2G77A

Crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
388
structure length
331
Chain Sequence
QELNSIIQRISKFDNILKDKTIINQQDLRQISWNGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQRKRKEYRDSLKHTFSDQHSRDIPTWHQIEIDIPRTNPHIPLYQFKSVQNSLQRILYLWAIRHPASGYVQGINDLVTPFFETFLTEYLPPSQIDDVKIKDPSTYMVDEQITDLEADTFWCLTKLLEQITDNYIHGQPGILRQVKNLSQLVKRIDADLYNHFQNEHVEFIQFAFRWMNCLLMREFQMGTVIRMWDTYLSETSQQSSLNEFHVFVCAAFLIKWSDQLMEMDFQETITFLQNPPTKDWTETDIEMLLSEAFIWQSLYKDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator/protein transport
molecule keywords GTPase-activating protein GYP1
publication title TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 135
structure length 331
sequence length 388
ec nomenclature
pdb deposition date 2006-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2g77A02
3QYBA 2QFZA 2QQ8A 4Z6YA 3QWLA 4HL4A 1FKMA 4HLQA 2G77A 3HZJA 3QYEA 5EJCA 4NC6A
chains in the Genus database with same CATH superfamily
1H4LD 1G3NC 2WIPB 1QLBA 2X1NB 1UGPB 5IDNB 4MIMA 2UZLB 1AHJB 2QDJA 1UNLD 3X20B 4AKIA 1UNGD 4OB3B 4IMYB 3WVDB 4OB2B 2IW9B 4CFXB 2ZZDB 4CFNB 3BLQB 2W9ZA 3KHIA 3QZ5B 5IF1B 4BCJB 3QWLA 4NC6A 2KMGA 2W9FA 1FVVB 2ZCFB 2ZPBB 3BHVB 1TFBA 5HBEB 4HNUA 3QHWB 2PHGA 3QHRB 3NDQA 3BG5A 5BNJB 2ZPEB 4F6SB 4AKHA 4ROEA 5I5ZB 1H1SB 2CZ6B 1JOWA 4BXXX 1AISB 5ACBA 2JGZB 1W98B 4YOSA 4EC8B 2UZBB 4LOCA 2QQ8A 3DDQB 2IN3A 3POMA 2QFZA 4BCMD 2WEVB 4MFDA 2ZPIB 3QYHB 3HZJA 2WIHB 3TN8B 4BCQB 3A8HB 2DMEA 2BS3A 3QZ9B 4F7NB 3LQ5B 2WMBB 1UGQB 5HNBB 2G9XB 3RGFB 4CFMB 2WPAB 4BBRM 2KR6A 2BS4A 3HO8A 3QYGB 4FX3B 4BCPB 1FINB 3A8MB 5CEIB 4BCNB 4EOPB 3M03A 4ZGEB 5EJCA 2CZ1B 3DOGB 3VYGB 2ZPHB 1PKDB 2CCIB 5CYIB 2I53A 4KRDB 2QGSA 1GUXA 1H27B 2PMIB 3MY5B 3K7AM 1ENWA 1C9BA 1H25B 3BHTB 4EONB 1BU2A 3TNHB 4KRCB 4NSTB 2F2CA 4OR5B 1H24B 5IHYA 3MY1B 5DQVA 1IREB 1O9KA 4II5B 4Y72B 4HNTA 4FM4B 2IW8B 2WFYB 2DXBB 3VKGA 1V29B 4M6VA 1UGSB 3VYHB 1JKWA 3B57A 3HB9A 3VKHA 2DPPB 4CFUB 1E9HB 1F5QB 3BLRB 3BG3A 2LW4A 1VYWB 3TNIB 4BCQD 2CJMB 2ZPFB 4EOLB 1H1RB 2DD5B 4OB0B 2CCHB 3PO3S 5EFQB 4OGRB 1E7PA 4EOSB 4EOJB 2PJQA 3WVEB 2BKZB 1N4MA 5DQWA 1TD6A 2BPMB 4CXAB 3HBLA 