9A 1MN3A 3BG3A 4L15A 2CE7A 4QHSA 4YC3B 1Z6TA 4MGHA 2V1UA 3GLIE 5IT9S 2L7HA 2C5VB 5DFLA 1IXSB 2C96A 3B9PA 4MB7A 1DV0A 4Y72B 4LF9M 5ITQA 1NY5A 4ZGDB 1G3NC 2DWMA 1C9BA 4DR4M 3SAUA 3QYEA 2D7HA 5LQFB 3SATA 4JI3M 3VYGB 2MH8A 4GIPA 4LGMA 4AKGA 3H4MA 3LCVB 2Y20A 3D8BA 2IW9B 4CISA 5HVYB 2ERCA 4LZJA 3JAMS 2PK9B 1UNGD 1VDLA 1DO2A 3DFZA 1YUBA 4CFNB 1HJPA 1UGQB 1IFYA 3KOXE 1L2DA 3BHTB 4AG5A 3GLGE 2QP9X 3J2PB 4WURA 4I3ZB 4DUYM 3SASA 4X65M 3BHVB 2DAKA 4M0WA 4PDIA 1XB2B 3CF0A 2DWLA 3AJIB 1J09A 5EXPA 4JN6A 1NJGA 4NRVA 2KMGA 1R7RA 2F5QA 2XFTA 4GC5A 1UNLD 3X26B 2LW4A 4LF5M 4S12A 4EOIB 4MFEA 4DR1M 1UGRB 3KHIA 1DO0A 4BCIB 5ITUA 4LJ4A 2CJMB 2QNJA 5BNJB 2L6OA 2BKZB 4IBCA 1OKVB 2LBCA 1QVRA 3JR5A 1QMZB 2DNAA 3FUUA 4LGYA 4OX9M 2DZNB 2JWSA 5ITTA 1G41A 2W96A 2ZPHB 1PM5A 5FGKB 3F5XB 1H26B 3KP1E 1GUXA 4DV7M 4CXAB 1C7YA 4OVZA 4DV4M 4CIZA 1TR8A 1SXJA 1JR3D 1OFHA 1NNUC 1IN6A 4I8OA 1GO5A 4GHLA 4R3DA 1N78A 1UGSB 3Q8XA 1E7PA 1IN5A 3QXEB 3MMPA 2OOBA 2DI0A 4M9XA 3BBZA 2QCUA 3A8GB 3CF2A 1SXJB 4JI7M 2D7GA 2YNMD 1W98B 3VKGA 4KODA 3B7NA 3I01M 1IM2A 3HHWA 5CYIB 5GKNA 1QUSA 4KT0F 4D81A 5JI3E 4AQYM 3LMMA 5LMUM 4AW4A 3GP1A 1JSUB 1TGUA 2W82A 1Q3BA 4NSRA 1OIPA 1NHWC 1HT1E 2C99A 4YOSA 2L4FA 3K2LA 1E9RA 2O25A 1TF0B 2F5OA 1WJ7A 2WXVB 2CCHB 3VK8A 3GQ5A 4QNMA 2B9RA 2DXBB 5IDNB 4M9ZA 3W67A 1TD6A 1ORYB 1IXZA 3QYHB 4BCND 4X66M 3EOCB 3KOWE 2QDJA 1AD6A 2CV0A 1VG5A 2ZAOA 2PMIB 2H1RA 4FCTA 4CFWB 4HL4A 4KLNA 4I81A 2Q2EB 5HBHB 1PGYA 4NXMM 4DV1M 2H5XA 2XSZD 3HZJA 2UZLB 3T1YM 4JI1M 4XK8F 2KNZA 2ZANA 1NSFA 4DR5M 1FNNA 1T3TA 2EO2A 1OJLA 3E46A 3HJ8A 3LQ5B 3BG5A 3GPUA 2WIHB 2LVAA 3EIEA 2ZZDB 3DOAA 2UZDB 2CCIB 5BPVA 4LRSA 4F7SB 4IJFA 1VYWB 4IBEA 3A98B 3MK6A 4B7GA 4D82A 3R8FA 1UM8A 3SMPA 4L8RC 2OOAA 4LZZA 2ZTCA 3GRRA 3BOSA 4EORB 4M9SA 1LV7A 4G6LB 3EIHA 1OAIA 2N35A 3NWLA 4B7HA 2WSFF 3SAWA 5F3WA 1XNQM 3FD9A 2DHYA 2RGOA 1IY0A 5ITRA 2ZPIB 4CRLB 2WMAB 2R4JA 3J7AS 1XHBA 2F5NA 2C5OB 4ANRA 3KSJA 4JX4A 1IN4A 4D80A 5EFQB 5IWAM 1DGFA 2KNAA 2OO9A 2XGNA 3NBXX 3HU3A 1H27B 1PJIA 2CZ0B 2MR9A 4EIWA 4Z6YA 3TW7A 3E4RA 2X49A 3HY5A 4II7A 3OTOM 2DXCB 2LVNC 1G8PA 2J7NA 3MY5B 3T38A 3TNWB 5EXSA 3K92A 1DGHA 1JR3A 5IDPB 1OL2B 4JI2M 3KFUG 2R0IA 3KDSE 2KXEA 3H4CA 3NDQA 3UJNA 4LG2A 3FTCA 2FFJA 2KEBA 1NNJA 1DGHB 4ROCA 2R45A 1E9SA 2JNHA 4HNTA 2OQ4A 4IBDA 2LVOC 2JY6B 4UN2B 2WSEF 3X25B 1PKDB 2CV1A 4DV5M 4OB0B 2W9ZA 4LRTA 1OTRA 3RGPA 4CGYB 5HBJB 2X4AA 3LQRA 2Z7JA 3GLIB 1R5LA 3J80S 1HR0M 2DAMA 4EOMB 2QPAA 2UXBM 3FRHA 3HU1A 3BG9A 5ACBA 4QOSA 2LHGA 2QENA 3BLQB 3O0GD 5EP1A 2ZTDA 4DR6M 2JUJA 2JGZB 1E32A 4LJ5A 2B3TA 3UMMA 4CFXB 1HQCA 1TTEA 2CHQA 1VEJA 4KRDB 3SHGB 4X62M 5I5ZB 2CWBA 4LF4M 2L2DA 1IXSA 3FE3A 3I4YA 4LJ8A 1FKMA 3AFHA 2DMEA 4Q7JA 4G4RA 1S3SA 4FWGA 3DZDA 4FM4B 4FCVA 4XGIA 4BCNB 4BBAA 2F5SA 2BS3A 1WHCA 2KNVA 4L6V6 2EUCA 3FRIA 1JSTB 3R9XB 1XMOM 3TPZA 2KHHA 4QHTA 4I5SA 1OI9B 2C5NB 3M0EA 3K9OA 4XBOA 4BCKB 4W5WA 2K0BX 1JB0F 1WR1B 4G6ZA 2KW0A 1O9KB 1N75A 1IQPA 3D8LA 4FCWA 1GL6A 8CATA 2KDLA 5E6JA 5FSWA 1H25B 3TE6A 1IY1A 4F7JB 2NQ8C 2WMBB 1G71A 1ZMWA 1H1RB 2FH0A 2M5ZA 2HWJA 3U5ZA 3B89A 4L78A 2C9CA 4F7NB 3TWLA 2XLJA 1PJSA 2PHGA 4BCMD 4WW0A 3I4VA 4R7GA 3K1JA 2XF3A 4ZGEB 1WGNA 3ZC7B 2UUBM 4IBFA 4DR2M 2GQFA 2V6ZM 3GRUA 3GLHE 3C58A 1AHJB 2EJSA 3SMSA 1R2ZA 4MH0E 3UGJA 4UN0A 3U5ZB 4K0KM 3L27A 1H28B 4OR5B 2DPPB 3E21A 1XXHB 3TN8B 2JY8A 3A8MB
chains in the Genus database with same CATH topology
