3A8GB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8gB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8gB02
1PSFA 1UGQB 4OB2B 3X28B 2ZPBB 1IREB 2ZPEB 2DXBA 2DD4A 3X25B 2DXCB 3A8HB 4KT0E 4FM4B 2ZPGB 3WVDB 3VYGB 4ZGDB 1PSEA 3X24B 2PU9B 3QZ5B 2WSCE 3X26B 3A8MB 3X20B 3A8OB 3QYHB 2ZPIB 4ZGJB 1GXIE 1UGPB 3A8LB 4XK8E 2WSEE 4OB3B 1V29B 2DD5B 2ZZDB 4OB0B 2DXBB 2PUKB 2DXCA 2O01E 3VYHB 3WVEB 3HHTB 2PUOB 2ZPHB 2QDYB 2CZ1B 4Y28E 3LW5E 2PVDB 4RKUE 2ZPFB 3A8GB 1UGSB 2CZ6B 2D0QB 2PVOB 1JB0E 2DD4B 1QP3A 2DD5A 2ZZDA 4L6V5 1UGRB 3VYGA 2CYZB 2CZ7B 3QXEB 1DJ7B 1QP2A 2AHJB 2WSFE 2DPPB 3QYGB 1AHJB 5L8RE 4OB1B 2PVGB 3QZ9B 4ZGEB 2ZCFB 2CZ0B
chains in the Genus database with same CATH superfamily
3QBYA 2LCLA 2X3XD 3MO8A 5CO7A 2OI3A 2EGEA 1WNLA 3CMAA 4J7IA 4C92A 3P8DA 1MMAA 3OB9A 4F6UB 1HD3A 1BI1A 3UATA 1P5EB 3N5BB 4QQ6A 4BY6C 1E7PA 2LC4A 4KT0E 3TVTA 3ZEHA 4OMFB 4HNUA 2CUBA 2GQIA 1NJIR 2KAFA 2RNAA 4E7JA 1JQQA 2MK5A 3BG3A 1WJSA 3UF4A 1QWEA 2PU9B 4PLIA 2QGFB 2WSCE 3OYCA 3OS5A 1Q82C 2E5KA 5GMKj 1H4LD 1FX7A 2K9GA 3M5AA 2L3SA 4GBQA 2DILA 2M51A 1KD1C 2W99A 2FZGB 2DEQA 2WFYB 2X4WA 5LJ3f 2RQWA 2FRYA 4JX6A 2DJZA 2W0ZA 4NOYA 5FW9A 2A28A 5AYFA 3JCMb 1AVZC 5DY9A 1G3TA 2GGRA 3EGDB 1XJWB 4OB0B 2X4XA 3EHRA 1NLPC 1YBYA 1WDXA 2AKKA 4OGRB 1CKAA 5GAMh 1OYXA 5CK9A 2FL7A 4OR5B 3NHNA 1D0YA 4B9WA 1VQLQ 3LWHA 3HZJA 1RAFB 4MMKA 3I55A 3CCRA 1VQ9T 4J5YA 4ESRA 2WJ9A 4RKUE 4BD3A 3QDFA 4LUEA 1H1SB 4LDVA 2IG0A 2GFUA 1MV3A 4XU3A 4BCQD 5IH2A 3CCMA 2DETA 3I55T 3UA7A 4EMKB 4E7LA 2UZLB 1M1FA 3ZL7C 1YHQT 3NDQA 1X2QA 1GCPA 1XTDA 2KR6A 5CIUA 3MI9B 2WSFE 4Y91A 1SSHA 4ORZA 2WPAB 1Y07A 1BCMA 3PIOA 2XG8D 2KMGA 1YJ9A 4E7IA 2W9ZA 5LJ3h 2EW3A 2YSQA 2QEXQ 2XIDA 1ABQA 4PFOA 1V1CA 4C8QB 5KCOA 2WMBB 1YJ9T 2OTLA 3SWNC 3DLLA 4PJOD 2C5XB 1UEBA 3CCET 1W4SA 2KY9A 3C95A 3OYMA 3E19A 1YI2Q 3J80E 4EMKA 1JKWA 3ZBDA 3S3MA 2DYIA 2CGHA 2LJ1A 3THKA 2NYSA 3EIDB 1WJQA 3FEOA 3BFMA 2ZPGB 2LJ3A 1ZX6A 1RADB 1N8RR 3BHVB 4C8QF 1ZBJA 2E64A 4MFEA 4Z02A 3L2WA 4ZGJB 4R55A 2KGTA 4XTXA 4F17A 4XTUA 3E2UA 1V29B 3SD4A 3QIIA 4IMYB 1QKWA 4JRQA 1ZUUA 1VA7A 2COWA 1RL2A 2JGZB 1QVPA 3HRUA 4AT1B 5FRMA 3SEMA 4C5GA 4BBRM 4AFZC 3BY7A 2JMAA 3GIBA 4E7ZA 4PJJA 5GAMe 1KQ1A 2RK2A 4BCKB 3QHSA 2KI7A 2SRCA 4MDXA 1JOWA 3A5ZB 1OIUB 1QQJA 3CC4Q 4N0AC 3G4SA 3NTHA 1IGQA 1RABB 4X34A 2HSEB 4BCQB 1AWWA 1UJ0A 4QKUA 3CEYA 2CP3A 2BPMB 2J6FA 5D6YA 1UGVA 1QLBA 2QGSA 2QQ9A 4ROEA 2IN3A 1R77A 4CC3A 2K3YA 2K2MA 4NSTB 1I5LA 2PHGA 2RM4A 2Y90A 2KQWA 3CC2Q 3CCJT 2CH4A 4ZGEB 4CFUD 2DXUA 4PJNA 1EFNA 2Y4XA 5IXFA 3H0HA 5KE2A 2JMCA 4EPCA 4OB2B 2MOXA 2D8HA 2E3HA 5CKBA 2K6DA 2EIFA 1IREB 2DXBA 4RTWA 2QA4A 3PE0A 4PJOB 2E3IA 2GQVA 5GANf 1VYWB 4FM4B 2KE9A 1MGQA 5J26A 4ZGDB 2DL7A 1YJNT 4N4IA 2DMOA 3V7RA 1JU5C 3MEUA 4Z6YA 3MHXA 5GMKl 3LLRA 2UZDB 3P8HA 3CCSQ 1E6HA 2HL3A 4FYYB 5I22A 2GFAA 4PJOF 1OEBA 1RUWA 3FB9A 3FJ5A 3CD6A 3QWYA 2DIGA 5IAYA 2GTOA 4EMKC 2WSEE 3GF5A 3GLXA 3JB9J 2LDMA 4ZTFA 2L3QA 4LDYA 1VQ6Q 3O8VA 1JBMA 4II1A 4OMMA 2DTOA 4Z89A 2X9HA 3KFVA 1M90C 4JJDA 4JJCA 2LJ0A 4AI6A 4Y72B 5FROA 1MHNA 5FWCA 1LVKA 2LNVA 4LD9K 2WEVB 3CMAQ 2GNCA 1VQ5T 1PKSA 2MYSA 3JCMd 1W70A 3L2QA 1HSQA 3M53A 1R8OB 3UPUA 1PKTA 2C5VB 4C8QC 2ESWA 3CCVT 2E4HA 3GPLA 1SHFA 2M1HA 1GUXB 5GANh 4M7DG 1TG0A 3RNJA 1KC8C 1VQ8A 3JSCA 4ANJA 4M7AA 1E6GA 3OYAA 3CQTA 3MP1A 3NPFA 3MEAA 3CCLA 4LDWA 4R56A 1ZSZA 1JJ2S 2QYZA 5I11A 5CKHA 4M75E 5AT1B 3QWXX 2FHDA 3L2VA 3CC7A 1CSKA 1MMGA 2RHUA 5IT9E 2VXEA 4AKIA 4CFUB 4J9GA 1K9MC 4IUUA 2CP2A 2HKNA 3JV3A 2WIHB 1X6OA 3KBGA 4LOCA 3JB9G 5IHNA 1G8XA 5C0MA 4LN2A 2HSPA 3CCRQ 4DOVA 4A4HA 4FYWB 1NZ9A 1GCQC 2P4TA 4CC4B 3I56T 3RERA 4KGZB 1VQKA 2JVVA 3G6EA 3ER0A 3CCMQ 3DL1A 1JJ2A 3QJYA 3TW6A 3JCMV 3HRSA 8ATCB 1SRLA 4D6WA 2L3PA 2RK1A 3TW7A 3EGXB 3G6ET 3BDLA 2DD5B 2X3WD 2A0FB 1PNJA 2QTVA 3RMSA 4BI8B 4E47A 4EMGA 2LRQA 5LJ5d 1UTIA 4KRCB 4AMCA 2JS2A 3FRNA 3G71A 1GH6B 2DYBA 5CKEA 5FLXE 5CQYA 2FPDA 4L59A 2XKOC 2BS3A 4BE0A 4OGCA 1NJIC 1JXMA 1HYOA 2OTLQ 3G71T 2V1QA 2JT4A 2J06A 1GBRA 3QG1A 5HKCA 4M78A 4II5B 3DKMA 4JRKA 1BI0A 2OAUA 3HO8A 4EOIB 4BY6B 2EYQA 3QDRB 3EGXA 2V8KA 4C5IA 4ELYC 2BS4A 1JRIA 2RHXA 2KT8A 2DD5A 2HBWA 4PJOC 2FEIA 2VVKA 3V7CA 1TUCA 1S72Q 1EIFA 1Q7YU 3SFMA 2F2VA 2LP5A 4BUGA 3CPWS 5GAN7 4P5NA 4EDUA 2RJFA 4HNVA 1E7OA 4QVCA 2KXCA 3EHQA 2Z0WA 4RTZA 2KYMA 4B6MA 5IN1A 1WHMA 4FL6A 4BCFB 5GAN4 4BCGB 4J9DA 2ZCFB 3QHRB 2BTTA 1YWPA 1Q81U 1YCSB 1GFCA 4BDZA 3ULRB 2R58A 4AKHA 1ARKA 2O88A 2RHYA 2SEMA 5BNJB 4M75D 4ATOA 1EX4A 3JCMc 1OPKA 2Y4YA 1TH7A 3H6ZA 1XOVA 1K73U 5HBHB 1WLPB 1ZUKA 2L8DA 5CKDA 1VQNA 1WIEA 1X01A 4PFZA 3CCUT 2F5TX 3CPWA 3SDZA 3X20B 2HEQA 4JLGA 1QCNA 1UNLD 1VQPA 4UN0A 1YJWA 2JNGA 1VQNT 3G4SQ 1KQSS 4XK8E 2C5OB 4BCPB 3H9NA 2F1LA 2JJ9A 2VXFA 5IDPB 2VC8A 3RBBB 1X69A 2DEUA 1SRMA 2E65A 2JOYA 1AWXA 2KYBA 5HK3A 4MFDA 2VV5A 5KYWB 2B86A 3I5RA 4ELZC 1M2VB 3K7AM 2BE9B 1JJ2P 4FT2A 2NUPB 4LE9A 3LQ5B 1W6XA 1VYTA 1URCB 1K8AR 3BG9A 2QDYB 1IHVA 4QVDA 4HVVA 2G6FX 1M1KU 1UHCA 2G3RA 1WYXA 1N8RC 1OU9A 2K57A 1TTHB 3HBLA 3RMQA 2CZ6B 3HSBA 4RODA 2D0QB 2CREA 2QA4Q 4TTHA 1G83A 2QAZA 1RACB 1VQ7T 3VUZA 4FCYA 1FXXA 3QWLA 2A7YA 2BE7D 5LJ3g 1KHIA 4PFPA 4LXCA 1T0JA 2FPFA 4X9CA 1PD1A 3O5ZA 4OF1A 1M2VA 2ZGWA 1VUBA 4IUTA 2AHJB 4XTVA 1N9RA 2LQ8A 4NS5A 4A4EA 1OZ2A 3LGFA 1WZOA 1VYVA 3EG9A 1YIJA 1OKVB 3CC2T 3CD6Q 3G33B 1AWJA 3RDVA 3GTMS 3JB9I 1S1NA 4KUDK 2F5KA 1VQMQ 2W96A 1WFWA 3CBPA 1E9HB 3H4CA 4C92G 4F7LB 2F69A 2HNIA 5KCHA 1JSUB 2EWNA 3OMCA 2MWOA 2VWFA 4DBHA 1NYGA 2CCIB 4M75B 4JX5A 3LGLA 2EJFA 1WHJA 2RMOA 1Q7YR 4MZMA 4JJNK 4MIMA 5FU6B 4KUIA 5KYUB 2K2VA 1VQ8Q 2K3XA 2YRDA 2YRCA 2MI6A 2HKQB 4EMHA 3BLHB 3VS6A 3TN8B 4M77G 3VKGA 4M75F 4RG2A 3CCQQ 3BW1A 4QQDA 2FZKB 1Q81R 3CBMA 1M1GA 2MCNA 1H641 4JUVA 3CCLQ 2ZZDB 1PD0A 3CPWP 2EQMA 4HCCA 2QG9B 3QPHA 4CFMB 1BCOA 5HY6A 1B07A 2RA2A 2PZ1A 1WXTA 2ABLA 2RJDA 4M75A 1N4MA 3CC7Q 3BHUB 5HBJB 5J39A 3DLMA 2MAMA 2DO3A 1K73R 1Q86R 2DNUA 1N5ZA 1OULA 2R57A 1K9AA 4JPBW 3A8GB 1UJYA 4PLLA 1H3HA 4VUBA 4HLQA 1WHKA 1YITT 4N0AA 4JS4A 5DLQE 1R0BG 2DA9A 1JB0E 5KYXB 5IF1B 1FYNA 2GBQA 1VQ9A 3L2RA 2CSIA 2D8JA 2ZZDA 5GAMj 1I0CA 4J8OA 2EQIA 2JTEA 2OTJQ 1VQKQ 4M7DE 1JO8A 1QP2A 3URGA 2DPPB 2RI3A 1VQOT 4XQ3A 4C5HA 1FWZA 2PJQA 1YHQA 3BLRB 4D8KA 1NPRA 1KQSP 3JCMQ 3OQ5A 4CFNB 1VQ4T 3V8KA 2BKZB 1PHTA 2LZ6B 2BKDN 1EZZB 3M54A 1GBQA 4CFVB 3HB9A 3EGDA 3V8JA 5KYXA 2EJ9A 5I2SA 4HT9A 1JEGA 2X35A 1AD6A 3MY5B 4XU2A 1O9KB 4F6WB 1I07A 4XAXB 5LJ3j 1AZEA 3CCEA 4PK4A 2EAYA 1G5VA 5A2QE 3A8OB 2HBPA 2UUEB 3NTIA 2MWPA 2KXDA 1D1BA 2EFIA 1I81A 4QW2A 3DDQB 3UDCA 2CSQA 3H0FA 4KGVB 4O5VA 5ACBA 4DEXA 2KVQG 1UUEA 2PQWA 2AIRB 3F5XB 1XNIA 1H25B 4XU1A 5A0GA 2HCKA 5GAN3 4HNTA 3LH0A 1A0NB 3PFSA 3O0GD 4QSHA 2DIQA 1UG1A 2YUQA 5GANg 2A3LA 4CXAB 1O9KA 2CZ1B 4EOSB 3NFCA 4XU0A 4BE2A 1SSFA 2XMFA 2X51A 4C8QA 1ZSGA 5GAN6 1J3TA 1SPKA 4KULA 4MDWA 3VU3C 4F7UG 3RIRA 1UDLA 2EYWA 5GMKe 1UNGD 4M75C 2HMAA 3TNHB 2QDLA 4ZNXA 2DXTA 1WX6A 2DTHA 1VQPQ 2CP6A 1YJWQ 2JN0A 4A63B 2OAWA 3HTRA 3BLQB 4OB1B 1T3LA 5FU6C 