3X28B 3O0GD 4CRLB 4ELJA 5HQ0B 2IW6B 3X26B 4F7SB 2IVXA 4BCIB 1D3UB 1OI9B 2WHBB 4HNVA 2W99A 1URCB 3G33B 1H26B 4OB1B 1VINA 3X24B 4TTHA 3EJ1B 3BLHB 1QMZB 1OL1B 1XO2A 4EOQB 5LQFB 3BG9A 3QXEB 4UN0A 2C5NB 2WXVB 5ICPB 2B9RA 2CZ7B 1UGRB 4HLQA 2WJ9A 2ZPGB 4EORB 4F70B 1OIYB 1OKWB 3EIDB 4EOIB 2UUEB 4HL4A 4EOOB 4YOZA 4ELLA 5HVYB 1AD6A 2R7GA 4F7JB 3DTOA 4CFUD 4F6UB 4YOOA 2QDYB 2DD4B 5FGKB 4BCOB 4EC9B 1OIUB 2UZDB 1H1PB 3DDPB 4EOKB 4AKGA 2CZ0B 2EUFA 3TW7A 3DJBA 3MIAB 2DXCB 3A8GB 2C5OB 2C5VB 3MI9B 3QYEA 2W96A 1GUXB 2AHJB 2C6TB 4YC3B 1OKVB 4AI6A 4ROCA 2UZEB 3X25B 1H1QB 3HHTB 3F5XB 2C5XB 4JX6A 4MFEA 2W2HA 3A8OB 2WMAB 4QSHA 3EOCB 4JX5A 1OGUB 4BCKB 2V22B 4BY1X 1O9KB 4G6LB 1UNHD 1GY3B 2PK9B 2CYZB 4Z6YA 5HBHB 1FKMA 2D0QB 3H4CA 2PK2A 5HBJB 4BCND 4CFVB 3BHUB 4F6WB 3DL1A 4BY7X 1P5EB 4BCFB 4JX4A 1JSTB 1GH6B 4F7LB 4ZGDB 4ZGJB 2BS2A 4BCGB 4EOMB 5L2WB 4I3ZB 3TNWB 4CFWB 3GTMS 1JSUB 2I40B 4BBSM 1H28B 2C4GB 3TW6A 4BCMB 5IDPB 1ZP2A 1KXUA 3QYBA 5LMKB 2G77A 4BCHB 1OL2B 4RODA 3A8LB 1VOLA 2QF7A
chains in the Genus database with same CATH topology
1UGQB 2DD5B 1QLBA 2DXCB 4OB0B 1UGPB 1E7PA 4BBRM 3A8GB 4MIMA 2KR6A 1AHJB 2BS4A 2QDJA 3HO8A 3QYGB 3X20B 4AKIA 3WVEB 3QYEA 3A8MB 4OB3B 3WVDB 4OB2B 2AHJB 3HBLA 2ZZDB 3X28B 4ZGEB 5EJCA 3KHIA 3QZ5B 2CZ1B 3QWLA 4AI6A 3VYGB 2ZPHB 3X25B 4NC6A 4ELJA 2KMGA 3HHTB 4JX6A 3X26B 4MFEA 3A8OB 4QSHA 4JX5A 2ZCFB 2ZPBB 2CYZB 4Z6YA 1FKMA 2D0QB 3H4CA 4HNUA 3DL1A 4HNVA 3BG5A 2ZPEB 4OB1B 4AKHA 3X24B 1IREB 4JX4A 4HNTA 2CZ6B 4FM4B 4ZGDB 3BG9A 3QXEB 3TW7A 2DXBB 4ZGJB 3VKGA 1V29B 2BS2A 4M6VA 2CZ7B 4HLQA 1UGRB 2WJ9A 1UGSB 2ZPGB 3VYHB 4BBSM 4LOCA 2QQ8A 3HB9A 3TW6A 3VKHA 4HL4A 2DPPB 3QYBA 2QFZA 4MFDA 2ZPIB 3QYHB 2QDYB 2G77A 2DD4B 3HZJA 3BG3A 3A8HB 4AKGA 2CZ0B 3QZ9B 2BS3A 3A8LB 2ZPFB 2QF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYB A;  2QFZ A;  2QQ8 A;  4Z6Y A;  3QWL A;  4HL4 A;  1FKM A;  4HLQ A;  2G77 A;  3HZJ A;  3QYE A;  5EJC A;  4NC6 A; 
#chains in the Genus database with same CATH topology