3K2LA 4DR3M 3HHZA 3U6CA 1E9RA 2KZUA 4NL4H 2HHHM 4JX5A 3KS8A 5DYGA 2XH9A 1R6BX 3KXEC 3A8HB 1WXQA 2F5OA 3A46A 2UUCM 3TQSA 2Z4SA 3AL0C 2E5LM 3VK8A 4GHAA 3KVWA 3M6AA 2CZ7B 3GQ5A 4QNMA 2DXBB 1ZQ9A 4M9ZA 1YE9A 3TL4X 3WHLA 3GLGB 2I7NA 2KR6A 1ORYB 3HWSA 1NY6A 2HL7A 1IXZA 2BNKA 3IG8A 3VFDA 4Z8XA 2C5RA 3FUTA 3PNVA 2BS2A 2XSZA 3L2AA 5IREB 2FNAA 3QZ9B 3QYHB 4NSOB 3QWLA 5EQTA 4X66M 3J7BA 3GLFA 3KOWE 4LF8M 2QDJA 1G59A 2CV0A 2BS4A 4DV2M 4QSHA 3ZCBB 2ZAOA 1I94M 3QAUA 1J5EM 2H1RA 4FCTA 1IBMM 3WVDB 1SXJC 5JI2E 2QZ4A 5FLXS 4OB1B 1DGBA 5EP2A 4HL4A 5FTJA 1K3WA 3QYBA 2ZAMA 1TDHA 2LH0A 4KLNA 4I81A 7CATA 2AHJB 3X28B 5H37D 2Q2EB 1Z5AA 2KA6B 4X64M 1IN7A 5KPTA 2DWZB 4LY6A 2R46A 1C1KA 3T1HM 3NBIA 3U61A 4DV1M 1PJJA 4NXMM 3KS4A 2XSZD 3HZJA 4P16A 3VDUA 3GLFB 3T1YM 4JI1M 3MJ5A 4JXJA 2R18A 2CFOA 2ZPBB 2ZANA 1NSFA 4DR7M 4G4OA 4DR5M 2DD5B 3TWMA 1FNNA 1T3TA 4MGZE 3RE8A 2EO2A 1OJLA 3UK6A 3HJ8A 1IXRC 2DVWB 3KSXA 1G3IA 4AG6A 4ZGJB 3BG5A 3M7GA 3GPUA 2UXCM 2G77A 2XZFA 3QZ5B 2Y0TA 2ZPFB 3EIEA 4LCBA 2ZZDB 2RGHA 4PCZA 3DOAA 1QQWA 4IBJA 3AKZA 2R62A 3FTEA 3U6MA 5BPVA 4LRSA 3IG5A 2LWXA 4IJFA 1SXJD 3VKHA 2O5RA 4MFDA 1XXHA 1HT2E 4IBEA 5EXXA 3HHYA 1W5SA 3A98B 5FTMA 3MK6A 4B7GA 2ZPGB 1G4AE 1XNRM 2WJ9A 2VIIA 4D82A 1IREB 4MIMA 3R8FA 1UM8A 3SMPA 3VDPA 4L8RC 2D7EA 4LZZA 2QDYB 1QANA 3GRRA 4GKJM 1E94E 3BOSA 1N77A 3GRYA 3VLFB 4M9SA 3SFZA 2XZUA 1LV7A 4B3RM 4LOCA 3EIHA 5A2QS 3CTWB 2C98A 3MHVC 4IBGA 4L4UA 3NWLA 5EJCA 4B7HA 5KPZA 2KRKA 3KW6A 3SAWA 5F3WA 1XNQM 3ILKA 3FD9A 4I4LA 4LJ6A 2JA2A 4BB9A 2CZ6B 2DHRA 5ITXE 2RGOA 1IY0A 2Z3XA 3K8ZA 1L1ZA 5ITRA 2ZPIB 2I7PA 3HBLA 2K47A 4ITQA 3QYGB 3GLHA 2AHMA 2R4JA 3DA1A 3J7AS 1J7KA 3X20B 1XHBA 2F5NA 3SAVA 4MGYE 3KSJA 2XFSA 2A5YB 2ZBKB 1N34M 4JX4A 2C9OA 3ZH9B 4HNVA 1NJFA 2LXEA 1IN4A 2R4EA 4D80A 2DD4B 3RFWA 5EP4A 5IWAM 5DNYA 1DGFA 4AZFA 1KSFX 4FWDA 5FTLA 1DGGA 4CHTB 1N33M 2CUZA 2BJWA 2XGNA 4KHPM 3SYKA 3U6EA 1MU5A 1FJGM 3U6LA 1I4WA 1XWIA 3HU3A 1L2BA 1HNWM 4KO8A 4GC9A 2RKOA 1PJIA 1NVMA 4JV5M 2CZ0B 4B7FA 4IIWA 3W0FA 4LF7M 4EIWA 3L26A 4Z6YA 3RGSA 3E9SA 3GLHB 1IN8A 1QAQA 2CHVA 4GITA 1NHGC 3GPXA 4JI5M 3TW7A 1JQJC 2ZPEB 1TDZA 4MGIE 3AV0A 3E4RA 3I51A 1HNXM 2X49A 4II7A 2D0QB 2ZCFB 3OTOM 1OFIA 4GH9A 5LMNM 4M6VA 3J81S 3DL1A 3A45A 3THGA 2DXCB 5C18A 1G8PA 2J7NA 2L7IA 3PFIA 2DXIA 3HJSA 3T38A 1GVNA 4FW9A 5EXSA 3K92A 1DGHA 2QF7A 3AOGA 3SARA 2CYZB 1K3XA 1JR3A 4NOOB 1TH2A 1Z5BA 5FTNA 4LJ9A 2EA0A 3BG3A 2LNHC 4L15A 4DV0M 2CE7A 4QHSA 3VYHB 1Z6TA 4MGHA 2V1UA 4FWHA 1SXJE 2Y21A 4IBBA 2VQEM 4JI2M 2YQZA 5E26A 3HKPA 3KFUG 5IT9S 2L7HA 3KDSE 4JX6A 1IXSB 3PVSA 4MM3B 2C96A 2KXEA 3B9PA 4MB7A 3H4CA 4LF9M 5ITQA 4BLCA 4YHHM 4PD2A 4M0DA 3FYDA 3UJNA 3HU2A 4LG2A 1NY5A 1QYRA 3FTCA 4ZGDB 2FFJA 3AOEC 4A3VB 2DWMA 2X8AA 4DR4M 2KEBA 1NNJA 3L25A 1DGHB 1IY2A 3SAUA 3QYEA 2R45A 2D7HA 3U6QA 3SATA 1E9SA 4QOZC 4JI3M 1D2NA 4DV3M 3WVEB 3VYGB 2OQ4A 4GIPA 4HNTA 4OB2B 3J27B 5EP3A 2P5TA 4IBDA 4LGMA 2FOIC 4AKGA 3H4MA 3U6SA 3X25B 3U6OA 2CV1A 2Y20A 3D8BA 3FKEA 2G8LA 1KFVA 4CISA 4JYAM 1R2YA 4ZPXA 4DV5M 3X24B 4OB0B 4ELJA 2ERCA 4LZJA 3JAMS 3PNYA 4LRTA 4QNRA 2FE8A 3RGPA 4CGYB 3U60A 1DO2A 4OVZB 2X4AA 1YSYA 3DFZA 1YUBA 3LQRA 4JI8M 2Z7JA 3GLIB 1UGQB 3J80S 2UU9M 2QBYB 3PXGA 3KOXE 4IJEA 1HR0M 2BJVA 2QPAA 1L2DA 4LFAM 1H6UA 2UXBM 1N36M 3HU1A 1ZAEA 3BG9A 2DZOB 4AG5A 2QP9X 3J2PB 3HHTB 4RF0A 1Q39A 3HO8A 3SHFA 4WURA 4NC6A 4QOSA 3L28A 4MGKE 4TUWA 4OW0A 4LJ7A 2V1CA 4DUYM 3SASA 4X65M 4G4NA 3LVWA 2L09A 2QENA 1GLNA 4FD2A 4REZA 4DUZM 4FVMA 3TW6A 3U60B 4M0WA 3TWKA 5EP1A 4PDIA 5ITXA 1MX0A 4HLQA 3GRVA 3CF0A 3LQQA 5KQ8A 4OU7A 4AKIA 2DWLA 3AJIB 4DR6M 1J09A 2ZM6M 3GO8A 5EXPA 1IBLM 1TH3A 4JN6A 1NJGA 4NRVA 5KPRA 2KMGA 1E32A 2Y0QA 4LJ5A 3UMMA 1XC8A 1R7RA 2F5QA 4G4QA 4PT5A 2XFTA 3U6DA 3SC3A 1HQCA 4GC5A 1K82A 2YR0A 4NXNM 3X26B 2CHQA 1VDDA 4LF5M 1L8QA 4S12A 5BR8M 4MFEA 4DR1M 1UGRB 3FUWA 3SHGB 4X62M 3KHIA 1DO0A 3KOYE 4AKHA 4LF4M 3I4YA 3CF6E 5ITUA 4B3SM 1GL7A 2R65A 4OB3B 4LJ4A 4LJ8A 1KYIA 4LFBM 1FKMA 3AFHA 3FTFA 4G4RA 2CEAA 1S3SA 4FWGA 3DZDA 2QQ8A 5IZ7D 2KZSA 2CV2A 4FM4B 1QZMA 2L6OA 4FCVA 4XGIA 