4HLQA

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
total genus 95
structure length 280
sequence length 280
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hlqA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hlqA02
2G77A 2QFZA 4NC6A 4HL4A 3QYBA 1FKMA 3HZJA 4HLQA 5EJCA 4Z6YA 3QWLA 3QYEA 2QQ8A
chains in the Genus database with same CATH superfamily
4KRCB 3AOEA 2JZ0A 4QOSA 4G4OA 5E6JA 2QDJA 3SASA 1WIVA 1DO2A 3E21A 3GPXA 7CATA 2XH9A 4GKJM 2CHVA 4HNVA 4UN0A 2LVPC 1DV0A 1H25B 3SBJA 3GLGE 2GNOA 5KPTA 1OJLA 1P5EB 1D0MA 4NL4H 2DVWB 4LF7M 3A98B 4JI2M 3ZH9B 4LFBM 3X25B 3W67A 2X8AA 4LJ9A 4B3MM 2JNHA 2LXEA 4BBAA 3CF2A 1WHCA 3VYHB 3PNYA 3R9XB 2G77A 2UZLB 5C1BA 2R62A 3T6PA 1E7PA 1N36M 1H27B 1V29B 3GP1A 4KRDB 1JR3A 1SXJD 2VDBB 1Q3BA 3MY5B 3QYBA 1XXHA 3M0EA 3TL4X 2EA0A 3B9PA 3W68A 5BNJB 3LQ5B 3GRRA 4LG2A 5HBEB 2EKFA 3TWLA 2KW0A 2QBYB 2JY8A 4CFVB 1QUTA 2ZAOA 3VYGB 1HNZM 1D0LA 4CFMB 2CCHB 2F5NA 4G4QA 1YE9A 1GKIA 2DMEA 5FTMA 4I3ZB 3GLHB 1G3IA 2QF7A 3HWSA 2ZZDB 4P16A 1SXJC 2UZEB 2YFQA 3QXEB 3QAUA 5FTJA 2UUBM 5L8RF 2BKZB 4YOSA 3GO8A 3SARA 1IXRC 4OB0B 1V34A 3NWLA 4G3OA 3SAWA 3DFZA 4UN2B 3HHYA 3FUXA 1KFVA 2PK2A 1OKWB 4QNRA 4JI8M 4K0KM 2XGNA 1GO5A 1VINA 3MI9B 3GLIB 3GPYA 3QYHB 4KT0F 1IM2A 4MGZE 4PDGA 3BHTB 2L4EA 3RGPA 4ITQA 4IBJA 1HNXM 1AD6A 2QENA 3GLFE 3BG9A 1XNQM 2FH0A 2KNVA 3MMPA 2KDLA 1HNWM 2CUZA 2Y20A 3FYCA 4MH0E 3U61A 2MGWA 3C3EA 5JI2E 5F3WA 2WIPB 4GHAA 3TE6A 4G6ZA 1VYWB 1K82A 1LV7A 2UXDM 2RRUA 2Z7JA 4JI0M 4F6UB 2ZPHB 2RKOA 4DR5M 3LQQA 4MM3B 2Z4SA 3HJ8A 2ZANA 3I04M 2APLA 2VF8A 4DV0M 1VDLA 2G5GX 1TH2A 4L8RC 2V6ZM 3HU3A 1ZP2A 4IIWA 3TW6A 3JAMS 4LJ5A 3DZDA 2M5ZA 4LRTA 1UNLD 4M9ZA 3PO3S 2YNMD 2HHHM 1T43A 2BJVA 3VDPA 2O01F 4DV7M 1W5SA 4EOKB 2XFSA 3AOGA 3L2AA 4LGYA 1SG9A 4M0DA 1R4GA 2H1RA 4BY7X 1BU2A 2LNHC 8CATA 1XMQM 1IXSB 3KOXE 4JXJA 3GLGA 4MB7A 2VQFM 1DGBA 2I7NA 2UXCM 2CP8A 3KOWE 2DXCB 3KP1E 2W9ZA 1G4AE 2KZSA 2AHJB 5EXTA 1RU3A 2F5QA 2PJQA 1QAMA 1TDHA 3A8OB 3BLQB 4AW4A 5IDNB 4LCBA 1KXUA 2XSZA 4KHPM 3QWLA 1DGFA 3AOEC 1I94M 1AISB 5HQ0B 1OAIA 2JA2A 2L7HA 4EC8B 3RGFB 2Y21A 5I5ZB 4AZFA 1QDTA 3VK8A 4B7HA 3KSJA 3SHFA 2DD5B 3H4JA 1H1SB 1C9BA 5IZ7D 4NSTB 2VIIA 4BBSM 4Z6YA 4Y28F 4BY1X 1NVMA 3U6OA 4YHHM 4LJ7A 2KMGA 1IFYA 1XO2A 1ZAEA 3L27A 2QSFX 5BR8M 2RGOA 4DV5M 3IG8A 5HBJB 3U6SA 3GRYA 1JSUB 1GJSA 4JI7M 4QNMA 2P5TA 2ZM6M 2L4FA 4LF4M 2G8LA 1IBLM 5FGKB 3CF6E 1H1QB 2C5XB 1R5LA 4OVZA 1NY5A 1VEGA 1NHGC 4IJFA 2ZPIB 3R8FA 2J7OA 4BCKB 2KRUA 5HNBB 3HU2A 1PRBA 1W98B 3HBLA 1UGRB 2D7GA 1E9RA 3EIHA 5CEIB 3WVDB 5HBHB 3IHPA 4JX5A 4TUWA 2BJWA 1NNUC 4BCJB 4LF5M 1TFBA 4DR7M 3J81S 3HJSA 2NQ8C 4Q7JA 2D7HA 2JZ1A 2R7GA 2FS1A 4JV5M 3GLIE 4B08A 3LW5F 4EOIB 1WR1B 1YSYA 2K0BX 2OO9A 1PJQA 1WXQA 2OOAA 3M03A 4S12A 2BWEA 1P3QQ 3I01M 3M7GA 2R4JA 4NOOB 3I51A 4L4UA 2I40B 2YQZA 1NJFA 1WGLA 4BXXX 2DAKA 3AL0C 4WP2A 4F7NB 2QP9X 2D7EA 4DV3M 4G4NA 1NY6A 5ITRA 3QZ5B 1OQYA 3UJNA 4IBBA 2C98A 4ZGJB 4NRWA 4DR2M 2R18A 2CJMB 3SYKA 4F7JB 3NDQA 2HAKA 3QHWB 2C9CA 5DNYA 3DDPB 3K7AM 1OTRA 2R46A 3EOCB 4FWHA 1L2DA 2MR9A 4BCOB 1QAOA 3LQRA 1QUSA 5EP2A 3BOSA 3TWKA 1XMOM 1NV8A 4IBGA 5FTKA 2JGZB 3I4YA 2LVOC 5LMKB 3PNVA 3QZ9B 1BVSA 4IBFA 3BG3A 2IW8B 4JI4M 2XZFA 1N33M 4RF1A 1AUAA 3D8BA 3KS4A 4RNAA 2CHQA 3HHZA 3AFHA 4AI6A 4M0WA 3VLFB 2UUCM 5ITXE 2QZ4A 2K6BA 1YLAA 3A8MB 4OU7A 1NJGA 5IHYA 4BBRM 4GHLA 3T1YM 4QOZC 2CZ6B 2XSZD 1S3SA 4ROEA 4RF0A 4GC5A 5EP3A 4QSHA 2F5SA 2C5RA 2C9OA 2DZNB 3MJ5A 4LRSA 1UNGD 2KXEA 3B7QA 2BNKA 2C5OB 1ZQ9A 4Y72B 4IJEA 1C1KA 4F6SB 2CZ0B 1A5TA 3J27B 2CV0A 3C58A 4KLNA 3SMSA 2C6TB 1OFHA 2DI0A 3K92A 3U6LA 2K9DA 2F4VM 2R45A 4DBGB 4LZZA 5GKNA 4BLCA 2BS2A 4CJ6A 3VFDA 2W96A 4EORB 3U6CA 1QYRA 5DFLA 2C5NB 2DXIA 5ITUA 4DV2M 1G71A 4XK8F 4DUYM 2CFOA 3TW7A 2WIHB 1T6OA 2O5RA 2JXNA 4AQYM 1XXHB 2ZPGB 1SXJE 1OIYB 3VK7A 2Y0TA 2CEAA 1MN3A 5IREB 2DAEA 2XEPA 1Z6TA 1TTEA 1R2ZA 3B57A 5EP4A 5FSWA 1IN4A 3HHWA 4LGMA 3SHGB 3HHXA 4MFDA 3T1HM 3MK6A 4DV6M 4NC6A 1VEJA 3FTEA 2AHMA 5EXSA 3WHLA 1G3NC 1PM5A 4EOQB 2B9RA 4IBCA 3Q8XA 3ZC7B 3GPPA 2R4EA 2DAGA 3RGSA 4OR5B 4CRLB 2O25A 2BS3A 4DR1M 2OQ4A 2I7PA 1HQCA 2C96A 3LVVA 5HVYB 4OGRB 1W5TA 4DR6M 2DWNA 2ZTCA 1H6UA 2Q2EB 1OIUB 3L26A 1QLBA 4MGKE 2BS4A 3CGWA 3T15A 1OL2B 2KZUA 4M9SA 2N35A 2UZDB 2DD4B 5IT9S 4BCHB 2VQEM 1VOLA 5E26A 1QZMA 3GRVA 4FD2A 3X20B 1NO1A 3DA1A 2DZLA 1N75A 2ZAMA 1ZMWA 1TH3A 4NSRA 5L2WB 1Z5BA 4R3DA 3TPZA 3J7BA 4ZGEB 3UK6A 3HX3A 