4HLQA

Crystal structure of human rab1b bound to gdp and bef3 in complex with the gap domain of tbc1d20 from homo sapiens
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator/protein transport
molecule keywords TBC1 domain family member 20
total genus 95
structure length 280
sequence length 280
chains with identical sequence C, E, G, I
ec nomenclature
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hlqA01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hlqA02
4NC6A 4HL4A 1FKMA 4Z6YA 5EJCA 3QYBA 4HLQA 2QQ8A 3HZJA 2QFZA 2G77A 3QWLA 3QYEA
chains in the Genus database with same CATH superfamily
2C96A 2WMBB 3PNYA 3DOGB 1QVRA 2LVNC 1VDDA 5CEIB 3J81S 1VG5A 2LXEA 1EE8A 3ZQJA 2HL7A 2W2HA 2WHBB 4IJFA 1ZP2A 1QZMA 1E9SA 4IBBA 5EQTA 4REZA 5DNYA 3I51A 4JX5A 1P5EB 1PJQA 2EA0A 2UXCM 3LCVB 5FTNA 3L2AA 1FVVB 1OI9B 4TUWA 3WHLA 2WSFF 3SBJA 3GQ5A 2VIIA 2HHHM 4NXNM 4KO8A 3HWSA 2ZPGB 4MGHA 4JX6A 1GL6A 1P3QQ 2X49A 4GITA 3I04M 4CFNB 2J7NA 2C5OB 4JI0M 4OB1B 4RF1A 4LGYA 3HBLA 4P16A 4IJEA 4LJ5A 3IG8A 2R45A 2Y21A 4F7LB 3B89A 4OB2B 1IN4A 1ZAEA 1BU2A 3AOEA 4BCND 3HX3A 1DGFA 2O5RA 3HZJA 1HT2E 2CEAA 2BJWA 3GLFA 3SHGB 4BB9A 3HHZA 3KW6A 2KEBA 1TDZA 4GHAA 3QHRB 4F2LA 2D7GA 2OO9A 1L8QA 2LWXA 1QUSA 3CF0A 3HO8A 4F6UB 3K1JA 2VQEM 3J7AS 1NSFA 2R46A 4JX4A 4YC3B 1D0MA 1XWIA 1NO1A 1V33A 3BOSA 2E5LM 4DR4M 3HU1A 2LNHC 3WVEB 3BG3A 4LFCM 2XFSA 2KA6B 2MGWA 2PJQA 3BBZA 1TH3A 4EC8B 1FNNA 1SXJE 2O25A 2VF7A 2DAIA 4FCVA 4LGMA 2JZ1A 4LG2A 1UNHD 5IT9S 2C6TB 1MU5A 2A5YB 3GQ4A 3JR5A 1L1TA 2CZ0B 1AISB 2JY7A 1T6OA 2QBYB 3NBXX 1IREB 3HY5A 3TN8B 2RGHA 4K0KM 3LVVA 1AHJB 1DO2A 2QCUA 3AJIB 5E6JA 3BXWA 3W68A 4G3OA 3EIEA 2BNKA 4X62M 1URCB 4HNUA 3A42A 4LZZA 4EOMB 4CGYB 2QF7A 3JAMS 4D81A 4OVZB 2WPAB 2Y0QA 2I7PA 4F6WB 1XNRM 4FW9A 2UUBM 1E94E 1N32M 3TPZA 1VYWB 4F7NB 2K47A 4F6SB 2FFJA 2DAGA 1BVSA 2KMGA 1UGRB 4LJ8A 1I4WA 2DWMA 2M60A 1NHGC 5ITTA 1TH4A 3K9PA 3FTDA 1T3TA 3K92A 3U6LA 2Y0TA 3R9XB 5KPZA 3X25B 4LF9M 4EOKB 3O0GD 1QYRA 3VYGB 4II7A 1E9RA 1Z59A 1ENWA 1HJPA 4YOSA 2L09A 2KDLA 3DA1A 2C5NB 4G6ZA 2DHYA 5EXTA 4EC9B 5FTLA 4NXMM 1WGLA 3E46A 3A8MB 2DZLA 3U60B 1HR0M 1OFHA 3A8HB 3GQ3A 2EO2A 3HHXA 2CV2A 2FS1A 4BCFB 4GC5A 4RF0A 4BCPB 4RKUF 2R7GA 4F70B 2GQFA 1VINA 4BBAA 2C9CA 2G9XB 4AKHA 3M7GA 4FX3B 4IMYB 1G59A 2RKOA 4Z6YA 1H1SB 4CRLB 3KOYE 1OIUB 3X28B 1NJFA 2I7NA 2V22B 1IXZA 5I5ZB 2EUFA 2KHHA 4FD2A 1W5TA 3QYEA 5HQ0B 2H5XA 5IHYA 3A46A 2K6BA 2J7OA 3LMMA 4DV2M 2DD5B 2JGZB 4YOOA 1GLNA 2JY5A 3B74A 1Q3CA 3TNIB 1TR8A 2WMAB 1IY2A 2WZJA 3DL1A 3LQ5B 3F92A 1TF0B 3CGWA 1XMQM 2QBYA 3MHVC 1WR1B 3HU2A 1JKWA 2BWBA 1GJTA 1CUKA 5LMNM 2L6OA 4HNVA 5JI3E 2V1CA 2V6ZM 4Q7JA 2KNVA 1QZEA 2MR9A 1NVMA 4I8OA 4DR3M 3W67A 3TW7A 2JY6B 2LVAA 5LQFB 2ZPEB 1HQCA 3MI9B 1TDHA 2ZTCA 1QDRA 1IFYA 2MROB 2C98A 5DYGA 4DR2M 3K2LA 4BY7X 1PRBA 3KSJA 3Q8GA 4BCMD 4GC9A 2RRUA 5LMKB 3DZDA 3TWKA 4DR1M 2CYZB 1L2BA 2CV1A 2IN3A 3LQQA 1PGYA 2CRUA 4F1IA 1WGNA 1GABA 2IW6B 3HKPA 4R7GA 1IN6A 1XXHB 5FTKA 4B3SM 2KXEA 4ZGDB 3HJQA 4UN2B 3OTOM 1TFBA 2KNZA 5EXSA 3T6PA 4ANRA 4DR5M 2LH0A 4MIMA 3RE8A 4B08A 3GPXA 3NDQA 3C3DA 3J2PB 2DKLA 4LJ9A 4AG6A 4OW0A 5KO3A 1DGBA 4B7FA 1NV9A 4BCQD 2YNMD 3FTCA 3C58A 2DWNA 4OVZA 1NJGA 3GRUA 3GLGA 1N78A 1H1QB 3I4VA 4I81A 1GY3B 4L16A 1VQ1A 2N35A 5FTJA 2D0QB 2KNAA 4ROEA 5ICPB 3LW5F 3UMMA 4BLCA 3GLGB 1SXJA 4M0DA 4QNRA 3AFHA 4B7GA 2CCIB 3J7BA 4M0WA 4LJ4A 2QDYB 1MX0A 3FD9A 2Z7JA 1GUXB 1OIPA 2WIPB 1D2NA 5KPTA 4II5B 4OGRB 3T15A 2ZM6M 4EONB 3VDUA 2QGSA 4QNMA 1XMOM 5ITXA 4GHLA 4L15A 2DD4B 1R2ZA 3UZUA 3ZH9B 3KOXE 3VKHA 3EIHA 2WFYB 2J5YA 2LVOC 3GLHE 5ACBA 1C9BA 5FSWA 2R4JA 3QZ9B 2C5XB 3VYHB 4EOQB 2DZNB 4LOCA 1J5EM 1V29B 2ZPFB 1DGHB 3TNWB 1IXSB 2R6FA 3FYCA 3KVWA 4MFEA 3FTEA 2M5ZA 5C18A 5ITQA 3U6MA 3GLIB 1Z5AA 3KP0E 2BJVA 4B3MM 3DTOA 2LHGA 4PT5A 4ELJA 4JI4M 2BS3A 4BCIB 2FOIC 2R65A 1DO0A 4WURA 4CIZA 4LZJA 1KXUA 4R3DA 1JQJC 1EFUB 1WXQA 1Z5BA 4KRCB 1A5TA 2K0BX 3IG5A 1L2DA 2C4GB 3U5ZB 3HB9A 5JI2E 1VDLA 3M03A 3B9PA 2UUEB 5EP3A 4HLQA 1H6UA 1GJSA 5HNBB 5L2WB 4DUYM 3A8GB 3LQRA 3DDQB 1FJGM 4KHPM 1YE9A 2F5NA 4NRWA 1OAIA 2X4AA 2WEVB 4QOSA 4Z8XA 3MK6A 5DQWA 4BBSM 1OKSA 3U5ZA 2F2CA 3QYHB 2APLA 4YOZA 2C5VB 1JR3E 1IN5A 4MB7A 3MY1B 2NQ8C 2VF8A 4XBOA 4PD2A 2DWLA 3TQSA 1PJTA 3D8LA 3LCUA 4MGZE 3GP1A 3QYBA 1VEKA 4AZFA 4CFUB 5ITYA 4EOOB 2CHGA 3A8LB 2XZFA 4LF4M 4FCWA 1C7YA 3A8OB 2EUCA 4M9ZA 2CZ1B 1MN3A 3QYGB 2H1RA 2W99A 4CISA 3KS4A 3I4YA 3U6EA 1H25B 4LF6M 4X66M 3QWLA 