1IBKM 4IBCA 4BBAA 1TH4A 4LJAA 3HJQA 5EXTA 2F5SA 2QFZA 2DWNA 1QAMA 2BS3A 3A8LB 1QVRA 3FUVA 3JR5A 1N32M 2EUCA 4RF1A 3GQ3A 1HNZM 4IBIA 2CZ1B 3R9XB 3HGIA 3HHXA 3FUUA 3GQ4A 4LGYA 1XMQM 4OX9M 2DZNB 1XMOM 3TPZA 4GRIA 3SYLA 5ITYA 1G41A 4L16A 5ITTA 4AI6A 4QHTA 2ZPHB 3FUXA 1PM5A 1L2CA 4JI4M 2XEPA 4I5SA 3KP1E 3M0EA 4XBOA 2YFQA 4DV7M 4W5WA 5DYIA 1UGPB 4OVZA 3GPPA 4G6ZA 1Q3CA 1Z59A 2KW0A 3JR4A 4DV4M 1QLBA 1N75A 2J7OA 1SXJA 3GLIA 3LVVA 3VK7A 2UUAM 2QBYA 1JR3D 2M60A 3T15A 1IQPA 1EE8A 1NNUC 1OFHA 1IN6A 3WHKA 5KO3A 4B3MM 4JI6M 3D8LA 4I8OA 4B08A 1HQYE 4FCWA 1GL6A 3U6PA 5KQDA 4GHLA 4R3DA 8CATA 1N78A 1UGSB 1Z5CA 3Q8XA 2F4VM 1E7PA 2KRUA 5E6JA 4PDGA 5FSWA 3FYCA 1IN5A 3TE6A 3QXEB 1IY1A 3KOZE 3W0LB 2UXDM 2CHGA 2NQ8C 4B3TM 3KP0E 3HB9A 5FTKA 4YY3M 4RNAA 1GKIA 2Z4RA 4M9XA 4IBKA 2M5ZA 4LFCM 1QAOA 2QCUA 3U5ZA 3U61B 4L78A 2C9CA 1SXJB 3AOEA 3CF2A 3TWLA 3UZUA 4JI7M 3A8GB 2D7GA 2YNMD 5C1BA 2XLJA 3VKGA 1W5TA 4GMQA 1X37A 4WW0A 3I4VA 3A8OB 2HCBA 2G5GX 4R7GA 2OPFA 3K1JA 2XF3A 4KODA 4ZGEB 3GPYA 3FTDA 3ZC7B 1IM2A 3HHWA 4IBFA 2UUBM 5GKNA 4DR2M 4BBSM 2VQFM 2V6ZM 3A42A 4BBRM 4D81A 5JI3E 4AQYM 3GRUA 3LMMA 3C58A 1AHJB 4DV6M 3SMSA 5LMUM 3SBJA 1R2ZA 4AW4A 3GP1A 1TGUA 4GKKM 4MH0E 3UGJA 2W82A 4HNUA 1Q3BA 3GLGA 4NSRA 3U5ZB 4JI0M 4K0KM 3L27A 1NHWC 2DPPB 1HT1E 3L29A 2C99A 2F5PA 1XXHB 4LF6M 4NRWA 1L1TA 1V29B 2HKJA 3A8MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC6 A;  3QYB A;  3QYE A;  5EJC A;  4Z6Y A;  3HZJ A;  4HLQ A;  2QQ8 A;  3QWL A;  2G77 A;  1FKM A;  4HL4 A;  2QFZ A; 
#chains in the Genus database with same CATH topology
 5IF1 B;  4DR3 M;  3U6C A;  2KZU A;  5DQW A;  2HHH M;  1F5Q B;  2WHB B;  3KXE C;  3A46 A;  3M6A A;  2R7G A;  3TL4 X;  1QDT A;  2HL7 A;  3VFD A;  3QZ9 B;  3PNV A;  4NSO B;  3J7B A;  3GLF A;  4LF8 M;  4DV2 M;  3QHR B;  1IBM M;  3WVD B;  1SXJ C;  4OB1 B;  1DGB A;  1H1S B;  3DDQ B;  2AHJ B;  1WGL A;  5H37 D;  1IN7 A;  2DWZ B;  3T1H M;  1C1K A;  1PJJ A;  3KS4 A;  4P16 A;  3GLF B;  1V33 A;  2R18 A;  2ZPB B;  4DR7 M;  4G4O A;  3DOG B;  4FX3 B;  3TWM A;  4MGZ E;  1IXR C;  4AG6 A;  2EKK A;  4ZGJ B;  2Z8Y M;  2G77 A;  2XZF A;  3TNH B;  1OGU B;  1QQW A;  2X1N B;  1GY3 B;  3U6M A;  2LWX A;  3VKH A;  2O5R A;  4MFD A;  2UZB B;  1HT2 E;  1QUT A;  2WJ9 A;  2D7E A;  1BVS A;  2QDY B;  1D0L A;  2LHC A;  2UUE B;  1E94 E;  2WSC F;  3SFZ A;  2XZU A;  1WIV A;  3CTW B;  4L4U A;  5KPZ A;  3KW6 A;  3ILK A;  4I4L A;  4NST B;  2WZJ A;  2PK2 A;  3K8Z A;  4BCF B;  2I7P A;  3B7Q A;  3QYG B;  4MGY E;  2A5Y B;  5L8R F;  1AIS B;  1NJF A;  1OL1 B;  5EP4 A;  4WP2 A;  4F7L B;  5FTL A;  1DGG A;  4CHT B;  1N33 M;  3SYK A;  2W9F A;  1I4W A;  1XWI A;  1HNW M;  3DTO A;  4JV5 M;  2BPM B;  3W0F A;  4LF7 M;  3L26 A;  2JY7 A;  3E9S A;  1QAQ A;  2EUF A;  3GPX A;  1JQJ C;  2APL A;  2ZPE B;  3AV0 A;  1HNX M;  1FIN B;  3A45 A;  3BXW A;  1P3Q Q;  3AOG A;  3SAR A;  3C3E A;  5FTN A;  2EA0 A;  2LNH C;  4DV0 M;  4FWH A;  1SXJ E;  2Y21 A;  5E26 A;  2VF7 A;  3M03 A;  3PVS A;  4MM3 B;  4YHH M;  4M0D A;  3FYD A;  3HU2 A;  2BWB A;  3AOE C;  2X8A A;  2VDB B;  4QOZ C;  4F2L A;  1D2N A;  3WVE B;  3Q8G A;  4OB2 B;  2P5T A;  2FOI C;  3U6S A;  5IHY A;  1ENW A;  3U6O A;  2GNO A;  1KFV A;  4JYA M;  1H4L D;  4ELJ A;  3PNY A;  4QNR A;  3U60 A;  1YSY A;  2UU9 M;  2QBY B;  3PXG A;  4BCM B;  2BJV A;  4F6U B;  1H6U A;  4RF0 A;  3HO8 A;  4BXX X;  3PO3 S;  4EOQ B;  3L28 A;  4MGK E;  4LJ7 A;  2IW8 B;  3LVW A;  2W99 A;  2L09 A;  2J5Y A;  1GLN A;  4FD2 A;  4REZ A;  4FVM A;  3TW6 A;  3U60 B;  3TWK A;  5ITX A;  1MX0 A;  3GRV A;  3LQQ A;  5KQ8 A;  4AKI A;  3GO8 A;  1IBL M;  1XC8 A;  1UFZ A;  3T6P A;  1K82 A;  1OAO C;  4NXN M;  1PJT A;  2DEN A;  1OKW B;  1L8Q A;  5BR8 M;  