5LMNM 2F5OA 1IQPA 1UFZA 2PHGA 1HQYE 2CCIB 3HU1A 3SATA 3U61B 2JWSA 1OI9B 1TDZA 4AG5A 3KHIA 1V92A 2ZPFB 4XGIA 2F2CA 4ELJA 4LFCM 1K3WA 4BCPB 4BCQD 3KXEC 3LCVB 4B7GA 4AKHA 3FD9A 4L15A 3Q8GA 1E9HB 2WSFF 3U6QA 2L6OA 1IY0A 1C7YA 2WXVB 2R6FA 1XC8A 1H28B 2IW6B 2CHGA 2QGSA 3A8GB 4I81A 4ANRA 3CTWB 1D3UB 1Z59A 4D82A 2E5LM 1L2BA 1AHJB 3KDSE 3L29A 3ILKA 1Q3CA 3FUUA 4GKKM 4YC3B 3G33B 2QNJA 2CE7A 4B3TM 2WMBB 4MGHA 5KPZA 2PMIB 4X65M 4IMYB 3UZUA 1CUKA 3GLGB 1DO0A 1EIJA 4I8OA 4CFUB 3QHRB 3I4VA 1R2YA 1JR3D 1OL1B 4YY3M 1UGPB 2W9FA 2MROB 3UMMA 2CZ1B 2DZOB 4BB9A 5JI3E 4IBEA 4MGIE 4GIPA 3GQ5A 1MJGM 2ZCFB 5CYIB 1PGYA 4BCGB 4ELLA 2VF7A 4I4LA 3LVWA 3TWMA 1N78A 3FYDA 1IY2A 4LF6M 1PJTA 3K9OA 2BWBA 3HGIA 2W2HA 1OAOC 4DR4M 2XLJA 3GQ3A 4RODA 2LHGA 5ITYA 3FKEA 1JR3E 1ZV1A 5ACBA 4M6VA 5EJCA 3ZQJA 4DR3M 3L28A 2XZUA 2UXBM 1E94E 4FCTA 4GRIA 3GLHE 1XB2B 2L7IA 1UGQB 2D0QB 1AIPC 4B3RM 2I53A 3FTDA 3B7ZA 4CXAB 1QANA 4MIMA 5KO3A 3U60A 2FNAA 3WVEB 2DXBB 3AKZA 3HKPA 4II5B 3J7AS 4JYAM 4L6V6 1H24B 1FVVB 1IREB 2QCUA 1H1RB 4OVZB 1GY3B 3F92A 1N4MA 4I5SA 4R71A 4II7A 1K3XA 4G6LB 5FLXS 3GLFA 3F5XB 2WEVB 4L78A 1O9KA 1OKVB 1DGHA 2KHHA 2WPAB 1QQWA 2LH0A 1GVNA 3QYGB 4BCMB 3IG5A 1D0KA 1TH4A 4LJAA 2DKLA 4FWDA 2XFTA 1EFUB 1JOWA 1J7KA 1UNHD 4HLQA 1HT2E 2BPMB 5IF1B 2DWMA 5EXPA 3BXWA 3K2LA 3RFWA 4XBOA 3X28B 3KFUG 1IN8A 4DV4M 1XWIA 2DENA 3VDUA 2M60A 1E9SA 4IBKA 1GUXA 4CFNB 4YOZA 2KEBA 3TQSA 2C4GB 2Z8YM 1JKWA 2V1UA 2LBCA 4BCFB 1VDDA 1N34M 2IW9B 3FUWA 3K8ZA 3EIDB 4CFUD 1R7RA 4LF8M 4D80A 4WURA 2Z4RA 1TGUA 3CF0A 2ZTDA 3T38A 3HO8A 4P17A 1GUXB 4BCQB 4QHTA 4GC9A 2QFZA 2QHOB 1NSFA 3W0FA 1GH6B 2ERCA 4IBIA 1OIZA 1JSTB 1PJJA 1IN7A 4MGYE 2ZPBB 1EE8A 4TTHA 1NV9A 3PVSA 3SAUA 3A42A 4G4RA 5LMUM 2LW4A 4GITA 1F4IA 3A8HB 3HY5A 3U6MA 4MFEA 4BCNB 3LCUA 4QHSA 2JUJA 1GABA 1OGUB 4LOCA 4RKUF 2DPPB 2R44A 3PFIA 3A8LB 3LMMA 4WW0A 4JI6M 4B3SM 4GH9A 4KO8A 2DAMA 3FUTA 3L25A 3BLRB 2CV1A 2JY5A 2QBYA 1GJTA 5EP1A 4B7FA 2L2DA 2LWXA 2MJ5B 3K1JA 4NRVA 4EOOB 2DWZB 4HNTA 1PKDB 1XHBA 3HHTB 5A2QS 4F6WB 1JB0F 2DAIA 3GLHA 1D2NA 4JI5M 4NSOB 4JI1M 2KNZA 1J09A 1V33A 4OB1B 1TD6A 1Q39A 1QAQA 2X4AA 2Y0QA 4HEOA 3KS8A 2JP7A 1GL6A 2YR0A 3U6PA 1H1PB 1F5QB 5EQTA 2LTUA 5IDPB 2QQ8A 2ZPEB 1TF0B 3SC3A 1Y8GA 4EOSB 2JY6B 4PT5A 4BCMD 2WSCF 2A5YB 3MIAB 2UUAM 1N32M 1VEKA 4DUZM 3GLIA 1OFIA 4JX6A 1H26B 1G8PA 1KYIA 3U6DA 3J2PB 3U6EA 2Z3XA 4F1IA 3RE8A 5KQDA 4LFAM 1IY1A 3E9SA 4F2LA 1OIPA 4F70B 1IBKM 1PJIA 3AV0A 2ZBKB 1JQJC 1TR8A 5ITTA 3H4CA 3KSXA 3KOZE 1VG5A 3DL1A 2G3QA 3GTMS 3C9PA 3FRIA 3GRUA 2FE8A 4F7LB 2C5VB 3GPUA 3DOAA 2R65A 4EC9B 4GMQA 4CISA 2W82A 3B89A 1G59A 4L16A 1I4WA 1ZMVA 3NBIA 2EUCA 2EJSA 3E46A 4Z8XA 2EKKA 2IVXA 1KSFX 2L09A 3X24B 3W0LB 1J5EM 4AKGA 3X26B 3O0GD 4JI3M 2UU9M 4OB3B 3A45A 1IBMM 4OW0A 3E4RA 4W5WA 4LJ4A 3EJ1B 2WSEF 2WFYB 4NXNM 1ORYB 4CFXB 4AKIA 3JR4A 5IWAM 3TNHB 3B7NA 1Z5AA 2CZ7B 4ZGDB 4HNUA 2FFJA 2K47A 4M9XA 3JR5A 3FE3A 1IXSA 1FKMA 5ITQA 1OKSA 2WZJA 3V76A 4FVMA 3WHKA 3B74A 1X37A 5ITXA 3K9PA 4CFWB 3VKGA 3ZCBB 5DYIA 2KA6B 4F7SB 4AG6A 3HB9A 1HR0M 4X64M 4BCND 4EONB 3C3DA 4JX4A 1IXZA 3TNIB 5DQVA 1L1TA 4LF9M 4NXMM 2CV2A 1QMZB 2V22B 4KODA 1DGGA 1WGNA 2DHYA 5EXXA 4CHTB 4YOOA 2KNAA 1UGSB 4FCWA 4PCZA 3MHVC 4OB2B 4LY6A 1FNNA 3MY1B 2CRUA 1HT1E 2HCBA 3DTOA 3FUVA 5DQWA 3EIEA 3SMPA 4D81A 2XF3A 1HJPA 3NBXX 1R6BX 3DOGB 4X62M 2R0IA 4REZA 1PJSA 4BCIB 1GL7A 4IBDA 1QZEA 2UZBB 3KOYE 5ICPB 2KR6A 3A46A 1T3TA 5BPVA 2DHRA 4CIZA 2B3TA 2X49A 3KVWA 2HL7A 1SXJA 2CYZB 3GQ4A 1ENWA 1G41A 4FX3B 4JN6A 4ZPXA 5KQ8A 1NNJA 4X66M 1VQ1A 1XXHE 3M6AA 3BBZA 2OOBA 2C99A 2G9XB 3KP0E 3BHUB 3D8LA 3UGJA 1L2CA 1FJGM 2W99A 3U5ZA 1SXJB 5C18A 2V1CA 4PD2A 2PK9B 3BLHB 3HZJA 2LHCA 4FCVA 2LVNC 4OX9M 1NHWC 4FW9A 5DYGA 4R7GA 2RGHA 2WJ9A 1LTMA 2CWBA 1N77A 4EOPB 4ROCA 2UUEB 1QVRA 3U5ZB 3SAVA 1IN6A 4LZJA 4DV1M 3AJIB 4CGYB 3U60B 2EO2A 1UM8A 3H4MA 1XNRM 3BG5A 1E32A 1IN5A 2DWLA 2LVAA 3VKHA 4FWGA 4LJ6A 3THGA 3DJBA 2X1NB 2FOIC 3SFZA 1GLNA 5H37D 3HJQA 1ZMUA 2MH8A 3POMA 3GLFB 1Q02A 4FM4B 2HWJA 1O9KB 1DGHB 1H4LD 3FRHA 4EOLB 3QYEA 2J5YA 2KRKA 2WHBB 2J7NA 1URCB 3BHVB 1MU5A 5EFQB 1QDRA 4EOJB 5KPRA 3TN8B 2OPFA 2F5PA 2QPAA 2HKJA 3OTOM 4HL4A 2H5XA 2GQFA 3FTFA 1Z5CA 3FTCA 1L8QA 2DNAA 3TNWB 2LVQD 3KW6A 4EIWA 2IN3A 1WJ7A 3SYLA 4EOMB 4A3VB 3IECA 2EUFA 2QDYB 1YUBA 1L1ZA 3DDQB 1FINB 5FTLA 5LQFB 4GEWA 2WMAB 4LJ8A 4PDIA 2JY7A 1MX0A 3J80S 3PXGA 5FTNA
chains in the Genus database with same CATH topology
