3A8GB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8gB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8gB02
2DPPB 1DJ7B 2CZ1B 4XK8E 4OB2B 4ZGJB 3X26B 2ZPEB 2WSFE 3VYHB 2PVDB 4Y28E 3LW5E 3QYHB 2ZCFB 1UGRB 1PSFA 2DD4A 2DD4B 2CZ6B 3VYGA 3A8HB 3WVEB 1UGPB 3QZ9B 2PUOB 1UGSB 2ZPBB 2O01E 2DD5A 1QP3A 2QDYB 2ZPGB 4OB0B 2CYZB 4L6V5 1GXIE 4ZGDB 3QZ5B 4FM4B 2WSCE 1AHJB 2ZZDA 3X24B 3X28B 2PU9B 1QP2A 2ZPHB 4OB3B 3X20B 2D0QB 3A8OB 3A8MB 2PUKB 3X25B 2ZPIB 3A8GB 2PVGB 3QXEB 2DD5B 4KT0E 3A8LB 4OB1B 1V29B 2AHJB 2ZPFB 2ZZDB 1UGQB 2PVOB 1PSEA 2DXCA 2DXCB 2CZ0B 1IREB 5L8RE 2DXBA 3QYGB 2DXBB 2WSEE 3WVDB 4ZGEB 3HHTB 2CZ7B 4RKUE 1JB0E 3VYGB
chains in the Genus database with same CATH superfamily
2O31A 4KRDB 1N5ZA 1KSWA 3CCUQ 2V8JA 4J9DA 2CH4A 4X9CA 2F2WA 3OYHA 5HBHB 2YLBA 2KR3A 4D8DA 4RG8A 3TW6A 3J80E 1NJIU 3QWYA 1VQ5A 2RK1A 1VOLA 1TS9A 3EGDA 5AT1B 1PKSA 3CMET 4AKIA 3EH1A 4ELJA 1T3LA 3S3NA 1URCB 5FWBA 2D8HA 2E6NA 1BI1A 2A0FB 2OTLT 5L2WB 2PQWA 4M7DC 5DLOA 4F7LB 1GH6B 3OW2A 3E9FA 2PUOB 1YWPA 4M78E 2ED0A 4RTXA 2D8JA 1I81A 5FU6B 2DERA 4MMLA 2Z0WA 1BU2A 1AISB 4OB0B 2K2MA 5IH2A 4BB7A 2K6DA 5GAMf 1KQSA 4C0DC 3QG1A 2HD0A 2XDPA 1VQOT 4FSXA 2B86A 5LJ3e 3CCMA 4J9IA 3CC7A 4M7DE 3M0QA 3MJXA 1D3BB 1VUBA 3X25B 4OMFB 4C0ZA 4BCQD 5KYXB 4FYXB 2OAWA 2PVGB 4CFNB 4F70B 1WNLA 1Y7XA 2HQEA 2LNHB 4OMMA 3MP1A 4FW1A 2H8HA 1ABQA 3HP9A 2VXFA 3UWNA 1H1SB 3H41A 4CC3A 2F69A 1GFCA 4EMKC 1Q81C 4QVDA 2RM4A 2KMGA 3CMAA 3CXCS 4DEYA 1HJDA 2HL3A 1M2VB 5C0MA 4YOOA 3CCSA 3P8DA 2MIOA 2O2OA 1ZQ1A 4PJOF 2EQUA 1UNLD 2OTJT 4L59A 3JCMc 2G3RA 2ZGWA 2QI2A 3UDCA 1JOWA 1JXOA 1ZSZB 2F2XA 3KBGA 2X1NB 3G33B 3CCQT 3G6EA 5GANe 4F7UB 3LQ5B 1AT1B 3I35A 5LJ5h 3JCMQ 1M90C 2C0TA 1VIFA 4JRKA 2KRSA 3ASKA 3JB9D 2CSQA 2PTKA 3CCVT 2O4XB 1W2BA 1EX4A 2D6FA 1EFNA 1QLYA 2EYWA 1O75A 3GBQA 3QDRB 2H3JA 4OMNA 4FT2A 2O9VA 3TN8B 2ZAEA 4BE0A 2MOXA 3V7RA 3PVLA 2QDJA 1TUDA 2PHGA 2QQAA 4RG2A 4XTYA 4CC7A 2QTVA 3I55T 3CCRQ 1MNEA 3HO8A 2DMOA 1QCNA 2PZ1A 1Y96B 3OQ5A 4HCBA 1QWFA 2MCNA 2P84A 4E47A 3LWHA 2FZKB 4BD3A 2DEQA 4DA4A 2ECZA 4EOMB 1YITT 5CKFA 1YJ9T 1I5OB 2A37A 4EOSB 2M1HA 1K8AC 4DBRA 3M54A 3QSUA 2HSEB 1AHJB 2K5LA 4X1VA 2RI2A 1I07A 3X20B 3OYJA 4LOCA 1X75C 3CBPA 4V2SA 2RHUA 3M0RA 3FLGA 2OI3A 2RHIA 1PM3A 3OYEA 1MUZA 1FXXA 3G4ST 2E6ZA 1JSTB 2KXCA 4NL2A 1RAHB 4OMOA 5IN1A 2M9UA 2E65A 4KGZB 4ELZC 3BG3A 1VQ9T 1Q86U 1LVKA 2KDSA 1XOVA 3SWNB 2JNGA 2LCSA 4C92B 2C5NB 3VU3C 3OB9A 1VQMA 4RUGA 1YI2T 1MGQA 1SF9A 3TSZA 3SB2A 2UZBB 1RAEB 3MPUB 1BCMA 3B57A 4IUTA 1PCXA 3GIBA 1G5VA 3NFCA 3FB9A 2HBPA 2P0PA 3OMCA 4BI8B 2NUZA 3V8KA 2FEIA 2M16A 2X3WD 4BACA 2PK9B 2AK5A 2CZ1B 1IGUA 1FMVA 2RN8A 3VS2A 2DBMA 5KE3A 4MMKA 2AIRB 2XDBA 3FJ5A 1WXUA 2K5FA 2E64A 3PMTA 3H4CA 2LVMA 4M7AD 4C8QD 2CP0A 2KVQG 2E1HA 3SD4A 3S6WA 1FX7A 5FROA 1H3HA 3JV3A 4M77A 1PSFA 2NUTA 4RCCA 3CCLT 3HB9A 1E6HA 4BCND 3C0CA 4DOWA 2LQ8A 3Q1JA 2YUOA 4M4ZA 2KK4A 2QQSA 3MEUA 4J9GA 4QVCA 4Y72B 2BKZB 4ANJA 5FRMA 3G71Q 4F14A 2E70A 2CP7A 4XTZA 4M75C 2EWNA 3LGFA 5D6WA 5CK9A 1O9SA 1QP3A 1SSHA 4RTWA 4BI4A 1T3SA 2D1XA 2VXEA 1NJIC 2K2VA 1P5EB 2P0KA 3DLLA 1UG1A 4J6XA 3EG9A 4M77C 1WIEA 1QP2A 2JTEA 1KD1C 3M4YA 4FIBA 1W4SA 1VQKT 1VQ6A 3EFSA 4BCJB 4M75E 1OPLA 3QBYA 4ELYC 1VQ7Q 1GUXA 1WX6A 1VINA 2HCKA 3QWLA 5GAN6 2GF7A 5GANh 2LJ3A 1V29B 3JB9F 1WPYA 1YJNA 1I0CA 2JTMA 1WHMA 1NLPC 1QVFS 2DXCB 1WQ7A 2NUPA 1W70A 1IREB 3BFMA 2DKGA 4M7AG 2EGAA 5KYUB 2VGNA 2CSIA 3HHTB 2KMTA 4HCCA 2R7GA 4M7DB 4TVRA 4MFEA 3G1JA 3ZFJA 4E7LA 3OBYA 4IUQA 2QEXQ 4KH1B 3CPWA 1DJ7B 3BLQB 1KHIA 3QHSA 2L2PA 5FGKB 4Y92A 4P5NA 4EDUA 5KCHA 4ZGJB 1M1KC 1MV0B 2W10A 2D9TA 4BCMB 1Q82R 3E2UA 1X6BA 3F5XB 1WI7A 4C0DB 3LH0A 1VQ8A 4ESRA 2R5AA 3L2ZA 1YJWQ 4A4EA 4EOOB 3EGDB 3TQ7P 5DM7R 3QYHB 5EC7A 4F16A 2SEMA 3E1SA 3CMEA 2LP5A 2FPEA 3MP8A 2NYSA 1E7PA 1SRLA 2COZA 4C92G 3BHUB 1JJ2A 3NHNA 2KT1A 2WMBB 5CYIB 1BK2A 1E6GA 1H24B 1PHTA 4EMKB 3I9QA 5GMKi 1QCOA 2BE7D 3U23A 5IAYA 2DVEA 2I40B 4LXCA 4M78D 4AMCA 9ATCB 4L6V5 1B34A 2QA4Q 3ZBDA 4ZGDB 4RTYA 4HNVA 2A36A 4E7JA 2XK0A 2LDMA 4XU0A 1VQOA 5HK0A 5D7UA 4CFUD 2HZYA 3CCRT 2F2VA 1WGSA 1MMDA 3HRUA 3IQLA 4JJCA 1E9HB 1NEBA 2FYKA 2QQ9A 3H0IA 3A8MB 2RHXA 3RERA 2KRNA 4E7ZA 2DL5A 2EVRA 2DD5B 3M0PA 2AKLA 4KT0E 4RTVA 2L3PA 3DKMA 4RTUA 1AZEA 2BZ8A 3RUXA 3CC2Q 2ZZDB 1I1JA 1XNIA 2RQWA 3PNWC 1GBRA 2JOYA 3BHVB 2VVKA 4F7UE 1UGQB 1TD6A 4M7AF 1K73R 4C8QF 3O0GD 3JB9J 3PIPA 2OTJA 3GLXA 2DXBA 2EUFA 4C0GA 4JLGA 2CP3A 1W2BP 1BIBA 3RBBB 3FC3A 2ATCB 4C8QA 3RGFB 2DF6A 2V1QA 4Z89A 1M1KR 4KBMB 5GJWB 2D0NA 4AT1B 3HRTA 3EH2A 3OYCA 2COWA 4F17A 3JCMe 2DPPB 5GAN5 3JCMd 3DB3A 2E41A 1UJ0A 3JSCA 4J83A 1F1BB 3MKDA 1VOMA 3DTOA 4XU1A 1Q86C 4EOKB 2W9FA 3CCVA 2JW4A 3P8HA 4XTVA 1NG2A 4KULA 1VQPQ 4M78G 4HVWA 3O8VA 1WHJA 1MMGA 2Y4YA 5DY9A 1SG5A 2YT6A 2CT4A 2K4YA 4C8QC 1YP5A 2NLUA 2JTFA 4O6JA 5M9OA 1H8KA 1UGSB 3CXCA 1AOJA 5GJVB 4NL3A 4JRQA 1EIFA 1R0BG 2K79A 3REBB 4CI0C 4M7DG 1BB9A 1ZA1B 1D09B 1YITA 2CGHA 5KYNA 2C06A 4BY1X 3QUIA 1YIJQ 1R0CB 5LJ5d 3FIFA 3POMA 1H4LD 1TSFA 5CR2A 3S3OA 2L8DA 3UA6A 3KFVA 1K0XA 3DDPB 1OIUB 1X01A 4N4GA 6AT1B 2RH2A 3BG5A 3DOGB 5J26A 2XDDA 1RAAB 2WACA 1B07A 4G6LB 4XU3A 3G71T 1U1SA 2YHTA 3CC4Q 3G4SA 1VQ4Q 3M53A 1G3TA 3M0TA 1PRMC 2DXTA 1VQ9A 2J06A 4HT9A 2YRVA 5KH6A 2QTXA 2DNUA 1UDLA 2CJMB 2VB6A 4HVUA 5I5ZB 3MHXA 5IDPB 2DTHA 2EJ9A 1YI2A 5L8RE 5CQYA 3BG9A 2FRWA 2K3BA 3WVDB 1VQ7T 1N8RR 4BCKB 5ICPB 1K1ZA 4HCZA 1PD0A 5CKHA 1PKTA 3MY5B 1HYOA 1LCKA 2W0ZA 3UA7A 5FWCA 1JQQA 1X2KA 1YCYA 4M75B 3EGXB 5DQVA 2EQJA 4C0FA 2J05A 1PRLC 1FVVB 2C0IA 1Q82U 3MP6A 1X69A 5ACBA 1NZ9A 1KFZA 2IW9B 1AZGB 4M77B 2NUTB 4BCGB 3UATA 4EOJB 1P92A 4JJNK 3OS0A 4KUDK 1ABOA 2QEXT 4HXJA 4DBQA 1HD3A 1OL1B 2W9ZA 5DLQE 3BW1A 1UEBA 5KYWB 2K3XA 2CKKA 2GGRA 3UT1A 2A08A 1D1CA 1K9MR 3RKWA 1KXUA 1YJWT 3I56A 4ZTJA 1KD1U 3EG1A 1U5SA 1YNZA 4CFWB 2V8IA 1YHQA 2F5TX 3X28B 2WIPB 3C12A 3OYGA 1Z9QA 1AWWA 4QQGA 2KSSA 3HL8A 4F7NB 3A8OB 3N5BB 2C6TB 1VQ5Q 1VQKA 1WHKA 2V26A 5HBJB 1UJYA 1Y07A 5LJ5j 1PG5B 3QXEB 1BCOA 2C4GB 2DRKA 1ZUUA 4J9HA 2QA4T 1RACB 4XQ3A 4OB1B 1JO8A 2FRYA 5IT9E 2J7IA 2K5IA 3M59A 4CRLB 2KRMA 5LJ3d 3CPWP 3JCMh 3PVQA 3CCET 3K7AM 2J6KA 2PVOB 2XHCA 1OI1A 1LPLA 4OMLA 2NUPB 1S72Q 2BS3A 4PNOA 1K73U 1QWEA 2EPDA 3CCMQ 2CUDA 3V7SA 3HTRA 1JB0E 1M1KU 3CC7Q 4BCOB 2MK5A 1KQ1A 3MY1B 1WQWA 5GMKl 1JJ2P 4HL4A 4BCFB 3P8BB 3J81E 3JCMW 1UNHD 4E2FB 1E7OA 1M27C 2I0NA 4RTZA 2AZVA 2RJCA 5CCAA 2I2LA 3KXTA 3QHWB 4PJOA 1GCPA 1VQLT 2JUFA 2DD4A 4R0KA 1XO2A 5GANd 3CMAQ 1VQNT 4IKFA 1OU9A 3M5AA 3AHUA 1OI9B 1KG1A 5BNJB 3BDLA 1H641 2KY9A 3VS0A 1M3CA 3G6EQ 4LNPA 5D6XA 1QKXA 4MDWA 4RODA 1QVFA 1K9AA 3TSWA 3LH5A 2X3XD 3FDRA 1CKAA 4MDXA 3CCJQ 2XMFA 1B34B 1JEGA 1VQPT 4M75G 1WXTA 4F6WB 3OYAA 1C9BA 3EFOA 2CS7A 4J7IA 3M03A 1FYNA 4PJOC 4A53A 2OJ2A 2ZPHB 3CCRA 3MI9B 4HT8A 4J9BA 1UB4A 2QXFA 3KHIA 2RPNA 1FMWA 2MAMA 2JJ9A 4JX6A 3H8ZA 2FG0A 4LDVA 4LUDA 3EIDB 3RMQA 1YIJT 4F6UB 5L23A 3OYFA 1KQ2A 3HZJA 3VRYA 2WMAB 3NTKA 1U1TA 2ZPFB 2P4TA 3EGUA 4J5YA 1IRXA 3LWIA 2EKOA 2FZCB 3L42A 