4IBEA 4QSHA 4LFBM 2R4EA 2Z4RA 4BBRM 4EOIB 3EOCB 4MGYE 3E9SA 5FLXS 4DV7M 2CV0A 1T43A 4BY1X 1NNUC 2D7EA 1F5QB 2W9ZA 3QHWB 1IY0A 4GMQA 2XH9A 3DFZA 3J27B 4IBJA 4KT0F 4NC6A 1IBMM 5EFQB 1OJLA 8CATA 1GH6B 1GUXA 1NY6A 1QANA 5EXPA 1Z5CA 2YQZA 2HCBA 4KRDB 4YHHM 3RGPA 2WJ9A 1H1RB 3VK8A 1LV7A 3B57A 1H28B 4NL4H 4JI7M 4LF5M 2R18A 2F5OA 3QZ5B 5DYIA 2AHMA 2F5PA 4DR6M 3TNHB 2CP8A 3SMSA 3VDPA 2DAEA 1C1KA 1ORYB 4GEWA 1O9KA 2HKJA 4B3TM 1GVNA 3ZCBB 2PHGA 1QDTA 3SHFA 2LTUA 4JI6M 1TGUA 2X8AA 4ITQA 3POMA 5E26A 3SASA 2W9FA 2CHVA 3GRYA 1G4AE 2R0IA 5GKNA 3HU3A 4IBDA 2G3QA 3KHIA 4CJ6A 1Y8GA 2F5QA 4NRVA 2UZBB 2Q2EB 3MMPA 4JI2M 3LVWA 1OAOC 3ILKA 1H1PB 5LMUM 2F5SA 1ZMUA 3D8BA 5DQVA 3HJSA 3WHKA 4LJAA 3SAVA 1UGPB 3TL4X 4XK8F 4LY6A 2IVXA 1KYIA 2LHCA 3MIAB 4HL4A 2DZOB 3NBIA 3U61A 4G4OA 1HNZM 2CJMB 2JNHA 2OQ4A 4AI6A 3E21A 4I4LA 3PXGA 2EKKA 4DV6M 4XGIA 2ERCA 3PVSA 5HVYB 2G8LA 5F3WA 2PK9B 1N4MA 1D0KA 4GH9A 3U6QA 1TH2A 1YSYA 4X65M 1IBLM 3TE6A 2ZCFB 2X1NB 4NSTB 2FE8A 1AIPC 3CTWB 1G8PA 3HHWA 3SFZA 3UJNA 4DV4M 1DV0A 1AD6A 2L4EA 4Y28F 5HBEB 4RODA 1W98B 4MGIE 2B3TA 1DGGA 2EJSA 3B7QA 4JN6A 2Z3XA 3B7NA 3RFWA 3FKEA 4GKJM 1QMZB 1SXJD 4ZGEB 5CYIB 2Y20A 2BWEA 2R62A 4TTHA 2DNAA 3U61B 1N34M 1N36M 3AOEC 4IBKA 1JOWA 4CFVB 4JI3M 3BLHB 1Q39A 1ZQ9A 3RGFB 4BCQB 2CE7A 1WHCA 3T1HM 3NWLA 4LF8M 2G5GX 1PJSA 4MM3B 5EJCA 5FTMA 1OQYA 2K9DA 4JI1M 2RGOA 2ZPBB 2DVWB 4L6V6 2XSZD 4CFXB 2R44A 4IBGA 4D80A 4DV1M 3A45A 3J80S 3KS8A 1QAQA 2DHRA 1GO5A 5EP1A 3VLFB 4IBFA 3MY5B 1JSUB 2F4VM 1XXHE 1AUAA 3SARA 2QNJA 4JYAM 2PMIB 2CCHB 2LW4A 2OOBA 2QSFX 2UUAM 2XZUA 4BCMB 4EOLB 4OB0B 2QHOB 4FVMA 3X24B 3FUXA 1MJGM 3GLFB 4IIWA 1IY1A 4G4RA 2KRKA 3GLFE 2JXNA 4HEOA 5ITXE 4OR5B 2LVPC 3FRIA 4X64M 1E9HB 1OL1B 4F7SB 1XC8A 5H37D 3L29A 2AHJB 1NV8A 2YFQA 3VK7A 5IDNB 2WSEF 4M9XA 4QHTA 3T38A 2XGNA 4OX9M 3CF6E 1IN8A 3AOGA 2O01F 3MJ5A 3FRHA 1E7PA 4P17A 2WIHB 1IN7A 3DOAA 4G4NA 4LRSA 2CHQA 1IXSA 1UFZA 2BPMB 1ZMWA 3H4CA 4I3ZB 1YLAA 2V1UA 2JZ0A 3KOWE 5BR8M 4QHSA 3BLQB 2MJ5B 4I5SA 3PFIA 3GLGE 2XSZA 2LBCA 1HT1E 3GRRA 1Z6TA 4FCTA 3CF2A 1V92A 1ZMVA 2ZANA 5KQ8A 3U6PA 1K82A 2VQFM 1N33M 2HWJA 1Q02A 3DDPB 1G41A 4CFMB 1QUTA 1LTMA 3K9OA 4S12A 5KQDA 2B9RA 3KFUG 2UZEB 3G33B 4EORB 3U6CA 4PCZA 1R5LA 2XF3A 4Y72B 2QQ8A 1OIZA 4CFUD 3SATA 4L8RC 3FUVA 4IBCA 4CXAB 4DUZM 1XNQM 4OU7A 3U6OA 2DAKA 3A98B 1G3NC 1UM8A 3E4RA 1OIYB 4EOSB 2KW0A 5A2QS 3VKGA 1IM2A 3GLHA 1FKMA 3PNVA 3VFDA 1EIJA 4AKGA 2DXIA 1FINB 2CFOA 2HAKA 4ZGJB 1KSFX 1H26B 1JR3D 5IREB 3EIDB 1JB0F 1NNJA 4NSOB 3SYKA 2KR6A 2ZZDB 3IHPA 2I53A 3K7AM 1WIVA 4KLNA 2D7HA 1OKWB 1XHBA 3GLIA 3GPPA 1VEGA 1JSTB 1XB2B 3HGIA 3I01M 1OFIA 3L26A 3W0FA 2GNOA 3IECA 3M6AA 4GIPA 5L8RF 2ZPIB 3F5XB 1OKVB 1D0LA 4FWGA 4NOOB 3SMPA 3ZC7B 4AG5A 5IZ7D 4DBGB 4RNAA 4OB3B 2QP9X 3WVDB 2XLJA 3X26B 4LCBA 5IDPB 2KRUA 1IBKM 1H27B 1PM5A 1N75A 5ITUA 2WSCF 3L28A 2DPPB 4KODA 2QDJA 1I94M 2JP7A 2P5TA 3K8ZA 2PK2A 3BLRB 1GKIA 3JR4A 4DV3M 2IW8B 3KDSE 2CWBA 3T1YM 3FYDA 3H4MA 1G3IA 1IQPA 1DGHA 1NHWC 2DI0A 3GO8A 3U60A 4AW4A 4ROCA 5ITRA 2YR0A 1PJIA 1OGUB 2OPFA 2QFZA 1J7KA 2C9OA 4LFAM 4YY3M 1VEJA 4G4QA 1UNLD 2BS4A 1VOLA 4R71A 3HHYA 4F7JB 3THGA 2CUZA 1OL2B 2ZAOA 1SXJB 4FM4B 4UN0A 3TWLA 2UU9M 1PJJA 4ZPXA 1Q3BA 1V34A 5DFLA 5KPRA 1WJ7A 3C9PA 2UUCM 2L7IA 3BHVB 3BG9A 2W82A 2C99A 1SG9A 4LJ6A 4D82A 2ZAMA 4PDIA 2L4FA 2DMEA 4EOJB 4M6VA 3TW6A 3Q8XA 3UK6A 1QAMA 2VDBB 4IBIA 4AKIA 3H4JA 1UNGD 2UZLB 4BCNB 1GL7A 3SYLA 3UGJA 3R8FA 4JI5M 4LRTA 4L4UA 1J09A 4B7HA 1K3WA 2BS2A 2Z8YM 4JV5M 4CHTB 3KXEC 3SAUA 2G77A 1OTRA 1SXJC 4JI8M 1O9KB 4BXXX 1R4GA 1R7RA 2QZ4A 1W5SA 2KZUA 2ZBKB 5EXXA 3W0LB 3SAWA 2UXBM 1S3SA 4W5WA 1KFVA 1XO2A 2I40B 2WXVB 3BHTB 4MH0E 1E32A 4PDGA 2C5RA 3DJBA 4BCOB 3RGSA 2LVQD 1ZV1A 3GPYA 3PO3S 4AQYM 3M0EA 5HBJB 3KP1E 4BCKB 3L27A 3L25A 1PKDB 3AKZA 3KOZE 3SC3A 1X37A 4A3VB 4BCGB 2OOAA 2EKFA 3C3EA 5BPVA 4M9SA 2CZ6B 2L7HA 4EIWA 2L2DA 5C1BA 1TD6A 4G6LB 2FH0A 5IF1B 4B3RM 4DV0M 3AL0C 3B7ZA 1JR3A 3QAUA 7CATA 1L1ZA 2UZDB 1IXRC 4EOPB 3U6DA 3KSXA 3TWMA 1R2YA 1HNWM 5EP4A 1H24B 1L2CA 5FGKB 1HQYE 3U6SA 3GPUA 1D3UB 3BG5A 3FUTA 2JA2A 1YUBA 2DWZB 4FWDA 4L78A 1QLBA 1K3XA 3GTMS 1G71A 1RU3A 4LJ7A 2DAMA 2Z4SA 3GLIE 4JXJA 4BCHB 2JUJA 2JWSA 5IWAM 2FNAA 2DXBB 2QPAA 2XEPA 4DV5M 2MH8A 2ZTDA 4MGKE 2KZSA 1R6BX 4FWHA 1HNXM 1UGSB 4BCJB 4GKKM 4NSRA 3QXEB 1TTEA 3GRVA 2XFTA 1NY5A 5HBHB 3GLHB 4DR7M 1QQWA 3AV0A 3FUWA 2UXDM 2JY8A 2DENA 4WP2A 2W96A 3FTFA 4CFWB 4QOZC 3BHUB 2IW9B 3EJ1B 2QENA 1F4IA 2CZ7B 4MFDA 3FUUA 5EP2A 4LF7M 2BKZB 1QAOA 1H4LD 3V76A 2ZPHB 4GRIA 3HHTB 4HNTA 3FE3A 3X20B 5BNJB 4ELLA 1UGQB 1XXHA 2DXCB 3HJ8A 4WW0A 1N77A
