3A8GB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8gB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8gB02
4RKUE 1QP3A 2ZPBB 1QP2A 2DD4A 3QYHB 2AHJB 4OB3B 2DXCB 4KT0E 4Y28E 3QYGB 4ZGEB 2ZPGB 3X20B 3QXEB 4OB0B 2CZ0B 2ZCFB 2WSEE 5L8RE 4OB1B 3QZ9B 2PUOB 3VYGB 3A8GB 2ZPFB 1GXIE 2ZPIB 2DXBA 1UGSB 2PVOB 2QDYB 2CZ6B 1UGRB 2WSFE 1IREB 3X24B 3VYHB 2CYZB 3X26B 1JB0E 2WSCE 3LW5E 2DXBB 3A8OB 2D0QB 2ZZDB 2PVGB 1PSEA 1AHJB 2O01E 4XK8E 2DD5B 1PSFA 4ZGDB 2ZPHB 3HHTB 3A8LB 2DXCA 2PVDB 3WVDB 3VYGA 1V29B 3X25B 4L6V5 2CZ1B 2DD5A 2PU9B 1UGPB 2ZPEB 2ZZDA 1UGQB 2DPPB 3WVEB 3X28B 2DD4B 3A8HB 4ZGJB 1DJ7B 4FM4B 3QZ5B 2PUKB 4OB2B 3A8MB 2CZ7B
chains in the Genus database with same CATH superfamily
1ZA1B 3TVTA 2RI2A 2LNVA 2DD4A 3QJ6A 1BIAA 2JTFA 1LOJA 2D9TA 2LW4A 2YRDA 1H24B 1PRLC 1H3ZA 7AT1B 1SEMA 3QJYA 1GCQA 5I2SA 5CEIB 3DTOA 3CXCP 2LC4A 2Y4XA 1QCNA 1NM7A 1VQ7T 1W6XA 1OOTA 3SWNB 5A0LA 3EH2A 2I2LA 4BCOB 3HO8A 3OYHA 1ZBJA 1VQ4T 1JQQA 3CMAA 1ZQ1A 3JCMW 4M7DA 1TWBA 1N6AA 3CCRT 1BBZA 2EKHA 3M57A 4X9DA 4XU1A 3FIFA 4FSSA 2M02A 4LE9A 3SWNA 1M1GA 1KJWA 4M78A 1VQ7A 4Z88A 1Q7YU 1FXXA 2V26A 2K3YA 1OU8A 1MMAA 1K8AR 2G77A 1YFNA 2XI9A 4MMLA 3OYJA 2BUDA 2J7IA 3UA7A 3CPFA 5DM7R 4J6XA 1KHIA 4RTVA 4XTVA 4AFUC 3DL1A 4C0GA 1Y96A 2A28A 2XD0A 2E4HA 4EOJB 1C1AA 4M77B 2RD1A 4OVAA 1W4SA 4EC8B 4BCIB 1B3QA 2MF2A 2EKOA 3E9GA 4G6LB 3BHTB 4NC6A 3THKA 2C6TB 3OYAA 1Y07A 4HCBA 5GAMh 3NPFA 4IIOA 4EMGA 1AT1B 4JS5A 3PMIA 3A8HB 2WFYB 2QAZA 1VQ8T 2DIQA 2BS2A 2R58A 4JX5A 1MMGA 2FRWA 4P5NA 3LH0A 1VYWB 4BUGA 2PHGA 4FIBA 1KG1A 3EIDB 4BBRM 1M4ZA 1WHJA 2XK0A 4N4IA 3SD4A 5LJ5d 4F7UF 3QDRB 5GANf 2MWOA 4M7DG 1QVPA 1SRMA 5FRMA 1YJNT 4FT2A 3JCMf 4KULA 3PIPA 2O2OA 5IXBA 3U23A 2OTJT 2SEMA 3G4SA 1XO2A 1YHQA 1PHTA 1QVGA 4KT0E 3NMZC 2R57A 3QWLA 2EGEA 2COZA 3QXEB 3OB9A 4OB0B 1N9RA 2EVRA 3C94A 1VQ8A 4JZ4A 2A37A 5GAMj 2PUOB 1P92A 1OZ3A 2BKZB 3E19A 1VIFA 2DVEA 3UDCA 2IW9B 4KRDB 2C5NB 1BKBA 1H25B 5GMKi 1K9MU 1OL2B 3CCVQ 1UGRB 1JSUB 9ATCB 1Y7XA 1PG5B 3X24B 2CSQA 2K7AA 1G8XA 2P4TA 1M8MA 1WPYA 2L89A 1MHNA 3EG3A 4J9DA 4BCHB 1N27A 1AD6A 3P8BB 3EG1A 5EC7A 2JVVA 4LD6A 4BCFB 2LMJA 2NUTA 1AHJB 5LMKB 4PJOG 1TSFA 4LDXA 3I56T 2WJ9A 4ZGDB 2RA2A 2NUPA 3BDLA 2ZPHB 1NLPC 3J81E 1VQOQ 2FYKA 4XTYA 1TOVA 5CKDA 2NLUA 5AYFA 2CUBA 3MEUA 5GAOm 1FX7A 1ZSZB 4Z6YA 2E6NA 5GMKl 2RQRA 1K73C 3I56A 2M0OA 4M78D 1KC8R 3EHRA 3RERA 2FB7A 5HQ0B 2JMCA 1Q95G 3C95A 5KYWB 4HCZA 4MIMA 2XIDA 4OF1A 5IN1A 2MYSA 2PUKB 3M53A 2EFIA 2A36A 4QT7A 5A0GA 1RUWA 3META 3H4CA 2VYTA 4J9CA 3LYIA 4PKCC 2YLBA 3H0IA 2BTTA 3JAME 4DBRA 2EQIA 4AMCA 3H0HA 1B07A 4YOOA 4ROEA 2KI7A 3BDUA 1UNHD 4E7ZA 3MP1A 1K73R 2W99A 4F6WB 1BI2A 1URCB 3PFSA 4OB1B 2EGAA 2YT6A 2FPFA 3HB9A 2HL3A 2HBPA 4E6RA 4O6JA 2HDAA 3QIIA 2C5VB 1G3TA 4EMKB 2JT4A 3HSBA 2K2VA 2K79A 1MMDA 2QDJA 1EFNA 4FW1A 5CKEA 4C92E 3FEOA 1OULA 4JPBW 4HT8A 1TXQA 4OMQA 3V7CA 5GMKm 3OYFA 1O9KB 2DETA 4HVUA 4YOSA 2EBPA 2HQHA 3FJPA 4CC2A 2FRYA 3X26B 1JO8A 3VS7A 4FL6A 3PIOA 2ESWA 2RMOA 3HFNA 3SHWA 3OMCA 3FC3A 2XG8D 2QF7A 4E7KA 1KK7A 3OYKA 2Z0WA 1AISB 1JBMA 4BB7A 2KXDA 4HLQA 5D6WA 2RJDA 1K4US 2CREA 3CCMA 3F5XB 3A8LB 1WJSA 1KQSP 4HVVA 1JJ2S 4ANJA 3ZBDA 4C92C 2CUDA 2FVUA 3G71T 4KBMB 1KD1U 1VQ7Q 1X2QA 1H4LD 3I35A 4EOKB 5HKCA 3RKYA 2C0IA 2DMEA 1Q81C 2M51A 3G7ZA 2KVQG 2EQUA 1FVVB 1MNDA 1VQKT 2PMIB 2E3HA 5CQXA 4BI3A 5IDPB 3CBPA 4BACA 4QVCA 1PKDB 2FZGB 3M59A 5IHNA 2KNBB 3RUXA 3MHXA 4BCPB 3G4SQ 2CGHA 1IHVA 1VYUA 1K76A 1YJ9T 3M03A 5EFQB 3EAEA 4EOMB 1UFFA 2YUOA 1AWXA 4C92A 1YI2A 1T0JA 4KH0B 2UZLB 2DTHA 2HSEB 4JJBA 2QQAA 3R6NA 2V8JA 1JKWA 2MCNA 3MI9B 2ZCFB 1TUCA 4J6YA 3CCEA 4NSTB 2JMAA 5J26A 2DMOA 4EOQB 1YP5A 4PLLA 2E70A 4FYXB 3OY9A 4FT4A 3QPHA 3LQ5B 2PVOB 2NUZA 1QCOA 1H28B 2HZYA 5GANh 4J9HA 4AG2C 4LUDA 1ZBXA 1JXMA 3CCQT 3CD6T 1QKXA 1UNLD 1YIJQ 2VUBA 1H1RB 1ZUKA 1R8OB 1K8AC 4OMNA 1R0BG 1B7TA 1WJRA 1VQ8Q 2GGRA 4CXAB 1WHGA 2LT1A 1T3LA 4HNUA 2F69A 1GH6B 3VKHA 2BS3A 3LGLA 2BPMB 2DD5B 1X01A 2D8JA 3KHIA 4A4GA 3L2WA 1GFCA 2P0QA 5IXFA 3OYBA 3CCLA 1WLPB 5GAN4 2E1HA 4JX6A 3MEVA 2LP5A 4M78E 2EAYA 5GAOl 1KD1R 3JCMc 4J9IA 2OTLA 2ENMA 1D1AA 3SDZA 2Y90A 1BIBA 2ZGWA 1M30A 2HKQB 3UWNA 2CH4W 1N4MA 1BK2A 2DNUA 2MOXA 3AT1B 3URGA 1WHLA 4M7AB 2MWPA 1ABQA 1NE8A 1VQLT 2DYIA 1DJ7B 5ICPB 1AWWA 1VQ5A 1BI1A 2UZBB 1VQLQ 2RM4A 2RNAA 2LX9A 1BI0A 2QQBA 3PE0A 1SKUB 2RJEA 5C0MA 1WGSA 2HQXA 1M3CA 1VQ4Q 2CT3A 3L2UA 1BU1A 2VC8A 1NLOC 1E7OA 1Y57A 3OS0A 1D3BA 2YXYA 4MDXA 1QMZB 2W0ZA 1D3UB 4RUGA 1YJWA 1GUXA 5L8RE 4HNTA 4HNVA 3CCVA 3CCJT 4QQDA 2ZPFB 3REBB 1VQ5T 5KYYB 3QHRB 4N4GA 4GLKA 1UE9A 3OSSC 4Z02A 4DBQA 2CZ6B 4F7UA 3O5ZA 2EJGA 2RHZA 2DIGA 2AT1B 2CDTA 3OSVA 3PGGA 4C5IA 4M75G 1F5QB 2C06A 4C0DC 1T0HA 5CIUA 1NEGA 3BG5A 3JB9G 4CFWB 1JRIA 3CBOA 4PL6A 1BB9A 3LW5E 2DL3A 2L5QA 4EIKA 2QEXT 2COWA 2L3RA 1YJWT 1RI0A 1VQPT 2XHCA 1RI9A 4BY1X 2W9FA 1QVGP 1UTIA 5L2WB 4J5YA 5CO7A 1NPPA 5J3BA 1VQ9Q 5GAOr 1OKVB 3VS1A 2C4GB 3OS1A 5HBHB 1YITT 2GQIA 4DEYA 3I56Q 4IURA 4N0AC 3QBYA 1H92A 1VQ9T 3QO3A 1SPKA 1VQOT 4PFZA 3L2ZA 1WZOA 2ED0A 1K8AU 3WVEB 3VS3A 2BKDN 2DAQA 2WPAB 2X35A 2DF6A 2A3LA 4A4EA 1H1SB 2XMFA 4MMKA 5CK9A 3BHUB 2QA4Q 3E1SA 1UGVA 3EFSA 3DDPB 1S72Q 3M54A 2RO0A 4F7LB 2G3RA 4M7AE 2X9HA 4M78G 3JB9J 3GP8A 3EFOA 1QW1A 4J8OA 4RKUE 4A54A 4GBQA 2H8HA 3TSWA 1QP2A 1H641 2DRKA 2HNIA 1YHQT 1W2BS 1ZSZA 1BCOA 1KQ2A 1PD0A 3CC4Q 2L0AA 3RNJA 2WXVB 1JSTB 2KR3A 1IRXA 1YBYA 4K11A 4OGCA 2B8AA 2W9ZA 1E7PA 1IGQA 2DO3A 4JJNK 3OYMA 4XTZA 3PNWC 3VS2A 4C5HA 4JZ3A 5IT9E 1QWEA 1SSFA 2VVKA 3M56A 1LJOA 4ELZC 5HCKA 3L2VA 2JN0A 2YHTA 3GOXA 1QLBA 1X6GA 4C0DB 1UGSB 2VXFA 5FU7B 2CH4A 4LD9K 3RKXA 2F5KA 1EIFA 2O9SA 4ATOA 1PC0A 5CCAA 1IREB 2COYA 3VV0A 4RG2A 2R5AA 1MV0B 4HA8A 4EOIB 5HVYB 2C0OA 1M3BA 2K5LA 1HYOA 1YJNA 5I21A 1ZSZC 4MFEA 1ZLMA 3LX7A 2XICA 1JU5C 2GFUA 3M0RA 2O9VA 3CXCS 3EGXB 3OS5A 2CP3A 5GAOn 4CRIA 4D8DA 3CCJA 1OI9B 2LQ8A 5IHKA 3JB9I 1Z9ZA 2ABLA 5D6YA 2AZVA 1WHHA 4CFNB 4MFDA 4QVZA 2ZPEB 1CKAA 3BFMA 3E2UA 1Q81U 1QVGS 5FWBA 1NJIR 4EORB 4J9EA 1D0YA 4DOVA 2DPPB 4XU3A 2JTEA 3WXMB 2QFZA 2JM8A 4LDWA 3OS2A 2M16A 4J9GA 2QQ9A 5FU6C 3LWIA 4A4FA 2K5IA 3TW7A 2DX1A 2DRMA 4EPCA 2RQTA 1SHGA 2RB6A 2X4XA 4J6WA 3UA6A 5I5ZB 2KEAA 2F2WA 4BCQB 5HK0A 2RH2A 4ELYC 3G71A 2CKKA 4JDSA 2YSQA 1B34A 1LPLA 5KE2A 4ZNXA 3S3NA 4PJNA 2PJQA 3LH5A 4DQ2A 1QVFP 3OW2A 2ZAEA 1UEBA 3MP6A 2DEQA 5GAN8 3EGDB 4E7JA 2DL4A 5FROA 3CMAQ 2QXFA 2GF7A 2OI3A 5HBEB 3G6ET 3CPWP 3CMAT 2RHUA 1C9BA 3GTMS 2D1XA 2GQVA 1M5Q1 1X75C 3VKIA 4KRCB 1AOJA 3RDVA 4C92B 1ZA2B 2JUFA 1E6HA 2EPDA 2G9XB 1TS9A 2KROA 2MPXC 1NZ9A 1FWZA 3JRZA 4BCJB 3C0CA 4MDWA 1VQ6A 4LN2A 2L8DA 3DKMA 4LDVA 4CI0C 4YTLA 1NBEB 3HTRA 3CCRQ 1G83A 1YCSB 1YITA 2XDDA 1F1BB 3V8JA 3N5BB 3HHTB 2M0YA 1TG0A 1HD3A 4ZN3A 3JSCA 3MP8A 3QHSA 4L6V5 5IF1B 4AKHA 1WHMA 1D09B 2XKOC 1VQ6T 4M7AA 2CS7A 3TCJA 1UGQB 4HL4A 2KY9A 4R56A 2RQUA 4OGEA 3X28B 4M7DE 3MKDA 5KCOA 1IZ6A 3I5SA 5KCHA 4CC7A 3TW6A 3O0GD 2X4WA 1SG5A 3SB2A 3CCVT 1M1KC 2ATCB 5LJ3f 3VKGA 4BBSM 2PNIA 1M1KR 1V76A 4F6UB 4M75F 