5GAOr 4KUIA 3PMIA 3EG0A 2CZ0B 2F5KA 3M0UA 1UFFA 3QYGB 2DXBB 3SHWA 4C5HA 1UNGD 4PLIA 2CZ7B 3OYKA 2E4HA 3OY9A 5LJ3j 3OYLA 2CCIB 3JB9H 1X43A 1N8RU 1BIAA 2IN3A 1BKBA 3CEYA 4OP0A 3VKHA 2EKHA 1KC8C 3M4GA 1MMNA 4BE2A 4Z8AA 2IVWA 3L1AA 2KQWA 1WHGA 2O88A 3ZL7C 1N6AA 2AKKA 4QW2A 4LDXA 4B9XA 2K9GA 1NPPA 3CXCP 1X27A 2DIQA 2DMEA 1BI0A 4IUPA 1OU8A 2IIMA 4IIOA 2QFZA 2HSPA 1ZLMA 3C94A 1J3TA 5GAN4 3JCMJ 1VQMQ 2DRMA 4QVZA 2BS4A 3J7AF 2DEUA 4IUVA 1M3BA 1IGQA 2DFUA 4AG1C 3G7ZA 2DO3A 1QQJA 1UHFA 1YCSB 4KGVB 5GANj 2WIHB 1OGUB 4CFVB 1K9MU 2LX7A 1UUEA 4RMOA 4C5GA 2MWOA 1Q82C 2DL4A 2KGTA 2HEQA 5HNBB 4BCHB 2DM1A 1QCFA 5LJ3h 3CCUT 1G3WA 2SRCA 1D0XA 3TNWB 3ZEHA 2GBQA 3DLMA 2V22B 1GRIA 3OA6A 4F7UG 3UPUA 1JU5C 2CT3A 1QVGS 2E10A 1Y57A 2L3RA 3JCMg 3OYDA 4C92D 1PWTA 4OGRB 1FMKA 4CFXB 2XKOC 4B6MA 5HKCA 1RADB 4FYVB 3JAME 4MZMA 5FU7C 2IVXA 5KE2A 2BE9B 1WZOA 3I5RA 2NWMA 4JPBW 4PKCC 3VKIA 4EOIB 1KC8R 5GAMe 2KXDA 1JXMA 4OR5B 5GAMd 1VQ7A 2V8KA 2VYTA 2C5XB 4BCIB 3QHRB 2GFAA 5A0LA 1VQ6Q 4M77E 4JZ3A 1OKVB 3OMGA 5D6YA 2E5KA 1S72T 4R56A 1SKUB 2RI3A 4CC4B 5LJ5g 3QYBA 2BKDN 2EIFA 2J6OA 4ZNXA 4YC3B 3GOXA 1K73C 1FWZA 1W1FA 2GCXA 1YJNQ 3CC7T 4Z88A 1D1BA 1B7TA 2QEXA 4HNTA 1U3OA 2YUNA 5CO7A 3QZ9B 1D3BA 2W96A 1R8OB 2A3LA 5KYXA 4CC2A 4N4HA 2GQIA 3CQTA 2QASA 4F7SB 5GAOp 4XTXA 2FHDA 2V1RA 1TTHB 5J39A 3M9QA 1YJWA 2C0OA 3INZA 3CMAT 5DQWA 3OYMA 2LCCA 3X24B 4IIMA 4I3ZB 1O9KA 2OTLA 4BI3A 1HSQA 1VQ8Q 4ME7A 2OX7A 1TU0B 1WA7A 4JZ4A 1NBEB 4FYYB 1OX9A 4J6WA 8AT1B 5LMKB 5C6SA 1JSUB 2EJGA 3EG2A 2UUEB 1QW1A 5IHIA 3OYNA 1EZZB 3CCJT 1ZUKA 2LZ6B 1OOTA 2R5MA 4J6YA 3BHTB 4ZN1A 3DDQB 3TU4K 1WXBA 2WJ9A 3OSVA 4LD9K 4J9FA 2CP2A 5GAN8 3CD6Q 4JS4A 3TW7A 2EJFA 2ROTA 5A0DA 3EHQA 5LL6S 3CCEA 2PNIA 3MEVA 3QJYA 4AI6A 1H27B 4M7DD 2HQHA 1MMAA 1M1GA 8ATCB 2GQVA 5HCKA 1F5QB 4QQDA 1GCQA 2JMCA 1YBYA 1M3AA 1TUGB 1WLPB 2LMJA 4UN0A 3LGLA 4BCMD 1V76A 2LNVA 3JCMP 2WSFE 3VYHB 2VUBA 1B3QA 4MZPA 3SFMA 3REAB 3A5ZB 4M7AA 3OYBA 3QDFA 4PJOB 2KI7A 2M0OA 2KR6A 1QVFP 4WTOB 1KIKA 2DD4B 3CCQA 1VQLA 5IHKA 3ULRB 1TOVA 3TNHB 3NPFA 3L2RA 2RHYA 4FSSA 4GLMA 1VQNA 2XU8A 3A1PA 3LYIA 4ROEA 1GCQC 4EOPB 1TXQA 1M2OA 2OTJQ 2DE0X 2F2CA 1N8RC 1WHHA 2EAYA 1N27A 1U06A 4EOLB 5GMKe 2EGEA 2L3QA 3OS5A 3TCJA 2XG8D 4PLLA 3ER0A 1BU1A 1A0NB 2RJEA 2DVJA 4C92F 3OBWA 2ZPGB 2A28A 2QQ8A 1G3YA 2H3EB 3RIRA 5EFQB 4OMQA 5LJ3g 1VQPA 2BTTA 3EFOB 4C92A 4M7AC 2RHZA 3I55A 1VQMT 2XICA 2MWPA 1D1AA 1XQHA 5CKBA 2PUKB 4PFZA 4J9EA 2ZPIB 3VKGA 1RABB 3QKJA 2RJFA 2PJQA 1BI3A 4L5GA 1YJ9A 4DBHA 4YOZA 4IURA 2WXVB 5GAMh 1SPKA 5I21A 2M0YA 1SEMA 2CREA 4GLKA 2EQIA 4C8QE 1K9MC 1BBZA 3MEAA 1Y0MA 3L2WA 4OMPA 5CIUA 2WHBB 1WJQA 2AT1B 2JM9A 1R77A 4BDZA 4EORB 1TFBA 2QG9B 4EIKA 2L0AA 5GAN3 5GANg 4EMHA 3OYIA 2QAZA 2JVVA 2DILA 1KC8U 5I22A 3VYGA 2RQTA 4HVVA 1G3NC 2MMPA 2X4YA 4VUBA 1C6VX 1RAFB 1QVPA 2BS2A 1UHCA 2CUBA 1RI0A 2KYBA 4Y28E 4XAXB 4TTHA 4DEXA 2QYZA 2EBPA 1UGRB 1W6XA 4WCIA 5HK3A 3VS3A 2VKNA 4LDUA 4ZN3A 3NTIA 1M5Q1 3A8HB 3SDZA 3QPHA 2OAUA 2RD1A 3QYEA 1VQ6T 3M0SA 1XJWB 5HBEB 2I53A 5IF1B 1TWBA 5I11A 5CVIA 1VA7A 2P4RA 1WHLA 5GAOq 4M78F 1GFDA 1VYWB 4FW2A 2CYZB 4YOSA 4BUGA 5FU7B 3HPWA 2RB6A 3T9NA 4M78A 1C0MA 3CCLA 1MV3A 4KRCB 2WSCE 2ESWA 2QGGA 1YJNT 1WJSA 3OSSC 3VS7A 3PFSA 5GAOm 3H0HA 4EC9B 5FW9A 2RQVA 2YSQA 3CCUA 4M7DF 2RI5A 2PMIB 3URGA 4FX3B 2JXBA 4DQ2A 2RMOA 1GBQA 3V7CA 3TNIB 4BCQB 4M7DA 1D0YA 4KGXB 3CBMA 1TH7A 2CP6A 3GP8A 2DK3A 2LT4A 5ECAA 2AHJB 3ME9A 1YWOA 1AEYA 3EG9B 3BLRB 1ZA2B 4JJBA 2GTOA 1PSEA 1X6GA 4M78C 5CQXA 3M58A 1LOJA 1VQ8T 3H6ZA 5FLXE 3KUFA 1M1FA 3CPFA 4PJNA 3VS1A 1U8RA 4PJJA 3GTMS 3I56Q 4X34A 1H3ZA 2RF0A 4MIMA 2VV5A 4NSTB 1SSFA 2K7AA 1GUXB 2FVUA 2HMAA 4A63B 1OZ3A 2MF2A 1YHQQ 4M75D 3JCMb 2DXUA 4MZTA 2BUDA 1K4US 1H1PB 1VQKQ 2EGCA 3CD6T 1QKWA 4JS5A 4F6SB 4PK4A 3VV0A 4Z02A 4EMKA 2HNIA 3LX7A 4HLQA 4M77D 1S72A 5GMKh 3LW5E 3SEMA 2ZCFB 4HNUA 2EW3A 4PJLA 1AWOA 3VS4A 2DBKA 3VJPA 4HKEA 1Q95G 2COYA 1QVGA 4JRIA 2YLCA 4EMGA 1YFNA 2X51A 1H26B 1NM7A 2QK0A 5IHYA 1NE8A 1XTDA 5IHNA 1BYMA 2HKQB 3TREA 3CC2T 2J6FA 1UE9A 1T0JA 4C5EA 1Q7YC 2O01E 2DD5A 3I5SA 3WXMB 2ABLA 4Q5WA 1IHVA 2EFIA 1AVZC 4FM4B 3PE0A 1D0ZA 2ZZDA 4MFDA 2X9HA 3CCSQ 2PU9B 5CKDA 1O9KB 1I4K1 4OB3B 1JKWA 4OGCA 2D0QB 4E6RA 5A2QE 4PL6A 3BLHB 4QT7A 1RUWA 5GAMg 1I8FA 2LRQA 4O5VA 1IO6A 2KT8A 1RI9A 1OPKA 2X4XA 3CCJA 5HY6A 1TUCA 2X4JA 3RNJA 1X2QA 3VUZA 1AD5A 2K57A 4JRPA 2ROLA 1ACMB 2FPFA 4JX5A 2DX1A 2DZ9A 2C5VB 2DL8A 5HQ0B 3HKSA 4M77G 3TEEA 1RAGB 4II5B 5KYYA 4XTWA 2DIGA 2JZ2A 1N4MA 4EPCA 3MO8A 4DBFA 4AFSC 3JRZA 2KYMA 1WYXA 4PJOE 3V8LA 1VYVA 1AWJA 1IZ6A 2EYXA 4JX4A 3DJBA 2QQBA 2XI9A 2WEVB 4JJDA 3EFRA 2GNCA 2DJZA 4FCYA 4RCBA 4A4GA 4M7AB 1V1CA 4C8QB 3CC4T 2R58A 1VQ4T 1IXDA 1Q7YR 4RTTA 5I2SA 4J9CA 3GNFB 1RAIB 2RK2A 1CSKA 1M8MA 4JDSA 3MIAB 2JN0A 2HKNA 4BCNB 2UZEB 1Q81R 3HBLA 2B9RA 3M57A 2JGZB 4LN2A 1W98B 1H28B 1C1AA 5IXFA 3QZ5B 2LQKA 1NYGA 4F04B 1IHWA 3JCMf 3R6NA 2X35A 1WFWA 3JB9G 4A54A 4DOVA 2G9XB 4II1A 1AWXA 1M90R 3A8GB 4KH0B 1H25B 2FZGB 4ATOA 2HL5C 5FRNA 1G3SA 4M75F 3LLRA 1VYTA 1UECA 2KEAA 1KK7A 1ZSGA 1AD6A 3OW2S 4J8OA 1PC0A 4HCKA 4ROCA 4M75A 2HAXA 2KE9A 3EGXA 4IMYB 4LD6A 2EYZA 3RKXA 4ORZA 4BY6C 1LJOA 2FO0A 2BZYA 4M77F 3PT9A 4WF2A 1ZHIA 2LJ1A 2VC8A 3G71A 1KQSS 1RLPC 4BXXX 3UF4A 1PD1A 1VYUA 1UTIA 2YUPA 5IDNB 3HRSA 2HBWA 4GBQA 3RDVA 4AKHA 5LJ5f 3VYGB 2ENMA 2YWWA 1TG0A 2RJDA 5CAIA 4BY7X 2KAFA 4LE9A 2YDLA 5GAOl 2G77A 4XK8E 2X4WA 1K8AR 1ZBJA 2ZPEB 4NC6A 1OIYB 5KYWA 2QGFB 4PFPA 3PTAA 1HXDA 1VQ5T 1FINB 3L2VA 2VASA 3RESA 3C95A 3E19A 3I56T 7AT1B 3THKA 4KRTA 2KBTA 1PKDB 1D3UB 3VRZA 3MEWA 1YHQT 4OF1A 1MHNA 4A4KA 2W2HA 3GNGA 2MYSA 2KNBB 3FRNA 2UZLB 3BY7A 4FT4A 4AKGA 1ENWA 4E7IA 2BPMB 4EC8B 4X9DA 3CBOA 2DETA 3E9GA 3NDQA 1YN8A 5GAN7 1UGVA 2E3IA 2ED1A 4EONB 5GAOn 2VGMA 3CCMT 1ZX6A 4M78B 1M4ZA 3FJPA 1W2BS 2IW6B 3H0FA 1SHGA 4PFOA 5LQFB 3PGGA 4CFUB 3S3MA 2C5OB 4D8KA 4AG2C 4C8QG 1NYFA 1M9SA 1SHFA 3A98A 4AFQC 3BDUA 1G83A 4E7SA 1OX8A 5CEIB 2DL3A 5FU6C 1OYXA 1SRMA 3NGPA 4K11A 3CCST 1M2VA 3M56A 5AYFA 3OW2P 1ZP2A 4CRIA 4F7UF 2VWFA 3QIIA 1ZSZA 3G6ET 5EG2A 4NS5A 2RNAA 2L3SA 2RA2A 2WSEE 2JMAA 3CMEQ 4GY5A 2DA9A 4F7UA 1G2BA 2XD0A 2Y90A 1H1RB 1OV3A 1Z9ZA 3M55A 2YRCA 5IXBA 5GAN2 3R6OA 2WPAB 1ZUYA 1KQSP 4LDWA 1OKWB 2QA4A 2OTLQ 2E5QA 2YUQA 3L2UA 2CDTA 1QVGP 2MI6A 4OB2B 4J7FA 1NJIR 1H1QB 2PK2A 3X26B 3CD6A 4E7HA 4BDYA 3H9NA 2O4XA 4EOQB 4FL6A 1T0HA 3QJ6A 2L89A 4Y91A 3FEOA 1KD1R 4CXAB 2QDLA 2RQUA 1Y71A 4B9WA 2WFYB 1VQOQ 2B8AA 4HA8A 3C4SA 4BCPB 4M6VA 2CCHB 4BBRM 2A7YA 1ZSZC 2QF7A 1Q7YU 2LC4A 3CCEQ 1UGPB 5GMKm 2XIDA 1Y96A 5EJCA 2E3HA 5LJ3f 3V8JA 3GPLA 1MNDA 4PJMA 4A4HA 3CC2A 2DZCA 4N0AA 3HSBA 4F7JB 4OVAA 2ZPBB 2EQKA 2LCLA 1Q81U 5GAMj 2HDAA 4D6WA 4C5IA 2LTOA 1CKBA 2QDYB 2DAQA 2DJQA 1OQKA 3RKYA 3MCAB 1GXIE 3F70A 1WJRA 4FU6A 2HQXA 2IW8B 3VS5A 2IPOB 3JCMX 2GTJA 1PNJA 4XTUA 1NPRA 1OEBA 3HFNA 3EJ1B 3JB9I 4IUUA 4QSHA 2JS0A 2LQWA 1M8VA 1M90U 1VQLQ 3CCQQ 2F1LA 2FB7A 4N0AC 3A8LB 1VQNQ 2JM8A 4N4IA 2E12A 2YXYA 2DLPA 3BE3A 5GANf 3SWNA 3VS6A 4BE1A 4LDYA 1K76A 3QO3A 2L5QA 5KCOA 2KROA 3CCVQ 2YRDA 3RR6A 2DYBA 1X6OA 2CP5A 2M51A 4Z6YA 2LT1A 2P0QA 4R55A 3RMSA 2QGSA 2RO0A 4RKUE 5KYYB 3EG3A 3I55Q 1QMZB 1YIJA 5I2MA 4QQ6A 2G6FX 4M7AE 4JLIA 3VUBA 1G8XA 3EOCB 3D7SB 2EYQA 2PVDB 3SWNC 3HFOA 1K0SA 2O9SA 1YITQ 1K8AU 5J3BA 4C92C 4PJOD 1YJ9Q 2DYIA 4LUEA 1KHCA 1OL2B 2EQMA 5LJ5e 3DL1A 2LJ0A 2K3YA 4JUVA 3EAEA 3CC4A 4YTLA 1VQ4A 2CZ6B 1QLBA 1BI2A 1LNXA 2W99A 3WVEB 4UC4A 4XU2A 1S1NA 4A4FA 2QQRA 3O5ZA 2JS2A 2DL7A 3EHRA 1H92A 3PIOA 1WDXA 4FYWB 1M30A 3TVTA 4AFZC 3G4SQ 2BIVA 4C92E 5A0GA 3NTHA 1RL2A 1N9RA 1NLOC 2RQRA 1KJWA 3CPWS 2UZDB 1ZBXA 3DB4A 1FKMA 1VQ9Q 4BY6B 1JRIA 1JBMA 1RLQC 3PO3S 4ZTFA 3JCMV 1QMCA 1GL5A 2R57A 4ELLA 1YI2Q 3GF5A 3AT1B 2GFUA 1VIEA 2JT4A 3QWXX 2DTOA 1JJ2S 1Q86R 3L2QA 2LX9A 2EYYA 2AZSA 1ARKA 5CKEA 1OULA 4AFUC 4CFMB 2Y4XA 4E7KA 1IB8A 1GY3B 4OGEA 2MPXC 2DTIA 3OS2A 1I5LA 2LQNA 2IG0A 2DXCA 2FL7A 5GMKj 2BZXA 1OZ2A 2CH4W 3OYYA 4QKUA 4NOYA 2M02A 3META 2FPDA 4PJOG 1NEGA 5KYUA 2LW4A 1HK9A 4ZGEB 3OS1A 3CCLQ 4BBSM 3NMZC 5HVYB 1N9SA