2RJCA 4J6XA 4E7SA 3FIFA 2E5QA 4IUPA 4OGEA 3KXTA 3CMET 9ATCB 1Z9QA 3EH1A 3PNWC 4M7DD 4EOOB 2K7AA 3GOXA 2V8JA 4BCMD 2RJEA 4F7UF 3M0TA 4GLKA 3L2UA 4C0DB 3CCJA 5GAOm 1CKBA 1MMDA 2HL5C 2KRSA 5GAOp 1H3ZA 3X25B 2ECZA 3OYFA 1OI9B 1ZBXA 2DF6A 1RAGB 2ED0A 1GCQA 2YUPA 5D6XA 2DFUA 2ATCB 2LW4A 2LTOA 4A4KA 3S3OA 1BI2A 3QYHB 2LMJA 1C9BA 1Y57A 2J05A 2XD0A 1K4US 2R5AA 1TS9A 3M0PA 1YJNA 3WXMB 3HFOA 1K1ZA 2WMAB 3JB9D 4OMNA 3OSSC 2LX7A 1NEBA 4J9IA 3M03A 2JTMA 5GMKi 3DB3A 1AT1B 3HL8A 1WXBA 2L89A 1YIJQ 5IDNB 2HQXA 3I5SA 3EFOB 4EONB 3PT9A 4RTUA 3POMA 1QW1A 3LW5E 3CXCS 2H3EB 1WQ7A 1FMKA 5LQFB 1C0MA 4LD6A 4RG8A 2IVXA 2COYA 3OYHA 1D09B 1KJWA 4BCHB 3TNIB 2CJMB 3JCMJ 4EOKB 4M7AG 5LJ3d 4PJOA 3EG1A 1VQ5A 2PK2A 3PO3S 1SHGA 2EJGA 3MEWA 3CCVA 1IXDA 3REAB 4C0FA 1H1PB 1WGSA 2FG0A 4BXXX 3M57A 3OSVA 3META 5HBEB 3HPWA 1OX8A 2BS2A 3EFOA 2I53A 2QI2A 3TNWB 5GAOr 5HCKA 2L5QA 5GANj 1K8AC 4EOPB 1M30A 4PJMA 2XDPA 4PNOA 3EG0A 2ROLA 3VKIA 3CXCA 2PK9B 1VQMT 4JX4A 2GTJA 1LOJA 4QVZA 2RPNA 2DZCA 2EQKA 4M7DB 1YN8A 3BE3A 4ELJA 4BCMB 4F7JB 1QVFS 4BCJB 4C92E 2ROTA 5ICPB 3VYGB 8AT1B 2RHZA 3MJXA 1TWBA 2RQVA 1KK7A 4O6JA 4RTYA 1IGUA 2QF7A 3J81E 1RAHB 3EG3A 4M7DF 2KBTA 2KDSA 1GXIE 2IW9B 5FWBA 2L0AA 3PVLA 1O75A 2E10A 1GUXA 1VQ9Q 1F5QB 3OW2S 1PM3A 3PMIA 4A53A 2K79A 4BCND 1WA7A 3I56A 2O31A 1KG1A 2AZSA 4LDXA 3I55Q 4JZ3A 2KSSA 3V7SA 2F2CA 3OYBA 1AZGB 1C1AA 1FMVA 4M7DA 1YHQQ 4M77E 3HP9A 1JSTB 4HL4A 3MP6A 3JAME 2RQUA 2RI5A 4BCOB 1QVFA 2ENMA 2W9FA 5IHKA 3JB9H 3DJBA 3L42A 4FYXB 4F16A 5A0LA 5LJ5f 1XQHA 2A36A 1Q7YC 1B3QA 2I2LA 3JB9F 4M78G 2HZYA 3M4YA 4C0DC 1U8RA 2KT1A 3RESA 4XTZA 4AFQC 3OYLA 3D7SB 3OW2A 3GP8A 1YJ9Q 1AWOA 1UECA 3IQLA 3CCEQ 2RF0A 1D1AA 2QQSA 2DMEA 2OTJT 1Q81C 5DM7R 2EGCA 2K5LA 1VQLT 2DERA 2QQAA 1I4K1 4AKGA 3HFNA 2LQWA 2JM9A 3ME9A 2KEAA 5L8RE 1KIKA 2PVGB 1Q95G 1ZLMA 3OA6A 2IW8B 2KK4A 2CZ0B 4CC2A 5IHIA 2EBPA 1NM7A 1PRMC 2J7IA 3H8ZA 2DBKA 1K73C 1Q86C 1PSFA 4Q5WA 2DVJA 1FMWA 1NYFA 4OVAA 3OYNA 1QVGS 5KH6A 2K3BA 5GAOn 4AFUC 2EYZA 4BE1A 5GJWB 5LJ5h 3BG5A 4MZPA 2DL3A 2EKHA 1OU8A 3CXCP 2QEXT 3UT1A 4EOLB 3M9QA 2AZVA 2C0TA 2XDBA 1U1SA 3QO3A 4D8DA 1KFZA 4F7NB 1SF9A 1SG5A 1ZA2B 2DM1A 4C92D 3VS7A 1YI2T 3QSUA 2DTIA 4A54A 3VJPA 2O4XB 3C4SA 3CCUA 1TUGB 5EJCA 3PMTA 3F70A 4GLMA 2B8AA 2J6KA 4BCNB 2LCCA 1U06A 1QVGA 2QDJA 1YP5A 1X6BA 4KRDB 5GANd 4DEYA 1WHLA 1BIBA 1PRLC 3NMZC 1JXOA 1WJRA 1BI3A 5CR2A 2PVDB 5GAMg 2HAXA 1ZUYA 5KYNA 3VRZA 1ZP2A 1YNZA 3CCJQ 4M77D 4RUGA 3J7AF 5D7UA 2CP7A 1TU0B 2UZEB 2O4XA 4BB7A 5L23A 4M7DC 1QVFP 3FLGA 2E6NA 4BI3A 3R6OA 4KRTA 3TU4K 4J6YA 2JM8A 1M3AA 3QXEB 4F7UE 1QLYA 4CFWB 4J7FA 3MPUB 3VV0A 1VQ7A 3EFSA 1M9SA 4HCZA 3CC4A 2LQKA 4RTXA 1MNDA 1VIFA 2BUDA 1IHWA 1PKDB 4RCCA 1BYMA 2QQRA 3OW2P 3TEEA 3VS4A 3M0UA 2P0QA 2EGAA 3CC4T 4MZTA 4BI4A 5GAN8 1KQSA 1NE8A 5KYWA 1KQ2A 3CC2A 1FKMA 1PWTA 2GCXA 2NUPA 1Y7XA 2O9VA 6AT1B 5HK0A 3M59A 5GMKm 2QQ8A 3VS0A 4ZN1A 3OYKA 4RTVA 3PTAA 5M9OA 4LUDA 3A8MB 5LJ5e 1B34B 2RN8A 3E1SA 2DL4A 1H26B 4XTWA 3HRTA 2UZBB 4J9HA 1D3BB 1MV0B 3SB2A 2G9XB 1VQ5Q 1RI9A 4OB3B 1BBZA 4C92B 1HXDA 2VGNA 1T0HA 4RMOA 3Q1JA 1GY3B 2A37A 1U5SA 2NUZA 2BZYA 3JRZA 3VYHB 3CCST 4GY5A 3LX7A 5LMKB 1I8FA 2JW4A 2GF7A 1H8KA 3M0RA 1TXQA 4Y28E 4PKCC 2BZ8A 2FVUA 4C92F 2V8IA 3MKDA 3EH2A 4EOMB 4FW2A 4F70B 4DBQA 1AOJA 5A0DA 3LWIA 1BU2A 2HDAA 2R7GA 2KMTA 1QVGP 1YWOA 2I40B 1VQ6T 3M0SA 2M02A 3GBQA 4M77B 4QT7A 4QQGA 1RAAB 3FDRA 2XI9A 4WTOB 4HXJA 1D0ZA 2CUDA 4JRPA 3E9GA 1ZA1B 1YITA 4M7AE 2D0NA 1LJOA 4E2FB 3QYGB 3CMAT 3LYIA 4A4GA 1AHJB 1H24B 3I35A 5KYUA 3MIAB 5HVYB 2NLUA 5CKFA 3QZ9B 4M77F 3I56Q 1WHHA 3TSWA 5GMKh 4M6VA 4EC8B 1U3OA 2YWWA 3RKXA 1VQOA 2A08A 5HNBB 1M27C 3OYYA 1VYUA 1X6GA 2K4YA 2C0OA 3L1AA 4YC3B 4M77A 4FU6A 3G6EQ 4BDYA 1TFBA 1M4ZA 2XDDA 4N4HA 1VQ4A 3AHUA 2H3JA 3VS3A 4CC7A 3VS1A 2YXYA 3L2ZA 2FZCB 2RQTA 1TD6A 2CKKA 2QXFA 4FYVB 4F04B 2EYXA 1YFNA 3GNFB 1QMZB 1M3CA 2O2OA 3MY1B 3JCMf 1W2BS 3LH5A 2LX9A 2X4YA 2ZPIB 2H8HA 1M1KR 2KRNA 2V26A 4X1VA 3PIPA 1UGPB 1VOLA 2CP0A 2X1NB 1K0SA 3EOCB 1IO6A 2C5NB 3G71Q 2P4RA 1OX9A 2VUBA 1Q82U 1H92A 1G3NC 2LQNA 1OI1A 4FW1A 2YT6A 1GFDA 2G77A 4WF2A 3EGUA 4A4FA 3R6NA 2W10A 3CCRT 4BY1X 1RI0A 1KD1U 1FINB 3G1JA 1Z9ZA 3QJ6A 2E41A 2LNHB 3FJPA 5GAOq 2F2WA 4J9FA 2XICA 2AT1B 3WVEB 2HQEA 2PUOB 1U1TA 3OYDA 4L5GA 3CCMT 1X2KA 4J83A 2QK0A 4X9DA 5CAIA 4RTTA 2RD1A 3A1PA 3KHIA 2OJ2A 4E7KA 4C8QG 1UHFA 4OMQA 3TREA 4DBFA 2MMPA 1W2BA 5GJVB 4HVWA 2YUNA 2NUTB 1ENWA 2PVOB 2DAQA 2OX7A 1R0CB 3PVQA 4DBRA 4ROCA 1W1FA 1H1QB 3BHTB 3SHWA 4HCBA 3JCMh 2JXBA 4M78E 1OL2B 2CZ7B 2O9SA 4KBMB 1O9SA 2KROA 2OTLT 2YDLA 2EQJA 4Z8AA 1MNEA 1S72A 5IXBA 2COZA 3OMGA 3CCUQ 2CDTA 1T3SA 2RI2A 4NL2A 3VS2A 1SKUB 4M7AD 4AG1C 2NUTA 1VQNQ 5I21A 1S72T 4C92C 4ELLA 3M56A 1PC0A 1ZHIA 3OYJA 1W98B 3DDPB 1X75C 2KR3A 4IIOA 2DL8A 4F7UB 3EG2A 4OP0A 2QTXA 4ZN3A 3CMEA 1PG5B 2WHBB 4YTLA 5DQWA 1BB9A 2V22B 3C0CA 4DQ2A 1PSEA 4FSSA 4F14A 2XU8A 3EJ1B 1FVVB 5EC7A 1XO2A 4LNPA 3DOGB 2E70A 4CI0C 5C6SA 1OIYB 1ABOA 3MCAB 2IW6B 4PJLA 4M77C 1Y96B 1WPYA 2K5FA 4I3ZB 1VQ7Q 2P0KA 4F7UA 1Y71A 2DXBB 2I0NA 1NBEB 1M2OA 2D1XA 1IB8A 2DL5A 3HHTB 2JUFA 2CH4W 3G4ST 2M0YA 4DOWA 2ZPFB 3M4GA 5GAMd 2W2HA 3DB4A 4B9XA 3VKHA 1RAIB 2YRVA 2BIVA 1I5OB 2P0PA 3RR6A 5KE3A 3QYBA 2DBMA 2DK3A 5LJ3e 4PJOG 1Y96A 1K76A 3OBYA 2XHCA 1Q82R 4AG2C 1TOVA 2DX1A 2NWMA 7AT1B 2EPDA 1W2BP 3EFRA 3JCMe 4EORB 4F7SB 2FO0A 1MUZA 3REBB 1KD1R 3VRYA 4V2SA 4JJBA 1IRXA 1D0XA 4ZTJA 4BACA 2BZXA 5ECAA 2QA4T 5LJ5g 4M78D 4C0GA 2P84A 2YLCA 1PCXA 4HKEA 3MEVA 3BDUA 4N4GA 4C5EA 2QGGA 2MPXC 2CCHB 4M7AB 4JZ4A 2DXCB 2QQBA 1BK2A 4C0ZA 1NPPA 3M55A 1VQMA 4EC9B 2JS0A 3CD6T 1M8VA 1OOTA 3C94A 4LDUA 3RKYA 1ZSZB 4FIBA 1UE9A 3QYEA 4J9CA 4FX3B 1OV3A 2DRMA 5CVIA 4M7AF 2K5IA 1VINA 2DRKA 1VOMA 4PL6A 1I1JA 4OMLA 1UFFA 1QCOA 4K11A 1YITQ 4J9BA 3B57A 2WIPB 1V76A 2L2PA 2YLBA 2DXCA 3CPFA 2O01E 3QHWB 3CCQA 4YOOA 3GNGA 4NL3A 2VKNA 3DTOA 2X4JA 4OMPA 2AKLA 1VQ8T 4TVRA 5FU7B 1VQOQ 4BCIB 1BIAA 2DE0X 5CCAA 4IUQA 1M90U 3E9FA 3CCQT 4FT4A 1UGSB 2EYYA 1TUDA 4J6WA 3HKSA 3ASKA 5FGKB 2AK5A 3CCLT 3CBOA 1QCFA 1OQKA 3OS2A 1VQ4Q 1NG2A 2D9TA 2RB6A 5I2MA 3VUBA 3EAEA 4IIMA 1M5Q1 3AT1B 3VYGA 2HQHA 3CC7T 3OS1A 1X27A 3PGGA 2M9UA 4Z88A 4HVUA 4F6SB 4BBSM 1K8AU 1OPLA 1KC8U 4WCIA 1AISB 4JLIA 1D1CA 4KH1B 1N6AA 3VS5A 1K0XA 2OTJA 2PNIA 1VQLA 2JTFA 3JCMW 4HT8A 2D6FA 4M4ZA 3UA6A 5J3BA 1D3UB 2JZ2A 4M78B 2EVRA 1UNHD 3X28B 2ZPEB 1VQKT 4J9EA 5HQ0B 1TSFA 5CEIB 3UWNA 3MP8A 3A8HB 5GAN5 4Y92A 1IZ6A 2F2XA 3WVDB 1H1RB 2YHTA 1K9MU 3X24B 5KYYB 4IUVA 3X26B 2IPOB 2C6TB 4CFXB 1H28B 5CQXA 2WACA 4M78F 4ME7A 2FRWA 2DLPA 1OZ3A 1G2BA 1Y0MA 4IKFA 3A8LB 4YOSA 4OMOA 1QWFA 3U23A 4IURA 2FPEA 1BU1A 1M3BA 3S6WA 4CRIA 2QEXA 2RQRA 3JCMX 2C0IA 3RUXA 5LJ5j 1G3WA 3OBWA 5LL6S 5FRNA 1OGUB 2PUKB 1YI2A 1BKBA 5GANe 4MMLA 4JS5A 2ZPHB 2B9RA 5KYYA 2E12A 1F1BB 4HA8A 2IVWA 2RO0A 2KNBB 1OL1B 1M1KC 4CRLB 3CMEQ 4KH0B 4JRIA 1NJIU 2DD4B 1HJDA 1QP3A 2ZAEA 4C8QE 2FB7A 2WXVB 4M7AC 4L6V5 2PMIB 1UB4A 4E6RA 5GAN2 3V8LA 2PTKA 2CYZB 1RLQC 2C06A 1WHGA 4EOQB 2DZ9A 2IIMA 2RH2A 2C4GB 3KUFA 1NLOC 1LCKA 2VB6A 1ACMB 4BY7X 3FC3A 1ZSZC 5EFQB 1M8MA 4FSXA 1Q86U 4EOJB 1RAEB 1HK9A 3TCJA 1NEGA 1KXUA 2VGMA 2XK0A 1X43A 3TQ7P 3G7ZA 2ED1A 5DQVA 4AFSC 3S3NA 1GRIA 3M58A 1WXUA 1M90R 2MIOA 5EG2A 2CT4A 1UGQB 2QFZA 1AD5A 2ZPBB 2LT1A 2DD4A 5IHYA 2VASA 1B7TA 4E7HA 2E1HA 1VQPT 1YJWT 2EQUA 5CYIB 5GAOl 1GL5A 3M0QA 1AEYA 3NTKA 1YJNQ 5D6WA 3C12A 2EKOA 3QZ5B 4RCBA 5FU7C 1QMCA 3INZA 3T9NA 1LPLA 2E6ZA 3OYEA 3NGPA 3ZFJA 1KC8R 4NC6A 3EG9B 1YCYA 1WI7A 3JCMP 1WQWA 4KGXB 5DLOA 1C6VX 4XTYA 2KRMA 3SWNB 5I5ZB 2MF2A 4G6LB 2DKGA 3OS0A 1N9SA 1G3YA 4DA4A 2EUFA 2DJQA 2YUOA 1KSWA 1P92A 2RHIA 3H41A 2CS7A 3A98A 4JDSA 2M0OA 1N27A 1OKWB 1QKXA 1MMNA 3P8BB 4YOZA 2QASA 2R5MA 3QKJA 3JCMg 1K9MR 1LNXA 3H0IA 3OYGA 3CCVQ 1SEMA 2V1RA 3OYIA 3CCSA 3OY9A 2LVMA 4M78C 1RLPC 2M16A 3QUIA 3TSZA 4HCKA 1KHCA 3SWNA 4M75G 1N8RU 2L3RA 2DVEA 1YIJT 2CP5A 1UGRB 2HD0A 3RGFB 1DJ7B 1VIEA 1VQ6A 2LT4A 1B34A 4R0KA 4EIKA 4PJOE 2CT3A 1H27B 4UC4A 1G3SA 2LCSA 5L2WB 2FYKA 2VYTA 4C8QD 1D3BA 2J6OA 1ZQ1A 3I9QA 3RKWA 5GAMf
