4HLQA

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator/protein transport
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 280
sequence length 280
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hlqA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hlqA02
2QQ8A 3QWLA 2G77A 4HL4A 1FKMA 2QFZA 3QYBA 4NC6A 3HZJA 4Z6YA 4HLQA 5EJCA 3QYEA
chains in the Genus database with same CATH superfamily
3LCVB 2UZEB 1E7PA 2Y20A 3KOWE 1OJLA 1ZMUA 3HU1A 5HQ0B 2M60A 2DD4B 1NHWC 3POMA 2ZZDB 3WVDB 4LRTA 4OB1B 4LJ4A 1IFYA 2DWZB 2FH0A 1IXSB 4AKHA 1H25B 4BCOB 1ZAEA 2G9XB 1NSFA 2MJ5B 3RFWA 1HQCA 1XWIA 3MHVC 2ZPIB 2XH9A 2K9DA 2ZPBB 3MY1B 3LCUA 1PM5A 4DV4M 2JP7A 1IN7A 3DA1A 2G3QA 3PVSA 4DR2M 1JR3E 3QWLA 5FTMA 1QDRA 3SMPA 4F6SB 3J7AS 2KEBA 4MB7A 4HNTA 1W98B 3GRRA 4BCJB 1EIJA 2B3TA 1IY1A 3SASA 4LZZA 3HB9A 3BLQB 2DNAA 4CHTB 1OKSA 4OW0A 1GABA 3M6AA 1TGUA 1ENWA 1UGQB 3Q8XA 4ZGDB 3B74A 5EP2A 1OIPA 4M6VA 2UZLB 3A45A 3SBJA 4JI0M 1HNZM 1OGUB 4DR5M 2FOIC 4GRIA 4AI6A 1Z5AA 1J7KA 2K47A 2KZUA 3KS8A 4DV3M 3H4CA 4LF8M 2UUCM 2IN3A 2L7HA 3AKZA 2A5YB 4LG2A 5EP1A 3HY5A 3TQSA 1P5EB 4RKUF 3QYBA 2W96A 3WHKA 4G4QA 1HQYE 2DXIA 1LV7A 3KSJA 1R6BX 2X8AA 1DGFA 4KT0F 4Y72B 1L2DA 4ELLA 2JXNA 4DV1M 4KRDB 4G4OA 3FUVA 2WSEF 1JR3D 3TW7A 1VQ1A 2EKKA 2RGOA 3I4YA 2DAKA 1HNWM 3MIAB 2QENA 4HL4A 5KPTA 2VQFM 3I04M 4KRCB 2QQ8A 1E9SA 2KRUA 2X1NB 2CYZB 4LOCA 2R65A 2QPAA 1CUKA 3HBLA 1HNXM 3K8ZA 1DO0A 4OVZA 2DWNA 3B89A 4JX5A 1H4LD 4Z6YA 1IN8A 3X20B 3E21A 1OKWB 1GUXB 5LQFB 4B3MM 4LCBA 1N77A 1QZMA 4BLCA 1P3QQ 4OR5B 2DI0A 4JI5M 4I3ZB 3BLHB 4EOLB 8CATA 4L4UA 3K92A 5FTKA 4QNRA 1S3SA 4LY6A 4X66M 2VDBB 3DJBA 1K82A 4BCFB 1Q3CA 2DD5B 3VFDA 5IZ7D 2MROB 2Z3XA 1D0LA 4LGYA 2OPFA 3KS4A 3I4VA 1GH6B 4ROEA 3U6QA 1SXJE 1KSFX 4AKIA 4DUYM 1TF0B 2QSFX 2O5RA 4UN2B 1IXRC 2QHOB 3F92A 5HBJB 1L1TA 1UGSB 2AHJB 3VDPA 4EIWA 1D0MA 4IIWA 4IJFA 1NJGA 3QYHB 4NXMM 1O9KB 2PHGA 2OOBA 2LVPC 2CCIB 3TWMA 2KA6B 5FTLA 2K0BX 4M9SA 4MGKE 2P5TA 1IQPA 3GPYA 4BCMB 2ZPEB 3GQ4A 3U60A 1D3UB 2R6FA 4DR6M 2BS4A 1SXJA 2ERCA 2I7NA 3RGFB 4LJ8A 1XXHE 4B7FA 2ZM6M 3FRIA 1JOWA 2DZNB 4YOZA 2LWXA 4LF4M 5IHYA 2IW8B 3DDQB 5IT9S 4OGRB 1IN4A 1SXJD 4F70B 2C99A 3K9OA 1V92A 2YFQA 2CZ6B 3HX3A 2K6BA 1ORYB 2DHRA 3U61A 1VINA 3DTOA 3FRHA 2ZPGB 2JY6B 4BXXX 2LVAA 3SARA 1KXUA 4AG6A 2KMGA 5ITYA 2JY7A 4F7SB 4ZPXA 2EJSA 1WGNA 2BPMB 2D7GA 2PJQA 4ELJA 4DV5M 2XFSA 2UXBM 2LVNC 4OU7A 1X37A 5E26A 4CFNB 3L25A 4MM3B 1OI9B 4JN6A 1AD6A 4GEWA 2L09A 2DPPB 3MK6A 3UJNA 3HHWA 3A46A 1F5QB 4AKGA 1IN5A 2QBYA 3E4RA 3SATA 2JUJA 3IG5A 2WFYB 3PNVA 1VYWB 4JX4A 4DV0M 3B9PA 1N78A 1IY0A 1VDDA 1TH2A 3L26A 1GO5A 5EJCA 4LJ9A 4RODA 1UNLD 2QFZA 1QAQA 4MH0E 2G5GX 1TDZA 2LTUA 3TNIB 3CF0A 3GLHE 3IHPA 4GIPA 2UU9M 5BR8M 3PXGA 1W5TA 5JI3E 3FE3A 3E9SA 3DOGB 1QAOA 2KNAA 2QF7A 3MMPA 5FTNA 4W5WA 3HHTB 2DAIA 2L2DA 3W68A 4NOOB 5FLXS 4TUWA 2BKZB 4DV6M 1H1QB 1VEGA 2IW9B 2UUBM 1VOLA 3O0GD 2JY8A 3A42A 4LJAA 3L2AA 2QZ4A 4F7NB 2DAMA 2PK2A 4L15A 2UXCM 4D82A 4LJ5A 3UGJA 4ZGEB 4MGYE 3GLHA 4B08A 3GLGE 1H28B 4IBFA 4BBSM 1IN6A 1WJ7A 1VG5A 4FVMA 1DGGA 1QYRA 3WHLA 2GQFA 4IBIA 3ZQJA 3JR4A 3R8FA 1HR0M 5KPZA 1PJSA 2F2CA 2JA2A 4G6ZA 3TNHB 3QYEA 2CCHB 1L2BA 4RF1A 3U6MA 5ITXA 4M0DA 2LHCA 3TWKA 3SC3A 1N75A 2G8LA 3U6SA 3U6EA 3GLGA 4GITA 2CEAA 1L1ZA 3BXWA 1R4GA 1OQYA 3GLFE 5IDPB 3U6OA 2W9FA 4OVZB 2JNHA 3U6PA 3VKGA 2DHYA 2J7NA 1G8PA 1NO1A 1XB2B 4L16A 1AIPC 1QANA 2C9CA 3FUWA 4EOIB 1E9HB 4EC9B 1GKIA 3DZDA 4HNUA 3AV0A 2MR9A 3KSXA 2LHGA 4NXNM 4GKKM 5KO3A 1JB0F 1T6OA 2ZAOA 5HVYB 4BCKB 4CXAB 1Z5BA 3AOEA 1OFHA 1QMZB 1QUSA 2C5VB 3BBZA 2DWLA 4P16A 3U6CA 1C9BA 1OTRA 3KP0E 1BVSA 3GLFA 1C7YA 1SG9A 3KOYE 4FWGA 2BWEA 4LF9M 4BCIB 1H1RB 4LJ6A 5FGKB 4QNMA 4KLNA 5EXSA 2OQ4A 2Y21A 4JI7M 5EQTA 2CV1A 2HWJA 4D81A 4HNVA 4MFEA 3I51A 4CRLB 2CE7A 1Q02A 4IBDA 2JZ0A 2DMEA 3GLIA 3U5ZA 4X62M 2BWBA 1SXJB 4DR7M 3IG8A 2WEVB 1MX0A 2PK9B 1XHBA 1XNQM 2LH0A 3C58A 2HHHM 4EOJB 4NRVA 1N34M 1DGHB 3TNWB 2LBCA 2EO2A 4G4NA 3BHUB 3B7QA 2BS2A 4BCGB 1URCB 3C3EA 5IWAM 1MN3A 4F7LB 3KW6A 3U61B 1IY2A 5ACBA 2F5OA 3VK7A 2KNZA 1T3TA 2KW0A 4IMYB 4I8OA 4JV5M 5CEIB 1GJTA 3M0EA 1H24B 3E46A 5DNYA 2WXVB 3KOZE 2L6OA 3MY5B 1V34A 2F4VM 2R4EA 1XXHB 3V76A 2UZDB 4FWDA 1HT2E 3GP1A 5DYGA 4R3DA 5BNJB 2CHQA 1IREB 2Z8YM 4I4LA 4PCZA 5L2WB 2DENA 2QBYB 2FE8A 4GC9A 1DV0A 2BNKA 5LMKB 2XZUA 1OL1B 4GH9A 1KFVA 1FJGM 4AZFA 1EE8A 5ICPB 3VDUA 3HO8A 4S12A 2YR0A 4PT5A 1GLNA 3NBIA 3DOAA 