chains in the Genus database with same CATH topology
3OYCA 3JCMe 4EPCA 2DPPB 3MO8A 5GAN5 3JCMd 3DB3A 2E41A 2GFAA 3JSCA 4J83A 5A0LA 3JRZA 2V8JA 4PJOE 4X9CA 4M77E 3V8LA 3OYHA 2YLBA 4XU1A 1Q86C 1IZ6A 4RG8A 4JX4A 3TW6A 2QQBA 3OMGA 5D6YA 3J80E 1NJIU 2XI9A 3CCVA 3EFRA 1S72T 1VQ5A 4R56A 2RI3A 2RK1A 3P8HA 5LJ5g 3QYBA 2DJZA 4XTVA 2BKDN 4RCBA 4A4GA 4M7AB 4KULA 2EIFA 4C8QB 3CMET 4AKIA 3CC4T 2R58A 4M78G 3O8VA 4ELJA 1VQ4T 5I2SA 2Y4YA 3GOXA 1K73C 3S3NA 3GNFB 5DY9A 1FWZA 2GCXA 2E6NA 2K4YA 1BI1A 2RK2A 4C8QC 3CC7T 4JDSA 2OTLT 2JN0A 2PQWA 2QEXA 4M7DC 5DLOA 4HNTA 2NLUA 5CO7A 3QZ9B 3OW2A 1D3BA 2JTFA 4O6JA 1R8OB 3E9FA 2A3LA 5M9OA 3HBLA 2PUOB 4M78E 4N4HA 1UGSB 3CXCA 4NL3A 4JRQA 1EIFA 4CI0C 4M7DG 1I81A 1YITA 5FU6B 2CGHA 3M57A 2FHDA 4XTXA 5GAOp 2C06A 4MMLA 4LDXA 5J39A 3QUIA 3M9QA 4OB0B 1YJWA 5LJ5d 3FIFA 4BB7A 5GAMf 5CR2A 3S3OA 1KQSA 4C0DC 3QG1A 2HD0A 2XDPA 2L8DA 3INZA 3QZ5B 4FSXA 2LQKA 1VQOT 3CMAT 3OYMA 2LCCA 5LJ3e 3X24B 3CCMA 1X01A 4N4GA 2RH2A 3BG5A 5J26A 3JCMf 2XDDA 3CC7A 4M7DE 2X35A 2WACA 3JB9G 2OTLA 4BI3A 1D3BB 4A54A 4DOVA 1VUBA 4XU3A 4II1A 4ME7A 3X25B 4OMFB 3G71T 4C0ZA 3A8GB 4J6WA 2PVGB 1U1SA 1Y7XA 4ATOA 1WNLA 5C6SA 2HQEA 2EJGA 2YHTA 3MP1A 3G4SA 5FRNA 1QW1A 1G3SA 4M75F 3LLRA 3M53A 3OYNA 1G3TA 3HP9A 2V8KA 3CCJT 2VXFA 3UWNA 2R5MA 2F69A 4J6YA 4EMKC 1Q81C 3OW2S 4J8OA 4ZN1A 4QVDA 2DXTA 3TU4K 1VQ9A 2WJ9A 4M75A 2HAXA 4HT9A 2RM4A 2KMGA 2YRVA 3OSVA 4LD6A 3CMAA 5GAN8 4LD9K 3RKXA 5KH6A 2QTXA 3CXCS 3TW7A 2EJFA 4JS4A 4BY6C 5C0MA 3CCSA 3P8DA 5A0DA 3MHXA 1LJOA 5LL6S 1ZQ1A 4PJOF 2DTHA 2EQUA 3QJYA 3MEVA 4M77F 3CCEA 4L59A 3PT9A 4WF2A 3JCMc 2OTJT 2EJ9A 2G3RA 5L8RE 1YI2A 5CQYA 1ZHIA 2ZGWA 2QI2A 3UDCA 4AI6A 2VC8A 3G71A 3BG9A 1KQSS 4M7DD 1M1GA 2GQVA 3KBGA 3CCQT 3WVDB 1VQ7T 4QQDA 3G6EA 5GANe 4HCZA 4F7UB 1YBYA 3HRSA 5CKHA 4AKHA 5LJ5h 5LJ5f 3VYGB 3JCMQ 1M90C 1VIFA 2RJDA 3LGLA 5CAIA 2KAFA 1YCYA 4M75B 5GAOl 2LNVA 4JRKA 2G77A 4XK8E 2X4WA 3ASKA 3JB9D 2ZPEB 4NC6A 2EQJA 2WSFE 4C0FA 3JCMP 3VYHB 3CCVT 2O4XB 1W2BA 2VUBA 1HXDA 3PTAA 1VQ5T 2D6FA 3L2VA 1Q82U 1O75A 4MZPA 3MP6A 3RESA 3C95A 3QDRB 3SFMA 3A5ZB 2H3JA 4FT2A 3E19A 3I56T 1NZ9A 4M7AA 4PJOD 3OYBA 4PJOB 2M0OA 4M77B 2KR6A 4BE0A 2DD4B 3CCQA 1VQLA 3V7RA 3MEWA 1YHQT 2QDJA 4RG2A 1P92A 2QQAA 4XTYA 3OS0A 4JJNK 4OF1A 2RHYA 1MHNA 4A4KA 3I55T 2XU8A 3GNGA 3L2RA 2QEXT 4KUDK 1VQNA 3LYIA 3HO8A 3FRNA 1Y96B 5DLQE 3BW1A 3OQ5A 1UEBA 4HCBA 4E47A 3LWHA 1N8RC 3BY7A 4FT4A 4AKGA 4BD3A 2EAYA 2DEQA 1N27A 2K3XA 4E7IA 4DA4A 2CKKA 1YITT 4X9DA 5GMKe 3UT1A 3CBOA 3OS5A 5CKFA 3TCJA 2XG8D 4PLLA 3ER0A 1YJ9T 2RJEA 3E9GA 3RKWA 1YJWT 4C92F 2M1HA 2ZPGB 3OBWA 2QQ8A 1G3YA 3RIRA 5GAN7 3I56A 4ZTJA 1K8AC 1KD1U 3M54A 5GAOn 5LJ3g 1VQPA 3QSUA 2VGMA 3CCMT 4M78B 1M4ZA 3FJPA 1AHJB 2K5LA 2V8IA 4C92A 2F5TX 1YHQA 4M7AC 3X28B 3C12A 3OYGA 1W2BS 2RI2A 2RHZA 3I55A 1VQMT 2XICA 2MWPA 3X20B 3OYJA 4QQGA 4LOCA 1X75C 2KSSA 3HL8A 3PGGA 3A8OB 1XQHA 3CBPA 3N5BB 2PUKB 2RHUA 5CKBA 3S3MA 1VQKA 3FLGA 2ZPIB 4V2SA 2RHIA 3OYEA 3VKGA 1Y07A 4C8QG 1M9SA 1FXXA 3QKJA 5LJ5j 3G4ST 2RJFA 3QXEB 1BI3A 2E6ZA 4L5GA 4NL2A 1YJ9A 3BDUA 4IURA 2QA4T 5GAMh 5IN1A 2M9UA 2E65A 1VQ9T 4ELZC 3BG3A 1Q86U 4XQ3A 4OB1B 1OYXA 2KDSA 1XOVA 5FU6C 3SWNB 5I21A 5IT9E 2JNGA 2K5IA 3M59A 4GLKA 5LJ3d 4C8QE 4C92B 3CCST 1K9MC 3VU3C 3JCMh 3CCET 3M56A 3MEAA 5AYFA 3L2WA 3OB9A 2PVOB 2XHCA 5CIUA 1WJQA 4BDZA 1VQMA 1OI1A 1YI2T 4CRIA 1MGQA 4F7UF 2BS3A 4PNOA 3SB2A 1K73U 3QIIA 5GAN3 3G6ET 5GANg 5EG2A 4IUTA 2WSEE 4NS5A 2RA2A 4EMHA 3NFCA 3GIBA 1G5VA 4GY5A 3FB9A 3OYIA 4F7UA 2HBPA 2P0PA 2XD0A 2Y90A 3M55A 2JVVA 3OMCA 4BI8B 1KC8U 3V7SA 1JB0E 3VYGA 1M1KU 5GAN2 3R6OA 3V8KA 2M16A 2MMPA 4LDWA 4BACA 2X4YA 2QA4A 4VUBA 2E5QA 1KQ1A 3L2UA 2CZ1B 1WQWA 5GMKl 2MI6A 4OB2B 4HL4A 4J7FA 1QVPA 5KE3A 2BS2A 3X26B 4MMKA 1RI0A 3CD6A 4E7HA 2XDBA 4BDYA 2K5FA 3P8BB 2O4XA 3J81E 3JCMW 4Y28E 4XAXB 4FL6A 3QJ6A 2E64A 3PMTA 3H4CA 2L89A 2LVMA 4M7AD 4Y91A 4C8QD 3FEOA 2KVQG 2RJCA 2E1HA 3SD4A 5CCAA 3S6WA 1FX7A 2I2LA 3KXTA 5FROA 4PJOA 4B9WA 1Y71A 1VQLT 4M77A 1PSFA 1UGRB 2JUFA 4RCCA 5HK3A 2DD4A 3CCLT 3HB9A 4LDUA 2B8AA 4HA8A 5GANd 3C4SA 1VQNT 4M6VA 4ZN3A 4BBRM 1M5Q1 3NTIA 2A7YA 3M5AA 2QF7A 3A8HB 2LQ8A 2LC4A 3Q1JA 3SDZA 4DOWA 3QPHA 2OAUA 1Q7YU 2RD1A 1UGPB 2KK4A 2QQSA 3MEUA 3QYEA 5GMKm 2XIDA 3AHUA 1Y96A 5EJCA 4QVCA 1VQ6T 5LJ3f 3V8JA 3GPLA 1KG1A 3BDLA 1H641 4A4HA 2KY9A 3CC2A 5FRMA 2DZCA 4N0AA 3HSBA 4OVAA 2E70A 4XTZA 2ZPBB 2EQKA 2EWNA 2LCLA 4M75C 5CVIA 3LGFA 1Q81U 5GAMj 5D6XA 4MDWA 5D6WA 4D6WA 4M78F 1O9SA 4C5IA 1QP3A 5CK9A 5GAOq 1QVFA 2LTOA 4MDXA 3FDRA 2QDYB 2DAQA 4BI4A 2CYZB 3RKYA 2VXEA 1B34B 3MCAB 1NJIC 4BUGA 1VQPT 1GXIE 5FU7B 4M75G 2K2VA 3HPWA 2RB6A 3F70A 3T9NA 4M78A 1WJRA 4FU6A 2HQXA 3CCLA 2WSCE 3OYAA 2P0KA 3DLLA 2CS7A 4J7IA 4J6XA 1YJNT 4PJOC 1WJSA 3OSSC 4A53A 4M77C 3PFSA 1QP2A 2ZPHB 3JCMX 3M4YA 5GAOm 3CCRA 4FIBA 1KD1C 1W4SA 1VQKT 1VQ6A 4HT8A 3EFSA 1UB4A 2QXFA 3CCUA 2RI5A 4M7DF 4XTUA 1NPRA 3KHIA 3HFNA 3JB9I 4IUUA 4M75E 4QSHA 3URGA 2MAMA 4DQ2A 1M8VA 1M90U 3V7CA 3QBYA 4ELYC 4JX6A 3H8ZA 2FB7A 4M7DA 4LDVA 4N0AC 3A8LB 3RMQA 3QWLA 5GAN6 2GF7A 1YIJT 4N4IA 3OYFA 3CBMA 1KQ2A 2E12A 3HZJA 1TH7A 3NTKA 3GP8A 5GANh 1U1TA 5GANf 3SWNA 2DK3A 4BE1A 1V29B 4LDYA 3JB9F 2LT4A 2AHJB 2ZPFB 2P4TA 3ME9A 4J5YA 3QO3A 2L5QA 5KCOA 1WPYA 2EKOA 3LWIA 3L42A 5GAOr 1YJNA 2JTMA 3PMIA 4KUIA 1PSEA 4M78C 1QVFS 2DXCB 2CZ0B 3M58A 1LOJA 5CQXA 1VQ8T 3H6ZA 1WQ7A 2F5KA 5FLXE 1IREB 1X6OA 3KUFA 1M1FA 3CPFA 3QYGB 2DXBB 2DKGA 3BFMA 1U8RA 4M7AG 4C5HA 4X34A 1H3ZA 2VGNA 4Z6YA 2LT1A 4MIMA 2VV5A 1SSFA 2P0QA 4R55A 4HCCA 3HHTB 2CZ7B 2FVUA 2KMTA 2RO0A 4PLIA 3RMSA 1OZ3A 2MF2A 4RKUE 4TVRA 3OYKA 4M7DB 3OY9A 4M75D 4MFEA 5LJ3j 3JCMb 2DXUA 3ZFJA 3OYLA 4E7LA 3JB9H 1YIJA 1N8RU 1BIAA 3OBYA 4IUQA 5I2MA 3CPWA 4MZTA 1BKBA 1DJ7B 3CEYA 1KHIA 2BUDA 3QHSA 4OP0A 4QQ6A 3VKHA 4M7AE 4JLIA 4P5NA 4EDUA 3VUBA 4ZGJB 3M4GA 5KCHA 4BE2A 4JS5A 1KC8C 1M1KC 3CD6T 2IVWA 2D9TA 2EYQA 3L1AA 2PVDB 3VV0A 2KQWA 3SWNC 3HFOA 4Z02A 4EMKA 1K8AU 5J3BA 4C0DB 1N6AA 2HNIA 4QW2A 3LH0A 