4HLQA

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
total genus 95
structure length 280
sequence length 280
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hlqA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hlqA02
4HLQA 3QWLA 3HZJA 2G77A 3QYBA 4HL4A 4NC6A 3QYEA 1FKMA 4Z6YA 2QQ8A 5EJCA 2QFZA
chains in the Genus database with same CATH superfamily
3F5XB 2C96A 4JI5M 1IN7A 3GRUA 2EKFA 5ITQA 1QVRA 2L7HA 3L26A 3E46A 4BCQD 2ZPEB 2DAEA 2D7GA 3PXGA 2FFJA 1VEJA 2CWBA 2N35A 2MH8A 5HQ0B 1OIZA 5KPTA 3QXEB 3THGA 8CATA 4LFAM 3BLHB 1AD6A 2EA0A 4ZPXA 4AI6A 2KZUA 1N36M 4F7LB 3O0GD 1NHWC 4G4OA 1UGRB 4K0KM 2GQFA 3M7GA 4RNAA 4G6LB 3WHLA 1OL1B 2G8LA 1HNZM 1TDZA 1F5QB 4OB3B 1TH4A 3A42A 3HU3A 3NBXX 2XZUA 2CV1A 4S12A 3FTDA 3AFHA 2IW6B 3EJ1B 3MHVC 4X66M 3A8HB 4RF0A 4CRLB 4OB1B 1R6BX 2R0IA 5E6JA 4DR3M 3T1YM 5EQTA 2JA2A 4II7A 4CJ6A 4R3DA 4IBGA 3GLIB 3B9PA 3RE8A 4BY7X 1TH3A 3AOEC 4CFXB 3GO8A 1IBMM 3GP1A 3HHWA 4GEWA 2UXBM 2EKKA 3BBZA 1FJGM 2R65A 1WR1B 1XNRM 3GLFE 4IIWA 2WSEF 2C9OA 5KQ8A 4LOCA 1MJGM 3RFWA 5ICPB 2CZ6B 4AKIA 2Y0QA 2JXNA 1JR3E 5EP4A 3FRHA 2IVXA 3OTOM 2ZPGB 2XZFA 2KR6A 4L15A 3GLGB 2Y20A 4QSHA 1OKSA 3DTOA 3KFUG 2J7NA 3QAUA 3IG8A 2ZBKB 3GLIE 2Y21A 2ZPHB 1I94M 4LG2A 3X28B 1IBLM 1VDDA 1XB2B 4AKGA 1IY2A 3K8ZA 2CEAA 4M9XA 4GKJM 2XSZD 3MI9B 2ZANA 1C9BA 4D80A 4NSOB 2XGNA 1R5LA 3VDPA 4CFUB 1ZV1A 1XNQM 4D82A 3J80S 2K47A 2QENA 1UNHD 1UFZA 3QZ9B 2EJSA 3GLGE 2DMEA 4EOMB 1MN3A 3GRVA 2CZ7B 1Q3BA 1D0LA 1WXQA 2DAKA 5LMNM 4FX3B 5KPRA 1PM5A 3L27A 3VK7A 3PNYA 1IM2A 1G3IA 2Y0TA 3NDQA 5JI2E 4QNMA 3U5ZB 3VKHA 4NC6A 2W82A 2L09A 1NJFA 2IW9B 4TTHA 3FKEA 2CV2A 3HHYA 1SXJC 1R4GA 3VFDA 2V22B 3UGJA 3BLQB 4CFWB 2DENA 1DGHB 5L2WB 2QHOB 3DZDA 2KHHA 5LMKB 4PD2A 2R4JA 2HCBA 1IY1A 3C58A 1N34M 2HHHM 2EO2A 3IHPA 1R2YA 4LF4M 3B7ZA 4WP2A 1YLAA 3GQ5A 1JSUB 4DV0M 2F5SA 4YY3M 2W9FA 1PJTA 2J7OA 1IN6A 3ZQJA 3GLHB 3PFIA 2PK2A 5DYGA 1E9HB 5ITYA 3U60B 2G77A 3HJSA 2LVAA 4JI2M 2LTUA 5EXPA 3SBJA 1HQCA 4A3VB 5HBJB 4IBEA 3LW5F 2LH0A 5JI3E 4RF1A 5EFQB 3TWKA 1XO2A 2DZOB 2WXVB 4OX9M 2QP9X 2KXEA 3SMPA 3CGWA 1K3XA 4X65M 3CF2A 1NY5A 2X8AA 1DGBA 5HVYB 5EP2A 3GLHE 4PDGA 1H26B 1WGNA 4Y28F 1FVVB 2C4GB 1L1ZA 5E26A 3GTMS 1ZAEA 1G71A 4AKHA 3DJBA 3AOGA 4MGIE 4M9SA 3HWSA 3SASA 1I4WA 3TNHB 2RKOA 1D0MA 2BPMB 2UZBB 4JI3M 4JX5A 1H28B 4KO8A 4CFVB 2E5LM 4NRWA 1ZMUA 4KRCB 4F7SB 3R8FA 3SC3A 1NHGC 3EIHA 4DV2M 4DR4M 4MB7A 4CISA 1PJQA 3MK6A 3FYDA 3TWMA 1O9KA 3DA1A 3MY1B 1T43A 4OW0A 1T3TA 4OU7A 3LMMA 1UGSB 2DPPB 4HNUA 2MROB 4FWHA 1SXJB 1ZMWA 3T38A 3B89A 3CF6E 3T1HM 1E94E 3ZCBB 2Z8YM 3BHTB 1TD6A 2LHGA 4EORB 2HWJA 2ZTCA 2MGWA 3KS8A 2M5ZA 3DDQB 3G33B 2R7GA 2CUZA 4F7JB 1N4MA 3M0EA 3T15A 4HL4A 3FTFA 3K2LA 3DL1A 3A46A 1ORYB 4R7GA 3U6MA 5DQVA 4XBOA 1YE9A 2JNHA 4B3TM 1E7PA 2ZZDB 3LVWA 4ELLA 1IXSB 3L2AA 1W5SA 2C5VB 5ITXE 5HBHB 2ZPFB 4M0WA 3T6PA 1OAOC 5ITUA 4GITA 1R7RA 2QGSA 4GHLA 3VYHB 3VDUA 3D8BA 1HR0M 2AHMA 2BNKA 2C98A 4CHTB 4RKUF 4DR5M 3WVDB 1TH2A 3I01M 2IW8B 2R62A 2D7HA 1NY6A 3I4VA 4G4NA 2BJWA 4LY6A 4LF6M 4I4LA 1DO0A 4B08A 1D0KA 2KA6B 3JR4A 2CCHB 2R44A 2CV0A 4LRTA 4ANRA 2OPFA 2JY8A 2G5GX 2CJMB 2O25A 1Q39A 4II5B 4X64M 4DUYM 4GHAA 4CFMB 4M0DA 4LCBA 1IQPA 2PJQA 2WIPB 1OAIA 3BHUB 3DDPB 2O01F 2PHGA 2KZSA 4I8OA 4PT5A 3AJIB 1UM8A 2VIIA 2BS3A 4LJ6A 5FTNA 4LFBM 1AIPC 2F5PA 3HB9A 2PMIB 2EUCA 3TE6A 3BLRB 2OOAA 3DOAA 4MGZE 3J2PB 1F4IA 4BCNB 4EOPB 1TDHA 4DR1M 3U61B 1JR3D 2G3QA 4UN0A 3GRYA 1OI9B 3SATA 4B3MM 1H27B 4GIPA 2FS1A 5EP1A 1H1QB 2KNZA 5EXXA 2CCIB 3VYGB 4JV5M 4OVZA 4JN6A 3LQQA 4EIWA 1Z6TA 2I40B 3K1JA 2UUAM 3RGFB 1OIYB 1J09A 4OB2B 1C7YA 3ZC7B 3EIDB 2QPAA 1NVMA 1N32M 4BB9A 3GLFA 3GQ4A 2DAMA 1L2CA 3BG3A 2DXCB 1QUSA 2CHGA 4FD2A 2BWEA 2UU9M 1OQYA 4F1IA 4ZGJB 4NL4H 2WPAB 2HKJA 1N33M 1JOWA 3GQ3A 1QQWA 3FUVA 4LZJA 1UGPB 3TW6A 1GL7A 5KQDA 3TN8B 2UUCM 3ZH9B 2Z4RA 1QLBA 4F6SB 4ROCA 4BCFB 4KRDB 5I5ZB 4GC9A 4FCTA 1NV8A 3HHTB 1IXZA 2VQFM 1T6OA 2DVWB 1QDRA 3KOXE 2C5OB 3QHRB 1G41A 1XHBA 2FH0A 3B74A 1G59A 3DOGB 4BCMB 4CFUD 2BS2A 2JZ0A 2P5TA 4R71A 2KRUA 1J5EM 2DWMA 4RODA 2L4FA 2DZLA 3M03A 2ZPBB 3BG9A 3U6QA 1NSFA 4KODA 3POMA 4CIZA 1OFHA 1FNNA 3A8GB 4LJAA 3SYLA 3TWLA 4BBRM 2JY5A 2L2DA 2CFOA 3TW7A 4LRSA 4QOZC 3KOWE 2X1NB 4OB0B 2DAGA 1EFUB 5EP3A 1GUXA 4G4RA 4Z8XA 2CHQA 4WURA 3FYCA 2BS4A 1QAOA 3HZJA 1E9SA 1GLNA 4ZGEB 4NRVA 1HNWM 1G8PA 3W67A 3H4CA 3GPYA 1URCB 4GRIA 4Z6YA 2XSZA 2JY6B 3HJ8A 5ITRA 4BCOB 5IWAM 2DXIA 