4DR4M 4LF5M 4GMQA 2V22B 4M9ZA 1E9RA 3SFZA 3FUUA 2XZFA 4EORB 1UFZA 3PFIA 1R7RA 3ZH9B 4JI4M 1PJTA 2KDLA 3TWLA 4GHAA 4NL4H 4IJEA 2CHGA 1G59A 3J80S 3GTMS 2UZBB 4FCWA 2Z4SA 3F5XB 3ZC7B 3KOXE 1XNRM 1QZEA 2I53A 4RF0A 2VF7A 3FUXA 3GLHB 3HHXA 4MFDA 3OTOM 2Z4RA 2KZSA 2UUAM 4DUZM 4XBOA 4CFMB 2AHMA 2LW4A 1TD6A 4L8RC 3EOCB 1XC8A 2QNJA 4IBCA 2J5YA 3TN8B 1AISB 4QHTA 1I94M 1RU3A 2OOAA 1XMQM 5IDNB 5LMNM 4HEOA 1OL2B 2DZLA 2C5NB 1AHJB 3KHIA 7CATA 3DDPB 4QOSA 3HKPA 4NSRA 1JKWA 4FX3B 2CUZA 2APLA 4QHSA 5F3WA 1PRBA 3SYKA 2F5QA 1IXZA 4EOOB 1H1PB 3GLGB 4JI2M 1TTEA 2CV0A 2QP9X 3FTFA 1H6UA 2F5PA 1UGRB 3ZCBB 1NVMA 1W5SA 3I01M 4YOSA 3T15A 3JR5A 4WURA 4WP2A 4Y28F 1DO2A 2OO9A 2B9RA 4PDGA 1E32A 1VEKA 1GJSA 2QDJA 2H5XA 4NRWA 3U6DA 2ZANA 2RGHA 1J09A 1JQJC 1QUTA 4Q7JA 1H1SB 2CZ7B 4CIZA 4X64M 3KFUG 2L7IA 2FNAA 3LMMA 2QCUA 3LW5F 2D7HA 3QHRB 3AL0C 4BCQD 2X4AA 3BLRB 1NNUC 3GLFB 2WSCF 3UZUA 1K3WA 1WHCA 2X49A 3HU3A 4GC5A 1QAMA 4KO8A 3HZJA 4NSOB 2PMIB 4KHPM 2C98A 1I4WA 2BS3A 5JI2E 4II7A 2DXCB 2BJWA 2CRUA 2V1CA 1O9KA 5ITXE 2GNOA 2WIHB 3SHGB 1XMOM 2E5LM 1WR1B 1HT1E 3GLIB 3CGWA 2JZ1A 1TFBA 4BY1X 1NJFA 3Q8GA 4F6WB 3GPPA 2WIPB 2UUEB 2C5RA 3VK8A 3HJ8A 1Q39A 5DQWA 1YE9A 2WMBB 2Y0TA 3X25B 1Q3BA 4IBBA 3BHTB 4DR3M 3LVWA 2DVWB 1BU2A 3GRUA 2KNVA 2M5ZA 2R46A 4MGIE 4LF7M 4NSTB 2R0IA 3AJIB 3GQ5A 3BHVB 2ZTDA 2R62A 2L4FA 4YOOA 1JSUB 3GO8A 3K1JA 3QYGB 2O25A 3D8LA 2C5OB 2Z7JA 4LRSA 4L6V6 4BCPB 1OIYB 1DGBA 4BBAA 4X65M 2DAGA 2V6ZM 5ITRA 3CF2A 4JI8M 2UXDM 4BCND 4UN0A 2KXEA 1FNNA 1IM2A 2HKJA 4YY3M 4DV2M 3JAMS 1WXQA 2C5XB 1ZP2A 3KP1E 1YUBA 3MI9B 3FYDA 3GLIE 2RRUA 2CZ0B 2R4JA 4A3VB 1OKVB 4CFUD 4OX9M 3A8MB 1JSTB 1ZMWA 4EONB 4F7JB 1NV8A 3W67A 2QGSA 4I5SA 2R7GA 3R9XB 4EOPB 1VDLA 4F6UB 2KRKA 4PDIA 5L8RF 2G77A 3D8BA 4DV7M 1NY6A 2RKOA 5CYIB 1IBMM 3U6LA 1QLBA 3HHZA 3LVVA 4B7GA 5FSWA 3ILKA 2V1UA 4IBGA 3L28A 2DKLA 5EFQB 4G6LB 1WGLA 2DWMA 1EFUB 3U60B 1PKDB 1UGPB 1MU5A 5H37D 3SAUA 1TH4A 2IVXA 4R71A 5LMUM 1F4IA 2DZOB 2HCBA 1GVNA 4IBKA 4AW4A 1XO2A 3KXEC 5EP4A 4MIMA 4CFXB 3J81S 1D0KA 1JR3A 4LZJA 3QXEB 3QZ5B 4M9XA 1YLAA 1SXJC 3IECA 1T43A 1KYIA 3WVEB 5I5ZB 3BOSA 4XK8F 5DQVA 1E94E 5ITUA 3MJ5A 3SAVA 3BG5A 3TW6A 5EXXA 4JI1M 4ZGJB 2WJ9A 1GL6A 4REZA 5EXPA 2XGNA 1VEJA 1N4MA 4P17A 2DAEA 4CGYB 4PD2A 4NC6A 2HL7A 4II5B 5HNBB 1QVRA 2W82A 1NY5A 4LGMA 3GPXA 3BG3A 2CZ1B 4AG5A 4DBGB 5HBHB 1G4AE 4G3OA 3H4MA 1Z5CA 2LVOC 4WW0A 2YNMD 2ZCFB 2MH8A 4JI6M 4YC3B 3EIDB 2WHBB 4HLQA 3AFHA 4EOQB 4K0KM 4B3RM 2ZPFB 3TE6A 2WPAB 1PJIA 2EUCA 4BCQB 3H4JA 5DFLA 2D0QB 2CWBA 4OB3B 3KVWA 1IXSA 1G3NC 3EIHA 5KPRA 1R5LA 1V33A 2C4GB 2Q2EB 2YQZA 3QZ9B 2I40B 2O01F 1OAIA 2BJVA 5IF1B 3UMMA 4JX6A 2HAKA 4EC8B 4ANRA 2VQEM 3CF6E 3GRVA 3HGIA 1IBKM 1HJPA 1R2YA 1WIVA 3T6PA 1FKMA 4CJ6A 3GPUA 2C6TB 2JY5A 2VIIA 2FS1A 1UNGD 4F2LA 1ZMVA 4KODA 4IBEA 1L8QA 5FTJA 4I81A 3PO3S 1NV9A 3B7ZA 3FUTA 3HWSA 4JXJA 1AUAA 2N35A 1H26B 1ZQ9A 2C96A 1NHGC 1OFIA 4B3SM 2WMAB 4YHHM 5C1BA 2JGZB 3FTEA 3SAWA 3A98B 3FTDA 3T1HM 4BBRM 4AQYM 3K2LA 3LQRA 2XEPA 5ITTA 1OIUB 1DGHA 3CTWB 4RNAA 1YSYA 3DL1A 1UNHD 3C3DA 3HJSA 3UK6A 5EP3A 3SHFA 1G41A 5EXTA 3QAUA 3FYCA 3HHYA 1NNJA 1Z6TA 2CHVA 1GL7A 1Y8GA 1TR8A 1D2NA 4R7GA 1QDTA 4G4RA 4LFBM 5KQ8A 3K9PA 3SYLA 4LFAM 4DR1M 4LF6M 4ITQA 4TTHA 2XSZA 3TPZA 3BG9A 4BCNB 3M03A 1ZV1A 3A8GB 3NDQA 2EA0A 1A5TA 3W0LB 3PNYA 2J7OA 1XXHA 1R2ZA 4LJ7A 2ZTCA 2L4EA 1PJJA 1PJQA 2ZPHB 3X28B 3RE8A 1GUXA 2WZJA 2XSZD 4CFUB 2H1RA 3TL4X 2DXBB 3GQ3A 1QQWA 4FD2A 1N33M 3KDSE 4BY7X 3W0FA 2LNHC 5ITQA 3T1YM 3VLFB 1G71A 3FKEA 5IREB 4MGZE 1Z59A 3FD9A 2VF8A 4Z8XA 3J7BA 1UM8A 2FFJA 1N36M 4OB2B 1K3XA 2XFTA 3SMSA 4FWHA 3EIEA 3X26B 3HU2A 3RGSA 4FM4B 4IBJA 3THGA 4QSHA 2F5SA 4OB0B 3RGPA 5HBEB 4B7HA 4JYAM 4LFCM 2LVQD 1J5EM 2CFOA 4CFWB 2JWSA 5DYIA 4ROCA 3AOEC 3B57A 4EOKB 4GHLA 5GKNA 2EKFA 4F1IA 1H27B 4QOZC 2IW6B 4L78A 2WSFF 3LQQA 2CJMB 1L2CA 3HJQA 3EJ1B 2F5NA 3U5ZB 1G3IA 1IBLM 3VYHB 4CFVB 4EOSB 3L27A 4D80A 3VYGB 2EUFA 3J2PB 3A8HB 5C18A 1OAOC 1V29B 2W99A 5E6JA 5A2QS 4CISA 3NBXX 2XF3A 3A8LB 3NWLA 3X24B 2CP8A 2KR6A 2XLJA 4BB9A 4GKJM 1GY3B 4BCMD 2NQ8C 2W2HA 2I7PA 4MGHA 3VKHA 2KHHA 2Y0QA 2LXEA 2R18A 4EOMB 2ZAMA 1TH3A 1LTMA 3M7GA 4FCTA 2ZBKB 2C9OA 2R45A 3LQ5B 4M0WA 4FCVA 5BPVA 1FINB 3C9PA 1PGYA 3A8OB 3AOGA 3QHWB 1MJGM 3B7NA 1C1KA 2CV2A 1TDHA 4FW9A 3K7AM 3J27B 4XGIA 3G33B 1FVVB 3FTCA 3DFZA 2MGWA 3L29A 2D7EA 4JI3M 2R44A 3GRYA 4B3TM 3T38A 2QDYB 1N32M 5KQDA 2W9ZA 1OIZA 4BCHB
