2G77A

Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
388
structure length
331
Chain Sequence
QELNSIIQRISKFDNILKDKTIINQQDLRQISWNGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQRKRKEYRDSLKHTFSDQHSRDIPTWHQIEIDIPRTNPHIPLYQFKSVQNSLQRILYLWAIRHPASGYVQGINDLVTPFFETFLTEYLPPSQIDDVKIKDPSTYMVDEQITDLEADTFWCLTKLLEQITDNYIHGQPGILRQVKNLSQLVKRIDADLYNHFQNEHVEFIQFAFRWMNCLLMREFQMGTVIRMWDTYLSETSQQSSLNEFHVFVCAAFLIKWSDQLMEMDFQETITFLQNPPTKDWTETDIEMLLSEAFIWQSLYKDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase-activating protein GYP1
publication title TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase activator/protein transport
total genus 135
structure length 331
sequence length 388
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2g77A02
1FKMA 3QWLA 4HLQA 5EJCA 2G77A 2QQ8A 4NC6A 4HL4A 4Z6YA 3HZJA 3QYBA 2QFZA 3QYEA
chains in the Genus database with same CATH superfamily
4FX3B 4G6LB 5HBHB 4BCGB 2ZPIB 2QDJA 1KXUA 4CFMB 3DTOA 1H24B 2QQ8A 2ZZDB 3TNHB 4NC6A 1H25B 2CCIB 2BPMB 5IHYA 2CZ7B 1QMZB 3VYHB 4HNTA 3HO8A 5EFQB 2QFZA 1VINA 5LMKB 2I40B 4CFUD 1FKMA 1H26B 3BLRB 4F7NB 3QHRB 4AKHA 2IVXA 4CXAB 2JGZB 3F5XB 4RODA 4IMYB 3BHUB 4ELJA 3DL1A 3X26B 4OB0B 3LQ5B 4BCNB 3TN8B 2KMGA 1OGUB 3O0GD 2DXCB 4NSTB 1O9KA 2UZDB 4HNUA 4ZGEB 1PKDB 4OGRB 1ENWA 2WMBB 2G9XB 3QHWB 2AHJB 4EOLB 1TD6A 4CFNB 3QYBA 1OI9B 4LOCA 5CYIB 4OB3B 4YOZA 4BCIB 3X25B 3MY1B 3H4CA 2D0QB 2PK9B 5HNBB 1AD6A 2DPPB 1ZP2A 2C5NB 4UN0A 5CEIB 4YOSA 4EORB 3DOGB 2ZPGB 1UNHD 4OB1B 3POMA 5HVYB 1TFBA 1UNGD 4I3ZB 3VKHA 4EOSB 1UGRB 2C6TB 2WEVB 2W9ZA 4CRLB 1H1PB 1JOWA 1GH6B 5ICPB 1H27B 4KRCB 4OB2B 1D3UB 4CFUB 1AISB 4F7SB 2BS4A 3HZJA 3TW7A 1UGQB 3X20B 4YOOA 5ACBA 1G3NC 1H1SB 4BCFB 3VKGA 1UGSB 4QSHA 1P5EB 1JSTB 3GTMS 4F6SB 4EC8B 4Z6YA 1IREB 1OKWB 1VOLA 4EOIB 4BCQD 4EC9B 3RGFB 4AKIA 2CZ1B 4F7JB 2WFYB 3BG3A 2F2CA 2IW6B 2UUEB 1C9BA 5IF1B 2KR6A 1UNLD 4EOMB 2DXBB 1GUXB 1OL2B 1E9HB 4KRDB 4II5B 2WXVB 2UZEB 3QXEB 2X1NB 3BG5A 2IW8B 4EOQB 2WMAB 2PJQA 3M03A 2DD5B 4F7LB 1OIYB 4CFVB 2G77A 5BNJB 2WIHB 2WHBB 3PO3S 2ZCFB 4HNVA 3TW6A 2PMIB 4BCHB 3WVEB 1GUXA 3KHIA 4BCJB 4F6WB 