 1H4L D;  1G3N C;  2WIP B;  1QLB A;  2X1N B;  1UGP B;  5IDN B;  4MIM A;  2UZL B;  1AHJ B;  2QDJ A;  1UNL D;  3X20 B;  4AKI A;  1UNG D;  4OB3 B;  4IMY B;  3WVD B;  4OB2 B;  2IW9 B;  4CFX B;  2ZZD B;  4CFN B;  3BLQ B;  2W9Z A;  3KHI A;  3QZ5 B;  5IF1 B;  4BCJ B;  3QWL A;  4NC6 A;  2KMG A;  2W9F A;  1FVV B;  2ZCF B;  2ZPB B;  3BHV B;  1TFB A;  5HBE B;  4HNU A;  3QHW B;  2PHG A;  3QHR B;  3NDQ A;  3BG5 A;  5BNJ B;  2ZPE B;  4F6S B;  4AKH A;  4ROE A;  5I5Z B;  1H1S B;  2CZ6 B;  1JOW A;  4BXX X;  1AIS B;  5ACB A;  2JGZ B;  1W98 B;  4YOS A;  4EC8 B;  2UZB B;  4LOC A;  2QQ8 A;  3DDQ B;  2IN3 A;  3POM A;  2QFZ A;  4BCM D;  2WEV B;  4MFD A;  2ZPI B;  3QYH B;  3HZJ A;  2WIH B;  3TN8 B;  4BCQ B;  3A8H B;  2DME A;  2BS3 A;  3QZ9 B;  4F7N B;  3LQ5 B;  2WMB B;  1UGQ B;  5HNB B;  2G9X B;  3RGF B;  4CFM B;  2WPA B;  4BBR M;  2KR6 A;  2BS4 A;  3HO8 A;  3QYG B;  4FX3 B;  4BCP B;  1FIN B;  3A8M B;  5CEI B;  4BCN B;  4EOP B;  3M03 A;  4ZGE B;  5EJC A;  2CZ1 B;  3DOG B;  3VYG B;  2ZPH B;  1PKD B;  2CCI B;  5CYI B;  2I53 A;  4KRD B;  2QGS A;  1GUX A;  1H27 B;  2PMI B;  3MY5 B;  3K7A M;  1ENW A;  1C9B A;  1H25 B;  3BHT B;  4EON B;  1BU2 A;  3TNH B;  4KRC B;  4NST B;  2F2C A;  4OR5 B;  1H24 B;  5IHY A;  3MY1 B;  5DQV A;  1IRE B;  1O9K A;  4II5 B;  4Y72 B;  4HNT A;  4FM4 B;  2IW8 B;  2WFY B;  2DXB B;  3VKG A;  1V29 B;  4M6V A;  1UGS B;  3VYH B;  1JKW A;  3B57 A;  3HB9 A;  3VKH A;  2DPP B;  4CFU B;  1E9H B;  1F5Q B;  3BLR B;  3BG3 A;  2LW4 A;  1VYW B;  3TNI B;  4BCQ D;  2CJM B;  2ZPF B;  4EOL B;  1H1R B;  2DD5 B;  4OB0 B;  2CCH B;  3PO3 S;  5EFQ B;  4OGR B;  1E7P A;  4EOS B;  4EOJ B;  2PJQ A;  3WVE B;  2BKZ B;  1N4M A;  5DQW A;  1TD6 A;  2BPM B;  4CXA B;  3HBL A;  3X28 B;  3O0G D;  4CRL B;  4ELJ A;  5HQ0 B;  2IW6 B;  3X26 B;  4F7S B;  2IVX A;  4BCI B;  1D3U B;  1OI9 B;  2WHB B;  4HNV A;  2W99 A;  1URC B;  3G33 B;  1H26 B;  4OB1 B;  1VIN A;  3X24 B;  4TTH A;  3EJ1 B;  3BLH B;  1QMZ B;  1OL1 B;  1XO2 A;  4EOQ B;  5LQF B;  3BG9 A;  3QXE B;  4UN0 A;  2C5N B;  2WXV B;  5ICP B;  2B9R A;  2CZ7 B;  1UGR B;  4HLQ A;  2WJ9 A;  2ZPG B;  4EOR B;  4F70 B;  1OIY B;  1OKW B;  3EID B;  4EOI B;  2UUE B;  4HL4 A;  4EOO B;  4YOZ A;  4ELL A;  5HVY B;  1AD6 A;  2R7G A;  4F7J B;  3DTO A;  4CFU