2G77A

Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
388
structure length
331
Chain Sequence
b'QELNSIIQRISKFDNILKDKTIINQQDLRQISWNGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQRKRKEYRDSLKHTFSDQHSRDIPTWHQIEIDIPRTNPHIPLYQFKSVQNSLQRILYLWAIRHPASGYVQGINDLVTPFFETFLTEYLPPSQIDDVKIKDPSTYMVDEQITDLEADTFWCLTKLLEQITDNYIHGQPGILRQVKNLSQLVKRIDADLYNHFQNEHVEFIQFAFRWMNCLLMREFQMGTVIRMWDTYLSETSQQSSLNEFHVFVCAAFLIKWSDQLMEMDFQETITFLQNPPTKDWTETDIEMLLSEAFIWQSLYKDAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase-activating protein GYP1
publication title TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase activator/protein transport
total genus 135
structure length 331
sequence length 388
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2g77A02
4Z6YA 2QFZA 3QYBA 2QQ8A 3QWLA 3QYEA 4HLQA 1FKMA 4HL4A 3HZJA 4NC6A 5EJCA 2G77A
chains in the Genus database with same CATH superfamily
4II5B 4MFEA 3A8OB 4BCMD 1G3NC 1AD6A 2CZ1B 1H1PB 2CZ0B 3F5XB 4CFVB 4BY1X 2X1NB 1O9KB 4FM4B 1H24B 2QFZA 2UZDB 1H27B 4CFMB 2QF7A 2DMEA 2QDJA 4YOZA 2WMAB 4Z6YA 5IDNB 2WIPB 2D0QB 4IMYB 1H1QB 4BCND 1UNGD 4BBSM 1UGPB 3DTOA 2V22B 4UN0A 4AI6A 3DDPB 3B57A 5ICPB 1OL2B 2W9ZA 4RODA 3BLRB 3G33B 3TNWB 1UGRB 3VYGB 2C6TB 4BCMB 4OGRB 2UZLB 2DXCB 4HL4A 3QYHB 1OIUB 4EONB 4AKIA 4LOCA 4NSTB 4BBRM 1URCB 4JX5A 2WHBB 3H4CA 4EOKB 4CFXB 3DDQB 2ZZDB 4HNTA 2UUEB 4OB1B 4CFWB 2WEVB 2G9XB 3K7AM 4F6SB 2BS2A 1JSTB 4HNVA 1GH6B 2ZCFB 1FKMA 4F6UB 5ACBA 2IW6B 1OI9B 3QWLA 2C5OB 4EOOB 2WXVB 4CXAB 2I40B 2IVXA 4CFUD 4EOSB 1TD6A 5IF1B 4BCQD 1GUXA 2LW4A 3BLHB 1D3UB 3VKGA 4ELLA 2ZPHB 4BY7X 1V29B 3WVDB 3HB9A 3DOGB 3X25B 4YOOA 2C5VB 5LQFB 2PMIB 4MFDA 4MIMA 3HZJA 2WMBB 2EUFA 2C5NB 1QLBA 2WFYB 4KRCB 3O0GD 4JX6A 4BCJB 4ZGEB 4F6WB 2F2CA 5CYIB 1OKWB 4CFUB 5DQVA 5L2WB 4BCFB 1IREB 3X26B 1UNHD 2DXBB 2KMGA 2R7GA 1GY3B 5FGKB 2ZPEB 1W98B 5IHYA 3A8GB 1FVVB 3QHWB 2KR6A 1H1RB 3X20B 2QQ8A 3TNIB 3QYBA 3A8HB 3X24B 3QYGB 1XO2A 5CEIB 4OB3B 1OGUB 4F7JB 2ZPGB 3BG3A 1JSUB 3EOCB 1JKWA 2JGZB 3QYEA 3BHTB 4OB2B 3PO3S 2PK9B 2W99A 1ZP2A 3MY1B 4BCNB 3QHRB 4OR5B 4HNUA 1FINB 4EOMB 3EIDB 2QDYB 1H1SB 