1NJIU 2V1QA 4MZMA 4C0ZA 3OMGA 2IN3A 1D0XA 4IUQA 4KUDK 4PJLA 2GTJA 2ROTA 1LNXA 2X1NB 4AFSC 2KRNA 1FKMA 3FB9A 1CKBA 2ZPBB 3HFOA 1YJWQ 2VXEA 4PK4A 3I5RA 3CCQQ 5LL6S 3VS4A 2PQWA 4L5GA 1RL2A 5DQVA 2QQ8A 1I1JA 3CC2Q 4CFXB 1V1CA 4LOCA 2HL5C 2KGTA 1YJNQ 4M7AD 3L42A 1N8RR 5I2MA 1OL1B 4TTHA 3CC2T 4F7JB 1AEYA 4ZN1A 2IIMA 1OI1A 5LJ5f 5LJ5h 1OIYB 4EDUA 2DJZA 5LJ3e 2EQMA 5DY9A 1IO6A 1R77A 3SWNC 3BLHB 2H3JA 4BE0A 1TFBA 4DOWA 1RAFB 3J7AF 3A1PA 5IHIA 1XTDA 4RCBA 2JS0A 1LVKA 3OYNA 1XOVA 3CPWA 2CCIB 4BY6C 1JOWA 2E3IA 1UJ0A 2NWMA 1WX6A 4V2SA 3MO8A 2NYSA 3CC7A 3MY5B 1PSEA 4BY7X 1VA7A 2LJ3A 1X6BA 3HP9A 3PT9A 5GJVB 5GAN5 1MNEA 2L2PA 2RQVA 3M4GA 1WNLA 2DXCA 3QYEA 1KQSS 5GAMd 5GMKh 3EOCB 3EH1A 4M7AF 1UGPB 3RR6A 4E7SA 4HVWA 2FEIA 4X9CA 4IIMA 2M9UA 1K1ZA 2P4RA 1K73U 3C4SA 5EG2A 1IGUA 4OMOA 2M1HA 2DD4B 4PJOD 1M2VB 2HMAA 1VYVA 1NG2A 4O5VA 1OQKA 1RLQC 4OMLA 4M75A 3GIBA 4A4HA 3EJ1B 2KYBA 4IUPA 5CVIA 1ZHIA 1CSKA 2CZ7B 5CAIA 2DYBA 4JJCA 2W2HA 2IVWA 1VOLA 3HRUA 4BE2A 1NJIC 2LQNA 3VRYA 3RBBB 3DOGB 1VQMT 4NL2A 3QYHB 2D6FA 1RAGB 2AHJB 1ZUUA 2OTLT 2LRQA 1BI3A 4ESRA 5CKBA 2J6OA 1KQ1A 3CCUA 1B34B 3RMSA 3KFVA 5KYYA 1C0MA 3MCAB 3UPUA 2QEXQ 4NS5A 1SF9A 3TN8B 3VYGB 2WEVB 4C92D 3G71Q 2O31A 1Y96B 2DVJA 2EW3A 4M75C 3JCMe 1RACB 4E47A 4E7HA 2DERA 3I55T 2I0NA 2DM1A 2CJMB 1YWPA 4WTOB 2F2VA 4JLGA 1YITQ 3DB4A 2F1LA 1IHWA 2O4XB 2DBKA 2YUQA 4J83A 3M58A 1VQNQ 1MMNA 3EGDA 5KYUA 2ROLA 4XQ3A 1G3WA 2KR6A 2JS2A 3CCMQ 4OMFB 3G4ST 3A8OB 5GAMg 4RTZA 1BCMA 3JCMP 3ZEHA 4YOZA 1WI7A 2EUFA 4F16A 1GCPA 5LQFB 3F70A 3HRTA 5GAOq 4B9XA 2RHYA 2CCHB 5I22A 1YI2Q 2C5OB 2O01E 1Q86R 2OJ2A 1S1NA 1HK9A 1J3TA 2WHBB 4XAXB 1G3NC 4M7DD 3M4YA 3PTAA 4PJOC 1E6GA 1M9SA 2ZZDA 4XU0A 3LLRA 4JRQA 2YRVA 4QVDA 5KYXA 3TSZA 3L2RA 3RESA 1GY3B 3QDFA 4EC9B 2E65A 3OW2P 3CCRA 5ACBA 2KT1A 4GY5A 1I07A 2WACA 3FLGA 3BLRB 4ELJA 2FO0A 2HSPA 2E41A 3POMA 4M78B 6AT1B 2P84A 3QWXX 4PJJA 4M75D 4XTWA 3GPLA 3VRZA 4PJOE 5IH2A 3EG2A 1PCXA 4MZTA 1KC8U 2MIOA 3FDRA 3CMEQ 1VIEA 2KDSA 3REAB 4FYWB 4IMYB 1WHKA 2DXCB 5GAMf 1VYTA 1ZSGA 4QKUA 2K2MA 3KXTA 3EG0A 1N5ZA 3FJ5A 3QKJA 4II1A 3VS6A 2QTXA 2HEQA 4F14A 2PK2A 4LNPA 4BCMB 4EMHA 1YIJA 1K0SA 5KYUB 2KRMA 5GANj 3G33B 2F2XA 2P0KA 3P8DA 1ABOA 2QYZA 4EOLB 4AFZC 2CP2A 1KXUA 2KRSA 4M7AC 4EOSB 4RMOA 4HCCA 4RTWA 2VV5A 2AZSA 2GTOA 3SFMA 1M90U 2PTKA 1I4K1 3JCMV 1ARKA 5CQYA 2E10A 4J9BA 3OQ5A 4CFMB 1NYGA 3VS5A 2ZZDB 1YWOA 2WMBB 2KSSA 1GFDA 1U8RA 3UT1A 2DK3A 1QVFS 4M4ZA 3TEEA 2KYMA 3QUIA 5A2QE 1Q86U 4J9FA 2LX7A 4C5GA 1GBQA 1WXBA 3UATA 4LDUA 2V8KA 3ZFJA 3WVDB 3ASKA 3X25B 2CZ1B 2PU9B 2CSIA 3OYCA 3CC7T 3ME9A 5GANd 3A98A 3QSUA 3I9QA 3MIAB 1M1FA 5CKHA 1FINB 4HXJA 3DLMA 5FW9A 3CD6A 2RK1A 3INZA 2K3XA 2QG9B 3T9NA 3JB9H 4QQGA 3OW2S 1G3SA 2EQKA 3CCUQ 3JCMJ 2MK5A 1QMCA 1AD5A 4JRIA 3OYIA 2WIPB 2JXBA 5I11A 1OEBA 3HKSA 5IDNB 3PO3S 4UN0A 3TREA 1TTHB 1H1QB 4Y92A 4BCMD 3OYDA 1KSWA 3H41A 4Y72B 2DXTA 1QP3A 1RAIB 3CC2A 2QGGA 2CP6A 3R6OA 3DB3A 4KH1B 1GRIA 2CP7A 2X51A 1G3YA 4F6SB 4PFPA 1YIJT 2A7YA 1W1FA 2OX7A 4F7UB 4BDZA 4FW2A 2K4YA 4OP0A 2JZ2A 3HPWA 4OGRB 4CFUD 2BE7D 1AVZC 2V8IA 1BU2A 8AT1B 1N8RC 1W70A 3CCET 4PFOA 4M7AG 1VUBA 2CT4A 3M0QA 3V8KA 2QASA 2E6ZA 2HD0A 1U1SA 2DXBA 3IQLA 2QDYB 1WQ7A 1UB4A 2K5FA 2OTJQ 1OPLA 2B86A 2LJ0A 1VQ5Q 1S72A 4JLIA 1H8KA 4FCYA 1E9HB 1KIKA 4HKEA 1I8FA 2LVMA 2V22B 2KAFA 2DXBB 3UF4A 4E2FB 2FPDA 5HY6A 2GFAA 4HCKA 4F70B 2EYWA 4RTYA 1OU9A 1SSHA 4IUTA 3JCMb 1TH7A 2BE9B 1YJ9A 3KBGA 2OTLQ 1M90R 4PJOA 2EYZA 2GBQA 1QQJA 2DZ9A 3JB9D 1R0CB 2UUEB 5DLQE 1QWFA 2IVXA 1M2VA 4KUIA 3EG9B 5FLXE 5FGKB 2MAMA 3RKWA 4C8QF 2W96A 4YC3B 2RK2A 1WFWA 1UECA 2JTMA 4C8QG 3PVLA 1GCQC 4L59A 3HL8A 5KYXB 2D8HA 1Q7YR 4FM4B 1VQNT 2D0NA 4KGZB 3NFCA 1UHFA 2IPOB 1YNZA 1GBRA 5EJCA 2FHDA 1Y0MA 2YDLA 4AI6A 4A4KA 3OBYA 1KHCA 5GAN6 1OV3A 4A53A 5GANg 3JCMh 3ZL7C 3CCJQ 4WCIA 4J7FA 1FMWA 2EYYA 1BYMA 3H6ZA 2HBWA 4EMKA 1OIUB 1Z9QA 2QQRA 3CCLT 1VQNA 2LDMA 5LJ5j 4CC4B 1WJQA 1H1PB 4JRPA 2QQSA 3BG3A 4ELLA 3QG1A 1Q86C 3VYHB 3ER0A 1M2OA 3NGPA 2IW6B 4ZTJA 3GF5A 2BS4A 2CYZB 2YWWA 1ACMB 3M0SA 4Z89A 4QSHA 3V7SA 5BNJB 5FU7C 1VQ9A 1I81A 4R55A 5HNBB 3TNWB 5CKFA 3LGFA 2RJFA 3CCMT 4DEXA 4CFVB 1JJ2A 4XK8E 1Y71A 2VGMA 1RAHB 1VQKA 1WQWA 3BY7A 4PJMA 2HCKA 3J80E 2MI6A 2MMPA 3DJBA 4PJOF 3M55A 4PLIA 1K9MR 4IKFA 2AIRB 2AK5A 4RCCA 1VQMQ 1S72T 1QKWA 2X3WD 4C8QA 3CPWS 1VQOA 5LJ5g 2QA4A 2EJ9A 2DLPA 1G5VA 1K0XA 3RMQA 5IAYA 2DA9A 2YUPA 1AWJA 4LXCA 2EJFA 2P0PA 2X3XD 4FYVB 4M77E 1K9MC 2DEUA 1PM3A 4AFQC 3L2QA 5M9OA 4C0FA 2DL8A 4RODA 1M1KU 1PKTA 2KQWA 1KC8C 4OB2B 3A8MB 4B6MA 4F17A 4FX3B 2EYXA 4WF2A 4CRLB 4JX4A 2A0FB 1UUEA 2KT8A 3CQTA 4Y91A 3HZJA 3S3MA 4EONB 3EHQA 5HBJB 4FU6A 4Q5WA 3JCMX 3S3OA 3M0TA 4GLMA 4DBHA 1XJWB 5FWCA 1X6OA 2OTJA 3QYGB 1VOMA 3PMTA 2ZPGB 2FL7A 2C5XB 3KUFA 2I40B 4OMMA 2VGNA 3OBWA 4ORZA 2LZ6B 2IW8B 2H3EB 2LQWA 2Y4YA 4IUUA 5LJ3d 2DXUA 5LJ3j 3M0PA 4F7SB 2G6FX 1MUZA 1I5LA 1PRMC 2JNGA 2UZEB 3D7SB 1QLYA 2V1RA 1X69A 4D8KA 3TQ7P 2I53A 2JW4A 2ED1A 4F7UG 1G2BA 1UNGD 2E5KA 2HQEA 1O75A 3P8HA 4AG1C 1GUXB 4BI8B 4CFUB 3MPUB 3LWHA 2VWFA 3CCQA 1TD6A 4RG8A 1I0CA 2LTOA 4C8QB 2AKKA 1GL5A 1QVFA 3CD6Q 1WA7A 1Q7YC 4AKGA 1NPRA 3EGXA 4BY6B 3V8LA 3GLXA 1T3SA 3MJXA 4IUVA 1D1BA 4TVRA 3VUBA 2FZCB 1QCFA 4X1VA 4EOOB 8ATCB 4E7LA 4RTXA 4NL3A 3JV3A 2KK4A 1JXOA 1YJ9Q 2R7GA 3BLQB 3QWYA 4M77F 2VB6A 3I55A 1H3HA 2LCLA 1FYNA 5J39A 1XQHA 3PVQA 3CCUT 4DA4A 5GAN3 2YLCA 3Q1JA 5D7UA 4E7IA 5CR2A 1M90C 1N8RU 1D3BB 3G6EQ 4KRTA 2DTIA 4M78F 4D6WA 1ENWA 1W98B 1YCYA 1W2BA 4M7DB 2EYQA 4ME7A 4C8QD 2F2CA 1P5EB 2KE9A 2L3QA 2JJ9A 2KXCA 3G1JA 3HBLA 2X4YA 2K57A 3MEWA 1X2KA 5KE3A 2DE0X 2DTOA 3JCMd 2OAUA 1PKSA 2BZ8A 1GXIE 2DBMA 2DKGA 2F5TX 4C92F 1FMKA 2CP0A 5KYWA 3CCEQ 3H0FA 2JOYA 2E64A 5CYIB 2BZYA 2DL7A 2DFUA 4OMPA 1VQKQ 4M77D 2PZ1A 2O88A 1WYXA 1K9AA 3CC7Q 1WXTA 2WSCE 2A08A 4BDYA 4BD3A 5GMKj 2O4XA 4BE1A 1KQSA 1UG1A 1RAEB 4QQ6A 2QGSA 1ZP2A 3CCSA 2RN8A 2EGCA 1W2BP 5ECAA 5L23A 2PVDB 3M0UA 2UZDB 1O9SA 2LT4A 3MY1B 2JM9A 1KD1C 2RI5A 2SRCA 3DDQB 1WIEA 2DJQA 3H9NA 2J6FA 3K7AM 4C8QC 1HXDA 4I3ZB 4X34A 2J05A 3CCLQ 5DQWA 1I5OB 3EFOB 4M75B 1Q82C 3M9QA 4EMKC 1UJYA 3L1AA 4ROCA 1VQPQ 3JCMQ 4II5B 4M78C 4M77A 4R0KA 4CC3A 4BCGB 3H8ZA 3RIRA 2L3PA 2C0TA 3OYGA 3ULRB 2RQWA 2HAXA 2IG0A 1U06A 1OGUB 1M3AA 1RLPC 1YN8A 3CEYA 2EWNA 3QHWB 4FYYB 2R5MA 1OYXA 2NUTB 5GMKe 1WDXA 4Y28E 3NTKA 3CXCA 4M7DC 4BCND 4ZGEB 1IB8A 2KMTA 1VQ4A 4OR5B 2JGZB 1U5SA 2WSEE 1AZGB 2K6DA 2L3SA 2QA4T 2KBTA 4DBFA 1YHQQ 3A8GB 4VUBA 2GNCA 2RJCA 3QYBA 2FZKB 3VJPA 3NHNA 3C12A 3AHUA 2B9RA 1XNIA 1A0NB 2XU8A 5HK3A 1PNJA 1M27C 2OAWA 3NTIA 3BG9A 2PK9B 4NOYA 1VQLA 1PD1A 3OYLA 2KMGA 2QK0A 1LCKA 5LJ5e 1U3OA 3JB9F 1EX4A 2PVGB 2ECZA 4N0AA 2QI2A 1Q81R 3NDQA 2RHXA 2QGFB 4QW2A 1PSFA 2VKNA 1VQMA 2YRCA 4LDYA 4F7UE 3EG9A 2EIFA 1TUGB 5GANe 3S6WA 4F7NB 3VYGA 4JJDA 1V29B 5IHYA 1H26B 3TNHB 4ZTFA 3B57A 3EFRA 4RTTA 2XDBA 1SHFA 4XTUA 2LNHB 1NYFA 1YI2T 2WMAB 2HKNA 5GAN7 5GAMe 5GAN2 2E12A 5GJWB 4M6VA 5FRNA 2J06A 4M75E 2CP5A 2FG0A 4C5EA 1TU0B 3OYYA 3VU3C 1M8VA 2EQJA 5DLOA 3VUZA 5GAOp 4UC4A 4ZGJB 1IXDA 1KFZA 4JS4A 2DILA 3M5AA 4FSXA 3E9FA 4MZPA 4RTUA 4M7DF 2K3BA 4M77G 3GNGA 3CC4T 1OX8A 2DZCA 2BIVA 1AWOA 2RI3A 3BW1A 1Q82U 3TU4K 2W10A 1UHCA 1AZEA 4KGVB 5LJ3h 4LUEA 1RADB 1C6VX 3GBQA 2DL5A 4OB3B 5AT1B 2QEXA 3VS0A 4BXXX 2LQKA 4A63B 5KH6A 2K9GA 4F04B 3X20B 3I55Q 3TNIB 2CZ0B 2QTVA 1MGQA 3CMET 1SRLA 1X27A 3CC4A 3QZ9B 3GNFB 4AKIA 1EZZB 3BHVB 2ZPIB 1JEGA 2RF0A 3DLLA 2WIHB 2WSFE 3NTHA 3OA6A 2J6KA 2XDPA 4Z8AA 5FU6B 3BE3A 2RPNA 2E5QA 3CCSQ 5LJ3g 4KGXB 1JB0E 3HRSA 2VASA 2LCSA 2AKLA 1OKWB 1FMVA 1OZ2A 1UDLA 1VINA 1RABB 3O8VA 2BZXA 2NUPB 2D0QB 3CCST 3CMEA 4BI4A 3JCMg 1WXUA 1HSQA 3MEAA 3V7RA 1VQPA 3CBMA 4HT9A 4BCKB 3A5ZB 5D6XA 2FPEA 1D0ZA 2LJ1A 1ZUYA 5KYNA 1JJ2P 2RHIA 1RAAB 1HJDA 2GCXA 1N9SA 2DD5A 2LCCA 3RGFB 2YUNA 2QDLA 5C6SA 4XU2A 1OPKA 4PNOA 1O9KA 4EOPB 4BCQD 4PJOB 3FRNA 1NEBA 4C92G 4AT1B 4J7IA 4M77C 4JUVA 1H27B 4JRKA 1D1CA 3G6EA 1X43A 4XTXA 3OYEA 2X4JA 3SEMA 3EGUA 4B9WA 3QZ5B 1TUDA 1ZX6A 4C8QE 1PWTA 1MV3A 4BCNB 1Q82R 1U1TA 1OX9A 5A0DA 4N4HA 1VQ6Q