1QANA 5FTLA 2ZM6M 4LF8M 4I3ZB 3BG5A 1MX0A 3IG5A 4FCWA 3GPUA 2X49A 2QBYA 1PKDB 1L2DA 2K6BA 3C3EA 2DHRA 4LJ4A 3E9SA 4LJ8A 4BCPB 5FTKA 2WHBB 2M60A 3AV0A 4JI6M 2C6TB 3KDSE 2WEVB 3A8MB 2XF3A 2LVPC 4IMYB 4JI1M 1QAQA 5HNBB 2Q2EB 3TL4X 2JWSA 1TF0B 3W0LB 5DQWA 2R6FA 2D0QB 3AOEA 3FUTA 1S3SA 2DKLA 2F4VM 3PO3S 4NSRA 1Z59A 5F3WA 3K9PA 3RGSA 3IECA 2KMGA 1EIJA 4Y72B 3I51A 2RGHA 1H25B 4MIMA 3GPPA 3NBIA 2UUEB 4YOSA 5A2QS 4AG6A 1EE8A 2VF8A 1NNJA 4P17A 3VLFB 2ZPIB 2Z3XA 2JY7A 1OL2B 1GH6B 1XXHB 2CZ1B 3SHFA 2KEBA 1GABA 1A5TA 3FD9A 3HY5A 1OIUB 1NJGA 4OGRB 1WHCA 4DV6M 2W99A 1UNGD 5CEIB 1VEKA 5KPZA 3MJ5A 4I81A 1ZQ9A 1GJSA 3V76A 1SXJD 4GKKM 2W9ZA 5BPVA 4BCGB 4HNTA 3U6PA 4F7NB 3HKPA 3HU2A 4IBCA 4JI8M 4YC3B 3I04M 3A45A 2L4EA 1BVSA 2QDJA 4B7HA 2ZCFB 1O9KB 5FGKB 1XXHE 3U6DA 3PNVA 2LVNC 1H6UA 3LQRA 4JYAM 4FVMA 1L1TA 2FOIC 1D2NA 1Z5BA 3GPXA 4XGIA 2RRUA 4KHPM 4L4UA 3B7QA 3I4YA 1N75A 4REZA 2XH9A 2BKZB 4MFEA 5ITXA 4IBKA 2LVQD 4EOLB 1J7KA 1JB0F 1KYIA 2BJVA 2LNHC 1PGYA 3WHKA 3U6OA 1TFBA 4B7FA 5LQFB 5IZ7D 1QZEA 4CXAB 2CE7A 3L28A 4HLQA 3CF0A 3JAMS 1SXJE 4YHHM 5BR8M 2ERCA 4FWDA 3FE3A 4MM3B 3J81S 3K92A 3A8LB 2YNMD 4CFNB 1GL6A 4NXMM 2OOBA 1LTMA 4LGYA 4L8RC 4L78A 3ILKA 7CATA 4F6WB 3MY5B 4M9ZA 1GO5A 1TGUA 3QYBA 3NWLA 2VF7A 2I7PA 4LJ7A 2X4AA 2UZDB 4I5SA 4F70B 2YFQA 2VQEM 1H1PB 1DV0A 2YQZA 2CP8A 4IBFA 4TUWA 3LVVA 2KW0A 1VYWB 4W5WA 2KDLA 1XC8A 1MU5A 2QCUA 4B3SM 2CHVA 1SG9A 2WSCF 4BBAA 3LCUA 4DUZM 1V92A 4JI7M 2K0BX 2H5XA 2J5YA 4BCND 4GC5A 1VINA 4QOSA 3WVEB 3EIEA 3KP1E 4BCIB 3H4MA 3SAWA 5IDNB 3L29A 3TQSA 2F5OA 3TNWB 2JUJA 3B57A 3KSXA 1OKVB 2CRUA 1DGGA 4IBDA 2V1UA 2QNJA 5L8RF 2R45A 1XMQM 4G4QA 1AUAA 1YUBA 3SARA 3QZ5B 4EC8B 2MR9A 3HU1A 2ZTDA 2DXBB 2WFYB 5IDPB 2H1RA 3R9XB 1ZP2A 4NOOB 1WJ7A 1IY0A 1IN4A 1R2ZA 4LF5M 4FW9A 2KRKA 4L6V6 4LF7M 4KLNA 4GH9A 3U61A 1WIVA 4JI0M 3FUWA 1Z5AA 1ZMVA 1QAMA 3X24B 4OVZB 4DR6M 1DGFA 2LXEA 5FLXS 4BY1X 5FTMA 2YR0A 4EOQB 4BCQB 3QYEA 4BCHB 4DV4M 3KOYE 1L2BA 4EOSB 1GJTA 2QZ4A 3GLFB 1UNLD 2RGOA 4MGKE 4HNVA 2LBCA 3H4JA 1JR3A 2LHCA 4BCMD 3UMMA 4DBGB 3KVWA 1OGUB 4F6UB 1JSTB 2DAIA 2UZEB 4GMQA 4WW0A 2NQ8C 2C5NB 3HBLA 2WSFF 3GLIA 3MIAB 4IJEA 1P3QQ 5GKNA 1KSFX 2LWXA 4P16A 3FTEA 2CYZB 4QHSA 1Z5CA 1HNXM 2DWZB 1KXUA 5CYIB 5BNJB 3SYKA 5FTJA 3DFZA 4NSTB 4BBSM 1ENWA 2UXCM 5LMUM 1RU3A 3J27B 4EONB 2WMAB 5IREB 2XFSA 4JI4M 1OKWB 2G9XB 1H24B 3TNIB 2XLJA 2JGZB 2LVOC 2R46A 5C18A 2ZAOA 3U6CA 2QQ8A 4DV7M 3GLGA 1HT1E 1H1RB 3AL0C 4AQYM 1QUTA 4UN2B 4B7GA 2D7EA 2W96A 1L8QA 2EUFA 1VQ1A 4AZFA 2V6ZM 1V34A 3K7AM 2Z7JA 2VDBB 5HBEB 3LCVB 1D3UB 3K9OA 3KOZE 4M6VA 3CTWB 1GUXB 1IN5A 2DHYA 2R4EA 3PVSA 1VG5A 3AKZA 3SMSA 1Y8GA 2BWBA 4DV1M 4FCVA 3X26B 1HJPA 1KFVA 4F2LA 3HGIA 4DR7M 2B3TA 3KP0E 1FKMA 2WJ9A 2B9RA 4LZZA 4DR2M 4AW4A 2IN3A 3U5ZA 2FNAA 3KXEC 1PJIA 5ACBA 3BXWA 4NXNM 3X20B 2DNAA 1TR8A 1IBKM 4BXXX 3RGPA 1DGHA 5C1BA 2FE8A 2QBYB 4MGYE 4BCJB 1FINB 2APLA 2ZAMA 4MFDA 3QYHB 3QWLA 5IT9S 5IF1B 5KO3A 4EOJB 2W2HA 2PK9B 1QZMA 2C99A 2A5YB 3GRRA 5IHYA 2AHJB 1VOLA 2DWNA 2QSFX 5DNYA 2I7NA 2UUBM 3J7BA 2KNVA 2QDYB 4B3RM 3GLHA 1XMOM 3UJNA 1HQYE 4AG5A 4G3OA 3TPZA 3D8LA 3U60A 1QMZB 2JP7A 4ROEA 4BLCA 3VK8A 1W5TA 5ITTA 4ELJA 1WGLA 4PCZA 2UZLB 4QNRA 2F5NA 4L16A 4XK8F 2DD5B 2WZJA 1E9RA 3LQ5B 3F92A 5FSWA 2XFTA 3L25A 4YOZA 3B7NA 3C9PA 3SAUA 1N78A 1GVNA 3MMPA 4G6ZA 2DD4B 4IBJA 2Z4SA 2UXDM 2JZ1A 4DV3M 2L7IA 3BHVB 2WIHB 2V1CA 2LW4A 1XXHA 1IN8A 1VEGA 3SFZA 3J7AS 1HT2E 1G3NC 2F2CA 2DZNB 3UK6A 3U6EA 2O5RA 1UGQB 1NNUC 4OR5B 3FRIA 4JX4A 5EXSA 2KNAA 1DO2A 3QHWB 1W98B 1PRBA 5DFLA 1YSYA 4DV5M 1VDLA 2K9DA 1Q3CA 4IBBA 2MJ5B 3C3DA 3A8OB 1K82A 5EJCA 1V33A 3HX3A 4EOKB 3HJQA 1C1KA 4X62M 1XWIA 1N77A 1SXJA 4JXJA 2L6OA 2CZ0B 1AISB 4IJFA 4HEOA 5H37D 4LGMA 2OQ4A 3QYGB 1E32A 3HHXA 1OIPA 1IREB 1H1SB 2OO9A 4QHTA 3HO8A 2C9CA 1PJSA 4YOOA 2DI0A 4FM4B 4JX6A 4Q7JA 4MGHA 3U6LA 3U6SA 3SAVA 4MH0E 1X37A 3SHGB 2R18A 4PDIA 2GNOA 3EOCB 3UZUA 1QYRA 1NV9A 2C5RA 3KW6A 1Q02A 4FWGA 1PJJA 1K3WA 1V29B 4EC9B 3W68A 2I53A 1GY3B 5EXTA 1IXSA 1CUKA 3FUUA 2C5XB 5DYIA 1IXRC 1OTRA 4ZGDB 2QF7A 4LJ9A 3KHIA 1GKIA 1OJLA 2QFZA 2XEPA 2WMBB 4KT0F 1AHJB 1JQJC 3Q8GA 3KS4A 4LFCM 3HHZA 3E21A 3FUXA 2HAKA 1BU2A 2F5QA 4IBIA 3KSJA 2HL7A 3BOSA 3X25B 3FTCA 4ITQA 1NO1A 4LJ5A 3W0FA 4EOIB 3VKGA 4D81A 1LV7A 1OFIA 1G4AE 3E4RA 1QDTA 4BCKB 3A98B 3M6AA 2DWLA 3JR5A 3Q8XA 1JKWA 4EOOB 4CGYB 1P5EB 1IFYA 1H4LD 1TTEA 4LF9M
chains in the Genus database with same CATH topology