chains in the Genus database with same CATH topology
2C96A 3PNYA 1QVRA 1VDDA 3J81S 2LXEA 1EE8A 2HL7A 4IJFA 1QZMA 1E9SA 4IBBA 5EQTA 4REZA 5DNYA 3I51A 4JX5A 2EA0A 2UXCM 5FTNA 3L2AA 4TUWA 3WHLA 3SBJA 3GQ5A 2VIIA 2HHHM 4NXNM 4KO8A 3HWSA 2ZPGB 4MGHA 4JX6A 1GL6A 4GITA 2X49A 2J7NA 4JI0M 4OB1B 4RF1A 4LGYA 3HBLA 4P16A 4IJEA 4LJ5A 3IG8A 2R45A 2Y21A 4OB2B 1IN4A 1ZAEA 3AOEA 1DGFA 2O5RA 3HZJA 1HT2E 2CEAA 2BJWA 3GLFA 3SHGB 4BB9A 3HHZA 3KW6A 2KEBA 1TDZA 4GHAA 2D7GA 1L8QA 2LWXA 3CF0A 3HO8A 3K1JA 2VQEM 3J7AS 1NSFA 2R46A 4JX4A 1XWIA 3BOSA 2E5LM 4DR4M 3HU1A 2LNHC 3WVEB 3BG3A 4LFCM 2XFSA 2KA6B 1TH3A 1FNNA 1SXJE 4FCVA 4LGMA 4LG2A 5IT9S 1MU5A 2A5YB 3GQ4A 3JR5A 1L1TA 2CZ0B 2QBYB 1IREB 2RGHA 4K0KM 3LVVA 1AHJB 1DO2A 2QCUA 3AJIB 5E6JA 4X62M 3EIEA 2BNKA 4HNUA 3A42A 4LZZA 4CGYB 2QF7A 3JAMS 4D81A 4OVZB 2Y0QA 2I7PA 1XNRM 4FW9A 2UUBM 1E94E 1N32M 3TPZA 2K47A 2FFJA 2KMGA 1UGRB 4LJ8A 1I4WA 2DWMA 2M60A 1NHGC 5ITTA 1TH4A 3K92A 3FTDA 1T3TA 3U6LA 3R9XB 2Y0TA 5KPZA 3X25B 4LF9M 1QYRA 3VYGB 4II7A 1E9RA 1Z59A 2L09A 3DA1A 4G6ZA 5EXTA 5FTLA 4NXMM 3A8MB 3A8HB 3U60B 1HR0M 1OFHA 3GQ3A 2EO2A 3HHXA 2CV2A 4GC5A 4RF0A 4BBAA 2C9CA 4AKHA 3M7GA 1G59A 2RKOA 4Z6YA 3KOYE 3X28B 1NJFA 2I7NA 1IXZA 4FD2A 1W5TA 3QYEA 3A46A 4DV2M 2J7OA 3LMMA 2DD5B 1GLNA 1Q3CA 1IY2A 3DL1A 1XMQM 2QBYA 3MHVC 3HU2A 4HNVA 5LMNM 2L6OA 5JI3E 2V1CA 2V6ZM 1NVMA 4I8OA 4DR3M 3TW7A 2ZPEB 1HQCA 1TDHA 5DYGA 2C98A 4DR2M 3K2LA 3KSJA 4GC9A 3DZDA 3TWKA 4DR1M 2CYZB 1L2BA 2CV1A 3LQQA 3HKPA 4R7GA 1IN6A 1XXHB 5FTKA 4B3SM 2KXEA 4ZGDB 3HJQA 3OTOM 4MIMA 5EXSA 4DR5M 2LH0A 3RE8A 4B08A 3GPXA 4LJ9A 3J2PB 4AG6A 5KO3A 4OW0A 1DGBA 4B7FA 2YNMD 3FTCA 3C58A 2DWNA 4OVZA 1NJGA 3GRUA 3GLGA 1N78A 3I4VA 4I81A 4L16A 5FTJA 3UMMA 4BLCA 3GLGB 1SXJA 4M0DA 4QNRA 3AFHA 4B7GA 3J7BA 4M0WA 4LJ4A 2QDYB 1MX0A 3FD9A 2Z7JA 1D2NA 5KPTA 3T15A 2ZM6M 3VDUA 4QNMA 1XMOM 5ITXA 4L15A 2DD4B 1R2ZA 3UZUA 3ZH9B 3KOXE 3VKHA 3EIHA 5FSWA 2R4JA 3QZ9B 3VYHB 2DZNB 4LOCA 1J5EM 1V29B 2ZPFB 1DGHB 1IXSB 3FYCA 3KVWA 4MFEA 3FTEA 2M5ZA 5C18A 5ITQA 3U6MA 3GLIB 1Z5AA 3KP0E 2BJVA 4B3MM 4ELJA 4PT5A 4JI4M 2BS3A 2FOIC 2R65A 1DO0A 4WURA 4LZJA 4R3DA 1JQJC 1WXQA 1Z5BA 3HB9A 3IG5A 1L2DA 3U5ZB 5JI2E 3B9PA 5EP3A 4HLQA 1H6UA 4DUYM 3A8GB 3LQRA 1FJGM 4KHPM 1YE9A 2F5NA 4NRWA 2X4AA 4BBSM 4QOSA 4Z8XA 3MK6A 3U5ZA 3QYHB 1IN5A 4MB7A 2NQ8C 4PD2A 4XBOA 2DWLA 3TQSA 3D8LA 4MGZE 3GP1A 3QYBA 4AZFA 5ITYA 2CHGA 3A8LB 2XZFA 4LF4M 4FCWA 3A8OB 2EUCA 4M9ZA 2CZ1B 3QYGB 2H1RA 4CISA 3KS4A 3I4YA 3U6EA 4LF6M 4X66M 3QWLA 4IBEA 4QSHA 4LFBM 2R4EA 2Z4RA 4BBRM 4MGYE 3E9SA 5FLXS 4DV7M 2CV0A 1NNUC 2D7EA 1IY0A 4GMQA 2XH9A 3DFZA 3J27B 4IBJA 4NC6A 1IBMM 1OJLA 8CATA 1NY6A 1QANA 5EXPA 1Z5CA 2YQZA 2HCBA 4YHHM 3RGPA 2WJ9A 3VK8A 1LV7A 4NL4H 4JI7M 4LF5M 2R18A 2F5OA 3QZ5B 5DYIA 2AHMA 2F5PA 4DR6M 3SMSA 3VDPA 1C1KA 1ORYB 2HKJA 4B3TM 1GVNA 3ZCBB 3SHFA 4JI6M 1TGUA 2X8AA 4ITQA 5E26A 3SASA 2CHVA 3GRYA 1G4AE 5GKNA 3HU3A 4IBDA 3KHIA 2F5QA 4NRVA 2Q2EB 4JI2M 3LVWA 3ILKA 5LMUM 2F5SA 3D8BA 3HJSA 3WHKA 4LJAA 3SAVA 1UGPB 3TL4X 4LY6A 1KYIA 4HL4A 2DZOB 3NBIA 3U61A 4G4OA 1HNZM 2OQ4A 4AI6A 4I4LA 3PXGA 4DV6M 4XGIA 2ERCA 3PVSA 2G8LA 5F3WA 4GH9A 3U6QA 1TH2A 1YSYA 4X65M 1IBLM 3TE6A 2ZCFB 2FE8A 3CTWB 4DV4M 1G8PA 3HHWA 3SFZA 3UJNA 4MGIE 1DGGA 4JN6A 2Z3XA 3RFWA 3FKEA 4GKJM 1SXJD 4ZGEB 2Y20A 2R62A 3U61B 1N34M 1N36M 3AOEC 4IBKA 4JI3M 1Q39A 1ZQ9A 2CE7A 3T1HM 3NWLA 4LF8M 2G5GX 5EJCA 4MM3B 5FTMA 4JI1M 2RGOA 2ZPBB 2DVWB 2XSZD 4IBGA 4D80A 4DV1M 3A45A 3J80S 3KS8A 1QAQA 2DHRA 5EP1A 3VLFB 4IBFA 2F4VM 3SARA 4JYAM 2UUAM 2XZUA 4OB0B 3X24B 4FVMA 3FUXA 3GLFB 4IIWA 1IY1A 4G4RA 2KRKA 5ITXE 4X64M 1XC8A 5H37D 3L29A 2YFQA 3VK7A 4M9XA 4QHTA 3T38A 2XGNA 4OX9M 3CF6E 1IN8A 3AOGA 3MJ5A 1E7PA 1IN7A 3DOAA 4G4NA 4LRSA 2CHQA 3H4CA 2V1UA 5BR8M 3KOWE 4QHSA 4I5SA 3PFIA 2XSZA 1HT1E 3GRRA 1Z6TA 4FCTA 3CF2A 2AHJB 1N33M 2ZANA 5KQ8A 3U6PA 1K82A 2VQFM 1G41A 4S12A 5KQDA 3KFUG 3U6CA 4PCZA 2XF3A 2QQ8A 3SATA 4L8RC 3FUVA 4IBCA 4DUZM 1XNQM 4OU7A 3U6OA 3A98B 1UM8A 3E4RA 2KW0A 5A2QS 3VKGA 1IM2A 3GLHA 1FKMA 3PNVA 3VFDA 4AKGA 2DXIA 2CFOA 4ZGJB 1KSFX 1JR3D 5IREB 1NNJA 4NSOB 3SYKA 2KR6A 2ZZDB 4KLNA 2D7HA 1XHBA 3GLIA 3GPPA 3HGIA 1OFIA 3L26A 3W0FA 3M6AA 2ZPIB 4GIPA 4NOOB 4FWGA 3ZC7B 3SMPA 4AG5A 5IZ7D 4RNAA 4OB3B 2QP9X 3WVDB 2XLJA 3X26B 4LCBA 2KRUA 1IBKM 1PM5A 1N75A 5ITUA 3L28A 2DPPB 4KODA 