3A8GB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8gB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8gB02
1UGQB 4KT0E 2CZ7B 3X24B 2ZZDA 4OB1B 3VYHB 1QP2A 2WSFE 3QYGB 2ZPIB 1UGSB 3LW5E 3A8MB 2CYZB 2DXBB 2DD5B 2DPPB 3QZ5B 3HHTB 2AHJB 4ZGJB 2ZCFB 3X20B 2WSCE 1UGRB 2CZ0B 4OB3B 1GXIE 2ZPFB 4FM4B 3VYGA 2ZZDB 2PVGB 2DXCB 3QXEB 2ZPEB 4L6V5 2CZ1B 2ZPHB 2DD4A 2O01E 3X25B 3QYHB 4XK8E 3VYGB 3X28B 2WSEE 3X26B 2CZ6B 3QZ9B 3A8HB 1V29B 4OB0B 5L8RE 1IREB 3A8GB 2ZPBB 3WVDB 2PVOB 1PSFA 1DJ7B 2QDYB 2DD5A 2D0QB 1UGPB 2PU9B 1QP3A 2DXBA 3WVEB 4ZGDB 1PSEA 4Y28E 1AHJB 4OB2B 4RKUE 3A8OB 2ZPGB 1JB0E 2DXCA 3A8LB 2PVDB 2PUOB 4ZGEB 2PUKB 2DD4B
chains in the Genus database with same CATH superfamily
4EMHA 1H24B 2RQVA 3M53A 2J7IA 5LJ5e 4EC9B 3A5ZB 2WSFE 1VYWB 2I40B 1WIEA 1WXTA 1ZLMA 3GBQA 2VXFA 4A4GA 1FXXA 4BI4A 2MMPA 2QEXQ 4O6JA 2CJMB 2VVKA 1K8AC 2DXBB 3JV3A 4EMKB 1WQWA 2K5LA 3SDZA 2LP5A 4C5HA 1VQLA 2LT4A 5HK3A 4AI6A 1WZOA 4P5NA 4EDUA 3OYNA 1YI2Q 4QSHA 1FYNA 4Q5WA 3JB9J 2A28A 4J9HA 1WHJA 1RADB 3INZA 4JDSA 2KGTA 4FSSA 1RI9A 2O9SA 1D1AA 2JXBA 1G3SA 3UWNA 3LH0A 3GTMS 2OJ2A 3LWHA 4JRKA 4PFZA 2FVUA 4RUGA 1VQ9Q 4PJMA 1IB8A 4DA4A 2RJEA 3Q1JA 3LX7A 2K3YA 2V1RA 4GLKA 4E7KA 3QHRB 1T0JA 2KSSA 1NYFA 2HNIA 5KYNA 2CP7A 3QHSA 1D3BA 3CCLT 1RAAB 4BDYA 4KUDK 5GAMf 2ECZA 1YP5A 2QDYB 1UDLA 2MPXC 3CMEQ 3BG9A 2G6FX 3O8VA 5CKBA 1YWOA 2RD1A 1K73C 1UE9A 2C0OA 2DILA 3HTRA 1YITQ 3SB2A 4B9WA 4B6MA 2OX7A 3MP8A 3HKSA 2RF0A 2B8AA 2QGFB 3CMAQ 3G6ET 5LJ3f 1UNGD 3N5BB 5IF1B 1I0CA 2LCLA 1H26B 4QT7A 1MV0B 1NPPA 1JJ2S 1KQSP 2V8KA 3LLRA 5ECAA 2GCXA 4PJLA 3QO3A 3CCMQ 4DQ2A 2ZZDA 5KCHA 4J5YA 4J6YA 5KYXB 4C92B 3OYEA 1X2KA 4YTLA 2Y4XA 2DA9A 2FZCB 3CCSQ 5IXBA 1HYOA 4TTHA 5A2QE 1T0HA 4IUQA 1VQLQ 2RQWA 1KG1A 2CP5A 2R5AA 4FL6A 5CAIA 5GMKe 4IIMA 2BS3A 1J3TA 2GNCA 1WHLA 4RG2A 4JLGA 2RNAA 4ME7A 3BLRB 1M1KC 5KH6A 3CCQQ 4EONB 2QEXT 2QGSA 4XU3A 4M77B 3TSZA 1NBEB 1YN8A 3D7SB 2WEVB 1ZSZC 3X25B 1M90R 1VQ9A 1V76A 1JRIA 1M27C 4CRLB 2RH2A 3M57A 2Y90A 5A0DA 5GAN2 3HB9A 3ZBDA 4CC7A 4M7AG 2P0QA 4C8QC 2QFZA 2E4HA 2EVRA 4DBHA 3A8GB 2KAFA 4FSXA 2EJ9A 4JJNK 2DD5A 5GAOn 3I56A 3M59A 5KYYA 2EKHA 3OYCA 1BI0A 3CCVT 4WTOB 1M8VA 1YITA 2DBKA 4E2FB 5HNBB 3MEWA 4FYWB 3EG9B 2QA4Q 7AT1B 4XQ3A 2FG0A 3OYIA 4CC3A 3CC2T 3EGDA 1JBMA 2CREA 4E7JA 4A4EA 5HVYB 4EOSB 3VKIA 3CXCP 1PM3A 1UEBA 1M2VB 4IURA 4LDYA 4A4FA 1RI0A 4F7LB 1NPRA 1N9RA 2L3RA 1E6HA 4M78D 2MK5A 5GAMd 3CCMA 2X4WA 1QVGA 2X4JA 3EG1A 1ZUKA 1TG0A 3JCMf 2JM9A 1TWBA 2LQKA 2AK5A 1FMKA 2ATCB 4C92E 1VQPQ 2OTLT 2M0YA 3CCSA 2A36A 2EWNA 1OQKA 4F14A 3SWNA 3JCMb 2DM1A 1VQ5Q 2HEQA 3SWNB 3OBYA 3OYLA 4M7DG 2DJZA 3V8JA 1VYTA 3JCMX 3DLMA 4E47A 1E7PA 2UZEB 4F7SB 4EC8B 2E1HA 3HP9A 4I3ZB 2RJDA 2QDLA 1R0BG 2I53A 1XNIA 2JS2A 4IUTA 2EQUA 3VS2A 5GJWB 1NE8A 4HKEA 1UJYA 1XOVA 1OGUB 4D8DA 3KFVA 2DAQA 2DL3A 1JKWA 3M5AA 3REBB 5GANf 1WFWA 3MY1B 1OZ3A 2RB6A 4BACA 1LJOA 5A0LA 2X3XD 1KK7A 3I55T 3S3MA 1T3LA 1QQJA 1OV3A 3EG3A 2RI3A 1N8RR 3PVLA 4Z88A 3CQTA 2YUNA 2MOXA 2OI3A 4C5IA 2LC4A 4E7ZA 4J9EA 4M78B 5FRNA 2XD0A 5KYWB 4JJDA 2KYMA 5KCOA 2DXBA 1RAFB 2EYXA 4M77E 4BBRM 1PWTA 2CCIB 3QG1A 1FMVA 2LX7A 1B7TA 3OMCA 1B34B 4PLLA 3QSUA 5GANg 1IGUA 3H4CA 3J80E 1I07A 1QMCA 1ZP2A 3RKWA 2F1LA 4KGXB 4BCMB 4PJOE 3CCUA 