2R46A 5C18A 2ZAOA 3U6CA 4JI1M 1QAQA 2QQ8A 4FWHA 4DV7M 1SXJB 2C96A 3GLGA 3T38A 3CF6E 4JI5M 3T1HM 1HT1E 1E94E 1IN7A 3GRUA 3AL0C 3ZCBB 2Q2EB 4AQYM 4B7GA 3TL4X 2D7EA 5ITQA 3W0LB 1QVRA 2L7HA 3L26A 2ZPEB 2D7GA 3PXGA 2FFJA 3KS8A 2D0QB 2M5ZA 3AOEA 3FUTA 1S3SA 2CUZA 1HNZM 1L8QA 2F4VM 4NSRA 1Z59A 3M0EA 5KPTA 5F3WA 3QXEB 3RGSA 4AZFA 3THGA 8CATA 4LFAM 2KMGA 3T15A 4HL4A 3FTFA 2V6ZM 3K2LA 3DL1A 3A46A 1ORYB 2EA0A 2Z7JA 4R7GA 4ZPXA 3I51A 2RGHA 4AI6A 3U6MA 2KZUA 1N36M 4MIMA 4XBOA 1YE9A 3GPPA 3KOZE 3NBIA 4M6VA 1NHWC 3CTWB 5A2QS 4G4OA 4B3TM 4AG6A 1EE8A 1E7PA 1UGRB 2ZZDB 3LVWA 4K0KM 3M7GA 1IN5A 2R4EA 1NNJA 3VLFB 2ZPIB 4RNAA 2Z3XA 1IXSB 3L2AA 1W5SA 3PVSA 3WHLA 5ITXE 3AKZA 2G8LA 2ZPFB 1XXHB 4M0WA 5ITUA 3SHFA 2KEBA 4GITA 3SMSA 1TDZA 1R7RA 4FCVA 4DV1M 2CZ1B 3X26B 4OB3B 1KFVA 3HGIA 4DR7M 1TH4A 3FD9A 3A42A 3HU3A 4GHLA 3KP0E 1FKMA 1NJGA 2WJ9A 2XZUA 3VYHB 3VDUA 3D8BA 4LZZA 2CV1A 4S12A 2AHMA 1HR0M 4DV6M 3FTDA 2BNKA 3AFHA 2C98A 4DR2M 4AW4A 4CHTB 4DR5M 3WVDB 1TH2A 3MHVC 4X66M 3U5ZA 3A8HB 4RF0A 2FNAA 3KXEC 1PJIA 5KPZA 4NXNM 4OB1B 1R6BX 3X20B 5E6JA 3MJ5A 4DR3M 4I81A 1ZQ9A 3T1YM 5EQTA 2R62A 2JA2A 1SXJD 2D7HA 1NY6A 4GKKM 3I4VA 5BPVA 4II7A 4G4NA 2BJWA 4R3DA 1IBKM 4LY6A 4LF6M 4I4LA 4HNTA 4IBGA 3U6PA 3GLIB 3RGPA 3B9PA 3HKPA 3HU2A 3RE8A 1DO0A 4IBCA 1DGHA 4JI8M 1TH3A 4B08A 3A45A 2KA6B 5C1BA 3AOEC 2FE8A 2QBYB 4MGYE 3GO8A 3JR4A 2QDJA 1IBMM 4B7HA 4LRTA 2CV0A 3GP1A 2ZAMA 3HHWA 4MFDA 2UXBM 2ZCFB 2OPFA 1FJGM 3U6DA 2R65A 2G5GX 3PNVA 3QYHB 1XNRM 3QWLA 5IT9S 1Q39A 4IIWA 5KO3A 1H6UA 2C9OA 5KQ8A 4X64M 4LOCA 3LQRA 3RFWA 4JYAM 4DUYM 4GHAA 1QZMA 4FVMA 1L1TA 2FOIC 4LCBA 4M0DA 2CZ6B 1IQPA 4AKIA 1D2NA 2Y0QA 2C99A 2A5YB 1Z5BA 5EP4A 3GPXA 4XGIA 3GRRA 4KHPM 3OTOM 2AHJB 2ZPGB 4L4UA 2XZFA 2KR6A 4L15A 3I4YA 2DWNA 3GLGB 5DNYA 2I7NA 2KZSA 2Y20A 4QSHA 4I8OA 2UUBM 4PT5A 3J7BA 2QDYB 1N75A 4REZA 3KFUG 3AJIB 2J7NA 3GLHA 3QAUA 4B3RM 3IG8A 1UM8A 1XMOM 2ZBKB 2VIIA 2XH9A 3UJNA 1HQYE 4AG5A 4MFEA 2Y21A 4LJ6A 5FTNA 4LFBM 2BS3A 3TPZA 1I94M 3D8LA 5ITXA 3U60A 4LG2A 2ZPHB 1IBLM 2F5PA 3X28B 1VDDA 4IBKA 3HB9A 4AKGA 1J7KA 2EUCA 1KYIA 1IY2A 3K8ZA 3TE6A 4BLCA 3DOAA 4MGZE 3J2PB 3VK8A 1W5TA 5ITTA 2CEAA 4ELJA 2BJVA 4M9XA 2LNHC 4PCZA 1TDHA 4DR1M 3WHKA 3U6OA 4GKJM 2XSZD 3U61B 1JR3D 2ZANA 4QNRA 2F5NA 4L16A 4B7FA 4D80A 4NSOB 2XGNA 3GRYA 3VDPA 2DD5B 1E9RA 5IZ7D 3SATA 4B3MM 2CE7A 4GIPA 5EP1A 1XNQM 3L28A 4D82A 3J80S 5FSWA 4HLQA 5EXXA 2XFTA 3CF0A 3JAMS 3L25A 1SXJE 2K47A 3VYGB 4YHHM 2QENA 5BR8M 3SAUA 1N78A 4JV5M 4OVZA 2ERCA 4JN6A 3QZ9B 3LQQA 4EIWA 4FWDA 1GVNA 4MM3B 3GRVA 4G6ZA 2DD4B 1Z6TA 4IBJA 3J81S 3K1JA 2UUAM 3K92A 2Z4SA 2YNMD 2UXDM 2CZ7B 3A8LB 1J09A 1GL6A 4DV3M 4OB2B 4NXMM 1Q3BA 3ZC7B 1WXQA 2L7IA 5LMNM 4LGYA 2QPAA 4L8RC 5KPRA 4L78A 3ILKA 1PM5A 2V1CA 7CATA 3L27A 1XXHA 1IN8A 1NVMA 3VK7A 4M9ZA 3PNYA 1N32M 1IM2A 1G3IA 1TGUA 4BB9A 2Y0TA 3SFZA 3GLFA 3GQ4A 3J7AS 3QYBA 5JI2E 3NWLA 1HT2E 4QNMA 3U5ZB 3VKHA 1L2CA 4NC6A 3BG3A 2W82A 2I7PA 4LJ7A 2DZNB 3UK6A 3U6EA 2X4AA 2DXCB 2O5RA 4I5SA 1UGQB 2L09A 2CHGA 1NJFA 4FD2A 2YFQA 1NNUC 2UU9M 3FKEA 4JX4A 2CV2A 2VQEM 2YQZA 3HHYA 4IBFA 1SXJC 4ZGJB 5EXSA 4NL4H 4TUWA 2HKJA 3LVVA 2KW0A 3VFDA 3UGJA 1N33M 1DO2A 3GQ3A 1QQWA 3FUVA 4W5WA 4LZJA 1DGHB 1UGPB 3TW6A 1GL7A 1XC8A 1MU5A 2QCUA 5KQDA 3DZDA 4B3SM 4PD2A 2CHVA 2UUCM 3ZH9B 4BBAA 2R4JA 2Z4RA 1QLBA 4DUZM 1YSYA 4DV5M 4JI7M 2HCBA 1Q3CA 1IY1A 3C58A 4IBBA 1N34M 2HHHM 2EO2A 4GC5A 4QOSA 4GC9A 4FCTA 3HHTB 1IXZA 3WVEB 2VQFM 1R2YA 1K82A 3A8OB 3EIEA 2DVWB 4LF4M 3KP1E 3H4MA 5EJCA 3KOXE 1G41A 1XHBA 3SAWA 1G59A 2BS2A 3GQ5A 3HJQA 2P5TA 1C1KA 3L29A 4X62M 1XWIA 3TQSA 2F5OA 4DV0M 2F5SA 2KRUA 4YY3M 1N77A 1J5EM 1SXJA 2J7OA 1IN6A 4JXJA 2L6OA 2CZ0B 4IJFA 3KSXA 2DWMA 5H37D 4LGMA 2ZPBB 2OQ4A 3GLHB 3BG9A 1DGGA 3U6QA 3PFIA 4IBDA 5DYGA 3QYGB 2V1UA 1NSFA 2R45A 1XMQM 4KODA 1E32A 4G4QA 5ITYA 3HHXA 3U60B 1IREB 2G77A 3HJSA 1YUBA 4JI2M 4QHTA 3SARA 3HO8A 1OFHA 2C9CA 5EXPA 3QZ5B 4FM4B 3HU1A 1FNNA 2DXBB 4JX6A 2H1RA 3R9XB 3SBJA 4NOOB 3A8GB 4MGHA 4LJAA 1IY0A 1HQCA 1IN4A 4A3VB 1R2ZA 3SYLA 3TWLA 3U6LA 4BBRM 4IBEA 3U6SA 4LF5M 2CFOA 4FW9A 3SAVA 4LRSA 3TW7A 4MH0E 4QOZC 1X37A 3SHGB 2LH0A 5JI3E 2R18A 4RF1A 2KRKA 4PDIA 4LF7M 3KOWE 4KLNA 3UZUA 4GH9A 3U61A 3TWKA 4JI0M 1QYRA 2DZOB 3FUWA 4OX9M 4OB0B 2QP9X 2KXEA 2C5RA 3KW6A 3SMPA 4FWGA 1Z5AA 5EP3A 1QAMA 1PJJA 1K3XA 3X24B 4OVZB 1K3WA 1V29B 4DR6M 1DGFA 4X65M 2LXEA 3CF2A 1NY5A 2X8AA 5EXTA 5FLXS 4G4RA 4Z8XA 1DGBA 3FUUA 2CHQA 