4B9XA 3LX7A 4HLQA 4M77D 4C92C 1VQ8A 1KHCA 1S72A 1NPPA 2R5AA 3L2ZA 4A4EA 2DIQA 2EQMA 5LJ5e 5GMKh 1BI0A 3LW5E 5DM7R 4IUPA 3DL1A 2ZCFB 3QYHB 4HNUA 3E1SA 3CMEA 2QFZA 2K3YA 3EAEA 3MP8A 4JUVA 3CC4A 4YTLA 1E7PA 3VJPA 4C92G 2CZ6B 1QLBA 1BI2A 1LNXA 3C94A 4HKEA 1QVGA 4JRIA 2YLCA 5GAN4 1JJ2A 4EMGA 3JCMJ 3WVEB 4UC4A 4XU2A 4A4FA 1NE8A 1XTDA 2QQRA 4QVZA 1BYMA 3TREA 2BS4A 3CC2T 3J7AF 4IUVA 4C5EA 3PIOA 1Q7YC 3G7ZA 2DO3A 2BIVA 2O01E 4C92E 4EMKB 5A0GA 3NTHA 1RL2A 2DD5A 5GMKi 1N9RA 5GANj 5IAYA 2DVEA 3WXMB 3CPWS 4M78D 4Q5WA 4L6V5 1B34A 1K9MU 1ZBXA 3ZBDA 3DB4A 1FKMA 4C5GA 4ZGDB 4BY6B 4HNVA 4RMOA 2MWOA 1Q82C 2EFIA 4E7JA 2XK0A 2LDMA 1JRIA 4FM4B 4XU0A 1VQOA 1JBMA 5HK0A 2ZZDA 4MFDA 4ZTFA 2PU9B 5CKDA 3JCMV 3HRUA 1WGSA 3CCRT 1I4K1 4OB3B 2R57A 2FYKA 4OGCA 5LJ3h 3CCUT 2D0QB 2QQ9A 3A8MB 3GF5A 1G3WA 5A2QE 2RHXA 4PL6A 2GFUA 1VIEA 3RERA 3ZEHA 3DLMA 5GAMg 1I8FA 2LRQA 3OA6A 4F7UG 4O5VA 2DD5B 3UPUA 2DTOA 1VQ4A 1JJ2S 4KT0E 2E10A 1QVGS 3L2QA 2LX9A 2X4XA 2L3RA 3JCMg 5CKEA 3OYDA 3CCJA 4C92D 3DKMA 5HY6A 2Y4XA 4E7KA 3RUXA 2X4JA 2XKOC 2ZZDB 1XNIA 5HKCA 3PNWC 4OGEA 3VUZA 4MZMA 3JAME 2JOYA 5FU7C 2DTIA 2K57A 1UGQB 4F7UE 3OS2A 4JRPA 1I5LA 4M7AF 5KE2A 4C8QF 2IG0A 2DXCA 2FL7A 3JB9J 5GMKj 4JX5A 3PIPA 2OTJA 1OZ2A 3OYYA 3GLXA 2DZ9A 4NOYA 2DXBA 4C0GA 3META 4JLGA 4PKCC 1BIBA 4PJOG 3VKIA 3FC3A 3HKSA 4M77G 3TEEA 4C8QA 1HK9A 5GAMe 4ZGEB 3OS1A 5GAMd 4BBSM 4KBMB 1VQ7A 4XTWA 3HRTA 1N9SA 4IKFA 2DIGA 2JZ2A 2VYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPP B;  1DJ7 B;  2CZ1 B;  4XK8 E;  4OB2 B;  4ZGJ B;  3X26 B;  2ZPE B;  2WSF E;  3VYH B;  2PVD B;  4Y28 E;  3LW5 E;  3QYH B;  2ZCF B;  1UGR B;  1PSF A;  2DD4 A;  2DD4 B;  2CZ6 B;  3VYG A;  3A8H B;  3WVE B;  1UGP B;  3QZ9 B;  2PUO B;  1UGS B;  2ZPB B;  2O01 E;  2DD5 A;  1QP3 A;  2QDY B;  2ZPG B;  4OB0 B;  2CYZ B;  4L6V 5;  1GXI E;  4ZGD B;  3QZ5 B;  4FM4 B;  2WSC E;  1AHJ B;  2ZZD A;  3X24 B;  3X28 B;  2PU9 B;  1QP2 A;  2ZPH B;  4OB3 B;  3X20 B;  2D0Q B;  3A8O B;  3A8M B;  2PUK B;  3X25 B;  2ZPI B;  3A8G B;  2PVG B;  3QXE B;  2DD5 B;  4KT0 E;  3A8L B;  4OB1 B;  1V29 B;  2AHJ B;  2ZPF B;  2ZZD B;  1UGQ B;  2PVO B;  1PSE A;  2DXC A;  2DXC B;  2CZ0 B;  1IRE B;  5L8R E;  2DXB A;  3QYG B;  2DXB B;  2WSE E;  3WVD B;  4ZGE B;  3HHT B;  2CZ7 B;  4RKU E;  1JB0 E;  3VYG B; 
#chains in the Genus database with same CATH topology
 2O31 A;  4KRD B;  1N5Z A;  1KSW A;  3CCU Q;  2V8J A;  4J9D A;  2CH4 A;  4X9C A;  2F2W A;  3OYH A;  5HBH B;  2YLB A;  2KR3 A;  4D8D A;  4RG8 A;  3TW6 A;  3J80 E;  1NJI U;  3QWY A;  1VQ5 A;  2RK1 A;  1VOL A;  1TS9 A;  3EGD A;  5AT1 B;  1PKS A;  3CME T;  4AKI A;  3EH1 A;  4ELJ A;  1T3L A;  3S3N A;  1URC B;  5FWB A;  2D8H A;  2E6N A;  1BI1 A;  2A0F B;  2OTL T;  5L2W B;  2PQW A;  4M7D C;  5DLO A;  4F7L B;  1GH6 B;  3OW2 A;  3E9F A;  2PUO B;  1YWP A;  4M78 E;  2ED0 A;  4RTX A;  2D8J A;  1I81 A;  5FU6 B;  2DER A;  4MML A;  2Z0W A;  1BU2 A;  1AIS B;  4OB0 B;  2K2M A;  5IH2 A;  4BB7 A;  2K6D A;  5GAM f;  1KQS A;  4C0D C;  3QG1 A;  2HD0 A;  2XDP A;  1VQO T;  4FSX A;  2B86 A;  5LJ3 e;  3CCM A;  4J9I A;  3CC7 A;  4M7D E;  3M0Q A;  3MJX A;  1D3B B;  1VUB A;  3X25 B;  4OMF B;  4C0Z A;  4BCQ D;  5KYX B;  4FYX B;  2OAW A;  2PVG B;  4CFN B;  4F70 B;  1WNL A;  1Y7X A;  2HQE A;  2LNH B;  4OMM A;  3MP1 A;  4FW1 A;  2H8H A;  1ABQ A;  3HP9 A;  2VXF A;  3UWN A;  1H1S B;  3H41 A;  4CC3 A;  2F69 A;  1GFC A;  4EMK C;  1Q81 C;  4QVD A;  2RM4 A;  2KMG A;  3CMA A;  3CXC S;  4DEY A;  1HJD A;  2HL3 A;  1M2V B;  5C0M A;  4YOO A;  3CCS A;  3P8D A;  2MIO A;  2O2O A;  1ZQ1 A;  4PJO F;  2EQU A;  1UNL D;  2OTJ T;  4L59 A;  3JCM c;  2G3R A;  2ZGW A;  2QI2 A;  3UDC A;  1JOW A;  1JXO A;  1ZSZ B;  2F2X A;  3KBG A;  2X1N B;  3G33 B;  3CCQ T;  3G6E A;  5GAN e;  4F7U B;  3LQ5 B;  1AT1 B;  3I35 A;  5LJ5 h;  3JCM Q;  1M90 C;  2C0T A;  1VIF A;  4JRK A;  2KRS A;  3ASK A;  3JB9 D;  2CSQ A;  2PTK A;  3CCV T;  2O4X B;  1W2B A;  1EX4 A;  2D6F A;  1EFN A;  1QLY A;  2EYW A;  1O75 A;  3GBQ A;  3QDR B;  2H3J A;  4OMN A;  4FT2 A;  2O9V A;  3TN8 B;  2ZAE A;  4BE0 A;  2MOX A;  3V7R A;  3PVL A;  2QDJ A;  1TUD A;  2PHG A;  2QQA A;  4RG2 A;  4XTY A;  4CC7 A;  2QTV A;  3I55 T;  3CCR Q;  1MNE A;  3HO8 A;  2DMO A;  1QCN A;  2PZ1 A;  1Y96 B;  3OQ5 A;  4HCB A;  1QWF A;  2MCN A;  2P84 A;  4E47 A;  3LWH A;  2FZK B;  4BD3 A;  2DEQ A;  4DA4 A;  2ECZ A;  4EOM B;  1YIT T;  5CKF A;  1YJ9 T;  1I5O B;  2A37 A;  4EOS B;  2M1H A;  1K8A C;  4DBR A;  3M54 A;  3QSU A;  2HSE B;  1AHJ B;  2K5L A;  4X1V A;  2RI2 A;  1I07 A;  3X20 B;  3OYJ A;  4LOC A;  1X75 C;  3CBP A;  4V2S A;  2RHU A;  3M0R A;  3FLG A;  2OI3 A;  2RHI A;  1PM3 A;  3OYE A;  1MUZ A;  1FXX A;  3G4S T;  2E6Z A;  1JST B;  2KXC A;  4NL2 A;  1RAH B;  4OMO A;  5IN1 A;  2M9U A;  2E65 A;  4KGZ B;  4ELZ C;  3BG3 A;  1VQ9 T;  1Q86 U;  1LVK A;  2KDS A;  1XOV A;  3SWN B;  2JNG A;  2LCS A;  4C92 B;  2C5N B;  3VU3 C;  3OB9 A;  1VQM A;  4RUG A;  1YI2 T;  1MGQ A;  1SF9 A;  3TSZ A;  3SB2 A;  2UZB B;  1RAE B;  3MPU B;  1BCM A;  3B57 A;  4IUT A;  1PCX A;  3GIB A;  1G5V A;  3NFC A;  3FB9 A;  2HBP A;  2P0P A;  3OMC A;  4BI8 B;  2NUZ A;  3V8K A;  2FEI A;  2M16 A;  2X3W D;  4BAC A;  2PK9 B;  2AK5 A;  2CZ1 B;  1IGU A;  1FMV A;  2RN8 A;  3VS2 A;  2DBM A;  5KE3 A;  4MMK A;  2AIR B;  2XDB A;  3FJ5 A;  1WXU A;  2K5F A;  2E64 A;  3PMT A;  3H4C A;  2LVM A;  4M7A D;  4C8Q D;  2CP0 A;  2KVQ G;  2E1H A;  3SD4 A;  3S6W A;  1FX7 A;  5FRO A;  1H3H A;  3JV3 A;  4M77 A;  1PSF A;  2NUT A;  4RCC A;  3CCL T;  3HB9 A;  1E6H A;  4BCN D;  3C0C A;  4DOW A;  2LQ8 A;  3Q1J A;  2YUO A;  4M4Z A;  2KK4 A;  2QQS A;  3MEU A;  4J9G A;  4QVC A;  4Y72 B;  2BKZ B;  4ANJ A;  5FRM A;  3G71 Q;  4F14 A;  2E70 A;  2CP7 A;  4XTZ A;  4M75 C;  2EWN A;  3LGF A;  5D6W A;  5CK9 A;  1O9S A;  1QP3 A;  1SSH A;  4RTW A;  4BI4 A;  1T3S A;  2D1X A;  2VXE A;  1NJI C;  2K2V A;  1P5E B;  2P0K A;  3DLL A;  1UG1 A;  4J6X A;  3EG9 A;  4M77 C;  1WIE A;  1QP2 A;  2JTE A;  1KD1 C;  3M4Y A;  4FIB A;  1W4S A;  1VQK T;  1VQ6 A;  3EFS A;  4BCJ B;  4M75 E;  1OPL A;  3QBY A;  4ELY C;  1VQ7 Q;  1GUX A;  1WX6 A;  1VIN A;  2HCK A;  3QWL A;  5GAN 6;  2GF7 A;  5GAN h;  2LJ3 A;  1V29 B;  3JB9 F;  1WPY A;  1YJN A;  1I0C A;  2JTM A;  1WHM A;  1NLP C;  1QVF S;  2DXC B;  1WQ7 A;  2NUP A;  1W70 A;  1IRE B;  3BFM A;  2DKG A;  4M7A G;  2EGA A;  5KYU B;  2VGN A;  2CSI A;  3HHT B;  2KMT A;  4HCC A;  2R7G A;  4M7D B;  4TVR A;  4MFE A;  3G1J A;  3ZFJ A;  4E7L A;  3OBY A;  4IUQ A;  2QEX Q;  4KH1 B;  3CPW A;  1DJ7 B;  3BLQ B;  1KHI A;  3QHS A;  2L2P A;  5FGK B;  4Y92 A;  4P5N A;  4EDU A;  5KCH A;  4ZGJ B;  1M1K C;  1MV0 B;  2W10 A;  2D9T A;  4BCM B;  1Q82 R;  3E2U A;  1X6B A;  3F5X B;  1WI7 A;  4C0D B;  3LH0 A;  1VQ8 A;  4ESR A;  2R5A A;  3L2Z A;  1YJW Q;  4A4E A;  4EOO B;  3EGD B;  3TQ7 P;  5DM7 R;  3QYH B;  5EC7 A;  4F16 A;  2SEM A;  3E1S A;  3CME A;  2LP5 A;  2FPE A;  3MP8 A;  2NYS A;  1E7P