3MI9B 4BCKB 4F70B 5L2WB 1H28B 4BCMD 1XO2A 2B9RA 2WJ9A 2PK2A 1OKVB 3EJ1B 4HLQA 4BCPB 2QF7A 3EOCB 2C5OB 3WVDB 1BU2A 3QZ9B 5FGKB 4ZGJB 4BCND 3QYGB 4FM4B 4EOJB 3G33B 4BCOB 4EOOB 3BLQB 4YC3B 5EJCA 3A8OB 4AKGA 3HHTB 2W9FA 3DJBA 4HL4A 2DD4B 2V22B 5HBJB 2R7GA 4BBSM 2DMEA 2ZPFB 1QLBA 4JX6A 2C5XB 4BCQB 2W2HA 3HBLA 4F6UB 1URCB 2CZ0B 3MY5B 1E7PA 1N4MA 3K7AM 3A8HB 3A8GB 3DDQB 2WPAB 1H1QB 2ZPEB 4Y72B 2IW9B 3A8LB 1GY3B 4ELLA 2QDYB 2LW4A 2CJMB 4BY1X 3VYGB 4MFDA 5IDPB 1UGPB 2ZPHB 1FINB 2IN3A 4M6VA 2PHGA 2EUFA 1O9KB 4TTHA 3NDQA 1OIUB 4MFEA 1F5QB 2C4GB 4EOPB 5HQ0B 3X24B 2CCHB 2UZLB 5DQWA 4OR5B 5IDNB 1FVVB 3BHVB 3QZ5B 3BLHB 4BCMB 3MIAB 1H1RB 1V29B 2QGSA 1W98B 2CYZB 1JKWA 4BXXX 3TNIB 4JX5A 1AHJB 4CFWB 3EIDB 3B57A 3HB9A 3A8MB 2CZ6B 3BG9A 2BS3A 2C5VB 2W96A 1OL1B 3BHTB 2WIPB 3DDPB 3TNWB 5HBEB 1JSUB 3X28B 5LQFB 5I5ZB 4EOKB 1VYWB 4CFXB 3QYHB 5DQVA 4JX4A 4MIMA 2BKZB 4AI6A 4BY7X 2ZPBB 4BBRM 4ROEA 1H4LD 3QWLA 2I53A 2BS2A 3QYEA 2UZBB 2W99A 4EONB 4ZGDB 4ROCA
chains in the Genus database with same CATH topology
3WVEB 2DPPB 3KHIA 3X24B 2ZPIB 2QDJA 2ZPGB 3QZ5B 4OB1B 1V29B 2QQ8A 2WJ9A 2ZZDB 3VKHA 1UGRB 4HLQA 2CYZB 4NC6A 2QF7A 2CZ7B 4JX5A 3VYHB 4OB2B 3QZ9B 3WVDB 4ZGJB 1AHJB 4HNTA 3HO8A 2QFZA 1FKMA 3QYGB 4FM4B 3HB9A 3A8MB 2BS4A 3HZJA 4AKHA 3TW7A 2CZ6B 1UGQB 3BG9A 3X20B 5EJCA 3A8OB 4AKGA 3VKGA 2BS3A 1UGSB 4QSHA 3HHTB 4HL4A 2DD4B 4ELJA 3DL1A 4BBSM 3X26B 2ZPFB 4OB0B 4Z6YA 1IREB 1QLBA 4JX6A 2KMGA 3X28B 3HBLA 2DXCB 2CZ0B 4HNUA 4AKIA 2CZ1B 1E7PA 4ZGEB 3BG3A 3A8HB 3QYHB 4JX4A 3A8GB 4MIMA 2KR6A 4AI6A 2DXBB 2ZPEB 2ZPBB 4BBRM 3A8LB 3QWLA 2AHJB 2BS2A 2QDYB 3QXEB 3QYBA 3QYEA 4LOCA 3VYGB 3BG5A 4MFDA 4OB3B 2DD5B 1UGPB 2G77A 2ZPHB 3X25B 3H4CA 4M6VA 2D0QB 4ZGDB 2ZCFB 4HNVA 3TW6A 4MFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKM A;  3QWL A;  4HLQ A;  5EJC A;  2G77 A;  2QQ8 A;  4NC6 A;  4HL4 A;  4Z6Y A;  3HZJ A;  3QYB A;  2QFZ A;  3QYE A; 
#chains in the Genus database with same CATH topology