3CGW A;  3B7Z A;  3FUW A;  3KOY E;  1GJS A;  1T6O A;  1ZMU A;  3CF6 E;  4B3S M;  2DZL A;  1KYI A;  4LFB M;  3FTF A;  1NO1 A;  5IZ7 D;  2RRU A;  2CV2 A;  1TH4 A;  3DJB A;  3HJQ A;  5EXT A;  2QFZ A;  1QAM A;  1N32 M;  4IBI A;  3LW5 F;  3ZQJ A;  3HGI A;  3HHX A;  1NV8 A;  4R71 A;  4BY1 X;  4GRI A;  3SYL A;  5ITY A;  4AI6 A;  4L16 A;  3FUX A;  2XEP A;  1OIU B;  2YFQ A;  1UGP B;  3GPP A;  3JR4 A;  3GLI A;  3VK7 A;  1JOW A;  2M60 A;  3T15 A;  5KO3 A;  3WHK A;  5KQD A;  1VIN A;  1GJT A;  2F4V M;  3FYC A;  2QSF X;  3W0L B;  2UXD M;  2CHG A;  4B3T M;  3KP0 E;  1RU3 A;  3HB9 A;  5FTK A;  1VEK A;  4RNA A;  3C3D A;  1QAO A;  3U61 B;  3UZU A;  3POM A;  2JP7 A;  4GMQ A;  3A8O B;  3QHW B;  2OPF A;  3GPY A;  4IMY B;  4BBR M;  2PJQ A;  2C6T B;  3SBJ A;  1GH6 B;  2G3Q A;  4GKK M;  1H1P B;  2DAG A;  2QHO B;  3GLG A;  4JI0 M;  1KXU A;  1BU2 A;  1L1T A;  2HKJ A;  1D0M A;  3HHZ A;  4NL4 H;  4JX5 A;  3KS8 A;  5DYG A;  1R6B X;  4YOO A;  3EJ1 B;  1NV9 A;  4GHA A;  3KVW A;  4BCO B;  3WHL A;  3GLG B;  2I7N A;  3HWS A;  1NY6 A;  2BS2 A;  1LTM A;  3FUT A;  2XSZ A;  3L2A A;  1O9K A;  3QWL A;  4EON B;  1JR3 E;  1H24 B;  2BS4 A;  2DKL A;  4QSH A;  3ZCB B;  2DAE A;  1EFU B;  3QAU A;  1J5E M;  2QZ4 A;  1E9H B;  2EKF A;  5FLX S;  5FTJ A;  2IW6 B;  2LH0 A;  1VOL A;  3X28 B;  2MRO B;  5CEI B;  4X64 M;  1N4M A;  3MY1 B;  4KRC B;  3MJ5 A;  5ICP B;  2C5X B;  2CFO A;  5LMK B;  2R44 A;  1P5E B;  3UK6 A;  1JKW A;  2DVW B;  3KSX A;  1G3I A;  3M7G A;  3QZ5 B;  4HEO A;  2ZPF B;  2RGH A;  3EID B;  3AKZ A;  4IBJ A;  2R62 A;  3FTE A;  4EC9 B;  2DAI A;  1XXH A;  2LVQ D;  1W5S A;  2ZPG B;  1G4A E;  4RKU F;  2VII A;  1IRE B;  3VDP A;  1UNH D;  1QAN A;  2JZ1 A;  1N77 A;  4II5 B;  4LOC A;  2C98 A;  3HX3 A;  1F4I A;  2JA2 A;  2DHR A;  1Q02 A;  2Z3X A;  3C9P A;  1D3U B;  2CRU A;  3HBL A;  2K47 A;  1PJQ A;  2AHM A;  1J7K A;  2WIP B;  4HNV A;  2LXE A;  2DD4 B;  2R4E A;  3RFW A;  5DNY A;  1KSF X;  4FWD A;  2CUZ A;  3MIA B;  2BJW A;  4KHP M;  3U6E A;  1MU5 A;  3V76 A;  1OQY A;  1L2B A;  4KO8 A;  3B57 A;  2IN3 A;  4IIW A;  2V22 B;  4EOJ B;  2IVX A;  1EIJ A;  1CUK A;  1NHG C;  4MGI E;  4EOS B;  2WFY B;  3I51 A;  1OFI A;  4BCG B;  4M6V A;  2LTU A;  1AUA A;  3DL1 A;  3THG A;  4CFU D;  1V92 A;  2MJ5 B;  1GVN A;  4FW9 A;  3H4J A;  1K3X A;  1TH2 A;  1Z5B A;  3VYH B;  4BCH B;  4IBB A;  2VQE M;  2YQZ A;  3HKP A;  4JX6 A;  2I40 B;  4BLC A;  3I04 M;  4PD2 A;  1QYR A;  1D0K A;  4A3V B;  2CP8 A;  3L25 A;  1IY2 A;  2LVP C;  3U6Q A;  4DV3 M;  3J27 B;  5EP3 A;  2JXN A;  4BCQ D;  4F70 B;  2QGS A;  3FKE A;  2G8L A;  1XXH E;  4ZPX A;  1R2Y A;  3X24 B;  2FE8 A;  1GUX B;  1QZE A;  4EOO B;  4OVZ B;  4JI8 M;  3G33 B;  4IJE A;  4LFA M;  1N36 M;  1ZAE A;  2DZO B;  1OIZ A;  3HHT B;  1Q39 A;  2MGW A;  3SHF A;  4NC6 A;  1OKS A;  2G9X B;  4TUW A;  3LCU A;  4OW0 A;  2V1C A;  3GTM S;  4G4N A;  2L4E A;  4DBG B;  4DUZ M;  1SG9 A;  3IEC A;  4P17 A;  2K9D A;  4HLQ A;  4OU7 A;  1FVV B;  2ZM6 M;  1TH3 A;  5KPR A;  2Y0Q A;  2JZ0 A;  4G4Q A;  3B74 A;  4PT5 A;  3U6D A;  3SC3 A;  2R6F A;  2YR0 A;  4F1I A;  1VDD A;  5DQV A;  3GLF E;  4AKH A;  1GL7 A;  2R65 A;  4OB3 B;  2CEA A;  2QQ8 A;  2KZS A;  1QZM A;  1IBK M;  4LJA A;  2DWN A;  3A8L B;  2JY5 A;  3FUV A;  4RF1 A;  3GQ3 A;  1HNZ M;  2CZ1 B;  3GQ4 A;  3RGF B;  1XMQ M;  2F2C A;  2WPA B;  1L2C A;  1T43 A;  5DYI A;  3MI9 B;  4Y28 F;  4OGR B;  1Q3C A;  1Z59 A;  1QLB A;  3K7A M;  2J7O A;  2UUA M;  3LVV A;  2QBY A;  1EE8 A;  4B3M M;  4JI6 M;  4B08 A;  1HQY E;  3U6P A;  4CFM B;  1GAB A;  1Z5C A;  2KRU A;  4PDG A;  4ROE A;  3KOZ E;  4YY3 M;  1GKI A;  2Z4R A;  4IBK A;  4LFC M;  1XO2 A;  3AOE A;  5C1B A;  1W5T A;  4EOP B;  1X37 A;  2HCB