3CTWB 2A5YB 2UUAM 1N32M 3HBLA 1Z59A 3AOEA 4DUZM 3GLIA 1OFIA 1UGRB 4G4OA 4QOSA 4JX6A 4D82A 5E6JA 2E5LM 1L2BA 1G8PA 1KYIA 2D7GA 2QDJA 1E9RA 3EIHA 3U6DA 3SASA 3J2PB 3WVDB 1DO2A 3GPXA 4JX5A 4TUWA 2BJWA 7CATA 3U6EA 2Z3XA 1NNUC 2XH9A 1AHJB 4GKJM 4LF5M 3KDSE 3L29A 2CHVA 4DR7M 4HNVA 3J81S 3HJSA 3RE8A 5KQDA 2NQ8C 3ILKA 4LFAM 1Q3CA 1IY1A 3E9SA 3FUUA 2D7HA 4GKKM 2CE7A 4B3TM 4JV5M 4MGHA 5KPZA 1PJIA 1IBKM 3SBJA 4B08A 3AV0A 4X65M 1YSYA 2ZBKB 3UZUA 1WXQA 1JQJC 5ITTA 3H4CA 5KPTA 3KSXA 1OJLA 3GLGB 1DO0A 3KOZE 4NL4H 2DVWB 3DL1A 4I8OA 4LF7M 4S12A 3A98B 4JI2M 3ZH9B 3M7GA 2R4JA 4LFBM 3GRUA 4NOOB 3X25B 2FE8A 3I4VA 1R2YA 1JR3D 3GPUA 4YY3M 2X8AA 3DOAA 2R65A 4LJ9A 1UGPB 4B3MM 3I51A 4L4UA 4BBAA 2LXEA 3CF2A 4GMQA 3VYHB 4CISA 2W82A 2YQZA 3PNYA 3R9XB 2G77A 1NJFA 3UMMA 5C1BA 2CZ1B 1G59A 4L16A 4OX9M 1I4WA 3NBIA 2DZOB 4BB9A 2R62A 2EUCA 5JI3E 4IBEA 4MGIE 3AL0C 1E7PA 1N36M 4GIPA 3GQ5A 3GP1A 1V29B 4Z8XA 1JR3A 1SXJD 2QP9X 2ZCFB 1Q3BA 1KSFX 2D7EA 3QYBA 2L09A 3X24B 3W0LB 1J5EM 4DV3M 4G4NA 4AKGA 1NY6A 1XXHA 5ITRA 3M0EA 3X26B 4I4LA 3TL4X 3LVWA 2EA0A 3TWMA 1N78A 3QZ5B 4JI3M 2UU9M 4OB3B 3UJNA 3A45A 3B9PA 3FYDA 1IY2A 4IBBA 4LF6M 1IBMM 2C98A 4OW0A 4ZGJB 3HGIA 3E4RA 4NRWA 4DR2M 3GRRA 4W5WA 4LJ4A 4DR4M 2R18A 2XLJA 4NXNM 3GQ3A 4LG2A 1ORYB 4AKIA 3JR4A 5ITYA 5IWAM 3FKEA 3TWLA 2KW0A 2QBYB 3SYKA 4M6VA 5EJCA 2ZAOA 2C9CA 5DNYA 1Z5AA 2CZ7B 1HNZM 3VYGB 4DR3M 4ZGDB 3L28A 2XZUA 2UXBM 4HNUA 2R46A 1E94E 4FCTA 2F5NA 2FFJA 4GRIA 4FWHA 2K47A 1L2DA 4M9XA 4G4QA 2L7IA 4I81A 3JR5A 1YE9A 1QAOA 3LQRA 1GKIA 1UGQB 2D0QB 4B3RM 5EP2A 3BOSA 3TWKA 5FTMA 1XMOM 3GLHB 1FKMA 1G3IA 2QF7A 4IBGA 5ITQA 5FTKA 3HWSA 3FTDA 4FVMA 2ZZDB 4P16A 3WHKA 3I4YA 1X37A 5ITXA 1SXJC 3PNVA 1QANA 3ZCBB 5KO3A 3VKGA 4MIMA 3U60A 3QZ9B 5DYIA 2FNAA 2YFQA 3QXEB 2DXBB 3WVEB 2KA6B 4IBFA 3QAUA 3AKZA 3BG3A 5FTJA 2UUBM 4JI4M 4AG6A 2XZFA 3HB9A 3HKPA 1N33M 4RF1A 3J7AS 4JYAM 1HR0M 3GO8A 3SARA 1IXRC 4X64M 1IREB 3D8BA 3KS4A 2QCUA 4OB0B 4RNAA 2CHQA 3NWLA 4OVZB 4JX4A 1IXZA 3AFHA 3HHZA 4AI6A 4M0WA 3VLFB 3SAWA 2UUCM 4I5SA 3DFZA 5ITXE 1L1TA 4II7A 4LF9M 4NXMM 1K3XA 2QZ4A 2CV2A 3HHYA 5FLXS 3A8MB 4OU7A 3GLFA 3FUXA 1KFVA 1NJGA 4BBRM 4GHLA 4QNRA 3T1YM 4QOZC 2CZ6B 2XSZD 4KODA 1DGGA 4L78A 4JI8M 1S3SA 4K0KM 1DGHA 2XGNA 4RF0A 4GC5A 5EP3A 3GLIB 4QSHA 1QQWA 2F5SA 5EXXA 3GPYA 2C5RA 2C9OA 2DZNB 4CHTB 3QYHB 1UGSB 3MJ5A 4LRSA 4FCWA 4PCZA 1IM2A 2KXEA 2LH0A 1GVNA 3MHVC 3QYGB 4OB2B 4LY6A 1FNNA 4MGZE 4PDGA 3IG5A 1HT1E 2BNKA 2HCBA 1ZQ9A 3RGPA 3FUVA 4ITQA 1TH4A 3EIEA 4IBJA 4LJAA 1HNXM 4IJEA 2QENA 3SMPA 4D81A 1C1KA 3BG9A 2CZ0B 1XNQM 3J27B 2CV0A 3C58A 4FWDA 2XF3A 2XFTA 4KLNA 1R6BX 1HNWM 2CUZA 4X62M 3SMSA 2Y20A 4REZA 1J7KA 1GL7A 3FYCA 4IBDA 4MH0E 4HLQA 1OFHA 3U61A 5JI2E 3KOYE 3K92A 3U6LA 5F3WA 1HT2E 2KR6A 3A46A 4GHAA 1T3TA 3TE6A 4G6ZA 2R45A 2F4VM 5BPVA 2DHRA 4LZZA 5GKNA 4BLCA 2DWMA 2X49A 3KVWA 5EXPA 2BS2A 3K2LA 3RFWA 4XBOA 2HL7A 1K82A 3VFDA 1LV7A 1SXJA 3X28B 2UXDM 3KFUG 3U6CA 2CYZB 1QYRA 2Z7JA 4JI0M 3GQ4A 2ZPHB 2RKOA 2DXIA 5ITUA 1G41A 4DV2M 4JN6A 1IN8A 4DR5M 3LQQA 4MM3B 4ZPXA 2CFOA 2Z4SA 3HJ8A 4DUYM 5KQ8A 4DV4M 2ZANA 1NNJA 1XWIA 4X66M 3M6AA 3TW7A 3VDUA 2M60A 4DV0M 1E9SA 2C99A 2G5GX 1TH2A 2O5RA 4L8RC 2V6ZM 3HU3A 3TW6A 4IIWA 1XXHB 4AQYM 3KP0E 2ZPGB 4IBKA 3JAMS 1SXJE 4LJ5A 3D8LA 5FTNA 3UGJA 3DZDA 1L2CA 2M5ZA 4LRTA 2KEBA 3TQSA 1FJGM 3VK7A 2Y0TA 2CEAA 5IREB 3U5ZA 4M9ZA 1SXJB 2V1UA 2YNMD 2XEPA 1VDDA 5C18A 2V1CA 4PD2A 2HHHM 1Z6TA 2BJVA 3VDPA 4DV7M 1R2ZA 1N34M 3HZJA 5EP4A 4FCVA 1W5SA 3FUWA 3K8ZA 5FSWA 1IN4A 3HHWA 2XFSA 4LGMA 1NHWC 4FW9A 3AOGA 3HHXA 3L2AA 4LGYA 3SHGB 1R7RA 5DYGA 4LF8M 4D80A 4WURA 4R7GA 2RGHA 2Z4RA 4MFDA 1TGUA 3CF0A 2WJ9A 4M0DA 3T1HM 3T38A 2H1RA 3MK6A 4DV6M 3HO8A 2LNHC 1N77A 4NC6A 8CATA 1XMQM 1IXSB 3KOXE 4JXJA 3GLGA 4MB7A 2VQFM 1DGBA 3FTEA 2AHMA 5EXSA 3WHLA 2I7NA 4QHTA 1QVRA 1PM5A 3U5ZB 2UXCM 4GC9A 3SAVA 1IN6A 2QFZA 3KOWE 4LZJA 2DXCB 3KP1E 1G4AE 1NSFA 2KZSA 4IBCA 3W0FA 4DV1M 2AHJB 2ERCA 3AJIB 3Q8XA 4CGYB 3U60B 2EO2A 5EXTA 3ZC7B 1UM8A 3GPPA 3H4MA 4IBIA 2R4EA 1XNRM 3BG5A 1E32A 2F5QA 1QAMA 1TDHA 3RGSA 3A8OB 1PJJA 1IN5A 4AW4A 2DWLA 1IN7A 2BS3A 4MGYE 3VKHA 4DR1M 4LCBA 4FWGA 2ZPBB 1EE8A 4LJ6A 2XSZA 3THGA 3PVSA 2OQ4A 4KHPM 2FOIC 2I7PA 1HQCA 2C96A 3SAUA 3LVVA 1GLNA 1DGFA 1W5TA 3QWLA 3SFZA 4DR6M 3A42A 3AOEC 5LMUM 5H37D 4G4RA 2DWNA 1I94M 3HJQA 4GITA 1H6UA 2JA2A 2Q2EB 3GLFB 3A8HB 2L7HA 3L26A 4FM4B 3U6MA 4MFEA 4QHSA 1DGHB 2Y21A 1QLBA 4LOCA 4MGKE 