A;  1SRL A;  2COZ A;  4C92 G;  3BHU B;  1JJ2 A;  3NHN A;  2KT1 A;  2WMB B;  5CYI B;  1BK2 A;  1E6G A;  1H24 B;  1PHT A;  4EMK B;  3I9Q A;  5GMK i;  1QCO A;  2BE7 D;  3U23 A;  5IAY A;  2DVE A;  2I40 B;  4LXC A;  4M78 D;  4AMC A;  9ATC B;  4L6V 5;  1B34 A;  2QA4 Q;  3ZBD A;  4ZGD B;  4RTY A;  4HNV A;  2A36 A;  4E7J A;  2XK0 A;  2LDM A;  4XU0 A;  1VQO A;  5HK0 A;  5D7U A;  4CFU D;  2HZY A;  3CCR T;  2F2V A;  1WGS A;  1MMD A;  3HRU A;  3IQL A;  4JJC A;  1E9H B;  1NEB A;  2FYK A;  2QQ9 A;  3H0I A;  3A8M B;  2RHX A;  3RER A;  2KRN A;  4E7Z A;  2DL5 A;  2EVR A;  2DD5 B;  3M0P A;  2AKL A;  4KT0 E;  4RTV A;  2L3P A;  3DKM A;  4RTU A;  1AZE A;  2BZ8 A;  3RUX A;  3CC2 Q;  2ZZD B;  1I1J A;  1XNI A;  2RQW A;  3PNW C;  1GBR A;  2JOY A;  3BHV B;  2VVK A;  4F7U E;  1UGQ B;  1TD6 A;  4M7A F;  1K73 R;  4C8Q F;  3O0G D;  3JB9 J;  3PIP A;  2OTJ A;  3GLX A;  2DXB A;  2EUF A;  4C0G A;  4JLG A;  2CP3 A;  1W2B P;  1BIB A;  3RBB B;  3FC3 A;  2ATC B;  4C8Q A;  3RGF B;  2DF6 A;  2V1Q A;  4Z89 A;  1M1K R;  4KBM B;  5GJW B;  2D0N A;  4AT1 B;  3HRT A;  3EH2 A;  3OYC A;  2COW A;  4F17 A;  3JCM e;  2DPP B;  5GAN 5;  3JCM d;  3DB3 A;  2E41 A;  1UJ0 A;  3JSC A;  4J83 A;  1F1B B;  3MKD A;  1VOM A;  3DTO A;  4XU1 A;  1Q86 C;  4EOK B;  2W9F A;  3CCV A;  2JW4 A;  3P8H A;  4XTV A;  1NG2 A;  4KUL A;  1VQP Q;  4M78 G;  4HVW A;  3O8V A;  1WHJ A;  1MMG A;  2Y4Y A;  5DY9 A;  1SG5 A;  2YT6 A;  2CT4 A;  2K4Y A;  4C8Q C;  1YP5 A;  2NLU A;  2JTF A;  4O6J A;  5M9O A;  1H8K A;  1UGS B;  3CXC A;  1AOJ A;  5GJV B;  4NL3 A;  4JRQ A;  1EIF A;  1R0B G;  2K79 A;  3REB B;  4CI0 C;  4M7D G;  1BB9 A;  1ZA1 B;  1D09 B;  1YIT A;  2CGH A;  5KYN A;  2C06 A;  4BY1 X;  3QUI A;  1YIJ Q;  1R0C B;  5LJ5 d;  3FIF A;  3POM A;  1H4L D;  1TSF A;  5CR2 A;  3S3O A;  2L8D A;  3UA6 A;  3KFV A;  1K0X A;  3DDP B;  1OIU B;  1X01 A;  4N4G A;  6AT1 B;  2RH2 A;  3BG5 A;  3DOG B;  5J26 A;  2XDD A;  1RAA B;  2WAC A;  1B07 A;  4G6L B;  4XU3 A;  3G71 T;  1U1S A;  2YHT A;  3CC4 Q;  3G4S A;  1VQ4 Q;  3M53 A;  1G3T A;  3M0T A;  1PRM C;  2DXT A;  1VQ9 A;  2J06 A;  4HT9 A;  2YRV A;  5KH6 A;  2QTX A;  2DNU A;  1UDL A;  2CJM B;  2VB6 A;  4HVU A;  5I5Z B;  3MHX A;  5IDP B;  2DTH A;  2EJ9 A;  1YI2 A;  5L8R E;  5CQY A;  3BG9 A;  2FRW A;  2K3B A;  3WVD B;  1VQ7 T;  1N8R R;  4BCK B;  5ICP B;  1K1Z A;  4HCZ A;  1PD0 A;  5CKH A;  1PKT A;  3MY5 B;  1HYO A;  1LCK A;  2W0Z A;  3UA7 A;  5FWC A;  1JQQ A;  1X2K A;  1YCY A;  4M75 B;  3EGX B;  5DQV A;  2EQJ A;  4C0F A;  2J05 A;  1PRL C;  1FVV B;  2C0I A;  1Q82 U;  3MP6 A;  1X69 A;  5ACB A;  1NZ9 A;  1KFZ A;  2IW9 B;  1AZG B;  4M77 B;  2NUT B;  4BCG B;  3UAT A;  4EOJ B;  1P92 A;  4JJN K;  3OS0 A;  4KUD K;  1ABO A;  2QEX T;  4HXJ A;  4DBQ A;  1HD3 A;  1OL1 B;  2W9Z A;  5DLQ E;  3BW1 A;  1UEB A;  5KYW B;  2K3X A;  2CKK A;  2GGR A;  3UT1 A;  2A08 A;  1D1C A;  1K9M R;  3RKW A;  1KXU A;  1YJW T;  3I56 A;  4ZTJ A;  1KD1 U;  3EG1 A;  1U5S A;  1YNZ A;  4CFW B;  2V8I A;  1YHQ A;  2F5T X;  3X28 B;  2WIP B;  3C12 A;  3OYG A;  1Z9Q A;  1AWW A;  4QQG A;  2KSS A;  3HL8 A;  4F7N B;  3A8O B;  3N5B B;  2C6T B;  1VQ5 Q;  1VQK A;  1WHK A;  2V26 A;  5HBJ B;  1UJY A;  1Y07 A;  5LJ5 j;  1PG5 B;  3QXE B;  1BCO A;  2C4G B;  2DRK A;  1ZUU A;  4J9H A;  2QA4 T;  1RAC B;  4XQ3 A;  4OB1 B;  1JO8 A;  2FRY A;  5IT9 E;  2J7I A;  2K5I A;  3M59 A;  4CRL B;  2KRM A;  5LJ3 d;  3CPW P;  3JCM h;  3PVQ A;  3CCE T;  3K7A M;  2J6K A;  2PVO B;  2XHC A;  1OI1 A;  1LPL A;  4OML A;  2NUP B;  1S72 Q;  2BS3 A;  4PNO A;  1K73 U;  1QWE A;  2EPD A;  3CCM Q;  2CUD A;  3V7S A;  3HTR A;  1JB0 E;  1M1K U;  3CC7 Q;  4BCO B;  2MK5 A;  1KQ1 A;  3MY1 B;  1WQW A;  5GMK l;  1JJ2 P;  4HL4 A;  4BCF B;  3P8B B;  3J81 E;  3JCM W;  1UNH D;  4E2F B;  1E7O A;  1M27 C;  2I0N A;  4RTZ A;  2AZV A;  2RJC A;  5CCA A;  2I2L A;  3KXT A;  3QHW B;  4PJO A;  1GCP A;  1VQL T;  2JUF A;  2DD4 A;  4R0K A;  1XO2 A;  5GAN d;  3CMA Q;  1VQN T;  4IKF A;  1OU9 A;  3M5A A;  3AHU A;  1OI9 B;  1KG1 A;  5BNJ B;  3BDL A;  1H64 1;  2KY9 A;  3VS0 A;  1M3C A;  3G6E Q;  4LNP A;  5D6X A;  1QKX A;  4MDW A;  4ROD A;  1QVF A;  1K9A A;  3TSW A;  3LH5 A;  2X3X D;  3FDR A;  1CKA A;  4MDX A;  3CCJ Q;  2XMF A;  1B34 B;  1JEG A;  1VQP T;  4M75 G;  1WXT A;  4F6W B;  3OYA A;  1C9B A;  3EFO A;  2CS7 A;  4J7I A;  3M03 A;  1FYN A;  4PJO C;  4A53 A;  2OJ2 A;  2ZPH B;  3CCR A;  3MI9 B;  4HT8 A;  4J9B A;  1UB4 A;  2QXF A;  3KHI A;  2RPN A;  1FMW A;  2MAM A;  2JJ9 A;  4JX6 A;  3H8Z A;  2FG0 A;  4LDV A;  4LUD A;  3EID B;  3RMQ A;  1YIJ T;  4F6U B;  5L23 A;  3OYF A;  1KQ2 A;  3HZJ A;  3VRY A;  2WMA B;  3NTK A;  1U1T A;  2ZPF B;  2P4T A;  3EGU A;  4J5Y A;  1IRX A;  3LWI A;  2EKO A;  2FZC B;  3L42 A;  5GAO r;  4KUI A;  3PMI A;  3EG0 A;  2CZ0 B;  2F5K A;  3M0U A;  1UFF A;  3QYG B;  2DXB B;  3SHW A;  4C5H A;  1UNG D;  4PLI A;  2CZ7 B;  3OYK A;  2E4H A;  3OY9 A;  5LJ3 j;  3OYL A;  2CCI B;  3JB9 H;  1X43 A;  1N8R U;  1BIA A;  2IN3 A;  1BKB A;  3CEY A;  4OP0 A;  3VKH A;  2EKH A;  1KC8 C;  3M4G A;  1MMN A;  4BE2 A;  4Z8A A;  2IVW A;  3L1A A;  2KQW A;  1WHG A;  2O88 A;  3ZL7 C;  1N6A A;  2AKK A;  4QW2 A;  4LDX A;  4B9X A;  2K9G A;  1NPP A;  3CXC P;  1X27 A;  2DIQ A;  2DME A;  1BI0 A;  4IUP A;  1OU8 A;  2IIM A;  4IIO A;  2QFZ A;  2HSP A;  1ZLM A;  3C94 A;  1J3T A;  5GAN 4;  3JCM J;  1VQM Q;  2DRM A;  4QVZ A;  2BS4 A;  3J7A F;  2DEU A;  4IUV A;  1M3B A;  1IGQ A;  2DFU A;  4AG1 C;  3G7Z A;  2DO3 A;  1QQJ A;  1UHF A;  1YCS B;  4KGV B;  5GAN j;  2WIH B;  1OGU B;  4CFV B;  1K9M U;  2LX7 A;  1UUE A;  4RMO A;  4C5G A;  2MWO A;  1Q82 C;  2DL4 A;  2KGT A;  2HEQ A;  5HNB B;  4BCH B;  2DM1 A;  1QCF A;  5LJ3 h;  3CCU T;  1G3W A;  2SRC A;  1D0X A;  3TNW B;  3ZEH A;  2GBQ A;  3DLM A;  2V22 B;  1GRI A;  3OA6 A;  4F7U G;  3UPU A;  1JU5 C;  2CT3 A;  1QVG S;  2E10 A;  1Y57 A;  2L3R A;  3JCM g;  3OYD A;  4C92 D;  1PWT A;  4OGR B;  1FMK A;  4CFX B;  2XKO C;  4B6M A;  5HKC A;  1RAD B;  4FYV B;  3JAM E;  4MZM A;  5FU7 C;  2IVX A;  5KE2 A;  2BE9 B;  1WZO A;  3I5R A;  2NWM A;  4JPB W;  4PKC C;  3VKI A;  4EOI B;  1KC8 R;  5GAM e;  2KXD A;  1JXM A;  4OR5 B;  5GAM d;  1VQ7 A;  2V8K A;  2VYT A;  2C5X B;  4BCI B;  3QHR B;  2GFA A;  5A0L A;  1VQ6 Q;  4M77 E;  4JZ3 A;  1OKV B;  3OMG A;  5D6Y A;  2E5K A;  1S72 T;  4R56 A;  1SKU B;  2RI3 A;  4CC4 B;  5LJ5 g;  3QYB A;  2BKD N;  2EIF A;  2J6O A;  4ZNX A;  4YC3 B;  3GOX A;  1K73 C;  1FWZ A;  1W1F A;  2GCX A;  1YJN Q;  3CC7 T;  4Z88 A;  1D1B A;  1B7T A;  2QEX A;  4HNT A;  1U3O A;  2YUN A;  5CO7 A;  3QZ9 B;  1D3B A;  2W96 A;  1R8O B;  2A3L A;  5KYX A;  4CC2 A;  4N4H A;  2GQI A;  3CQT A;  2QAS A;  4F7S B;  5GAO p;  4XTX A;  2FHD A;  2V1R A;  1TTH B;  5J39 A;  3M9Q A;  1YJW A;  2C0O A;  3INZ A;  3CMA T;  5DQW A;  3OYM A;  2LCC A;  3X24 B;  4IIM A;  4I3Z B;  1O9K A;  2OTL A;  4BI3 A;  1HSQ A;  1VQ8 Q;  4ME7 A;  2OX7 A;  1TU0 B;  1WA7 A;  4JZ4 A;  1NBE