3KXTA 4DBQA 1JU5C 1AZGB 3L2QA 2K4YA 3LYIA 2MI6A 2PQWA 3EJ1B 2DD4B 3KUFA 1NEGA 5IT9E 2RQTA 1NJIR 1WGSA 3RMQA 2CZ7B 5GANh 4ROEA 2RO0A 3BHUB 1JOWA 4GLMA 4QVCA 1AWOA 1WX6A 2DL4A 2P0PA 3I35A 4CFVB 1IGQA 2IIMA 2DX1A 1Q81U 4M7DC 2HMAA 2RA2A 2RQRA 2DF6A 4JPBW 4F6UB 3EIDB 4ZGJB 1Y57A 2LNHB 3G4ST 2DXUA 3E1SA 2J6KA 1MNDA 2EYWA 1Q7YC 3OYBA 3CPWA 4NSTB 3CCST 1H1RB 3CCET 2WACA 4BCND 2KMGA 2NUTB 5D6WA 2EGAA 3UDCA 2CZ1B 3M0TA 1U1SA 2C0TA 1F5QB 1OU8A 1YJNQ 1GL5A 2WJ9A 4M75A 4JZ4A 2D1XA 1O9KA 1P5EB 2JTFA 2M02A 2CZ6B 4PLIA 4BCIB 2ABLA 1PKTA 1SRLA 2FHDA 5FU7C 1Q86R 4JX4A 2PVOB 1K0XA 5I22A 3G6EQ 3VS4A 2LX9A 4M75D 2EQIA 5GMKj 5FU6B 4D8KA 1SKUB 1K73U 5M9OA 1RABB 3OW2P 1QP3A 2XDBA 1YITT 2FPDA 5FRMA 3OQ5A 3RR6A 4Y28E 1AHJB 2HQHA 4A63B 2GTJA 2YRCA 5D6XA 2WIHB 3QIIA 4Z8AA 3CCEQ 5GMKh 1R8OB 4KRCB 5A0GA 2PUOB 3JCMV 1BU2A 3I5RA 4ZN1A 1PCXA 4X1VA 2EPDA 4PJJA 1YCSB 5IN1A 4BE1A 1K1ZA 1WJSA 3M55A 4F7JB 3UF4A 5BNJB 3OYGA 1VQ6T 4EOOB 1GCQA 3T9NA 3CCRA 2L89A 3M0UA 3I55Q 2IW6B 4BD3A 3CXCS 3V7SA 5DQVA 3MP6A 2DD5B 4N0AA 3MHXA 3JCMP 1C0MA 3MEUA 2DKGA 2KE9A 3EFSA 4C8QE 3QPHA 1QCFA 3BDLA 4MMLA 1TTHB 4WF2A 2E6NA 1D1BA 1M3BA 2XKOC 8AT1B 2ZPFB 4AT1B 4UC4A 3CMET 2SEMA 5CIUA 2EYZA 4LUDA 1VQ4Q 2ROLA 2LJ1A 2YSQA 4YOSA 1YIJA 1VQLT 2K3XA 3EHQA 1RL2A 1OL2B 1VQKT 1KFZA 2KRMA 3ULRB 1Q81R 1QLYA 2O31A 3S6WA 4BY1X 3OSVA 3PIOA 3CC7T 3CMAT 3IQLA 4F04B 2YUPA 3OA6A 1MUZA 4JLIA 3QDRB 1KC8C 1H28B 2JOYA 4J9GA 5LJ3e 1H1SB 2FEIA 1QLBA 5L8RE 1W70A 1GUXA 1YJ9Q 1P92A 3G6EA 1NLOC 4AKHA 2JUFA 3LGLA 1WXBA 4M7DD 1YHQQ 3OW2A 2F5KA 4AFSC 4HVWA 3M0SA 3OY9A 1TS9A 2DLPA 1O9KB 3WVEB 1D0YA 1VQNQ 4F7UE 2R7GA 3EFOA 3FJPA 4FYVB 3CD6A 2RM4A 1MV3A 3VUZA 4Y72B 4XTUA 3JCMe 2HD0A 5EFQB 3CD6T 4BCGB 2VGMA 1H92A 5LJ5j 4C0ZA 1IXDA 1SRMA 3PMIA 4J6WA 2W9FA 2K2MA 1QWEA 2KRNA 3MJXA 4DBRA 2C5OB 5GAN6 5CQYA 1KHCA 2WHBB 2KEAA 1VINA 1RLPC 2DTIA 1KHIA 2QQ9A 4RTYA 4IKFA 2GGRA 4XTXA 2CUDA 2L3QA 1QP2A 3CCJQ 5J3BA 1WHHA 1N4MA 3LH5A 2W0ZA 4M78E 5D6YA 3V7RA 5EG2A 1UNHD 3CCRQ 4AKIA 2XDPA 1I4K1 1VQ8T 4EOPB 2PMIB 4M78G 2QQSA 2K6DA 1WYXA 2EJFA 2BZYA 1GUXB 4B9XA 3CC2A 1QW1A 3UATA 2JGZB 2H8HA 2HSPA 4X9CA 5GAOm 2ZCFB 5GAN7 4HCCA 2K7AA 4M6VA 4JJCA 3BLHB 2JZ2A 1S72A 4RTWA 1F1BB 4OP0A 2ZAEA 1VIEA 2CP3A 3FC3A 2DIQA 5HBJB 1VQ4A 4BCHB 2DXCB 2LCCA 3BG3A 2RPNA 5DLQE 1YIJQ 2C4GB 2ZPEB 3OW2S 1BK2A 4M7AC 1XTDA 2DZCA 3OS5A 2X51A 1K76A 4M77F 4HNVA 4ELYC 4YOOA 1RAIB 5LL6S 1TUDA 4PJNA 4BCKB 3X28B 1BI3A 1B07A 1G2BA 3OS1A 5DM7R 4XU0A 1VQ6A 2C5VB 1YHQT 4NC6A 3L2ZA 3J7AF 4WCIA 2ZPBB 2CT4A 1N9SA 2C5NB 1UGVA 4BCQB 1D1CA 1NEBA 2E12A 3BHVB 5FU7B 1I8FA 3G71Q 4EIKA 4BUGA 1AISB 2EBPA 4BI3A 1D0XA 4OGEA 2ED0A 2VB6A 3DB3A 3FDRA 1U5SA 4F6WB 1UECA 4M7DA 4M7DF 4PJOC 1PD0A 1YBYA 2G77A 1M1GA 1SSFA 2BKDN 2Y4YA 1BKBA 2E65A 5FWBA 2OTJA 3VV0A 1B3QA 3CCJT 2DXCA 1KSWA 2KNBB 3DB4A 3NTIA 4A4KA 3VS0A 3OYKA 4EOJB 1VA7A 4F7UA 3JCMJ 5L2WB 1NJIC 2EIFA 1E6GA 1WHKA 2OTJT 4BCFB 1LOJA 2I2LA 3CCJA 3P8DA 4C8QD 2AZSA 4ELZC 5J39A 3G7ZA 3QWYA 1QVFP 4EOLB 3CCLQ 3V8LA 1W1FA 3CC2Q 3AHUA 2BS2A 3TVTA 1GH6B 4LOCA 2O4XA 1BI1A 3L2WA 4MIMA 2LNVA 3FIFA 4RCCA 4PFPA 3VYGA 3VKHA 2MCNA 1N8RC 3DTOA 2PHGA 5CVIA 5LJ5d 3MPUB 3NGPA 1SF9A 3QYBA 2G3RA 1SHFA 2KT8A 2KK4A 1I5LA 1VQPT 2OTLQ 1ZHIA 2V22B 2O9VA 1Y07A 4F7UF 