chains in the Genus database with same CATH topology
2RJEA 5C0MA 2IVWA 1WGSA 2HQXA 3HRUA 4WF2A 4BE2A 1NJIC 4JX4A 2RI2A 2LNVA 3L2UA 1VQMT 2DD4A 3QJ6A 4NL2A 3QYHB 1BIAA 2VC8A 3HZJA 4Y91A 2AHJB 2JTFA 1LOJA 4FU6A 4Q5WA 3JCMX 3S3OA 3S3MA 2OTLT 2LRQA 1BI3A 2D9TA 5CKBA 3OS0A 1D3BA 1H3ZA 1KQ1A 2OTJA 1X6OA 3CCUA 3QYGB 1B34B 3PMTA 3RMSA 4MDXA 2ZPGB 2FL7A 3QJYA 3KUFA 5I2SA 3MCAB 2VGNA 3OBWA 1YJWA 3UPUA 2LC4A 2Y4XA 5L8RE 4HNTA 4HNVA 3CCVA 1VQ7T 2Y4YA 4NS5A 3CCJT 4IUUA 3VYGB 4QQDA 5LJ3d 4C92D 2ZPFB 2DXUA 1VQ5T 3SWNB 5A0LA 1Y96B 5LJ3j 4M75C 4N4GA 3JCMe 4GLKA 2I2LA 3OSSC 4E47A 4E7HA 4Z02A 3I55T 3HO8A 3OYHA 2CZ6B 4F7UA 1VQ4T 4JLGA 3DB4A 2EJGA 3CMAA 1I5LA 2O4XB 2RHZA 2DIGA 2JNGA 3OSVA 4J83A 3PGGA 1ZQ1A 4C5IA 3M58A 4M75G 3JCMW 2C06A 4C0DC 4M7DA 5CIUA 1N6AA 3BG5A 3CCRT 3M57A 4X9DA 4XQ3A 3JB9G 4XU1A 1VQKT 3FIFA 1JRIA 1G3WA 3CBOA 1M1GA 4PL6A 3SWNA 4F7UG 3LW5E 4M78A 2KR6A 1VQ7A 4OMFB 2L5QA 3G4ST 1Q7YU 3A8OB 5GAMg 2QEXT 1FXXA 2L3RA 2HQEA 1O75A 3P8HA 3JCMP 3ZEHA 1YJWT 1RI0A 2K3YA 2XHCA 1VQPT 4BI8B 2G77A 3F70A 3HRTA 5GAOq 4B9XA 2RHYA 2XI9A 3LWHA 2O01E 4J5YA 4MMLA 5CO7A 1NPPA 3OYJA 3CCQA 2BUDA 4RG8A 5J3BA 3CPFA 5GAOr 5DM7R 1HK9A 3OS1A 4J6XA 4PJOE 2LTOA 4C8QB 1KHIA 1YITT 4XAXB 4IURA 4N0AC 1QVFA 4M7DD 3M4YA 3QBYA 4XTVA 3DL1A 4C0GA 3QO3A 1VQ9T 3PTAA 1Q7YC 1Y96A 4PJOC 4AKGA 1NPRA 1M9SA 2ZZDA 4BY6B 1VQOT 2XD0A 4XU0A 3V8LA 3GLXA 3LLRA 3L2ZA 4M77B 2RD1A 4OVAA 1W4SA 4JRQA 2YRVA 1K8AU 4QVDA 3WVEB 2MF2A 2EKOA 4IUVA 3E9GA 3L2RA 4TVRA 3RESA 3VUBA 4NC6A 3OYAA 1Y07A 2E65A 4E7LA 2BKDN 2DAQA 4NL3A 4HCBA 2KK4A 2X35A 5GAMh 3CCRA 2A3LA 4A4EA 4EMGA 4GY5A 4M77F 4JS5A 2WACA 4MMKA 3PMIA 5CK9A 3FLGA 3A8HB 4ELJA 3I55A 2E41A 3E1SA 3EFSA 4M78B 3M54A 2DIQA 2BS2A 2R58A 4JX5A 2RO0A 4M75D 1VQ8T 2G3RA 2LCLA 3LH0A 4P5NA 4M7AE 5J39A 3CCUT 1XQHA 4BUGA 3GPLA 4DA4A 4M78G 3JB9J 4FIBA 5GAN3 1KG1A 2YLCA 4BBRM 1M4ZA 3Q1JA 2XK0A 4N4IA 3SD4A 5LJ5d 5CR2A 1QW1A 1D3BB 4MZTA 3GP8A 1N8RU 4F7UF 3QDRB 4J8OA 4RKUE 2MWOA 5GANf 1KC8U 3FDRA 4M7DG 1QVPA 5FRMA 2DTIA 1VIEA 4A54A 1YJNT 4FT2A 4M78F 4KULA 2KDSA 3JCMf 4D6WA 1QP2A 2D6FA 3PIPA 1H641 1YCYA 1W2BA 2HNIA 4M7DB 2EYQA 1YHQT 1W2BS 2DXCB 2OTJT 5GAMf 4ME7A 3G4SA 4C8QD 1YHQA 1KQ2A 1QVGA 4KT0E 2R57A 3QWLA 1YBYA 4OGCA 2B8AA 3KXTA 3QXEB 4OB0B 1N9RA 3OB9A 3HBLA 1E7PA 2X4YA 2K57A 3QKJA 3C94A 2DO3A 3MEWA 4II1A 5KE3A 4JJNK 1VQ8A 2DTOA 3OYMA 3JCMd 2OAUA 2QTXA 4XTZA 5GAMj 2PUOB 3PNWC 1P92A 1OZ3A 4C5HA 3E19A 1VIFA 2DVEA 1GXIE 5IT9E 2DKGA 3UDCA 1SSFA 1BKBA 2F5TX 3M56A 1LJOA 4ELZC 4C92F 3L2VA 4EMHA 1YIJA 2JN0A 2YHTA 3GOXA 1QLBA 2JOYA 4C0DB 2E64A 2P0KA 5GMKi 1UGSB 3P8DA 5GANj 2VXFA 5FU7B 1K9MU 4LD9K 3RKXA 2F5KA 4M7AC 1EIFA 1UGRB 4ATOA 1Y7XA 5CCAA 1IREB 4M77D 3X24B 4RMOA 2P4TA 3VV0A 4RG2A 1WPYA 4HCCA 2R5AA 2L89A 2VV5A 1MHNA 4HA8A 3SFMA 1M90U 2K5LA 1YJNA 5I21A 2WSCE 4MFEA 1I4K1 1N27A 3LX7A 2XICA 3JCMV 5CQYA 4BDYA 4BD3A 5GMKj 2GFUA 2O4XA 3P8BB 2E10A 4BE1A 1KQSA 3OQ5A 2JVVA 4LD6A 3CXCS 2ZZDB 3OS5A 2KSSA 1U8RA 5GAOn 4CRIA 4QQ6A 1AHJB 3CCSA 3UT1A 2DK3A 3CCJA 1QVFS 3TEEA 4PJOG 3QUIA 2LQ8A 5A2QE 1Q86U 3JB9I 3I56T 4LDXA 2WJ9A 4ZGDB 2RA2A 3BDLA 2ZPHB 4C5GA 5D6YA 3J81E 4LDUA 2FYKA 2PVDB 2V8KA 3ZFJA 3WVDB 1O9SA 4XTYA 2LT4A 3ASKA 5CKDA 1KD1C 3X25B 2NLUA 2RI5A 2CZ1B 4MFDA 2PU9B 2ZPEB 4QVZA 5AYFA 3MEUA 3BFMA 3OYCA 3CC7T 5GAOm 3ME9A 1FX7A 1Q81U 4C8QC 1HXDA 5GANd 1QVGS 4Z6YA 2E6NA 5GMKl 4X34A 3QSUA 1M1FA 5CKHA 4DOVA 2DPPB 1K73C 4XU3A 3WXMB 2QFZA 3I56A 4M75B 1Q82C 2M0OA 3DLMA 3M9QA 4LDWA 4M78D 4EMKC 3CD6A 3L1AA 2RK1A 3OS2A 3INZA 2FB7A 2K3XA 3JCMQ 3RERA 2M16A 3C95A 4M78C 3T9NA 4M77A 2QQ9A 4QQGA 5FU6C 5GAOp 3LWIA 3OW2S 3JB9H 1G3SA 2EQKA 4HCZA 4A4FA 4JRIA 2K5IA 3OYIA 3JCMJ 3H8ZA 3RIRA 4MIMA 3TW7A 3OYGA 2XIDA 4EPCA 4OF1A 5IN1A 2RB6A 2X4XA 3HKSA 4J6WA 2PUKB 3TREA 2HAXA 2IG0A 3M53A 5HK0A 2EFIA 2RH2A 5A0GA 3OYDA 4ELYC 3G71A 2CKKA 4JDSA 3META 3H4CA 2VYTA 2DXTA 1QP3A 3CEYA 1B34A 3CC2A 2EWNA 3LYIA 5KE2A 3S3NA 4PKCC 3R6OA 2YLBA 3DB3A 2R5MA 3JAME 1G3YA 1OYXA 4DQ2A 1YIJT 5GMKe 2A7YA 4Y28E 4F7UB 3NTKA 3CXCA 4BDZA 4M7DC 2KMTA 4ZGEB 2K4YA 3BDUA 4OP0A 3OW2A 1VQ4A 2JZ2A 3MP1A 1UEBA 3HPWA 3MP6A 2DEQA 5GAN8 2WSEE 1BI2A 2V8IA 1N8RC 3PFSA 4OB1B 2QA4T 4E7JA 3CCET 5FROA 3HB9A 4M7AG 1VUBA 3V8KA 3A8GB 2HBPA 4O6JA 2E6ZA 3QIIA 4VUBA 2QXFA 1G3TA 2GF7A 2HD0A 2RJCA 3QYBA 1U1SA 2DXBA 3VJPA 4EMKB 3G6ET 3C12A 3AHUA 2K2VA 3CMAT 3HSBA 2QDYB 2QDJA 2RHUA 1WQ7A 1UB4A 1XNIA 2GQVA 5CKEA 1M5Q1 1X75C 4C92E 2XU8A 3FEOA 5HK3A 2K5FA 3VKIA 3NTIA 3BG9A 4HT8A 3V7CA 4C92B 4NOYA 5GMKm 3OYFA 1S72A 2JUFA 4JLIA 3FJPA 1VQLA 3X26B 1NZ9A 3OYLA 2KMGA 4HKEA 1FWZA 1I8FA 3JRZA 2LVMA 2KAFA 2DXBB 4FL6A 4MDWA 3PIOA 1VQ6A 5LJ5e 3JB9F 3HFNA 2L8DA 3DKMA 2PVGB 3OMCA 3FC3A 4LDVA 2XG8D 2QF7A 5HY6A 2GFAA 4N0AA 4E7KA 2QI2A 4CI0C 3OYKA 4YTLA 2RHXA 1JBMA 4QW2A 4BB7A 4IUTA 1PSFA 3JCMb 4HLQA 1TH7A 2RJDA 3KBGA 5D6WA 3CCMA 1YITA 2XDDA 3V8JA 1YJ9A 3N5BB 1VQMA 3HHTB 4LDYA 4F7UE 3A8LB 1WJSA 2EIFA 5GANe 3S6WA 3VYGA 4PJOA 1V29B 4ZN3A 3JSCA 3MP8A 2DZ9A 3QHSA 1JJ2S 4L6V5 3ZBDA 4AKHA 2XKOC 4C92C 3JB9D 2FVUA 3EFRA 3G71T 4KBMB 4ZTFA 1VQ6T 5DLQE 4XTUA 1YI2T 1KD1U 2CS7A 2XDBA 5GAN7 3TCJA 1UGQB 5GAMe 5GAN2 2E12A 4HL4A 2KY9A 4KUIA 5FLXE 4R56A 2MAMA 4E7IA 3RKWA 4M6VA 4C8QF 4OGEA 5FRNA 3X28B 4M7DE 4M75E 5HKCA 3RKYA 5KCOA 1IZ6A 2RK2A 1Q81C 4C5EA 5KCHA 2KVQG 3TW6A 2EQUA 2JTMA 2X4WA 3G7ZA 4C8QG 3SB2A 3CCVT 3OYYA 3VU3C 1M1KC 2EQJA 5DLOA 3VUZA 4L59A 3VKGA 3HL8A 4ZGJB 4BBSM 4UC4A 5CQXA 5LJ3f 4BI3A 4FM4B 3CBPA 4QVCA 4BACA 1VQNT 4JS4A 3M59A 4M75F 1NJIU 3M5AA 4FSXA 3E9FA 4MZPA 4MZMA 3RUXA 3OMGA 3MHXA 3GNGA 3NFCA 4IUQA 4M77G 2DZCA 4C0ZA 3CC4T 2BIVA 4KUDK 5EJCA 2FHDA 2RI3A 3BW1A 1LNXA 2CGHA 4AI6A 4A4KA 1Q82U 3OBYA 1KHCA 1FKMA 3FB9A 5GAN6 3TU4K 1YJ9T 4A53A 5LJ3h 2ZPBB 5GANg 3EAEA 3HFOA 2QQBA 2VXEA 3JCMh 4C92A 1YI2A 2QEXA 4OB3B 5LL6S 4J7FA 2PQWA 2LQKA 4L5GA 5KH6A 2DTHA 1BYMA 1RL2A 2QQAA 2V8JA 3X20B 4M7DF 2QQ8A 3H6ZA 2CZ0B 2ZCFB 3CCEA 4J6YA 1MGQA 4EMKA 3CMET 4LOCA 4M7AD 3L42A 5I2MA 2QQRA 