chains in the Genus database with same CATH topology
5BR8M 3PXGA 1KYIA 4RF0A 1E7PA 2Y20A 3WVEB 3BOSA 1OJLA 3FUXA 3GLHB 3KOWE 1W5TA 3HHXA 1E94E 3HU1A 5JI3E 5ITUA 3OTOM 4MFDA 2M60A 2Z4RA 3E9SA 3MJ5A 3SAVA 2DD4B 3BG5A 3TW6A 1NHWC 5EXXA 2KZSA 4JI1M 2ZZDB 4ZGJB 2UUAM 3WVDB 4DUZM 4LRTA 1QAOA 4OB1B 4XBOA 4LJ4A 2QF7A 2WJ9A 1GL6A 2DWZB 4REZA 5EXPA 2XGNA 1IXSB 4AKHA 2AHMA 5FTNA 4W5WA 1ZAEA 3HHTB 1NSFA 3RFWA 1HQCA 4L8RC 4NOOB 1XWIA 5FLXS 1XC8A 4CGYB 3MHVC 4IBCA 4PD2A 2ZPIB 4TUWA 4NC6A 2HL7A 4QHTA 4DV6M 2XH9A 1QVRA 2UUBM 1I94M 2W82A 1NY5A 4LGMA 2ZPBB 3GPXA 3BG3A 1XMQM 3A42A 2CZ1B 5LMNM 4AG5A 1PM5A 4DV4M 4LJAA 1G4AE 3L2AA 2QZ4A 1IN7A 3H4MA 1Z5CA 4WW0A 2YNMD 1AHJB 4L15A 2UXCM 4D82A 3KHIA 7CATA 2ZCFB 4JI6M 3DA1A 4LJ5A 3PVSA 4DR2M 3UGJA 3QWLA 3HKPA 4NSRA 4MGYE 4QOSA 5FTMA 4ZGEB 3SMPA 3GLHA 4HLQA 4B08A 3J7AS 3AFHA 2KEBA 2CUZA 4MB7A 4IBFA 4K0KM 4HNTA 4BBSM 4B3RM 2ZPFB 3TE6A 3GRRA 4QHSA 5F3WA 1IN6A 1PJIA 2EUCA 3SYKA 4FVMA 1DGGA 2F5QA 1IXZA 1QYRA 1IY1A 3SASA 4LZZA 2D0QB 3HB9A 3WHLA 4OB3B 3KVWA 4CHTB 3GLGB 4JI2M 4OW0A 2CV0A 3M6AA 3EIHA 4IBIA 5KPRA 3JR4A 1TGUA 2QP9X 1UGQB 3Q8XA 3FTFA 2Q2EB 4ZGDB 1H6UA 2YQZA 3QZ9B 5EP2A 2F5PA 1UGRB 3ZCBB 4M6VA 3A45A 3R8FA 3SBJA 1NVMA 4JI0M 1HR0M 1HNZM 1W5SA 5KPZA 4DR5M 2JA2A 3T15A 3JR5A 4WURA 2BJVA 2FOIC 1DO2A 4GRIA 4AI6A 1Z5AA 1J7KA 2K47A 3UMMA 4G6ZA 2KZUA 4PDGA 1E32A 3KS8A 3QYEA 4JX6A 2QDJA 4NRWA 4DV3M 3U6DA 2ZANA 1L2BA 3H4CA 4LF8M 4RF1A 2VQEM 2RGHA 1J09A 3U6MA 2UUCM 3CF6E 1JQJC 5ITXA 4M0DA 2L7HA 3GRVA 3HGIA 2A5YB 3AKZA 1IBKM 4LG2A 5EP1A 3TWKA 3SC3A 1N75A 2CZ7B 2G8LA 1R2YA 3TQSA 4X64M 3KFUG 3U6SA 3U6EA 2L7IA 1FKMA 3QYBA 3GLGA 4GITA 3GPUA 2CEAA 3WHKA 1L1ZA 2VIIA 4G4QA 1HQYE 2FNAA 3LMMA 2QCUA 3U6OA 1LV7A 2D7HA 1R6BX 3KSJA 4KODA 2DXIA 4OVZB 2X8AA 1DGFA 4IBEA 3U6PA 1L2DA 3VKGA 3AL0C 1L8QA 2J7NA 1G8PA 5FTJA 4DV1M 4I81A 4G4OA 2X4AA 1NNUC 3GLFB 3FUVA 3UZUA 1K3WA 4L16A 1JR3D 3TW7A 3FUTA 2X49A 3HU3A 1QANA 2C9CA 3FUWA 3HWSA 4JXJA 4GC5A 2RGOA 3I4YA 1QAMA 1GKIA 1ZQ9A 2C96A 3DZDA 4KO8A 1HNWM 3HZJA 1NHGC 4NSOB 1OFIA 4B3SM 4HNUA 4YHHM 2QENA 3AV0A 4HL4A 4KHPM 3KSXA 2C98A 5KPTA 5C1BA 2VQFM 2QQ8A 3FTEA 3SAWA 1I4WA 1E9SA 3A98B 3FTDA 2KRUA 3T1HM 2BS3A 4NXNM 4BBRM 5JI2E 4II7A 4AQYM 2DXCB 4GKKM 3K2LA 5KO3A 2BJWA 2CYZB 4LOCA 2ZAOA 3LQRA 2V1CA 2XEPA 2R65A 2QPAA 1Z5BA 3HBLA 3AOEA 5ITTA 5ITXE 1HNXM 1OFHA 3K8ZA 1DO0A 1DGHA 3CTWB 4OVZA 2DWNA 4RNAA 1YSYA 3SHGB 3DL1A 2DWLA 1XMOM 3HJSA 4JX5A 4P16A 3UK6A 5EP3A 3SHFA 3U6CA 2E5LM 1G41A 4Z6YA 1IN8A 1HT1E 3X20B 3GLIB 5EXTA 3KP0E 3QAUA 3FYCA 4B3MM 3GLFA 3HHYA 1NNJA 1Z6TA 2CHVA 4LCBA 1GL7A 3KOYE 1N77A 1D2NA 1QZMA 1NJFA 4BLCA 4R7GA 4FWGA 4JI5M 4LF9M 8CATA 4L4UA 4LFBM 4G4RA 3K92A 5KQ8A 3GPPA 5FTKA 4QNRA 1S3SA 4LY6A 3SYLA 4LFAM 3VK8A 4LJ6A 4DR1M 2C5RA 4LF6M 4X66M 3HJ8A 4QNMA 1Q39A 4ITQA 1K82A 4KLNA 1Q3CA 2XSZA 2DD5B 5EXSA 3VFDA 2Y21A 2OQ4A 5IZ7D 3TPZA 4JI7M 1YE9A 3BG9A 2Y0TA 5EQTA 3X25B 3A8GB 2CV1A 2Z3XA 4LGYA 4D81A 4HNVA 2EA0A 3KS4A 2OPFA 4MFEA 3I4VA 3W0LB 1Q3BA 3I51A 3PNYA 4IBBA 2J7OA 3U6QA 1XXHA 1SXJE 1KSFX 4DR3M 1R2ZA 2CE7A 3LVWA 4LJ7A 4AKIA 4DUYM 2DVWB 1PJJA 4IBDA 3GRUA 2ZPHB 3GLIA 3U5ZA 3X28B 2O5RA 3RE8A 1IXRC 2XSZD 2M5ZA 2R46A 4MGIE 4X62M 2H1RA 1SXJB 4LF7M 3TL4X 3AJIB 3IG8A 1L1TA 4DR7M 1MX0A 3GQ5A 1UGSB 2AHJB 3VDPA 1XHBA 2DXBB 3GQ3A 4EIWA 1QQWA 4IIWA 2R62A 4IJFA 1NJGA 4FD2A 1N33M 1XNQM 2LH0A 3C58A 2HHHM 3KDSE 3QYHB 3GO8A 4NXMM 3W0FA 2LNHC 4NRVA 1N34M 1DGHB 5ITQA 3T1YM 3VLFB 3K1JA 3QYGB 2EO2A 3FKEA 4G4NA 5IREB 4MGZE 1Z59A 3FD9A 4Z8XA 3TWMA 3J7BA 2KA6B 5FTLA 1UM8A 3D8LA 4M9SA 2FFJA 2BS2A 1N36M 4MGKE 2Z7JA 4LRSA 5IWAM 4OB2B 1K3XA 2P5TA 2XFTA 3SMSA 3KW6A 1DGBA 4FWHA 3EIEA 4BBAA 1IQPA 3GPYA 3U61B 1IY2A 3X26B 3HU2A 3RGSA 4X65M 4FM4B 4IBJA 3THGA 2ZPEB 2F5OA 3VK7A 2F5SA 4OB0B 4QSHA 3RGPA 3GQ4A 1T3TA 2KW0A 4B7HA 2V6ZM 3U60A 5ITRA 3CF2A 4I8OA 4DR6M 4JYAM 4LFCM 2BS4A 1SXJA 4JI8M 2UXDM 4JV5M 1J5EM 2CFOA 2ERCA 2I7NA 4LJ8A 5DYIA 3M0EA 2KXEA 1FNNA 1IM2A 4B7FA 3AOEC 5DNYA 2HKJA 4YY3M 4DV2M 3KOZE 3JAMS 2L6OA 1WXQA 2ZM6M 4GHLA 3KP1E 1YUBA 5GKNA 3FYDA 2DZNB 2F4VM 2LWXA 2R4EA 4LF4M 1XXHB 4QOZC 2CZ0B 4FWDA 4L78A 2R4JA 1HT2E 5IT9S 3GP1A 5DYGA 4A3VB 4R3DA 3LQQA 1IN4A 4OX9M 3A8MB 1SXJD 2CHQA 1L2CA 1IREB 2C99A 3HJQA 2F5NA 3U5ZB 2YFQA 2CZ6B 1G3IA 4I4LA 1IBLM 3VYHB 4I5SA 1ORYB 3R9XB 4PCZA 3L27A 4D80A 2DHRA 3U61A 3VYGB 2QBYB 2KRKA 4PDIA 2ZPGB 2G77A 3D8BA 3J2PB 3A8HB 5C18A 2FE8A 4DV7M 4GC9A 1NY6A 3SARA 2RKOA 1V29B 2BNKA 1IBMM 