2QDJA 1I94M 2P5TA 3K8ZA 1GKIA 3JR4A 4DV3M 3KDSE 3T1YM 2D0QB 3FYDA 3H4MA 1G3IA 1IQPA 1DGHA 1NHWC 3GO8A 3U60A 4GHLA 4AW4A 5ITRA 2YR0A 1PJIA 2OPFA 2QFZA 1J7KA 2C9OA 4LFAM 4YY3M 4G4QA 2BS4A 3HHYA 3THGA 2CUZA 2ZAOA 1SXJB 4FM4B 3TWLA 2UU9M 1PJJA 4ZPXA 1Q3BA 5KPRA 2UUCM 2L7IA 3BG9A 2W82A 2C99A 4LJ6A 4PDIA 4D82A 2ZAMA 4M6VA 3TW6A 3Q8XA 3UK6A 1QAMA 4IBIA 4AKIA 1GL7A 3SYLA 3UGJA 3R8FA 4JI5M 4LRTA 4L4UA 1J09A 4B7HA 1K3WA 2BS2A 4JV5M 4CHTB 3KXEC 3SAUA 2G77A 1SXJC 4JI8M 1R7RA 2QZ4A 2ZBKB 1W5SA 2KZUA 5EXXA 3W0LB 3SAWA 2UXBM 1S3SA 4W5WA 1KFVA 4MH0E 1E32A 4PDGA 2C5RA 3RGSA 3GPYA 4AQYM 3M0EA 3KP1E 3L27A 3L25A 3AKZA 3KOZE 3SC3A 1X37A 4A3VB 2CZ6B 5BPVA 4M9SA 2L7HA 4EIWA 5C1BA 4B3RM 4DV0M 3AL0C 1JR3A 3QAUA 7CATA 1L1ZA 1IXRC 3U6DA 3KSXA 3TWMA 1R2YA 1HNWM 5EP4A 1L2CA 1HQYE 3U6SA 3GPUA 3BG5A 3FUTA 2JA2A 1YUBA 2DWZB 4FWDA 4L78A 1QLBA 1K3XA 4LJ7A 2Z4SA 4JXJA 5IWAM 2FNAA 2DXBB 2QPAA 2XEPA 4DV5M 4MGKE 2KZSA 1R6BX 4FWHA 1HNXM 1UGSB 4GKKM 4NSRA 3QXEB 3GRVA 2XFTA 1NY5A 3GLHB 4DR7M 1QQWA 3AV0A 3FUWA 2UXDM 3FTFA 4QOZC 2QENA 2CZ7B 4MFDA 3FUUA 5EP2A 4LF7M 1QAOA 2ZPHB 3HHTB 4HNTA 4GRIA 3X20B 1UGQB 1XXHA 2DXCB 3HJ8A 4WW0A 1N77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC6 A;  4HL4 A;  1FKM A;  4Z6Y A;  5EJC A;  3QYB A;  4HLQ A;  2QQ8 A;  3HZJ A;  2QFZ A;  2G77 A;  3QWL A;  3QYE A; 
#chains in the Genus database with same CATH topology
 2C96 A;  2WMB B;  3PNY A;  3DOG B;  1QVR A;  2LVN C;  1VDD A;  5CEI B;  3J81 S;  1VG5 A;  2LXE A;  1EE8 A;  3ZQJ A;  2HL7 A;  2W2H A;  2WHB B;  4IJF A;  1ZP2 A;  1QZM A;  1E9S A;  4IBB A;  5EQT A;  4REZ A;  5DNY A;  3I51 A;  4JX5 A;  1P5E B;  1PJQ A;  2EA0 A;  2UXC M;  3LCV B;  5FTN A;  3L2A A;  1FVV B;  1OI9 B;  4TUW A;  3WHL A;  2WSF F;  3SBJ A;  3GQ5 A;  2VII A;  2HHH M;  4NXN M;  4KO8 A;  3HWS A;  2ZPG B;  4MGH A;  4JX6 A;  1GL6 A;  1P3Q Q;  2X49 A;  4GIT A;  3I04 M;  4CFN B;  2J7N A;  2C5O B;  4JI0 M;  4OB1 B;  4RF1 A;  4LGY A;  3HBL A;  4P16 A;  4IJE A;  4LJ5 A;  3IG8 A;  2R45 A;  2Y21 A;  4F7L B;  3B89 A;  4OB2 B;  1IN4 A;  1ZAE A;  1BU2 A;  3AOE A;  4BCN D;  3HX3 A;  1DGF A;  2O5R A;  3HZJ A;  1HT2 E;  2CEA A;  2BJW A;  3GLF A;  3SHG B;  4BB9 A;  3HHZ A;  3KW6 A;  2KEB A;  1TDZ A;  4GHA A;  3QHR B;  4F2L A;  2D7G A;  2OO9 A;  1L8Q A;  2LWX A;  1QUS A;  3CF0 A;  3HO8 A;  4F6U B;  3K1J A;  2VQE M;  3J7A S;  1NSF A;  2R46 A;  4JX4 A;  4YC3 B;  1D0M A;  1XWI A;  1NO1 A;  1V33 A;  3BOS A;  2E5L M;  4DR4 M;  3HU1 A;  2LNH C;  3WVE B;  3BG3 A;  4LFC M;  2XFS A;  2KA6 B;  2MGW A;  2PJQ A;  3BBZ A;  1TH3 A;  4EC8 B;  1FNN A;  1SXJ E;  2O25 A;  2VF7 A;  2DAI A;  4FCV A;  4LGM A;  2JZ1 A;  4LG2 A;  1UNH D;  5IT9 S;  2C6T B;  1MU5 A;  2A5Y B;  3GQ4 A;  3JR5 A;  1L1T A;  2CZ0 B;  1AIS B;  2JY7 A;  1T6O A;  2QBY B;  3NBX X;  1IRE B;  3HY5 A;  3TN8 B;  2RGH A;  4K0K M;  3LVV A;  1AHJ B;  1DO2 A;  2QCU A;  3AJI B;  5E6J A;  3BXW A;  3W68 A;  4G3O A;  3EIE A;  2BNK A;  4X62 M;  1URC B;  4HNU A;  3A42 A;  4LZZ A;  4EOM B;  4CGY B;  2QF7 A;  3JAM S;  4D81 A;  4OVZ B;  2WPA B;  2Y0Q A;  2I7P A;  4F6W B;  1XNR M;  4FW9 A;  2UUB M;  1E94 E;  1N32 M;  3TPZ A;  1VYW B;  4F7N B;  2K47 A;  4F6S B;  2FFJ A;  2DAG A;  1BVS A;  2KMG A;  1UGR B;  4LJ8 A;  1I4W A;  2DWM A;  2M60 A;  1NHG C;  5ITT A;  1TH4 A;  3K9P A;  3FTD A;  1T3T A;  3K92 A;  3U6L A;  2Y0T A;  3R9X B;  5KPZ A;  3X25 B;  4LF9 M;  4EOK B;  3O0G D;  1QYR A;  3VYG B;  4II7 A;  1E9R A;  1Z59 A;  1ENW A;  1HJP A;  4YOS A;  2L09 A;  2KDL A;  3DA1 A;  2C5N B;  4G6Z A;  2DHY A;  5EXT A;  4EC9 B;  5FTL A;  4NXM M;  1WGL A;  3E46 A;  3A8M B;  2DZL A;  3U60 B;  1HR0 M;  1OFH A;  3A8H B;  3GQ3 A;  2EO2 A;  3HHX A;  2CV2 A;  2FS1 A;  4BCF B;  4GC5 A;  4RF0 A;  4BCP B;  4RKU F;  2R7G A;  4F70 B;  2GQF A;  1VIN A;  4BBA A;  2C9C A;  2G9X B;  4AKH A;  3M7G A;  4FX3 B;  4IMY B;  1G59 A;  2RKO A;  4Z6Y A;  1H1S B;  4CRL B;  3KOY E;  1OIU B;  3X28 B;  1NJF A;  2I7N A;  2V22 B;  1IXZ A;  5I5Z B;  2EUF A;  2KHH A;  4FD2 A;  1W5T A;  3QYE A;  5HQ0 B;  2H5X A;  5IHY A;  3A46 A;  2K6B A;  2J7O A;  3LMM A;  4DV2 M;  2DD5 B;  2JGZ B;  4YOO A;  1GLN A;  2JY5 A;  3B74 A;  1Q3C A;  3TNI B;  1TR8 A;  2WMA B;  1IY2 A;  2WZJ A;  3DL1 A;  3LQ5 B;  3F92 A;  1TF0 B;  3CGW A;  1XMQ M;  2QBY A;  3MHV C;  1WR1 B;  3HU2 A;  1JKW A;  2BWB A;  1GJT A;  1CUK A;  5LMN M;  2L6O A;  4HNV A;  5JI3 E;  2V1C A;  2V6Z M;  4Q7J A;  