3CC4A 5J26A 3QZ9B 3GNFB 3CC2T 4AKIA 3CCLT 1VQNA 2LDMA 4ZN1A 5LJ5f 1OI1A 4PLLA 5LJ5j 5LJ5h 2ZPIB 2E70A 3OY9A 1WJQA 4FT4A 4EDUA 3QPHA 4JRPA 2DJZA 3DLLA 5LJ3e 2PVOB 2EQMA 5DY9A 2QQSA 3BG3A 3SWNC 2H3JA 2WSFE 3QG1A 5GANh 1Q86C 4BE0A 3VYHB 3ER0A 3NTHA 1ZBXA 4DOWA 3CCQT 3CD6T 3J7AF 3OA6A 2XDPA 5FU6B 2VUBA 1K8AC 4ZTJA 1R8OB 1WJRA 2BS4A 2E5QA 1XTDA 2CYZB 3GF5A 4RCBA 5LJ3g 1JB0E 3HRSA 3OYNA 4QSHA 1XOVA 3V7SA 1OZ2A 5FU7C 3CPWA 1VQ9A 4BY6C 3O8VA 1I81A 4R55A 2D0QB 2LT1A 4HNUA 3CCST 2F69A 3MO8A 3CMEA 4V2SA 4BI4A 5CKFA 3CC7A 3JCMg 3LGFA 3VKHA 1PSEA 2RJFA 3MEAA 3V7RA 3CCMT 2BS3A 3HP9A 1VQPA 1JJ2A 3CBMA 3PT9A 2DD5B 1Y71A 1X01A 2VGMA 3A5ZB 3LGLA 3KHIA 4XK8E 5D6XA 4A4GA 5GAN5 1VQKA 1WQWA 3L2WA 3BY7A 2RHIA 3M4GA 3J80E 1WNLA 2DXCA 2MI6A 2P0QA 3OYBA 3CCLA 3QYEA 2MMPA 2GCXA 5GAN4 4PJOF 2E1HA 4JX6A 3MEVA 5GAMd 1KQSS 1N9SA 5GMKh 4M78E 2DD5A 2EAYA 1UGPB 4M7AF 3M55A 4PLIA 5GAOl 3JCMc 2LCCA 2OTLA 4IKFA 5C6SA 3SDZA 4RCCA 4X9CA 2Y90A 1BIBA 2M9UA 2ZGWA 4PNOA 4XU2A 3CPWS 1S72T 4C8QA 1VQOA 5LJ5g 3UWNA 2QA4A 2EJ9A 1M90C 1K73U 3FRNA 4PJOB 3URGA 1G5VA 4C92G 3C4SA 3RMQA 5EG2A 5IAYA 4M7AB 1M8VA 2EJFA 4J7IA 2MWPA 2P0PA 2M1HA 4M77C 4JUVA 2DD4B 4JRKA 4PJOD 1NE8A 1VQLT 4M77E 1K9MC 3G6EA 4HT9A 4M7AA 4XTXA 1DJ7B 5M9OA 3OYEA 3L2QA 4O5VA 4C0FA 2X4JA 4M75A 1VQ5A 1M1KU 3GIBA 4A4HA 2KQWA 1BI1A 5CVIA 4IUPA 4B9WA 3QZ5B 2RM4A 1ZHIA 1KC8C 4C8QE 4OB2B 3A8MB 2CZ7B 2LX9A 1BI0A 5CAIA 1U1TA 4XTWA 5A0DA 4N4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKU E;  1QP3 A;  2ZPB B;  1QP2 A;  2DD4 A;  3QYH B;  2AHJ B;  4OB3 B;  2DXC B;  4KT0 E;  4Y28 E;  3QYG B;  4ZGE B;  2ZPG B;  3X20 B;  3QXE B;  4OB0 B;  2CZ0 B;  2ZCF B;  2WSE E;  5L8R E;  4OB1 B;  3QZ9 B;  2PUO B;  3VYG B;  3A8G B;  2ZPF B;  1GXI E;  2ZPI B;  2DXB A;  1UGS B;  2PVO B;  2QDY B;  2CZ6 B;  1UGR B;  2WSF E;  1IRE B;  3X24 B;  3VYH B;  2CYZ B;  3X26 B;  1JB0 E;  2WSC E;  3LW5 E;  2DXB B;  3A8O B;  2D0Q B;  2ZZD B;  2PVG B;  1PSE A;  1AHJ B;  2O01 E;  4XK8 E;  2DD5 B;  1PSF A;  4ZGD B;  2ZPH B;  3HHT B;  3A8L B;  2DXC A;  2PVD B;  3WVD B;  3VYG A;  1V29 B;  3X25 B;  4L6V 5;  2CZ1 B;  2DD5 A;  2PU9 B;  1UGP B;  2ZPE B;  2ZZD A;  1UGQ B;  2DPP B;  3WVE B;  3X28 B;  2DD4 B;  3A8H B;  4ZGJ B;  1DJ7 B;  4FM4 B;  3QZ5 B;  2PUK B;  4OB2 B;  3A8M B;  2CZ7 B; 
#chains in the Genus database with same CATH topology
 1ZA1 B;  3TVT A;  2RI2 A;  2LNV A;  2DD4 A;  3QJ6 A;  1BIA A;  2JTF A;  1LOJ A;  2D9T A;  2LW4 A;  2YRD A;  1H24 B;  1PRL C;  1H3Z A;  7AT1 B;  1SEM A;  3QJY A;  1GCQ A;  5I2S A;  5CEI B;  3DTO A;  3CXC P;  2LC4 A;  2Y4X A;  1QCN A;  1NM7 A;  1VQ7 T;  1W6X A;  1OOT A;  3SWN B;  5A0L A;  3EH2 A;  2I2L A;  4BCO B;  3HO8 A;  3OYH A;  1ZBJ A;  1VQ4 T;  1JQQ A;  3CMA A;  1ZQ1 A;  3JCM W;  4M7D A;  1TWB A;  1N6A A;  3CCR T;  1BBZ A;  2EKH A;  3M57 A;  4X9D A;  4XU1 A;  3FIF A;  4FSS A;  2M02 A;  4LE9 A;  3SWN A;  1M1G A;  1KJW A;  4M78 A;  1VQ7 A;  4Z88 A;  1Q7Y U;  1FXX A;  2V26 A;  2K3Y A;  1OU8 A;  1MMA A;  1K8A R;  2G77 A;  1YFN A;  2XI9 A;  4MML A;  3OYJ A;  2BUD A;  2J7I A;  3UA7 A;  3CPF A;  5DM7 R;  4J6X A;  1KHI A;  4RTV A;  4XTV A;  4AFU C;  3DL1 A;  4C0G A;  1Y96 A;  2A28 A;  2XD0 A;  2E4H A;  4EOJ B;  1C1A A;  4M77 B;  2RD1 A;  4OVA A;  1W4S A;  4EC8 B;  4BCI B;  1B3Q A;  2MF2 A;  2EKO A;  3E9G A;  4G6L B;  3BHT B;  4NC6 A;  3THK A;  2C6T B;  3OYA A;  1Y07 A;  4HCB A;  5GAM h;  3NPF A;  4IIO A;  4EMG A;  1AT1 B;  4JS5 A;  3PMI A;  3A8H B;  2WFY B;  2QAZ A;  1VQ8 T;  2DIQ A;  2BS2 A;  2R58 A;  4JX5 A;  1MMG A;  2FRW A;  4P5N A;  3LH0 A;  1VYW B;  4BUG A;  2PHG A;  4FIB A;  1KG1 A;  3EID B;  4BBR M;  1M4Z A;  1WHJ A;  2XK0 A;  4N4I A;  3SD4 A;  5LJ5 d;  4F7U F;  3QDR B;  5GAN f;  2MWO A;  4M7D G;  1QVP A;  1SRM A;  5FRM A;  1YJN T;  4FT2 A;  3JCM f;  4KUL A;  3PIP A;  2O2O A;  5IXB A;  3U23 A;  2OTJ T;  2SEM A;  3G4S A;  1XO2 A;  1YHQ A;  1PHT A;  1QVG A;  4KT0 E;  3NMZ C;  2R57 A;  3QWL A;  2EGE A;  2COZ A;  3QXE B;  3OB9 A;  4OB0 B;  1N9R A;  2EVR A;  3C94 A;  1VQ8 A;  4JZ4 A;  2A37 A;  5GAM j;  2PUO B;  1P92 A;  1OZ3 A;  2BKZ B;  3E19 A;  1VIF A;  2DVE A;  3UDC A;  2IW9 B;  4KRD B;  2C5N B;  1BKB A;  1H25 B;  5GMK i;  1K9M U;  1OL2 B;  3CCV Q;  1UGR B;  1JSU B;  9ATC B;  1Y7X A;  1PG5 B;  3X24 B;  2CSQ A;  2K7A A;  1G8X A;  2P4T A;  1M8M A;  1WPY A;  2L89 A;  1MHN A;  3EG3 A;  4J9D A;  4BCH B;  1N27 A;  1AD6 A;  3P8B B;  3EG1 A;  5EC7 A;  2JVV A;  4LD6 A;  4BCF B;  2LMJ A;  2NUT A;  1AHJ B;  5LMK B;  4PJO G;  1TSF A;  4LDX A;  3I56 T;  2WJ9 A;  4ZGD B;  2RA2 A;  2NUP A;  3BDL A;  2ZPH B;  1NLP C;  3J81 E;  1VQO Q;  2FYK A;  4XTY A;  1TOV A;  5CKD A;  2NLU A;  5AYF A;  2CUB A;  3MEU A;  5GAO m;  1FX7 A;  1ZSZ B;  4Z6Y A;  2E6N A;  5GMK l;  2RQR A;  1K73 C;  3I56 A;  2M0O A;  4M78 D;  1KC8 R;  3EHR A;  3RER A;  2FB7 A;  5HQ0 B;  2JMC A;  1Q95 G;  3C95 A;  5KYW B;  4HCZ A;  4MIM A;  2XID A;  4OF1 A;  5IN1 A;  2MYS A;  2PUK B;  3M53 A;  2EFI A;  2A36 A;  4QT7 A;  5A0G A;  1RUW A;  3MET A;  3H4C A;  2VYT A;  4J9C A;  3LYI A;  4PKC C;  2YLB A;  3H0I A;  2BTT A;  3JAM E;  4DBR A;  2EQI A;  4AMC A;  3H0H A;  1B07 A;  4YOO A;  4ROE A;  2KI7 A;  3BDU A;  1UNH D;  4E7Z A;  3MP1 A;  1K73 R;  2W99 A;  4F6W B;  1BI2 A;  1URC B;  3PFS A;  4OB1 B;  2EGA A;  2YT6 A;  2FPF A;  3HB9 A;  2HL3 A;  2HBP A;  4E6R A;  4O6J A;  2HDA A;  3QII A;  2C5V B;  1G3T A;  4EMK B;  2JT4 A;  3HSB A;  2K2V A;  2K79 A;  1MMD A;  2QDJ A;  1EFN A;  4FW1 A;  5CKE A;  4C92 E;  3FEO A;  1OUL A;  4JPB W;  4HT8 A;  1TXQ A;  4OMQ A;  3V7C A;  5GMK m;  3OYF A;  1O9K B;  2DET A;  4HVU A;  4YOS A;  2EBP A;  2HQH A;  3FJP A;  4CC2 A;  2FRY A;  3X26 B;  1JO8 A;  3VS7 A;  4FL6 A;  3PIO A;  2ESW A;  2RMO A;  3HFN A;  3SHW A;  3OMC A;  3FC3 A;  2XG8 D;  2QF7 A;  4E7K A;  1KK7 A;  3OYK A;  2Z0W A;  1AIS B;  1JBM A;  4BB7 A;  2KXD A;  4HLQ A;  5D6W A;  2RJD A;  1K4U S;  2CRE A;  3CCM A;  3F5X B;  3A8L B;  1WJS A;  1KQS P;  4HVV A;  1JJ2 S;  4ANJ A;  3ZBD A;  4C92 C;  2CUD A;  2FVU A;  3G71 T;  4KBM B;  1KD1 U;  1VQ7 Q;  1X2Q A;  1H4L D;  3I35 A;  4EOK B;  5HKC A;  3RKY A;  2C0I A;  2DME A;  1Q81 C;  2M51 A;  3G7Z A;  2KVQ G;  2EQU A;  1FVV B;  1MND A;  1VQK T;  2PMI B;  2E3H A;  5CQX A;  4BI3 A;  5IDP B;  3CBP A;  4BAC A;  4QVC A;  1PKD B;  2FZG B;  3M59 A;  5IHN A;  2KNB B;  3RUX A;  3MHX A;  4BCP B;  3G4S Q;  2CGH A;  1IHV A;  1VYU A;  1K76 A;  1YJ9 T;  3M03 A;  5EFQ B;  3EAE A;  4EOM B;  1UFF A;  2YUO A;  1AWX A;  4C92 A;  1YI2 A;  1T0J A;  4KH0 B;  2UZL B;  2DTH A;  2HSE B;  4JJB A;  2QQA A;  3R6N A;  2V8J A;  1JKW A;  2MCN A;  3MI9 B;  2ZCF B;  1TUC A;  4J6Y A;  3CCE A;  4NST B;  2JMA A;  5J26 A;  2DMO A;  4EOQ B;  1YP5 A;  4PLL A;  2E70 A;  4FYX B;  3OY9 A;  4FT4 A;  3QPH A;  3LQ5 B;  2PVO B;  2NUZ A;  1QCO A;  1H28 B;  2HZY A;  5GAN h;  4J9H A;  4AG2 C;  4LUD A;  1ZBX A;  1JXM A;  3CCQ T;  3CD6 T;  1QKX A;  1UNL