chains in the Genus database with same CATH topology
2XDPA 4NL2A 1Q81U 3QBYA 4PNOA 2LCLA 4BDZA 3VKIA 3CXCA 3MO8A 5CO7A 3CMAA 4JX4A 1WNLA 2R58A 4AKHA 4J7IA 3P8DA 1LOJA 4C92A 4M7AD 5I21A 3OB9A 1S72T 4C92C 4QVZA 2RHYA 3M56A 1BI1A 2DZCA 2EQKA 4M75D 4ATOA 1ZHIA 3OYJA 4M7DB 3N5BB 1X75C 3JCMc 4F7UB 4QQ6A 4BY6C 1E7PA 4ELJA 4OP0A 1QVFS 2LC4A 4KT0E 2Y4YA 2QTXA 3ZEHA 4OMFB 4HNUA 1TH7A 4C92E 4ZN3A 3CMEA 3H6ZA 1XOVA 2KAFA 4YTLA 1K73U 4E7JA 3VYGB 3BG3A 2L8DA 2RHZA 4DQ2A 1WJSA 5CKDA 1PSEA 2PU9B 1VQNA 4PLIA 2XU8A 1X01A 2WSCE 3OYCA 3OS5A 3CCUT 2F5TX 3CPWA 3SDZA 3X20B 5GMKj 1Q82C 1FX7A 4JLGA 4O6JA 3M5AA 2QF7A 2E70A 3J81E 4CI0C 1VQPA 5C6SA 1YJWA 4M7DF 2KDSA 3MCAB 1GXIE 1KD1C 2JNGA 1VQNT 1O75A 2E10A 3OW2S 3PMIA 1KQSS 4A53A 4XK8E 2DEQA 2X4WA 5LJ3f 3I56A 2VXFA 4M77C 2VC8A 1Y96B 4JX6A 1WPYA 2DJZA 2K5FA 4NOYA 2JOYA 2E65A 1VQMT 1KG1A 4LDXA 5AYFA 3JCMb 5DY9A 2KSSA 3V7SA 4MFDA 1G3TA 2VV5A 5HK3A 3OYBA 2P0KA 4M7DA 4OB0B 4ELZC 4F7UA 2X4XA 1Y71A 2DXBB 4M77E 1YBYA 3HP9A 4FT2A 4HL4A 3MP6A 3JAME 2RI5A 3HHTB 2JUFA 1OYXA 5GAMh 1QVFA 5CK9A 2FL7A 3BG9A 3JB9H 2QDYB 4B9WA 4QVDA 3LWHA 3HZJA 3L42A 4MMKA 3I55A 3G4ST 3CCRA 1VQ9T 4DOWA 4J5YA 1M1KU 5A0LA 5LJ5f 1XQHA 2G3RA 2WJ9A 2ZPFB 3M4GA 4RKUE 4BD3A 3DB4A 5GAMd 1N8RC 2K57A 4B9XA 1Q7YC 4LDVA 3HBLA 3VKHA 2I2LA 2YRVA 2BIVA 3RMQA 2IG0A 2CZ6B 2GFUA 4XU3A 1K8AC 3HSBA 4M78G 3JB9F 2P0PA 2D0QB 3CCMA 3I55T 3M4YA 4C0DC 1U8RA 5KE3A 3VUZA 3RESA 3QYBA 4XTZA 4EMKB 2DK3A 3OYLA 4E7LA 5LJ3e 1FXXA 3QWLA 1M1FA 2A7YA 4PJOG 5LJ3g 1Y96A 3GP8A 3OW2A 1KHIA 1YHQT 1XTDA 3OBYA 2QQSA 4X9CA 2XHCA 2OTJT 4OF1A 2KR6A 5CIUA 5DM7R 1Q81C 2ZGWA 1K8AU 2K5LA 1VUBA 2AHJB 2QQAA 2WSFE 1I4K1 4IUTA 1N9RA 4XTVA 4Y91A 1VQLT 4AKGA 1Y07A 3EFRA 3JCMe 3PIOA 2XG8D 3HFNA 2LQ8A 2KMGA 3ME9A 4NS5A 4A4EA 5L8RE 1YJ9A 4E7IA 4V2SA 1OZ2A 3LGFA 5LJ3h 2PVGB 1YIJA 3CC2T 4ZTJA 4BACA 3OA6A 2KK4A 2CZ0B 2QA4T 2XIDA 5LJ5g 4M78D 4C0GA 3JB9I 4KUDK 2F5KA 3H8ZA 1K73C 1Q86C 1PSFA 3CBPA 4C8QB 4Q5WA 3H4CA 5KCOA 4C92G 1YJ9T 2F69A 2YLCA 3SWNC 2OTLA 3DLLA 2HNIA 1UEBA 4OVAA 5KCHA 1W4SA 3OYNA 2KY9A 3CCET 4PJOD 3C95A 3OYMA 3E19A 1QVGS 3J80E 5KH6A 4EMKA 4HKEA 5GAOn 2EWNA 3ZBDA 3MEVA 3BDUA 3S3MA 3OMCA 2CGHA 4N4GA 4C5EA 4M7AB 4BE1A 2DXCB 2MWOA 1WJQA 2QQBA 3FEOA 3BFMA 1NPPA 3BG5A 2ZPGB 4JX5A 3LGLA 2EJFA 3M55A 4M75B 4MZPA 5LJ5h 1VQMA 3CD6T 1M8VA 3C94A 4LDUA 4MZMA 4C8QF 3RKYA 2QEXT 2E64A 3UT1A 4JJNK 4MFEA 3M9QA 4FIBA 4MIMA 4Z02A 4KUIA 3QYEA 5FU6B 2XDBA 3L2WA 4ZGJB 1U1SA 3QO3A 2K2VA 5CVIA 4R55A 4XTXA 2K3XA 4XTUA 4M7AF 2K5IA 4C92D 2MI6A 4EMHA 1YI2T 3QSUA 2DTIA 4M77G 3VKGA 4M75F 4RG2A 4PL6A 2O4XB 3VJPA 3C4SA 3BW1A 4QQDA 3CCUA 5EJCA 1V29B 3CBMA 1M1GA 3PMTA 1H641 3SD4A 3F70A 3QIIA 4JUVA 2ZZDB 2EQMA 2B8AA 4HCCA 3QPHA 2LCCA 2YLBA 4JRQA 1QVGA 2QDJA 5HY6A 2DXCA 3CPFA 2RA2A 1RL2A 2O01E 2RJDA 4M75A 1QVPA 3HRUA 5GANd 3CCQA 3GNGA 5J39A 4NL3A 5FRMA 4C5GA 2X4JA 1BIBA 4BBRM 3DLMA 3BY7A 1VQ8T 2MAMA 2DO3A 4TVRA 1WJRA 5FU7B 1BI3A 3GIBA 2R57A 5CR2A 2PVDB 5GAMe 1KQ1A 2RK2A 5GAMg 1BIAA 3QHSA 3A8GB 4PLLA 5CCAA 2HAXA 4IUQA 1M90U 3E9FA 4VUBA 3CCQT 4MDXA 4FT4A 4HLQA 4M77D 1UGSB 3A5ZB 4J6WA 3HKSA 3ASKA 1YITT 3J7AF 1VQ7A 3CCLT 4N0AA 4JS4A 5DLQE 3CBOA 3OS2A 1JB0E 2O4XA 4N0AC 4BB7A 2D9TA 3G4SA 1VQ9A 3NTHA 4M7DC 3FLGA 4X34A 2RB6A 2E6NA 5I2MA 3VUBA 3L2RA 3EAEA 4BI3A 1M5Q1 3R6OA 2ZZDA 3CEYA 3TU4K 4J6YA 5GAMj 3VYGA 3CC7T 4J8OA 3OS1A 3PGGA 2M9UA 4M7DE 5D6YA 3QXEB 1QP2A 3URGA 4F7UE 1QLBA 2QQ9A 4J7FA 3VV0A 2DPPB 4BBSM 3EFSA 1M9SA 2RI3A 4HCZA 4XQ3A 2K3YA 4C5HA 1FWZA 1VQOT 1KC8U 3CC4A 1YHQA 1I5LA 2LQKA 2Y90A 2RM4A 4JLIA 1VIFA 2BUDA 2KQWA 3CCJT 1N6AA 4RCCA 4ZGEB 2QQRA 1BYMA 3TEEA 1NPRA 2DXUA 2OTJA 2P0QA 3JCMQ 2Y4XA 3OQ5A 1VQ4T 3CC4T 1VQLA 2JTFA 3V8KA 4MZTA 5KE2A 4BI4A 3JCMW 5GAN8 4HT8A 1KQSA 2D6FA 1NE8A 5J3BA 2BKDN 3M54A 3HB9A 2JZ2A 4M78B 3V8JA 4OB2B 5CKBA 4EPCA 1KQ2A 3X28B 3CC2A 1FKMA 2EJ9A 2EIFA 2GCXA 1IREB 2ZPEB 2DXBA 1VQKT 2QA4A 5I2SA 3UWNA 1Y7XA 4HT9A 3MP8A 3A8HB 5HK0A 4PJOB 2GQVA 5GAN5 1IZ6A 2X35A 3M59A 5GMKm 5GANf 4FM4B 3WVDB 2QQ8A 1MGQA 5J26A 4ZN1A 4XU2A 4ZGDB 3OYKA 2YHTA 5LJ3j 4XAXB 1K9MU 3X24B 3CCEA 1YJNT 3PTAA 4IUVA 5M9OA 2EAYA 4N4IA 3X26B 3V7RA 3MEUA 3A8MB 4Z6YA 3MHXA 1B34B 5GMKl 5LJ5e 5A2QE 3LLRA 3A8OB 2HBPA 3P8HA 3E1SA 5CQXA 3NTIA 2WACA 2MWPA 4M78F 2EFIA 1I81A 4XTWA 4ME7A 4QW2A 3HRTA 3UDCA 1VQ7T 2GFAA 1OZ3A 1D3BB 4IKFA 3A8LB 4O5VA 3SB2A 4PJOF 4IURA 3FB9A 3CD6A 2DIGA 5IAYA 2KVQG 3S6WA 4EMKC 4CRIA 2PQWA 2WSEE 3GF5A 2QEXA 4OB3B 3JCMX 1XNIA 3GLXA 4C92B 3JB9J 2LDMA 4XU1A 1HXDA 4ZTFA 3RUXA 5LJ5j 5A0GA 4LDYA 3O8VA 1JBMA 5GAN3 1G3WA 3OBWA 4HNTA 3LH0A 5LL6S 4II1A 2DTOA 2VGNA 4RMOA 3Q1JA 1M90C 3PFSA 5FRNA 2PUKB 4QSHA 1YI2A 2DIQA 1BKBA 3JRZA 3VYHB 4AI6A 5GANe 5FROA 4MMLA 1MHNA 5GANg 3CCST 2A3LA 4GY5A 4JS5A 3LX7A 2ZPHB 1I8FA 2GF7A 2LNVA 4LD9K 2E12A 2CZ1B 4Y28E 4PKCC 3NFCA 4HA8A 2FVUA 1VQ5T 4XU0A 4BE2A 1SSFA 4C92F 3JCMd 3L2QA 2V8IA 3M53A 1R8OB 4C8QA 5A0DA 2IVWA 3UPUA 3LWIA 2RO0A 5GAN6 4C8QC 3CCVT 2KMTA 4KULA 4MDWA 3GPLA 3VU3C 2M1HA 1M1KC 5GANh 1VQ6T 4M7DG 1KC8C 1VQ8A 4F7UG 3JSCA 4JRIA 4M7AA 4M77B 1NJIU 2DD4B 3RIRA 1QP3A 4QQGA 4C8QE 2FB7A 4M7AC 3FDRA 2XI9A 5GMKe 3OYAA 4L6V5 1UB4A 5GAN2 3V8LA 2CYZB 4M75C 2C06A 2DZ9A 3MP1A 4JRPA 3E9GA 3MEAA 2DXTA 1YITA 2RH2A 3CCLA 4M7AE 3KUFA 2DTHA 4LDWA 1LJOA 4R56A 3QYGB 2JN0A 1JJ2S 3CMAT 1G5VA 3FC3A 5CKHA 3LYIA 4M75E 4A4GA 1AHJB 2FHDA 4FSXA 1Q86U 4OB1B 5FU6C 1HK9A 2NLUA 2RJCA 5CKFA 3TCJA 3L2VA 3QZ9B 4M77F 4J6XA 3CC7A 2VGMA 2XK0A 3FIFA 2E5QA 5GMKh 4M6VA 3G7ZA 4IUPA 2RHUA 4OGEA 3KXTA 3CMET 5IT9E 3RKXA 3PNWC 4M7DD 2VXEA 4AKIA 3S3NA 1VQOA 3GOXA 2V8JA 3M58A 1K9MC 2RJEA 4F7UF 3L2UA 4GLKA 3OYYA 4IUUA 4C0DB 5EG2A 2K4YA 1X6OA 1UGQB 3KBGA 2QFZA 4LOCA 3CCJA 3JB9G 3L1AA 5GAOm 5GAOp 2ZPBB 2LT1A 4M77A 1H3ZA 2DD4A 4FU6A 5C0MA 3X25B 4E7HA 4BDYA 1M4ZA 2E1HA 2XDDA 4N4HA 1VQPT 1VQ4A 3AHUA 2H3JA 3OYFA 1YJWT 2EQUA 1ZBXA 5GAOl 3L2ZA 2CKKA 2QXFA 3NTKA 4DOVA 4A4HA 5D6XA 1NZ9A 5D6WA 3C12A 2EKOA 3GNFB 3QZ5B 2P4TA 4RCBA 2LTOA 5FU7C 