3M0RA 2KI7A 2A08A 2F2VA 3QHWB 4QQ6A 4R56A 4F7NB 2M16A 4HCZA 2HBPA 4KGVB 5KYYB 3BY7A 3JCMc 4IIOA 2FB7A 1DJ7B 4PK4A 1FWZA 4ORZA 1ABQA 5EC7A 2NUPA 1Y71A 2GQIA 1VQOQ 3TEEA 1YJ9T 2COYA 1PRMC 4XU2A 4R0KA 2LZ6B 1YJNT 4ROCA 3VU3C 3UA6A 2LW4A 3P8BB 4OB2B 4MZTA 1QKXA 3FRNA 1PHTA 4RKUE 1NG2A 1VQNT 3VS1A 1I81A 3VUBA 2OTJQ 4OMPA 1IHVA 4FYXB 5GANj 2HKNA 2DJQA 2DERA 1VQKQ 3A8LB 4J7FA 1NJIU 2NUTA 3GPLA 4NOYA 3C95A 3OS2A 3EOCB 4F7UG 3DOGB 4M77A 4J7IA 4QW2A 4HNTA 1TSFA 1K9MU 1VOLA 4M78A 2CSIA 4E7SA 3JB9H 2YRVA 3FLGA 2RHIA 3U23A 1C1AA 2DVJA 3EG9A 4RMOA 5LJ3h 2AKLA 1H8KA 3G71T 1OPLA 1SHGA 4EMGA 2KVQG 1IO6A 1M3CA 4OMFB 2R57A 1WJRA 1VQOT 1YI2A 3V8KA 4C0DB 4M75B 2O88A 2RK1A 2DIGA 2R5MA 1WI7A 5CR2A 3OS0A 1U1TA 2L0AA 4RTVA 4R55A 2GF7A 2CUBA 2E6ZA 4C92G 2LJ0A 2HL5C 2DL7A 1PNJA 3M03A 4QVDA 2YWWA 5D7UA 3TSWA 4M4ZA 3QJYA 2OTLA 4RG8A 3VS7A 1JSUB 2CP6A 1EIFA 3EH2A 4HT8A 1K0SA 3QYEA 5GAOl 1OULA 4ESRA 5ACBA 4BI8B 4GY5A 1Q86U 1V1CA 3H0HA 3EG2A 4X34A 3TNIB 4EOQB 1VQ8A 2DETA 1OL1B 2IVWA 5IHNA 4HXJA 3RNJA 4LDXA 4Y91A 4BB7A 3EFRA 2QDJA 1UGPB 3AT1B 1PKDB 4HT9A 1O75A 1JSTB 3NPFA 4HCKA 4LN2A 3CPWS 3DLLA 1GY3B 3REAB 1LVKA 4M77C 1X01A 4C92A 3KHIA 3CMAA 4PFOA 3VS3A 1X2QA 1YCYA 4Z6YA 5KE2A 2L3PA 1QVFS 2C0IA 1VQMT 2KR6A 3V7CA 2PZ1A 1AVZC 2KR3A 2GFUA 2IW9B 3X24B 2DL8A 3VRZA 2A3LA 4M78C 4QVZA 3TU4K 1KC8R 1QVGS 5CKDA 1MHNA 5DQWA 1N8RU 4YC3B 2JMCA 3CC4T 2D8JA 1I5OB 1WHMA 2NLUA 1QWFA 4NL2A 2HCKA 4KRTA 1Q81C 4XAXB 2LCSA 2NUZA 1X69A 2CKKA 1OOTA 3ME9A 3CCVQ 2KY9A 3HHTB 4FU6A 2NYSA 3EHRA 2EGCA 1JEGA 2F2CA 1HD3A 3MKDA 2V8IA 2COZA 5IDPB 2X9HA 4D6WA 2YUQA 3G4SA 1YJWA 3CCQA 2D8HA 4HA8A 3JB9G 3DKMA 1OI1A 4MZPA 2K5IA 4E7LA 3QDFA 1QKWA 2DK3A 2GTOA 2RQUA 3RGFB 2DD4A 5CCAA 4HNUA 2VKNA 3TQ7P 2CH4W 5C0MA 2VV5A 1M1KR 3E19A 1ZBJA 1UB4A 1BIBA 3H6ZA 3CPFA 1YWPA 3RMSA 2AKKA 3EG0A 1ZX6A 4IUPA 1WDXA 1QCNA 4OGRB 1G5VA 3I56Q 1XJWB 2EKOA 2EQKA 1AZEA 3DJBA 1NZ9A 2WMAB 2CP2A 2MAMA 1WPYA 4ELJA 2BZ8A 2QA4A 3JB9I 1K8AR 4EPCA 2VASA 2QGGA 3JSCA 2VC8A 2DXTA 3O0GD 3QWLA 1Y0MA 3LQ5B 1KQSA 1TU0B 4J9DA 3R6OA 4XTZA 5GAN3 3L2RA 1ZA2B 1BCOA 4M77G 5GAOr 1U3OA 3M9QA 3M4GA 4OR5B 3BDUA 5CKFA 3M0PA 3NFCA 3I9QA 2QAZA 1HXDA 4EMKC 1YIJT 4QQDA 3LW5E 2IG0A 4AFUC 1QCOA 3OB9A 2FO0A 1X43A 2QTXA 2CYZB 3G33B 2RHZA 4J9BA 1JJ2A 3H8ZA 2DTOA 3QZ5B 1M90U 2DFUA 1TUGB 4CFXB 1VQ5A 2EQJA 2RJCA 3JCMQ 1OX9A 2QTVA 4PKCC 1GCPA 1K9AA 4YOZA 5GANe 3P8HA 2E70A 1UHCA 1RAGB 2DRKA 4CI0C 3H0IA 3G4SQ 3TNWB 2BPMB 4HLQA 3C0CA 1S1NA 1M2VA 3CBOA 1VQMA 2CCHB 3NTHA 1X6GA 2J6OA 2LVMA 4LDWA 4CC2A 2P4TA 4M7AA 4X9DA 2MWPA 1UG1A 1JQQA 1OIYB 3CBPA 5LMKB 5DY9A 4ELLA 5GMKl 4VUBA 4IUUA 3X26B 3CC4A 2KBTA 3I5SA 2WFYB 1OX8A 3QWXX 5FROA 1CSKA 4JS5A 4OB0B 1W2BA 2EUFA 4N4GA 4BE2A 1PSFA 2SRCA 2HSEB 3HRTA 4BDZA 1GRIA 1FX7A 1N5ZA 2RHYA 3GNFB 3BHTB 4BXXX 5GAMe 5HBHB 2K3BA 4CRIA 2QK0A 3OYDA 1IRXA 2XU8A 1IHWA 2HBWA 1X27A 4KRDB 1ZA1B 5ICPB 1PC0A 2RK2A 1ZSZA 2DEQA 2DNUA 1AT1B 3QKJA 1LNXA 3DDQB 3OYJA 5HK0A 1MMAA 1TOVA 4IUVA 3OYMA 3A8OB 3K7AM 2JW4A 2V26A 4PL6A 1KC8U 4C8QA 4Y92A 2E10A 4N4IA 4ZGEB 4C0DC 2PNIA 2DMOA 3TW6A 2LJ3A 4C5EA 2A37A 2K9GA 1VQ7T 1C6VX 1U06A 3M4YA 4PJOG 3JB9F 1MNEA 3VYHB 1EZZB 4FCYA 3JCMg 5IHKA 1MMDA 2ENMA 4KH0B 1OEBA 3MP1A 1RUWA 3OYFA 2EQMA 3A8MB 3SHWA 3ZL7C 5KYWA 