4WURA 5EP2A 3FYCA 4PDGA 5DYIA 5FTMA 1IXRC 2BS4A 1QAOA 3HZJA 2YR0A 1L1ZA 4ZGDB 3QYEA 5E26A 4DV4M 2QF7A 1E9SA 1GLNA 4LJ9A 1ZAEA 4ZGEB 3KHIA 3KOYE 1GKIA 1L2BA 4AKHA 1OJLA 4NRVA 3AOGA 4MGIE 1G8PA 2QZ4A 1HNWM 3GPYA 3GLFB 2QFZA 3H4CA 2RGOA 2XEPA 4MGKE 4HNVA 4GRIA 4M9SA 4Z6YA 2XSZA 3HWSA 1JR3A 3SASA 1AHJB 1JQJC 1I4WA 2RKOA 3HJ8A 3KS4A 5ITRA 3UMMA 4JI3M 5IWAM 2DXIA 4LFCM 4JX5A 3KVWA 3HHZA 1QANA 3FUXA 5FTLA 4KO8A 2ZM6M 2F5QA 2E5LM 4IBIA 4LF8M 4NRWA 3KSJA 4GMQA 4WW0A 2HL7A 3BOSA 3X25B 3FTCA 2NQ8C 3BG5A 3HBLA 1MX0A 4ITQA 4LJ5A 3GLIA 3R8FA 3W0FA 4IJEA 5GKNA 1KSFX 2LWXA 3IG5A 4P16A 3FTEA 3VKGA 3SC3A 4FCWA 4D81A 2CYZB 4QHSA 1Z5CA 3GPUA 1NHGC 1LV7A 2DWZB 2X49A 1HNXM 2QBYA 3EIHA 3SYKA 4DV2M 5FTJA 1OFIA 1G4AE 3DFZA 3E4RA 1L2DA 4DR4M 4MB7A 4CISA 3TWMA 3MK6A 3FYDA 3DA1A 2DHRA 4LJ4A 3E9SA 4LJ8A 4BBSM 5FTKA 3A98B 2UXCM 2M60A 3M6AA 5LMUM 2DWLA 3AV0A 4OW0A 3J27B 5IREB 4JI6M 2XFSA 3JR5A 4JI4M 3Q8XA 1T3TA 4OU7A 4CGYB 3KDSE 3LMMA 1UGSB 2XLJA 2DPPB 3A8MB 2XF3A 4LF9M 4HNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLQ A;  3QWL A;  3HZJ A;  2G77 A;  3QYB A;  4HL4 A;  4NC6 A;  3QYE A;  1FKM A;  4Z6Y A;  2QQ8 A;  5EJC A;  2QFZ A; 
#chains in the Genus database with same CATH topology
 3F5X B;  2C96 A;  4JI5 M;  1IN7 A;  3GRU A;  2EKF A;  5ITQ A;  1QVR A;  2L7H A;  3L26 A;  3E46 A;  4BCQ D;  2ZPE B;  2DAE A;  2D7G A;  3PXG A;  2FFJ A;  1VEJ A;  2CWB A;  2N35 A;  2MH8 A;  5HQ0 B;  1OIZ A;  5KPT A;  3QXE B;  3THG A;  8CAT A;  4LFA M;  3BLH B;  1AD6 A;  2EA0 A;  4ZPX A;  4AI6 A;  2KZU A;  1N36 M;  4F7L B;  3O0G D;  1NHW C;  4G4O A;  1UGR B;  4K0K M;  2GQF A;  3M7G A;  4RNA A;  4G6L B;  3WHL A;  1OL1 B;  2G8L A;  1HNZ M;  1TDZ A;  1F5Q B;  4OB3 B;  1TH4 A;  3A42 A;  3HU3 A;  3NBX X;  2XZU A;  2CV1 A;  4S12 A;  3FTD A;  3AFH A;  2IW6 B;  3EJ1 B;  3MHV C;  4X66 M;  3A8H B;  4RF0 A;  4CRL B;  4OB1 B;  1R6B X;  2R0I A;  5E6J A;  4DR3 M;  3T1Y M;  5EQT A;  2JA2 A;  4II7 A;  4CJ6 A;  4R3D A;  4IBG A;  3GLI B;  3B9P A;  3RE8 A;  4BY7 X;  1TH3 A;  3AOE C;  4CFX B;  3GO8 A;  1IBM M;  3GP1 A;  3HHW A;  4GEW A;  2UXB M;  2EKK A;  3BBZ A;  1FJG M;  2R65 A;  1WR1 B;  1XNR M;  3GLF E;  4IIW A;  2WSE F;  2C9O A;  5KQ8 A;  4LOC A;  1MJG M;  3RFW A;  5ICP B;  2CZ6 B;  4AKI A;  2Y0Q A;  2JXN A;  1JR3 E;  5EP4 A;  3FRH A;  2IVX A;  3OTO M;  2ZPG B;  2XZF A;  2KR6 A;  4L15 A;  3GLG B;  2Y20 A;  4QSH A;  1OKS A;  3DTO A;  3KFU G;  2J7N A;  3QAU A;  3IG8 A;  2ZBK B;  3GLI E;  2Y21 A;  2ZPH B;  1I94 M;  4LG2 A;  3X28 B;  1IBL M;  1VDD A;  1XB2 B;  4AKG A;  1IY2 A;  3K8Z A;  2CEA A;  4M9X A;  4GKJ M;  2XSZ D;  3MI9 B;  2ZAN A;  1C9B A;  4D80 A;  4NSO B;  2XGN A;  1R5L A;  3VDP A;  4CFU B;  1ZV1 A;  1XNQ M;  4D82 A;  3J80 S;  2K47 A;  2QEN A;  1UNH D;  1UFZ A;  3QZ9 B;  2EJS A;  3GLG E;  2DME A;  4EOM B;  1MN3 A;  3GRV A;  2CZ7 B;  1Q3B A;  1D0L A;  1WXQ A;  2DAK A;  5LMN M;  4FX3 B;  5KPR A;  1PM5 A;  3L27 A;  3VK7 A;  3PNY A;  1IM2 A;  1G3I A;  2Y0T A;  3NDQ A;  5JI2 E;  4QNM A;  3U5Z B;  3VKH A;  4NC6 A;  2W82 A;  2L09 A;  1NJF A;  2IW9 B;  4TTH A;  3FKE A;  2CV2 A;  3HHY A;  1SXJ C;  1R4G A;  3VFD A;  2V22 B;  3UGJ A;  3BLQ B;  4CFW B;  2DEN A;  1DGH B;  5L2W B;  2QHO B;  3DZD A;  2KHH A;  5LMK B;  4PD2 A;  2R4J A;  2HCB A;  1IY1 A;  3C58 A;  1N34 M;  2HHH M;  2EO2 A;  3IHP A;  1R2Y A;  4LF4 M;  3B7Z A;  4WP2 A;  1YLA A;  3GQ5 A;  1JSU B;  4DV0 M;  2F5S A;  4YY3 M;  2W9F A;  1PJT A;  2J7O A;  1IN6 A;  3ZQJ A;  3GLH B;  3PFI A;  2PK2 A;  5DYG A;  1E9H B;  5ITY A;  3U60 B;  2G77 A;  3HJS A;  2LVA A;  4JI2 M;  2LTU A;  5EXP A;  3SBJ A;  1HQC A;  4A3V B;  5HBJ B;  4IBE A;  3LW5 F;  2LH0 A;  5JI3 E;  4RF1 A;  5EFQ B;  3TWK A;  1XO2 A;  2DZO B;  2WXV B;  4OX9 M;  2QP9 X;  2KXE A;  3SMP A;  3CGW A;  1K3X A;  4X65 M;  3CF2 A;  1NY5 A;  2X8A A;  1DGB A;  5HVY B;  5EP2 A;  3GLH E;  4PDG A;  1H26 B;  1WGN A;  4Y28 F;  1FVV B;  2C4G B;  1L1Z A;  5E26 A;  3GTM S;  1ZAE A;  1G71 A;  4AKH A;  3DJB A;  3AOG A;  4MGI E;  4M9S A;  3HWS A;  3SAS A;  1I4W A;  3TNH B;  2RKO A;  1D0M A;  2BPM B;  2UZB B;  4JI3 M;  4JX5 A;  1H28 B;  4KO8 A;  4CFV B;  2E5L M;  4NRW A;  1ZMU A;  4KRC B;  4F7S B;  3R8F A;  3SC3 A;  1NHG C;  3EIH A;  4DV2 M;  4DR4 M;  4MB7 A;  4CIS A;  1PJQ A;  3MK6 A;  3FYD A;  3TWM A;  1O9K A;  3DA1 A;  3MY1 B;  1T43 A;  4OW0 A;  1T3T A;  4OU7 A;  3LMM A;  1UGS