B;  4FYY B;  1OX9 A;  4J6W A;  8AT1 B;  5LMK B;  5C6S A;  1JSU B;  2EJG A;  3EG2 A;  2UUE B;  1QW1 A;  5IHI A;  3OYN A;  1EZZ B;  3CCJ T;  1ZUK A;  2LZ6 B;  1OOT A;  2R5M A;  4J6Y A;  3BHT B;  4ZN1 A;  3DDQ B;  3TU4 K;  1WXB A;  2WJ9 A;  3OSV A;  4LD9 K;  4J9F A;  2CP2 A;  5GAN 8;  3CD6 Q;  4JS4 A;  3TW7 A;  2EJF A;  2ROT A;  5A0D A;  3EHQ A;  5LL6 S;  3CCE A;  2PNI A;  3MEV A;  3QJY A;  4AI6 A;  1H27 B;  4M7D D;  2HQH A;  1MMA A;  1M1G A;  8ATC B;  2GQV A;  5HCK A;  1F5Q B;  4QQD A;  1GCQ A;  2JMC A;  1YBY A;  1M3A A;  1TUG B;  1WLP B;  2LMJ A;  4UN0 A;  3LGL A;  4BCM D;  1V76 A;  2LNV A;  3JCM P;  2WSF E;  3VYH B;  2VUB A;  1B3Q A;  4MZP A;  3SFM A;  3REA B;  3A5Z B;  4M7A A;  3OYB A;  3QDF A;  4PJO B;  2KI7 A;  2M0O A;  2KR6 A;  1QVF P;  4WTO B;  1KIK A;  2DD4 B;  3CCQ A;  1VQL A;  5IHK A;  3ULR B;  1TOV A;  3TNH B;  3NPF A;  3L2R A;  2RHY A;  4FSS A;  4GLM A;  1VQN A;  2XU8 A;  3A1P A;  3LYI A;  4ROE A;  1GCQ C;  4EOP B;  1TXQ A;  1M2O A;  2OTJ Q;  2DE0 X;  2F2C A;  1N8R C;  1WHH A;  2EAY A;  1N27 A;  1U06 A;  4EOL B;  5GMK e;  2EGE A;  2L3Q A;  3OS5 A;  3TCJ A;  2XG8 D;  4PLL A;  3ER0 A;  1BU1 A;  1A0N B;  2RJE A;  2DVJ A;  4C92 F;  3OBW A;  2ZPG B;  2A28 A;  2QQ8 A;  1G3Y A;  2H3E B;  3RIR A;  5EFQ B;  4OMQ A;  5LJ3 g;  1VQP A;  2BTT A;  3EFO B;  4C92 A;  4M7A C;  2RHZ A;  3I55 A;  1VQM T;  2XIC A;  2MWP A;  1D1A A;  1XQH A;  5CKB A;  2PUK B;  4PFZ A;  4J9E A;  2ZPI B;  3VKG A;  1RAB B;  3QKJ A;  2RJF A;  2PJQ A;  1BI3 A;  4L5G A;  1YJ9 A;  4DBH A;  4YOZ A;  4IUR A;  2WXV B;  5GAM h;  1SPK A;  5I21 A;  2M0Y A;  1SEM A;  2CRE A;  4GLK A;  2EQI A;  4C8Q E;  1K9M C;  1BBZ A;  3MEA A;  1Y0M A;  3L2W A;  4OMP A;  5CIU A;  2WHB B;  1WJQ A;  2AT1 B;  2JM9 A;  1R77 A;  4BDZ A;  4EOR B;  1TFB A;  2QG9 B;  4EIK A;  2L0A A;  5GAN 3;  5GAN g;  4EMH A;  3OYI A;  2QAZ A;  2JVV A;  2DIL A;  1KC8 U;  5I22 A;  3VYG A;  2RQT A;  4HVV A;  1G3N C;  2MMP A;  2X4Y A;  4VUB A;  1C6V X;  1RAF B;  1QVP A;  2BS2 A;  1UHC A;  2CUB A;  1RI0 A;  2KYB A;  4Y28 E;  4XAX B;  4TTH A;  4DEX A;  2QYZ A;  2EBP A;  1UGR B;  1W6X A;  4WCI A;  5HK3 A;  3VS3 A;  2VKN A;  4LDU A;  4ZN3 A;  3NTI A;  1M5Q 1;  3A8H B;  3SDZ A;  3QPH A;  2OAU A;  2RD1 A;  3QYE A;  1VQ6 T;  3M0S A;  1XJW B;  5HBE B;  2I53 A;  5IF1 B;  1TWB A;  5I11 A;  5CVI A;  1VA7 A;  2P4R A;  1WHL A;  5GAO q;  4M78 F;  1GFD A;  1VYW B;  4FW2 A;  2CYZ B;  4YOS A;  4BUG A;  5FU7 B;  3HPW A;  2RB6 A;  3T9N A;  4M78 A;  1C0M A;  3CCL A;  1MV3 A;  4KRC B;  2WSC E;  2ESW A;  2QGG A;  1YJN T;  1WJS A;  3OSS C;  3VS7 A;  3PFS A;  5GAO m;  3H0H A;  4EC9 B;  5FW9 A;  2RQV A;  2YSQ A;  3CCU A;  4M7D F;  2RI5 A;  2PMI B;  3URG A;  4FX3 B;  2JXB A;  4DQ2 A;  2RMO A;  1GBQ A;  3V7C A;  3TNI B;  4BCQ B;  4M7D A;  1D0Y A;  4KGX B;  3CBM A;  1TH7 A;  2CP6 A;  3GP8 A;  2DK3 A;  2LT4 A;  5ECA A;  2AHJ B;  3ME9 A;  1YWO A;  1AEY A;  3EG9 B;  3BLR B;  1ZA2 B;  4JJB A;  2GTO A;  1PSE A;  1X6G A;  4M78 C;  5CQX A;  3M58 A;  1LOJ A;  1VQ8 T;  3H6Z A;  5FLX E;  3KUF A;  1M1F A;  3CPF A;  4PJN A;  3VS1 A;  1U8R A;  4PJJ A;  3GTM S;  3I56 Q;  4X34 A;  1H3Z A;  2RF0 A;  4MIM A;  2VV5 A;  4NST B;  1SSF A;  2K7A A;  1GUX B;  2FVU A;  2HMA A;  4A63 B;  1OZ3 A;  2MF2 A;  1YHQ Q;  4M75 D;  3JCM b;  2DXU A;  4MZT A;  2BUD A;  1K4U S;  1H1P B;  1VQK Q;  2EGC A;  3CD6 T;  1QKW A;  4JS5 A;  4F6S B;  4PK4 A;  3VV0 A;  4Z02 A;  4EMK A;  2HNI A;  3LX7 A;  4HLQ A;  4M77 D;  1S72 A;  5GMK h;  3LW5 E;  3SEM A;  2ZCF B;  4HNU A;  2EW3 A;  4PJL A;  1AWO A;  3VS4 A;  2DBK A;  3VJP A;  4HKE A;  1Q95 G;  2COY A;  1QVG A;  4JRI A;  2YLC A;  4EMG A;  1YFN A;  2X51 A;  1H26 B;  1NM7 A;  2QK0 A;  5IHY A;  1NE8 A;  1XTD A;  5IHN A;  1BYM A;  2HKQ B;  3TRE A;  3CC2 T;  2J6F A;  1UE9 A;  1T0J A;  4C5E A;  1Q7Y C;  2O01 E;  2DD5 A;  3I5S A;  3WXM B;  2ABL A;  4Q5W A;  1IHV A;  2EFI A;  1AVZ C;  4FM4 B;  3PE0 A;  1D0Z A;  2ZZD A;  4MFD A;  2X9H A;  3CCS Q;  2PU9 B;  5CKD A;  1O9K B;  1I4K 1;  4OB3 B;  1JKW A;  4OGC A;  2D0Q B;  4E6R A;  5A2Q E;  4PL6 A;  3BLH B;  4QT7 A;  1RUW A;  5GAM g;  1I8F A;  2LRQ A;  4O5V A;  1IO6 A;  2KT8 A;  1RI9 A;  1OPK A;  2X4X A;  3CCJ A;  5HY6 A;  1TUC A;  2X4J A;  3RNJ A;  1X2Q A;  3VUZ A;  1AD5 A;  2K57 A;  4JRP A;  2ROL A;  1ACM B;  2FPF A;  4JX5 A;  2DX1 A;  2DZ9 A;  2C5V B;  2DL8 A;  5HQ0 B;  3HKS A;  4M77 G;  3TEE A;  1RAG B;  4II5 B;  5KYY A;  4XTW A;  2DIG A;  2JZ2 A;  1N4M A;  4EPC A;  3MO8 A;  4DBF A;  4AFS C;  3JRZ A;  2KYM A;  1WYX A;  4PJO E;  3V8L A;  1VYV A;  1AWJ A;  1IZ6 A;  2EYX A;  4JX4 A;  3DJB A;  2QQB A;  2XI9 A;  2WEV B;  4JJD A;  3EFR A;  2GNC A;  2DJZ A;  4FCY A;  4RCB A;  4A4G A;  4M7A B;  1V1C A;  4C8Q B;  3CC4 T;  2R58 A;  1VQ4 T;  1IXD A;  1Q7Y R;  4RTT A;  5I2S A;  4J9C A;  3GNF B;  1RAI B;  2RK2 A;  1CSK A;  1M8M A;  4JDS A;  3MIA B;  2JN0 A;  2HKN A;  4BCN B;  2UZE B;  1Q81 R;  3HBL A;  2B9R A;  3M57 A;  2JGZ B;  4LN2 A;  1W98 B;  1H28 B;  1C1A A;  5IXF A;  3QZ5 B;  2LQK A;  1NYG A;  4F04 B;  1IHW A;  3JCM f;  3R6N A;  2X35 A;  1WFW A;  3JB9 G;  4A54 A;  4DOV A;  2G9X B;  4II1 A;  1AWX A;  1M90 R;  3A8G B;  4KH0 B;  1H25 B;  2FZG B;  4ATO A;  2HL5 C;  5FRN A;  1G3S A;  4M75 F;  3LLR A;  1VYT A;  1UEC A;  2KEA A;  1KK7 A;  1ZSG A;  1AD6 A;  3OW2 S;  4J8O A;  1PC0 A;  4HCK A;  4ROC A;  4M75 A;  2HAX A;  2KE9 A;  3EGX A;  4IMY B;  4LD6 A;  2EYZ A;  3RKX A;  4ORZ A;  4BY6 C;  1LJO A;  2FO0 A;  2BZY A;  4M77 F;  3PT9 A;  4WF2 A;  1ZHI A;  2LJ1 A;  2VC8 A;  3G71 A;  1KQS S;  1RLP C;  4BXX X;  3UF4 A;  1PD1 A;  1VYU A;  1UTI A;  2YUP A;  5IDN B;  3HRS A;  2HBW A;  4GBQ A;  3RDV A;  4AKH A;  5LJ5 f;  3VYG B;  2ENM A;  2YWW A;  1TG0 A;  2RJD A;  5CAI A;  4BY7 X;  2KAF A;  4LE9 A;  2YDL A;  5GAO l;  2G77 A;  4XK8 E;  2X4W A;  1K8A R;  1ZBJ A;  2ZPE B;  4NC6 A;  1OIY B;  5KYW A;  2QGF B;  4PFP A;  3PTA A;  1HXD A;  1VQ5 T;  1FIN B;  3L2V A;  2VAS A;  3RES A;  3C95 A;  3E19 A;  3I56 T;  7AT1 B;  3THK A;  4KRT A;  2KBT A;  1PKD B;  1D3U B;  3VRZ A;  3MEW A;  1YHQ T;  4OF1 A;  1MHN A;  4A4K A;  2W2H A;  3GNG A;  2MYS A;  2KNB B;  3FRN A;  2UZL B;  3BY7 A;  4FT4 A;  4AKG A;  1ENW A;  4E7I A;  2BPM B;  4EC8 B;  4X9D A;  3CBO A;  2DET A;  3E9G A;  3NDQ A;  1YN8 A;  5GAN 7;  1UGV A;  2E3I A;  2ED1 A;  4EON B;  5GAO n;  2VGM A;  3CCM T;  1ZX6 A;  4M78 B;  1M4Z A;  3FJP A;  1W2B S;  2IW6 B;  3H0F A;  1SHG A;  4PFO A;  5LQF B;  3PGG A;  4CFU B;  3S3M A;  2C5O B;  4D8K A;  4AG2 C;  4C8Q G;  1NYF A;  1M9S A;  1SHF A;  3A98 A;  4AFQ C;  3BDU A;  1G83 A;  4E7S A;  1OX8 A;  5CEI B;  2DL3 A;  5FU6 C;  1OYX A;  1SRM A;  3NGP A;  4K11 A;  3CCS T;  1M2V A;  3M56 A;  5AYF A;  3OW2 P;  1ZP2 A;  4CRI A;  4F7U F;  2VWF A;  3QII A;  1ZSZ A;  3G6E T;  5EG2 A;  4NS5 A;  2RNA A;  2L3S A;  2RA2 A;  2WSE E;  2JMA A;  3CME Q;  4GY5 A;  2DA9 A;  4F7U A;  1G2B A;  2XD0 A;  2Y90 A;  