2KNV A;  1QZE A;  2MR9 A;  1NVM A;  4I8O A;  4DR3 M;  3W67 A;  3TW7 A;  2JY6 B;  2LVA A;  5LQF B;  2ZPE B;  1HQC A;  3MI9 B;  1TDH A;  2ZTC A;  1QDR A;  1IFY A;  2MRO B;  2C98 A;  5DYG A;  4DR2 M;  3K2L A;  4BY7 X;  1PRB A;  3KSJ A;  3Q8G A;  4BCM D;  4GC9 A;  2RRU A;  5LMK B;  3DZD A;  3TWK A;  4DR1 M;  2CYZ B;  1L2B A;  2CV1 A;  2IN3 A;  3LQQ A;  1PGY A;  2CRU A;  4F1I A;  1WGN A;  1GAB A;  2IW6 B;  3HKP A;  4R7G A;  1IN6 A;  1XXH B;  5FTK A;  4B3S M;  2KXE A;  4ZGD B;  3HJQ A;  4UN2 B;  3OTO M;  1TFB A;  2KNZ A;  5EXS A;  3T6P A;  4ANR A;  4DR5 M;  2LH0 A;  4MIM A;  3RE8 A;  4B08 A;  3GPX A;  3NDQ A;  3C3D A;  3J2P B;  2DKL A;  4LJ9 A;  4AG6 A;  4OW0 A;  5KO3 A;  1DGB A;  4B7F A;  1NV9 A;  4BCQ D;  2YNM D;  3FTC A;  3C58 A;  2DWN A;  4OVZ A;  1NJG A;  3GRU A;  3GLG A;  1N78 A;  1H1Q B;  3I4V A;  4I81 A;  1GY3 B;  4L16 A;  1VQ1 A;  2N35 A;  5FTJ A;  2D0Q B;  2KNA A;  4ROE A;  5ICP B;  3LW5 F;  3UMM A;  4BLC A;  3GLG B;  1SXJ A;  4M0D A;  4QNR A;  3AFH A;  4B7G A;  2CCI B;  3J7B A;  4M0W A;  4LJ4 A;  2QDY B;  1MX0 A;  3FD9 A;  2Z7J A;  1GUX B;  1OIP A;  2WIP B;  1D2N A;  5KPT A;  4II5 B;  4OGR B;  3T15 A;  2ZM6 M;  4EON B;  3VDU A;  2QGS A;  4QNM A;  1XMO M;  5ITX A;  4GHL A;  4L15 A;  2DD4 B;  1R2Z A;  3UZU A;  3ZH9 B;  3KOX E;  3VKH A;  3EIH A;  2WFY B;  2J5Y A;  2LVO C;  3GLH E;  5ACB A;  1C9B A;  5FSW A;  2R4J A;  3QZ9 B;  2C5X B;  3VYH B;  4EOQ B;  2DZN B;  4LOC A;  1J5E M;  1V29 B;  2ZPF B;  1DGH B;  3TNW B;  1IXS B;  2R6F A;  3FYC A;  3KVW A;  4MFE A;  3FTE A;  2M5Z A;  5C18 A;  5ITQ A;  3U6M A;  3GLI B;  1Z5A A;  3KP0 E;  2BJV A;  4B3M M;  3DTO A;  2LHG A;  4PT5 A;  4ELJ A;  4JI4 M;  2BS3 A;  4BCI B;  2FOI C;  2R65 A;  1DO0 A;  4WUR A;  4CIZ A;  4LZJ A;  1KXU A;  4R3D A;  1JQJ C;  1EFU B;  1WXQ A;  1Z5B A;  4KRC B;  1A5T A;  2K0B X;  3IG5 A;  1L2D A;  2C4G B;  3U5Z B;  3HB9 A;  5JI2 E;  1VDL A;  3M03 A;  3B9P A;  2UUE B;  5EP3 A;  4HLQ A;  1H6U A;  1GJS A;  5HNB B;  5L2W B;  4DUY M;  3A8G B;  3LQR A;  3DDQ B;  1FJG M;  4KHP M;  1YE9 A;  2F5N A;  4NRW A;  1OAI A;  2X4A A;  2WEV B;  4QOS A;  4Z8X A;  3MK6 A;  5DQW A;  4BBS M;  1OKS A;  3U5Z A;  2F2C A;  3QYH B;  2APL A;  4YOZ A;  2C5V B;  1JR3 E;  1IN5 A;  4MB7 A;  3MY1 B;  2NQ8 C;  2VF8 A;  4XBO A;  4PD2 A;  2DWL A;  3TQS A;  1PJT A;  3D8L A;  3LCU A;  4MGZ E;  3GP1 A;  3QYB A;  1VEK A;  4AZF A;  4CFU B;  5ITY A;  4EOO B;  2CHG A;  3A8L B;  2XZF A;  4LF4 M;  4FCW A;  1C7Y A;  3A8O B;  2EUC A;  4M9Z A;  2CZ1 B;  1MN3 A;  3QYG B;  2H1R A;  2W99 A;  4CIS A;  3KS4 A;  3I4Y A;  3U6E A;  1H25 B;  4LF6 M;  4X66 M;  3QWL A;  4IBE A;  4QSH A;  4LFB M;  2R4E A;  2Z4R A;  4BBR M;  4EOI B;  3EOC B;  4MGY E;  3E9S A;  5FLX S;  4DV7 M;  2CV0 A;  1T43 A;  4BY1 X;  1NNU C;  2D7E A;  1F5Q B;  2W9Z A;  3QHW B;  1IY0 A;  4GMQ A;  2XH9 A;  3DFZ A;  3J27 B;  4IBJ A;  4KT0 F;  4NC6 A;  1IBM M;  5EFQ B;  1OJL A;  8CAT A;  1GH6 B;  1GUX A;  1NY6 A;  1QAN A;  5EXP A;  1Z5C A;  2YQZ A;  2HCB A;  4KRD B;  4YHH M;  3RGP A;  2WJ9 A;  1H1R B;  3VK8 A;  1LV7 A;  3B57 A;  1H28 B;  4NL4 H;  4JI7 M;  4LF5 M;  2R18 A;  2F5O A;  3QZ5 B;  5DYI A;  2AHM A;  2F5P A;  4DR6 M;  3TNH B;  2CP8 A;  3SMS A;  3VDP A;  2DAE A;  1C1K A;  1ORY B;  4GEW A;  1O9K A;  2HKJ A;  4B3T M;  1GVN A;  3ZCB B;  2PHG A;  1QDT A;  3SHF A;  2LTU A;  4JI6 M;  1TGU A;  2X8A A;  4ITQ A;  3POM A;  5E26 A;  3SAS A;  2W9F A;  2CHV A;  3GRY A;  1G4A E;  2R0I A;  5GKN A;  3HU3 A;  4IBD A;  2G3Q A;  3KHI A;  4CJ6 A;  1Y8G A;  2F5Q A;  4NRV A;  2UZB B;  2Q2E B;  3MMP A;  4JI2 M;  3LVW A;  1OAO C;  3ILK A;  1H1P B;  5LMU M;  2F5S A;  1ZMU A;  3D8B A;  5DQV A;  3HJS A;  3WHK A;  4LJA A;  3SAV A;  1UGP B;  3TL4 X;  4XK8 F;  4LY6 A;  2IVX A;  1KYI A;  2LHC A;  3MIA B;  4HL4 A;  2DZO B;  3NBI A;  3U61 A;  4G4O A;  1HNZ M;  2CJM B;  2JNH A;  2OQ4 A;  4AI6 A;  3E21 A;  4I4L A;  3PXG A;  2EKK A;  4DV6 M;  4XGI A;  2ERC A;  3PVS A;  5HVY B;  2G8L A;  5F3W A;  2PK9 B;  1N4M A;  1D0K A;  4GH9 A;  3U6Q A;  1TH2 A;  1YSY A;  4X65 M;  1IBL M;  3TE6 A;  2ZCF B;  2X1N B;  4NST B;  2FE8 A;  1AIP C;  3CTW B;  1G8P A;  3HHW A;  3SFZ A;  3UJN A;  4DV4 M;  1DV0 A;  1AD6 A;  2L4E A;  4Y28 F;  5HBE B;  4ROD A;  1W98 B;  4MGI E;  2B3T A;  1DGG A;  2EJS A;  3B7Q A;  4JN6 A;  2Z3X A;  3B7N A;  3RFW A;  3FKE A;  4GKJ M;  1QMZ B;  1SXJ D;  4ZGE B;  5CYI B;  2Y20 A;  2BWE A;  