B;  2DPP B;  4HNU A;  2MRO B;  4FWH A;  1SXJ B;  1ZMW A;  3T38 A;  3B89 A;  3CF6 E;  3T1H M;  1E94 E;  3ZCB B;  2Z8Y M;  3BHT B;  1TD6 A;  2LHG A;  4EOR B;  2HWJ A;  2ZTC A;  2MGW A;  3KS8 A;  2M5Z A;  3DDQ B;  3G33 B;  2R7G A;  2CUZ A;  4F7J B;  1N4M A;  3M0E A;  3T15 A;  4HL4 A;  3FTF A;  3K2L A;  3DL1 A;  3A46 A;  1ORY B;  4R7G A;  3U6M A;  5DQV A;  4XBO A;  1YE9 A;  2JNH A;  4B3T M;  1E7P A;  2ZZD B;  3LVW A;  4ELL A;  1IXS B;  3L2A A;  1W5S A;  2C5V B;  5ITX E;  5HBH B;  2ZPF B;  4M0W A;  3T6P A;  1OAO C;  5ITU A;  4GIT A;  1R7R A;  2QGS A;  4GHL A;  3VYH B;  3VDU A;  3D8B A;  1HR0 M;  2AHM A;  2BNK A;  2C98 A;  4CHT B;  4RKU F;  4DR5 M;  3WVD B;  1TH2 A;  3I01 M;  2IW8 B;  2R62 A;  2D7H A;  1NY6 A;  3I4V A;  4G4N A;  2BJW A;  4LY6 A;  4LF6 M;  4I4L A;  1DO0 A;  4B08 A;  1D0K A;  2KA6 B;  3JR4 A;  2CCH B;  2R44 A;  2CV0 A;  4LRT A;  4ANR A;  2OPF A;  2JY8 A;  2G5G X;  2CJM B;  2O25 A;  1Q39 A;  4II5 B;  4X64 M;  4DUY M;  4GHA A;  4CFM B;  4M0D A;  4LCB A;  1IQP A;  2PJQ A;  2WIP B;  1OAI A;  3BHU B;  3DDP B;  2O01 F;  2PHG A;  2KZS A;  4I8O A;  4PT5 A;  3AJI B;  1UM8 A;  2VII A;  2BS3 A;  4LJ6 A;  5FTN A;  4LFB M;  1AIP C;  2F5P A;  3HB9 A;  2PMI B;  2EUC A;  3TE6 A;  3BLR B;  2OOA A;  3DOA A;  4MGZ E;  3J2P B;  1F4I A;  4BCN B;  4EOP B;  1TDH A;  4DR1 M;  3U61 B;  1JR3 D;  2G3Q A;  4UN0 A;  3GRY A;  1OI9 B;  3SAT A;  4B3M M;  1H27 B;  4GIP A;  2FS1 A;  5EP1 A;  1H1Q B;  2KNZ A;  5EXX A;  2CCI B;  3VYG B;  4JV5 M;  4OVZ A;  4JN6 A;  3LQQ A;  4EIW A;  1Z6T A;  2I40 B;  3K1J A;  2UUA M;  3RGF B;  1OIY B;  1J09 A;  4OB2 B;  1C7Y A;  3ZC7 B;  3EID B;  2QPA A;  1NVM A;  1N32 M;  4BB9 A;  3GLF A;  3GQ4 A;  2DAM A;  1L2C A;  3BG3 A;  2DXC B;  1QUS A;  2CHG A;  4FD2 A;  2BWE A;  2UU9 M;  1OQY A;  4F1I A;  4ZGJ B;  4NL4 H;  2WPA B;  2HKJ A;  1N33 M;  1JOW A;  3GQ3 A;  1QQW A;  3FUV A;  4LZJ A;  1UGP B;  3TW6 A;  1GL7 A;  5KQD A;  3TN8 B;  2UUC M;  3ZH9 B;  2Z4R A;  1QLB A;  4F6S B;  4ROC A;  4BCF B;  4KRD B;  5I5Z B;  4GC9 A;  4FCT A;  1NV8 A;  3HHT B;  1IXZ A;  2VQF M;  1T6O A;  2DVW B;  1QDR A;  3KOX E;  2C5O B;  3QHR B;  1G41 A;  1XHB A;  2FH0 A;  3B74 A;  1G59 A;  3DOG B;  4BCM B;  4CFU D;  2BS2 A;  2JZ0 A;  2P5T A;  4R71 A;  2KRU A;  1J5E M;  2DWM A;  4ROD A;  2L4F A;  2DZL A;  3M03 A;  2ZPB B;  3BG9 A;  3U6Q A;  1NSF A;  4KOD A;  3POM A;  4CIZ A;  1OFH A;  1FNN A;  3A8G B;  4LJA A;  3SYL A;  3TWL A;  4BBR M;  2JY5 A;  2L2D A;  2CFO A;  3TW7 A;  4LRS A;  4QOZ C;  3KOW E;  2X1N B;  4OB0 B;  2DAG A;  1EFU B;  5EP3 A;  1GUX A;  4G4R A;  4Z8X A;  2CHQ A;  4WUR A;  3FYC A;  2BS4 A;  1QAO A;  3HZJ A;  1E9S A;  1GLN A;  4ZGE B;  4NRV A;  1HNW M;  1G8P A;  3W67 A;  3H4C A;  3GPY A;  1URC B;  4GRI A;  4Z6Y A;  2XSZ A;  2JY6 B;  3HJ8 A;  5ITR A;  4BCO B;  5IWA M;  2DXI A;  1QAN A;  5FTL A;  2ZM6 M;  4LF8 M;  4I3Z B;  3BG5 A;  1MX0 A;  3IG5 A;  4FCW A;  3GPU A;  2X49 A;  2QBY A;  1PKD B;  1L2D A;  2K6B A;  3C3E A;  2DHR A;  4LJ4 A;  3E9S A;  4LJ8 A;  4BCP B;  5FTK A;  2WHB B;  2M60 A;  3AV0 A;  4JI6 M;  2C6T B;  3KDS E;  2WEV B;  3A8M B;  2XF3 A;  2LVP C;  4IMY B;  4JI1 M;  1QAQ A;  5HNB B;  2Q2E B;  3TL4 X;  2JWS A;  1TF0 B;  3W0L B;  5DQW A;  2R6F A;  2D0Q B;  3AOE A;  3FUT A;  1S3S A;  2DKL A;  2F4V M;  3PO3 S;  4NSR A;  1Z59 A;  5F3W A;  3K9P A;  3RGS A;  3IEC A;  2KMG A;  1EIJ A;  4Y72 B;  3I51 A;  2RGH A;  1H25 B;  4MIM A;  3GPP A;  3NBI A;  2UUE B;  4YOS A;  5A2Q S;  4AG6 A;  1EE8 A;  2VF8 A;  1NNJ A;  4P17 A;  3VLF B;  2ZPI B;  2Z3X A;  2JY7 A;  1OL2 B;  1GH6 B;  1XXH B;  2CZ1 B;  3SHF A;  2KEB A;  1GAB A;  1A5T A;  3FD9 A;  3HY5 A;  1OIU B;  1NJG A;  4OGR B;  1WHC A;  4DV6 M;  2W99 A;  1UNG D;  5CEI B;  1VEK A;  5KPZ A;  3MJ5 A;  4I81 A;  1ZQ9 A;  1GJS A;  3V76 A;  1SXJ D;  4GKK M;  2W9Z A;  5BPV A;  4BCG B;  4HNT A;  3U6P A;  4F7N B;  3HKP A;  3HU2 A;  4IBC A;  4JI8 M;  4YC3 B;  3I04 M;  3A45 A;  2L4E A;  1BVS A;  2QDJ A;  4B7H A;  2ZCF B;  1O9K B;  5FGK B;  1XXH E;  3U6D A;  3PNV A;  2LVN C;  1H6U A;  3LQR A;  4JYA M;  4FVM A;  1L1T A;  2FOI C;  1D2N A;  1Z5B A;  3GPX A;  4XGI A;  2RRU A;  4KHP M;  4L4U A;  3B7Q A;  3I4Y A;  1N75 A;  4REZ A;  2XH9 A;  2BKZ B;  4MFE A;  5ITX A;  4IBK A;  2LVQ D;  4EOL B;  1J7K A;  1JB0 F;  1KYI A;  2BJV A;  2LNH C;  1PGY A;  3WHK A;  3U6O A;  1TFB A;  4B7F A;  5LQF B;  