1Z9QA 2KMTA 4PJOA 3J81E 4RODA 2ROTA 3PNWC 2WSCE 1LPLA 3JB9D 2ZGWA 4OMOA 5IHIA 5LJ5f 3PO3S 2D0NA 3L2VA 2FPFA 5CQXA 4BCQD 4FM4B 2JTEA 4EOMB 2K57A 2ZZDB 2A0FB 4LDUA 2IN3A 1VQMQ 2E3HA 2WPAB 4C8QB 4AFQC 2E5QA 1VOMA 4M78F 2EAYA 1QVPA 3UT1A 1BYMA 1U8RA 4XK8E 1YJNA 5CK9A 4AFZC 4Z02A 4IMYB 1KQ1A 3TCJA 5KYUB 4N4HA 2L2PA 2XIDA 2BE9B 4F70B 1ZSZB 2K2VA 3A98A 4BCOB 5IHYA 3CC4Q 3QZ9B 1AD6A 3ZFJA 2COWA 1V29B 3BFMA 1IREB 3G1JA 4E6RA 1ZBXA 1KD1C 4JRQA 2O2OA 1KXUA 4JX6A 2CDTA 3E9FA 2HDAA 3THKA 1M1KU 4EMKA 1UJ0A 2LDMA 3VKGA 2MIOA 1X6OA 5CKEA 2PU9B 3BE3A 1G3YA 3H9NA 3OBWA 1ZSGA 2F2WA 3PTAA 4G6LB 4C0FA 2C06A 4QQGA 1ACMB 3OYAA 4OVAA 4HVUA 3URGA 4M77D 4C92C 1K9MR 2J6FA 4OMQA 5I5ZB 3CCEA 5HQ0B 5LJ3j 3FJ5A 4MDWA 4HCBA 1M8MA 2PUKB 3VS5A 3DDPB 1WQ7A 4XU1A 1G3TA 2XK0A 5LJ3g 1UFFA 8ATCB 1G3NC 4KULA 1EFNA 2IW8B 4AG1C 2KRSA 2XMFA 1FKMA 1OPKA 1M4ZA 1OKVB 3GOXA 4Z89A 2VYTA 2QQ8A 9ATCB 4BBSM 1VQPA 1OZ2A 2MYSA 2MWOA 5LQFB 2DPPB 1HJDA 2DMEA 2DTHA 4PJOD 4RTUA 1FVVB 3M0QA 2DYIA 2LTOA 2CZ0B 2P84A 2PK2A 1GFCA 3ER0A 1PG5B 1SG5A 3PMTA 3CCUT 2B9RA 2KXCA 4LXCA 2PVGB 4NS5A 2QQBA 4CC4B 2ZPHB 4XTYA 2H3JA 2VGNA 3NTKA 4AMCA 4F6SB 3RUXA 1NLPC 2WXVB 2V8JA 1RLQC 1PRLC 2X4YA 2JNGA 3QBYA 2HAXA 5C6SA 1M5Q1 3CCQT 2B86A 1Q95G 1KQ2A 1B34A 3QUIA 2X1NB 1TD6A 4DOVA 1H3HA 1ZUYA 2P4RA 3EGXB 1XO2A 3CEYA 5KYXA 2CH4A 1YHQA 4KBMB 3TW7A 3C12A 2F69A 2A7YA 1OKWB 2E41A 3RESA 1OIUB 2CSQA 3GNGA 5KYUA 2AT1B 4C0GA 5HBEB 4M7AB 1BI2A 4MDXA 3EGUA 1K73R 3MIAB 4C92F 2ED1A 1BB9A 2UUEB 3CCUQ 1JXOA 1OYXA 5GAMj 3L42A 3S3OA 3FB9A 2DVEA 2PVDB 4EOIB 2QA4T 4HL4A 1AWXA 4A4HA 2ESWA 4KT0E 1QVGP 2RI5A 3PVQA 1KIKA 3QYGB 4J9FA 3PFSA 3NHNA 3SEMA 1AD5A 4KGZB 4CXAB 4ATOA 2W96A 4EORB 2QASA 4FW2A 5I2SA 4II1A 1Q82U 1OU9A 1A0NB 5FW9A 5GJVB 3S3NA 4RTZA 3C94A 1M2OA 4BY6C 1YNZA 3M58A 2M9UA 2W10A 1PKSA 4RTTA 1GFDA 4LD9K 3ASKA 1UGRB 1S72Q 1YJWT 1CKBA 1SEMA 4OB3B 2FL7A 2H3EB 1GXIE 2WIPB 2DL5A 3M54A 3H41A 3EAEA 4LUEA 2DBMA 4M7DE 1AOJA 5HY6A 3WXMB 3FEOA 2YLBA 3CCRT 1G8XA 5HCKA 3MEAA 1JO8A 1YFNA 3JCMd 1K4US 3PGGA 2KQWA 1RACB 2BS4A 2L8DA 3VYGB 1M9SA 1G83A 1MGQA 4CFUB 1W2BS 3RBBB 3A1PA 2LMJA 3HSBA 2VUBA 3MEVA 4DEYA 4BCNB 2V1QA 1YI2T 3WVDB 2F2XA 4ZTJA 1W2BP 1Q7YU 3G71A 1UTIA 4M75C 2BZXA 4CFMB 4DEXA 3HZJA 1WNLA 2LRQA 4PJOB 2EGEA 2RI2A 1VQ9T 2LT1A 3BW1A 2M1HA 1FMWA 2BE7D 2RMOA 4OMMA 1PSEA 2EW3A 4RTXA 2KYBA 4CFWB 5EJCA 1BU1A 1T3SA 5GAN4 1Y96B 2IPOB 2E5KA 5GAN8 1Y96A 2HQEA 1MMNA 2WMBB 1WJQA 3HFOA 5GMKi 4O5VA 1W98B 4LE9A 2FRYA 4C5GA 4AG2C 4F17A 3MI9B 1O9SA 2C5XB 3E9GA 2YDLA 2CS7A 4FX3B 2JN0A 2PJQA 5GAMh 2FRWA 1WA7A 1D3UB 1SPKA 3TREA 4FT4A 1Z9ZA 2ZPIB 5GANd 1GCQC 4CFNB 3I55A 2XDDA 4PJOF 1NM7A 1UUEA 4UN0A 3R6NA 5GAMg 1UNLD 3MY5B 1W4SA 2C6TB 2YUOA 3X20B 1BCMA 2M51A 2K5FA 4OMNA 1RAHB 1VUBA 3PIPA 3GP8A 1AEYA 2FZKB 2JS0A 1Q7YR 2GQVA 4MFDA 2QQRA 2YLCA 4AKGA 2YXYA 2P0KA 4JS4A 3L2UA 5CKHA 5KE3A 3LWIA 1MMGA 4ZN3A 2XG8D 1AWJA 1D0ZA 1ENWA 1X75C 1URCB 2O01E 4A53A 2EJGA 3RKYA 5I11A 2FZGB 3EGDB 3TNHB 5HKCA 4II5B 2E3IA 2RHUA 2OAWA 1TXQA 3EFOB 3NMZC 1BBZA 3VS6A 2WSEE 4M75G 2W99A 2O4XB 1SSHA 4LNPA 2W2HA 4BCMD 3E2UA 2D6FA 2LQ8A 2M0OA 2OAUA 4OGCA 2D9TA 1KD1R 1NYGA 3GIBA 1YJ9A 1AWWA 3OYYA 4DOWA 4RCBA 1GBQA 1KD1U 2QF7A 4EOKB 5AYFA 3PE0A 3BG5A 2BTTA 3ZEHA 5IXFA 5LJ5h 