D;  1YIJ Q;  2VUB A;  1H1R B;  1ZUK A;  1R8O B;  1K8A C;  4OMN A;  1R0B G;  1B7T A;  1WJR A;  1VQ8 Q;  2GGR A;  4CXA B;  1WHG A;  2LT1 A;  1T3L A;  4HNU A;  2F69 A;  1GH6 B;  3VKH A;  2BS3 A;  3LGL A;  2BPM B;  2DD5 B;  1X01 A;  2D8J A;  3KHI A;  4A4G A;  3L2W A;  1GFC A;  2P0Q A;  5IXF A;  3OYB A;  3CCL A;  1WLP B;  5GAN 4;  2E1H A;  4JX6 A;  3MEV A;  2LP5 A;  4M78 E;  2EAY A;  5GAO l;  1KD1 R;  3JCM c;  4J9I A;  2OTL A;  2ENM A;  1D1A A;  3SDZ A;  2Y90 A;  1BIB A;  2ZGW A;  1M30 A;  2HKQ B;  3UWN A;  2CH4 W;  1N4M A;  1BK2 A;  2DNU A;  2MOX A;  3AT1 B;  3URG A;  1WHL A;  4M7A B;  2MWP A;  1ABQ A;  1NE8 A;  1VQL T;  2DYI A;  1DJ7 B;  5ICP B;  1AWW A;  1VQ5 A;  1BI1 A;  2UZB B;  1VQL Q;  2RM4 A;  2RNA A;  2LX9 A;  1BI0 A;  2QQB A;  3PE0 A;  1SKU B;  2RJE A;  5C0M A;  1WGS A;  2HQX A;  1M3C A;  1VQ4 Q;  2CT3 A;  3L2U A;  1BU1 A;  2VC8 A;  1NLO C;  1E7O A;  1Y57 A;  3OS0 A;  1D3B A;  2YXY A;  4MDX A;  1QMZ B;  2W0Z A;  1D3U B;  4RUG A;  1YJW A;  1GUX A;  5L8R E;  4HNT A;  4HNV A;  3CCV A;  3CCJ T;  4QQD A;  2ZPF B;  3REB B;  1VQ5 T;  5KYY B;  3QHR B;  4N4G A;  4GLK A;  1UE9 A;  3OSS C;  4Z02 A;  4DBQ A;  2CZ6 B;  4F7U A;  3O5Z A;  2EJG A;  2RHZ A;  2DIG A;  2AT1 B;  2CDT A;  3OSV A;  3PGG A;  4C5I A;  4M75 G;  1F5Q B;  2C06 A;  4C0D C;  1T0H A;  5CIU A;  1NEG A;  3BG5 A;  3JB9 G;  4CFW B;  1JRI A;  3CBO A;  4PL6 A;  1BB9 A;  3LW5 E;  2DL3 A;  2L5Q A;  4EIK A;  2QEX T;  2COW A;  2L3R A;  1YJW T;  1RI0 A;  1VQP T;  2XHC A;  1RI9 A;  4BY1 X;  2W9F A;  1QVG P;  1UTI A;  5L2W B;  4J5Y A;  5CO7 A;  1NPP A;  5J3B A;  1VQ9 Q;  5GAO r;  1OKV B;  3VS1 A;  2C4G B;  3OS1 A;  5HBH B;  1YIT T;  2GQI A;  4DEY A;  3I56 Q;  4IUR A;  4N0A C;  3QBY A;  1H92 A;  1VQ9 T;  3QO3 A;  1SPK A;  1VQO T;  4PFZ A;  3L2Z A;  1WZO A;  2ED0 A;  1K8A U;  3WVE B;  3VS3 A;  2BKD N;  2DAQ A;  2WPA B;  2X35 A;  2DF6 A;  2A3L A;  4A4E A;  1H1S B;  2XMF A;  4MMK A;  5CK9 A;  3BHU B;  2QA4 Q;  3E1S A;  1UGV A;  3EFS A;  3DDP B;  1S72 Q;  3M54 A;  2RO0 A;  4F7L B;  2G3R A;  4M7A E;  2X9H A;  4M78 G;  3JB9 J;  3GP8 A;  3EFO A;  1QW1 A;  4J8O A;  4RKU E;  4A54 A;  4GBQ A;  2H8H A;  3TSW A;  1QP2 A;  1H64 1;  2DRK A;  2HNI A;  1YHQ T;  1W2B S;  1ZSZ A;  1BCO A;  1KQ2 A;  1PD0 A;  3CC4 Q;  2L0A A;  3RNJ A;  2WXV B;  1JST B;  2KR3 A;  1IRX A;  1YBY A;  4K11 A;  4OGC A;  2B8A A;  2W9Z A;  1E7P A;  1IGQ A;  2DO3 A;  4JJN K;  3OYM A;  4XTZ A;  3PNW C;  3VS2 A;  4C5H A;  4JZ3 A;  5IT9 E;  1QWE A;  1SSF A;  2VVK A;  3M56 A;  1LJO A;  4ELZ C;  5HCK A;  3L2V A;  2JN0 A;  2YHT A;  3GOX A;  1QLB A;  1X6G A;  4C0D B;  1UGS B;  2VXF A;  5FU7 B;  2CH4 A;  4LD9 K;  3RKX A;  2F5K A;  1EIF A;  2O9S A;  4ATO A;  1PC0 A;  5CCA A;  1IRE B;  2COY A;  3VV0 A;  4RG2 A;  2R5A A;  1MV0 B;  4HA8 A;  4EOI B;  5HVY B;  2C0O A;  1M3B A;  2K5L A;  1HYO A;  1YJN A;  5I21 A;  1ZSZ C;  4MFE A;  1ZLM A;  3LX7 A;  2XIC A;  1JU5 C;  2GFU A;  3M0R A;  2O9V A;  3CXC S;  3EGX B;  3OS5 A;  2CP3 A;  5GAO n;  4CRI A;  4D8D A;  3CCJ A;  1OI9 B;  2LQ8 A;  5IHK A;  3JB9 I;  1Z9Z A;  2ABL A;  5D6Y A;  2AZV A;  1WHH A;  4CFN B;  4MFD A;  4QVZ A;  2ZPE B;  1CKA A;  3BFM A;  3E2U A;  1Q81 U;  1QVG S;  5FWB A;  1NJI R;  4EOR B;  4J9E A;  1D0Y A;  4DOV A;  2DPP B;  4XU3 A;  2JTE A;  3WXM B;  2QFZ A;  2JM8 A;  4LDW A;  3OS2 A;  2M16 A;  4J9G A;  2QQ9 A;  5FU6 C;  3LWI A;  4A4F A;  2K5I A;  3TW7 A;  2DX1 A;  2DRM A;  4EPC A;  2RQT A;  1SHG A;  2RB6 A;  2X4X A;  4J6W A;  3UA6 A;  5I5Z B;  2KEA A;  2F2W A;  4BCQ B;  5HK0 A;  2RH2 A;  4ELY C;  3G71 A;  2CKK A;  4JDS A;  2YSQ A;  1B34 A;  1LPL A;  5KE2 A;  4ZNX A;  3S3N A;  4PJN A;  2PJQ A;  3LH5 A;  4DQ2 A;  1QVF P;  3OW2 A;  2ZAE A;  1UEB A;  3MP6 A;  2DEQ A;  5GAN 8;  3EGD B;  4E7J A;  2DL4 A;  5FRO A;  3CMA Q;  2QXF A;  2GF7 A;  2OI3 A;  5HBE B;  3G6E T;  3CPW P;  3CMA T;  2RHU A;  1C9B A;  3GTM S;  2D1X A;  2GQV A;  1M5Q 1;  1X75 C;  3VKI A;  4KRC B;  1AOJ A;  3RDV A;  4C92 B;  1ZA2 B;  2JUF A;  1E6H A;  2EPD A;  2G9X B;  1TS9 A;  2KRO A;  2MPX C;  1NZ9 A;  1FWZ A;  3JRZ A;  4BCJ B;  3C0C A;  4MDW A;  1VQ6 A;  4LN2 A;  2L8D A;  3DKM A;  4LDV A;  4CI0 C;  4YTL A;  1NBE B;  3HTR A;  3CCR Q;  1G83 A;  1YCS B;  1YIT A;  2XDD A;  1F1B B;  3V8J A;  3N5B B;  3HHT B;  2M0Y A;  1TG0 A;  1HD3 A;  4ZN3 A;  3JSC A;  3MP8 A;  3QHS A;  4L6V 5;  5IF1 B;  4AKH A;  1WHM A;  1D09 B;  2XKO C;  1VQ6 T;  4M7A A;  2CS7 A;  3TCJ A;  1UGQ B;  4HL4 A;  2KY9 A;  4R56 A;  2RQU A;  4OGE A;  3X28 B;  4M7D E;  3MKD A;  5KCO A;  1IZ6 A;  3I5S A;  5KCH A;  4CC7 A;  3TW6 A;  3O0G D;  2X4W A;  1SG5 A;  3SB2 A;  3CCV T;  1M1K C;  2ATC B;  5LJ3 f;  3VKG A;  4BBS M;  2PNI A;  1M1K R;  1V76 A;  4F6U B;  4M75 F;  1NJI U;  2V1Q A;  4MZM A;  4C0Z A;  3OMG A;  2IN3 A;  1D0X A;  4IUQ A;  4KUD K;  4PJL A;  2GTJ A;  2ROT A;  1LNX A;  2X1N B;  4AFS C;  2KRN A;  1FKM A;  3FB9 A;  1CKB A;  2ZPB B;  3HFO A;  1YJW Q;  2VXE A;  4PK4 A;  3I5R A;  3CCQ Q;  5LL6 S;  3VS4 A;  2PQW A;  4L5G A;  1RL2 A;  5DQV A;  2QQ8 A;  1I1J A;  3CC2 Q;  4CFX B;  1V1C A;  4LOC A;  2HL5 C;  2KGT A;  1YJN Q;  4M7A D;  3L42 A;  1N8R R;  5I2M A;  1OL1 B;  4TTH A;  3CC2 T;  4F7J B;  1AEY A;  4ZN1 A;  2IIM A;  1OI1 A;  5LJ5 f;  5LJ5 h;  1OIY B;  4EDU A;  2DJZ A;  5LJ3 e;  2EQM A;  5DY9 A;  1IO6 A;  1R77 A;  3SWN C;  3BLH B;  2H3J A;  4BE0 A;  1TFB A;  4DOW A;  1RAF B;  3J7A F;  3A1P A;  5IHI A;  1XTD A;  4RCB A;  2JS0 A;  1LVK A;  3OYN A;  1XOV A;  3CPW A;  2CCI B;  4BY6 C;  1JOW A;  2E3I A;  1UJ0 A;  2NWM A;  1WX6 A;  4V2S A;  3MO8 A;  2NYS A;  3CC7 A;  3MY5 B;  1PSE A;  4BY7 X;  1VA7 A;  2LJ3 A;  1X6B A;  3HP9 A;  3PT9 A;  5GJV B;  5GAN 5;  1MNE A;  2L2P A;  2RQV A;  3M4G A;  1WNL A;  2DXC A;  3QYE A;  1KQS S;  5GAM d;  5GMK h;  3EOC B;  3EH1 A;  4M7A F;  1UGP B;  3RR6 A;  4E7S A;  4HVW A;  2FEI A;  4X9C A;  4IIM A;  2M9U A;  1K1Z A;  2P4R A;  1K73 U;  3C4S A;  5EG2 A;  1IGU A;  4OMO A;  2M1H A;  2DD4 B;  4PJO D;  1M2V B;  2HMA A;  1VYV A;  1NG2 A;  4O5V A;  1OQK A;  1RLQ C;  4OML A;  4M75 A;  3GIB A;  4A4H A;  3EJ1 B;  2KYB A;  4IUP A;  5CVI A;  1ZHI A;  1CSK A;  2CZ7 B;  5CAI A;  2DYB A;  4JJC A;  2W2H A;  2IVW A;  1VOL A;  3HRU A;  4BE2 A;  1NJI C;  2LQN A;  3VRY A;  3RBB B;  3DOG B;  1VQM T;  4NL2 A;  3QYH B;  2D6F A;  1RAG B;  2AHJ B;  1ZUU A;  2OTL T;  2LRQ A;  1BI3 A;  4ESR A;  5CKB A;  2J6O A;  1KQ1 A;  3CCU A;  1B34 B;  3RMS A;  3KFV A;  5KYY A;  1C0M A;  3MCA B;  3UPU A;  2QEX Q;  4NS5 A;  1SF9 A;  3TN8 B;  3VYG B;  2WEV B;  4C92 D;  3G71 Q;  2O31 A;  1Y96 B;  2DVJ A;  2EW3 A;  4M75 C;  3JCM e;  1RAC B;  4E47 A;  4E7H A;  2DER A;  3I55 T;  2I0N A;  2DM1 A;  2CJM B;  1YWP A;  4WTO B;  2F2V A;  4JLG A;  1YIT Q;  3DB4 A;  2F1L A;  1IHW A;  2O4X B;  2DBK A;  2YUQ A;  4J83 A;  3M58 A;  1VQN Q;  1MMN A;  3EGD A;  5KYU A;  2ROL A;  4XQ3 A;  1G3W A;  2KR6 A;  2JS2 A;  3CCM Q;  4OMF B;  3G4S T;  3A8O