 4FX3 B;  4G6L B;  5HBH B;  4BCG B;  2ZPI B;  2QDJ A;  1KXU A;  4CFM B;  3DTO A;  1H24 B;  2QQ8 A;  2ZZD B;  3TNH B;  4NC6 A;  1H25 B;  2CCI B;  2BPM B;  5IHY A;  2CZ7 B;  1QMZ B;  3VYH B;  4HNT A;  3HO8 A;  5EFQ B;  2QFZ A;  1VIN A;  5LMK B;  2I40 B;  4CFU D;  1FKM A;  1H26 B;  3BLR B;  4F7N B;  3QHR B;  4AKH A;  2IVX A;  4CXA B;  2JGZ B;  3F5X B;  4ROD A;  4IMY B;  3BHU B;  4ELJ A;  3DL1 A;  3X26 B;  4OB0 B;  3LQ5 B;  4BCN B;  3TN8 B;  2KMG A;  1OGU B;  3O0G D;  2DXC B;  4NST B;  1O9K A;  2UZD B;  4HNU A;  4ZGE B;  1PKD B;  4OGR B;  1ENW A;  2WMB B;  2G9X B;  3QHW B;  2AHJ B;  4EOL B;  1TD6 A;  4CFN B;  3QYB A;  1OI9 B;  4LOC A;  5CYI B;  4OB3 B;  4YOZ A;  4BCI B;  3X25 B;  3MY1 B;  3H4C A;  2D0Q B;  2PK9 B;  5HNB B;  1AD6 A;  2DPP B;  1ZP2 A;  2C5N B;  4UN0 A;  5CEI B;  4YOS A;  4EOR B;  3DOG B;  2ZPG B;  1UNH D;  4OB1 B;  3POM A;  5HVY B;  1TFB A;  1UNG D;  4I3Z B;  3VKH A;  4EOS B;  1UGR B;  2C6T B;  2WEV B;  2W9Z A;  4CRL B;  1H1P B;  1JOW A;  1GH6 B;  5ICP B;  1H27 B;  4KRC B;  4OB2 B;  1D3U B;  4CFU B;  1AIS B;  4F7S B;  2BS4 A;  3HZJ A;  3TW7 A;  1UGQ B;  3X20 B;  4YOO A;  5ACB A;  1G3N C;  1H1S B;  4BCF B;  3VKG A;  1UGS B;  4QSH A;  1P5E B;  1JST B;  3GTM S;  4F6S B;  4EC8 B;  4Z6Y A;  1IRE B;  1OKW B;  1VOL A;  4EOI B;  4BCQ D;  4EC9 B;  3RGF B;  4AKI A;  2CZ1 B;  4F7J B;  2WFY B;  3BG3 A;  2F2C A;  2IW6 B;  2UUE B;  1C9B A;  5IF1 B;  2KR6 A;  1UNL D;  4EOM B;  2DXB B;  1GUX B;  1OL2 B;  1E9H B;  4KRD B;  4II5 B;  2WXV B;  2UZE B;  3QXE B;  2X1N B;  3BG5 A;  2IW8 B;  4EOQ B;  2WMA B;  2PJQ A;  3M03 A;  2DD5 B;  4F7L B;  1OIY B;  4CFV B;  2G77 A;  5BNJ B;  2WIH B;  2WHB B;  3PO3 S;  2ZCF B;  4HNV A;  3TW6 A;  2PMI B;  4BCH B;  3WVE B;  1GUX A;  3KHI A;  4BCJ B;  4F6W B;  3MI9 B;  4BCK B;  4F70 B;  5L2W B;  1H28 B;  4BCM D;  1XO2 A;  2B9R A;  2WJ9 A;  2PK2 A;  1OKV B;  3EJ1 B;  4HLQ A;  4BCP B;  2QF7 A;  3EOC B;  2C5O B;  3WVD B;  1BU2 A;  3QZ9 B;  5FGK B;  4ZGJ B;  4BCN D;  3QYG B;  4FM4 B;  4EOJ B;  3G33 B;  4BCO B;  4EOO B;  3BLQ B;  4YC3 B;  5EJC A;  3A8O B;  4AKG A;  3HHT B;  2W9F A;  3DJB A;  4HL4 A;  2DD4 B;  2V22 B;  5HBJ B;  2R7G A;  4BBS M;  2DME A;  2ZPF B;  1QLB A;  4JX6 A;  2C5X B;  4BCQ B;  2W2H A;  3HBL A;  4F6U B;  1URC B;  2CZ0 