5HBEB 5EJCA 1OL1B 3TW7A 3DL1A 2PHGA 2CZ7B 1GUXB 1E9HB 4BCPB 2UZEB 1C9BA 3VKHA 4ROEA 3EJ1B 4F7LB 5HNBB 2W9FA 1VYWB 1JOWA 2CZ6B 3MIAB 3X28B 4CRLB 1VINA 4EOPB 4NC6A 2WPAB 4BCKB 2BS4A 4OB0B 2UZBB 3GTMS 1N4MA 5I5ZB 1OIYB 4EOLB 1VOLA 2WIHB 3MY5B 4YOSA 4BXXX 4BCIB 1UGSB 3RGFB 3NDQA 2DD5B 1F5QB 1QMZB 4YC3B 4KRDB 4QSHA 4BCQB 4M6VA 3TN8B 4BCGB 4F70B 2G77A 1H4LD 5BNJB 3WVEB 4JX4A 4G6LB 2C4GB 1ENWA 2C5XB 2CCHB 3HO8A 1O9KA 5HVYB 4F7SB 3TNHB 5HBJB 4EOIB 3VYHB 4EORB 2BS3A 4EC9B 4BCHB 2ZPFB 2B9RA 4Y72B 3TW6A 2BPMB 3LQ5B 1OKVB 5IDPB 2ZPIB 4CFNB 2CYZB 1UNLD 4HLQA 1AISB 3BG5A 2PJQA 3HBLA 3POMA 1P5EB 1E7PA 2QGSA 3A8MB 1H26B 3DJBA 1PKDB 4I3ZB 1H28B 3QZ5B 3HHTB 3QZ9B 4AKHA 2W2HA 4FX3B 5DQWA 3MI9B 1TFBA 2IN3A 3BLQB 2CCIB 2I53A 2ZPBB 4BCOB 5HBHB 2CJMB 4ZGDB 2IW9B 2IW8B 3KHIA 1UGQB 4EOQB 3BHUB 4ROCA 5HQ0B 4AKGA 1BU2A 2PK2A 1AHJB 4ELJA 4F7NB 2WJ9A 3BHVB 2DPPB 1H25B 2BKZB 2W96A 4EC8B 3M03A 4EOJB 5EFQB 4ZGJB 2AHJB 3BG9A 1KXUA 4TTHA 2DD4B 3A8LB 3QXEB 5LMKB
chains in the Genus database with same CATH topology
4MFEA 4OB2B 2ZPHB 3A8OB 2ZPIB 1V29B 3WVDB 4HNUA 2CYZB 2CZ1B 3HB9A 2CZ0B 2QDYB 3X25B 4HLQA 5EJCA 4FM4B 2QFZA 4MFDA 3BG5A 2QF7A 4MIMA 3HZJA 3DL1A 3TW7A 2QDJA 3HBLA 2CZ7B 4Z6YA 2D0QB 3VKHA 1QLBA 1E7PA 4JX6A 3A8MB 4BBSM 4ZGEB 1UGPB 2CZ6B 3X28B 3QZ5B 4AI6A 3HHTB 4NC6A 1IREB 3X26B 3QZ9B 4AKHA 2BS4A 2DXBB 4OB0B 2KMGA 1UGRB 3VYGB 2DXCB 2ZPBB 4HL4A 3QYHB 2ZPEB 4ZGDB 4AKIA 1UGSB 4LOCA 4BBRM 4JX5A 2DD5B 3KHIA 3A8GB 1UGQB 3H4CA 2KR6A 2ZZDB 4QSHA 4HNTA 4OB1B 4M6VA 3X20B 4AKGA 2QQ8A 2BS2A 2G77A 1AHJB 3QYBA 3A8HB 4HNVA 2ZCFB 1FKMA 3WVEB 3X24B 4ELJA 4JX4A 3QYGB 2WJ9A 3QWLA 4OB3B 2DPPB 3HO8A 2ZPGB 3BG3A 3VYHB 4ZGJB 2BS3A 2AHJB 3BG9A 2DD4B 2ZPFB 3A8LB 3QYEA 3QXEB 3TW6A 3VKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6Y A;  2QFZ A;  3QYB A;  2QQ8 A;  3QWL A;  3QYE A;  4HLQ A;  1FKM A;  4HL4 A;  3HZJ A;  4NC6 A;  5EJC A;  2G77 A; 
#chains in the Genus database with same CATH topology