2BS4A 2DPPB 3T15A 2KZUA 3PFIA 4M9SA 3QYEA 2KRKA 3A8LB 3LMMA 2DD4B 2J7NA 4WW0A 4AZFA 4JI6M 3VK8A 4B7HA 4B3SM 4GH9A 3KSJA 4KO8A 3SHFA 5IT9S 3FUTA 3L25A 2VQEM 2CV1A 2DD5B 5E26A 2QBYA 1QZMA 3GRVA 4FD2A 1MU5A 3X20B 3DA1A 5EP1A 1N75A 2ZAMA 4B7FA 2LWXA 5IZ7D 1TH3A 3K1JA 2VIIA 4NRVA 4NSRA 5KPRA 4BBSM 4Z6YA 1NVMA 3U6OA 2DWZB 4YHHM 2OPFA 4LJ7A 2KMGA 4HNTA 1Z5BA 2QPAA 2HKJA 1ZAEA 2F5PA 1XHBA 3L27A 4R3DA 3TPZA 3J7BA 3HHTB 3OTOM 3UK6A 5BR8M 5A2QS 4ZGEB 4HL4A 5LMNM 2F5OA 1IQPA 2RGOA 3GLHA 1D2NA 4JI5M 3FTFA 4NSOB 4JI1M 1J09A 1HQYE 1Z5CA 4DV5M 3HU1A 3SATA 3FTCA 3IG8A 1L8QA 3U61B 4OB1B 4EIWA 3KW6A 3GRYA 3U6SA 1TDZA 1Q39A 3SYLA 1QAQA 4AG5A 3KHIA 2X4AA 2ZPFB 4XGIA 4A3VB 4ELJA 2Y0QA 4LFCM 2QDYB 1K3WA 3KS8A 4JI7M 4QNMA 2P5TA 2ZM6M 3KXEC 4B7GA 1GL6A 2YR0A 4AKHA 3FD9A 3U6PA 4LF4M 2G8LA 1YUBA 4L15A 1IBLM 3CF6E 1L1ZA 5EQTA 3U6QA 2L6OA 1IY0A 4OVZA 5FTLA 1NY5A 2QQ8A 1NHGC 2ZPEB 4IJFA 3SC3A 2ZPIB 3R8FA 4LJ8A 1XC8A 4PDIA 2J7OA 4PT5A 2CHGA 2KRUA 3A8GB 1MX0A 3J80S 3PXGA 3HU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G77 A;  2QFZ A;  4NC6 A;  4HL4 A;  3QYB A;  1FKM A;  3HZJ A;  4HLQ A;  5EJC A;  4Z6Y A;  3QWL A;  3QYE A;  2QQ8 A; 
#chains in the Genus database with same CATH topology
 4KRC B;  3AOE A;  2JZ0 A;  4QOS A;  4G4O A;  5E6J A;  2QDJ A;  3SAS A;  1WIV A;  1DO2 A;  3E21 A;  3GPX A;  7CAT A;  2XH9 A;  4GKJ M;  2CHV A;  4HNV A;  4UN0 A;  2LVP C;  1DV0 A;  1H25 B;  3SBJ A;  3GLG E;  2GNO A;  5KPT A;  1OJL A;  1P5E B;  1D0M A;  4NL4 H;  2DVW B;  4LF7 M;  3A98 B;  4JI2 M;  3ZH9 B;  4LFB M;  3X25 B;  3W67 A;  2X8A A;  4LJ9 A;  4B3M M;  2JNH A;  2LXE A;  4BBA A;  3CF2 A;  1WHC A;  3VYH B;  3PNY A;  3R9X B;  2G77 A;  2UZL B;  5C1B A;  2R62 A;  3T6P A;  1E7P A;  1N36 M;  1H27 B;  1V29 B;  3GP1 A;  4KRD B;  1JR3 A;  1SXJ D;  2VDB B;  1Q3B A;  3MY5 B;  3QYB A;  1XXH A;  3M0E A;  3TL4 X;  2EA0 A;  3B9P A;  3W68 A;  5BNJ B;  3LQ5 B;  3GRR A;  4LG2 A;  5HBE B;  2EKF A;  3TWL A;  2KW0 A;  2QBY B;  2JY8 A;  4CFV B;  1QUT A;  2ZAO A;  3VYG B;  1HNZ M;  1D0L A;  4CFM B;  2CCH B;  2F5N A;  4G4Q A;  1YE9 A;  1GKI A;  2DME A;  5FTM A;  4I3Z B;  3GLH B;  1G3I A;  2QF7 A;  3HWS A;  2ZZD B;  4P16 A;  1SXJ C;  2UZE B;  2YFQ A;  3QXE B;  3QAU A;  5FTJ A;  2UUB M;  5L8R F;  2BKZ B;  4YOS A;  3GO8 A;  3SAR A;  1IXR C;  4OB0 B;  1V34 A;  3NWL A;  4G3O A;  3SAW A;  3DFZ A;  4UN2 B;  3HHY A;  3FUX A;  1KFV A;  2PK2 A;  1OKW B;  4QNR A;  4JI8 M;  4K0K M;  2XGN A;  1GO5 A;  1VIN A;  3MI9 B;  3GLI B;  3GPY A;  3QYH B;  4KT0 F;  1IM2 A;  4MGZ E;  4PDG A;  3BHT B;  2L4E A;  3RGP A;  4ITQ A;  4IBJ A;  1HNX M;  1AD6 A;  2QEN A;  3GLF E;  3BG9 A;  1XNQ M;  2FH0 A;  2KNV A;  3MMP A;  2KDL A;  1HNW M;  2CUZ A;  2Y20 A;  3FYC A;  4MH0 E;  3U61 A;  2MGW A;  3C3E A;  5JI2 E;  5F3W A;  2WIP B;  4GHA A;  3TE6 A;  4G6Z A;  1VYW B;  1K82 A;  1LV7 A;  2UXD M;  2RRU A;  2Z7J A;  4JI0 M;  4F6U B;  2ZPH B;  2RKO A;  4DR5 M;  3LQQ A;  4MM3 B;  2Z4S A;  3HJ8 A;  2ZAN A;  3I04 M;  2APL A;  2VF8 A;  4DV0 M;  1VDL A;  2G5G X;  1TH2 A;  4L8R C;  2V6Z M;  3HU3 A;  1ZP2 A;  4IIW A;  3TW6 A;  3JAM S;  4LJ5 A;  3DZD A;  2M5Z A;  4LRT A;  1UNL D;  4M9Z A;  3PO3 S;  2YNM D;  2HHH M;  1T43 A;  2BJV A;  3VDP A;  2O01 F;  4DV7 M;  1W5S A;  4EOK B;  2XFS A;  3AOG A;  3L2A A;  4LGY A;  1SG9 A;  4M0D A;  1R4G A;  2H1R A;  4BY7 X;  1BU2 A;  2LNH C;  8CAT A;  1XMQ M;  1IXS B;  3KOX E;  4JXJ A;  3GLG A;  4MB7 A;  2VQF M;  1DGB A;  2I7N A;  2UXC M;  2CP8 A;  3KOW E;  2DXC B;  3KP1 E;  2W9Z A;  1G4A E;  2KZS A;  2AHJ B;  5EXT A;  1RU3 A;  2F5Q A;  2PJQ A;  1QAM A;  1TDH A;  3A8O B;  3BLQ B;  4AW4 A;  5IDN B;  4LCB A;  1KXU A;  2XSZ A;  4KHP M;  3QWL A;  1DGF A;  3AOE C;  1I94 M;  1AIS B;  5HQ0 B;  1OAI A;  2JA2 A;  2L7H A;  4EC8 B;  3RGF B;  2Y21 A;  5I5Z B;  4AZF A;  1QDT A;  3VK8 A;  4B7H A;  3KSJ A;  3SHF A;  2DD5 B;  3H4J A;  1H1S B;  1C9B A;  5IZ7 D;  4NST B;  2VII A;  4BBS M;  4Z6Y A;  4Y28 F;  4BY1 X;  1NVM A;  3U6O A;  4YHH M;  4LJ7 A;  2KMG A;  1IFY A;  1XO2 A;  1ZAE A;  3L27 A;  2QSF X;  5BR8 M;  2RGO A;  4DV5 M;  3IG8 A;  5HBJ B;  3U6S A;  3GRY A;  1JSU B;  1GJS A;  4JI7 M;  4QNM A;  2P5T A;  2ZM6 M;  2L4F A;  4LF4 M;  2G8L A;  1IBL M;  5FGK B;  3CF6 E;  1H1Q B;  2C5X B;  1R5L A;  4OVZ A;  1NY5 A;  1VEG A;  1NHG C;  4IJF A;  2ZPI B;  3R8F A;  2J7O A;  4BCK B;  2KRU A;  5HNB B;  3HU2 