B;  5GAM g;  4RTZ A;  1BCM A;  3JCM P;  3ZEH A;  4YOZ A;  1WI7 A;  2EUF A;  4F16 A;  1GCP A;  5LQF B;  3F70 A;  3HRT A;  5GAO q;  4B9X A;  2RHY A;  2CCH B;  5I22 A;  1YI2 Q;  2C5O B;  2O01 E;  1Q86 R;  2OJ2 A;  1S1N A;  1HK9 A;  1J3T A;  2WHB B;  4XAX B;  1G3N C;  4M7D D;  3M4Y A;  3PTA A;  4PJO C;  1E6G A;  1M9S A;  2ZZD A;  4XU0 A;  3LLR A;  4JRQ A;  2YRV A;  4QVD A;  5KYX A;  3TSZ A;  3L2R A;  3RES A;  1GY3 B;  3QDF A;  4EC9 B;  2E65 A;  3OW2 P;  3CCR A;  5ACB A;  2KT1 A;  4GY5 A;  1I07 A;  2WAC A;  3FLG A;  3BLR B;  4ELJ A;  2FO0 A;  2HSP A;  2E41 A;  3POM A;  4M78 B;  6AT1 B;  2P84 A;  3QWX X;  4PJJ A;  4M75 D;  4XTW A;  3GPL A;  3VRZ A;  4PJO E;  5IH2 A;  3EG2 A;  1PCX A;  4MZT A;  1KC8 U;  2MIO A;  3FDR A;  3CME Q;  1VIE A;  2KDS A;  3REA B;  4FYW B;  4IMY B;  1WHK A;  2DXC B;  5GAM f;  1VYT A;  1ZSG A;  4QKU A;  2K2M A;  3KXT A;  3EG0 A;  1N5Z A;  3FJ5 A;  3QKJ A;  4II1 A;  3VS6 A;  2QTX A;  2HEQ A;  4F14 A;  2PK2 A;  4LNP A;  4BCM B;  4EMH A;  1YIJ A;  1K0S A;  5KYU B;  2KRM A;  5GAN j;  3G33 B;  2F2X A;  2P0K A;  3P8D A;  1ABO A;  2QYZ A;  4EOL B;  4AFZ C;  2CP2 A;  1KXU A;  2KRS A;  4M7A C;  4EOS B;  4RMO A;  4HCC A;  4RTW A;  2VV5 A;  2AZS A;  2GTO A;  3SFM A;  1M90 U;  2PTK A;  1I4K 1;  3JCM V;  1ARK A;  5CQY A;  2E10 A;  4J9B A;  3OQ5 A;  4CFM B;  1NYG A;  3VS5 A;  2ZZD B;  1YWO A;  2WMB B;  2KSS A;  1GFD A;  1U8R A;  3UT1 A;  2DK3 A;  1QVF S;  4M4Z A;  3TEE A;  2KYM A;  3QUI A;  5A2Q E;  1Q86 U;  4J9F A;  2LX7 A;  4C5G A;  1GBQ A;  1WXB A;  3UAT A;  4LDU A;  2V8K A;  3ZFJ A;  3WVD B;  3ASK A;  3X25 B;  2CZ1 B;  2PU9 B;  2CSI A;  3OYC A;  3CC7 T;  3ME9 A;  5GAN d;  3A98 A;  3QSU A;  3I9Q A;  3MIA B;  1M1F A;  5CKH A;  1FIN B;  4HXJ A;  3DLM A;  5FW9 A;  3CD6 A;  2RK1 A;  3INZ A;  2K3X A;  2QG9 B;  3T9N A;  3JB9 H;  4QQG A;  3OW2 S;  1G3S A;  2EQK A;  3CCU Q;  3JCM J;  2MK5 A;  1QMC A;  1AD5 A;  4JRI A;  3OYI A;  2WIP B;  2JXB A;  5I11 A;  1OEB A;  3HKS A;  5IDN B;  3PO3 S;  4UN0 A;  3TRE A;  1TTH B;  1H1Q B;  4Y92 A;  4BCM D;  3OYD A;  1KSW A;  3H41 A;  4Y72 B;  2DXT A;  1QP3 A;  1RAI B;  3CC2 A;  2QGG A;  2CP6 A;  3R6O A;  3DB3 A;  4KH1 B;  1GRI A;  2CP7 A;  2X51 A;  1G3Y A;  4F6S B;  4PFP A;  1YIJ T;  2A7Y A;  1W1F A;  2OX7 A;  4F7U B;  4BDZ A;  4FW2 A;  2K4Y A;  4OP0 A;  2JZ2 A;  3HPW A;  4OGR B;  4CFU D;  2BE7 D;  1AVZ C;  2V8I A;  1BU2 A;  8AT1 B;  1N8R C;  1W70 A;  3CCE T;  4PFO A;  4M7A G;  1VUB A;  2CT4 A;  3M0Q A;  3V8K A;  2QAS A;  2E6Z A;  2HD0 A;  1U1S A;  2DXB A;  3IQL A;  2QDY B;  1WQ7 A;  1UB4 A;  2K5F A;  2OTJ Q;  1OPL A;  2B86 A;  2LJ0 A;  1VQ5 Q;  1S72 A;  4JLI A;  1H8K A;  4FCY A;  1E9H B;  1KIK A;  4HKE A;  1I8F A;  2LVM A;  2V22 B;  2KAF A;  2DXB B;  3UF4 A;  4E2F B;  2FPD A;  5HY6 A;  2GFA A;  4HCK A;  4F70 B;  2EYW A;  4RTY A;  1OU9 A;  1SSH A;  4IUT A;  3JCM b;  1TH7 A;  2BE9 B;  1YJ9 A;  3KBG A;  2OTL Q;  1M90 R;  4PJO A;  2EYZ A;  2GBQ A;  1QQJ A;  2DZ9 A;  3JB9 D;  1R0C B;  2UUE B;  5DLQ E;  1QWF A;  2IVX A;  1M2V A;  4KUI A;  3EG9 B;  5FLX E;  5FGK B;  2MAM A;  3RKW A;  4C8Q F;  2W96 A;  4YC3 B;  2RK2 A;  1WFW A;  1UEC A;  2JTM A;  4C8Q G;  3PVL A;  1GCQ C;  4L59 A;  3HL8 A;  5KYX B;  2D8H A;  1Q7Y R;  4FM4 B;  1VQN T;  2D0N A;  4KGZ B;  3NFC A;  1UHF A;  2IPO B;  1YNZ A;  1GBR A;  5EJC A;  2FHD A;  1Y0M A;  2YDL A;  4AI6 A;  4A4K A;  3OBY A;  1KHC A;  5GAN 6;  1OV3 A;  4A53 A;  5GAN g;  3JCM h;  3ZL7 C;  3CCJ Q;  4WCI A;  4J7F A;  1FMW A;  2EYY A;  1BYM A;  3H6Z A;  2HBW A;  4EMK A;  1OIU B;  1Z9Q A;  2QQR A;  3CCL T;  1VQN A;  2LDM A;  5LJ5 j;  4CC4 B;  1WJQ A;  1H1P B;  4JRP A;  2QQS A;  3BG3 A;  4ELL A;  3QG1 A;  1Q86 C;  3VYH B;  3ER0 A;  1M2O A;  3NGP A;  2IW6 B;  4ZTJ A;  3GF5 A;  2BS4 A;  2CYZ B;  2YWW A;  1ACM B;  3M0S A;  4Z89 A;  4QSH A;  3V7S A;  5BNJ B;  5FU7 C;  1VQ9 A;  1I81 A;  4R55 A;  5HNB B;  3TNW B;  5CKF A;  3LGF A;  2RJF A;  3CCM T;  4DEX A;  4CFV B;  1JJ2 A;  4XK8 E;  1Y71 A;  2VGM A;  1RAH B;  1VQK A;  1WQW A;  3BY7 A;  4PJM A;  2HCK A;  3J80 E;  2MI6 A;  2MMP A;  3DJB A;  4PJO F;  3M55 A;  4PLI A;  1K9M R;  4IKF A;  2AIR B;  2AK5 A;  4RCC A;  1VQM Q;  1S72 T;  1QKW A;  2X3W D;  4C8Q A;  3CPW S;  1VQO A;  5LJ5 g;  2QA4 A;  2EJ9 A;  2DLP A;  1G5V A;  1K0X A;  3RMQ A;  5IAY A;  2DA9 A;  2YUP A;  1AWJ A;  4LXC A;  2EJF A;  2P0P A;  2X3X D;  4FYV B;  4M77 E;  1K9M C;  2DEU A;  1PM3 A;  4AFQ C;  3L2Q A;  5M9O A;  4C0F A;  2DL8 A;  4ROD A;  1M1K U;  1PKT A;  2KQW A;  1KC8 C;  4OB2 B;  3A8M B;  4B6M A;  4F17 A;  4FX3 B;  2EYX A;  4WF2 A;  4CRL B;  4JX4 A;  2A0F B;  1UUE A;  2KT8 A;  3CQT A;  4Y91 A;  3HZJ A;  3S3M A;  4EON B;  3EHQ A;  5HBJ B;  4FU6 A;  4Q5W A;  3JCM X;  3S3O A;  3M0T A;  4GLM A;  4DBH A;  1XJW B;  5FWC A;  1X6O A;  2OTJ A;  3QYG B;  1VOM A;  3PMT A;  2ZPG B;  2FL7 A;  2C5X B;  3KUF A;  2I40 B;  4OMM A;  2VGN A;  3OBW A;  4ORZ A;  2LZ6 B;  2IW8 B;  2H3E B;  2LQW A;  2Y4Y A;  4IUU A;  5LJ3 d;  2DXU A;  5LJ3 j;  3M0P A;  4F7S B;  2G6F X;  1MUZ A;  1I5L A;  1PRM C;  2JNG A;  2UZE B;  3D7S B;  1QLY A;  2V1R A;  1X69 A;  4D8K A;  3TQ7 P;  2I53 A;  2JW4 A;  2ED1 A;  4F7U G;  1G2B A;  1UNG D;  2E5K A;  2HQE A;  1O75 A;  3P8H A;  4AG1 C;  1GUX B;  4BI8 B;  4CFU B;  3MPU B;  3LWH A;  2VWF A;  3CCQ A;  1TD6 A;  4RG8 A;  1I0C A;  2LTO A;  4C8Q B;  2AKK A;  1GL5 A;  1QVF A;  3CD6 Q;  1WA7 A;  1Q7Y C;  4AKG A;  1NPR A;  3EGX A;  4BY6 B;  3V8L A;  3GLX A;  1T3S A;  3MJX A;  4IUV A;  1D1B A;  4TVR A;  3VUB A;  2FZC B;  1QCF A;  4X1V A;  4EOO B;  8ATC B;  4E7L A;  4RTX A;  4NL3 A;  3JV3 A;  2KK4 A;  1JXO A;  1YJ9 Q;  2R7G A;  3BLQ B;  3QWY A;  4M77 F;  2VB6 A;  3I55 A;  1H3H A;  2LCL A;  1FYN A;  5J39 A;  1XQH A;  3PVQ A;  3CCU T;  4DA4 A;  5GAN 3;  2YLC A;  3Q1J A;  5D7U A;  4E7I A;  5CR2 A;  1M90 C;  1N8R U;  1D3B B;  3G6E Q;  4KRT A;  2DTI A;  4M78 F;  4D6W A;  1ENW A;  1W98 B;  1YCY A;  1W2B A;  4M7D B;  2EYQ A;  4ME7 A;  4C8Q D;  2F2C A;  1P5E B;  2KE9 A;  2L3Q A;  2JJ9 A;  2KXC A;  3G1J A;  3HBL A;  2X4Y A;  2K57 A;  3MEW A;  1X2K A;  5KE3 A;  2DE0 X;  2DTO A;  3JCM d;  2OAU A;  1PKS A;  2BZ8 A;  1GXI E;  2DBM A;  2DKG A;  2F5T X;  4C92 F;  1FMK A;  2CP0 A;  5KYW A;  3CCE Q;  3H0F A;  2JOY A;  2E64 A;  5CYI B;  2BZY A;  2DL7 A;  2DFU A;  4OMP A;  1VQK Q;  4M77 D;  2PZ1 A;  2O88 A;  1WYX A;  1K9A A;  3CC7 Q;  1WXT A;  2WSC E;  2A08 A;  4BDY A;  4BD3 A;  5GMK j;  2O4X A;  4BE1 A;  1KQS A;  1UG1 A;  1RAE B;  4QQ6 A;  2QGS A;  1ZP2 A;  3CCS A;  2RN8 A;  2EGC A;  1W2B P;  5ECA A;  5L23 A;  2PVD B;  3M0U A;  2UZD B;  1O9S A;  2LT4 A;  3MY1 B;  2JM9 A;  1KD1 C;  2RI5 A;  2SRC A;  3DDQ B;  1WIE A;  2DJQ A;  3H9N A;  2J6F A;  3K7A M;  4C8Q C;  1HXD A;  4I3Z B;  4X34 A;  2J05 A;  3CCL Q;  5DQW A;  1I5O B;  3EFO B;  4M75 B;  1Q82 C;  3M9Q A;  4EMK C;  1UJY A;  3L1A A;  4ROC A;  1VQP Q;  3JCM Q;  4II5 B;  4M78 C;  4M77 A;  