3I56T 3RERA 4A4KA 3JCMf 3S3OA 1W2BS 1VQKA 3INZA 1BI2A 3QYHB 2JVVA 2LX9A 2X4YA 3T9NA 3G6EA 2ZPIB 3ER0A 2E6ZA 3DL1A 3OYEA 1JJ2A 3ZFJA 3QJYA 2XD0A 4NC6A 3PIPA 1UGPB 3TW6A 3HRSA 3JCMV 1YCYA 2R5AA 3JCMP 1WQWA 4D6WA 5DLOA 1YJNA 3WXMB 3HFOA 2RK1A 3TW7A 2VUBA 4XTYA 3G6ET 3JB9D 3SWNB 3OSSC 2MF2A 1Q82U 2DKGA 2DD5B 1N9SA 1OI1A 1G3YA 3BDLA 3OS0A 2G77A 4WF2A 4A4FA 2JTMA 4DA4A 5GMKi 3RMSA 4BI8B 3CCRT 4E47A 1RI0A 3DB3A 4EMGA 2LRQA 1P92A 3HL8A 1KD1U 2RHIA 3QJ6A 5LJ5d 2E41A 3FJPA 5GAOq 2CS7A 4JDSA 2M0OA 1N27A 2L89A 2XICA 3FRNA 3G71A 5CKEA 5FLXE 3WVEB 2HQEA 5CQYA 4L59A 2PUOB 1U1TA 3OYDA 4L5GA 3CCMT 2XKOC 2HQXA 2BS3A 3P8BB 4J83A 4X9DA 5CAIA 4BE0A 4OGCA 3PT9A 1NJIC 2RD1A 1QW1A 2R5MA 3LW5E 3CXCS 3QKJA 3JCMg 3KHIA 4E7KA 1LNXA 4C8QG 1WQ7A 3OYGA 3G71T 4A54A 3TREA 2MMPA 1W2BA 4LD6A 4RG8A 3QG1A 3OYIA 3CCSA 5HKCA 4M78A 3OYHA 2PVOB 3OY9A 3DKMA 2DAQA 2LVMA 4JRKA 4M78C 1BI0A 2OAUA 3HO8A 4BY6B 4C5IA 2EYQA 2M16A 3QDRB 2V8KA 3QUIA 4ELYC 3JCMJ 1KHCA 4M7AG 2BS4A 3SWNA 1JRIA 5LJ3d 4C0ZA 1VQ5A 4PJOA 2RHXA 2DD5A 4M75G 4PJOC 1N8RU 2L3RA 2DVEA 3V7CA 1EIFA 2EJGA 3JCMh 1YIJT 3SFMA 1Q7YU 1UGRB 2HD0A 4M78E 4HCBA 4BUGA 3MEWA 3CCVA 3CPWS 5GAN7 4P5NA 2CZ7B 1DJ7B 1VIEA 4KBMB 4C0FA 4EDUA 1VQ6A 2LT4A 4HNVA 1B34A 2RJFA 1WGSA 4QVCA 4PJOE 1O9SA 3OSVA 3M57A 4UC4A 2OTLT 1G3SA 2EQJA 3META 5IN1A 3HPWA 2BS2A 2FYKA 2VYTA 4FL6A 4C8QD 1S72A 1D3BA 2QI2A 5GAN4 5GAOr 2ZCFB 3OMGA 2L5QA 1ZQ1A 5GANj 2RI2A 3RKWA 5GAMf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSF A;  1UGQ B;  4OB2 B;  3X28 B;  2ZPB B;  1IRE B;  2ZPE B;  2DXB A;  2DD4 A;  3X25 B;  2DXC B;  3A8H B;  4KT0 E;  4FM4 B;  2ZPG B;  3WVD B;  3VYG B;  4ZGD B;  1PSE A;  3X24 B;  2PU9 B;  3QZ5 B;  2WSC E;  3X26 B;  3A8M B;  3X20 B;  3A8O B;  3QYH B;  2ZPI B;  4ZGJ B;  1GXI E;  1UGP B;  3A8L B;  4XK8 E;  2WSE E;  4OB3 B;  1V29 B;  2DD5 B;  2ZZD B;  4OB0 B;  2DXB B;  2PUK B;  2DXC A;  2O01 E;  3VYH B;  3WVE B;  3HHT B;  2PUO B;  2ZPH B;  2QDY B;  2CZ1 B;  4Y28 E;  3LW5 E;  2PVD B;  4RKU E;  2ZPF B;  3A8G B;  1UGS B;  2CZ6 B;  2D0Q B;  2PVO B;  1JB0 E;  2DD4 B;  1QP3 A;  2DD5 A;  2ZZD A;  4L6V 5;  1UGR B;  3VYG A;  2CYZ B;  2CZ7 B;  3QXE B;  1DJ7 B;  1QP2 A;  2AHJ B;  2WSF E;  2DPP B;  3QYG B;  1AHJ B;  5L8R E;  4OB1 B;  2PVG B;  3QZ9 B;  4ZGE B;  2ZCF B;  2CZ0 B; 
#chains in the Genus database with same CATH topology
 3QBY A;  2LCL A;  2X3X D;  3MO8 A;  5CO7 A;  2OI3 A;  2EGE A;  1WNL A;  3CMA A;  4J7I A;  4C92 A;  3P8D A;  1MMA A;  3OB9 A;  4F6U B;  1HD3 A;  1BI1 A;  3UAT A;  1P5E B;  3N5B B;  4QQ6 A;  4BY6 C;  1E7P A;  2LC4 A;  4KT0 E;  3TVT A;  3ZEH A;  4OMF B;  4HNU A;  2CUB A;  2GQI A;  1NJI R;  2KAF A;  2RNA A;  4E7J A;  1JQQ A;  2MK5 A;  3BG3 A;  1WJS A;  3UF4 A;  1QWE A;  2PU9 B;  4PLI A;  2QGF B;  2WSC E;  3OYC A;  3OS5 A;  1Q82 C;  2E5K A;  5GMK j;  1H4L D;  1FX7 A;  2K9G A;  3M5A A;  2L3S A;  4GBQ A;  2DIL A;  2M51 A;  1KD1 C;  2W99 A;  2FZG B;  2DEQ A;  2WFY B;  2X4W A;  5LJ3 f;  2RQW A;  2FRY A;  4JX6 A;  2DJZ A;  2W0Z A;  4NOY A;  5FW9 A;  2A28 A;  5AYF A;  3JCM b;  1AVZ C;  5DY9 A;  1G3T A;  2GGR A;  3EGD B;  1XJW B;  4OB0 B;  2X4X A;  3EHR A;  1NLP C;  1YBY A;  1WDX A;  2AKK A;  4OGR B;  1CKA A;  5GAM h;  1OYX A;  5CK9 A;  2FL7 A;  4OR5 B;  3NHN A;  1D0Y A;  4B9W A;  1VQL Q;  3LWH A;  3HZJ A;  1RAF B;  4MMK A;  3I55 A;  3CCR A;  1VQ9 T;  4J5Y A;  4ESR A;  2WJ9 A;  4RKU E;  4BD3 A;  3QDF A;  4LUE A;  1H1S B;  4LDV A;  2IG0 A;  2GFU A;  1MV3 A;  4XU3 A;  4BCQ D;  5IH2 A;  3CCM A;  2DET A;  3I55 T;  3UA7 A;  4EMK B;  4E7L A;  2UZL B;  1M1F A;  3ZL7 C;  1YHQ T;  3NDQ A;  1X2Q A;  1GCP A;  1XTD A;  2KR6 A;  5CIU A;  3MI9 B;  2WSF E;  4Y91 A;  1SSH A;  4ORZ A;  2WPA B;  1Y07 A;  1BCM A;  3PIO A;  2XG8 D;  2KMG A;  1YJ9 A;  4E7I A;  2W9Z A;  5LJ3 h;  2EW3 A;  2YSQ A;  2QEX Q;  2XID A;  1ABQ A;  4PFO A;  1V1C A;  4C8Q B;  5KCO A;  2WMB B;  1YJ9 T;  2OTL A;  3SWN C;  3DLL A;  4PJO D;  2C5X B;  1UEB A;  3CCE T;  1W4S A;  2KY9 A;  3C95 A;  3OYM A;  3E19 A;  1YI2 Q;  3J80 E;  4EMK A;  1JKW A;  3ZBD A;  3S3M A;  2DYI A;  2CGH A;  2LJ1 A;  3THK A;  2NYS A;  3EID B;  1WJQ A;  3FEO A;  3BFM A;  2ZPG B;  2LJ3 A;  1ZX6 A;  1RAD B;  1N8R R;  3BHV B;  4C8Q F;  1ZBJ A;  2E64 A;  4MFE A;  4Z02 A;  3L2W A;  4ZGJ B;  4R55 A;  2KGT A;  4XTX A;  4F17 A;  4XTU A;  3E2U A;  1V29 B;  3SD4 A;  3QII A;  4IMY B;  1QKW A;  4JRQ A;  1ZUU A;  1VA7 A;  2COW A;  1RL2 A;  2JGZ B;  1QVP A;  3HRU A;  4AT1 B;  5FRM A;  3SEM A;  4C5G A;  4BBR M;  4AFZ C;  3BY7 A;  2JMA A;  3GIB A;  4E7Z A;  4PJJ A;  5GAM e;  1KQ1 A;  2RK2 A;  4BCK B;  3QHS A;  2KI7 A;  2SRC A;  4MDX A;  1JOW A;  3A5Z B;  1OIU B;  1QQJ A;  3CC4 Q;  4N0A C;  3G4S A;  3NTH A;  1IGQ A;  1RAB B;  4X34 A;  2HSE B;  4BCQ B;  1AWW A;  1UJ0 A;  4QKU A;  3CEY A;  2CP3 A;  2BPM B;  2J6F A;  5D6Y A;  1UGV A;  1QLB A;  2QGS A;  2QQ9 A;  4ROE A;  2IN3 A;  1R77 A;  4CC3 A;  2K3Y A;  2K2M A;  4NST B;  1I5L A;  2PHG A;  2RM4 A;  2Y90 A;  2KQW A;  3CC2 Q;  3CCJ T;  2CH4 A;  4ZGE B;  4CFU D;  2DXU A;  4PJN A;  1EFN A;  2Y4X A;  5IXF A;  3H0H A;  5KE2 A;  2JMC A;  4EPC A;  4OB2 B;  2MOX A;  2D8H A;  2E3H A;  5CKB A;  2K6D A;  2EIF A;  1IRE B;  2DXB A;  4RTW A;  2QA4 A;  3PE0 A;  4PJO B;  2E3I A;  2GQV A;  5GAN f;  1VYW B;  4FM4 B;  2KE9 A;  1MGQ A;  5J26 A;  4ZGD B;  2DL7 A;  1YJN T;  4N4I A;  2DMO A;  3V7R A;  1JU5 C;  3MEU A;  4Z6Y A;  3MHX A;  5GMK l;  3LLR A;  2UZD B;  3P8H A;  3CCS Q;  1E6H A;  2HL3 A;  4FYY B;  5I22 A;  2GFA A;  4PJO F;  1OEB A;  1RUW A;  3FB9 A;  3FJ5 A;  3CD6 A;  3QWY A;  2DIG A;  5IAY A;  2GTO A;  4EMK C;  2WSE E;  3GF5 A;  3GLX A;  3JB9 J;  2LDM A;  4ZTF A;  2L3Q A;  4LDY A;  1VQ6 Q;  3O8V A;  1JBM A;  4II1 A;  4OMM A;  2DTO A;  4Z89 A;  2X9H A;  3KFV A;  1M90 C;  4JJD A;  4JJC A;  2LJ0 A;  4AI6 A;  4Y72 B;  5FRO A;  1MHN A;  5FWC A;  1LVK A;  2LNV A;  4LD9 K;  2WEV B;  3CMA Q;  2GNC A;  1VQ5 T;  1PKS A;  2MYS A;  3JCM d;  1W70 A;  3L2Q A;  1HSQ A;  3M53 A;  1R8O B;  3UPU A;  1PKT A;  2C5V B;  4C8Q C;  2ESW A;  3CCV T;  2E4H A;  3GPL A;  1SHF A;  2M1H A;  1GUX B;  5GAN h;  4M7D G;  1TG0 A;  3RNJ A;  1KC8 C;  1VQ8 A;  3JSC A;  4ANJ A;  4M7A A;  1E6G A;  3OYA A;  3CQT A;  3MP1 A;  3NPF A;  3MEA A;  3CCL A;  4LDW A;  4R56 A;  1ZSZ A;  1JJ2 S;  2QYZ A;  5I11 A;  5CKH A;  4M75 E;  5AT1 B;  3QWX X;  2FHD A;  3L2V A;  3CC7 A;  1CSK A;  1MMG A;  2RHU A;  5IT9 E;  2VXE A;  4AKI A;  4CFU B;  4J9G A;  1K9M C;  4IUU A;  2CP2 A;  2HKN A;  3JV3 A;  2WIH B;  1X6O A;  3KBG A;  4LOC A;  3JB9 G;  5IHN A;  1G8X A;  5C0M A;  4LN2 A;  2HSP A;  3CCR Q;  4DOV A;  4A4H A;  4FYW B;  1NZ9 A;  1GCQ C;  2P4T A;  4CC4 B;  3I56 T;  3RER A;  4KGZ B;  1VQK A;  2JVV A;  3G6E A;  3ER0 A;  3CCM Q;  3DL1 A;  1JJ2 A;  3QJY A;  3TW6 A;  3JCM V;  3HRS A;  8ATC B;  1SRL A;  4D6W A;  2L3P A;  2RK1 A;  3TW7 A;  3EGX B;  3G6E T;  3BDL A;  2DD5 B;  2X3W D;  2A0F B;  1PNJ A;  2QTV