A;  2G5G X;  1QDR A;  5HQ0 B;  3FTD A;  4G3O A;  4BBS M;  2VQF M;  3A42 A;  4EOK B;  1H1Q B;  4DV6 M;  4CFV B;  4HNU A;  1ZV1 A;  3BHU B;  3L29 A;  2F5P A;  4LF6 M;  4NRW A;  1V29 B;  2FS1 A;  4JI4 M;  5L2W B;  4BY7 X;  4BCJ B;  2XH9 A;  1AIP C;  3A8H B;  1WXQ A;  1URC B;  2WEV B;  4TTH A;  2UUC M;  3TQS A;  2Z4S A;  3AL0 C;  2E5L M;  2CZ7 B;  1Y8G A;  2VF8 A;  1ZQ9 A;  1YE9 A;  1ZMV A;  2KR6 A;  4ROD A;  4BCP B;  2BNK A;  3IG8 A;  2C5R A;  4Z8X A;  5IRE B;  2FNA A;  5EQT A;  2C4G B;  1VQ1 A;  4GEW A;  1G59 A;  1ZP2 A;  1MJG M;  1I94 M;  5HNB B;  4CFU B;  5JI2 E;  2K6B A;  5EP2 A;  1K3W A;  3QYB A;  2ZAM A;  1TDH A;  7CAT A;  1Z5A A;  2KA6 B;  5KPT A;  4LY6 A;  2R46 A;  4F6W B;  3NBI A;  3U61 A;  1TFB A;  3VDU A;  4JXJ A;  2DD5 B;  3W68 A;  3RE8 A;  4CJ6 A;  1A5T A;  2UZE B;  1PRB A;  2I53 A;  4EC8 B;  2UXC M;  2Y0T A;  4LCB A;  1V34 A;  4PCZ A;  4BCQ B;  2W2H A;  3IG5 A;  1SXJ D;  5EXX A;  3IHP A;  4YOZ A;  3HHY A;  5FTM A;  1XNR M;  1R4G A;  4MIM A;  3DDP B;  1OIY B;  1VEG A;  4GKJ M;  3GRY A;  3VLF B;  4B3R M;  5A2Q S;  3MHV C;  4IBG A;  5EJC A;  3K9P A;  2KRK A;  3BLR B;  4LJ6 A;  4BB9 A;  2CZ6 B;  5ITX E;  1L1Z A;  2HAK A;  4ITQ A;  3GLH A;  3DA1 A;  3X20 B;  2BWE A;  3SAV A;  2XFS A;  1N34 M;  2ZBK B;  2C9O A;  3ZH9 B;  3F92 A;  4AZF A;  3TNI B;  1FJG M;  3U6L A;  4ELL A;  4GC9 A;  2RKO A;  1NVM A;  4B7F A;  2O01 F;  3RGS A;  3GLH B;  1IN8 A;  4GIT A;  2CHV A;  4EOL B;  4JI5 M;  1YLA A;  5HBE B;  1TDZ A;  3BLH B;  2D0Q B;  2ZCF B;  4GH9 A;  5LMN M;  4F6S B;  3J81 S;  5C18 A;  2L7I A;  3PFI A;  2DXI A;  3HJS A;  2QF7 A;  2CYZ B;  4NOO B;  4LJ9 A;  1MN3 A;  3BG3 A;  4L15 A;  2CE7 A;  4QHS A;  4YC3 B;  1Z6T A;  4MGH A;  2V1U A;  3GLI E;  5IT9 S;  2L7H A;  2C5V B;  5DFL A;  1IXS B;  2C96 A;  3B9P A;  4MB7 A;  1DV0 A;  4Y72 B;  4LF9 M;  5ITQ A;  1NY5 A;  4ZGD B;  1G3N C;  2DWM A;  1C9B A;  4DR4 M;  3SAU A;  3QYE A;  2D7H A;  5LQF B;  3SAT A;  4JI3 M;  3VYG B;  2MH8 A;  4GIP A;  4LGM A;  4AKG A;  3H4M A;  3LCV B;  2Y20 A;  3D8B A;  2IW9 B;  4CIS A;  5HVY B;  2ERC A;  4LZJ A;  3JAM S;  2PK9 B;  1UNG D;  1VDL A;  1DO2 A;  3DFZ A;  1YUB A;  4CFN B;  1HJP A;  1UGQ B;  1IFY A;  3KOX E;  1L2D A;  3BHT B;  4AG5 A;  3GLG E;  2QP9 X;  3J2P B;  4WUR A;  4I3Z B;  4DUY M;  3SAS A;  4X65 M;  3BHV B;  2DAK A;  4M0W A;  4PDI A;  1XB2 B;  3CF0 A;  2DWL A;  3AJI B;  1J09 A;  5EXP A;  4JN6 A;  1NJG A;  4NRV A;  2KMG A;  1R7R A;  2F5Q A;  2XFT A;  4GC5 A;  1UNL D;  3X26 B;  2LW4 A;  4LF5 M;  4S12 A;  4EOI B;  4MFE A;  4DR1 M;  1UGR B;  3KHI A;  1DO0 A;  4BCI B;  5ITU A;  4LJ4 A;  2CJM B;  2QNJ A;  5BNJ B;  2L6O A;  2BKZ B;  4IBC A;  1OKV B;  2LBC A;  1QVR A;  3JR5 A;  1QMZ B;  2DNA A;  3FUU A;  4LGY A;  4OX9 M;  2DZN B;  2JWS A;  5ITT A;  1G41 A;  2W96 A;  2ZPH B;  1PM5 A;  5FGK B;  3F5X B;  1H26 B;  3KP1 E;  1GUX A;  4DV7 M;  4CXA B;  1C7Y A;  4OVZ A;  4DV4 M;  4CIZ A;  1TR8 A;  1SXJ A;  1JR3 D;  1OFH A;  1NNU C;  1IN6 A;  4I8O A;  1GO5 A;  4GHL A;  4R3D A;  1N78 A;  1UGS B;  3Q8X A;  1E7P A;  1IN5 A;  3QXE B;  3MMP A;  2OOB A;  2DI0 A;  4M9X A;  3BBZ A;  2QCU A;  3A8G B;  3CF2 A;  1SXJ B;  4JI7 M;  2D7G A;  2YNM D;  1W98 B;  3VKG A;  4KOD A;  3B7N A;  3I01 M;  1IM2 A;  3HHW A;  5CYI B;  5GKN A;  1QUS A;  4KT0 F;  4D81 A;  5JI3 E;  4AQY M;  3LMM A;  5LMU M;  4AW4 A;  3GP1 A;  1JSU B;  1TGU A;  2W82 A;  1Q3B A;  4NSR A;  1OIP A;  1NHW C;  1HT1 E;  2C99 A;  4YOS A;  2L4F A;  3K2L A;  1E9R A;  2O25 A;  1TF0 B;  2F5O A;  1WJ7 A;  2WXV B;  2CCH B;  3VK8 A;  3GQ5 A;  4QNM A;  2B9R A;  2DXB B;  5IDN B;  4M9Z A;  3W67 A;  1TD6 A;  1ORY B;  1IXZ A;  3QYH B;  4BCN D;  4X66 M;  3EOC B;  3KOW E;  2QDJ A;  