4R0K A;  4CC3 A;  4BCG B;  3H8Z A;  3RIR A;  2L3P A;  2C0T A;  3OYG A;  3ULR B;  2RQW A;  2HAX A;  2IG0 A;  1U06 A;  1OGU B;  1M3A A;  1RLP C;  1YN8 A;  3CEY A;  2EWN A;  3QHW B;  4FYY B;  2R5M A;  1OYX A;  2NUT B;  5GMK e;  1WDX A;  4Y28 E;  3NTK A;  3CXC A;  4M7D C;  4BCN D;  4ZGE B;  1IB8 A;  2KMT A;  1VQ4 A;  4OR5 B;  2JGZ B;  1U5S A;  2WSE E;  1AZG B;  2K6D A;  2L3S A;  2QA4 T;  2KBT A;  4DBF A;  1YHQ Q;  3A8G B;  4VUB A;  2GNC A;  2RJC A;  3QYB A;  2FZK B;  3VJP A;  3NHN A;  3C12 A;  3AHU A;  2B9R A;  1XNI A;  1A0N B;  2XU8 A;  5HK3 A;  1PNJ A;  1M27 C;  2OAW A;  3NTI A;  3BG9 A;  2PK9 B;  4NOY A;  1VQL A;  1PD1 A;  3OYL A;  2KMG A;  2QK0 A;  1LCK A;  5LJ5 e;  1U3O A;  3JB9 F;  1EX4 A;  2PVG B;  2ECZ A;  4N0A A;  2QI2 A;  1Q81 R;  3NDQ A;  2RHX A;  2QGF B;  4QW2 A;  1PSF A;  2VKN A;  1VQM A;  2YRC A;  4LDY A;  4F7U E;  3EG9 A;  2EIF A;  1TUG B;  5GAN e;  3S6W A;  4F7N B;  3VYG A;  4JJD A;  1V29 B;  5IHY A;  1H26 B;  3TNH B;  4ZTF A;  3B57 A;  3EFR A;  4RTT A;  2XDB A;  1SHF A;  4XTU A;  2LNH B;  1NYF A;  1YI2 T;  2WMA B;  2HKN A;  5GAN 7;  5GAM e;  5GAN 2;  2E12 A;  5GJW B;  4M6V A;  5FRN A;  2J06 A;  4M75 E;  2CP5 A;  2FG0 A;  4C5E A;  1TU0 B;  3OYY A;  3VU3 C;  1M8V A;  2EQJ A;  5DLO A;  3VUZ A;  5GAO p;  4UC4 A;  4ZGJ B;  1IXD A;  1KFZ A;  4JS4 A;  2DIL A;  3M5A A;  4FSX A;  3E9F A;  4MZP A;  4RTU A;  4M7D F;  2K3B A;  4M77 G;  3GNG A;  3CC4 T;  1OX8 A;  2DZC A;  2BIV A;  1AWO A;  2RI3 A;  3BW1 A;  1Q82 U;  3TU4 K;  2W10 A;  1UHC A;  1AZE A;  4KGV B;  5LJ3 h;  4LUE A;  1RAD B;  1C6V X;  3GBQ A;  2DL5 A;  4OB3 B;  5AT1 B;  2QEX A;  3VS0 A;  4BXX X;  2LQK A;  4A63 B;  5KH6 A;  2K9G A;  4F04 B;  3X20 B;  3I55 Q;  3TNI B;  2CZ0 B;  2QTV A;  1MGQ A;  3CME T;  1SRL A;  1X27 A;  3CC4 A;  3QZ9 B;  3GNF B;  4AKI A;  1EZZ B;  3BHV B;  2ZPI B;  1JEG A;  2RF0 A;  3DLL A;  2WIH B;  2WSF E;  3NTH A;  3OA6 A;  2J6K A;  2XDP A;  4Z8A A;  5FU6 B;  3BE3 A;  2RPN A;  2E5Q A;  3CCS Q;  5LJ3 g;  4KGX B;  1JB0 E;  3HRS A;  2VAS A;  2LCS A;  2AKL A;  1OKW B;  1FMV A;  1OZ2 A;  1UDL A;  1VIN A;  1RAB B;  3O8V A;  2BZX A;  2NUP B;  2D0Q B;  3CCS T;  3CME A;  4BI4 A;  3JCM g;  1WXU A;  1HSQ A;  3MEA A;  3V7R A;  1VQP A;  3CBM A;  4HT9 A;  4BCK B;  3A5Z B;  5D6X A;  2FPE A;  1D0Z A;  2LJ1 A;  1ZUY A;  5KYN A;  1JJ2 P;  2RHI A;  1RAA B;  1HJD A;  2GCX A;  1N9S A;  2DD5 A;  2LCC A;  3RGF B;  2YUN A;  2QDL A;  5C6S A;  4XU2 A;  1OPK A;  4PNO A;  1O9K A;  4EOP B;  4BCQ D;  4PJO B;  3FRN A;  1NEB A;  4C92 G;  4AT1 B;  4J7I A;  4M77 C;  4JUV A;  1H27 B;  4JRK A;  1D1C A;  3G6E A;  1X43 A;  4XTX A;  3OYE A;  2X4J A;  3SEM A;  3EGU A;  4B9W A;  3QZ5 B;  1TUD A;  1ZX6 A;  4C8Q E;  1PWT A;  1MV3 A;  4BCN B;  1Q82 R;  1U1T A;  1OX9 A;  5A0D A;  4N4H A;  1VQ6 Q; 
#chains in the Genus database with same CATH homology
 2RJE A;  5C0M A;  2IVW A;  1WGS A;  2HQX A;  3HRU A;  4WF2 A;  4BE2 A;  1NJI C;  4JX4 A;  2RI2 A;  2LNV A;  3L2U A;  1VQM T;  2DD4 A;  3QJ6 A;  4NL2 A;  3QYH B;  1BIA A;  2VC8 A;  3HZJ A;  4Y91 A;  2AHJ B;  2JTF A;  1LOJ A;  4FU6 A;  4Q5W A;  3JCM X;  3S3O A;  3S3M A;  2OTL T;  2LRQ A;  1BI3 A;  2D9T A;  5CKB A;  3OS0 A;  1D3B A;  1H3Z A;  1KQ1 A;  2OTJ A;  1X6O A;  3CCU A;  3QYG B;  1B34 B;  3PMT A;  3RMS A;  4MDX A;  2ZPG B;  2FL7 A;  3QJY A;  3KUF A;  5I2S A;  3MCA B;  2VGN A;  3OBW A;  1YJW A;  3UPU A;  2LC4 A;  2Y4X A;  5L8R E;  4HNT A;  4HNV A;  3CCV A;  1VQ7 T;  2Y4Y A;  4NS5 A;  3CCJ T;  4IUU A;  3VYG B;  4QQD A;  5LJ3 d;  4C92 D;  2ZPF B;  2DXU A;  1VQ5 T;  3SWN B;  5A0L A;  1Y96 B;  5LJ3 j;  4M75 C;  4N4G A;  3JCM e;  4GLK A;  2I2L A;  3OSS C;  4E47 A;  4E7H A;  4Z02 A;  3I55 T;  3HO8 A;  3OYH A;  2CZ6 B;  4F7U A;  1VQ4 T;  4JLG A;  3DB4 A;  2EJG A;  3CMA A;  1I5L A;  2O4X B;  2RHZ A;  2DIG A;  2JNG A;  3OSV A;  4J83 A;  3PGG A;  1ZQ1 A;  4C5I A;  3M58 A;  4M75 G;  3JCM W;  2C06 A;  4C0D C;  4M7D A;  5CIU A;  1N6A A;  3BG5 A;  3CCR T;  3M57 A;  4X9D A;  4XQ3 A;  3JB9 G;  4XU1 A;  1VQK T;  3FIF A;  1JRI A;  1G3W A;  3CBO A;  1M1G A;  4PL6 A;  3SWN A;  4F7U G;  3LW5 E;  4M78 A;  2KR6 A;  1VQ7 A;  4OMF B;  2L5Q A;  3G4S T;  1Q7Y U;  3A8O B;  5GAM g;  2QEX T;  1FXX A;  2L3R A;  2HQE A;  1O75 A;  3P8H A;  3JCM P;  3ZEH A;  1YJW T;  1RI0 A;  2K3Y A;  2XHC A;  1VQP T;  4BI8 B;  2G77 A;  3F70 A;  3HRT A;  5GAO q;  4B9X A;  2RHY A;  2XI9 A;  3LWH A;  2O01 E;  4J5Y A;  4MML A;  5CO7 A;  1NPP A;  3OYJ A;  3CCQ A;  2BUD A;  4RG8 A;  5J3B A;  3CPF A;  5GAO r;  5DM7 R;  1HK9 A;  3OS1 A;  4J6X A;  4PJO E;  2LTO A;  4C8Q B;  1KHI A;  1YIT T;  4XAX B;  4IUR A;  4N0A C;  1QVF A;  4M7D D;  3M4Y A;  3QBY A;  4XTV A;  3DL1 A;  4C0G A;  3QO3 A;  1VQ9 T;  3PTA A;  1Q7Y C;  1Y96 A;  4PJO C;  4AKG A;  1NPR A;  1M9S A;  2ZZD A;  4BY6 B;  1VQO T;  2XD0 A;  4XU0 A;  3V8L A;  3GLX A;  3LLR A;  3L2Z A;  4M77 B;  2RD1 A;  4OVA A;  1W4S A;  4JRQ A;  2YRV A;  1K8A U;  4QVD A;  3WVE B;  2MF2 A;  2EKO A;  4IUV A;  3E9G A;  3L2R A;  4TVR A;  3RES A;  3VUB A;  4NC6 A;  3OYA A;  1Y07 A;  2E65 A;  4E7L A;  2BKD N;  2DAQ A;  4NL3 A;  4HCB A;  2KK4 A;  2X35 A;  5GAM h;  3CCR A;  2A3L A;  4A4E A;  4EMG A;  4GY5 A;  4M77 F;  4JS5 A;  2WAC A;  4MMK A;  3PMI A;  5CK9 A;  3FLG A;  3A8H B;  4ELJ A;  3I55 A;  2E41 A;  3E1S A;  3EFS A;  4M78 B;  3M54 A;  2DIQ A;  2BS2 A;  2R58 A;  4JX5 A;  2RO0 A;  4M75 D;  1VQ8 T;  2G3R A;  2LCL A;  3LH0 A;  4P5N A;  4M7A E;  5J39 A;  3CCU T;  1XQH A;  4BUG A;  3GPL A;  4DA4 A;  4M78 G;  3JB9 J;  4FIB A;  5GAN 3;  1KG1 A;  2YLC A;  4BBR M;  1M4Z A;  3Q1J A;  2XK0 A;  4N4I A;  3SD4 A;  5LJ5 d;  5CR2 A;  1QW1 A;  1D3B B;  4MZT A;  3GP8 A;  1N8R U;  4F7U F;  3QDR B;  4J8O A;  4RKU E;  2MWO A;  5GAN f;  1KC8 U;  3FDR A;  4M7D G;  1QVP A;  5FRM A;  2DTI A;  1VIE A;  4A54 A;  1YJN T;  4FT2 A;  4M78 F;  4KUL A;  2KDS A;  3JCM f;  4D6W A;  1QP2 A;  2D6F A;  3PIP A;  1H64 1;  1YCY A;  1W2B A;  2HNI A;  4M7D B;  2EYQ A;  1YHQ T;  1W2B S;  2DXC B;  2OTJ T;  5GAM f;  4ME7 A;  3G4S A;  4C8Q D;  1YHQ A;  1KQ2 A;  1QVG A;  4KT0 E;  2R57 A;  3QWL A;  1YBY A;  4OGC A;  2B8A A;  3KXT A;  3QXE B;  4OB0 B;  1N9R A;  3OB9 A;  3HBL A;  1E7P A;  2X4Y A;  2K57 A;  3QKJ A;  3C94 A;  2DO3 A;  3MEW A;  4II1 A;  5KE3 A;  4JJN K;  1VQ8 A;  2DTO A;  3OYM A;  3JCM d;  2OAU A;  2QTX A;  4XTZ A;  5GAM j;  2PUO B;  3PNW C;  1P92 A;  1OZ3 A;  4C5H A;  3E19 A;  1VIF A;  2DVE A;  1GXI E;  5IT9 E;  2DKG A;  3UDC A;  1SSF A;  1BKB A;  2F5T X;  3M56 A;  1LJO A;  4ELZ C;  4C92 F;  3L2V A;  4EMH A;  1YIJ A;  2JN0 A;  2YHT A;  3GOX A;  1QLB A;  2JOY A;  4C0D B;  2E64 A;  2P0K A;  5GMK i;  1UGS B;  3P8D A;  5GAN j;  2VXF A;  5FU7 B;  1K9M U;  4LD9 K;  3RKX A;  2F5K A;  4M7A C;  1EIF A;  1UGR B;  4ATO A;  1Y7X A;  5CCA A;  1IRE B;  4M77 D;  3X24 B;  4RMO A;  2P4T A;  3VV0 A;  4RG2 A;  1WPY A;  4HCC A;  2R5A A;  2L89 A;  2VV5 A;  1MHN A;  4HA8 