1VQNA 1CKAA 3VRYA 4ZNXA 3CD6Q 1ZQ1A 1D09B 5IAYA 3F5XB 3SD4A 1H641 3B57A 2FPEA 1QMZB 3UA7A 3JCMh 1Q82C 2YT6A 1IZ6A 5LJ3d 4M7AD 4M75E 5CEIB 3OYHA 2JM8A 4C8QF 3CXCA 1ARKA 1UGQB 2AIRB 1H4LD 1WLPB 4JRPA 3RKXA 1H25B 2BUDA 4E7HA 5J26A 4OB1B 4C8QG 1E7OA 2RHXA 4A54A 1K8AU 1K9MC 5DLOA 4DBFA 2DEUA 1TH7A 1ABOA 3POMA 2K79A 3HRSA 5CYIB 2HKQB 1WXUA 2EYQA 3MO8A 1M1FA 2DRMA 3RERA 2DE0X 2BKZB 2DYBA 1KQSS 2AHJB 1JJ2P 2IVXA 2L3SA 2JVVA 2LQNA 4TVRA 1GBRA 2W9ZA 3HBLA 3CPWP 2CT3A 4KH1B 4GBQA 2J06A 2MF2A 4FT2A 1H3ZA 1VQ7Q 4XTWA 1R77A 3PT9A 2XI9A 5GAN5 3JAME 2KROA 3QXEB 1WHGA 3JCMW 1TFBA 4L6V5 3CC7Q 1Q82R 1E9HB 4M7AF 4CFUD 1PD1A 2AZVA 3QYHB 2NWMA 2X3WD 2YHTA 4F7UB 2QG9B 4J9CA 1VQ5T 1VYUA 2CP0A 4JRIA 3CBMA 4JUVA 1VQ4T 5GAOq 3MCAB 1VQ6Q 4BCPB 4ZTFA 4J9IA 3A8HB 1Y7XA 2PTKA 1Q86C 1JXMA 2UZDB 3HPWA 3F70A 3NDQA 2QQAA 1VQ8Q 3RIRA 1VIFA 1N27A 2BIVA 2RN8A 4J6XA 4XTVA 4F16A 2DO3A 2UZBB 4V2SA 1H27B 1EX4A 2QI2A 3OMGA 4LD6A 5CO7A 2I0NA 2JMAA 4ZGDB 5FU6C 1D3BB 3O5ZA 1C9BA 2CGHA 3RDVA 3META 1UHFA 3I56T 4FYYB 3LGFA 2VWFA 1TUCA 1RAEB 4BE0A 2ZPGB 2VXEA 2XICA 3KBGA 4L59A 5IH2A 4J83A 3M56A 4MZMA 2UZLB 1R0CB 1KJWA 1FINB 2GBQA 2X4XA 3SWNC 2PK9B 5I2MA 6AT1B 2HQXA 3HL8A 1S72T 3TN8B 1HSQA 1M90C 2YRDA 5LJ5g 1UGSB 2HL3A 2QXFA 2QEXA 3CCLA 3HFNA 3SFMA 2NUPB 3H0FA 1QVFA 1X6BA 3CCVA 1M30A 4JZ3A 2JJ9A 3CCMT 3UPUA 3HO8A 2QYZA 3EGXA 2XHCA 3GF5A 4J8OA 4M75F 1XQHA 4ANJA 2KT1A 2EYYA 1G3WA 2GFAA 4BCJB 4MMKA 1VQ7A 4JJBA 1YJWQ 5IDNB 3BLQB 4OMLA 1H1QB 4FW1A 1N6AA 2L5QA 2E64A 3QJ6A 3C4SA 4FIBA 1BIAA 5FWCA 2DZ9A 4C92D 1HK9A 3CC7A 2G9XB 4MFEA 4L5GA 5L23A 1LCKA 3HRUA 5AT1B 5FGKB 4NL3A 2RJFA 3L1AA 4KUIA 2KXDA 2F5TX 2R58A 4QKUA 5GMKm 4JX5A 1H1PB 3GLXA 4M7DB 1VYVA 4N0AC 1I1JA 3DL1A 3CMEA 2X35A 1M3AA 2LQWA 2FYKA 1VQOA 4BY7X 2D0QB 2KDSA 3VJPA 3EH1A 5FLXE 5I21A 2HZYA 4K11A 4M7AE 4BY6B 2J05A 5GAOp 4HVVA 2JT4A 4LDVA 4OF1A 4PNOA 1W6XA 1ZUUA 2Z0WA 2JTMA 3OSSC 3JRZA 1OI9B 1JB0E 2EFIA 1VQKA 4E7IA
chains in the Genus database with same CATH topology
4HL4A 4ZN1A 4A4HA 4EMHA 2GFUA 4KT0E 3X24B 2RI5A 3M53A 5IN1A 4BE1A 5LJ5e 2A3LA 4M78C 4QVZA 3TU4K 1WJSA 3M55A 1QVGS 5CKDA 1MHNA 2WSFE 3A5ZB 3OYGA 3QYGB 1N8RU 3PFSA 3CC4T 1VQ6T 2VXFA 3T9NA 3CCRA 4ATOA 2NLUA 2L89A 4NL2A 4A4GA 1FXXA 4BI4A 2MMPA 4II1A 5I2SA 1Q82U 4O6JA 4BD3A 1Q81C 3CXCS 4XAXB 3V7SA 3MP6A 2CKKA 1K8AC 2DXBB 3S3NA 4EMKB 2DD5B 1WQWA 4N0AA 3MHXA 2K5LA 3C94A 3ME9A 4BY6C 3MEUA 3JCMP 3M58A 3SDZA 2KY9A 2M9UA 2DKGA 3HHTB 3EFSA 4FU6A 4C8QE 4C5HA 3QPHA 3BDLA 4MMLA 1VQLA 2LT4A 5HK3A 4WF2A 4AI6A 4LD9K 3ASKA 1UGRB 4P5NA 2E6NA 4EDUA 2XKOC 3OYNA 4QSHA 1YJWT 4OB3B 2FL7A 2V8IA 4Q5WA 1GXIE 2ZPFB 4D6WA 4UC4A 3CMET 3M54A 3JB9J 3G4SA 1YJWA 5CIUA 3CCQA 3EAEA 4HA8A 3JB9G 3INZA 3DKMA 1OI1A 4MZPA 2K5IA 4JDSA 4E7LA 1YIJA 1VQLT 5HY6A 4M7DE 3WXMB 3FEOA 2K3XA 2YLBA 2DK3A 3CCRT 3MEAA 1RL2A 1VQKT 2DD4A 5CCAA 3JCMd 1G3SA 3UWNA 4HNUA 3LH0A 3LWHA 3S6WA 5C0MA 2VV5A 3OSVA 2KQWA 3PGGA 4JRKA 3E19A 2BS4A 2FVUA 3PIOA 2L8DA 3CC7T 3VYGB 1M9SA 1MGQA 1UB4A 3CMAT 1BIBA 3OA6A 3H6ZA 4JLIA 4DA4A 1W2BS 3QDRB 1KC8C 2RJEA 3Q1JA 3CPFA 2JOYA 2K3YA 3LX7A 5LJ3e 3HSBA 4GLKA 4E7KA 3RMSA 2KSSA 2VUBA 2HNIA 1QLBA 3MEVA 3QHSA 1D3BA 5L8RE 3CCLT 4BDYA 1YI2T 3WVDB 4KUDK 4IUPA 5GAMf 2QDYB 1P92A 3G6EA 4ZTJA 1Q7YU 4AKHA 