2R62 A;  4TTH A;  2DNA A;  3U61 B;  1N34 M;  1N36 M;  3AOE C;  4IBK A;  1JOW A;  4CFV B;  4JI3 M;  3BLH B;  1Q39 A;  1ZQ9 A;  3RGF B;  4BCQ B;  2CE7 A;  1WHC A;  3T1H M;  3NWL A;  4LF8 M;  2G5G X;  1PJS A;  4MM3 B;  5EJC A;  5FTM A;  1OQY A;  2K9D A;  4JI1 M;  2RGO A;  2ZPB B;  2DVW B;  4L6V 6;  2XSZ D;  4CFX B;  2R44 A;  4IBG A;  4D80 A;  4DV1 M;  3A45 A;  3J80 S;  3KS8 A;  1QAQ A;  2DHR A;  1GO5 A;  5EP1 A;  3VLF B;  4IBF A;  3MY5 B;  1JSU B;  2F4V M;  1XXH E;  1AUA A;  3SAR A;  2QNJ A;  4JYA M;  2PMI B;  2CCH B;  2LW4 A;  2OOB A;  2QSF X;  2UUA M;  2XZU A;  4BCM B;  4EOL B;  4OB0 B;  2QHO B;  4FVM A;  3X24 B;  3FUX A;  1MJG M;  3GLF B;  4IIW A;  1IY1 A;  4G4R A;  2KRK A;  3GLF E;  2JXN A;  4HEO A;  5ITX E;  4OR5 B;  2LVP C;  3FRI A;  4X64 M;  1E9H B;  1OL1 B;  4F7S B;  1XC8 A;  5H37 D;  3L29 A;  2AHJ B;  1NV8 A;  2YFQ A;  3VK7 A;  5IDN B;  2WSE F;  4M9X A;  4QHT A;  3T38 A;  2XGN A;  4OX9 M;  3CF6 E;  1IN8 A;  3AOG A;  2O01 F;  3MJ5 A;  3FRH A;  1E7P A;  4P17 A;  2WIH B;  1IN7 A;  3DOA A;  4G4N A;  4LRS A;  2CHQ A;  1IXS A;  1UFZ A;  2BPM B;  1ZMW A;  3H4C A;  4I3Z B;  1YLA A;  2V1U A;  2JZ0 A;  3KOW E;  5BR8 M;  4QHS A;  3BLQ B;  2MJ5 B;  4I5S A;  3PFI A;  3GLG E;  2XSZ A;  2LBC A;  1HT1 E;  3GRR A;  1Z6T A;  4FCT A;  3CF2 A;  1V92 A;  1ZMV A;  2ZAN A;  5KQ8 A;  3U6P A;  1K82 A;  2VQF M;  1N33 M;  2HWJ A;  1Q02 A;  3DDP B;  1G41 A;  4CFM B;  1QUT A;  1LTM A;  3K9O A;  4S12 A;  5KQD A;  2B9R A;  3KFU G;  2UZE B;  3G33 B;  4EOR B;  3U6C A;  4PCZ A;  1R5L A;  2XF3 A;  4Y72 B;  2QQ8 A;  1OIZ A;  4CFU D;  3SAT A;  4L8R C;  3FUV A;  4IBC A;  4CXA B;  4DUZ M;  1XNQ M;  4OU7 A;  3U6O A;  2DAK A;  3A98 B;  1G3N C;  1UM8 A;  3E4R A;  1OIY B;  4EOS B;  2KW0 A;  5A2Q S;  3VKG A;  1IM2 A;  3GLH A;  1FKM A;  3PNV A;  3VFD A;  1EIJ A;  4AKG A;  2DXI A;  1FIN B;  2CFO A;  2HAK A;  4ZGJ B;  1KSF X;  1H26 B;  1JR3 D;  5IRE B;  3EID B;  1JB0 F;  1NNJ A;  4NSO B;  3SYK A;  2KR6 A;  2ZZD B;  3IHP A;  2I53 A;  3K7A M;  1WIV A;  4KLN A;  2D7H A;  1OKW B;  1XHB A;  3GLI A;  3GPP A;  1VEG A;  1JST B;  1XB2 B;  3HGI A;  3I01 M;  1OFI A;  3L26 A;  3W0F A;  2GNO A;  3IEC A;  3M6A A;  4GIP A;  5L8R F;  2ZPI B;  3F5X B;  1OKV B;  1D0L A;  4FWG A;  4NOO B;  3SMP A;  3ZC7 B;  4AG5 A;  5IZ7 D;  4DBG B;  4RNA A;  4OB3 B;  2QP9 X;  3WVD B;  2XLJ A;  3X26 B;  4LCB A;  5IDP B;  2KRU A;  1IBK M;  1H27 B;  1PM5 A;  1N75 A;  5ITU A;  2WSC F;  3L28 A;  2DPP B;  4KOD A;  2QDJ A;  1I94 M;  2JP7 A;  2P5T A;  3K8Z A;  2PK2 A;  3BLR B;  1GKI A;  3JR4 A;  4DV3 M;  2IW8 B;  3KDS E;  2CWB A;  3T1Y M;  3FYD A;  3H4M A;  1G3I A;  1IQP A;  1DGH A;  1NHW C;  2DI0 A;  3GO8 A;  3U60 A;  4AW4 A;  4ROC A;  5ITR A;  2YR0 A;  1PJI A;  1OGU B;  2OPF A;  2QFZ A;  1J7K A;  2C9O A;  4LFA M;  4YY3 M;  1VEJ A;  4G4Q A;  1UNL D;  2BS4 A;  1VOL A;  4R71 A;  3HHY A;  4F7J B;  3THG A;  2CUZ A;  1OL2 B;  2ZAO A;  1SXJ B;  4FM4 B;  4UN0 A;  3TWL A;  2UU9 M;  1PJJ A;  4ZPX A;  1Q3B A;  1V34 A;  5DFL A;  5KPR A;  1WJ7 A;  3C9P A;  2UUC M;  2L7I A;  3BHV B;  3BG9 A;  2W82 A;  2C99 A;  1SG9 A;  4LJ6 A;  4D82 A;  2ZAM A;  4PDI A;  2L4F A;  2DME A;  4EOJ B;  4M6V A;  3TW6 A;  3Q8X A;  3UK6 A;  1QAM A;  2VDB B;  4IBI A;  4AKI A;  3H4J A;  1UNG D;  2UZL B;  4BCN B;  1GL7 A;  3SYL A;  3UGJ A;  3R8F A;  4JI5 M;  4LRT A;  4L4U A;  1J09 A;  4B7H A;  1K3W A;  2BS2 A;  2Z8Y M;  4JV5 M;  4CHT B;  3KXE C;  3SAU A;  2G77 A;  1OTR A;  1SXJ C;  4JI8 M;  1O9K B;  4BXX X;  1R4G A;  1R7R A;  2QZ4 A;  1W5S A;  2KZU A;  2ZBK B;  5EXX A;  3W0L B;  3SAW A;  2UXB M;  1S3S A;  4W5W A;  1KFV A;  1XO2 A;  2I40 B;  2WXV B;  3BHT B;  4MH0 E;  1E32 A;  4PDG A;  2C5R A;  3DJB A;  4BCO B;  3RGS A;  2LVQ D;  1ZV1 A;  3GPY A;  3PO3 S;  4AQY M;  3M0E A;  5HBJ B;  3KP1 E;  4BCK B;  3L27 A;  3L25 A;  1PKD B;  3AKZ A;  3KOZ E;  3SC3 A;  1X37 A;  4A3V B;  4BCG B;  2OOA A;  2EKF A;  3C3E A;  5BPV A;  4M9S A;  2CZ6 B;  2L7H A;  4EIW A;  2L2D A;  5C1B A;  1TD6 A;  4G6L B;  2FH0 A;  5IF1 B;  4B3R M;  4DV0 M;  3AL0 C;  3B7Z A;  1JR3 A;  3QAU A;  7CAT A;  1L1Z A;  2UZD B;  1IXR C;  4EOP B;  3U6D A;  3KSX A;  3TWM A;  1R2Y A;  1HNW M;  5EP4 A;  1H24 B;  1L2C A;  5FGK B;  1HQY E;  3U6S A;  3GPU A;  1D3U B;  3BG5 A;  3FUT A;  2JA2 A;  1YUB A;  2DWZ B;  4FWD A;  4L78 A;  1QLB A;  1K3X A;  3GTM S;  1G71 A;  1RU3 A;  4LJ7 A;  2DAM A;  2Z4S A;  3GLI E;  4JXJ A;  4BCH B;  2JUJ A;  2JWS A;  5IWA M;  2FNA A;  2DXB B;  2QPA A;  2XEP A;  4DV5 M;  2MH8 A;  2ZTD A;  4MGK E;  2KZS A;  1R6B X;  4FWH A;  1HNX M;  1UGS B;  4BCJ B;  4GKK M;  4NSR A;  3QXE B;  1TTE A;  3GRV A;  2XFT A;  1NY5 A;  5HBH B;  3GLH B;  4DR7 M;  1QQW A;  3AV0 A;  3FUW A;  2UXD M;  2JY8 A;  2DEN A;  4WP2 A;  2W96 A;  3FTF A;  4CFW B;  4QOZ C;  3BHU B;  2IW9 B;  3EJ1 B;  2QEN A;  1F4I A;  2CZ7 B;  4MFD A;  3FUU A;  5EP2 A;  4LF7 M;  2BKZ B;  1QAO A;  1H4L D;  3V76 A;  2ZPH B;  4GRI A;  3HHT B;  4HNT A;  3FE3 A;  3X20 B;  5BNJ B;  4ELL A;  1UGQ B;  1XXH A;  2DXC B;  3HJ8 A;  4WW0 A;  1N77 A; 