3U6LA 1QLBA 4AG6A 2KMGA 5E6JA 5ITYA 5A2QS 3HHZA 2XZUA 4CISA 4ZPXA 4GH9A 2XF3A 3A8LB 1KFVA 2D7GA 1FJGM 4AZFA 3LVVA 3NWLA 4B7GA 5FSWA 3ILKA 2V1UA 3X24B 1EE8A 4IBGA 4ELJA 2KR6A 3L28A 4DV5M 2XFSA 2UXBM 2XLJA 4OU7A 4BB9A 4GKJM 1X37A 3VDUA 2NQ8C 5E26A 2I7PA 4S12A 3HO8A 4MGHA 3VKHA 2YR0A 4PT5A 3L25A 1GLNA 2Y0QA 3NBIA 2LXEA 2DWMA 2R18A 3DOAA 4DR4M 2ZAMA 4MM3B 1TH3A 4JN6A 3U60B 4LF5M 4GMQA 1UGPB 4M9ZA 1E9RA 2L09A 3M7GA 4FCTA 3SFZA 2DPPB 2ZBKB 2C9OA 1MU5A 3MK6A 5H37D 3FUUA 3SAUA 3UJNA 2XZFA 3HHWA 3A46A 1TH4A 2R45A 3PFIA 4AKGA 5LMUM 1IN5A 4M0WA 2QBYA 4FCVA 3E4RA 3SATA 2DZOB 5BPVA 3IG5A 1R7RA 3ZH9B 2HCBA 3PNVA 3A8OB 4JI4M 3AOGA 4JX4A 1GVNA 4DV0M 4IBKA 4AW4A 3KXEC 5EP4A 3B9PA 3TWLA 4GHAA 1N78A 1IY0A 1VDDA 1C1KA 1TH2A 3L26A 1TDHA 2CV2A 4MIMA 5EJCA 4FW9A 3J27B 4LJ9A 4NL4H 4XGIA 3J81S 2QFZA 4IJEA 1QAQA 2CHGA 1JR3A 4MH0E 1G59A 3FTCA 3DFZA 3L29A 3J80S 2G5GX 2D7EA 4LZJA 4JI3M 3QXEB 3GRYA 1TDZA 4B3TM 4FCWA 3T38A 3CF0A 2Z4SA 3QZ5B 2QDYB 3ZC7B 4GIPA 4M9XA 3KOXE 2UU9M 1N32M 5KQDA 1SXJC 1XNRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQ8 A;  3QWL A;  2G77 A;  4HL4 A;  1FKM A;  2QFZ A;  3QYB A;  4NC6 A;  3HZJ A;  4Z6Y A;  4HLQ A;  5EJC A;  3QYE A; 
#chains in the Genus database with same CATH topology
 3LCV B;  2UZE B;  1E7P A;  2Y20 A;  3KOW E;  1OJL A;  1ZMU A;  3HU1 A;  5HQ0 B;  2M60 A;  2DD4 B;  1NHW C;  3POM A;  2ZZD B;  3WVD B;  4LRT A;  4OB1 B;  4LJ4 A;  1IFY A;  2DWZ B;  2FH0 A;  1IXS B;  4AKH A;  1H25 B;  4BCO B;  1ZAE A;  2G9X B;  1NSF A;  2MJ5 B;  3RFW A;  1HQC A;  1XWI A;  3MHV C;  2ZPI B;  2XH9 A;  2K9D A;  2ZPB B;  3MY1 B;  3LCU A;  1PM5 A;  4DV4 M;  2JP7 A;  1IN7 A;  3DA1 A;  2G3Q A;  3PVS A;  4DR2 M;  1JR3 E;  3QWL A;  5FTM A;  1QDR A;  3SMP A;  4F6S B;  3J7A S;  2KEB A;  4MB7 A;  4HNT A;  1W98 B;  3GRR A;  4BCJ B;  1EIJ A;  2B3T A;  1IY1 A;  3SAS A;  4LZZ A;  3HB9 A;  3BLQ B;  2DNA A;  4CHT B;  1OKS A;  4OW0 A;  1GAB A;  3M6A A;  1TGU A;  1ENW A;  1UGQ B;  3Q8X A;  4ZGD B;  3B74 A;  5EP2 A;  1OIP A;  4M6V A;  2UZL B;  3A45 A;  3SBJ A;  4JI0 M;  1HNZ M;  1OGU B;  4DR5 M;  2FOI C;  4GRI A;  4AI6 A;  1Z5A A;  1J7K A;  2K47 A;  2KZU A;  3KS8 A;  4DV3 M;  3H4C A;  4LF8 M;  2UUC M;  2IN3 A;  2L7H A;  3AKZ A;  2A5Y B;  4LG2 A;  5EP1 A;  3HY5 A;  3TQS A;  1P5E B;  4RKU F;  3QYB A;  2W96 A;  3WHK A;  4G4Q A;  1HQY E;  2DXI A;  1LV7 A;  3KSJ A;  1R6B X;  2X8A A;  1DGF A;  4KT0 F;  4Y72 B;  1L2D A;  4ELL A;  2JXN A;  4DV1 M;  4KRD B;  4G4O A;  3FUV A;  2WSE F;  1JR3 D;  3TW7 A;  1VQ1 A;  2EKK A;  2RGO A;  3I4Y A;  2DAK A;  1HNW M;  3MIA B;  2QEN A;  4HL4 A;  5KPT A;  2VQF M;  3I04 M;  4KRC B;  2QQ8 A;  1E9S A;  2KRU A;  2X1N B;  2CYZ B;  4LOC A;  2R65 A;  2QPA A;  1CUK A;  3HBL A;  1HNX M;  3K8Z A;  1DO0 A;  4OVZ A;  2DWN A;  3B89 A;  4JX5 A;  1H4L D;  4Z6Y A;  1IN8 A;  3X20 B;  3E21 A;  1OKW B;  1GUX B;  5LQF B;  4B3M M;  4LCB A;  1N77 A;  1QZM A;  4BLC A;  1P3Q Q;  4OR5 B;  2DI0 A;  4JI5 M;  4I3Z B;  3BLH B;  4EOL B;  8CAT A;  4L4U A;  3K92 A;  5FTK A;  4QNR A;  1S3S A;  4LY6 A;  4X66 M;  2VDB B;  3DJB A;  1K82 A;  4BCF B;  1Q3C A;  2DD5 B;  3VFD A;  5IZ7 D;  2MRO B;  2Z3X A;  1D0L A;  4LGY A;  2OPF A;  3KS4 A;  3I4V A;  1GH6 B;  4ROE A;  3U6Q A;  1SXJ E;  1KSF X;  4AKI A;  4DUY M;  1TF0 B;  2QSF X;  2O5R A;  4UN2 B;  1IXR C;  2QHO B;  3F92 A;  5HBJ B;  1L1T A;  1UGS B;  2AHJ B;  3VDP A;  4EIW A;  1D0M A;  4IIW A;  4IJF A;  1NJG A;  3QYH B;  4NXM M;  1O9K B;  2PHG A;  2OOB A;  2LVP C;  2CCI B;  3TWM A;  2KA6 B;  5FTL A;  2K0B X;  4M9S A;  4MGK E;  2P5T A;  1IQP A;  3GPY A;  4BCM B;  2ZPE B;  3GQ4 A;  3U60 A;  1D3U B;  2R6F A;  4DR6 M;  2BS4 A;  1SXJ A;  2ERC A;  2I7N A;  3RGF B;  4LJ8 A;  1XXH E;  4B7F A;  2ZM6 M;  3FRI A;  1JOW A;  2DZN B;  4YOZ A;  2LWX A;  4LF4 M;  5IHY A;  2IW8 B;  3DDQ B;  5IT9 S;  4OGR B;  1IN4 A;  1SXJ D;  4F70 B;  2C99 A;  3K9O A;  1V92 A;  2YFQ A;  2CZ6 B;  3HX3 A;  2K6B A;  1ORY B;  2DHR A;  3U61 A;  1VIN A;  3DTO A;  3FRH A;  2ZPG B;  2JY6 B;  4BXX X;  2LVA A;  3SAR A;  1KXU A;  4AG6 A;  2KMG A;  5ITY A;  2JY7 A;  4F7S B;  4ZPX A;  2EJS A;  1WGN A;  2BPM B;  2D7G A;  2PJQ A;  4ELJ A;  4DV5 M;  2XFS A;  2UXB M;  2LVN C;  4OU7 A;  1X37 A;  5E26 A;  4CFN B;  3L25 A;  4MM3 B;  1OI9 B;  4JN6 A;  1AD6 A;  4GEW A;  2L09 A;  2DPP B;  3MK6 A;  3UJN A;  3HHW A;  3A46 A;  1F5Q B;  4AKG A;  1IN5 A;  