2JUFA 1G5VA 3BG9A 3LGLA 2EKOA 2EQKA 3O8VA 4M75C 5CKBA 3G71A 2RD1A 4M7DD 3HZJA 1K73C 3OW2A 1WNLA 1NZ9A 2LRQA 4PJOB 2F5KA 2RI2A 3SB2A 3OY9A 2MAMA 1WPYA 4B9WA 1VQ9T 2LT1A 4ELJA 3WVEB 3BW1A 3MP8A 2QA4A 4F7UE 3FJPA 3JB9I 2M1HA 3CD6A 1PSEA 2RM4A 3VUZA 4EPCA 4XTUA 3HKSA 3JCMe 2HD0A 3CD6T 5EJCA 3JSCA 2B8AA 2VGMA 2VC8A 2DXTA 5GAN4 3G6ET 5LJ3f 1Y96B 3N5BB 3QWLA 5LJ5j 4C0ZA 5GAN8 1Y96A 1KQSA 2LCLA 3PMIA 4J6WA 2HQEA 3R6OA 1JJ2S 1WJQA 1NPPA 4XTZA 3HFOA 5GAN3 3L2RA 5GMKi 4O5VA 4M77G 5GAN6 5GAOr 2V8KA 5CQYA 1KHCA 3LLRA 3M9QA 4C5GA 3M4GA 1O9SA 2GCXA 2DTIA 3E9GA 1KHIA 3BDUA 2QQ9A 3QO3A 2CS7A 2JN0A 2ZZDA 4DQ2A 5CKFA 5GAMh 1VQ4A 3NFCA 4XTXA 5KCHA 4IKFA 1QP2A 4J5YA 5J3BA 4M78E 1HXDA 4EMKC 4M7AG 5D6YA 3TREA 4J6YA 5EG2A 4FT4A 3V7RA 4AKIA 2ZPIB 2XDPA 4C92B 3OYEA 1I4K1 4YTLA 2Y4XA 1YIJT 1VQ8T 5GANd 4QQDA 3LW5E 4M78G 2IG0A 2QQSA 3I55A 2XDDA 3OB9A 2EJFA 2CYZB 2QTXA 2RHZA 4B9XA 4PJOF 1JJ2A 3CC2A 1QW1A 3H8ZA 2DTOA 5GAMg 3QZ5B 1M90U 5A2QE 4X9CA 1W4SA 1VQ5A 5GAOm 2EQJA 2RJCA 2ZCFB 4IUQA 3X20B 3JCMQ 5GAN7 1KG1A 4HCCA 2R5AA 4M6VA 4PKCC 4FL6A 2K5FA 5CAIA 5GMKe 1VUBA 2JZ2A 3PIPA 3GP8A 2BS3A 5GANe 1S72A 3P8HA 2E70A 4OP0A 4RG2A 4CI0C 4JLGA 1VIEA 2GQVA 4ME7A 3FC3A 4MFDA 2DIQA 2QQRA 2YLCA 1M1KC 4AKGA 2P0KA 5KH6A 4HLQA 3L2UA 5CKHA 4JS4A 2LCCA 2DXCB 2QEXT 3BG3A 5DLQE 5KE3A 3LWIA 2ZPEB 3CBOA 4XU3A 4ZN3A 2XG8D 1VQMA 3OW2S 4M77B 3NTHA 4M7AC 1X75C 1XTDA 2LVMA 2P4TA 4LDWA 2DZCA 2O01E 3OS5A 2EJGA 4M77F 3RKYA 4A53A 3X25B 4HNVA 4X9DA 4ELYC 4M7AA 2MWPA 5HKCA 2RHUA 5LL6S 1VQ9A 3CBPA 5DY9A 1JRIA 2Y90A 2RH2A 3X28B 3M57A 1BI3A 5A0DA 5GMKl 5GAN2 2WSEE 4VUBA 3OS1A 3HB9A 4IUUA 3X26B 5DM7R 4XU0A 4M75G 3ZBDA 1YHQT 2O4XB 3CC4A 1VQ6A 4NC6A 2P0QA 4C8QC 4JS5A 3L2ZA 2QFZA 5FROA 3J7AF 4OB0B 1W2BA 2D6FA 4BE2A 3A8GB 4N4GA 2KAFA 2ZPBB 2LQ8A 1N9SA 2M0OA 1PSFA 2OAUA 2D9TA 4FSXA 4OGCA 3GIBA 2EJ9A 1YJ9A 2E12A 4JJNK 3OYYA 2DD5A 5FU7B 4RCBA 3HRTA 4DOWA 5GAOn 3I56A 4BDZA 3M59A 1KD1U 1I8FA 1FX7A 2QF7A 2RHYA 3OYCA 1BI0A 3GNFB 3CCVT 4BUGA 5GAMe 4BI3A 4CRIA 1M8VA 4OGEA 3OYDA 1YITA 5AYFA 3DB3A 2XU8A 3FDRA 4M7DA 4M7DF 3BG5A 3ZEHA 3MEWA 4PJOC 1YBYA 4XQ3A 5LJ5h 3OYIA 1VQNA 2G77A 1M1GA 1SSFA 2DEQA 2RK2A 1ZQ1A 3QKJA 3CC2T 2BKDN 1LNXA 5IAYA 3SD4A 1JBMA 1H641 2Y4YA 3OYJA 1BKBA 2E65A 5HK0A 4IUVA 3JCMh 4A4EA 3OYMA 3A8OB 4E7JA 1Q82C 2OTJA 3VKIA 3VV0A 1IZ6A 4PL6A 1KC8U 5LJ3d 4M7AD 4M75E 4C8QA 3CCJT 2DXCA 4A4KA 3DB4A 3NTIA 3OYHA 1UEBA 2E10A 4N4IA 4IURA 4LDYA 4ZGEB 1RI0A 4A4FA 4C0DC 4C8QF 3OYKA 3CXCA 4F7UA 1NJIC 3JCMJ 1UGQB 1NPRA 2EIFA 3TW6A 1N9RA 4C5EA 2L3RA 4M78D 1VQ7T 2OTJT 4JRPA 3RKXA 5GAMd 3M4YA 2BUDA 3CCMA 4PJOG 4E7HA 1LOJA 5J26A 3JB9F 4OB1B 2I2LA 2X4WA 3VYHB 2RHXA 2X4JA 4A54A 4C8QG 3CCJA 3JCMg 1QVGA 5DLOA 1K8AU 1K9MC 3JCMf 3P8DA 4C8QD 1TH7A 4ELZC 5J39A 2LQKA 3G7ZA 3HRSA 3MP1A 3OYFA 2EQMA 3A8MB 3V8LA 4C92E 2OTLT 2EYQA 3MO8A 2KMTA 1M1FA 4PJOA 3CCSA 2EWNA 3AHUA 3J81E 3RERA 3SWNA 1KQSS 2BS2A 3JCMb 2AHJB 3PNWC 3SWNB 2JVVA 4LOCA 2WSCE 3OBYA 3OYLA 4TVRA 3HBLA 4M7DG 2DJZA 3JB9D 2ZGWA 2O4XA 1BI1A 3V8JA 5LJ5f 3L2WA 3L2VA 4MIMA 2LNVA 3FIFA 4RCCA 5CQXA 3JCMX 3DLMA 4E47A 2MF2A 4FT2A 1E7PA 1H3ZA 4FM4B 4XTWA 3VYGA 3PT9A 3VKHA 2XI9A 2K57A 1N8RC 2ZZDB 2E1HA 3HP9A 5GAN5 3JAME 3QXEB 5CVIA 2RJDA 4LDUA 3JCMW 5LJ5d 4L6V5 3QYBA 1XNIA 