1H1R B;  1OV3 A;  1Z9Z A;  3M55 A;  2YRC A;  5IXB A;  5GAN 2;  3R6O A;  2WPA B;  1ZUY A;  1KQS P;  4LDW A;  1OKW B;  2QA4 A;  2OTL Q;  2E5Q A;  2YUQ A;  3L2U A;  2CDT A;  1QVG P;  2MI6 A;  4OB2 B;  4J7F A;  1NJI R;  1H1Q B;  2PK2 A;  3X26 B;  3CD6 A;  4E7H A;  4BDY A;  3H9N A;  2O4X A;  4EOQ B;  4FL6 A;  1T0H A;  3QJ6 A;  2L89 A;  4Y91 A;  3FEO A;  1KD1 R;  4CXA B;  2QDL A;  2RQU A;  1Y71 A;  4B9W A;  2WFY B;  1VQO Q;  2B8A A;  4HA8 A;  3C4S A;  4BCP B;  4M6V A;  2CCH B;  4BBR M;  2A7Y A;  1ZSZ C;  2QF7 A;  1Q7Y U;  2LC4 A;  3CCE Q;  1UGP B;  5GMK m;  2XID A;  1Y96 A;  5EJC A;  2E3H A;  5LJ3 f;  3V8J A;  3GPL A;  1MND A;  4PJM A;  4A4H A;  3CC2 A;  2DZC A;  4N0A A;  3HSB A;  4F7J B;  4OVA A;  2ZPB B;  2EQK A;  2LCL A;  1Q81 U;  5GAM j;  2HDA A;  4D6W A;  4C5I A;  2LTO A;  1CKB A;  2QDY B;  2DAQ A;  2DJQ A;  1OQK A;  3RKY A;  3MCA B;  1GXI E;  3F70 A;  1WJR A;  4FU6 A;  2HQX A;  2IW8 B;  3VS5 A;  2IPO B;  3JCM X;  2GTJ A;  1PNJ A;  4XTU A;  1NPR A;  1OEB A;  3HFN A;  3EJ1 B;  3JB9 I;  4IUU A;  4QSH A;  2JS0 A;  2LQW A;  1M8V A;  1M90 U;  1VQL Q;  3CCQ Q;  2F1L A;  2FB7 A;  4N0A C;  3A8L B;  1VQN Q;  2JM8 A;  4N4I A;  2E12 A;  2YXY A;  2DLP A;  3BE3 A;  5GAN f;  3SWN A;  3VS6 A;  4BE1 A;  4LDY A;  1K76 A;  3QO3 A;  2L5Q A;  5KCO A;  2KRO A;  3CCV Q;  2YRD A;  3RR6 A;  2DYB A;  1X6O A;  2CP5 A;  2M51 A;  4Z6Y A;  2LT1 A;  2P0Q A;  4R55 A;  3RMS A;  2QGS A;  2RO0 A;  4RKU E;  5KYY B;  3EG3 A;  3I55 Q;  1QMZ B;  1YIJ A;  5I2M A;  4QQ6 A;  2G6F X;  4M7A E;  4JLI A;  3VUB A;  1G8X A;  3EOC B;  3D7S B;  2EYQ A;  2PVD B;  3SWN C;  3HFO A;  1K0S A;  2O9S A;  1YIT Q;  1K8A U;  5J3B A;  4C92 C;  4PJO D;  1YJ9 Q;  2DYI A;  4LUE A;  1KHC A;  1OL2 B;  2EQM A;  5LJ5 e;  3DL1 A;  2LJ0 A;  2K3Y A;  4JUV A;  3EAE A;  3CC4 A;  4YTL A;  1VQ4 A;  2CZ6 B;  1QLB A;  1BI2 A;  1LNX A;  2W99 A;  3WVE B;  4UC4 A;  4XU2 A;  1S1N A;  4A4F A;  2QQR A;  3O5Z A;  2JS2 A;  2DL7 A;  3EHR A;  1H92 A;  3PIO A;  1WDX A;  4FYW B;  1M30 A;  3TVT A;  4AFZ C;  3G4S Q;  2BIV A;  4C92 E;  5A0G A;  3NTH A;  1RL2 A;  1N9R A;  1NLO C;  2RQR A;  1KJW A;  3CPW S;  2UZD B;  1ZBX A;  3DB4 A;  1FKM A;  1VQ9 Q;  4BY6 B;  1JRI A;  1JBM A;  1RLQ C;  3PO3 S;  4ZTF A;  3JCM V;  1QMC A;  1GL5 A;  2R57 A;  4ELL A;  1YI2 Q;  3GF5 A;  3AT1 B;  2GFU A;  1VIE A;  2JT4 A;  3QWX X;  2DTO A;  1JJ2 S;  1Q86 R;  3L2Q A;  2LX9 A;  2EYY A;  2AZS A;  1ARK A;  5CKE A;  1OUL A;  4AFU C;  4CFM B;  2Y4X A;  4E7K A;  1IB8 A;  1GY3 B;  4OGE A;  2MPX C;  2DTI A;  3OS2 A;  1I5L A;  2LQN A;  2IG0 A;  2DXC A;  2FL7 A;  5GMK j;  2BZX A;  1OZ2 A;  2CH4 W;  3OYY A;  4QKU A;  4NOY A;  2M02 A;  3MET A;  2FPD A;  4PJO G;  1NEG A;  5KYU A;  2LW4 A;  1HK9 A;  4ZGE B;  3OS1 A;  3CCL Q;  4BBS M;  3NMZ C;  5HVY B;  1N9S A; 
#chains in the Genus database with same CATH homology
 3OYC A;  3JCM e;  4EPC A;  2DPP B;  3MO8 A;  5GAN 5;  3JCM d;  3DB3 A;  2E41 A;  2GFA A;  3JSC A;  4J83 A;  5A0L A;  3JRZ A;  2V8J A;  4PJO E;  4X9C A;  4M77 E;  3V8L A;  3OYH A;  2YLB A;  4XU1 A;  1Q86 C;  1IZ6 A;  4RG8 A;  4JX4 A;  3TW6 A;  2QQB A;  3OMG A;  5D6Y A;  3J80 E;  1NJI U;  2XI9 A;  3CCV A;  3EFR A;  1S72 T;  1VQ5 A;  4R56 A;  2RI3 A;  2RK1 A;  3P8H A;  5LJ5 g;  3QYB A;  2DJZ A;  4XTV A;  2BKD N;  4RCB A;  4A4G A;  4M7A B;  4KUL A;  2EIF A;  4C8Q B;  3CME T;  4AKI A;  3CC4 T;  2R58 A;  4M78 G;  3O8V A;  4ELJ A;  1VQ4 T;  5I2S A;  2Y4Y A;  3GOX A;  1K73 C;  3S3N A;  3GNF B;  5DY9 A;  1FWZ A;  2GCX A;  2E6N A;  2K4Y A;  1BI1 A;  2RK2 A;  4C8Q C;  3CC7 T;  4JDS A;  2OTL T;  2JN0 A;  2PQW A;  2QEX A;  4M7D C;  5DLO A;  4HNT A;  2NLU A;  5CO7 A;  3QZ9 B;  3OW2 A;  1D3B A;  2JTF A;  4O6J A;  1R8O B;  3E9F A;  2A3L A;  5M9O A;  3HBL A;  2PUO B;  4M78 E;  4N4H A;  1UGS B;  3CXC A;  4NL3 A;  4JRQ A;  1EIF A;  4CI0 C;  4M7D G;  1I81 A;  1YIT A;  5FU6 B;  2CGH A;  3M57 A;  2FHD A;  4XTX A;  5GAO p;  2C06 A;  4MML A;  4LDX A;  5J39 A;  3QUI A;  3M9Q A;  4OB0 B;  1YJW A;  5LJ5 d;  3FIF A;  4BB7 A;  5GAM f;  5CR2 A;  3S3O A;  1KQS A;  4C0D C;  3QG1 A;  2HD0 A;  2XDP A;  2L8D A;  3INZ A;  3QZ5 B;  4FSX A;  2LQK A;  1VQO T;  3CMA T;  3OYM A;  2LCC A;  5LJ3 e;  3X24 B;  3CCM A;  1X01 A;  4N4G A;  2RH2 A;  3BG5 A;  5J26 A;  3JCM f;  2XDD A;  3CC7 A;  4M7D E;  2X35 A;  2WAC A;  3JB9 G;  2OTL A;  4BI3 A;  1D3B B;  4A54 A;  4DOV A;  1VUB A;  4XU3 A;  4II1 A;  4ME7 A;  3X25 B;  4OMF B;  3G71 T;  4C0Z A;  3A8G B;  4J6W A;  2PVG B;  1U1S A;  1Y7X A;  4ATO A;  1WNL A;  5C6S A;  2HQE A;  2EJG A;  2YHT A;  3MP1 A;  3G4S A;  5FRN A;  1QW1 A;  1G3S A;  4M75 F;  3LLR A;  3M53 A;  3OYN A;  1G3T A;  3HP9 A;  2V8K A;  3CCJ T;  2VXF A;  3UWN A;  2R5M A;  2F69 A;  4J6Y A;  4EMK C;  1Q81 C;  3OW2 S;  4J8O A;  4ZN1 A;  4QVD A;  2DXT A;  3TU4 K;  1VQ9 A;  2WJ9 A;  4M75 A;  2HAX A;  4HT9 A;  2RM4 A;  2KMG A;  2YRV A;  3OSV A;  4LD6 A;  3CMA A;  5GAN 8;  4LD9 K;  3RKX A;  5KH6 A;  2QTX A;  3CXC S;  3TW7 A;  2EJF A;  4JS4 A;  4BY6 C;  5C0M A;  3CCS A;  3P8D A;  5A0D A;  3MHX A;  1LJO A;  5LL6 S;  1ZQ1 A;  4PJO F;  2DTH A;  2EQU A;  3QJY A;  3MEV A;  4M77 F;  3CCE A;  4L59 A;  3PT9 A;  4WF2 A;  3JCM c;  2OTJ T;  2EJ9 A;  2G3R A;  5L8R E;  1YI2 A;  5CQY A;  1ZHI A;  2ZGW A;  2QI2 A;  3UDC A;  4AI6 A;  2VC8 A;  3G71 A;  3BG9 A;  1KQS S;  4M7D D;  1M1G A;  2GQV A;  3KBG A;  3CCQ T;  3WVD B;  1VQ7 T;  4QQD A;  3G6E A;  5GAN e;  4HCZ A;  4F7U B;  1YBY A;  3HRS A;  5CKH A;  4AKH A;  5LJ5 h;  5LJ5 f;  3VYG B;  3JCM Q;  1M90 C;  1VIF A;  2RJD A;  3LGL A;  5CAI A;  2KAF A;  1YCY A;  4M75 B;  5GAO l;  2LNV A;  4JRK A;  2G77 A;  4XK8 E;  2X4W A;  3ASK A;  3JB9 D;  2ZPE B;  4NC6 A;  2EQJ A;  2WSF E;  4C0F A;  3JCM P;  3VYH B;  3CCV T;  2O4X B;  1W2B A;  2VUB A;  1HXD A;  3PTA A;  1VQ5 T;  2D6F A;  3L2V A;  1Q82 U;  1O75 A;  4MZP A;  3MP6 A;  3RES A;  3C95 A;  3QDR B;  3SFM A;  3A5Z B;  2H3J A;  4FT2 A;  3E19 A;  3I56 T;  1NZ9 A;  4M7A A;  4PJO D;  3OYB A;  4PJO B;  2M0O A;  4M77 B;  2KR6 A;  4BE0 A;  2DD4 B;  3CCQ A;  1VQL A;  3V7R A;  3MEW A;  1YHQ T;  2QDJ A;  4RG2 A;  1P92 A;  2QQA A;  4XTY A;  3OS0 A;  4JJN K;  4OF1 A;  2RHY A;  1MHN A;  4A4K A;  3I55 T;  2XU8 A;  3GNG A;  3L2R A;  2QEX T;  4KUD K;  1VQN A;  3LYI A;  3HO8 A;  3FRN A;  1Y96 B;  5DLQ E;  3BW1 A;  3OQ5 A;  1UEB A;  4HCB A;  4E47 A;  3LWH A;  1N8R C;  3BY7 A;  4FT4 A;  4AKG A;  4BD3 A;  2EAY A;  2DEQ A;  1N27 A;  2K3X A;  4E7I A;  4DA4 A;  2CKK A;  1YIT T;  4X9D A;  5GMK e;  3UT1 A;  3CBO A;  3OS5 A;  5CKF A;  3TCJ A;  2XG8 D;  4PLL A;  3ER0 A;  1YJ9 T;  2RJE A;  3E9G A;  3RKW A;  1YJW T;  4C92 F;  2M1H A;  2ZPG B;  3OBW A;  2QQ8 A;  1G3Y A;  3RIR A;  5GAN 7;  3I56 A;  4ZTJ A;  1K8A C;  1KD1 U;  3M54 A;  5GAO n;  5LJ3 g;  1VQP A;  3QSU A;  2VGM A;  3CCM T;  4M78 B;  1M4Z A;  3FJP A;  1AHJ B;  2K5L A;  2V8I A;  4C92 A;  2F5T X;  1YHQ A;  4M7A C;  3X28 B;  3C12 A;  3OYG