A;  1PRB A;  1W98 B;  3HBL A;  1UGR B;  2D7G A;  1E9R A;  3EIH A;  5CEI B;  3WVD B;  5HBH B;  3IHP A;  4JX5 A;  4TUW A;  2BJW A;  1NNU C;  4BCJ B;  4LF5 M;  1TFB A;  4DR7 M;  3J81 S;  3HJS A;  2NQ8 C;  4Q7J A;  2D7H A;  2JZ1 A;  2R7G A;  2FS1 A;  4JV5 M;  3GLI E;  4B08 A;  3LW5 F;  4EOI B;  1WR1 B;  1YSY A;  2K0B X;  2OO9 A;  1PJQ A;  1WXQ A;  2OOA A;  3M03 A;  4S12 A;  2BWE A;  1P3Q Q;  3I01 M;  3M7G A;  2R4J A;  4NOO B;  3I51 A;  4L4U A;  2I40 B;  2YQZ A;  1NJF A;  1WGL A;  4BXX X;  2DAK A;  3AL0 C;  4WP2 A;  4F7N B;  2QP9 X;  2D7E A;  4DV3 M;  4G4N A;  1NY6 A;  5ITR A;  3QZ5 B;  1OQY A;  3UJN A;  4IBB A;  2C98 A;  4ZGJ B;  4NRW A;  4DR2 M;  2R18 A;  2CJM B;  3SYK A;  4F7J B;  3NDQ A;  2HAK A;  3QHW B;  2C9C A;  5DNY A;  3DDP B;  3K7A M;  1OTR A;  2R46 A;  3EOC B;  4FWH A;  1L2D A;  2MR9 A;  4BCO B;  1QAO A;  3LQR A;  1QUS A;  5EP2 A;  3BOS A;  3TWK A;  1XMO M;  1NV8 A;  4IBG A;  5FTK A;  2JGZ B;  3I4Y A;  2LVO C;  5LMK B;  3PNV A;  3QZ9 B;  1BVS A;  4IBF A;  3BG3 A;  2IW8 B;  4JI4 M;  2XZF A;  1N33 M;  4RF1 A;  1AUA A;  3D8B A;  3KS4 A;  4RNA A;  2CHQ A;  3HHZ A;  3AFH A;  4AI6 A;  4M0W A;  3VLF B;  2UUC M;  5ITX E;  2QZ4 A;  2K6B A;  1YLA A;  3A8M B;  4OU7 A;  1NJG A;  5IHY A;  4BBR M;  4GHL A;  3T1Y M;  4QOZ C;  2CZ6 B;  2XSZ D;  1S3S A;  4ROE A;  4RF0 A;  4GC5 A;  5EP3 A;  4QSH A;  2F5S A;  2C5R A;  2C9O A;  2DZN B;  3MJ5 A;  4LRS A;  1UNG D;  2KXE A;  3B7Q A;  2BNK A;  2C5O B;  1ZQ9 A;  4Y72 B;  4IJE A;  1C1K A;  4F6S B;  2CZ0 B;  1A5T A;  3J27 B;  2CV0 A;  3C58 A;  4KLN A;  3SMS A;  2C6T B;  1OFH A;  2DI0 A;  3K92 A;  3U6L A;  2K9D A;  2F4V M;  2R45 A;  4DBG B;  4LZZ A;  5GKN A;  4BLC A;  2BS2 A;  4CJ6 A;  3VFD A;  2W96 A;  4EOR B;  3U6C A;  1QYR A;  5DFL A;  2C5N B;  2DXI A;  5ITU A;  4DV2 M;  1G71 A;  4XK8 F;  4DUY M;  2CFO A;  3TW7 A;  2WIH B;  1T6O A;  2O5R A;  2JXN A;  4AQY M;  1XXH B;  2ZPG B;  1SXJ E;  1OIY B;  3VK7 A;  2Y0T A;  2CEA A;  1MN3 A;  5IRE B;  2DAE A;  2XEP A;  1Z6T A;  1TTE A;  1R2Z A;  3B57 A;  5EP4 A;  5FSW A;  1IN4 A;  3HHW A;  4LGM A;  3SHG B;  3HHX A;  4MFD A;  3T1H M;  3MK6 A;  4DV6 M;  4NC6 A;  1VEJ A;  3FTE A;  2AHM A;  5EXS A;  3WHL A;  1G3N C;  1PM5 A;  4EOQ B;  2B9R A;  4IBC A;  3Q8X A;  3ZC7 B;  3GPP A;  2R4E A;  2DAG A;  3RGS A;  4OR5 B;  4CRL B;  2O25 A;  2BS3 A;  4DR1 M;  2OQ4 A;  2I7P A;  1HQC A;  2C96 A;  3LVV A;  5HVY B;  4OGR B;  1W5T A;  4DR6 M;  2DWN A;  2ZTC A;  1H6U A;  2Q2E B;  1OIU B;  3L26 A;  1QLB A;  4MGK E;  2BS4 A;  3CGW A;  3T15 A;  1OL2 B;  2KZU A;  4M9S A;  2N35 A;  2UZD B;  2DD4 B;  5IT9 S;  4BCH B;  2VQE M;  1VOL A;  5E26 A;  1QZM A;  3GRV A;  4FD2 A;  3X20 B;  1NO1 A;  3DA1 A;  2DZL A;  1N75 A;  2ZAM A;  1ZMW A;  1TH3 A;  4NSR A;  5L2W B;  1Z5B A;  4R3D A;  3TPZ A;  3J7B A;  4ZGE B;  3UK6 A;  3HX3 A;  5LMN M;  2F5O A;  1IQP A;  1UFZ A;  2PHG A;  1HQY E;  2CCI B;  3HU1 A;  3SAT A;  3U61 B;  2JWS A;  1OI9 B;  1TDZ A;  4AG5 A;  3KHI A;  1V92 A;  2ZPF B;  4XGI A;  2F2C A;  4ELJ A;  4LFC M;  1K3W A;  4BCP B;  4BCQ D;  3KXE C;  3LCV B;  4B7G A;  4AKH A;  3FD9 A;  4L15 A;  3Q8G A;  1E9H B;  2WSF F;  3U6Q A;  2L6O A;  1IY0 A;  1C7Y A;  2WXV B;  2R6F A;  1XC8 A;  1H28 B;  2IW6 B;  2CHG A;  2QGS A;  3A8G B;  4I81 A;  4ANR A;  3CTW B;  1D3U B;  1Z59 A;  4D82 A;  2E5L M;  1L2B A;  1AHJ B;  3KDS E;  3L29 A;  3ILK A;  1Q3C A;  3FUU A;  4GKK M;  4YC3 B;  3G33 B;  2QNJ A;  2CE7 A;  4B3T M;  2WMB B;  4MGH A;  5KPZ A;  2PMI B;  4X65 M;  4IMY B;  3UZU A;  1CUK A;  3GLG B;  1DO0 A;  1EIJ A;  4I8O A;  4CFU B;  3QHR B;  3I4V A;  1R2Y A;  1JR3 D;  1OL1 B;  4YY3 M;  1UGP B;  2W9F A;  2MRO B;  3UMM A;  2CZ1 B;  2DZO B;  4BB9 A;  5JI3 E;  4IBE A;  4MGI E;  4GIP A;  3GQ5 A;  1MJG M;  2ZCF B;  5CYI B;  1PGY A;  4BCG B;  4ELL A;  2VF7 A;  4I4L A;  3LVW A;  3TWM A;  1N78 A;  3FYD A;  1IY2 A;  4LF6 M;  1PJT A;  3K9O A;  2BWB A;  3HGI A;  2W2H A;  1OAO C;  4DR4 M;  2XLJ A;  3GQ3 A;  4ROD A;  2LHG A;  5ITY A;  3FKE A;  1JR3 E;  1ZV1 A;  5ACB A;  4M6V A;  5EJC A;  3ZQJ A;  4DR3 M;  3L28 A;  2XZU A;  2UXB M;  1E94 E;  4FCT A;  4GRI A;  3GLH E;  1XB2 B;  2L7I A;  1UGQ B;  2D0Q B;  1AIP C;  4B3R M;  2I53 A;  3FTD A;  3B7Z A;  4CXA B;  1QAN A;  4MIM A;  5KO3 A;  3U60 A;  2FNA A;  3WVE B;  2DXB B;  3AKZ A;  3HKP A;  4II5 B;  3J7A S;  4JYA M;  4L6V 6;  1H24 B;  1FVV B;  1IRE B;  