1AD6 A;  2CV0 A;  1VG5 A;  2ZAO A;  2PMI B;  2H1R A;  4FCT A;  4CFW B;  4HL4 A;  4KLN A;  4I81 A;  2Q2E B;  5HBH B;  1PGY A;  4NXM M;  4DV1 M;  2H5X A;  2XSZ D;  3HZJ A;  2UZL B;  3T1Y M;  4JI1 M;  4XK8 F;  2KNZ A;  2ZAN A;  1NSF A;  4DR5 M;  1FNN A;  1T3T A;  2EO2 A;  1OJL A;  3E46 A;  3HJ8 A;  3LQ5 B;  3BG5 A;  3GPU A;  2WIH B;  2LVA A;  3EIE A;  2ZZD B;  3DOA A;  2UZD B;  2CCI B;  5BPV A;  4LRS A;  4F7S B;  4IJF A;  1VYW B;  4IBE A;  3A98 B;  3MK6 A;  4B7G A;  4D82 A;  3R8F A;  1UM8 A;  3SMP A;  4L8R C;  2OOA A;  4LZZ A;  2ZTC A;  3GRR A;  3BOS A;  4EOR B;  4M9S A;  1LV7 A;  4G6L B;  3EIH A;  1OAI A;  2N35 A;  3NWL A;  4B7H A;  2WSF F;  3SAW A;  5F3W A;  1XNQ M;  3FD9 A;  2DHY A;  2RGO A;  1IY0 A;  5ITR A;  2ZPI B;  4CRL B;  2WMA B;  2R4J A;  3J7A S;  1XHB A;  2F5N A;  2C5O B;  4ANR A;  3KSJ A;  4JX4 A;  1IN4 A;  4D80 A;  5EFQ B;  5IWA M;  1DGF A;  2KNA A;  2OO9 A;  2XGN A;  3NBX X;  3HU3 A;  1H27 B;  1PJI A;  2CZ0 B;  2MR9 A;  4EIW A;  4Z6Y A;  3TW7 A;  3E4R A;  2X49 A;  3HY5 A;  4II7 A;  3OTO M;  2DXC B;  2LVN C;  1G8P A;  2J7N A;  3MY5 B;  3T38 A;  3TNW B;  5EXS A;  3K92 A;  1DGH A;  1JR3 A;  5IDP B;  1OL2 B;  4JI2 M;  3KFU G;  2R0I A;  3KDS E;  2KXE A;  3H4C A;  3NDQ A;  3UJN A;  4LG2 A;  3FTC A;  2FFJ A;  2KEB A;  1NNJ A;  1DGH B;  4ROC A;  2R45 A;  1E9S A;  2JNH A;  4HNT A;  2OQ4 A;  4IBD A;  2LVO C;  2JY6 B;  4UN2 B;  2WSE F;  3X25 B;  1PKD B;  2CV1 A;  4DV5 M;  4OB0 B;  2W9Z A;  4LRT A;  1OTR A;  3RGP A;  4CGY B;  5HBJ B;  2X4A A;  3LQR A;  2Z7J A;  3GLI B;  1R5L A;  3J80 S;  1HR0 M;  2DAM A;  4EOM B;  2QPA A;  2UXB M;  3FRH A;  3HU1 A;  3BG9 A;  5ACB A;  4QOS A;  2LHG A;  2QEN A;  3BLQ B;  3O0G D;  5EP1 A;  2ZTD A;  4DR6 M;  2JUJ A;  2JGZ B;  1E32 A;  4LJ5 A;  2B3T A;  3UMM A;  4CFX B;  1HQC A;  1TTE A;  2CHQ A;  1VEJ A;  4KRD B;  3SHG B;  4X62 M;  5I5Z B;  2CWB A;  4LF4 M;  2L2D A;  1IXS A;  3FE3 A;  3I4Y A;  4LJ8 A;  1FKM A;  3AFH A;  2DME A;  4Q7J A;  4G4R A;  1S3S A;  4FWG A;  3DZD A;  4FM4 B;  4FCV A;  4XGI A;  4BCN B;  4BBA A;  2F5S A;  2BS3 A;  1WHC A;  2KNV A;  4L6V 6;  2EUC A;  3FRI A;  1JST B;  3R9X B;  1XMO M;  3TPZ A;  2KHH A;  4QHT A;  4I5S A;  1OI9 B;  2C5N B;  3M0E A;  3K9O A;  4XBO A;  4BCK B;  4W5W A;  2K0B X;  1JB0 F;  1WR1 B;  4G6Z A;  2KW0 A;  1O9K B;  1N75 A;  1IQP A;  3D8L A;  4FCW A;  1GL6 A;  8CAT A;  2KDL A;  5E6J A;  5FSW A;  1H25 B;  3TE6 A;  1IY1 A;  4F7J B;  2NQ8 C;  2WMB B;  1G71 A;  1ZMW A;  1H1R B;  2FH0 A;  2M5Z A;  2HWJ A;  3U5Z A;  3B89 A;  4L78 A;  2C9C A;  4F7N B;  3TWL A;  2XLJ A;  1PJS A;  2PHG A;  4BCM D;  4WW0 A;  3I4V A;  4R7G A;  3K1J A;  2XF3 A;  4ZGE B;  1WGN A;  3ZC7 B;  2UUB M;  4IBF A;  4DR2 M;  2GQF A;  2V6Z M;  3GRU A;  3GLH E;  3C58 A;  1AHJ B;  2EJS A;  3SMS A;  1R2Z A;  4MH0 E;  3UGJ A;  4UN0 A;  3U5Z B;  4K0K M;  3L27 A;  1H28 B;  4OR5 B;  2DPP B;  3E21 A;  1XXH B;  3TN8 B;  2JY8 A;  3A8M B; 
#chains in the Genus database with same CATH homology
 3K2L A;  4DR3 M;  3HHZ A;  3U6C A;  1E9R A;  2KZU A;  4NL4 H;  2HHH M;  4JX5 A;  3KS8 A;  5DYG A;  2XH9 A;  1R6B X;  3KXE C;  3A8H B;  1WXQ A;  2F5O A;  3A46 A;  2UUC M;  3TQS A;  2Z4S A;  3AL0 C;  2E5L M;  3VK8 A;  4GHA A;  3KVW A;  3M6A A;  2CZ7 B;  3GQ5 A;  4QNM A;  2DXB B;  1ZQ9 A;  4M9Z A;  1YE9 A;  3TL4 X;  3WHL A;  3GLG B;  2I7N A;  2KR6 A;  1ORY B;  3HWS A;  1NY6 A;  2HL7 A;  1IXZ A;  2BNK A;  3IG8 A;  3VFD A;  4Z8X A;  2C5R A;  3FUT A;  3PNV A;  2BS2 A;  2XSZ A;  3L2A A;  5IRE B;  2FNA A;  3QZ9 B;  3QYH B;  4NSO B;  3QWL A;  5EQT A;  4X66 M;  3J7B A;  3GLF A;  3KOW E;  4LF8 M;  2QDJ A;  1G59 A;  2CV0 A;  2BS4 A;  4DV2 M;  4QSH A;  3ZCB B;  2ZAO A;  1I94 M;  