A;  1W2B S;  2RI2 A;  2RHZ A;  3I55 A;  1VQM T;  2XIC A;  2MWP A;  3X20 B;  3OYJ A;  4QQG A;  4LOC A;  1X75 C;  2KSS A;  3HL8 A;  3PGG A;  3A8O B;  1XQH A;  3CBP A;  3N5B B;  2PUK B;  2RHU A;  5CKB A;  3S3M A;  1VQK A;  3FLG A;  2ZPI B;  4V2S A;  2RHI A;  3OYE A;  3VKG A;  1Y07 A;  4C8Q G;  1M9S A;  1FXX A;  3QKJ A;  5LJ5 j;  3G4S T;  2RJF A;  3QXE B;  1BI3 A;  2E6Z A;  4L5G A;  4NL2 A;  1YJ9 A;  3BDU A;  4IUR A;  2QA4 T;  5GAM h;  5IN1 A;  2M9U A;  2E65 A;  1VQ9 T;  4ELZ C;  3BG3 A;  1Q86 U;  4XQ3 A;  4OB1 B;  1OYX A;  2KDS A;  1XOV A;  5FU6 C;  3SWN B;  5I21 A;  5IT9 E;  2JNG A;  2K5I A;  3M59 A;  4GLK A;  5LJ3 d;  4C8Q E;  4C92 B;  3CCS T;  1K9M C;  3VU3 C;  3JCM h;  3CCE T;  3M56 A;  3MEA A;  5AYF A;  3L2W A;  3OB9 A;  2PVO B;  2XHC A;  5CIU A;  1WJQ A;  4BDZ A;  1VQM A;  1OI1 A;  1YI2 T;  4CRI A;  1MGQ A;  4F7U F;  2BS3 A;  4PNO A;  3SB2 A;  1K73 U;  3QII A;  5GAN 3;  3G6E T;  5GAN g;  5EG2 A;  4IUT A;  2WSE E;  4NS5 A;  2RA2 A;  4EMH A;  3NFC A;  3GIB A;  1G5V A;  4GY5 A;  3FB9 A;  3OYI A;  4F7U A;  2HBP A;  2P0P A;  2XD0 A;  2Y90 A;  3M55 A;  2JVV A;  3OMC A;  4BI8 B;  1KC8 U;  3V7S A;  1JB0 E;  3VYG A;  1M1K U;  5GAN 2;  3R6O A;  3V8K A;  2M16 A;  2MMP A;  4LDW A;  4BAC A;  2X4Y A;  2QA4 A;  4VUB A;  2E5Q A;  1KQ1 A;  3L2U A;  2CZ1 B;  1WQW A;  5GMK l;  2MI6 A;  4OB2 B;  4HL4 A;  4J7F A;  1QVP A;  5KE3 A;  2BS2 A;  3X26 B;  4MMK A;  1RI0 A;  3CD6 A;  4E7H A;  2XDB A;  4BDY A;  2K5F A;  3P8B B;  2O4X A;  3J81 E;  3JCM W;  4Y28 E;  4XAX B;  4FL6 A;  3QJ6 A;  2E64 A;  3PMT A;  3H4C A;  2L89 A;  2LVM A;  4M7A D;  4Y91 A;  4C8Q D;  3FEO A;  2KVQ G;  2RJC A;  2E1H A;  3SD4 A;  5CCA A;  3S6W A;  1FX7 A;  2I2L A;  3KXT A;  5FRO A;  4PJO A;  4B9W A;  1Y71 A;  1VQL T;  4M77 A;  1PSF A;  1UGR B;  2JUF A;  4RCC A;  5HK3 A;  2DD4 A;  3CCL T;  3HB9 A;  4LDU A;  2B8A A;  4HA8 A;  5GAN d;  3C4S A;  1VQN T;  4M6V A;  4ZN3 A;  4BBR M;  1M5Q 1;  3NTI A;  2A7Y A;  3M5A A;  2QF7 A;  3A8H B;  2LQ8 A;  2LC4 A;  3Q1J A;  3SDZ A;  4DOW A;  3QPH A;  2OAU A;  1Q7Y U;  2RD1 A;  1UGP B;  2KK4 A;  2QQS A;  3MEU A;  3QYE A;  5GMK m;  2XID A;  3AHU A;  1Y96 A;  5EJC A;  4QVC A;  1VQ6 T;  5LJ3 f;  3V8J A;  3GPL A;  1KG1 A;  3BDL A;  1H64 1;  4A4H A;  2KY9 A;  3CC2 A;  5FRM A;  2DZC A;  4N0A A;  3HSB A;  4OVA A;  2E70 A;  4XTZ A;  2ZPB B;  2EQK A;  2EWN A;  2LCL A;  4M75 C;  5CVI A;  3LGF A;  1Q81 U;  5GAM j;  5D6X A;  4MDW A;  5D6W A;  4D6W A;  4M78 F;  1O9S A;  4C5I A;  1QP3 A;  5CK9 A;  5GAO q;  1QVF A;  2LTO A;  4MDX A;  3FDR A;  2QDY B;  2DAQ A;  4BI4 A;  2CYZ B;  3RKY A;  2VXE A;  1B34 B;  3MCA B;  1NJI C;  4BUG A;  1VQP T;  1GXI E;  5FU7 B;  4M75 G;  2K2V A;  3HPW A;  2RB6 A;  3F70 A;  3T9N A;  4M78 A;  1WJR A;  4FU6 A;  2HQX A;  3CCL A;  2WSC E;  3OYA A;  2P0K A;  3DLL A;  2CS7 A;  4J7I A;  4J6X A;  1YJN T;  4PJO C;  1WJS A;  3OSS C;  4A53 A;  4M77 C;  3PFS A;  1QP2 A;  2ZPH B;  3JCM X;  3M4Y A;  5GAO m;  3CCR A;  4FIB A;  1KD1 C;  1W4S A;  1VQK T;  1VQ6 A;  4HT8 A;  3EFS A;  1UB4 A;  2QXF A;  3CCU A;  2RI5 A;  4M7D F;  4XTU A;  1NPR A;  3KHI A;  3HFN A;  3JB9 I;  4IUU A;  4M75 E;  4QSH A;  3URG A;  2MAM A;  4DQ2 A;  1M8V A;  1M90 U;  3V7C A;  3QBY A;  4ELY C;  4JX6 A;  3H8Z A;  2FB7 A;  4M7D A;  4LDV A;  4N0A C;  3A8L B;  3RMQ A;  3QWL A;  5GAN 6;  2GF7 A;  1YIJ T;  4N4I A;  3OYF A;  3CBM A;  1KQ2 A;  2E12 A;  3HZJ A;  1TH7 A;  3NTK A;  3GP8 A;  5GAN h;  1U1T A;  5GAN f;  3SWN A;  2DK3 A;  4BE1 A;  1V29 B;  4LDY A;  3JB9 F;  2LT4 A;  2AHJ B;  2ZPF B;  2P4T A;  3ME9 A;  4J5Y A;  3QO3 A;  2L5Q A;  5KCO A;  1WPY A;  2EKO A;  3LWI A;  3L42 A;  5GAO r;  1YJN A;  2JTM A;  3PMI A;  4KUI A;  1PSE A;  4M78 C;  1QVF S;  2DXC B;  2CZ0 B;  3M58 A;  1LOJ A;  5CQX A;  1VQ8 T;  3H6Z A;  1WQ7 A;  2F5K A;  5FLX E;  1IRE B;  1X6O A;  3KUF A;  1M1F A;  3CPF A;  3QYG B;  2DXB B;  2DKG A;  3BFM A;  1U8R A;  4M7A G;  4C5H A;  4X34 A;  1H3Z A;  2VGN A;  4Z6Y A;  2LT1 A;  4MIM A;  2VV5 A;  1SSF A;  2P0Q A;  4R55 A;  4HCC A;  3HHT B;  2CZ7 B;  2FVU A;  2KMT A;  2RO0 A;  4PLI A;  3RMS A;  1OZ3 A;  2MF2 A;  4RKU E;  4TVR A;  3OYK A;  4M7D B;  3OY9 A;  4M75 D;  4MFE A;  5LJ3 j;  3JCM b;  2DXU A;  3ZFJ A;  3OYL A;  4E7L A;  3JB9 H;  1YIJ A;  1N8R U;  1BIA A;  3OBY A;  4IUQ A;  5I2M A;  3CPW A;  4MZT A;  1BKB A;  1DJ7 B;  3CEY A;  1KHI A;  2BUD A;  3QHS A;  4OP0 A;  4QQ6 A;  3VKH A;  4M7A E;  4JLI A;  4P5N A;  4EDU A;  3VUB A;  4ZGJ B;  3M4G A;  5KCH A;  4BE2 A;  4JS5 A;  1KC8 C;  1M1K C;  3CD6 T;  2IVW A;  2D9T A;  2EYQ A;  3L1A A;  2PVD B;  3VV0 A;  2KQW A;  3SWN C;  3HFO A;  4Z02 A;  4EMK A;  1K8A U;  5J3B A;  4C0D B;  1N6A A;  2HNI A;  4QW2 A;  3LH0 A;  4B9X A;  3LX7 A;  4HLQ A;  4M77 D;  4C92 C;  1VQ8 A;  1KHC A;  1S72 A;  1NPP A;  2R5A A;  3L2Z A;  4A4E A;  2DIQ A;  2EQM A;  5LJ5 e;  5GMK h;  1BI0 A;  3LW5 E;  5DM7 R;  4IUP A;  3DL1 A;  2ZCF B;  3QYH B;  4HNU A;  3E1S A;  3CME A;  2QFZ A;  2K3Y A;  3EAE A;  3MP8 A;  4JUV A;  3CC4 A;  4YTL A;  1E7P A;  3VJP A;  4C92 G;  2CZ6 B;  1QLB A;  1BI2 A;  1LNX A;  3C94 A;  4HKE A;  1QVG A;  4JRI A;  2YLC A;  5GAN 4;  1JJ2 A;  4EMG A;  3JCM J;  3WVE B;  4UC4 A;  4XU2 A;  4A4F A;  1NE8 A;  1XTD A;  2QQR A;  4QVZ A;  1BYM A;  3TRE A;  2BS4 A;  3CC2 T;  3J7A F;  4IUV A;  4C5E A;  3PIO A;  1Q7Y C;  3G7Z A;  2DO3 A;  2BIV A;  2O01 E;  4C92 E;  4EMK B;  5A0G A;  3NTH A;  1RL2 A;  2DD5 A;  5GMK i;  1N9R A;  5GAN j;  5IAY A;  2DVE A;  3WXM B;  3CPW S;  4M78 D;  4Q5W A;  4L6V 5;  1B34 A;  1K9M U;  1ZBX A;  3ZBD A;  3DB4 A;  1FKM A;  4C5G A;  4ZGD B;  4BY6 B;  4HNV A;  4RMO A;  2MWO A;  1Q82 C;  2EFI A;  4E7J A;  2XK0 A;  2LDM A;  1JRI A;  4FM4 B;  4XU0 A;  1VQO A;  1JBM A;  5HK0 A;  2ZZD A;  4MFD A;  4ZTF A;  2PU9 B;  5CKD A;  3JCM V;  3HRU A;  1WGS A;  3CCR T;  1I4K 1;  4OB3 B;  2R57 A;  2FYK A;  4OGC A;  5LJ3 h;  3CCU T;  2D0Q B;  2QQ9 A;  3A8M B;  3GF5 A;  1G3W A;  5A2Q E;  2RHX A;  4PL6 A;  2GFU A;  1VIE A;  3RER A;  3ZEH A;  3DLM A;  5GAM g;  1I8F A;  2LRQ A;  3OA6 A;  4F7U G;  4O5V A;  2DD5 B;  3UPU A;  2DTO A;  1VQ4 A;  1JJ2 S;  4KT0 E;  2E10 A;  1QVG S;  3L2Q A;  2LX9 A;  2X4X A;  2L3R A;  3JCM g;  5CKE A;  3OYD A;  3CCJ A;  4C92 D;  3DKM A;  5HY6 A;  2Y4X A;  4E7K A;  3RUX A;  2X4J A;  2XKO C;  2ZZD B;  1XNI A;  5HKC A;  3PNW C;  4OGE A;  3VUZ A;  4MZM A;  3JAM E;  2JOY A;  5FU7 C;  2DTI A;  2K57 A;  1UGQ B;  4F7U E;  3OS2 A;  4JRP A;  1I5L A;  4M7A F;  5KE2 A;  4C8Q F;  2IG0 A;  2DXC A;  2FL7 A;  3JB9 J;  5GMK j;  4JX5 A;  3PIP A;  2OTJ A;  1OZ2 A;  3OYY A;  3GLX A;  2DZ9 A;  4NOY A;  2DXB A;  4C0G A;  3MET A;  4JLG A;  4PKC C;  1BIB A;  4PJO G;  3VKI A;  3FC3 A;  3HKS A;  4M77 G;  3TEE A;  4C8Q A;  1HK9 A;  5GAM e;  4ZGE B;  3OS1 A;  5GAM d;  4BBS M;  4KBM B;  1VQ7 A;  4XTW A;  3HRT A;  1N9S A;  4IKF A;  2DIG A;  2JZ2 A;  2VYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...