2QCU A;  1H1R B;  4OVZ B;  1GY3 B;  3F92 A;  1N4M A;  4I5S A;  4R71 A;  4II7 A;  1K3X A;  4G6L B;  5FLX S;  3GLF A;  3F5X B;  2WEV B;  4L78 A;  1O9K A;  1OKV B;  1DGH A;  2KHH A;  2WPA B;  1QQW A;  2LH0 A;  1GVN A;  3QYG B;  4BCM B;  3IG5 A;  1D0K A;  1TH4 A;  4LJA A;  2DKL A;  4FWD A;  2XFT A;  1EFU B;  1JOW A;  1J7K A;  1UNH D;  4HLQ A;  1HT2 E;  2BPM B;  5IF1 B;  2DWM A;  5EXP A;  3BXW A;  3K2L A;  3RFW A;  4XBO A;  3X28 B;  3KFU G;  1IN8 A;  4DV4 M;  1XWI A;  2DEN A;  3VDU A;  2M60 A;  1E9S A;  4IBK A;  1GUX A;  4CFN B;  4YOZ A;  2KEB A;  3TQS A;  2C4G B;  2Z8Y M;  1JKW A;  2V1U A;  2LBC A;  4BCF B;  1VDD A;  1N34 M;  2IW9 B;  3FUW A;  3K8Z A;  3EID B;  4CFU D;  1R7R A;  4LF8 M;  4D80 A;  4WUR A;  2Z4R A;  1TGU A;  3CF0 A;  2ZTD A;  3T38 A;  3HO8 A;  4P17 A;  1GUX B;  4BCQ B;  4QHT A;  4GC9 A;  2QFZ A;  2QHO B;  1NSF A;  3W0F A;  1GH6 B;  2ERC A;  4IBI A;  1OIZ A;  1JST B;  1PJJ A;  1IN7 A;  4MGY E;  2ZPB B;  1EE8 A;  4TTH A;  1NV9 A;  3PVS A;  3SAU A;  3A42 A;  4G4R A;  5LMU M;  2LW4 A;  4GIT A;  1F4I A;  3A8H B;  3HY5 A;  3U6M A;  4MFE A;  4BCN B;  3LCU A;  4QHS A;  2JUJ A;  1GAB A;  1OGU B;  4LOC A;  4RKU F;  2DPP B;  2R44 A;  3PFI A;  3A8L B;  3LMM A;  4WW0 A;  4JI6 M;  4B3S M;  4GH9 A;  4KO8 A;  2DAM A;  3FUT A;  3L25 A;  3BLR B;  2CV1 A;  2JY5 A;  2QBY A;  1GJT A;  5EP1 A;  4B7F A;  2L2D A;  2LWX A;  2MJ5 B;  3K1J A;  4NRV A;  4EOO B;  2DWZ B;  4HNT A;  1PKD B;  1XHB A;  3HHT B;  5A2Q S;  4F6W B;  1JB0 F;  2DAI A;  3GLH A;  1D2N A;  4JI5 M;  4NSO B;  4JI1 M;  2KNZ A;  1J09 A;  1V33 A;  4OB1 B;  1TD6 A;  1Q39 A;  1QAQ A;  2X4A A;  2Y0Q A;  4HEO A;  3KS8 A;  2JP7 A;  1GL6 A;  2YR0 A;  3U6P A;  1H1P B;  1F5Q B;  5EQT A;  2LTU A;  5IDP B;  2QQ8 A;  2ZPE B;  1TF0 B;  3SC3 A;  1Y8G A;  4EOS B;  2JY6 B;  4PT5 A;  4BCM D;  2WSC F;  2A5Y B;  3MIA B;  2UUA M;  1N32 M;  1VEK A;  4DUZ M;  3GLI A;  1OFI A;  4JX6 A;  1H26 B;  1G8P A;  1KYI A;  3U6D A;  3J2P B;  3U6E A;  2Z3X A;  4F1I A;  3RE8 A;  5KQD A;  4LFA M;  1IY1 A;  3E9S A;  4F2L A;  1OIP A;  4F70 B;  1IBK M;  1PJI A;  3AV0 A;  2ZBK B;  1JQJ C;  1TR8 A;  5ITT A;  3H4C A;  3KSX A;  3KOZ E;  1VG5 A;  3DL1 A;  2G3Q A;  3GTM S;  3C9P A;  3FRI A;  3GRU A;  2FE8 A;  4F7L B;  2C5V B;  3GPU A;  3DOA A;  2R65 A;  4EC9 B;  4GMQ A;  4CIS A;  2W82 A;  3B89 A;  1G59 A;  4L16 A;  1I4W A;  1ZMV A;  3NBI A;  2EUC A;  2EJS A;  3E46 A;  4Z8X A;  2EKK A;  2IVX A;  1KSF X;  2L09 A;  3X24 B;  3W0L B;  1J5E M;  4AKG A;  3X26 B;  3O0G D;  4JI3 M;  2UU9 M;  4OB3 B;  3A45 A;  1IBM M;  4OW0 A;  3E4R A;  4W5W A;  4LJ4 A;  3EJ1 B;  2WSE F;  2WFY B;  4NXN M;  1ORY B;  4CFX B;  4AKI A;  3JR4 A;  5IWA M;  3TNH B;  3B7N A;  1Z5A A;  2CZ7 B;  4ZGD B;  4HNU A;  2FFJ A;  2K47 A;  4M9X A;  3JR5 A;  3FE3 A;  1IXS A;  1FKM A;  5ITQ A;  1OKS A;  2WZJ A;  3V76 A;  4FVM A;  3WHK A;  3B74 A;  1X37 A;  5ITX A;  3K9P A;  4CFW B;  3VKG A;  3ZCB B;  5DYI A;  2KA6 B;  4F7S B;  4AG6 A;  3HB9 A;  1HR0 M;  4X64 M;  4BCN D;  4EON B;  3C3D A;  4JX4 A;  1IXZ A;  3TNI B;  5DQV A;  1L1T A;  4LF9 M;  4NXM M;  2CV2 A;  1QMZ B;  2V22 B;  4KOD A;  1DGG A;  1WGN A;  2DHY A;  5EXX A;  4CHT B;  4YOO A;  2KNA A;  1UGS B;  4FCW A;  4PCZ A;  3MHV C;  4OB2 B;  4LY6 A;  1FNN A;  3MY1 B;  2CRU A;  1HT1 E;  2HCB A;  3DTO A;  3FUV A;  5DQW A;  3EIE A;  3SMP A;  4D81 A;  2XF3 A;  1HJP A;  3NBX X;  1R6B X;  3DOG B;  4X62 M;  2R0I A;  4REZ A;  1PJS A;  4BCI B;  1GL7 A;  4IBD A;  1QZE A;  2UZB B;  3KOY E;  5ICP B;  2KR6 A;  3A46 A;  1T3T A;  5BPV A;  2DHR A;  4CIZ A;  2B3T A;  2X49 A;  3KVW A;  2HL7 A;  1SXJ A;  2CYZ B;  3GQ4 A;  1ENW A;  1G41 A;  4FX3 B;  4JN6 A;  4ZPX A;  5KQ8 A;  1NNJ A;  4X66 M;  1VQ1 A;  1XXH E;  3M6A A;  3BBZ A;  2OOB A;  2C99 A;  2G9X B;  3KP0 E;  3BHU B;  3D8L A;  3UGJ A;  1L2C A;  1FJG M;  2W99 A;  3U5Z A;  1SXJ B;  5C18 A;  2V1C A;  4PD2 A;  2PK9 B;  3BLH B;  3HZJ A;  2LHC A;  4FCV A;  2LVN C;  4OX9 M;  1NHW C;  4FW9 A;  5DYG A;  4R7G A;  2RGH A;  2WJ9 A;  1LTM A;  2CWB A;  1N77 A;  4EOP B;  4ROC A;  2UUE B;  1QVR A;  3U5Z B;  3SAV A;  1IN6 A;  4LZJ A;  4DV1 M;  3AJI B;  4CGY B;  3U60 B;  2EO2 A;  1UM8 A;  3H4M A;  1XNR M;  3BG5 A;  1E32 A;  1IN5 A;  2DWL A;  2LVA A;  3VKH A;  4FWG A;  4LJ6 A;  3THG A;  3DJB A;  2X1N B;  2FOI C;  3SFZ A;  1GLN A;  5H37 D;  3HJQ A;  1ZMU A;  2MH8 A;  3POM A;  3GLF B;  1Q02 A;  4FM4 B;  2HWJ A;  1O9K B;  1DGH B;  1H4L D;  3FRH A;  4EOL B;  3QYE A;  2J5Y A;  2KRK A;  2WHB B;  2J7N A;  1URC B;  3BHV B;  1MU5 A;  5EFQ B;  1QDR A;  4EOJ B;  5KPR A;  3TN8 B;  2OPF A;  2F5P A;  2QPA A;  2HKJ A;  3OTO M;  4HL4 A;  2H5X A;  2GQF A;  3FTF A;  1Z5C A;  3FTC A;  1L8Q A;  2DNA A;  3TNW B;  2LVQ D;  3KW6 A;  4EIW A;  2IN3 A;  1WJ7 A;  3SYL A;  4EOM B;  4A3V B;  3IEC A;  2EUF A;  2QDY B;  1YUB A;  1L1Z A;  3DDQ B;  1FIN B;  5FTL A;  5LQF B;  4GEW A;  2WMA B;  4LJ8 A;  4PDI A;  2JY7 A;  1MX0 A;  3J80 S;  3PXG A;  5FTN A; 