A;  3SFM A;  1M90 U;  2K5L A;  1YJN A;  5I21 A;  2WSC E;  4MFE A;  1I4K 1;  1N27 A;  3LX7 A;  2XIC A;  3JCM V;  5CQY A;  4BDY A;  4BD3 A;  5GMK j;  2GFU A;  2O4X A;  3P8B B;  2E10 A;  4BE1 A;  1KQS A;  3OQ5 A;  2JVV A;  4LD6 A;  3CXC S;  2ZZD B;  3OS5 A;  2KSS A;  1U8R A;  5GAO n;  4CRI A;  4QQ6 A;  1AHJ B;  3CCS A;  3UT1 A;  2DK3 A;  3CCJ A;  1QVF S;  3TEE A;  4PJO G;  3QUI A;  2LQ8 A;  5A2Q E;  1Q86 U;  3JB9 I;  3I56 T;  4LDX A;  2WJ9 A;  4ZGD B;  2RA2 A;  3BDL A;  2ZPH B;  4C5G A;  5D6Y A;  3J81 E;  4LDU A;  2FYK A;  2PVD B;  2V8K A;  3ZFJ A;  3WVD B;  1O9S A;  4XTY A;  2LT4 A;  3ASK A;  5CKD A;  1KD1 C;  3X25 B;  2NLU A;  2RI5 A;  2CZ1 B;  4MFD A;  2PU9 B;  2ZPE B;  4QVZ A;  5AYF A;  3MEU A;  3BFM A;  3OYC A;  3CC7 T;  5GAO m;  3ME9 A;  1FX7 A;  1Q81 U;  4C8Q C;  1HXD A;  5GAN d;  1QVG S;  4Z6Y A;  2E6N A;  5GMK l;  4X34 A;  3QSU A;  1M1F A;  5CKH A;  4DOV A;  2DPP B;  1K73 C;  4XU3 A;  3WXM B;  2QFZ A;  3I56 A;  4M75 B;  1Q82 C;  2M0O A;  3DLM A;  3M9Q A;  4LDW A;  4M78 D;  4EMK C;  3CD6 A;  3L1A A;  2RK1 A;  3OS2 A;  3INZ A;  2FB7 A;  2K3X A;  3JCM Q;  3RER A;  2M16 A;  3C95 A;  4M78 C;  3T9N A;  4M77 A;  2QQ9 A;  4QQG A;  5FU6 C;  5GAO p;  3LWI A;  3OW2 S;  3JB9 H;  1G3S A;  2EQK A;  4HCZ A;  4A4F A;  4JRI A;  2K5I A;  3OYI A;  3JCM J;  3H8Z A;  3RIR A;  4MIM A;  3TW7 A;  3OYG A;  2XID A;  4EPC A;  4OF1 A;  5IN1 A;  2RB6 A;  2X4X A;  3HKS A;  4J6W A;  2PUK B;  3TRE A;  2HAX A;  2IG0 A;  3M53 A;  5HK0 A;  2EFI A;  2RH2 A;  5A0G A;  3OYD A;  4ELY C;  3G71 A;  2CKK A;  4JDS A;  3MET A;  3H4C A;  2VYT A;  2DXT A;  1QP3 A;  3CEY A;  1B34 A;  3CC2 A;  2EWN A;  3LYI A;  5KE2 A;  3S3N A;  4PKC C;  3R6O A;  2YLB A;  3DB3 A;  2R5M A;  3JAM E;  1G3Y A;  1OYX A;  4DQ2 A;  1YIJ T;  5GMK e;  2A7Y A;  4Y28 E;  4F7U B;  3NTK A;  3CXC A;  4BDZ A;  4M7D C;  2KMT A;  4ZGE B;  2K4Y A;  3BDU A;  4OP0 A;  3OW2 A;  1VQ4 A;  2JZ2 A;  3MP1 A;  1UEB A;  3HPW A;  3MP6 A;  2DEQ A;  5GAN 8;  2WSE E;  1BI2 A;  2V8I A;  1N8R C;  3PFS A;  4OB1 B;  2QA4 T;  4E7J A;  3CCE T;  5FRO A;  3HB9 A;  4M7A G;  1VUB A;  3V8K A;  3A8G B;  2HBP A;  4O6J A;  2E6Z A;  3QII A;  4VUB A;  2QXF A;  1G3T A;  2GF7 A;  2HD0 A;  2RJC A;  3QYB A;  1U1S A;  2DXB A;  3VJP A;  4EMK B;  3G6E T;  3C12 A;  3AHU A;  2K2V A;  3CMA T;  3HSB A;  2QDY B;  2QDJ A;  2RHU A;  1WQ7 A;  1UB4 A;  1XNI A;  2GQV A;  5CKE A;  1M5Q 1;  1X75 C;  4C92 E;  2XU8 A;  3FEO A;  5HK3 A;  2K5F A;  3VKI A;  3NTI A;  3BG9 A;  4HT8 A;  3V7C A;  4C92 B;  4NOY A;  5GMK m;  3OYF A;  1S72 A;  2JUF A;  4JLI A;  3FJP A;  1VQL A;  3X26 B;  1NZ9 A;  3OYL A;  2KMG A;  4HKE A;  1FWZ A;  1I8F A;  3JRZ A;  2LVM A;  2KAF A;  2DXB B;  4FL6 A;  4MDW A;  3PIO A;  1VQ6 A;  5LJ5 e;  3JB9 F;  3HFN A;  2L8D A;  3DKM A;  2PVG B;  3OMC A;  3FC3 A;  4LDV A;  2XG8 D;  2QF7 A;  5HY6 A;  2GFA A;  4N0A A;  4E7K A;  2QI2 A;  4CI0 C;  3OYK A;  4YTL A;  2RHX A;  1JBM A;  4QW2 A;  4BB7 A;  4IUT A;  1PSF A;  3JCM b;  4HLQ A;  1TH7 A;  2RJD A;  3KBG A;  5D6W A;  3CCM A;  1YIT A;  2XDD A;  3V8J A;  1YJ9 A;  3N5B B;  1VQM A;  3HHT B;  4LDY A;  4F7U E;  3A8L B;  1WJS A;  2EIF A;  5GAN e;  3S6W A;  3VYG A;  4PJO A;  1V29 B;  4ZN3 A;  3JSC A;  3MP8 A;  2DZ9 A;  3QHS A;  1JJ2 S;  4L6V 5;  3ZBD A;  4AKH A;  2XKO C;  4C92 C;  3JB9 D;  2FVU A;  3EFR A;  3G71 T;  4KBM B;  4ZTF A;  1VQ6 T;  5DLQ E;  4XTU A;  1YI2 T;  1KD1 U;  2CS7 A;  2XDB A;  5GAN 7;  3TCJ A;  1UGQ B;  5GAM e;  5GAN 2;  2E12 A;  4HL4 A;  2KY9 A;  4KUI A;  5FLX E;  4R56 A;  2MAM A;  4E7I A;  3RKW A;  4M6V A;  4C8Q F;  4OGE A;  5FRN A;  3X28 B;  4M7D E;  4M75 E;  5HKC A;  3RKY A;  5KCO A;  1IZ6 A;  2RK2 A;  1Q81 C;  4C5E A;  5KCH A;  2KVQ G;  3TW6 A;  2EQU A;  2JTM A;  2X4W A;  3G7Z A;  4C8Q G;  3SB2 A;  3CCV T;  3OYY A;  3VU3 C;  1M1K C;  2EQJ A;  5DLO A;  3VUZ A;  4L59 A;  3VKG A;  3HL8 A;  4ZGJ B;  4BBS M;  4UC4 A;  5CQX A;  5LJ3 f;  4BI3 A;  4FM4 B;  3CBP A;  4QVC A;  4BAC A;  1VQN T;  4JS4 A;  3M59 A;  4M75 F;  1NJI U;  3M5A A;  4FSX A;  3E9F A;  4MZP A;  4MZM A;  3RUX A;  3OMG A;  3MHX A;  3GNG A;  3NFC A;  4IUQ A;  4M77 G;  2DZC A;  4C0Z A;  3CC4 T;  2BIV A;  4KUD K;  5EJC A;  2FHD A;  2RI3 A;  3BW1 A;  1LNX A;  2CGH A;  4AI6 A;  4A4K A;  1Q82 U;  3OBY A;  1KHC A;  1FKM A;  3FB9 A;  5GAN 6;  3TU4 K;  1YJ9 T;  4A53 A;  5LJ3 h;  2ZPB B;  5GAN g;  3EAE A;  3HFO A;  2QQB A;  2VXE A;  3JCM h;  4C92 A;  1YI2 A;  2QEX A;  4OB3 B;  5LL6 S;  4J7F A;  2PQW A;  2LQK A;  4L5G A;  5KH6 A;  2DTH A;  1BYM A;  1RL2 A;  2QQA A;  2V8J A;  3X20 B;  4M7D F;  2QQ8 A;  3H6Z A;  2CZ0 B;  2ZCF B;  3CCE A;  4J6Y A;  1MGQ A;  4EMK A;  3CME T;  4LOC A;  4M7A D;  3L42 A;  5I2M A;  2QQR A;  3CC4 A;  5J26 A;  3QZ9 B;  3GNF B;  3CC2 T;  4AKI A;  3CCL T;  1VQN A;  2LDM A;  4ZN1 A;  5LJ5 f;  1OI1 A;  4PLL A;  5LJ5 j;  5LJ5 h;  2ZPI B;  2E70 A;  3OY9 A;  1WJQ A;  4FT4 A;  4EDU A;  3QPH A;  4JRP A;  2DJZ A;  3DLL A;  5LJ3 e;  2PVO B;  2EQM A;  5DY9 A;  2QQS A;  3BG3 A;  3SWN C;  2H3J A;  2WSF E;  3QG1 A;  5GAN h;  1Q86 C;  4BE0 A;  3VYH B;  3ER0 A;  3NTH A;  1ZBX A;  4DOW A;  3CCQ T;  3CD6 T;  3J7A F;  3OA6 A;  2XDP A;  5FU6 B;  2VUB A;  1K8A C;  4ZTJ A;  1R8O B;  1WJR A;  2BS4 A;  2E5Q A;  1XTD A;  2CYZ B;  3GF5 A;  4RCB A;  5LJ3 g;  1JB0 E;  3HRS A;  3OYN A;  4QSH A;  1XOV A;  3V7S A;  1OZ2 A;  5FU7 C;  3CPW A;  1VQ9 A;  4BY6 C;  3O8V A;  1I81 A;  4R55 A;  2D0Q B;  2LT1 A;  4HNU A;  3CCS T;  2F69 A;  3MO8 A;  3CME A;  4V2S A;  4BI4 A;  5CKF A;  3CC7 A;  3JCM g;  3LGF A;  3VKH A;  1PSE A;  2RJF A;  3MEA A;  3V7R A;  3CCM T;  2BS3 A;  3HP9 A;  1VQP A;  1JJ2 A;  3CBM A;  3PT9 A;  2DD5 B;  1Y71 A;  1X01 A;  2VGM A;  3A5Z B;  3LGL A;  3KHI A;  4XK8 E;  5D6X A;  4A4G A;  5GAN 5;  1VQK A;  1WQW A;  3L2W A;  3BY7 A;  2RHI A;  3M4G A;  3J80 E;  1WNL A;  2DXC A;  2MI6 A;  2P0Q A;  3OYB A;  3CCL A;  3QYE A;  2MMP A;  2GCX A;  5GAN 4;  4PJO F;  2E1H A;  4JX6 A;  3MEV A;  5GAM d;  1KQS S;  1N9S A;  5GMK h;  4M78 E;  2DD5 A;  2EAY A;  1UGP B;  4M7A F;  3M55 A;  4PLI A;  5GAO l;  3JCM c;  2LCC A;  2OTL A;  4IKF A;  5C6S A;  3SDZ A;  4RCC A;  4X9C A;  2Y90 A;  1BIB A;  2M9U A;  2ZGW A;  4PNO A;  4XU2 A;  3CPW S;  1S72 T;  4C8Q A;  1VQO A;  5LJ5 g;  3UWN A;  2QA4 A;  2EJ9 A;  1M90 C;  1K73 U;  3FRN A;  4PJO B;  3URG A;  1G5V A;  4C92 G;  3C4S A;  3RMQ A;  5EG2 A;  5IAY A;  4M7A B;  1M8V A;  2EJF A;  4J7I A;  2MWP A;  2P0P A;  2M1H A;  4M77 C;  4JUV A;  2DD4 B;  4JRK A;  4PJO D;  1NE8 A;  1VQL T;  4M77 E;  1K9M C;  3G6E A;  4HT9 A;  4M7A A;  4XTX A;  1DJ7 B;  5M9O A;  3OYE A;  3L2Q A;  4O5V A;  4C0F A;  2X4J A;  4M75 A;  1VQ5 A;  1M1K U;  3GIB A;  4A4H A;  2KQW A;  1BI1 A;  5CVI A;  4IUP A;  4B9W A;  3QZ5 B;  2RM4 A;  1ZHI A;  1KC8 C;  4C8Q E;  4OB2 B;  3A8M B;  2CZ7 B;  2LX9 A;  1BI0 A;  5CAI A;  1U1T A;  4XTW A;  5A0D A;  4N4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...