2QBY A;  3E4R A;  3SAT A;  2JUJ A;  3IG5 A;  2WFY B;  3PNV A;  1VYW B;  4JX4 A;  4DV0 M;  3B9P A;  1N78 A;  1IY0 A;  1VDD A;  1TH2 A;  3L26 A;  1GO5 A;  5EJC A;  4LJ9 A;  4ROD A;  1UNL D;  2QFZ A;  1QAQ A;  4MH0 E;  2G5G X;  1TDZ A;  2LTU A;  3TNI B;  3CF0 A;  3GLH E;  3IHP A;  4GIP A;  2UU9 M;  5BR8 M;  3PXG A;  1W5T A;  5JI3 E;  3FE3 A;  3E9S A;  3DOG B;  1QAO A;  2KNA A;  2QF7 A;  3MMP A;  5FTN A;  4W5W A;  3HHT B;  2DAI A;  2L2D A;  3W68 A;  4NOO B;  5FLX S;  4TUW A;  2BKZ B;  4DV6 M;  1H1Q B;  1VEG A;  2IW9 B;  2UUB M;  1VOL A;  3O0G D;  2JY8 A;  3A42 A;  4LJA A;  3L2A A;  2QZ4 A;  4F7N B;  2DAM A;  2PK2 A;  4L15 A;  2UXC M;  4D82 A;  4LJ5 A;  3UGJ A;  4ZGE B;  4MGY E;  3GLH A;  4B08 A;  3GLG E;  1H28 B;  4IBF A;  4BBS M;  1IN6 A;  1WJ7 A;  1VG5 A;  4FVM A;  1DGG A;  1QYR A;  3WHL A;  2GQF A;  4IBI A;  3ZQJ A;  3JR4 A;  3R8F A;  1HR0 M;  5KPZ A;  1PJS A;  2F2C A;  2JA2 A;  4G6Z A;  3TNH B;  3QYE A;  2CCH B;  1L2B A;  4RF1 A;  3U6M A;  5ITX A;  4M0D A;  2LHC A;  3TWK A;  3SC3 A;  1N75 A;  2G8L A;  3U6S A;  3U6E A;  3GLG A;  4GIT A;  2CEA A;  1L1Z A;  3BXW A;  1R4G A;  1OQY A;  3GLF E;  5IDP B;  3U6O A;  2W9F A;  4OVZ B;  2JNH A;  3U6P A;  3VKG A;  2DHY A;  2J7N A;  1G8P A;  1NO1 A;  1XB2 B;  4L16 A;  1AIP C;  1QAN A;  2C9C A;  3FUW A;  4EOI B;  1E9H B;  4EC9 B;  1GKI A;  3DZD A;  4HNU A;  3AV0 A;  2MR9 A;  3KSX A;  2LHG A;  4NXN M;  4GKK M;  5KO3 A;  1JB0 F;  1T6O A;  2ZAO A;  5HVY B;  4BCK B;  4CXA B;  1Z5B A;  3AOE A;  1OFH A;  1QMZ B;  1QUS A;  2C5V B;  3BBZ A;  2DWL A;  4P16 A;  3U6C A;  1C9B A;  1OTR A;  3KP0 E;  1BVS A;  3GLF A;  1C7Y A;  1SG9 A;  3KOY E;  4FWG A;  2BWE A;  4LF9 M;  4BCI B;  1H1R B;  4LJ6 A;  5FGK B;  4QNM A;  4KLN A;  5EXS A;  2OQ4 A;  2Y21 A;  4JI7 M;  5EQT A;  2CV1 A;  2HWJ A;  4D81 A;  4HNV A;  4MFE A;  3I51 A;  4CRL B;  2CE7 A;  1Q02 A;  4IBD A;  2JZ0 A;  2DME A;  3GLI A;  3U5Z A;  4X62 M;  2BWB A;  1SXJ B;  4DR7 M;  3IG8 A;  2WEV B;  1MX0 A;  2PK9 B;  1XHB A;  1XNQ M;  2LH0 A;  3C58 A;  2HHH M;  4EOJ B;  4NRV A;  1N34 M;  1DGH B;  3TNW B;  2LBC A;  2EO2 A;  4G4N A;  3BHU B;  3B7Q A;  2BS2 A;  4BCG B;  1URC B;  3C3E A;  5IWA M;  1MN3 A;  4F7L B;  3KW6 A;  3U61 B;  1IY2 A;  5ACB A;  2F5O A;  3VK7 A;  2KNZ A;  1T3T A;  2KW0 A;  4IMY B;  4I8O A;  4JV5 M;  5CEI B;  1GJT A;  3M0E A;  1H24 B;  3E46 A;  5DNY A;  2WXV B;  3KOZ E;  2L6O A;  3MY5 B;  1V34 A;  2F4V M;  2R4E A;  1XXH B;  3V76 A;  2UZD B;  4FWD A;  1HT2 E;  3GP1 A;  5DYG A;  4R3D A;  5BNJ B;  2CHQ A;  1IRE B;  2Z8Y M;  4I4L A;  4PCZ A;  5L2W B;  2DEN A;  2QBY B;  2FE8 A;  4GC9 A;  1DV0 A;  2BNK A;  5LMK B;  2XZU A;  1OL1 B;  4GH9 A;  1KFV A;  1FJG M;  4AZF A;  1EE8 A;  5ICP B;  3VDU A;  3HO8 A;  4S12 A;  2YR0 A;  4PT5 A;  1GLN A;  3NBI A;  3DOA A;  4DR4 M;  4LF5 M;  4GMQ A;  2V22 B;  4M9Z A;  1E9R A;  3SFZ A;  3FUU A;  2XZF A;  4EOR B;  1UFZ A;  3PFI A;  1R7R A;  3ZH9 B;  4JI4 M;  1PJT A;  2KDL A;  3TWL A;  4GHA A;  4NL4 H;  4IJE A;  2CHG A;  1G59 A;  3J80 S;  3GTM S;  2UZB B;  4FCW A;  2Z4S A;  3F5X B;  3ZC7 B;  3KOX E;  1XNR M;  1QZE A;  2I53 A;  4RF0 A;  2VF7 A;  3FUX A;  3GLH B;  3HHX A;  4MFD A;  3OTO M;  2Z4R A;  2KZS A;  2UUA M;  4DUZ M;  4XBO A;  4CFM B;  2AHM A;  2LW4 A;  1TD6 A;  4L8R C;  3EOC B;  1XC8 A;  2QNJ A;  4IBC A;  2J5Y A;  3TN8 B;  1AIS B;  4QHT A;  1I94 M;  1RU3 A;  2OOA A;  1XMQ M;  5IDN B;  5LMN M;  4HEO A;  1OL2 B;  2DZL A;  2C5N B;  1AHJ B;  3KHI A;  7CAT A;  3DDP B;  4QOS A;  3HKP A;  4NSR A;  1JKW A;  4FX3 B;  2CUZ A;  2APL A;  4QHS A;  5F3W A;  1PRB A;  3SYK A;  2F5Q A;  1IXZ A;  4EOO B;  1H1P B;  3GLG B;  4JI2 M;  1TTE A;  2CV0 A;  2QP9 X;  3FTF A;  1H6U A;  2F5P A;  1UGR B;  3ZCB B;  1NVM A;  1W5S A;  3I01 M;  4YOS A;  3T15 A;  3JR5 A;  4WUR A;  4WP2 A;  4Y28 F;  1DO2 A;  2OO9 A;  2B9R A;  4PDG A;  1E32 A;  1VEK A;  1GJS A;  2QDJ A;  2H5X A;  4NRW A;  3U6D A;  2ZAN A;  2RGH A;  1J09 A;  1JQJ C;  1QUT A;  4Q7J A;  1H1S B;  2CZ7 B;  4CIZ A;  4X64 M;  3KFU G;  2L7I A;  2FNA A;  3LMM A;  2QCU A;  3LW5 F;  2D7H A;  3QHR B;  3AL0 C;  4BCQ D;  2X4A A;  3BLR B;  1NNU C;  3GLF B;  2WSC F;  3UZU A;  1K3W A;  1WHC A;  2X49 A;  3HU3 A;  4GC5 A;  1QAM A;  4KO8 A;  3HZJ A;  4NSO B;  2PMI B;  4KHP M;  2C98 A;  1I4W A;  2BS3 A;  5JI2 E;  4II7 A;  2DXC B;  2BJW A;  2CRU A;  2V1C A;  1O9K A;  5ITX E;  2GNO A;  