#chains in the Genus database with same CATH homology
 2C96 A;  3PNY A;  1QVR A;  1VDD A;  3J81 S;  2LXE A;  1EE8 A;  2HL7 A;  4IJF A;  1QZM A;  1E9S A;  4IBB A;  5EQT A;  4REZ A;  5DNY A;  3I51 A;  4JX5 A;  2EA0 A;  2UXC M;  5FTN A;  3L2A A;  4TUW A;  3WHL A;  3SBJ A;  3GQ5 A;  2VII A;  2HHH M;  4NXN M;  4KO8 A;  3HWS A;  2ZPG B;  4MGH A;  4JX6 A;  1GL6 A;  4GIT A;  2X49 A;  2J7N A;  4JI0 M;  4OB1 B;  4RF1 A;  4LGY A;  3HBL A;  4P16 A;  4IJE A;  4LJ5 A;  3IG8 A;  2R45 A;  2Y21 A;  4OB2 B;  1IN4 A;  1ZAE A;  3AOE A;  1DGF A;  2O5R A;  3HZJ A;  1HT2 E;  2CEA A;  2BJW A;  3GLF A;  3SHG B;  4BB9 A;  3HHZ A;  3KW6 A;  2KEB A;  1TDZ A;  4GHA A;  2D7G A;  1L8Q A;  2LWX A;  3CF0 A;  3HO8 A;  3K1J A;  2VQE M;  3J7A S;  1NSF A;  2R46 A;  4JX4 A;  1XWI A;  3BOS A;  2E5L M;  4DR4 M;  3HU1 A;  2LNH C;  3WVE B;  3BG3 A;  4LFC M;  2XFS A;  2KA6 B;  1TH3 A;  1FNN A;  1SXJ E;  4FCV A;  4LGM A;  4LG2 A;  5IT9 S;  1MU5 A;  2A5Y B;  3GQ4 A;  3JR5 A;  1L1T A;  2CZ0 B;  2QBY B;  1IRE B;  2RGH A;  4K0K M;  3LVV A;  1AHJ B;  1DO2 A;  2QCU A;  3AJI B;  5E6J A;  4X62 M;  3EIE A;  2BNK A;  4HNU A;  3A42 A;  4LZZ A;  4CGY B;  2QF7 A;  3JAM S;  4D81 A;  4OVZ B;  2Y0Q A;  2I7P A;  1XNR M;  4FW9 A;  2UUB M;  1E94 E;  1N32 M;  3TPZ A;  2K47 A;  2FFJ A;  2KMG A;  1UGR B;  4LJ8 A;  1I4W A;  2DWM A;  2M60 A;  1NHG C;  5ITT A;  1TH4 A;  3K92 A;  3FTD A;  1T3T A;  3U6L A;  3R9X B;  2Y0T A;  5KPZ A;  3X25 B;  4LF9 M;  1QYR A;  3VYG B;  4II7 A;  1E9R A;  1Z59 A;  2L09 A;  3DA1 A;  4G6Z A;  5EXT A;  5FTL A;  4NXM M;  3A8M B;  3A8H B;  3U60 B;  1HR0 M;  1OFH A;  3GQ3 A;  2EO2 A;  3HHX A;  2CV2 A;  4GC5 A;  4RF0 A;  4BBA A;  2C9C A;  4AKH A;  3M7G A;  1G59 A;  2RKO A;  4Z6Y A;  3KOY E;  3X28 B;  1NJF A;  2I7N A;  1IXZ A;  4FD2 A;  1W5T A;  3QYE A;  3A46 A;  4DV2 M;  2J7O A;  3LMM A;  2DD5 B;  1GLN A;  1Q3C A;  1IY2 A;  3DL1 A;  1XMQ M;  2QBY A;  3MHV C;  3HU2 A;  4HNV A;  5LMN M;  2L6O A;  5JI3 E;  2V1C A;  2V6Z M;  1NVM A;  4I8O A;  4DR3 M;  3TW7 A;  2ZPE B;  1HQC A;  1TDH A;  5DYG A;  2C98 A;  4DR2 M;  3K2L A;  3KSJ A;  4GC9 A;  3DZD A;  3TWK A;  4DR1 M;  2CYZ B;  1L2B A;  2CV1 A;  3LQQ A;  3HKP A;  4R7G A;  1IN6 A;  1XXH B;  5FTK A;  4B3S M;  2KXE A;  4ZGD B;  3HJQ A;  3OTO M;  4MIM A;  5EXS A;  4DR5 M;  2LH0 A;  3RE8 A;  4B08 A;  3GPX A;  4LJ9 A;  3J2P B;  4AG6 A;  5KO3 A;  4OW0 A;  1DGB A;  4B7F A;  2YNM D;  3FTC A;  3C58 A;  2DWN A;  4OVZ A;  1NJG A;  3GRU A;  3GLG A;  1N78 A;  3I4V A;  4I81 A;  4L16 A;  5FTJ A;  3UMM A;  4BLC A;  3GLG B;  1SXJ A;  4M0D A;  4QNR A;  3AFH A;  4B7G A;  3J7B A;  4M0W A;  4LJ4 A;  2QDY B;  1MX0 A;  3FD9 A;  2Z7J A;  1D2N A;  5KPT A;  3T15 A;  2ZM6 M;  3VDU A;  4QNM A;  1XMO M;  5ITX A;  4L15 A;  2DD4 B;  1R2Z A;  3UZU A;  3ZH9 B;  3KOX E;  3VKH A;  3EIH A;  5FSW A;  2R4J A;  3QZ9 B;  3VYH B;  2DZN B;  4LOC A;  1J5E M;  1V29 B;  2ZPF B;  1DGH B;  1IXS B;  3FYC A;  3KVW A;  4MFE A;  3FTE A;  2M5Z A;  5C18 A;  5ITQ A;  3U6M A;  3GLI B;  1Z5A A;  3KP0 E;  2BJV A;  4B3M M;  4ELJ A;  4PT5 A;  4JI4 M;  2BS3 A;  2FOI C;  2R65 A;  1DO0 A;  4WUR A;  4LZJ A;  4R3D A;  1JQJ C;  1WXQ A;  1Z5B A;  3HB9 A;  3IG5 A;  1L2D A;  3U5Z B;  5JI2 E;  3B9P A;  5EP3 A;  4HLQ A;  1H6U A;  4DUY M;  3A8G B;  3LQR A;  1FJG M;  4KHP M;  1YE9 A;  2F5N A;  4NRW A;  2X4A A;  4BBS M;  4QOS A;  4Z8X A;  3MK6 A;  3U5Z A;  3QYH B;  1IN5 A;  4MB7 A;  2NQ8 C;  4PD2 A;  4XBO A;  2DWL A;  3TQS A;  3D8L A;  4MGZ E;  3GP1 A;  3QYB A;  4AZF A;  5ITY A;  2CHG A;  3A8L B;  2XZF A;  4LF4 M;  4FCW A;  3A8O B;  2EUC A;  4M9Z A;  2CZ1 B;  3QYG B;  2H1R A;  4CIS A;  3KS4 A;  3I4Y A;  3U6E A;  4LF6 M;  4X66 M;  3QWL A;  4IBE A;  4QSH A;  4LFB M;  2R4E A;  2Z4R A;  4BBR M;  4MGY E;  3E9S