2G3RA 4IUTA 4M7AF 4C8QB 2EQUA 2E5QA 4M78F 2EAYA 1QVPA 2KK4A 3UT1A 1NE8A 1BYMA 3QYHB 1U8RA 4XK8E 4HKEA 1XOVA 2YHTA 1YJNA 5CK9A 4F7UB 1VQPT 1I5LA 4Z02A 1KQ1A 3TCJA 4N4HA 1VQ5T 1ZHIA 2DAQA 2XIDA 1Y07A 4F7UF 3M5AA 2K2VA 5GANf 4JRIA 3CBMA 4JUVA 1VQ4T 5GAOq 3MCAB 1OZ3A 4QQ6A 3QZ9B 2RB6A 3ZFJA 3A8HB 4BACA 4ZTFA 1Y7XA 1V29B 1LJOA 2M16A 4R56A 5A0LA 3BFMA 1Q86C 3HPWA 1IREB 3I55T 4HCZA 3S3MA 2HBPA 2QQAA 3F70A 3BY7A 3JCMc 3RIRA 2RI3A 1VIFA 1ZBXA 2FB7A 1DJ7B 1N27A 2BIVA 1FWZA 1KD1C 4J6XA 4JRQA 4XTVA 4C5IA 4JX6A 1Y71A 2LC4A 2DO3A 3E9FA 1M1KU 4V2SA 3TEEA 1YJ9T 4EMKA 4M78B 5FRNA 2XD0A 2LDMA 3VKGA 1X6OA 5CKEA 2PU9B 4XU2A 5KCOA 1G3YA 2DXBA 2QI2A 3OBWA 3OMGA 4LD6A 5CO7A 1YJNT 3VU3C 3PTAA 4C0FA 4ZGDB 2C06A 5FU6C 1D3BB 3P8BB 4M77E 4BBRM 4QQGA 3QG1A 3OYAA 2CGHA 4OB2B 3META 4MZTA 3FRNA 1B34B 3OMCA 4OVAA 4PLLA 4RKUE 3I56T 5GANg 3QSUA 3URGA 1VQNT 3H4CA 4M77D 3J80E 1I81A 3VUBA 3LGFA 3RKWA 4C92C 4BE0A 5GANj 4PJOE 2ZPGB 3CCEA 3CCUA 2VXEA 2XICA 5LJ3j 3KBGA 4L59A 4MDWA 3KXTA 3L2QA 3A8LB 2K4YA 3LYIA 4HCBA 4J7FA 2MI6A 2PQWA 1NJIU 4J83A 2PUKB 2DD4B 3KUFA 1WQ7A 4XU1A 1G3TA 2XK0A 3M56A 5LJ3g 3GPLA 4NOYA 5IT9E 3C95A 4MZMA 1WGSA 4F7UG 3OS2A 3RMQA 2CZ7B 4KULA 5GANh 2X4XA 3SWNC 2RO0A 5I2MA 2HQXA 4M77A 4J7IA 4QW2A 4HNTA 3JCMV 1FKMA 3HL8A 1K9MU 1M4ZA 1S72T 4M78A 4QVCA 2P0PA 3JB9H 3GOXA 2YRVA 1M90C 5LJ5g 2VYTA 1UGSB 2QQ8A 2QXFA 2RHIA 3FLGA 4BBSM 2QEXA 3CCLA 3HFNA 3SFMA 1VQPA 1Q81U 4M7DC 1OZ2A 1QVFA 4RMOA 2RA2A 2MWOA 5LJ3h 3CCVA 2DPPB 3G71T 3CCMT 3UPUA 4ZGJB 3HO8A 2DTHA 4PJOD 2XHCA 3G4ST 3GF5A 2DXUA 3E1SA 2KVQG 4J8OA 4M75F 2LTOA 1XQHA 4OMFB 4EMGA 2R57A 2CZ0B 1WJRA 1VQOT 1YI2A 3V8KA 4C0DB 3OYBA 1Q7YC 2QA4T 1G3WA 4M75B 2GFAA 3CPWA 3CCST 4MMKA 3ER0A 1VQ7A 2RK1A 3PMTA 2DIGA 3CCUT 3CCET 2WACA 2R5MA 5CR2A 3OS0A 1U1TA 2PVGB 4R55A 2KMGA 2GF7A 1N6AA 2QQBA 2E6ZA 4NS5A 5D6WA 4C92G 2L5QA 2E64A 3QJ6A 3UDCA 3C4SA 4FIBA 2CZ1B 2ZPHB 1BIAA 2DZ9A 4C92D 1HK9A 3CC7A 4MFEA 2H3JA 4XTYA 1U1SA 4L5GA 2VGNA 3NTKA 4QVDA 3RUXA 3HRUA 3QJYA 2OTLA 4RG8A 2WJ9A 4M75A 4NL3A 2V8JA 2RJFA 3L1AA 2X4YA 2JNGA 3QBYA 4KUIA 2F5TX 2HAXA 1EIFA 5C6SA 4HT8A 1M5Q1 3QYEA 2R58A 5GMKm 4JX5A 2JTFA 5GAOl 3CCQT 2CZ6B 4BI8B 4PLIA 1KQ2A 4GY5A 1B34A 1Q86U 3QUIA 3GLXA 4M7DB 4X34A 4DOVA 2FHDA 4N0AC 5FU7C 4JX4A 2PVOB 1VQ8A 3DL1A 2LX9A 3CMEA 2X35A 4M75D 5GMKj 5FU6B 2IVWA 3CEYA 2FYKA 1YHQA 1VQOA 4LDXA 4Y91A 4KBMB 2D0QB 2KDSA 3VJPA 4BB7A 3TW7A 5FLXE 3C12A 3EFRA 5I21A 5M9OA 2QDJA 2F69A 1K73U 1UGPB 1QP3A 2XDBA 2A7YA 1YITT 4HT9A 4M7AE 1O75A 2E41A 4BY6B 3RESA 5FRMA 3GNGA 3OQ5A 4C0GA 3CPWS 4Y28E 1AHJB 5GAOp 3DLLA 4M7AB 1BI2A 4MDXA 4LDVA 4M77C 1X01A 4C92A 3KHIA 4OF1A 3CMAA 5D6XA 4PNOA 2JTMA 3OSSC 4C92F 3QIIA 1YCYA 4Z6YA 3JRZA 1JB0E 2EFIA 5KE2A 1OYXA 5GMKh 5GAMj 1VQKA 1R8OB 3L42A 4E7IA 3S3OA 1QVFS 3FB9A 1VQMT 2DVEA 2PVDB 5A0GA 2PUOB 2KR6A 3V7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGQ B;  4KT0 E;  2CZ7 B;  3X24 B;  2ZZD A;  4OB1 B;  3VYH B;  1QP2 A;  2WSF E;  3QYG B;  2ZPI B;  1UGS B;  3LW5 E;  3A8M B;  2CYZ B;  2DXB B;  2DD5 B;  2DPP B;  3QZ5 B;  3HHT B;  2AHJ B;  4ZGJ B;  2ZCF B;  3X20 B;  2WSC E;  1UGR B;  2CZ0 B;  4OB3 B;  1GXI E;  2ZPF B;  4FM4 B;  3VYG A;  2ZZD B;  2PVG B;  2DXC B;  3QXE B;  2ZPE B;  4L6V 5;  2CZ1 B;  2ZPH B;  2DD4 A;  2O01 E;  3X25 B;  3QYH B;  4XK8 E;  3VYG B;  3X28 B;  2WSE E;  3X26 B;  2CZ6 B;  3QZ9 B;  3A8H B;  1V29 B;  4OB0 B;  5L8R E;  1IRE B;  3A8G B;  2ZPB B;  3WVD B;  2PVO B;  1PSF A;  1DJ7 B;  2QDY B;  2DD5 A;  2D0Q B;  1UGP B;  2PU9 B;  1QP3 A;  2DXB A;  3WVE B;  4ZGD B;  1PSE A;  4Y28 E;  1AHJ B;  4OB2 B;  4RKU E;  3A8O B;  2ZPG B;  1JB0 E;  2DXC A;  3A8L B;  2PVD B;  2PUO B;  4ZGE B;  2PUK B;  2DD4 B; 