2WIH B;  3SHG B;  1XMO M;  2E5L M;  1WR1 B;  1HT1 E;  3GLI B;  3CGW A;  2JZ1 A;  1TFB A;  4BY1 X;  1NJF A;  3Q8G A;  4F6W B;  3GPP A;  2WIP B;  2UUE B;  2C5R A;  3VK8 A;  3HJ8 A;  1Q39 A;  5DQW A;  1YE9 A;  2WMB B;  2Y0T A;  3X25 B;  1Q3B A;  4IBB A;  3BHT B;  4DR3 M;  3LVW A;  2DVW B;  1BU2 A;  3GRU A;  2KNV A;  2M5Z A;  2R46 A;  4MGI E;  4LF7 M;  4NST B;  2R0I A;  3AJI B;  3GQ5 A;  3BHV B;  2ZTD A;  2R62 A;  2L4F A;  4YOO A;  1JSU B;  3GO8 A;  3K1J A;  3QYG B;  2O25 A;  3D8L A;  2C5O B;  2Z7J A;  4LRS A;  4L6V 6;  4BCP B;  1OIY B;  1DGB A;  4BBA A;  4X65 M;  2DAG A;  2V6Z M;  5ITR A;  3CF2 A;  4JI8 M;  2UXD M;  4BCN D;  4UN0 A;  2KXE A;  1FNN A;  1IM2 A;  2HKJ A;  4YY3 M;  4DV2 M;  3JAM S;  1WXQ A;  2C5X B;  1ZP2 A;  3KP1 E;  1YUB A;  3MI9 B;  3FYD A;  3GLI E;  2RRU A;  2CZ0 B;  2R4J A;  4A3V B;  1OKV B;  4CFU D;  4OX9 M;  3A8M B;  1JST B;  1ZMW A;  4EON B;  4F7J B;  1NV8 A;  3W67 A;  2QGS A;  4I5S A;  2R7G A;  3R9X B;  4EOP B;  1VDL A;  4F6U B;  2KRK A;  4PDI A;  5L8R F;  2G77 A;  3D8B A;  4DV7 M;  1NY6 A;  2RKO A;  5CYI B;  1IBM M;  3U6L A;  1QLB A;  3HHZ A;  3LVV A;  4B7G A;  5FSW A;  3ILK A;  2V1U A;  4IBG A;  3L28 A;  2DKL A;  5EFQ B;  4G6L B;  1WGL A;  2DWM A;  1EFU B;  3U60 B;  1PKD B;  1UGP B;  1MU5 A;  5H37 D;  3SAU A;  1TH4 A;  2IVX A;  4R71 A;  5LMU M;  1F4I A;  2DZO B;  2HCB A;  1GVN A;  4IBK A;  4AW4 A;  1XO2 A;  3KXE C;  5EP4 A;  4MIM A;  4CFX B;  3J81 S;  1D0K A;  1JR3 A;  4LZJ A;  3QXE B;  3QZ5 B;  4M9X A;  1YLA A;  1SXJ C;  3IEC A;  1T43 A;  1KYI A;  3WVE B;  5I5Z B;  3BOS A;  4XK8 F;  5DQV A;  1E94 E;  5ITU A;  3MJ5 A;  3SAV A;  3BG5 A;  3TW6 A;  5EXX A;  4JI1 M;  4ZGJ B;  2WJ9 A;  1GL6 A;  4REZ A;  5EXP A;  2XGN A;  1VEJ A;  1N4M A;  4P17 A;  2DAE A;  4CGY B;  4PD2 A;  4NC6 A;  2HL7 A;  4II5 B;  5HNB B;  1QVR A;  2W82 A;  1NY5 A;  4LGM A;  3GPX A;  3BG3 A;  2CZ1 B;  4AG5 A;  4DBG B;  5HBH B;  1G4A E;  4G3O A;  3H4M A;  1Z5C A;  2LVO C;  4WW0 A;  2YNM D;  2ZCF B;  2MH8 A;  4JI6 M;  4YC3 B;  3EID B;  2WHB B;  4HLQ A;  3AFH A;  4EOQ B;  4K0K M;  4B3R M;  2ZPF B;  3TE6 A;  2WPA B;  1PJI A;  2EUC A;  4BCQ B;  3H4J A;  5DFL A;  2D0Q B;  2CWB A;  4OB3 B;  3KVW A;  1IXS A;  1G3N C;  3EIH A;  5KPR A;  1R5L A;  1V33 A;  2C4G B;  2Q2E B;  2YQZ A;  3QZ9 B;  2I40 B;  2O01 F;  1OAI A;  2BJV A;  5IF1 B;  3UMM A;  4JX6 A;  2HAK A;  4EC8 B;  4ANR A;  2VQE M;  3CF6 E;  3GRV A;  3HGI A;  1IBK M;  1HJP A;  1R2Y A;  1WIV A;  3T6P A;  1FKM A;  4CJ6 A;  3GPU A;  2C6T B;  2JY5 A;  2VII A;  2FS1 A;  1UNG D;  4F2L A;  1ZMV A;  4KOD A;  4IBE A;  1L8Q A;  5FTJ A;  4I81 A;  3PO3 S;  1NV9 A;  3B7Z A;  3FUT A;  3HWS A;  4JXJ A;  1AUA A;  2N35 A;  1H26 B;  1ZQ9 A;  2C96 A;  1NHG C;  1OFI A;  4B3S M;  2WMA B;  4YHH M;  5C1B A;  2JGZ B;  3FTE A;  3SAW A;  3A98 B;  3FTD A;  3T1H M;  4BBR M;  4AQY M;  3K2L A;  3LQR A;  2XEP A;  5ITT A;  1OIU B;  1DGH A;  3CTW B;  4RNA A;  1YSY A;  3DL1 A;  1UNH D;  3C3D A;  3HJS A;  3UK6 A;  5EP3 A;  3SHF A;  1G41 A;  5EXT A;  3QAU A;  3FYC A;  3HHY A;  1NNJ A;  1Z6T A;  2CHV A;  1GL7 A;  1Y8G A;  1TR8 A;  1D2N A;  4R7G A;  1QDT A;  4G4R A;  4LFB M;  5KQ8 A;  3K9P A;  3SYL A;  4LFA M;  4DR1 M;  4LF6 M;  4ITQ A;  4TTH A;  2XSZ A;  3TPZ A;  3BG9 A;  4BCN B;  3M03 A;  1ZV1 A;  3A8G B;  3NDQ A;  2EA0 A;  1A5T A;  3W0L B;  3PNY A;  2J7O A;  1XXH A;  1R2Z A;  4LJ7 A;  2ZTC A;  2L4E A;  1PJJ A;  1PJQ A;  2ZPH B;  3X28 B;  3RE8 A;  1GUX A;  2WZJ A;  2XSZ D;  4CFU B;  2H1R A;  3TL4 X;  2DXB B;  3GQ3 A;  1QQW A;  4FD2 A;  1N33 M;  3KDS E;  4BY7 X;  3W0F A;  2LNH C;  5ITQ A;  3T1Y M;  3VLF B;  1G71 A;  3FKE A;  5IRE B;  4MGZ E;  1Z59 A;  3FD9 A;  2VF8 A;  4Z8X A;  3J7B A;  1UM8 A;  2FFJ A;  1N36 M;  4OB2 B;  1K3X A;  2XFT A;  3SMS A;  4FWH A;  3EIE A;  3X26 B;  3HU2 A;  3RGS A;  4FM4 B;  4IBJ A;  3THG A;  4QSH A;  2F5S A;  4OB0 B;  3RGP A;  5HBE B;  4B7H A;  4JYA M;  4LFC M;  2LVQ D;  1J5E M;  2CFO A;  4CFW B;  2JWS A;  5DYI A;  4ROC A;  3AOE C;  3B57 A;  4EOK B;  4GHL A;  5GKN A;  2EKF A;  4F1I A;  1H27 B;  4QOZ C;  2IW6 B;  4L78 A;  2WSF F;  3LQQ A;  2CJM B;  1L2C A;  3HJQ A;  3EJ1 B;  2F5N A;  3U5Z B;  1G3I A;  1IBL M;  3VYH B;  4CFV B;  4EOS B;  3L27 A;  4D80 A;  3VYG B;  2EUF A;  3J2P B;  3A8H B;  5C18 A;  1OAO C;  1V29 B;  2W99 A;  5E6J A;  5A2Q S;  4CIS A;  3NBX X;  2XF3 A;  3A8L B;  3NWL A;  3X24 B;  2CP8 A;  2KR6 A;  2XLJ A;  4BB9 A;  4GKJ M;  1GY3 B;  4BCM D;  2NQ8 C;  2W2H A;  2I7P A;  4MGH A;  3VKH A;  2KHH A;  2Y0Q A;  2LXE A;  2R18 A;  4EOM B;  2ZAM A;  1TH3 A;  1LTM A;  3M7G A;  4FCT A;  2ZBK B;  2C9O A;  2R45 A;  3LQ5 B;  4M0W A;  4FCV A;  5BPV A;  1FIN B;  3C9P A;  1PGY A;  3A8O B;  3AOG A;  3QHW B;  1MJG M;  3B7N A;  1C1K A;  2CV2 A;  1TDH A;  4FW9 A;  3K7A M;  3J27 B;  4XGI A;  3G33 B;  1FVV B;  3FTC A;  3DFZ A;  2MGW A;  3L29 A;  2D7E A;  4JI3 M;  2R44 A;  3GRY A;  4B3T M;  3T38 A;  2QDY B;  1N32 M;  5KQD A;  2W9Z A;  1OIZ A;  4BCH B; 