5IZ7 D;  1QZE A;  4CXA B;  2CE7 A;  3L28 A;  4HLQ A;  3CF0 A;  3JAM S;  1SXJ E;  4YHH M;  5BR8 M;  2ERC A;  4FWD A;  3FE3 A;  4MM3 B;  3J81 S;  3K92 A;  3A8L B;  2YNM D;  4CFN B;  1GL6 A;  4NXM M;  2OOB A;  1LTM A;  4LGY A;  4L8R C;  4L78 A;  3ILK A;  7CAT A;  4F6W B;  3MY5 B;  4M9Z A;  1GO5 A;  1TGU A;  3QYB A;  3NWL A;  2VF7 A;  2I7P A;  4LJ7 A;  2X4A A;  2UZD B;  4I5S A;  4F70 B;  2YFQ A;  2VQE M;  1H1P B;  1DV0 A;  2YQZ A;  2CP8 A;  4IBF A;  4TUW A;  3LVV A;  2KW0 A;  1VYW B;  4W5W A;  2KDL A;  1XC8 A;  1MU5 A;  2QCU A;  4B3S M;  2CHV A;  1SG9 A;  2WSC F;  4BBA A;  3LCU A;  4DUZ M;  1V92 A;  4JI7 M;  2K0B X;  2H5X A;  2J5Y A;  4BCN D;  4GC5 A;  1VIN A;  4QOS A;  3WVE B;  3EIE A;  3KP1 E;  4BCI B;  3H4M A;  3SAW A;  5IDN B;  3L29 A;  3TQS A;  2F5O A;  3TNW B;  2JUJ A;  3B57 A;  3KSX A;  1OKV B;  2CRU A;  1DGG A;  4IBD A;  2V1U A;  2QNJ A;  5L8R F;  2R45 A;  1XMQ M;  4G4Q A;  1AUA A;  1YUB A;  3SAR A;  3QZ5 B;  4EC8 B;  2MR9 A;  3HU1 A;  2ZTD A;  2DXB B;  2WFY B;  5IDP B;  2H1R A;  3R9X B;  1ZP2 A;  4NOO B;  1WJ7 A;  1IY0 A;  1IN4 A;  1R2Z A;  4LF5 M;  4FW9 A;  2KRK A;  4L6V 6;  4LF7 M;  4KLN A;  4GH9 A;  3U61 A;  1WIV A;  4JI0 M;  3FUW A;  1Z5A A;  1ZMV A;  1QAM A;  3X24 B;  4OVZ B;  4DR6 M;  1DGF A;  2LXE A;  5FLX S;  4BY1 X;  5FTM A;  2YR0 A;  4EOQ B;  4BCQ B;  3QYE A;  4BCH B;  4DV4 M;  3KOY E;  1L2B A;  4EOS B;  1GJT A;  2QZ4 A;  3GLF B;  1UNL D;  2RGO A;  4MGK E;  4HNV A;  2LBC A;  3H4J A;  1JR3 A;  2LHC A;  4BCM D;  3UMM A;  4DBG B;  3KVW A;  1OGU B;  4F6U B;  1JST B;  2DAI A;  2UZE B;  4GMQ A;  4WW0 A;  2NQ8 C;  2C5N B;  3HBL A;  2WSF F;  3GLI A;  3MIA B;  4IJE A;  1P3Q Q;  5GKN A;  1KSF X;  2LWX A;  4P16 A;  3FTE A;  2CYZ B;  4QHS A;  1Z5C A;  1HNX M;  2DWZ B;  1KXU A;  5CYI B;  5BNJ B;  3SYK A;  5FTJ A;  3DFZ A;  4NST B;  4BBS M;  1ENW A;  2UXC M;  5LMU M;  1RU3 A;  3J27 B;  4EON B;  2WMA B;  5IRE B;  2XFS A;  4JI4 M;  1OKW B;  2G9X B;  1H24 B;  3TNI B;  2XLJ A;  2JGZ B;  2LVO C;  2R46 A;  5C18 A;  2ZAO A;  3U6C A;  2QQ8 A;  4DV7 M;  3GLG A;  1HT1 E;  1H1R B;  3AL0 C;  4AQY M;  1QUT A;  4UN2 B;  4B7G A;  2D7E A;  2W96 A;  1L8Q A;  2EUF A;  1VQ1 A;  4AZF A;  2V6Z M;  1V34 A;  3K7A M;  2Z7J A;  2VDB B;  5HBE B;  3LCV B;  1D3U B;  3K9O A;  3KOZ E;  4M6V A;  3CTW B;  1GUX B;  1IN5 A;  2DHY A;  2R4E A;  3PVS A;  1VG5 A;  3AKZ A;  3SMS A;  1Y8G A;  2BWB A;  4DV1 M;  4FCV A;  3X26 B;  1HJP A;  1KFV A;  4F2L A;  3HGI A;  4DR7 M;  2B3T A;  3KP0 E;  1FKM A;  2WJ9 A;  2B9R A;  4LZZ A;  4DR2 M;  4AW4 A;  2IN3 A;  3U5Z A;  2FNA A;  3KXE C;  1PJI A;  5ACB A;  3BXW A;  4NXN M;  3X20 B;  2DNA A;  1TR8 A;  1IBK M;  4BXX X;  3RGP A;  1DGH A;  5C1B A;  2FE8 A;  2QBY B;  4MGY E;  4BCJ B;  1FIN B;  2APL A;  2ZAM A;  4MFD A;  3QYH B;  3QWL A;  5IT9 S;  5IF1 B;  5KO3 A;  4EOJ B;  2W2H A;  2PK9 B;  1QZM A;  2C99 A;  2A5Y B;  3GRR A;  5IHY A;  2AHJ B;  1VOL A;  2DWN A;  2QSF X;  5DNY A;  2I7N A;  2UUB M;  3J7B A;  2KNV A;  2QDY B;  4B3R M;  3GLH A;  1XMO M;  3UJN A;  1HQY E;  4AG5 A;  4G3O A;  3TPZ A;  3D8L A;  3U60 A;  1QMZ B;  2JP7 A;  4ROE A;  4BLC A;  3VK8 A;  1W5T A;  5ITT A;  4ELJ A;  1WGL A;  4PCZ A;  2UZL B;  4QNR A;  2F5N A;  4L16 A;  4XK8 F;  2DD5 B;  2WZJ A;  1E9R A;  3LQ5 B;  3F92 A;  5FSW A;  2XFT A;  3L25 A;  4YOZ A;  3B7N A;  3C9P A;  3SAU A;  1N78 A;  1GVN A;  3MMP A;  4G6Z A;  2DD4 B;  4IBJ A;  2Z4S A;  2UXD M;  2JZ1 A;  4DV3 M;  2L7I A;  3BHV B;  2WIH B;  2V1C A;  2LW4 A;  1XXH A;  1IN8 A;  1VEG A;  3SFZ A;  3J7A S;  1HT2 E;  1G3N C;  2F2C A;  2DZN B;  3UK6 A;  3U6E A;  2O5R A;  1UGQ B;  1NNU C;  4OR5 B;  3FRI A;  4JX4 A;  5EXS A;  2KNA A;  1DO2 A;  3QHW B;  1W98 B;  1PRB A;  5DFL A;  1YSY A;  4DV5 M;  1VDL A;  2K9D A;  1Q3C A;  4IBB A;  2MJ5 B;  3C3D A;  3A8O B;  1K82 A;  5EJC A;  1V33 A;  3HX3 A;  4EOK B;  3HJQ A;  1C1K A;  4X62 M;  1XWI A;  1N77 A;  1SXJ A;  4JXJ A;  2L6O A;  2CZ0 B;  1AIS B;  4IJF A;  4HEO A;  5H37 D;  4LGM A;  2OQ4 A;  3QYG B;  1E32 A;  3HHX A;  1OIP A;  1IRE B;  1H1S B;  2OO9 A;  4QHT A;  3HO8 A;  2C9C A;  1PJS A;  4YOO A;  2DI0 A;  4FM4 B;  4JX6 A;  4Q7J A;  4MGH A;  3U6L A;  3U6S A;  3SAV A;  4MH0 E;  1X37 A;  3SHG B;  2R18 A;  4PDI A;  2GNO A;  3EOC B;  3UZU A;  1QYR A;  1NV9 A;  2C5R A;  3KW6 A;  1Q02 A;  4FWG A;  1PJJ A;  1K3W A;  1V29 B;  4EC9 B;  3W68 A;  2I53 A;  1GY3 B;  5EXT A;  1IXS A;  1CUK A;  3FUU A;  2C5X B;  5DYI A;  1IXR C;  1OTR A;  4ZGD B;  2QF7 A;  4LJ9 A;  3KHI A;  1GKI A;  1OJL A;  2QFZ A;  2XEP A;  2WMB B;  4KT0 F;  1AHJ B;  1JQJ C;  3Q8G A;  3KS4 A;  4LFC M;  3HHZ A;  3E21 A;  3FUX A;  2HAK A;  1BU2 A;  2F5Q A;  4IBI A;  3KSJ A;  2HL7 A;  3BOS A;  3X25 B;  3FTC A;  4ITQ A;  1NO1 A;  4LJ5 A;  3W0F A;  4EOI B;  3VKG A;  4D81 A;  1LV7 A;  1OFI A;  1G4A E;  3E4R A;  1QDT A;  4BCK B;  3A98 B;  3M6A A;  2DWL A;  3JR5 A;  3Q8X A;  1JKW A;  4EOO B;  4CGY B;  1P5E B;  1IFY A;  1H4L D;  1TTE A;  4LF9 M; 
#chains in the Genus database with same CATH homology
 2R46 A;  5C18 A;  2ZAO A;  3U6C A;  4JI1 M;  1QAQ A;  2QQ8 A;  4FWH A;  4DV7 M;  1SXJ B;  2C96 A;  3GLG A;  3T38 A;  3CF6 E;  4JI5 M;  3T1H M;  1HT1 E;  1E94 E;  1IN7 A;  3GRU A;  3AL0 C;  3ZCB B;  2Q2E B;  4AQY M;  4B7G A;  3TL4 X;  2D7E A;  5ITQ A;  3W0L B;  1QVR A;  2L7H A;  3L26 A;  2ZPE B;  2D7G A;  3PXG A;  2FFJ A;  3KS8 A;  2D0Q B;  2M5Z A;  3AOE A;  3FUT A;  1S3S A;  2CUZ A;  1HNZ M;  1L8Q A;  2F4V M;  4NSR A;  1Z59 A;  3M0E A;  5KPT A;  5F3W A;  3QXE B;  3RGS A;  4AZF A;  3THG A;  8CAT A;  4LFA M;  2KMG A;  3T15 A;  4HL4 A;  3FTF A;  2V6Z M;  3K2L A;  3DL1 A;  3A46 A;  1ORY B;  2EA0 A;  2Z7J A;  4R7G A;  4ZPX A;  3I51 A;  2RGH A;  4AI6 A;  3U6M A;  2KZU A;  1N36 M;  4MIM A;  4XBO A;  1YE9 A;  3GPP A;  3KOZ E;  3NBI A;  4M6V A;  1NHW C;  3CTW B;  5A2Q S;  4G4O A;  4B3T M;  4AG6 A;  1EE8 A;  1E7P A;  1UGR B;  2ZZD B;  3LVW A;  4K0K M;  3M7G A;  1IN5 A;  2R4E A;  1NNJ A;  3VLF B;  2ZPI B;  4RNA A;  2Z3X A;  1IXS B;  3L2A A;  1W5S A;  3PVS A;  3WHL A;  5ITX E;  3AKZ A;  2G8L A;  2ZPF B;  1XXH B;  4M0W A;  5ITU A;  3SHF A;  2KEB A;  4GIT A;  3SMS A;  1TDZ A;  1R7R A;  4FCV A;  4DV1 M;  2CZ1 B;  3X26 B;  4OB3 B;  1KFV A;  3HGI A;  4DR7 M;  1TH4 A;  3FD9 A;  3A42 A;  3HU3 A;  4GHL A;  3KP0 E;  1FKM A;  1NJG A;  2WJ9 A;  2XZU A;  3VYH B;  3VDU A;  3D8B A;  4LZZ A;  2CV1 A;  4S12 A;  2AHM A;  1HR0 M;  4DV6 M;  3FTD A;  2BNK A;  3AFH A;  2C98 A;  4DR2 M;  4AW4 A;  4CHT B;  4DR5 M;  3WVD B;  1TH2 A;  3MHV C;  4X66 M;  3U5Z A;  3A8H B;  4RF0 A;  2FNA A;  3KXE C;  1PJI A;  5KPZ A;  4NXN M;  4OB1 B;  1R6B X;  3X20 B;  5E6J A;  3MJ5 A;  4DR3 M;  4I81 A;  1ZQ9 A;  3T1Y M;  5EQT A;  2R62 A;  2JA2 A;  1SXJ D;  2D7H A;  1NY6 A;  4GKK M;  3I4V A;  5BPV A;  4II7 A;  4G4N A;  2BJW A;  4R3D A;  1IBK M;  4LY6 A;  4LF6 M;  4I4L A;  4HNT A;  4IBG A;  3U6P A;  3GLI B;  3RGP A;  3B9P A;  3HKP A;  3HU2 A;  3RE8 A;  1DO0 A;  4IBC A;  1DGH A;  4JI8 M;  1TH3 A;  4B08 A;  3A45 A;  2KA6 B;  5C1B A;  3AOE C;  2FE8 A;  2QBY B;  4MGY E;  3GO8 A;  3JR4 A;  2QDJ A;  1IBM M;  4B7H A;  4LRT A;  2CV0 A;  3GP1 A;  2ZAM A;  3HHW A;  4MFD A;  2UXB M;  2ZCF B;  2OPF A;  1FJG M;  3U6D A;  2R65 A;  2G5G X;  3PNV A;  3QYH B;  1XNR M;  3QWL A;  5IT9 S;  1Q39 A;  4IIW A;  5KO3 A;  1H6U A;  2C9O A;  5KQ8 A;  4X64 M;  4LOC A;  3LQR A;  3RFW A;  4JYA M;  4DUY M;  4GHA A;  1QZM A;  4FVM A;  1L1T A;  2FOI C;  4LCB A;  4M0D A;  2CZ6 B;  1IQP A;  4AKI A;  1D2N A;  2Y0Q A;  2C99 A;  2A5Y B;  1Z5B A;  5EP4 A;  3GPX A;  4XGI A;  3GRR A;  4KHP M;  3OTO M;  2AHJ B;  2ZPG B;  4L4U A;  2XZF A;  2KR6 A;  4L15 A;  3I4Y A;  2DWN A;  3GLG B;  5DNY A;  2I7N A;  2KZS A;  2Y20 A;  4QSH A;  4I8O A;  2UUB M;  4PT5 A;  3J7B A;  2QDY B;  1N75 A;  4REZ A;  3KFU G;  3AJI B;  2J7N A;  3GLH A;  3QAU A;  4B3R M;  3IG8 A;  1UM8 A;  1XMO M;  2ZBK B;  2VII A;  2XH9 A;  3UJN A;  1HQY E;  4AG5 A;  4MFE A;  2Y21 A;  4LJ6 A;  5FTN A;  4LFB M;  2BS3 A;  3TPZ A;  1I94 M;  3D8L A;  5ITX A;  3U60 A;  4LG2 A;  2ZPH B;  1IBL M;  2F5P A;  3X28 B;  1VDD A;  4IBK A;  3HB9 A;  4AKG A;  1J7K A;  2EUC A;  1KYI A;  1IY2 A;  3K8Z A;  3TE6 A;  4BLC A;  3DOA A;  4MGZ E;  3J2P B;  3VK8 A;  1W5T A;  5ITT A;  2CEA A;  4ELJ A;  2BJV A;  4M9X A;  2LNH C;  4PCZ A;  1TDH A;  4DR1 M;  3WHK A;  3U6O A;  4GKJ M;  2XSZ D;  3U61 B;  1JR3 D;  2ZAN A;  4QNR A;  2F5N A;  4L16 A;  4B7F A;  4D80 A;  4NSO B;  2XGN A;  3GRY A;  3VDP A;  2DD5 B;  1E9R A;  5IZ7 D;  3SAT A;  4B3M M;  2CE7 A;  4GIP A;  5EP1 A;  1XNQ M;  3L28 A;  4D82 A;  3J80 S;  5FSW A;  4HLQ A;  5EXX A;  2XFT A;  3CF0 A;  3JAM S;  3L25 A;  1SXJ E;  2K47 A;  3VYG B;  4YHH M;  2QEN A;  5BR8 M;  3SAU A;  1N78 A;  4JV5 M;  4OVZ A;  2ERC A;  4JN6 A;  3QZ9 B;  