#chains in the Genus database with same CATH homology
 3CTW B;  2A5Y B;  2UUA M;  1N32 M;  3HBL A;  1Z59 A;  3AOE A;  4DUZ M;  3GLI A;  1OFI A;  1UGR B;  4G4O A;  4QOS A;  4JX6 A;  4D82 A;  5E6J A;  2E5L M;  1L2B A;  1G8P A;  1KYI A;  2D7G A;  2QDJ A;  1E9R A;  3EIH A;  3U6D A;  3SAS A;  3J2P B;  3WVD B;  1DO2 A;  3GPX A;  4JX5 A;  4TUW A;  2BJW A;  7CAT A;  3U6E A;  2Z3X A;  1NNU C;  2XH9 A;  1AHJ B;  4GKJ M;  4LF5 M;  3KDS E;  3L29 A;  2CHV A;  4DR7 M;  4HNV A;  3J81 S;  3HJS A;  3RE8 A;  5KQD A;  2NQ8 C;  3ILK A;  4LFA M;  1Q3C A;  1IY1 A;  3E9S A;  3FUU A;  2D7H A;  4GKK M;  2CE7 A;  4B3T M;  4JV5 M;  4MGH A;  5KPZ A;  1PJI A;  1IBK M;  3SBJ A;  4B08 A;  3AV0 A;  4X65 M;  1YSY A;  2ZBK B;  3UZU A;  1WXQ A;  1JQJ C;  5ITT A;  3H4C A;  5KPT A;  3KSX A;  1OJL A;  3GLG B;  1DO0 A;  3KOZ E;  4NL4 H;  2DVW B;  3DL1 A;  4I8O A;  4LF7 M;  4S12 A;  3A98 B;  4JI2 M;  3ZH9 B;  3M7G A;  2R4J A;  4LFB M;  3GRU A;  4NOO B;  3X25 B;  2FE8 A;  3I4V A;  1R2Y A;  1JR3 D;  3GPU A;  4YY3 M;  2X8A A;  3DOA A;  2R65 A;  4LJ9 A;  1UGP B;  4B3M M;  3I51 A;  4L4U A;  4BBA A;  2LXE A;  3CF2 A;  4GMQ A;  3VYH B;  4CIS A;  2W82 A;  2YQZ A;  3PNY A;  3R9X B;  2G77 A;  1NJF A;  3UMM A;  5C1B A;  2CZ1 B;  1G59 A;  4L16 A;  4OX9 M;  1I4W A;  3NBI A;  2DZO B;  4BB9 A;  2R62 A;  2EUC A;  5JI3 E;  4IBE A;  4MGI E;  3AL0 C;  1E7P A;  1N36 M;  4GIP A;  3GQ5 A;  3GP1 A;  1V29 B;  4Z8X A;  1JR3 A;  1SXJ D;  2QP9 X;  2ZCF B;  1Q3B A;  1KSF X;  2D7E A;  3QYB A;  2L09 A;  3X24 B;  3W0L B;  1J5E M;  4DV3 M;  4G4N A;  4AKG A;  1NY6 A;  1XXH A;  5ITR A;  3M0E A;  3X26 B;  4I4L A;  3TL4 X;  3LVW A;  2EA0 A;  3TWM A;  1N78 A;  3QZ5 B;  4JI3 M;  2UU9 M;  4OB3 B;  3UJN A;  3A45 A;  3B9P A;  3FYD A;  1IY2 A;  4IBB A;  4LF6 M;  1IBM M;  2C98 A;  4OW0 A;  4ZGJ B;  3HGI A;  3E4R A;  4NRW A;  4DR2 M;  3GRR A;  4W5W A;  4LJ4 A;  4DR4 M;  2R18 A;  2XLJ A;  4NXN M;  3GQ3 A;  4LG2 A;  1ORY B;  4AKI A;  3JR4 A;  5ITY A;  5IWA M;  3FKE A;  3TWL A;  2KW0 A;  2QBY B;  3SYK A;  4M6V A;  5EJC A;  2ZAO A;  2C9C A;  5DNY A;  1Z5A A;  2CZ7 B;  1HNZ M;  3VYG B;  4DR3 M;  4ZGD B;  3L28 A;  2XZU A;  2UXB M;  4HNU A;  2R46 A;  1E94 E;  4FCT A;  2F5N A;  2FFJ A;  4GRI A;  4FWH A;  2K47 A;  1L2D A;  4M9X A;  4G4Q A;  2L7I A;  4I81 A;  3JR5 A;  1YE9 A;  1QAO A;  3LQR A;  1GKI A;  1UGQ B;  2D0Q B;  4B3R M;  5EP2 A;  3BOS A;  3TWK A;  5FTM A;  1XMO M;  3GLH B;  1FKM A;  1G3I A;  2QF7 A;  4IBG A;  5ITQ A;  5FTK A;  3HWS A;  3FTD A;  4FVM A;  2ZZD B;  4P16 A;  3WHK A;  3I4Y A;  1X37 A;  5ITX A;  1SXJ C;  3PNV A;  1QAN A;  3ZCB B;  5KO3 A;  3VKG A;  4MIM A;  3U60 A;  3QZ9 B;  5DYI A;  2FNA A;  2YFQ A;  3QXE B;  2DXB B;  3WVE B;  2KA6 B;  4IBF A;  3QAU A;  3AKZ A;  3BG3 A;  5FTJ A;  2UUB M;  4JI4 M;  4AG6 A;  2XZF A;  3HB9 A;  3HKP A;  1N33 M;  4RF1 A;  3J7A S;  4JYA M;  1HR0 M;  3GO8 A;  3SAR A;  1IXR C;  4X64 M;  1IRE B;  3D8B A;  3KS4 A;  2QCU A;  4OB0 B;  4RNA A;  2CHQ A;  3NWL A;  4OVZ B;  4JX4 A;  1IXZ A;  3AFH A;  3HHZ A;  4AI6 A;  4M0W A;  3VLF B;  3SAW A;  2UUC M;  4I5S A;  3DFZ A;  5ITX E;  1L1T A;  4II7 A;  4LF9 M;  4NXM M;  1K3X A;  2QZ4 A;  2CV2 A;  3HHY A;  5FLX S;  3A8M B;  4OU7 A;  3GLF A;  3FUX A;  1KFV A;  1NJG A;  4BBR M;  4GHL A;  4QNR A;  3T1Y M;  4QOZ C;  2CZ6 B;  2XSZ D;  4KOD A;  1DGG A;  4L78 A;  4JI8 M;  1S3S A;  4K0K M;  1DGH A;  2XGN A;  4RF0 A;  4GC5 A;  5EP3 A;  3GLI B;  4QSH A;  1QQW A;  2F5S A;  5EXX A;  3GPY A;  2C5R A;  2C9O A;  2DZN B;  4CHT B;  3QYH B;  1UGS B;  3MJ5 A;  4LRS A;  4FCW A;  4PCZ A;  1IM2 A;  2KXE A;  2LH0 A;  1GVN A;  3MHV C;  3QYG B;  4OB2 B;  4LY6 A;  1FNN A;  4MGZ E;  4PDG A;  3IG5 A;  1HT1 E;  2BNK A;  2HCB A;  1ZQ9 A;  3RGP A;  3FUV A;  4ITQ A;  1TH4 A;  3EIE A;  4IBJ A;  4LJA A;  