D;  4F6U B;  4YOO A;  2QDY B;  2DD4 B;  5FGK B;  4BCO B;  4EC9 B;  1OIU B;  2UZD B;  1H1P B;  3DDP B;  4EOK B;  4AKG A;  2CZ0 B;  2EUF A;  3TW7 A;  3DJB A;  3MIA B;  2DXC B;  3A8G B;  2C5O B;  2C5V B;  3MI9 B;  3QYE A;  2W96 A;  1GUX B;  2AHJ B;  2C6T B;  4YC3 B;  1OKV B;  4AI6 A;  4ROC A;  2UZE B;  3X25 B;  1H1Q B;  3HHT B;  3F5X B;  2C5X B;  4JX6 A;  4MFE A;  2W2H A;  3A8O B;  2WMA B;  4QSH A;  3EOC B;  4JX5 A;  1OGU B;  4BCK B;  2V22 B;  4BY1 X;  1O9K B;  4G6L B;  1UNH D;  1GY3 B;  2PK9 B;  2CYZ B;  4Z6Y A;  5HBH B;  1FKM A;  2D0Q B;  3H4C A;  2PK2 A;  5HBJ B;  4BCN D;  4CFV B;  3BHU B;  4F6W B;  3DL1 A;  4BY7 X;  1P5E B;  4BCF B;  4JX4 A;  1JST B;  1GH6 B;  4F7L B;  4ZGD B;  4ZGJ B;  2BS2 A;  4BCG B;  4EOM B;  5L2W B;  4I3Z B;  3TNW B;  4CFW B;  3GTM S;  1JSU B;  2I40 B;  4BBS M;  1H28 B;  2C4G B;  3TW6 A;  4BCM B;  5IDP B;  1ZP2 A;  1KXU A;  3QYB A;  5LMK B;  2G77 A;  4BCH B;  1OL2 B;  4ROD A;  3A8L B;  1VOL A;  2QF7 A; 
#chains in the Genus database with same CATH homology
 1UGQ B;  2DD5 B;  1QLB A;  2DXC B;  4OB0 B;  1UGP B;  1E7P A;  4BBR M;  3A8G B;  4MIM A;  2KR6 A;  1AHJ B;  2BS4 A;  2QDJ A;  3HO8 A;  3QYG B;  3X20 B;  4AKI A;  3WVE B;  3QYE A;  3A8M B;  4OB3 B;  3WVD B;  4OB2 B;  2AHJ B;  3HBL A;  2ZZD B;  3X28 B;  4ZGE B;  5EJC A;  3KHI A;  3QZ5 B;  2CZ1 B;  3QWL A;  4AI6 A;  3VYG B;  2ZPH B;  3X25 B;  4NC6 A;  4ELJ A;  2KMG A;  3HHT B;  4JX6 A;  3X26 B;  4MFE A;  3A8O B;  4QSH A;  4JX5 A;  2ZCF B;  2ZPB B;  2CYZ B;  4Z6Y A;  1FKM A;  2D0Q B;  3H4C A;  4HNU A;  3DL1 A;  4HNV A;  3BG5 A;  2ZPE B;  4OB1 B;  4AKH A;  3X24 B;  1IRE B;  4JX4 A;  4HNT A;  2CZ6 B;  4FM4 B;  4ZGD B;  3BG9 A;  3QXE B;  3TW7 A;  2DXB B;  4ZGJ B;  3VKG A;  1V29 B;  2BS2 A;  4M6V A;  2CZ7 B;  4HLQ A;  1UGR B;  2WJ9 A;  1UGS B;  2ZPG B;  3VYH B;  4BBS M;  4LOC A;  2QQ8 A;  3HB9 A;  3TW6 A;  3VKH A;  4HL4 A;  2DPP B;  3QYB A;  2QFZ A;  4MFD A;  2ZPI B;  3QYH B;  2QDY B;  2G77 A;  2DD4 B;  3HZJ A;  3BG3 A;  3A8H B;  4AKG A;  2CZ0 B;  3QZ9 B;  2BS3 A;  3A8L B;  2ZPF B;  2QF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...