 4II5 B;  4MFE A;  3A8O B;  4BCM D;  1G3N C;  1AD6 A;  2CZ1 B;  1H1P B;  2CZ0 B;  3F5X B;  4CFV B;  4BY1 X;  2X1N B;  1O9K B;  4FM4 B;  1H24 B;  2QFZ A;  2UZD B;  1H27 B;  4CFM B;  2QF7 A;  2DME A;  2QDJ A;  4YOZ A;  2WMA B;  4Z6Y A;  5IDN B;  2WIP B;  2D0Q B;  4IMY B;  1H1Q B;  4BCN D;  1UNG D;  4BBS M;  1UGP B;  3DTO A;  2V22 B;  4UN0 A;  4AI6 A;  3DDP B;  3B57 A;  5ICP B;  1OL2 B;  2W9Z A;  4ROD A;  3BLR B;  3G33 B;  3TNW B;  1UGR B;  3VYG B;  2C6T B;  4BCM B;  4OGR B;  2UZL B;  2DXC B;  4HL4 A;  3QYH B;  1OIU B;  4EON B;  4AKI A;  4LOC A;  4NST B;  4BBR M;  1URC B;  4JX5 A;  2WHB B;  3H4C A;  4EOK B;  4CFX B;  3DDQ B;  2ZZD B;  4HNT A;  2UUE B;  4OB1 B;  4CFW B;  2WEV B;  2G9X B;  3K7A M;  4F6S B;  2BS2 A;  1JST B;  4HNV A;  1GH6 B;  2ZCF B;  1FKM A;  4F6U B;  5ACB A;  2IW6 B;  1OI9 B;  3QWL A;  2C5O B;  4EOO B;  2WXV B;  4CXA B;  2I40 B;  2IVX A;  4CFU D;  4EOS B;  1TD6 A;  5IF1 B;  4BCQ D;  1GUX A;  2LW4 A;  3BLH B;  1D3U B;  3VKG A;  4ELL A;  2ZPH B;  4BY7 X;  1V29 B;  3WVD B;  3HB9 A;  3DOG B;  3X25 B;  4YOO A;  2C5V B;  5LQF B;  2PMI B;  4MFD A;  4MIM A;  3HZJ A;  2WMB B;  2EUF A;  2C5N B;  1QLB A;  2WFY B;  4KRC B;  3O0G D;  4JX6 A;  4BCJ B;  4ZGE B;  4F6W B;  2F2C A;  5CYI B;  1OKW B;  4CFU B;  5DQV A;  5L2W B;  4BCF B;  1IRE B;  3X26 B;  1UNH D;  2DXB B;  2KMG A;  2R7G A;  1GY3 B;  5FGK B;  2ZPE B;  1W98 B;  5IHY A;  3A8G B;  1FVV B;  3QHW B;  2KR6 A;  1H1R B;  3X20 B;  2QQ8 A;  3TNI B;  3QYB A;  3A8H B;  3X24 B;  3QYG B;  1XO2 A;  5CEI B;  4OB3 B;  1OGU B;  4F7J B;  2ZPG B;  3BG3 A;  1JSU B;  3EOC B;  1JKW A;  2JGZ B;  3QYE A;  3BHT B;  4OB2 B;  3PO3 S;  2PK9 B;  2W99 A;  1ZP2 A;  3MY1 B;  4BCN B;  3QHR B;  4OR5 B;  4HNU A;  1FIN B;  4EOM B;  3EID B;  2QDY B;  1H1S B;  5HBE B;  5EJC A;  1OL1 B;  3TW7 A;  3DL1 A;  2PHG A;  2CZ7 B;  1GUX B;  1E9H B;  4BCP B;  2UZE B;  1C9B A;  3VKH A;  4ROE A;  3EJ1 B;  4F7L B;  5HNB B;  2W9F A;  1VYW B;  1JOW A;  2CZ6 B;  3MIA B;  3X28 B;  4CRL B;  1VIN A;  4EOP B;  4NC6 A;  2WPA B;  4BCK B;  2BS4 A;  4OB0 B;  2UZB B;  3GTM S;  1N4M A;  5I5Z B;  1OIY B;  4EOL B;  1VOL A;  2WIH B;  3MY5 B;  4YOS A;  4BXX X;  4BCI B;  1UGS B;  3RGF B;  3NDQ A;  2DD5 B;  1F5Q B;  1QMZ B;  4YC3 B;  4KRD B;  4QSH A;  4BCQ B;  4M6V