B;  3MY5 B;  1E7P A;  1N4M A;  3K7A M;  3A8H B;  3A8G B;  3DDQ B;  2WPA B;  1H1Q B;  2ZPE B;  4Y72 B;  2IW9 B;  3A8L B;  1GY3 B;  4ELL A;  2QDY B;  2LW4 A;  2CJM B;  4BY1 X;  3VYG B;  4MFD A;  5IDP B;  1UGP B;  2ZPH B;  1FIN B;  2IN3 A;  4M6V A;  2PHG A;  2EUF A;  1O9K B;  4TTH A;  3NDQ A;  1OIU B;  4MFE A;  1F5Q B;  2C4G B;  4EOP B;  5HQ0 B;  3X24 B;  2CCH B;  2UZL B;  5DQW A;  4OR5 B;  5IDN B;  1FVV B;  3BHV B;  3QZ5 B;  3BLH B;  4BCM B;  3MIA B;  1H1R B;  1V29 B;  2QGS A;  1W98 B;  2CYZ B;  1JKW A;  4BXX X;  3TNI B;  4JX5 A;  1AHJ B;  4CFW B;  3EID B;  3B57 A;  3HB9 A;  3A8M B;  2CZ6 B;  3BG9 A;  2BS3 A;  2C5V B;  2W96 A;  1OL1 B;  3BHT B;  2WIP B;  3DDP B;  3TNW B;  5HBE B;  1JSU B;  3X28 B;  5LQF B;  5I5Z B;  4EOK B;  1VYW B;  4CFX B;  3QYH B;  5DQV A;  4JX4 A;  4MIM A;  2BKZ B;  4AI6 A;  4BY7 X;  2ZPB B;  4BBR M;  4ROE A;  1H4L D;  3QWL A;  2I53 A;  2BS2 A;  3QYE A;  2UZB B;  2W99 A;  4EON B;  4ZGD B;  4ROC A; 
#chains in the Genus database with same CATH homology
 3WVE B;  2DPP B;  3KHI A;  3X24 B;  2ZPI B;  2QDJ A;  2ZPG B;  3QZ5 B;  4OB1 B;  1V29 B;  2QQ8 A;  2WJ9 A;  2ZZD B;  3VKH A;  1UGR B;  4HLQ A;  2CYZ B;  4NC6 A;  2QF7 A;  2CZ7 B;  4JX5 A;  3VYH B;  4OB2 B;  3QZ9 B;  3WVD B;  4ZGJ B;  1AHJ B;  4HNT A;  3HO8 A;  2QFZ A;  1FKM A;  3QYG B;  4FM4 B;  3HB9 A;  3A8M B;  2BS4 A;  3HZJ A;  4AKH A;  3TW7 A;  2CZ6 B;  1UGQ B;  3BG9 A;  3X20 B;  5EJC A;  3A8O B;  4AKG A;  3VKG A;  2BS3 A;  1UGS B;  4QSH A;  3HHT B;  4HL4 A;  2DD4 B;  4ELJ A;  3DL1 A;  4BBS M;  3X26 B;  2ZPF B;  4OB0 B;  4Z6Y A;  1IRE B;  1QLB A;  4JX6 A;  2KMG A;  3X28 B;  3HBL A;  2DXC B;  2CZ0 B;  4HNU A;  4AKI A;  2CZ1 B;  1E7P A;  4ZGE B;  3BG3 A;  3A8H B;  3QYH B;  4JX4 A;  3A8G B;  4MIM A;  2KR6 A;  4AI6 A;  2DXB B;  2ZPE B;  2ZPB B;  4BBR M;  3A8L B;  3QWL A;  2AHJ B;  2BS2 A;  2QDY B;  3QXE B;  3QYB A;  3QYE A;  4LOC A;  3VYG B;  3BG5 A;  4MFD A;  4OB3 B;  2DD5 B;  1UGP B;  2G77 A;  2ZPH B;  3X25 B;  3H4C A;  4M6V A;  2D0Q B;  4ZGD B;  2ZCF B;  4HNV A;  3TW6 A;  4MFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...