A;  3RMS A;  4BI8 B;  4E47 A;  4EMG A;  2LRQ A;  5LJ5 d;  1UTI A;  4KRC B;  4AMC A;  2JS2 A;  3FRN A;  3G71 A;  1GH6 B;  2DYB A;  5CKE A;  5FLX E;  5CQY A;  2FPD A;  4L59 A;  2XKO C;  2BS3 A;  4BE0 A;  4OGC A;  1NJI C;  1JXM A;  1HYO A;  2OTL Q;  3G71 T;  2V1Q A;  2JT4 A;  2J06 A;  1GBR A;  3QG1 A;  5HKC A;  4M78 A;  4II5 B;  3DKM A;  4JRK A;  1BI0 A;  2OAU A;  3HO8 A;  4EOI B;  4BY6 B;  2EYQ A;  3QDR B;  3EGX A;  2V8K A;  4C5I A;  4ELY C;  2BS4 A;  1JRI A;  2RHX A;  2KT8 A;  2DD5 A;  2HBW A;  4PJO C;  2FEI A;  2VVK A;  3V7C A;  1TUC A;  1S72 Q;  1EIF A;  1Q7Y U;  3SFM A;  2F2V A;  2LP5 A;  4BUG A;  3CPW S;  5GAN 7;  4P5N A;  4EDU A;  2RJF A;  4HNV A;  1E7O A;  4QVC A;  2KXC A;  3EHQ A;  2Z0W A;  4RTZ A;  2KYM A;  4B6M A;  5IN1 A;  1WHM A;  4FL6 A;  4BCF B;  5GAN 4;  4BCG B;  4J9D A;  2ZCF B;  3QHR B;  2BTT A;  1YWP A;  1Q81 U;  1YCS B;  1GFC A;  4BDZ A;  3ULR B;  2R58 A;  4AKH A;  1ARK A;  2O88 A;  2RHY A;  2SEM A;  5BNJ B;  4M75 D;  4ATO A;  1EX4 A;  3JCM c;  1OPK A;  2Y4Y A;  1TH7 A;  3H6Z A;  1XOV A;  1K73 U;  5HBH B;  1WLP B;  1ZUK A;  2L8D A;  5CKD A;  1VQN A;  1WIE A;  1X01 A;  4PFZ A;  3CCU T;  2F5T X;  3CPW A;  3SDZ A;  3X20 B;  2HEQ A;  4JLG A;  1QCN A;  1UNL D;  1VQP A;  4UN0 A;  1YJW A;  2JNG A;  1VQN T;  3G4S Q;  1KQS S;  4XK8 E;  2C5O B;  4BCP B;  3H9N A;  2F1L A;  2JJ9 A;  2VXF A;  5IDP B;  2VC8 A;  3RBB B;  1X69 A;  2DEU A;  1SRM A;  2E65 A;  2JOY A;  1AWX A;  2KYB A;  5HK3 A;  4MFD A;  2VV5 A;  5KYW B;  2B86 A;  3I5R A;  4ELZ C;  1M2V B;  3K7A M;  2BE9 B;  1JJ2 P;  4FT2 A;  2NUP B;  4LE9 A;  3LQ5 B;  1W6X A;  1VYT A;  1URC B;  1K8A R;  3BG9 A;  2QDY B;  1IHV A;  4QVD A;  4HVV A;  2G6F X;  1M1K U;  1UHC A;  2G3R A;  1WYX A;  1N8R C;  1OU9 A;  2K57 A;  1TTH B;  3HBL A;  3RMQ A;  2CZ6 B;  3HSB A;  4ROD A;  2D0Q B;  2CRE A;  2QA4 Q;  4TTH A;  1G83 A;  2QAZ A;  1RAC B;  1VQ7 T;  3VUZ A;  4FCY A;  1FXX A;  3QWL A;  2A7Y A;  2BE7 D;  5LJ3 g;  1KHI A;  4PFP A;  4LXC A;  1T0J A;  2FPF A;  4X9C A;  1PD1 A;  3O5Z A;  4OF1 A;  1M2V A;  2ZGW A;  1VUB A;  4IUT A;  2AHJ B;  4XTV A;  1N9R A;  2LQ8 A;  4NS5 A;  4A4E A;  1OZ2 A;  3LGF A;  1WZO A;  1VYV A;  3EG9 A;  1YIJ A;  1OKV B;  3CC2 T;  3CD6 Q;  3G33 B;  1AWJ A;  3RDV A;  3GTM S;  3JB9 I;  1S1N A;  4KUD K;  2F5K A;  1VQM Q;  2W96 A;  1WFW A;  3CBP A;  1E9H B;  3H4C A;  4C92 G;  4F7L B;  2F69 A;  2HNI A;  5KCH A;  1JSU B;  2EWN A;  3OMC A;  2MWO A;  2VWF A;  4DBH A;  1NYG A;  2CCI B;  4M75 B;  4JX5 A;  3LGL A;  2EJF A;  1WHJ A;  2RMO A;  1Q7Y R;  4MZM A;  4JJN K;  4MIM A;  5FU6 B;  4KUI A;  5KYU B;  2K2V A;  1VQ8 Q;  2K3X A;  2YRD A;  2YRC A;  2MI6 A;  2HKQ B;  4EMH A;  3BLH B;  3VS6 A;  3TN8 B;  4M77 G;  3VKG A;  4M75 F;  4RG2 A;  3CCQ Q;  3BW1 A;  4QQD A;  2FZK B;  1Q81 R;  3CBM A;  1M1G A;  2MCN A;  1H64 1;  4JUV A;  3CCL Q;  2ZZD B;  1PD0 A;  3CPW P;  2EQM A;  4HCC A;  2QG9 B;  3QPH A;  4CFM B;  1BCO A;  5HY6 A;  1B07 A;  2RA2 A;  2PZ1 A;  1WXT A;  2ABL A;  2RJD A;  4M75 A;  1N4M A;  3CC7 Q;  3BHU B;  5HBJ B;  5J39 A;  3DLM A;  2MAM A;  2DO3 A;  1K73 R;  1Q86 R;  2DNU A;  1N5Z A;  1OUL A;  2R57 A;  1K9A A;  4JPB W;  3A8G B;  1UJY A;  4PLL A;  1H3H A;  4VUB A;  4HLQ A;  1WHK A;  1YIT T;  4N0A A;  4JS4 A;  5DLQ E;  1R0B G;  2DA9 A;  1JB0 E;  5KYX B;  5IF1 B;  1FYN A;  2GBQ A;  1VQ9 A;  3L2R A;  2CSI A;  2D8J A;  2ZZD A;  5GAM j;  1I0C A;  4J8O A;  2EQI A;  2JTE A;  2OTJ Q;  1VQK Q;  4M7D E;  1JO8 A;  1QP2 A;  3URG A;  2DPP B;  2RI3 A;  1VQO T;  4XQ3 A;  4C5H A;  1FWZ A;  2PJQ A;  1YHQ A;  3BLR B;  4D8K A;  1NPR A;  1KQS P;  3JCM Q;  3OQ5 A;  4CFN B;  1VQ4 T;  3V8K A;  2BKZ B;  1PHT A;  2LZ6 B;  2BKD N;  1EZZ B;  3M54 A;  1GBQ A;  4CFV B;  3HB9 A;  3EGD A;  3V8J A;  5KYX A;  2EJ9 A;  5I2S A;  4HT9 A;  1JEG A;  2X35 A;  1AD6 A;  3MY5 B;  4XU2 A;  1O9K B;  4F6W B;  1I07 A;  4XAX B;  5LJ3 j;  1AZE A;  3CCE A;  4PK4 A;  2EAY A;  1G5V A;  5A2Q E;  3A8O B;  2HBP A;  2UUE B;  3NTI A;  2MWP A;  2KXD A;  1D1B A;  2EFI A;  1I81 A;  4QW2 A;  3DDQ B;  3UDC A;  2CSQ A;  3H0F A;  4KGV B;  4O5V A;  5ACB A;  4DEX A;  2KVQ G;  1UUE A;  2PQW A;  2AIR B;  3F5X B;  1XNI A;  1H25 B;  4XU1 A;  5A0G A;  2HCK A;  5GAN 3;  4HNT A;  3LH0 A;  1A0N B;  3PFS A;  3O0G D;  4QSH A;  2DIQ A;  1UG1 A;  2YUQ A;  5GAN g;  2A3L A;  4CXA B;  1O9K A;  2CZ1 B;  4EOS B;  3NFC A;  4XU0 A;  4BE2 A;  1SSF A;  2XMF A;  2X51 A;  4C8Q A;  1ZSG A;  5GAN 6;  1J3T A;  1SPK A;  4KUL A;  4MDW A;  3VU3 C;  4F7U G;  3RIR A;  1UDL A;  2EYW A;  5GMK e;  1UNG D;  4M75 C;  2HMA A;  3TNH B;  2QDL A;  4ZNX A;  2DXT A;  1WX6 A;  2DTH A;  1VQP Q;  2CP6 A;  1YJW Q;  2JN0 A;  4A63 B;  2OAW A;  3HTR A;  3BLQ B;  4OB1 B;  1T3L A;  5FU6 C;  2RJC A;  4J6X A;  4E7S A;  3FIF A;  2E5Q A;  4IUP A;  4OGE A;  3KXT A;  3CME T;  9ATC B;  1Z9Q A;  3EH1 A;  3PNW C;  4M7D D;  4EOO B;  2K7A A;  3GOX A;  2V8J A;  4BCM D;  2RJE A;  4F7U F;  3M0T A;  4GLK A;  3L2U A;  4C0D B;  3CCJ A;  5GAO m;  1CKB A;  1MMD A;  2HL5 C;  2KRS A;  5GAO p;  1H3Z A;  3X25 B;  2ECZ A;  3OYF A;  1OI9 B;  1ZBX A;  2DF6 A;  1RAG B;  2ED0 A;  1GCQ A;  2YUP A;  5D6X A;  2DFU A;  2ATC B;  2LW4 A;  2LTO A;  4A4K A;  3S3O A;  1BI2 A;  3QYH B;  2LMJ A;  1C9B A;  1Y57 A;  2J05 A;  2XD0 A;  1K4U S;  2R5A A;  1TS9 A;  3M0P A;  1YJN A;  3WXM B;  3HFO A;  1K1Z A;  2WMA B;  3JB9 D;  4OMN A;  3OSS C;  2LX7 A;  1NEB A;  4J9I A;  3M03 A;  2JTM A;  5GMK i;  3DB3 A;  1AT1 B;  3HL8 A;  1WXB A;  2L89 A;  1YIJ Q;  5IDN B;  2HQX A;  3I5S A;  3EFO B;  4EON B;  3PT9 A;  4RTU A;  3POM A;  1QW1 A;  3LW5 E;  3CXC S;  2H3E B;  1WQ7 A;  1FMK A;  5LQF B;  1C0M A;  4LD6 A;  4RG8 A;  2IVX A;  2COY A;  3OYH A;  1D09 B;  1KJW A;  4BCH B;  3TNI B;  2CJM B;  3JCM J;  4EOK B;  4M7A G;  5LJ3 d;  4PJO A;  3EG1 A;  1VQ5 A;  2PK2 A;  3PO3 S;  1SHG A;  2EJG A;  3MEW A;  3CCV A;  1IXD A;  3REA B;  4C0F A;  1H1P B;  1WGS A;  2FG0 A;  4BXX X;  3M57 A;  3OSV A;  3MET A;  5HBE B;  3HPW A;  1OX8 A;  2BS2 A;  3EFO A;  2I53 A;  2QI2 A;  3TNW B;  5GAO r;  5HCK A;  2L5Q A;  5GAN j;  1K8A C;  4EOP B;  1M30 A;  4PJM A;  2XDP A;  4PNO A;  3EG0 A;  2ROL A;  3VKI A;  3CXC A;  2PK9 B;  1VQM T;  4JX4 A;  2GTJ A;  1LOJ A;  4QVZ A;  2RPN A;  2DZC A;  2EQK A;  4M7D B;  1YN8 A;  3BE3 A;  4ELJ A;  4BCM B;  4F7J B;  1QVF S;  4BCJ B;  4C92 E;  2ROT A;  5ICP B;  3VYG B;  8AT1 B;  2RHZ A;  3MJX A;  1TWB A;  2RQV A;  1KK7 A;  4O6J A;  4RTY A;  1IGU A;  2QF7 A;  3J81 E;  1RAH B;  3EG3 A;  4M7D F;  2KBT A;  2KDS A;  1GXI E;  2IW9 B;  5FWB A;  2L0A A;  3PVL A;  1O75 A;  2E10 A;  1GUX A;  1VQ9 Q;  1F5Q B;  3OW2 S;  1PM3 A;  3PMI A;  4A53 A;  2K79 A;  4BCN D;  1WA7 A;  3I56 A;  2O31 A;  1KG1 A;  2AZS A;  4LDX A;  3I55 Q;  4JZ3 A;  2KSS A;  3V7S A;  2F2C A;  3OYB A;  1AZG B;  1C1A A;  1FMV A;  4M7D A;  1YHQ Q;  4M77 E;  3HP9 A;  1JST B;  4HL4 A;  3MP6 A;  3JAM E;  2RQU A;  2RI5 A;  4BCO B;  1QVF A;  2ENM