1HNX M;  4IJE A;  2QEN A;  3SMP A;  4D81 A;  1C1K A;  3BG9 A;  2CZ0 B;  1XNQ M;  3J27 B;  2CV0 A;  3C58 A;  4FWD A;  2XF3 A;  2XFT A;  4KLN A;  1R6B X;  1HNW M;  2CUZ A;  4X62 M;  3SMS A;  2Y20 A;  4REZ A;  1J7K A;  1GL7 A;  3FYC A;  4IBD A;  4MH0 E;  4HLQ A;  1OFH A;  3U61 A;  5JI2 E;  3KOY E;  3K92 A;  3U6L A;  5F3W A;  1HT2 E;  2KR6 A;  3A46 A;  4GHA A;  1T3T A;  3TE6 A;  4G6Z A;  2R45 A;  2F4V M;  5BPV A;  2DHR A;  4LZZ A;  5GKN A;  4BLC A;  2DWM A;  2X49 A;  3KVW A;  5EXP A;  2BS2 A;  3K2L A;  3RFW A;  4XBO A;  2HL7 A;  1K82 A;  3VFD A;  1LV7 A;  1SXJ A;  3X28 B;  2UXD M;  3KFU G;  3U6C A;  2CYZ B;  1QYR A;  2Z7J A;  4JI0 M;  3GQ4 A;  2ZPH B;  2RKO A;  2DXI A;  5ITU A;  1G41 A;  4DV2 M;  4JN6 A;  1IN8 A;  4DR5 M;  3LQQ A;  4MM3 B;  4ZPX A;  2CFO A;  2Z4S A;  3HJ8 A;  4DUY M;  5KQ8 A;  4DV4 M;  2ZAN A;  1NNJ A;  1XWI A;  4X66 M;  3M6A A;  3TW7 A;  3VDU A;  2M60 A;  4DV0 M;  1E9S A;  2C99 A;  2G5G X;  1TH2 A;  2O5R A;  4L8R C;  2V6Z M;  3HU3 A;  3TW6 A;  4IIW A;  1XXH B;  4AQY M;  3KP0 E;  2ZPG B;  4IBK A;  3JAM S;  1SXJ E;  4LJ5 A;  3D8L A;  5FTN A;  3UGJ A;  3DZD A;  1L2C A;  2M5Z A;  4LRT A;  2KEB A;  3TQS A;  1FJG M;  3VK7 A;  2Y0T A;  2CEA A;  5IRE B;  3U5Z A;  4M9Z A;  1SXJ B;  2V1U A;  2YNM D;  2XEP A;  1VDD A;  5C18 A;  2V1C A;  4PD2 A;  2HHH M;  1Z6T A;  2BJV A;  3VDP A;  4DV7 M;  1R2Z A;  1N34 M;  3HZJ A;  5EP4 A;  4FCV A;  1W5S A;  3FUW A;  3K8Z A;  5FSW A;  1IN4 A;  3HHW A;  2XFS A;  4LGM A;  1NHW C;  4FW9 A;  3AOG A;  3HHX A;  3L2A A;  4LGY A;  3SHG B;  1R7R A;  5DYG A;  4LF8 M;  4D80 A;  4WUR A;  4R7G A;  2RGH A;  2Z4R A;  4MFD A;  1TGU A;  3CF0 A;  2WJ9 A;  4M0D A;  3T1H M;  3T38 A;  2H1R A;  3MK6 A;  4DV6 M;  3HO8 A;  2LNH C;  1N77 A;  4NC6 A;  8CAT A;  1XMQ M;  1IXS B;  3KOX E;  4JXJ A;  3GLG A;  4MB7 A;  2VQF M;  1DGB A;  3FTE A;  2AHM A;  5EXS A;  3WHL A;  2I7N A;  4QHT A;  1QVR A;  1PM5 A;  3U5Z B;  2UXC M;  4GC9 A;  3SAV A;  1IN6 A;  2QFZ A;  3KOW E;  4LZJ A;  2DXC B;  3KP1 E;  1G4A E;  1NSF A;  2KZS A;  4IBC A;  3W0F A;  4DV1 M;  2AHJ B;  2ERC A;  3AJI B;  3Q8X A;  4CGY B;  3U60 B;  2EO2 A;  5EXT A;  3ZC7 B;  1UM8 A;  3GPP A;  3H4M A;  4IBI A;  2R4E A;  1XNR M;  3BG5 A;  1E32 A;  2F5Q A;  1QAM A;  1TDH A;  3RGS A;  3A8O B;  1PJJ A;  1IN5 A;  4AW4 A;  2DWL A;  1IN7 A;  2BS3 A;  4MGY E;  3VKH A;  4DR1 M;  4LCB A;  4FWG A;  2ZPB B;  1EE8 A;  4LJ6 A;  2XSZ A;  3THG A;  3PVS A;  2OQ4 A;  4KHP M;  2FOI C;  2I7P A;  1HQC A;  2C96 A;  3SAU A;  3LVV A;  1GLN A;  1DGF A;  1W5T A;  3QWL A;  3SFZ A;  4DR6 M;  3A42 A;  3AOE C;  5LMU M;  5H37 D;  4G4R A;  2DWN A;  1I94 M;  3HJQ A;  4GIT A;  1H6U A;  2JA2 A;  2Q2E B;  3GLF B;  3A8H B;  2L7H A;  3L26 A;  4FM4 B;  3U6M A;  4MFE A;  4QHS A;  1DGH B;  2Y21 A;  1QLB A;  4LOC A;  4MGK E;  2BS4 A;  2DPP B;  3T15 A;  2KZU A;  3PFI A;  4M9S A;  3QYE A;  2KRK A;  3A8L B;  3LMM A;  2DD4 B;  2J7N A;  4WW0 A;  4AZF A;  4JI6 M;  3VK8 A;  4B7H A;  4B3S M;  4GH9 A;  3KSJ A;  4KO8 A;  3SHF A;  5IT9 S;  3FUT A;  3L25 A;  2VQE M;  2CV1 A;  2DD5 B;  5E26 A;  2QBY A;  1QZM A;  3GRV A;  4FD2 A;  1MU5 A;  3X20 B;  3DA1 A;  5EP1 A;  1N75 A;  2ZAM A;  4B7F A;  2LWX A;  5IZ7 D;  1TH3 A;  3K1J A;  2VII A;  4NRV A;  4NSR A;  5KPR A;  4BBS M;  4Z6Y A;  1NVM A;  3U6O A;  2DWZ B;  4YHH M;  2OPF A;  4LJ7 A;  2KMG A;  4HNT A;  1Z5B A;  2QPA A;  2HKJ A;  1ZAE A;  2F5P A;  1XHB A;  3L27 A;  4R3D A;  3TPZ A;  3J7B A;  3HHT B;  3OTO M;  3UK6 A;  5BR8 M;  5A2Q S;  4ZGE B;  4HL4 A;  5LMN M;  2F5O A;  1IQP A;  2RGO A;  3GLH A;  1D2N A;  4JI5 M;  3FTF A;  4NSO B;  4JI1 M;  1J09 A;  1HQY E;  1Z5C A;  4DV5 M;  3HU1 A;  3SAT A;  3FTC A;  3IG8 A;  1L8Q A;  3U61 B;  4OB1 B;  4EIW A;  3KW6 A;  3GRY A;  3U6S A;  1TDZ A;  1Q39 A;  3SYL A;  1QAQ A;  4AG5 A;  3KHI A;  2X4A A;  2ZPF B;  4XGI A;  4A3V B;  4ELJ A;  2Y0Q A;  4LFC M;  2QDY B;  1K3W A;  3KS8 A;  4JI7 M;  4QNM A;  2P5T A;  2ZM6 M;  3KXE C;  4B7G A;  1GL6 A;  2YR0 A;  4AKH A;  3FD9 A;  3U6P A;  4LF4 M;  2G8L A;  1YUB A;  4L15 A;  1IBL M;  3CF6 E;  1L1Z A;  5EQT A;  3U6Q A;  2L6O A;  1IY0 A;  4OVZ A;  5FTL A;  1NY5 A;  2QQ8 A;  1NHG C;  2ZPE B;  4IJF A;  3SC3 A;  2ZPI B;  3R8F A;  4LJ8 A;  1XC8 A;  4PDI A;  2J7O A;  4PT5 A;  2CHG A;  2KRU A;  3A8G B;  1MX0 A;  3J80 S;  3PXG A;  3HU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...