A;  5FLX S;  4DV7 M;  2CV0 A;  1NNU C;  2D7E A;  1IY0 A;  4GMQ A;  2XH9 A;  3DFZ A;  3J27 B;  4IBJ A;  4NC6 A;  1IBM M;  1OJL A;  8CAT A;  1NY6 A;  1QAN A;  5EXP A;  1Z5C A;  2YQZ A;  2HCB A;  4YHH M;  3RGP A;  2WJ9 A;  3VK8 A;  1LV7 A;  4NL4 H;  4JI7 M;  4LF5 M;  2R18 A;  2F5O A;  3QZ5 B;  5DYI A;  2AHM A;  2F5P A;  4DR6 M;  3SMS A;  3VDP A;  1C1K A;  1ORY B;  2HKJ A;  4B3T M;  1GVN A;  3ZCB B;  3SHF A;  4JI6 M;  1TGU A;  2X8A A;  4ITQ A;  5E26 A;  3SAS A;  2CHV A;  3GRY A;  1G4A E;  5GKN A;  3HU3 A;  4IBD A;  3KHI A;  2F5Q A;  4NRV A;  2Q2E B;  4JI2 M;  3LVW A;  3ILK A;  5LMU M;  2F5S A;  3D8B A;  3HJS A;  3WHK A;  4LJA A;  3SAV A;  1UGP B;  3TL4 X;  4LY6 A;  1KYI A;  4HL4 A;  2DZO B;  3NBI A;  3U61 A;  4G4O A;  1HNZ M;  2OQ4 A;  4AI6 A;  4I4L A;  3PXG A;  4DV6 M;  4XGI A;  2ERC A;  3PVS A;  2G8L A;  5F3W A;  4GH9 A;  3U6Q A;  1TH2 A;  1YSY A;  4X65 M;  1IBL M;  3TE6 A;  2ZCF B;  2FE8 A;  3CTW B;  4DV4 M;  1G8P A;  3HHW A;  3SFZ A;  3UJN A;  4MGI E;  1DGG A;  4JN6 A;  2Z3X A;  3RFW A;  3FKE A;  4GKJ M;  1SXJ D;  4ZGE B;  2Y20 A;  2R62 A;  3U61 B;  1N34 M;  1N36 M;  3AOE C;  4IBK A;  4JI3 M;  1Q39 A;  1ZQ9 A;  2CE7 A;  3T1H M;  3NWL A;  4LF8 M;  2G5G X;  5EJC A;  4MM3 B;  5FTM A;  4JI1 M;  2RGO A;  2ZPB B;  2DVW B;  2XSZ D;  4IBG A;  4D80 A;  4DV1 M;  3A45 A;  3J80 S;  3KS8 A;  1QAQ A;  2DHR A;  5EP1 A;  3VLF B;  4IBF A;  2F4V M;  3SAR A;  4JYA M;  2UUA M;  2XZU A;  4OB0 B;  3X24 B;  4FVM A;  3FUX A;  3GLF B;  4IIW A;  1IY1 A;  4G4R A;  2KRK A;  5ITX E;  4X64 M;  1XC8 A;  5H37 D;  3L29 A;  2YFQ A;  3VK7 A;  4M9X A;  4QHT A;  3T38 A;  2XGN A;  4OX9 M;  3CF6 E;  1IN8 A;  3AOG A;  3MJ5 A;  1E7P A;  1IN7 A;  3DOA A;  4G4N A;  4LRS A;  2CHQ A;  3H4C A;  2V1U A;  5BR8 M;  3KOW E;  4QHS A;  4I5S A;  3PFI A;  2XSZ A;  1HT1 E;  3GRR A;  1Z6T A;  4FCT A;  3CF2 A;  2AHJ B;  1N33 M;  2ZAN A;  5KQ8 A;  3U6P A;  1K82 A;  2VQF M;  1G41 A;  4S12 A;  5KQD A;  3KFU G;  3U6C A;  4PCZ A;  2XF3 A;  2QQ8 A;  3SAT A;  4L8R C;  3FUV A;  4IBC A;  4DUZ M;  1XNQ M;  4OU7 A;  3U6O A;  3A98 B;  1UM8 A;  3E4R A;  2KW0 A;  5A2Q S;  3VKG A;  1IM2 A;  3GLH A;  1FKM A;  3PNV A;  3VFD A;  4AKG A;  2DXI A;  2CFO A;  4ZGJ B;  1KSF X;  1JR3 D;  5IRE B;  1NNJ A;  4NSO B;  3SYK A;  2KR6 A;  2ZZD B;  4KLN A;  2D7H A;  1XHB A;  3GLI A;  3GPP A;  3HGI A;  1OFI A;  3L26 A;  3W0F A;  3M6A A;  2ZPI B;  4GIP A;  4NOO B;  4FWG A;  3ZC7 B;  3SMP A;  4AG5 A;  5IZ7 D;  4RNA A;  4OB3 B;  2QP9 X;  3WVD B;  2XLJ A;  3X26 B;  4LCB A;  2KRU A;  1IBK M;  1PM5 A;  1N75 A;  5ITU A;  3L28 A;  2DPP B;  4KOD A;  2QDJ A;  1I94 M;  2P5T A;  3K8Z A;  1GKI A;  3JR4 A;  4DV3 M;  3KDS E;  3T1Y M;  2D0Q B;  3FYD A;  3H4M A;  1G3I A;  1IQP A;  1DGH A;  1NHW C;  3GO8 A;  3U60 A;  4GHL A;  4AW4 A;  5ITR A;  2YR0 A;  1PJI A;  2OPF A;  2QFZ A;  1J7K A;  2C9O A;  4LFA M;  4YY3 M;  4G4Q A;  2BS4 A;  3HHY A;  3THG A;  2CUZ A;  2ZAO A;  1SXJ B;  4FM4 B;  3TWL A;  2UU9 M;  1PJJ A;  4ZPX A;  1Q3B A;  5KPR A;  2UUC M;  2L7I A;  3BG9 A;  2W82 A;  2C99 A;  4LJ6 A;  4PDI A;  4D82 A;  2ZAM A;  4M6V A;  3TW6 A;  3Q8X A;  3UK6 A;  1QAM A;  4IBI A;  4AKI A;  1GL7 A;  3SYL A;  3UGJ A;  3R8F A;  4JI5 M;  4LRT A;  4L4U A;  1J09 A;  4B7H A;  1K3W A;  2BS2 A;  4JV5 M;  4CHT B;  3KXE C;  3SAU A;  2G77 A;  1SXJ C;  4JI8 M;  1R7R A;  2QZ4 A;  2ZBK B;  1W5S A;  2KZU A;  5EXX A;  3W0L B;  3SAW A;  2UXB M;  1S3S A;  4W5W A;  1KFV A;  4MH0 E;  1E32 A;  4PDG A;  2C5R A;  3RGS A;  3GPY A;  4AQY M;  3M0E A;  3KP1 E;  3L27 A;  3L25 A;  3AKZ A;  3KOZ E;  3SC3 A;  1X37 A;  4A3V B;  2CZ6 B;  5BPV A;  4M9S A;  2L7H A;  4EIW A;  5C1B A;  4B3R M;  4DV0 M;  3AL0 C;  1JR3 A;  3QAU A;  7CAT A;  1L1Z A;  1IXR C;  3U6D A;  3KSX A;  3TWM A;  1R2Y A;  1HNW M;  5EP4 A;  1L2C A;  1HQY E;  3U6S A;  3GPU A;  3BG5 A;  3FUT A;  2JA2 A;  1YUB A;  2DWZ B;  4FWD A;  4L78 A;  1QLB A;  1K3X A;  4LJ7 A;  2Z4S A;  4JXJ A;  5IWA M;  2FNA A;  2DXB B;  2QPA A;  2XEP A;  4DV5 M;  4MGK E;  2KZS A;  1R6B X;  4FWH A;  1HNX M;  1UGS B;  4GKK M;  4NSR A;  3QXE B;  3GRV A;  2XFT A;  1NY5 A;  3GLH B;  4DR7 M;  1QQW A;  3AV0 A;  3FUW A;  2UXD M;  3FTF A;  4QOZ C;  2QEN A;  2CZ7 B;  4MFD A;  3FUU A;  5EP2 A;  4LF7 M;  1QAO A;  2ZPH B;  3HHT B;  4HNT A;  4GRI A;  3X20 B;  1UGQ B;  1XXH A;  2DXC B;  3HJ8 A;  4WW0 A;  1N77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...