3QAU A;  1J5E M;  2H1R A;  4FCT A;  1IBM M;  3WVD B;  1SXJ C;  5JI2 E;  2QZ4 A;  5FLX S;  4OB1 B;  1DGB A;  5EP2 A;  4HL4 A;  5FTJ A;  1K3W A;  3QYB A;  2ZAM A;  1TDH A;  2LH0 A;  4KLN A;  4I81 A;  7CAT A;  2AHJ B;  3X28 B;  5H37 D;  2Q2E B;  1Z5A A;  2KA6 B;  4X64 M;  1IN7 A;  5KPT A;  2DWZ B;  4LY6 A;  2R46 A;  1C1K A;  3T1H M;  3NBI A;  3U61 A;  4DV1 M;  1PJJ A;  4NXM M;  3KS4 A;  2XSZ D;  3HZJ A;  4P16 A;  3VDU A;  3GLF B;  3T1Y M;  4JI1 M;  3MJ5 A;  4JXJ A;  2R18 A;  2CFO A;  2ZPB B;  2ZAN A;  1NSF A;  4DR7 M;  4G4O A;  4DR5 M;  2DD5 B;  3TWM A;  1FNN A;  1T3T A;  4MGZ E;  3RE8 A;  2EO2 A;  1OJL A;  3UK6 A;  3HJ8 A;  1IXR C;  2DVW B;  3KSX A;  1G3I A;  4AG6 A;  4ZGJ B;  3BG5 A;  3M7G A;  3GPU A;  2UXC M;  2G77 A;  2XZF A;  3QZ5 B;  2Y0T A;  2ZPF B;  3EIE A;  4LCB A;  2ZZD B;  2RGH A;  4PCZ A;  3DOA A;  1QQW A;  4IBJ A;  3AKZ A;  2R62 A;  3FTE A;  3U6M A;  5BPV A;  4LRS A;  3IG5 A;  2LWX A;  4IJF A;  1SXJ D;  3VKH A;  2O5R A;  4MFD A;  1XXH A;  1HT2 E;  4IBE A;  5EXX A;  3HHY A;  1W5S A;  3A98 B;  5FTM A;  3MK6 A;  4B7G A;  2ZPG B;  1G4A E;  1XNR M;  2WJ9 A;  2VII A;  4D82 A;  1IRE B;  4MIM A;  3R8F A;  1UM8 A;  3SMP A;  3VDP A;  4L8R C;  2D7E A;  4LZZ A;  2QDY B;  1QAN A;  3GRR A;  4GKJ M;  1E94 E;  3BOS A;  1N77 A;  3GRY A;  3VLF B;  4M9S A;  3SFZ A;  2XZU A;  1LV7 A;  4B3R M;  4LOC A;  3EIH A;  5A2Q S;  3CTW B;  2C98 A;  3MHV C;  4IBG A;  4L4U A;  3NWL A;  5EJC A;  4B7H A;  5KPZ A;  2KRK A;  3KW6 A;  3SAW A;  5F3W A;  1XNQ M;  3ILK A;  3FD9 A;  4I4L A;  4LJ6 A;  2JA2 A;  4BB9 A;  2CZ6 B;  2DHR A;  5ITX E;  2RGO A;  1IY0 A;  2Z3X A;  3K8Z A;  1L1Z A;  5ITR A;  2ZPI B;  2I7P A;  3HBL A;  2K47 A;  4ITQ A;  3QYG B;  3GLH A;  2AHM A;  2R4J A;  3DA1 A;  3J7A S;  1J7K A;  3X20 B;  1XHB A;  2F5N A;  3SAV A;  4MGY E;  3KSJ A;  2XFS A;  2A5Y B;  2ZBK B;  1N34 M;  4JX4 A;  2C9O A;  3ZH9 B;  4HNV A;  1NJF A;  2LXE A;  1IN4 A;  2R4E A;  4D80 A;  2DD4 B;  3RFW A;  5EP4 A;  5IWA M;  5DNY A;  1DGF A;  4AZF A;  1KSF X;  4FWD A;  5FTL A;  1DGG A;  4CHT B;  1N33 M;  2CUZ A;  2BJW A;  2XGN A;  4KHP M;  3SYK A;  3U6E A;  1MU5 A;  1FJG M;  3U6L A;  1I4W A;  1XWI A;  3HU3 A;  1L2B A;  1HNW M;  4KO8 A;  4GC9 A;  2RKO A;  1PJI A;  1NVM A;  4JV5 M;  2CZ0 B;  4B7F A;  4IIW A;  3W0F A;  4LF7 M;  4EIW A;  3L26 A;  4Z6Y A;  3RGS A;  3E9S A;  3GLH B;  1IN8 A;  1QAQ A;  2CHV A;  4GIT A;  1NHG C;  3GPX A;  4JI5 M;  3TW7 A;  1JQJ C;  2ZPE B;  1TDZ A;  4MGI E;  3AV0 A;  3E4R A;  3I51 A;  1HNX M;  2X49 A;  4II7 A;  2D0Q B;  2ZCF B;  3OTO M;  1OFI A;  4GH9 A;  5LMN M;  4M6V A;  3J81 S;  3DL1 A;  3A45 A;  3THG A;  2DXC B;  5C18 A;  1G8P A;  2J7N A;  2L7I A;  3PFI A;  2DXI A;  3HJS A;  3T38 A;  1GVN A;  4FW9 A;  5EXS A;  3K92 A;  1DGH A;  2QF7 A;  3AOG A;  3SAR A;  2CYZ B;  1K3X A;  1JR3 A;  4NOO B;  1TH2 A;  1Z5B A;  5FTN A;  4LJ9 A;  2EA0 A;  3BG3 A;  2LNH C;  4L15 A;  4DV0 M;  2CE7 A;  4QHS A;  3VYH B;  1Z6T A;  4MGH A;  2V1U A;  4FWH A;  1SXJ E;  2Y21 A;  4IBB A;  2VQE M;  4JI2 M;  2YQZ A;  5E26 A;  3HKP A;  3KFU G;  5IT9 S;  2L7H A;  3KDS E;  4JX6 A;  1IXS B;  3PVS A;  4MM3 B;  2C96 A;  2KXE A;  3B9P A;  4MB7 A;  3H4C A;  4LF9 M;  5ITQ A;  4BLC A;  4YHH M;  4PD2 A;  4M0D A;  3FYD A;  3UJN A;  3HU2 A;  4LG2 A;  1NY5 A;  1QYR A;  3FTC A;  4ZGD B;  2FFJ A;  3AOE C;  4A3V B;  2DWM A;  2X8A A;  4DR4 M;  2KEB A;  1NNJ A;  3L25 A;  1DGH B;  1IY2 A;  3SAU A;  3QYE A;  2R45 A;  2D7H A;  3U6Q A;  3SAT A;  1E9S A;  4QOZ C;  4JI3 M;  1D2N A;  4DV3 M;  3WVE B;  3VYG B;  2OQ4 A;  4GIP A;  4HNT A;  4OB2 B;  3J27 B;  5EP3 A;  2P5T A;  4IBD A;  4LGM A;  2FOI C;  4AKG A;  3H4M A;  3U6S A;  3X25 B;  3U6O A;  2CV1 A;  2Y20 