3LQQ A;  4EIW A;  4FWD A;  1GVN A;  4MM3 B;  3GRV A;  4G6Z A;  2DD4 B;  1Z6T A;  4IBJ A;  3J81 S;  3K1J A;  2UUA M;  3K92 A;  2Z4S A;  2YNM D;  2UXD M;  2CZ7 B;  3A8L B;  1J09 A;  1GL6 A;  4DV3 M;  4OB2 B;  4NXM M;  1Q3B A;  3ZC7 B;  1WXQ A;  2L7I A;  5LMN M;  4LGY A;  2QPA A;  4L8R C;  5KPR A;  4L78 A;  3ILK A;  1PM5 A;  2V1C A;  7CAT A;  3L27 A;  1XXH A;  1IN8 A;  1NVM A;  3VK7 A;  4M9Z A;  3PNY A;  1N32 M;  1IM2 A;  1G3I A;  1TGU A;  4BB9 A;  2Y0T A;  3SFZ A;  3GLF A;  3GQ4 A;  3J7A S;  3QYB A;  5JI2 E;  3NWL A;  1HT2 E;  4QNM A;  3U5Z B;  3VKH A;  1L2C A;  4NC6 A;  3BG3 A;  2W82 A;  2I7P A;  4LJ7 A;  2DZN B;  3UK6 A;  3U6E A;  2X4A A;  2DXC B;  2O5R A;  4I5S A;  1UGQ B;  2L09 A;  2CHG A;  1NJF A;  4FD2 A;  2YFQ A;  1NNU C;  2UU9 M;  3FKE A;  4JX4 A;  2CV2 A;  2VQE M;  2YQZ A;  3HHY A;  4IBF A;  1SXJ C;  4ZGJ B;  5EXS A;  4NL4 H;  4TUW A;  2HKJ A;  3LVV A;  2KW0 A;  3VFD A;  3UGJ A;  1N33 M;  1DO2 A;  3GQ3 A;  1QQW A;  3FUV A;  4W5W A;  4LZJ A;  1DGH B;  1UGP B;  3TW6 A;  1GL7 A;  1XC8 A;  1MU5 A;  2QCU A;  5KQD A;  3DZD A;  4B3S M;  4PD2 A;  2CHV A;  2UUC M;  3ZH9 B;  4BBA A;  2R4J A;  2Z4R A;  1QLB A;  4DUZ M;  1YSY A;  4DV5 M;  4JI7 M;  2HCB A;  1Q3C A;  1IY1 A;  3C58 A;  4IBB A;  1N34 M;  2HHH M;  2EO2 A;  4GC5 A;  4QOS A;  4GC9 A;  4FCT A;  3HHT B;  1IXZ A;  3WVE B;  2VQF M;  1R2Y A;  1K82 A;  3A8O B;  3EIE A;  2DVW B;  4LF4 M;  3KP1 E;  3H4M A;  5EJC A;  3KOX E;  1G41 A;  1XHB A;  3SAW A;  1G59 A;  2BS2 A;  3GQ5 A;  3HJQ A;  2P5T A;  1C1K A;  3L29 A;  4X62 M;  1XWI A;  3TQS A;  2F5O A;  4DV0 M;  2F5S A;  2KRU A;  4YY3 M;  1N77 A;  1J5E M;  1SXJ A;  2J7O A;  1IN6 A;  4JXJ A;  2L6O A;  2CZ0 B;  4IJF A;  3KSX A;  2DWM A;  5H37 D;  4LGM A;  2ZPB B;  2OQ4 A;  3GLH B;  3BG9 A;  1DGG A;  3U6Q A;  3PFI A;  4IBD A;  5DYG A;  3QYG B;  2V1U A;  1NSF A;  2R45 A;  1XMQ M;  4KOD A;  1E32 A;  4G4Q A;  5ITY A;  3HHX A;  3U60 B;  1IRE B;  2G77 A;  3HJS A;  1YUB A;  4JI2 M;  4QHT A;  3SAR A;  3HO8 A;  1OFH A;  2C9C A;  5EXP A;  3QZ5 B;  4FM4 B;  3HU1 A;  1FNN A;  2DXB B;  4JX6 A;  2H1R A;  3R9X B;  3SBJ A;  4NOO B;  3A8G B;  4MGH A;  4LJA A;  1IY0 A;  1HQC A;  1IN4 A;  4A3V B;  1R2Z A;  3SYL A;  3TWL A;  3U6L A;  4BBR M;  4IBE A;  3U6S A;  4LF5 M;  2CFO A;  4FW9 A;  3SAV A;  4LRS A;  3TW7 A;  4MH0 E;  4QOZ C;  1X37 A;  3SHG B;  2LH0 A;  5JI3 E;  2R18 A;  4RF1 A;  2KRK A;  4PDI A;  4LF7 M;  3KOW E;  4KLN A;  3UZU A;  4GH9 A;  3U61 A;  3TWK A;  4JI0 M;  1QYR A;  2DZO B;  3FUW A;  4OX9 M;  4OB0 B;  2QP9 X;  2KXE A;  2C5R A;  3KW6 A;  3SMP A;  4FWG A;  1Z5A A;  5EP3 A;  1QAM A;  1PJJ A;  1K3X A;  3X24 B;  4OVZ B;  1K3W A;  1V29 B;  4DR6 M;  1DGF A;  4X65 M;  2LXE A;  3CF2 A;  1NY5 A;  2X8A A;  5EXT A;  5FLX S;  4G4R A;  4Z8X A;  1DGB A;  3FUU A;  2CHQ A;  4WUR A;  5EP2 A;  3FYC A;  4PDG A;  5DYI A;  5FTM A;  1IXR C;  2BS4 A;  1QAO A;  3HZJ A;  2YR0 A;  1L1Z A;  4ZGD B;  3QYE A;  5E26 A;  4DV4 M;  2QF7 A;  1E9S A;  1GLN A;  4LJ9 A;  1ZAE A;  4ZGE B;  3KHI A;  3KOY E;  1GKI A;  1L2B A;  4AKH A;  1OJL A;  4NRV A;  3AOG A;  4MGI E;  1G8P A;  2QZ4 A;  1HNW M;  3GPY A;  3GLF B;  2QFZ A;  3H4C A;  2RGO A;  2XEP A;  4MGK E;  4HNV A;  4GRI A;  4M9S A;  4Z6Y A;  2XSZ A;  3HWS A;  1JR3 A;  3SAS A;  1AHJ B;  1JQJ C;  1I4W A;  2RKO A;  3HJ8 A;  3KS4 A;  5ITR A;  3UMM A;  4JI3 M;  5IWA M;  2DXI A;  4LFC M;  4JX5 A;  3KVW A;  3HHZ A;  1QAN A;  3FUX A;  5FTL A;  4KO8 A;  2ZM6 M;  2F5Q A;  2E5L M;  4IBI A;  4LF8 M;  4NRW A;  3KSJ A;  4GMQ A;  4WW0 A;  2HL7 A;  3BOS A;  3X25 B;  3FTC A;  2NQ8 C;  3BG5 A;  3HBL A;  1MX0 A;  4ITQ A;  4LJ5 A;  3GLI A;  3R8F A;  3W0F A;  4IJE A;  5GKN A;  1KSF X;  2LWX A;  3IG5 A;  4P16 A;  3FTE A;  3VKG A;  3SC3 A;  4FCW A;  4D81 A;  2CYZ B;  4QHS A;  1Z5C A;  3GPU A;  1NHG C;  1LV7 A;  2DWZ B;  2X49 A;  1HNX M;  2QBY A;  3EIH A;  3SYK A;  4DV2 M;  5FTJ A;  1OFI A;  1G4A E;  3DFZ A;  3E4R A;  1L2D A;  4DR4 M;  4MB7 A;  4CIS A;  3TWM A;  3MK6 A;  3FYD A;  3DA1 A;  2DHR A;  4LJ4 A;  3E9S A;  4LJ8 A;  4BBS M;  5FTK A;  3A98 B;  2UXC M;  2M60 A;  3M6A A;  5LMU M;  2DWL A;  3AV0 A;  4OW0 A;  3J27 B;  5IRE B;  4JI6 M;  2XFS A;  3JR5 A;  4JI4 M;  3Q8X A;  1T3T A;  4OU7 A;  4CGY B;  3KDS E;  3LMM A;  1UGS B;  2XLJ A;  2DPP B;  3A8M B;  2XF3 A;  4LF9 M;  4HNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...