A;  2W9F A;  5IHK A;  3JB9 H;  3DJB A;  3L42 A;  4FYX B;  4F16 A;  5A0L A;  5LJ5 f;  1XQH A;  2A36 A;  1Q7Y C;  1B3Q A;  2I2L A;  3JB9 F;  4M78 G;  2HZY A;  3M4Y A;  4C0D C;  1U8R A;  2KT1 A;  3RES A;  4XTZ A;  4AFQ C;  3OYL A;  3D7S B;  3OW2 A;  3GP8 A;  1YJ9 Q;  1AWO A;  1UEC A;  3IQL A;  3CCE Q;  2RF0 A;  1D1A A;  2QQS A;  2DME A;  2OTJ T;  1Q81 C;  5DM7 R;  2EGC A;  2K5L A;  1VQL T;  2DER A;  2QQA A;  1I4K 1;  4AKG A;  3HFN A;  2LQW A;  2JM9 A;  3ME9 A;  2KEA A;  5L8R E;  1KIK A;  2PVG B;  1Q95 G;  1ZLM A;  3OA6 A;  2IW8 B;  2KK4 A;  2CZ0 B;  4CC2 A;  5IHI A;  2EBP A;  1NM7 A;  1PRM C;  2J7I A;  3H8Z A;  2DBK A;  1K73 C;  1Q86 C;  1PSF A;  4Q5W A;  2DVJ A;  1FMW A;  1NYF A;  4OVA A;  3OYN A;  1QVG S;  5KH6 A;  2K3B A;  5GAO n;  4AFU C;  2EYZ A;  4BE1 A;  5GJW B;  5LJ5 h;  3BG5 A;  4MZP A;  2DL3 A;  2EKH A;  1OU8 A;  3CXC P;  2QEX T;  3UT1 A;  4EOL B;  3M9Q A;  2AZV A;  2C0T A;  2XDB A;  1U1S A;  3QO3 A;  4D8D A;  1KFZ A;  4F7N B;  1SF9 A;  1SG5 A;  1ZA2 B;  2DM1 A;  4C92 D;  3VS7 A;  1YI2 T;  3QSU A;  2DTI A;  4A54 A;  3VJP A;  2O4X B;  3C4S A;  3CCU A;  1TUG B;  5EJC A;  3PMT A;  3F70 A;  4GLM A;  2B8A A;  2J6K A;  4BCN B;  2LCC A;  1U06 A;  1QVG A;  2QDJ A;  1YP5 A;  1X6B A;  4KRD B;  5GAN d;  4DEY A;  1WHL A;  1BIB A;  1PRL C;  3NMZ C;  1JXO A;  1WJR A;  1BI3 A;  5CR2 A;  2PVD B;  5GAM g;  2HAX A;  1ZUY A;  5KYN A;  3VRZ A;  1ZP2 A;  1YNZ A;  3CCJ Q;  4M77 D;  4RUG A;  3J7A F;  5D7U A;  2CP7 A;  1TU0 B;  2UZE B;  2O4X A;  4BB7 A;  5L23 A;  4M7D C;  1QVF P;  3FLG A;  2E6N A;  4BI3 A;  3R6O A;  4KRT A;  3TU4 K;  4J6Y A;  2JM8 A;  1M3A A;  3QXE B;  4F7U E;  1QLY A;  4CFW B;  4J7F A;  3MPU B;  3VV0 A;  1VQ7 A;  3EFS A;  1M9S A;  4HCZ A;  3CC4 A;  2LQK A;  4RTX A;  1MND A;  1VIF A;  2BUD A;  1IHW A;  1PKD B;  4RCC A;  1BYM A;  2QQR A;  3OW2 P;  3TEE A;  3VS4 A;  3M0U A;  2P0Q A;  2EGA A;  3CC4 T;  4MZT A;  4BI4 A;  5GAN 8;  1KQS A;  1NE8 A;  5KYW A;  1KQ2 A;  3CC2 A;  1FKM A;  1PWT A;  2GCX A;  2NUP A;  1Y7X A;  2O9V A;  6AT1 B;  5HK0 A;  3M59 A;  5GMK m;  2QQ8 A;  3VS0 A;  4ZN1 A;  3OYK A;  4RTV A;  3PTA A;  5M9O A;  4LUD A;  3A8M B;  5LJ5 e;  1B34 B;  2RN8 A;  3E1S A;  2DL4 A;  1H26 B;  4XTW A;  3HRT A;  2UZB B;  4J9H A;  1D3B B;  1MV0 B;  3SB2 A;  2G9X B;  1VQ5 Q;  1RI9 A;  4OB3 B;  1BBZ A;  4C92 B;  1HXD A;  2VGN A;  1T0H A;  4RMO A;  3Q1J A;  1GY3 B;  2A37 A;  1U5S A;  2NUZ A;  2BZY A;  3JRZ A;  3VYH B;  3CCS T;  4GY5 A;  3LX7 A;  5LMK B;  1I8F A;  2JW4 A;  2GF7 A;  1H8K A;  3M0R A;  1TXQ A;  4Y28 E;  4PKC C;  2BZ8 A;  2FVU A;  4C92 F;  2V8I A;  3MKD A;  3EH2 A;  4EOM B;  4FW2 A;  4F70 B;  4DBQ A;  1AOJ A;  5A0D A;  3LWI A;  1BU2 A;  2HDA A;  2R7G A;  2KMT A;  1QVG P;  1YWO A;  2I40 B;  1VQ6 T;  3M0S A;  2M02 A;  3GBQ A;  4M77 B;  4QT7 A;  4QQG A;  1RAA B;  3FDR A;  2XI9 A;  4WTO B;  4HXJ A;  1D0Z A;  2CUD A;  4JRP A;  3E9G A;  1ZA1 B;  1YIT A;  4M7A E;  2D0N A;  1LJO A;  4E2F B;  3QYG B;  3CMA T;  3LYI A;  4A4G A;  1AHJ B;  1H24 B;  3I35 A;  5KYU A;  3MIA B;  5HVY B;  2NLU A;  5CKF A;  3QZ9 B;  4M77 F;  3I56 Q;  1WHH A;  3TSW A;  5GMK h;  4M6V A;  4EC8 B;  1U3O A;  2YWW A;  3RKX A;  1VQO A;  2A08 A;  5HNB B;  1M27 C;  3OYY A;  1VYU A;  1X6G A;  2K4Y A;  2C0O A;  3L1A A;  4YC3 B;  4M77 A;  4FU6 A;  3G6E Q;  4BDY A;  1TFB A;  1M4Z A;  2XDD A;  4N4H A;  1VQ4 A;  3AHU A;  2H3J A;  3VS3 A;  4CC7 A;  3VS1 A;  2YXY A;  3L2Z A;  2FZC B;  2RQT A;  1TD6 A;  2CKK A;  2QXF A;  4FYV B;  4F04 B;  2EYX A;  1YFN A;  3GNF B;  1QMZ B;  1M3C A;  2O2O A;  3MY1 B;  3JCM f;  1W2B S;  3LH5 A;  2LX9 A;  2X4Y A;  2ZPI B;  2H8H A;  1M1K R;  2KRN A;  2V26 A;  4X1V A;  3PIP A;  1UGP B;  1VOL A;  2CP0 A;  2X1N B;  1K0S A;  3EOC B;  1IO6 A;  2C5N B;  3G71 Q;  2P4R A;  1OX9 A;  2VUB A;  1Q82 U;  1H92 A;  1G3N C;  2LQN A;  1OI1 A;  4FW1 A;  2YT6 A;  1GFD A;  2G77 A;  4WF2 A;  3EGU A;  4A4F A;  3R6N A;  2W10 A;  3CCR T;  4BY1 X;  1RI0 A;  1KD1 U;  1FIN B;  3G1J A;  1Z9Z A;  3QJ6 A;  2E41 A;  2LNH B;  3FJP A;  5GAO q;  2F2W A;  4J9F A;  2XIC A;  2AT1 B;  3WVE B;  2HQE A;  2PUO B;  1U1T A;  3OYD A;  4L5G A;  3CCM T;  1X2K A;  4J83 A;  2QK0 A;  4X9D A;  5CAI A;  4RTT A;  2RD1 A;  3A1P A;  3KHI A;  2OJ2 A;  4E7K A;  4C8Q G;  1UHF A;  4OMQ A;  3TRE A;  4DBF A;  2MMP A;  1W2B A;  5GJV B;  4HVW A;  2YUN A;  2NUT B;  1ENW A;  2PVO B;  2DAQ A;  2OX7 A;  1R0C B;  3PVQ A;  4DBR A;  4ROC A;  1W1F A;  1H1Q B;  3BHT B;  3SHW A;  4HCB A;  3JCM h;  2JXB A;  4M78 E;  1OL2 B;  2CZ7 B;  2O9S A;  4KBM B;  1O9S A;  2KRO A;  2OTL T;  2YDL A;  2EQJ A;  4Z8A A;  1MNE A;  1S72 A;  5IXB A;  2COZ A;  3OMG A;  3CCU Q;  2CDT A;  1T3S A;  2RI2 A;  4NL2 A;  3VS2 A;  1SKU B;  4M7A D;  4AG1 C;  2NUT A;  1VQN Q;  5I21 A;  1S72 T;  4C92 C;  4ELL A;  3M56 A;  1PC0 A;  1ZHI A;  3OYJ A;  1W98 B;  3DDP B;  1X75 C;  2KR3 A;  4IIO A;  2DL8 A;  4F7U B;  3EG2 A;  4OP0 A;  2QTX A;  4ZN3 A;  3CME A;  1PG5 B;  2WHB B;  4YTL A;  5DQW A;  1BB9 A;  2V22 B;  3C0C A;  4DQ2 A;  1PSE A;  4FSS A;  4F14 A;  2XU8 A;  3EJ1 B;  1FVV B;  5EC7 A;  1XO2 A;  4LNP A;  3DOG B;  2E70 A;  4CI0 C;  5C6S A;  1OIY B;  1ABO A;  3MCA B;  2IW6 B;  4PJL A;  4M77 C;  1Y96 B;  1WPY A;  2K5F A;  4I3Z B;  1VQ7 Q;  2P0K A;  4F7U A;  1Y71 A;  2DXB B;  2I0N A;  1NBE B;  1M2O A;  2D1X A;  1IB8 A;  2DL5 A;  3HHT B;  2JUF A;  2CH4 W;  3G4S T;  2M0Y A;  4DOW A;  2ZPF B;  3M4G A;  5GAM d;  2W2H A;  3DB4 A;  4B9X A;  3VKH A;  1RAI B;  2YRV A;  2BIV A;  1I5O B;  2P0P A;  3RR6 A;  5KE3 A;  3QYB A;  2DBM A;  2DK3 A;  5LJ3 e;  4PJO G;  1Y96 A;  1K76 A;  3OBY A;  2XHC A;  1Q82 R;  4AG2 C;  1TOV A;  2DX1 A;  2NWM A;  7AT1 B;  2EPD A;  1W2B P;  3EFR A;  3JCM e;  4EOR B;  4F7S B;  2FO0 A;  1MUZ A;  3REB B;  1KD1 R;  3VRY A;  4V2S A;  4JJB A;  1IRX A;  1D0X A;  4ZTJ A;  4BAC A;  2BZX A;  5ECA A;  2QA4 T;  5LJ5 g;  4M78 D;  4C0G A;  2P84 A;  2YLC A;  1PCX A;  4HKE A;  3MEV A;  3BDU A;  4N4G A;  4C5E A;  2QGG A;  2MPX C;  2CCH B;  4M7A B;  4JZ4 A;  2DXC B;  2QQB A;  1BK2 A;  4C0Z A;  1NPP A;  3M55 A;  1VQM A;  4EC9 B;  2JS0 A;  3CD6 T;  1M8V A;  1OOT A;  3C94 A;  4LDU A;  3RKY A;  1ZSZ B;  4FIB A;  1UE9 A;  3QYE A;  4J9C A;  4FX3 B;  1OV3 A;  2DRM A;  5CVI A;  4M7A F;  2K5I A;  1VIN A;  2DRK A;  1VOM A;  4PL6 A;  1I1J A;  4OML A;  1UFF A;  1QCO A;  4K11 A;  1YIT Q;  4J9B A;  3B57 A;  2WIP B;  1V76 A;  2L2P A;  2YLB A;  2DXC A;  3CPF A;  2O01 E;  3QHW B;  3CCQ A;  4YOO A;  3GNG A;  4NL3 A;  2VKN A;  3DTO A;  2X4J A;  4OMP A;  2AKL A;  1VQ8 T;  4TVR A;  5FU7 B;  1VQO Q;  4BCI B;  1BIA A;  2DE0 X;  5CCA A;  4IUQ A;  1M90 U;  3E9F A;  3CCQ T;  4FT4 A;  1UGS B;  2EYY A;  1TUD A;  4J6W A;  3HKS A;  3ASK A;  5FGK B;  2AK5 A;  3CCL T;  3CBO A;  1QCF A;  1OQK A;  3OS2 A;  1VQ4 Q;  1NG2 A;  2D9T A;  2RB6 A;  5I2M A;  3VUB A;  3EAE A;  4IIM A;  1M5Q 1;  3AT1 B;  3VYG A;  2HQH A;  3CC7 T;  3OS1 A;  1X27 A;  3PGG