A;  3D8B A;  3FKE A;  2G8L A;  1KFV A;  4CIS A;  4JYA M;  1R2Y A;  4ZPX A;  4DV5 M;  3X24 B;  4OB0 B;  4ELJ A;  2ERC A;  4LZJ A;  3JAM S;  3PNY A;  4LRT A;  4QNR A;  2FE8 A;  3RGP A;  4CGY B;  3U60 A;  1DO2 A;  4OVZ B;  2X4A A;  1YSY A;  3DFZ A;  1YUB A;  3LQR A;  4JI8 M;  2Z7J A;  3GLI B;  1UGQ B;  3J80 S;  2UU9 M;  2QBY B;  3PXG A;  3KOX E;  4IJE A;  1HR0 M;  2BJV A;  2QPA A;  1L2D A;  4LFA M;  1H6U A;  2UXB M;  1N36 M;  3HU1 A;  1ZAE A;  3BG9 A;  2DZO B;  4AG5 A;  2QP9 X;  3J2P B;  3HHT B;  4RF0 A;  1Q39 A;  3HO8 A;  3SHF A;  4WUR A;  4NC6 A;  4QOS A;  3L28 A;  4MGK E;  4TUW A;  4OW0 A;  4LJ7 A;  2V1C A;  4DUY M;  3SAS A;  4X65 M;  4G4N A;  3LVW A;  2L09 A;  2QEN A;  1GLN A;  4FD2 A;  4REZ A;  4DUZ M;  4FVM A;  3TW6 A;  3U60 B;  4M0W A;  3TWK A;  5EP1 A;  4PDI A;  5ITX A;  1MX0 A;  4HLQ A;  3GRV A;  3CF0 A;  3LQQ A;  5KQ8 A;  4OU7 A;  4AKI A;  2DWL A;  3AJI B;  4DR6 M;  1J09 A;  2ZM6 M;  3GO8 A;  5EXP A;  1IBL M;  1TH3 A;  4JN6 A;  1NJG A;  4NRV A;  5KPR A;  2KMG A;  1E32 A;  2Y0Q A;  4LJ5 A;  3UMM A;  1XC8 A;  1R7R A;  2F5Q A;  4G4Q A;  4PT5 A;  2XFT A;  3U6D A;  3SC3 A;  1HQC A;  4GC5 A;  1K82 A;  2YR0 A;  4NXN M;  3X26 B;  2CHQ A;  1VDD A;  4LF5 M;  1L8Q A;  4S12 A;  5BR8 M;  4MFE A;  4DR1 M;  1UGR B;  3FUW A;  3SHG B;  4X62 M;  3KHI A;  1DO0 A;  3KOY E;  4AKH A;  4LF4 M;  3I4Y A;  3CF6 E;  5ITU A;  4B3S M;  1GL7 A;  2R65 A;  4OB3 B;  4LJ4 A;  4LJ8 A;  1KYI A;  4LFB M;  1FKM A;  3AFH A;  3FTF A;  4G4R A;  2CEA A;  1S3S A;  4FWG A;  3DZD A;  2QQ8 A;  5IZ7 D;  2KZS A;  2CV2 A;  4FM4 B;  1QZM A;  2L6O A;  4FCV A;  4XGI A;  1IBK M;  4IBC A;  4BBA A;  1TH4 A;  4LJA A;  3HJQ A;  5EXT A;  2F5S A;  2QFZ A;  2DWN A;  1QAM A;  2BS3 A;  3A8L B;  1QVR A;  3FUV A;  3JR5 A;  1N32 M;  2EUC A;  4RF1 A;  3GQ3 A;  1HNZ M;  4IBI A;  2CZ1 B;  3R9X B;  3HGI A;  3HHX A;  3FUU A;  3GQ4 A;  4LGY A;  1XMQ M;  4OX9 M;  2DZN B;  1XMO M;  3TPZ A;  4GRI A;  3SYL A;  5ITY A;  1G41 A;  4L16 A;  5ITT A;  4AI6 A;  4QHT A;  2ZPH B;  3FUX A;  1PM5 A;  1L2C A;  4JI4 M;  2XEP A;  4I5S A;  3KP1 E;  3M0E A;  4XBO A;  2YFQ A;  4DV7 M;  4W5W A;  5DYI A;  1UGP B;  4OVZ A;  3GPP A;  4G6Z A;  1Q3C A;  1Z59 A;  2KW0 A;  3JR4 A;  4DV4 M;  1QLB A;  1N75 A;  2J7O A;  1SXJ A;  3GLI A;  3LVV A;  3VK7 A;  2UUA M;  2QBY A;  1JR3 D;  2M60 A;  3T15 A;  1IQP A;  1EE8 A;  1NNU C;  1OFH A;  1IN6 A;  3WHK A;  5KO3 A;  4B3M M;  4JI6 M;  3D8L A;  4I8O A;  4B08 A;  1HQY E;  4FCW A;  1GL6 A;  3U6P A;  5KQD A;  4GHL A;  4R3D A;  8CAT A;  1N78 A;  1UGS B;  1Z5C A;  3Q8X A;  2F4V M;  1E7P A;  2KRU A;  5E6J A;  4PDG A;  5FSW A;  3FYC A;  1IN5 A;  3TE6 A;  3QXE B;  1IY1 A;  3KOZ E;  3W0L B;  2UXD M;  2CHG A;  2NQ8 C;  4B3T M;  3KP0 E;  3HB9 A;  5FTK A;  4YY3 M;  4RNA A;  1GKI A;  2Z4R A;  4M9X A;  4IBK A;  2M5Z A;  4LFC M;  1QAO A;  2QCU A;  3U5Z A;  3U61 B;  4L78 A;  2C9C A;  1SXJ B;  3AOE A;  3CF2 A;  3TWL A;  3UZU A;  4JI7 M;  3A8G B;  2D7G A;  2YNM D;  5C1B A;  2XLJ A;  3VKG A;  1W5T A;  4GMQ A;  1X37 A;  4WW0 A;  3I4V A;  3A8O B;  2HCB A;  2G5G X;  4R7G A;  2OPF A;  3K1J A;  2XF3 A;  4KOD A;  4ZGE B;  3GPY A;  3FTD A;  3ZC7 B;  1IM2 A;  3HHW A;  4IBF A;  2UUB M;  5GKN A;  4DR2 M;  4BBS M;  2VQF M;  2V6Z M;  3A42 A;  4BBR M;  4D81 A;  5JI3 E;  4AQY M;  3GRU A;  3LMM A;  3C58 A;  1AHJ B;  4DV6 M;  3SMS A;  5LMU M;  3SBJ A;  1R2Z A;  4AW4 A;  3GP1 A;  1TGU A;  4GKK M;  4MH0 E;  3UGJ A;  2W82 A;  4HNU A;  1Q3B A;  3GLG A;  4NSR A;  3U5Z B;  4JI0 M;  4K0K M;  3L27 A;  1NHW C;  2DPP B;  1HT1 E;  3L29 A;  2C99 A;  2F5P A;  1XXH B;  4LF6 M;  4NRW A;  1L1T A;  1V29 B;  2HKJ A;  3A8M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...