A;  3TN8 B;  4BCG B;  4F70 B;  2G77 A;  1H4L D;  5BNJ B;  3WVE B;  4JX4 A;  4G6L B;  2C4G B;  1ENW A;  2C5X B;  2CCH B;  3HO8 A;  1O9K A;  5HVY B;  4F7S B;  3TNH B;  5HBJ B;  4EOI B;  3VYH B;  4EOR B;  2BS3 A;  4EC9 B;  4BCH B;  2ZPF B;  2B9R A;  4Y72 B;  3TW6 A;  2BPM B;  3LQ5 B;  1OKV B;  5IDP B;  2ZPI B;  4CFN B;  2CYZ B;  1UNL D;  4HLQ A;  1AIS B;  3BG5 A;  2PJQ A;  3HBL A;  3POM A;  1P5E B;  1E7P A;  2QGS A;  3A8M B;  1H26 B;  3DJB A;  1PKD B;  4I3Z B;  1H28 B;  3QZ5 B;  3HHT B;  3QZ9 B;  4AKH A;  2W2H A;  4FX3 B;  5DQW A;  3MI9 B;  1TFB A;  2IN3 A;  3BLQ B;  2CCI B;  2I53 A;  2ZPB B;  4BCO B;  5HBH B;  2CJM B;  4ZGD B;  2IW9 B;  2IW8 B;  3KHI A;  1UGQ B;  4EOQ B;  3BHU B;  4ROC A;  5HQ0 B;  4AKG A;  1BU2 A;  2PK2 A;  1AHJ B;  4ELJ A;  4F7N B;  2WJ9 A;  3BHV B;  2DPP B;  1H25 B;  2BKZ B;  2W96 A;  4EC8 B;  3M03 A;  4EOJ B;  5EFQ B;  4ZGJ B;  2AHJ B;  3BG9 A;  1KXU A;  4TTH A;  2DD4 B;  3A8L B;  3QXE B;  5LMK B; 
#chains in the Genus database with same CATH homology
 4MFE A;  4OB2 B;  2ZPH B;  3A8O B;  2ZPI B;  1V29 B;  3WVD B;  4HNU A;  2CYZ B;  2CZ1 B;  3HB9 A;  2CZ0 B;  2QDY B;  3X25 B;  4HLQ A;  5EJC A;  4FM4 B;  2QFZ A;  4MFD A;  3BG5 A;  2QF7 A;  4MIM A;  3HZJ A;  3DL1 A;  3TW7 A;  2QDJ A;  3HBL A;  2CZ7 B;  4Z6Y A;  2D0Q B;  3VKH A;  1QLB A;  1E7P A;  4JX6 A;  3A8M B;  4BBS M;  4ZGE B;  1UGP B;  2CZ6 B;  3X28 B;  3QZ5 B;  4AI6 A;  3HHT B;  4NC6 A;  1IRE B;  3X26 B;  3QZ9 B;  4AKH A;  2BS4 A;  2DXB B;  4OB0 B;  2KMG A;  1UGR B;  3VYG B;  2DXC B;  2ZPB B;  4HL4 A;  3QYH B;  2ZPE B;  4ZGD B;  4AKI A;  1UGS B;  4LOC A;  4BBR M;  4JX5 A;  2DD5 B;  3KHI A;  3A8G B;  1UGQ B;  3H4C A;  2KR6 A;  2ZZD B;  4QSH A;  4HNT A;  4OB1 B;  4M6V A;  3X20 B;  4AKG A;  2QQ8 A;  2BS2 A;  2G77 A;  1AHJ B;  3QYB A;  3A8H B;  4HNV A;  2ZCF B;  1FKM A;  3WVE B;  3X24 B;  4ELJ A;  4JX4 A;  3QYG B;  2WJ9 A;  3QWL A;  4OB3 B;  2DPP B;  3HO8 A;  2ZPG B;  3BG3 A;  3VYH B;  4ZGJ B;  2BS3 A;  2AHJ B;  3BG9 A;  2DD4 B;  2ZPF B;  3A8L B;  3QYE A;  3QXE B;  3TW6 A;  3VKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...