A;  2M9U A;  4Z88 A;  4HVU A;  4F6S B;  4BBS M;  1K8A U;  1OPL A;  1KC8 U;  4WCI A;  1AIS B;  4JLI A;  1D1C A;  4KH1 B;  1N6A A;  3VS5 A;  1K0X A;  2OTJ A;  2PNI A;  1VQL A;  2JTF A;  3JCM W;  4HT8 A;  2D6F A;  4M4Z A;  3UA6 A;  5J3B A;  1D3U B;  2JZ2 A;  4M78 B;  2EVR A;  1UNH D;  3X28 B;  2ZPE B;  1VQK T;  4J9E A;  5HQ0 B;  1TSF A;  5CEI B;  3UWN A;  3MP8 A;  3A8H B;  5GAN 5;  4Y92 A;  1IZ6 A;  2F2X A;  3WVD B;  1H1R B;  2YHT A;  1K9M U;  3X24 B;  5KYY B;  4IUV A;  3X26 B;  2IPO B;  2C6T B;  4CFX B;  1H28 B;  5CQX A;  2WAC A;  4M78 F;  4ME7 A;  2FRW A;  2DLP A;  1OZ3 A;  1G2B A;  1Y0M A;  4IKF A;  3A8L B;  4YOS A;  4OMO A;  1QWF A;  3U23 A;  4IUR A;  2FPE A;  1BU1 A;  1M3B A;  3S6W A;  4CRI A;  2QEX A;  2RQR A;  3JCM X;  2C0I A;  3RUX A;  5LJ5 j;  1G3W A;  3OBW A;  5LL6 S;  5FRN A;  1OGU B;  2PUK B;  1YI2 A;  1BKB A;  5GAN e;  4MML A;  4JS5 A;  2ZPH B;  2B9R A;  5KYY A;  2E12 A;  1F1B B;  4HA8 A;  2IVW A;  2RO0 A;  2KNB B;  1OL1 B;  1M1K C;  4CRL B;  3CME Q;  4KH0 B;  4JRI A;  1NJI U;  2DD4 B;  1HJD A;  1QP3 A;  2ZAE A;  4C8Q E;  2FB7 A;  2WXV B;  4M7A C;  4L6V 5;  2PMI B;  1UB4 A;  4E6R A;  5GAN 2;  3V8L A;  2PTK A;  2CYZ B;  1RLQ C;  2C06 A;  1WHG A;  4EOQ B;  2DZ9 A;  2IIM A;  2RH2 A;  2C4G B;  3KUF A;  1NLO C;  1LCK A;  2VB6 A;  1ACM B;  4BY7 X;  3FC3 A;  1ZSZ C;  5EFQ B;  1M8M A;  4FSX A;  1Q86 U;  4EOJ B;  1RAE B;  1HK9 A;  3TCJ A;  1NEG A;  1KXU A;  2VGM A;  2XK0 A;  1X43 A;  3TQ7 P;  3G7Z A;  2ED1 A;  5DQV A;  4AFS C;  3S3N A;  1GRI A;  3M58 A;  1WXU A;  1M90 R;  2MIO A;  5EG2 A;  2CT4 A;  1UGQ B;  2QFZ A;  1AD5 A;  2ZPB B;  2LT1 A;  2DD4 A;  5IHY A;  2VAS A;  1B7T A;  4E7H A;  2E1H A;  1VQP T;  1YJW T;  2EQU A;  5CYI B;  5GAO l;  1GL5 A;  3M0Q A;  1AEY A;  3NTK A;  1YJN Q;  5D6W A;  3C12 A;  2EKO A;  3QZ5 B;  4RCB A;  5FU7 C;  1QMC A;  3INZ A;  3T9N A;  1LPL A;  2E6Z A;  3OYE A;  3NGP A;  3ZFJ A;  1KC8 R;  4NC6 A;  3EG9 B;  1YCY A;  1WI7 A;  3JCM P;  1WQW A;  4KGX B;  5DLO A;  1C6V X;  4XTY A;  2KRM A;  3SWN B;  5I5Z B;  2MF2 A;  4G6L B;  2DKG A;  3OS0 A;  1N9S A;  1G3Y A;  4DA4 A;  2EUF A;  2DJQ A;  2YUO A;  1KSW A;  1P92 A;  2RHI A;  3H41 A;  2CS7 A;  3A98 A;  4JDS A;  2M0O A;  1N27 A;  1OKW B;  1QKX A;  1MMN A;  3P8B B;  4YOZ A;  2QAS A;  2R5M A;  3QKJ A;  3JCM g;  1K9M R;  1LNX A;  3H0I A;  3OYG A;  3CCV Q;  1SEM A;  2V1R A;  3OYI A;  3CCS A;  3OY9 A;  2LVM A;  4M78 C;  1RLP C;  2M16 A;  3QUI A;  3TSZ A;  4HCK A;  1KHC A;  3SWN A;  4M75 G;  1N8R U;  2L3R A;  2DVE A;  1YIJ T;  2CP5 A;  1UGR B;  2HD0 A;  3RGF B;  1DJ7 B;  1VIE A;  1VQ6 A;  2LT4 A;  1B34 A;  4R0K A;  4EIK A;  4PJO E;  2CT3 A;  1H27 B;  4UC4 A;  1G3S A;  2LCS A;  5L2W B;  2FYK A;  2VYT A;  4C8Q D;  1D3B A;  2J6O A;  1ZQ1 A;  3I9Q A;  3RKW A;  5GAM f; 
#chains in the Genus database with same CATH homology
 2XDP A;  4NL2 A;  1Q81 U;  3QBY A;  4PNO A;  2LCL A;  4BDZ A;  3VKI A;  3CXC A;  3MO8 A;  5CO7 A;  3CMA A;  4JX4 A;  1WNL A;  2R58 A;  4AKH A;  4J7I A;  3P8D A;  1LOJ A;  4C92 A;  4M7A D;  5I21 A;  3OB9 A;  1S72 T;  4C92 C;  4QVZ A;  2RHY A;  3M56 A;  1BI1 A;  2DZC A;  2EQK A;  4M75 D;  4ATO A;  1ZHI A;  3OYJ A;  4M7D B;  3N5B B;  1X75 C;  3JCM c;  4F7U B;  4QQ6 A;  4BY6 C;  1E7P A;  4ELJ A;  4OP0 A;  1QVF S;  2LC4 A;  4KT0 E;  2Y4Y A;  2QTX A;  3ZEH A;  4OMF B;  4HNU A;  1TH7 A;  4C92 E;  4ZN3 A;  3CME A;  3H6Z A;  1XOV A;  2KAF A;  4YTL A;  1K73 U;  4E7J A;  3VYG B;  3BG3 A;  2L8D A;  2RHZ A;  4DQ2 A;  1WJS A;  5CKD A;  1PSE A;  2PU9 B;  1VQN A;  4PLI A;  2XU8 A;  1X01 A;  2WSC E;  3OYC A;  3OS5 A;  3CCU T;  2F5T X;  3CPW A;  3SDZ A;  3X20 B;  5GMK j;  1Q82 C;  1FX7 A;  4JLG A;  4O6J A;  3M5A A;  2QF7 A;  2E70 A;  3J81 E;  4CI0 C;  1VQP A;  5C6S A;  1YJW A;  4M7D F;  2KDS A;  3MCA B;  1GXI E;  1KD1 C;  2JNG A;  1VQN T;  1O75 A;  2E10 A;  3OW2 S;  3PMI A;  1KQS S;  4A53 A;  4XK8 E;  2DEQ A;  2X4W A;  5LJ3 f;  3I56 A;  2VXF A;  4M77 C;  2VC8 A;  1Y96 B;  4JX6 A;  1WPY A;  2DJZ A;  2K5F A;  4NOY A;  2JOY A;  2E65 A;  1VQM T;  1KG1 A;  4LDX A;  5AYF A;  3JCM b;  5DY9 A;  2KSS A;  3V7S A;  4MFD A;  1G3T A;  2VV5 A;  5HK3 A;  3OYB A;  2P0K A;  4M7D A;  4OB0 B;  4ELZ C;  4F7U A;  2X4X A;  1Y71 A;  2DXB B;  4M77 E;  1YBY A;  3HP9 A;  4FT2 A;  4HL4 A;  3MP6 A;  3JAM E;  2RI5 A;  3HHT B;  2JUF A;  1OYX A;  5GAM h;  1QVF A;  5CK9 A;  2FL7 A;  3BG9 A;  3JB9 H;  2QDY B;  4B9W A;  4QVD A;  3LWH A;  3HZJ A;  3L42 A;  4MMK A;  3I55 A;  3G4S T;  3CCR A;  1VQ9 T;  4DOW A;  4J5Y A;  1M1K U;  5A0L A;  5LJ5 f;  1XQH A;  2G3R A;  2WJ9 A;  2ZPF B;  3M4G A;  4RKU E;  4BD3 A;  3DB4 A;  5GAM d;  1N8R C;  2K57 A;  4B9X A;  1Q7Y C;  4LDV A;  3HBL A;  3VKH A;  2I2L A;  2YRV A;  2BIV A;  3RMQ A;  2IG0 A;  2CZ6 B;  2GFU A;  4XU3 A;  1K8A C;  3HSB A;  4M78 G;  3JB9 F;  2P0P A;  2D0Q B;  3CCM A;  3I55 T;  3M4Y A;  4C0D C;  1U8R A;  5KE3 A;  3VUZ A;  3RES A;  3QYB A;  4XTZ A;  4EMK B;  2DK3 A;  3OYL A;  4E7L A;  5LJ3 e;  1FXX A;  3QWL A;  1M1F A;  2A7Y A;  4PJO G;  5LJ3 g;  1Y96 A;  3GP8 A;  3OW2 A;  1KHI A;  1YHQ T;  1XTD A;  3OBY A;  2QQS A;  4X9C A;  2XHC A;  2OTJ T;  4OF1 A;  2KR6 A;  5CIU A;  5DM7 R;  1Q81 C;  2ZGW A;  1K8A U;  2K5L A;  1VUB A;  2AHJ B;  2QQA A;  2WSF E;  1I4K 1;  4IUT A;  1N9R A;  4XTV A;  4Y91 A;  1VQL T;  4AKG A;  1Y07 A;  3EFR A;  3JCM e;  3PIO A;  2XG8 D;  3HFN A;  2LQ8 A;  2KMG A;  3ME9 A;  4NS5 A;  4A4E A;  5L8R E;  1YJ9 A;  4E7I A;  4V2S A;  1OZ2 A;  3LGF A;  5LJ3 h;  2PVG B;  1YIJ A;  3CC2 T;  4ZTJ A;  4BAC A;  3OA6 A;  2KK4 A;  2CZ0 B;  2QA4 T;  2XID A;  5LJ5 g;  4M78 D;  4C0G A;  3JB9 I;  4KUD K;  2F5K A;  3H8Z A;  1K73 C;  1Q86 C;  1PSF A;  3CBP A;  4C8Q B;  4Q5W A;  3H4C A;  5KCO A;  4C92 G;  1YJ9 T;  2F69 A;  2YLC A;  3SWN C;  2OTL A;  3DLL A;  2HNI A;  1UEB A;  4OVA A;  5KCH A;  1W4S A;  3OYN A;  2KY9 A;  3CCE T;  4PJO D;  3C95 A;  3OYM A;  3E19 A;  1QVG S;  3J80 E;  5KH6 A;  4EMK A;  4HKE A;  5GAO n;  2EWN A;  3ZBD A;  3MEV A;  3BDU A;  3S3M A;  3OMC A;  2CGH A;  4N4G A;  4C5E A;  4M7A B;  4BE1 A;  2DXC B;  2MWO A;  1WJQ A;  2QQB A;  3FEO A;  3BFM A;  1NPP A;  3BG5 A;  2ZPG B;  4JX5 A;  3LGL A;  2EJF A;  3M55 A;  4M75 B;  4MZP A;  5LJ5 h;  1VQM A;  3CD6 T;  1M8V A;  3C94 A;  4LDU A;  4MZM A;  4C8Q F;  3RKY A;  2QEX T;  2E64 A;  3UT1 A;  4JJN K;  4MFE A;  3M9Q A;  4FIB A;  4MIM A;  4Z02 A;  4KUI A;  3QYE A;  5FU6 B;  2XDB A;  3L2W A;  4ZGJ B;  1U1S A;  3QO3 A;  2K2V A;  5CVI A;  4R55 A;  4XTX A;  2K3X A;  4XTU A;  4M7A F;  2K5I A;  4C92 D;  2MI6 A;  4EMH A;  1YI2 T;  3QSU A;  2DTI A;  4M77 G;  3VKG A;  4M75 F;  4RG2 A;  4PL6 A;  2O4X B;  3VJP A;  3C4S A;  3BW1 A;  4QQD A;  3CCU A;  5EJC A;  1V29 B;  3CBM A;  1M1G A;  3PMT A;  1H64 1;  3SD4 A;  3F70 A;  3QII A;  4JUV A;  2ZZD B;  2EQM A;  2B8A A;  4HCC A;  3QPH A;  2LCC A;  2YLB A;  4JRQ A;  1QVG A;  2QDJ A;  5HY6 A;  2DXC A;  3CPF A;  2RA2 A;  