#chains in the Genus database with same CATH homology
 5BR8 M;  3PXG A;  1KYI A;  4RF0 A;  1E7P A;  2Y20 A;  3WVE B;  3BOS A;  1OJL A;  3FUX A;  3GLH B;  3KOW E;  1W5T A;  3HHX A;  1E94 E;  3HU1 A;  5JI3 E;  5ITU A;  3OTO M;  4MFD A;  2M60 A;  2Z4R A;  3E9S A;  3MJ5 A;  3SAV A;  2DD4 B;  3BG5 A;  3TW6 A;  1NHW C;  5EXX A;  2KZS A;  4JI1 M;  2ZZD B;  4ZGJ B;  2UUA M;  3WVD B;  4DUZ M;  4LRT A;  1QAO A;  4OB1 B;  4XBO A;  4LJ4 A;  2QF7 A;  2WJ9 A;  1GL6 A;  2DWZ B;  4REZ A;  5EXP A;  2XGN A;  1IXS B;  4AKH A;  2AHM A;  5FTN A;  4W5W A;  1ZAE A;  3HHT B;  1NSF A;  3RFW A;  1HQC A;  4L8R C;  4NOO B;  1XWI A;  5FLX S;  1XC8 A;  4CGY B;  3MHV C;  4IBC A;  4PD2 A;  2ZPI B;  4TUW A;  4NC6 A;  2HL7 A;  4QHT A;  4DV6 M;  2XH9 A;  1QVR A;  2UUB M;  1I94 M;  2W82 A;  1NY5 A;  4LGM A;  2ZPB B;  3GPX A;  3BG3 A;  1XMQ M;  3A42 A;  2CZ1 B;  5LMN M;  4AG5 A;  1PM5 A;  4DV4 M;  4LJA A;  1G4A E;  3L2A A;  2QZ4 A;  1IN7 A;  3H4M A;  1Z5C A;  4WW0 A;  2YNM D;  1AHJ B;  4L15 A;  2UXC M;  4D82 A;  3KHI A;  7CAT A;  2ZCF B;  4JI6 M;  3DA1 A;  4LJ5 A;  3PVS A;  4DR2 M;  3UGJ A;  3QWL A;  3HKP A;  4NSR A;  4MGY E;  4QOS A;  5FTM A;  4ZGE B;  3SMP A;  3GLH A;  4HLQ A;  4B08 A;  3J7A S;  3AFH A;  2KEB A;  2CUZ A;  4MB7 A;  4IBF A;  4K0K M;  4HNT A;  4BBS M;  4B3R M;  2ZPF B;  3TE6 A;  3GRR A;  4QHS A;  5F3W A;  1IN6 A;  1PJI A;  2EUC A;  3SYK A;  4FVM A;  1DGG A;  2F5Q A;  1IXZ A;  1QYR A;  1IY1 A;  3SAS A;  4LZZ A;  2D0Q B;  3HB9 A;  3WHL A;  4OB3 B;  3KVW A;  4CHT B;  3GLG B;  4JI2 M;  4OW0 A;  2CV0 A;  3M6A A;  3EIH A;  4IBI A;  5KPR A;  3JR4 A;  1TGU A;  2QP9 X;  1UGQ B;  3Q8X A;  3FTF A;  2Q2E B;  4ZGD B;  1H6U A;  2YQZ A;  3QZ9 B;  5EP2 A;  2F5P A;  1UGR B;  3ZCB B;  4M6V A;  3A45 A;  3R8F A;  3SBJ A;  1NVM A;  4JI0 M;  1HR0 M;  1HNZ M;  1W5S A;  5KPZ A;  4DR5 M;  2JA2 A;  3T15 A;  3JR5 A;  4WUR A;  2BJV A;  2FOI C;  1DO2 A;  4GRI A;  4AI6 A;  1Z5A A;  1J7K A;  2K47 A;  3UMM A;  4G6Z A;  2KZU A;  4PDG A;  1E32 A;  3KS8 A;  3QYE A;  4JX6 A;  2QDJ A;  4NRW A;  4DV3 M;  3U6D A;  2ZAN A;  1L2B A;  3H4C A;  4LF8 M;  4RF1 A;  2VQE M;  2RGH A;  1J09 A;  3U6M A;  2UUC M;  3CF6 E;  1JQJ C;  5ITX A;  4M0D A;  2L7H A;  3GRV A;  3HGI A;  2A5Y B;  3AKZ A;  1IBK M;  4LG2 A;  5EP1 A;  3TWK A;  3SC3 A;  1N75 A;  2CZ7 B;  2G8L A;  1R2Y A;  3TQS A;  4X64 M;  3KFU G;  3U6S A;  3U6E A;  2L7I A;  1FKM A;  3QYB A;  3GLG A;  4GIT A;  3GPU A;  2CEA A;  3WHK A;  1L1Z A;  2VII A;  4G4Q A;  1HQY E;  2FNA A;  3LMM A;  2QCU A;  3U6O A;  1LV7 A;  2D7H A;  1R6B X;  3KSJ A;  4KOD A;  2DXI A;  4OVZ B;  2X8A A;  1DGF A;  4IBE A;  3U6P A;  1L2D A;  3VKG A;  3AL0 C;  1L8Q A;  2J7N A;  1G8P A;  5FTJ A;  4DV1 M;  4I81 A;  4G4O A;  2X4A A;  1NNU C;  3GLF B;  3FUV A;  3UZU A;  1K3W A;  4L16 A;  1JR3 D;  3TW7 A;  3FUT A;  2X49 A;  3HU3 A;  1QAN A;  2C9C A;  3FUW A;  3HWS A;  4JXJ A;  4GC5 A;  2RGO A;  3I4Y A;  1QAM A;  1GKI A;  1ZQ9 A;  2C96 A;  3DZD A;  4KO8 A;  1HNW M;  3HZJ A;  1NHG C;  4NSO B;  1OFI A;  4B3S M;  4HNU A;  4YHH M;  2QEN A;  3AV0 A;  4HL4 A;  4KHP M;  3KSX A;  2C98 A;  5KPT A;  5C1B A;  2VQF M;  2QQ8 A;  3FTE A;  3SAW A;  1I4W A;  1E9S A;  3A98 B;  3FTD A;  2KRU A;  3T1H M;  2BS3 A;  4NXN M;  4BBR M;  5JI2 E;  4II7 A;  4AQY M;  2DXC B;  4GKK M;  3K2L A;  5KO3 A;  2BJW A;  2CYZ B;  4LOC A;  2ZAO A;  3LQR A;  2V1C A;  2XEP A;  2R65 A;  2QPA A;  1Z5B A;  3HBL A;  3AOE A;  5ITT A;  5ITX E;  1HNX M;  1OFH A;  3K8Z A;  1DO0 A;  1DGH A;  3CTW B;  4OVZ A;  2DWN A;  4RNA A;  1YSY A;  3SHG B;  3DL1 A;  2DWL A;  1XMO M;  3HJS A;  4JX5 A;  4P16 A;  3UK6 A;  5EP3 A;  3SHF A;  3U6C A;  2E5L M;  1G41 A;  4Z6Y A;  1IN8 A;  1HT1 E;  3X20 B;  3GLI B;  5EXT A;  3KP0 E;  3QAU A;  3FYC A;  4B3M M;  3GLF A;  3HHY A;  1NNJ A;  1Z6T A;  2CHV A;  4LCB A;  1GL7 A;  3KOY E;  1N77 A;  1D2N A;  1QZM A;  1NJF A;  4BLC A;  4R7G A;  4FWG A;  4JI5 M;  4LF9 M;  8CAT A;  4L4U A;  4LFB M;  4G4R A;  3K92 A;  5KQ8 A;  3GPP A;  5FTK A;  4QNR A;  1S3S A;  4LY6 A;  3SYL A;  4LFA M;  3VK8 A;  4LJ6 A;  4DR1 M;  2C5R A;  4LF6 M;  4X66 M;  3HJ8 A;  4QNM A;  1Q39 A;  4ITQ A;  1K82 A;  4KLN A;  1Q3C A;  2XSZ A;  2DD5 B;  5EXS A;  3VFD A;  2Y21 A;  2OQ4 A;  5IZ7 D;  3TPZ A;  4JI7 M;  1YE9 A;  3BG9 A;  2Y0T A;  5EQT A;  3X25 B;  3A8G B;  2CV1 A;  2Z3X A;  4LGY A;  4D81 A;  4HNV A;  2EA0 A;  3KS4 A;  2OPF A;  4MFE A;  3I4V A;  3W0L B;  1Q3B A;  3I51 A;  3PNY A;  4IBB A;  2J7O A;  3U6Q A;  1XXH A;  1SXJ E;  1KSF X;  4DR3 M;  1R2Z A;  2CE7 A;  3LVW A;  4LJ7 A;  4AKI A;  4DUY M;  2DVW B;  1PJJ A;  4IBD A;  3GRU A;  2ZPH B;  3GLI A;  3U5Z A;  3X28 B;  2O5R A;  3RE8 A;  1IXR C;  2XSZ D;  2M5Z A;  2R46 A;  4MGI E;  4X62 M;  2H1R A;  1SXJ B;  4LF7 M;  3TL4 X;  3AJI B;  3IG8 A;  1L1T A;  4DR7 M;  1MX0 A;  3GQ5 A;  1UGS B;  2AHJ B;  3VDP A;  1XHB A;  2DXB B;  3GQ3 A;  4EIW A;  1QQW A;  4IIW A;  2R62 A;  4IJF A;  1NJG A;  4FD2 A;  1N33 M;  1XNQ M;  2LH0 A;  3C58 A;  2HHH M;  3KDS E;  3QYH B;  3GO8 A;  4NXM M;  3W0F A;  2LNH C;  4NRV A;  1N34 M;  1DGH B;  5ITQ A;  3T1Y M;  3VLF B;  3K1J A;  3QYG B;  2EO2 A;  3FKE A;  4G4N A;  5IRE B;  4MGZ E;  1Z59 A;  3FD9 A;  4Z8X A;  3TWM A;  3J7B A;  2KA6 B;  5FTL A;  1UM8 A;  3D8L A;  4M9S A;  2FFJ A;  2BS2 A;  1N36 M;  4MGK E;  2Z7J A;  4LRS A;  5IWA M;  4OB2 B;  1K3X A;  2P5T A;  2XFT A;  3SMS A;  3KW6 A;  1DGB A;  4FWH A;  3EIE A;  4BBA A;  1IQP A;  3GPY A;  3U61 B;  1IY2 A;  3X26 B;  3HU2 A;  3RGS A;  4X65 M;  4FM4 B;  4IBJ A;  3THG A;  2ZPE B;  2F5O A;  3VK7 A;  2F5S A;  4OB0 B;  4QSH A;  3RGP A;  3GQ4 A;  1T3T A;  2KW0 A;  4B7H A;  2V6Z M;  3U60 A;  5ITR A;  3CF2 A;  4I8O A;  4DR6 M;  4JYA M;  4LFC M;  2BS4 A;  1SXJ A;  4JI8 M;  2UXD M;  4JV5 M;  1J5E M;  2CFO A;  2ERC A;  2I7N A;  4LJ8 A;  5DYI A;  3M0E A;  2KXE A;  1FNN A;  1IM2 A;  4B7F A;  3AOE C;  5DNY A;  2HKJ A;  4YY3 M;  4DV2 M;  3KOZ E;  3JAM S;  2L6O A;  1WXQ A;  2ZM6 M;  4GHL A;  3KP1 E;  1YUB A;  5GKN A;  3FYD A;  2DZN B;  2F4V M;  2LWX A;  2R4E A;  4LF4 M;  1XXH B;  4QOZ C;  2CZ0 B;  4FWD A;  4L78 A;  2R4J A;  1HT2 E;  5IT9 S;  3GP1 A;  5DYG A;  4A3V B;  4R3D A;  3LQQ A;  1IN4 A;  4OX9 M;  3A8M B;  1SXJ D;  2CHQ A;  1L2C A;  1IRE B;  2C99 A;  3HJQ A;  2F5N A;  3U5Z B;  2YFQ A;  2CZ6 B;  1G3I A;  4I4L A;  1IBL M;  3VYH B;  4I5S A;  1ORY B;  3R9X B;  4PCZ A;  3L27 A;  4D80 A;  2DHR A;  3U61 A;  3VYG B;  2QBY B;  2KRK A;  4PDI A;  2ZPG B;  2G77 A;  3D8B A;  3J2P B;  3A8H B;  5C18 A;  2FE8 A;  4DV7 M;  4GC9 A;  1NY6 A;  3SAR A;  2RKO A;  1V29 B;  2BNK A;  1IBM M;  3U6L A;  1QLB A;  4AG6 A;  2KMG A;  5E6J A;  5ITY A;  5A2Q S;  3HHZ A;  2XZU A;  4CIS A;  4ZPX A;  4GH9 A;  2XF3 A;  3A8L B;  1KFV A;  2D7G A;  1FJG M;  4AZF A;  3LVV A;  3NWL A;  4B7G A;  5FSW A;  3ILK A;  2V1U A;  3X24 B;  1EE8 A;  4IBG A;  4ELJ A;  2KR6 A;  3L28 A;  4DV5 M;  2XFS A;  2UXB M;  2XLJ A;  4OU7 A;  4BB9 A;  4GKJ M;  1X37 A;  3VDU A;  2NQ8 C;  5E26 A;  2I7P A;  4S12 A;  3HO8 A;  4MGH A;  3VKH A;  2YR0 A;  4PT5 A;  3L25 A;  1GLN A;  2Y0Q A;  3NBI A;  2LXE A;  2DWM A;  2R18 A;  3DOA A;  4DR4 M;  2ZAM A;  4MM3 B;  1TH3 A;  4JN6 A;  3U60 B;  4LF5 M;  4GMQ A;  1UGP B;  4M9Z A;  1E9R A;  2L09 A;  3M7G A;  4FCT A;  3SFZ A;  2DPP B;  2ZBK B;  2C9O A;  1MU5 A;  3MK6 A;  5H37 D;  3FUU A;  3SAU A;  3UJN A;  2XZF A;  3HHW A;  3A46 A;  1TH4 A;  2R45 A;  3PFI A;  4AKG A;  5LMU M;  1IN5 A;  4M0W A;  2QBY A;  4FCV A;  3E4R A;  3SAT A;  2DZO B;  5BPV A;  3IG5 A;  1R7R A;  3ZH9 B;  2HCB A;  3PNV A;  3A8O B;  4JI4 M;  3AOG A;  4JX4 A;  1GVN A;  4DV0 M;  4IBK A;  4AW4 A;  3KXE C;  5EP4 A;  3B9P A;  3TWL A;  4GHA A;  1N78 A;  1IY0 A;  1VDD A;  1C1K A;  1TH2 A;  3L26 A;  1TDH A;  2CV2 A;  4MIM A;  5EJC A;  4FW9 A;  3J27 B;  4LJ9 A;  4NL4 H;  4XGI A;  3J81 S;  2QFZ A;  4IJE A;  1QAQ A;  2CHG A;  1JR3 A;  4MH0 E;  1G59 A;  3FTC A;  3DFZ A;  3L29 A;  3J80 S;  2G5G X;  2D7E A;  4LZJ A;  4JI3 M;  3QXE B;  3GRY A;  1TDZ A;  4B3T M;  4FCW A;  3T38 A;  3CF0 A;  2Z4S A;  3QZ5 B;  2QDY B;  3ZC7 B;  4GIP A;  4M9X A;  3KOX E;  2UU9 M;  1N32 M;  5KQD A;  1SXJ C;  1XNR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...