1RL2 A;  2O01 E;  2RJD A;  4M75 A;  1QVP A;  3HRU A;  5GAN d;  3CCQ A;  3GNG A;  5J39 A;  4NL3 A;  5FRM A;  4C5G A;  2X4J A;  1BIB A;  4BBR M;  3DLM A;  3BY7 A;  1VQ8 T;  2MAM A;  2DO3 A;  4TVR A;  1WJR A;  5FU7 B;  1BI3 A;  3GIB A;  2R57 A;  5CR2 A;  2PVD B;  5GAM e;  1KQ1 A;  2RK2 A;  5GAM g;  1BIA A;  3QHS A;  3A8G B;  4PLL A;  5CCA A;  2HAX A;  4IUQ A;  1M90 U;  3E9F A;  4VUB A;  3CCQ T;  4MDX A;  4FT4 A;  4HLQ A;  4M77 D;  1UGS B;  3A5Z B;  4J6W A;  3HKS A;  3ASK A;  1YIT T;  3J7A F;  1VQ7 A;  3CCL T;  4N0A A;  4JS4 A;  5DLQ E;  3CBO A;  3OS2 A;  1JB0 E;  2O4X A;  4N0A C;  4BB7 A;  2D9T A;  3G4S A;  1VQ9 A;  3NTH A;  4M7D C;  3FLG A;  4X34 A;  2RB6 A;  2E6N A;  5I2M A;  3VUB A;  3L2R A;  3EAE A;  4BI3 A;  1M5Q 1;  3R6O A;  2ZZD A;  3CEY A;  3TU4 K;  4J6Y A;  5GAM j;  3VYG A;  3CC7 T;  4J8O A;  3OS1 A;  3PGG A;  2M9U A;  4M7D E;  5D6Y A;  3QXE B;  1QP2 A;  3URG A;  4F7U E;  1QLB A;  2QQ9 A;  4J7F A;  3VV0 A;  2DPP B;  4BBS M;  3EFS A;  1M9S A;  2RI3 A;  4HCZ A;  4XQ3 A;  2K3Y A;  4C5H A;  1FWZ A;  1VQO T;  1KC8 U;  3CC4 A;  1YHQ A;  1I5L A;  2LQK A;  2Y90 A;  2RM4 A;  4JLI A;  1VIF A;  2BUD A;  2KQW A;  3CCJ T;  1N6A A;  4RCC A;  4ZGE B;  2QQR A;  1BYM A;  3TEE A;  1NPR A;  2DXU A;  2OTJ A;  2P0Q A;  3JCM Q;  2Y4X A;  3OQ5 A;  1VQ4 T;  3CC4 T;  1VQL A;  2JTF A;  3V8K A;  4MZT A;  5KE2 A;  4BI4 A;  3JCM W;  5GAN 8;  4HT8 A;  1KQS A;  2D6F A;  1NE8 A;  5J3B A;  2BKD N;  3M54 A;  3HB9 A;  2JZ2 A;  4M78 B;  3V8J A;  4OB2 B;  5CKB A;  4EPC A;  1KQ2 A;  3X28 B;  3CC2 A;  1FKM A;  2EJ9 A;  2EIF A;  2GCX A;  1IRE B;  2ZPE B;  2DXB A;  1VQK T;  2QA4 A;  5I2S A;  3UWN A;  1Y7X A;  4HT9 A;  3MP8 A;  3A8H B;  5HK0 A;  4PJO B;  2GQV A;  5GAN 5;  1IZ6 A;  2X35 A;  3M59 A;  5GMK m;  5GAN f;  4FM4 B;  3WVD B;  2QQ8 A;  1MGQ A;  5J26 A;  4ZN1 A;  4XU2 A;  4ZGD B;  3OYK A;  2YHT A;  5LJ3 j;  4XAX B;  1K9M U;  3X24 B;  3CCE A;  1YJN T;  3PTA A;  4IUV A;  5M9O A;  2EAY A;  4N4I A;  3X26 B;  3V7R A;  3MEU A;  3A8M B;  4Z6Y A;  3MHX A;  1B34 B;  5GMK l;  5LJ5 e;  5A2Q E;  3LLR A;  3A8O B;  2HBP A;  3P8H A;  3E1S A;  5CQX A;  3NTI A;  2WAC A;  2MWP A;  4M78 F;  2EFI A;  1I81 A;  4XTW A;  4ME7 A;  4QW2 A;  3HRT A;  3UDC A;  1VQ7 T;  2GFA A;  1OZ3 A;  1D3B B;  4IKF A;  3A8L B;  4O5V A;  3SB2 A;  4PJO F;  4IUR A;  3FB9 A;  3CD6 A;  2DIG A;  5IAY A;  2KVQ G;  3S6W A;  4EMK C;  4CRI A;  2PQW A;  2WSE E;  3GF5 A;  2QEX A;  4OB3 B;  3JCM X;  1XNI A;  3GLX A;  4C92 B;  3JB9 J;  2LDM A;  4XU1 A;  1HXD A;  4ZTF A;  3RUX A;  5LJ5 j;  5A0G A;  4LDY A;  3O8V A;  1JBM A;  5GAN 3;  1G3W A;  3OBW A;  4HNT A;  3LH0 A;  5LL6 S;  4II1 A;  2DTO A;  2VGN A;  4RMO A;  3Q1J A;  1M90 C;  3PFS A;  5FRN A;  2PUK B;  4QSH A;  1YI2 A;  2DIQ A;  1BKB A;  3JRZ A;  3VYH B;  4AI6 A;  5GAN e;  5FRO A;  4MML A;  1MHN A;  5GAN g;  3CCS T;  2A3L A;  4GY5 A;  4JS5 A;  3LX7 A;  2ZPH B;  1I8F A;  2GF7 A;  2LNV A;  4LD9 K;  2E12 A;  2CZ1 B;  4Y28 E;  4PKC C;  3NFC A;  4HA8 A;  2FVU A;  1VQ5 T;  4XU0 A;  4BE2 A;  1SSF A;  4C92 F;  3JCM d;  3L2Q A;  2V8I A;  3M53 A;  1R8O B;  4C8Q A;  5A0D A;  2IVW A;  3UPU A;  3LWI A;  2RO0 A;  5GAN 6;  4C8Q C;  3CCV T;  2KMT A;  4KUL A;  4MDW A;  3GPL A;  3VU3 C;  2M1H A;  1M1K C;  5GAN h;  1VQ6 T;  4M7D G;  1KC8 C;  1VQ8 A;  4F7U G;  3JSC A;  4JRI A;  4M7A A;  4M77 B;  1NJI U;  2DD4 B;  3RIR A;  1QP3 A;  4QQG A;  4C8Q E;  2FB7 A;  4M7A C;  3FDR A;  2XI9 A;  5GMK e;  3OYA A;  4L6V 5;  1UB4 A;  5GAN 2;  3V8L A;  2CYZ B;  4M75 C;  2C06 A;  2DZ9 A;  3MP1 A;  4JRP A;  3E9G A;  3MEA A;  2DXT A;  1YIT A;  2RH2 A;  3CCL A;  4M7A E;  3KUF A;  2DTH A;  4LDW A;  1LJO A;  4R56 A;  3QYG B;  2JN0 A;  1JJ2 S;  3CMA T;  1G5V A;  3FC3 A;  5CKH A;  3LYI A;  4M75 E;  4A4G A;  1AHJ B;  2FHD A;  4FSX A;  1Q86 U;  4OB1 B;  5FU6 C;  1HK9 A;  2NLU A;  2RJC A;  5CKF A;  3TCJ A;  3L2V A;  3QZ9 B;  4M77 F;  4J6X A;  3CC7 A;  2VGM A;  2XK0 A;  3FIF A;  2E5Q A;  5GMK h;  4M6V A;  3G7Z A;  4IUP A;  2RHU A;  4OGE A;  3KXT A;  3CME T;  5IT9 E;  3RKX A;  3PNW C;  4M7D D;  2VXE A;  4AKI A;  3S3N A;  1VQO A;  3GOX A;  2V8J A;  3M58 A;  1K9M C;  2RJE A;  4F7U F;  3L2U A;  4GLK A;  3OYY A;  4IUU A;  4C0D B;  5EG2 A;  2K4Y A;  1X6O A;  1UGQ B;  3KBG A;  2QFZ A;  4LOC A;  3CCJ A;  3JB9 G;  3L1A A;  5GAO m;  5GAO p;  2ZPB B;  2LT1 A;  4M77 A;  1H3Z A;  2DD4 A;  4FU6 A;  5C0M A;  3X25 B;  4E7H A;  4BDY A;  1M4Z A;  2E1H A;  2XDD A;  4N4H A;  1VQP T;  1VQ4 A;  3AHU A;  2H3J A;  3OYF A;  1YJW T;  2EQU A;  1ZBX A;  5GAO l;  3L2Z A;  2CKK A;  2QXF A;  3NTK A;  4DOV A;  4A4H A;  5D6X A;  1NZ9 A;  5D6W A;  3C12 A;  2EKO A;  3GNF B;  3QZ5 B;  2P4T A;  4RCB A;  2LTO A;  5FU7 C;  3I56 T;  3RER A;  4A4K A;  3JCM f;  3S3O A;  1W2B S;  1VQK A;  3INZ A;  1BI2 A;  3QYH B;  2JVV A;  2LX9 A;  2X4Y A;  3T9N A;  3G6E A;  2ZPI B;  3ER0 A;  2E6Z A;  3DL1 A;  3OYE A;  1JJ2 A;  3ZFJ A;  3QJY A;  2XD0 A;  4NC6 A;  3PIP A;  1UGP B;  3TW6 A;  3HRS A;  3JCM V;  1YCY A;  2R5A A;  3JCM P;  1WQW A;  4D6W A;  5DLO A;  1YJN A;  3WXM B;  3HFO A;  2RK1 A;  3TW7 A;  2VUB A;  4XTY A;  3G6E T;  3JB9 D;  3SWN B;  3OSS C;  2MF2 A;  1Q82 U;  2DKG A;  2DD5 B;  1N9S A;  1OI1 A;  1G3Y A;  3BDL A;  3OS0 A;  2G77 A;  4WF2 A;  4A4F A;  2JTM A;  4DA4 A;  5GMK i;  3RMS A;  4BI8 B;  3CCR T;  4E47 A;  1RI0 A;  3DB3 A;  4EMG A;  2LRQ A;  1P92 A;  3HL8 A;  1KD1 U;  2RHI A;  3QJ6 A;  5LJ5 d;  2E41 A;  3FJP A;  5GAO q;  2CS7 A;  4JDS A;  2M0O A;  1N27 A;  2L89 A;  2XIC A;  3FRN A;  3G71 A;  5CKE A;  5FLX E;  3WVE B;  2HQE A;  5CQY A;  4L59 A;  2PUO B;  1U1T A;  3OYD A;  4L5G A;  3CCM T;  2XKO C;  2HQX A;  2BS3 A;  3P8B B;  4J83 A;  4X9D A;  5CAI A;  4BE0 A;  4OGC A;  3PT9 A;  1NJI C;  2RD1 A;  1QW1 A;  2R5M A;  3LW5 E;  3CXC S;  3QKJ A;  3JCM g;  3KHI A;  4E7K A;  1LNX A;  4C8Q G;  1WQ7 A;  3OYG A;  3G71 T;  4A54 A;  3TRE A;  2MMP A;  1W2B A;  4LD6 A;  4RG8 A;  3QG1 A;  3OYI A;  3CCS A;  5HKC A;  4M78 A;  3OYH A;  2PVO B;  3OY9 A;  3DKM A;  2DAQ A;  2LVM A;  4JRK A;  4M78 C;  1BI0 A;  2OAU A;  3HO8 A;  4BY6 B;  4C5I A;  2EYQ A;  2M16 A;  3QDR B;  2V8K A;  3QUI A;  4ELY C;  3JCM J;  1KHC A;  4M7A G;  2BS4 A;  3SWN A;  1JRI A;  5LJ3 d;  4C0Z A;  1VQ5 A;  4PJO A;  2RHX A;  2DD5 A;  4M75 G;  4PJO C;  1N8R U;  2L3R A;  2DVE A;  3V7C A;  1EIF A;  2EJG A;  3JCM h;  1YIJ T;  3SFM A;  1Q7Y U;  1UGR B;  2HD0 A;  4M78 E;  4HCB A;  4BUG A;  3MEW A;  3CCV A;  3CPW S;  5GAN 7;  4P5N A;  2CZ7 B;  1DJ7 B;  1VIE A;  4KBM B;  4C0F A;  4EDU A;  1VQ6 A;  2LT4 A;  4HNV A;  1B34 A;  2RJF A;  1WGS A;  4QVC A;  4PJO E;  1O9S A;  3OSV A;  3M57 A;  4UC4 A;  2OTL T;  1G3S A;  2EQJ A;  3MET A;  5IN1 A;  3HPW A;  2BS2 A;  2FYK A;  2VYT A;  4FL6 A;  4C8Q D;  1S72 A;  1D3B A;  2QI2 A;  5GAN 4;  5GAO r;  2ZCF B;  3OMG A;  2L5Q A;  1ZQ1 A;  5GAN j;  2RI2 A;  3RKW A;  5GAM f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...