#chains in the Genus database with same CATH topology
 4EMH A;  1H24 B;  2RQV A;  3M53 A;  2J7I A;  5LJ5 e;  4EC9 B;  3A5Z B;  2WSF E;  1VYW B;  2I40 B;  1WIE A;  1WXT A;  1ZLM A;  3GBQ A;  2VXF A;  4A4G A;  1FXX A;  4BI4 A;  2MMP A;  2QEX Q;  4O6J A;  2CJM B;  2VVK A;  1K8A C;  2DXB B;  3JV3 A;  4EMK B;  1WQW A;  2K5L A;  3SDZ A;  2LP5 A;  4C5H A;  1VQL A;  2LT4 A;  5HK3 A;  4AI6 A;  1WZO A;  4P5N A;  4EDU A;  3OYN A;  1YI2 Q;  4QSH A;  1FYN A;  4Q5W A;  3JB9 J;  2A28 A;  4J9H A;  1WHJ A;  1RAD B;  3INZ A;  4JDS A;  2KGT A;  4FSS A;  1RI9 A;  2O9S A;  1D1A A;  2JXB A;  1G3S A;  3UWN A;  3LH0 A;  3GTM S;  2OJ2 A;  3LWH A;  4JRK A;  4PFZ A;  2FVU A;  4RUG A;  1VQ9 Q;  4PJM A;  1IB8 A;  4DA4 A;  2RJE A;  3Q1J A;  3LX7 A;  2K3Y A;  2V1R A;  4GLK A;  4E7K A;  3QHR B;  1T0J A;  2KSS A;  1NYF A;  2HNI A;  5KYN A;  2CP7 A;  3QHS A;  1D3B A;  3CCL T;  1RAA B;  4BDY A;  4KUD K;  5GAM f;  2ECZ A;  1YP5 A;  2QDY B;  1UDL A;  2MPX C;  3CME Q;  3BG9 A;  2G6F X;  3O8V A;  5CKB A;  1YWO A;  2RD1 A;  1K73 C;  1UE9 A;  2C0O A;  2DIL A;  3HTR A;  1YIT Q;  3SB2 A;  4B9W A;  4B6M A;  2OX7 A;  3MP8 A;  3HKS A;  2RF0 A;  2B8A A;  2QGF B;  3CMA Q;  3G6E T;  5LJ3 f;  1UNG D;  3N5B B;  5IF1 B;  1I0C A;  2LCL A;  1H26 B;  4QT7 A;  1MV0 B;  1NPP A;  1JJ2 S;  1KQS P;  2V8K A;  3LLR A;  5ECA A;  2GCX A;  4PJL A;  3QO3 A;  3CCM Q;  4DQ2 A;  2ZZD A;  5KCH A;  4J5Y A;  4J6Y A;  5KYX B;  4C92 B;  3OYE A;  1X2K A;  4YTL A;  2Y4X A;  2DA9 A;  2FZC B;  3CCS Q;  5IXB A;  1HYO A;  4TTH A;  5A2Q E;  1T0H A;  4IUQ A;  1VQL Q;  2RQW A;  1KG1 A;  2CP5 A;  2R5A A;  4FL6 A;  5CAI A;  5GMK e;  4IIM A;  2BS3 A;  1J3T A;  2GNC A;  1WHL A;  4RG2 A;  4JLG A;  2RNA A;  4ME7 A;  3BLR B;  1M1K C;  5KH6 A;  3CCQ Q;  4EON B;  2QEX T;  2QGS A;  4XU3 A;  4M77 B;  3TSZ A;  1NBE B;  1YN8 A;  3D7S B;  2WEV B;  1ZSZ C;  3X25 B;  1M90 R;  1VQ9 A;  1V76 A;  1JRI A;  1M27 C;  4CRL B;  2RH2 A;  3M57 A;  2Y90 A;  5A0D A;  5GAN 2;  3HB9 A;  3ZBD A;  4CC7 A;  4M7A G;  2P0Q A;  4C8Q C;  2QFZ A;  2E4H A;  2EVR A;  4DBH A;  3A8G B;  2KAF A;  4FSX A;  2EJ9 A;  4JJN K;  2DD5 A;  5GAO n;  3I56 A;  3M59 A;  5KYY A;  2EKH A;  3OYC A;  1BI0 A;  3CCV T;  4WTO B;  1M8V A;  1YIT A;  2DBK A;  4E2F B;  5HNB B;  3MEW A;  4FYW B;  3EG9 B;  2QA4 Q;  7AT1 B;  4XQ3 A;  2FG0 A;  3OYI A;  4CC3 A;  3CC2 T;  3EGD A;  1JBM A;  2CRE A;  4E7J A;  4A4E A;  5HVY B;  4EOS B;  3VKI A;  3CXC P;  1PM3 A;  1UEB A;  1M2V B;  4IUR A;  4LDY A;  4A4F A;  1RI0 A;  4F7L B;  1NPR A;  1N9R A;  2L3R A;  1E6H A;  4M78 D;  2MK5 A;  5GAM d;  3CCM A;  2X4W A;  1QVG A;  2X4J A;  3EG1 A;  1ZUK A;  1TG0 A;  3JCM f;  2JM9 A;  1TWB A;  2LQK A;  2AK5 A;  1FMK A;  2ATC B;  4C92 E;  1VQP Q;  2OTL T;  2M0Y A;  3CCS A;  2A36 A;  2EWN A;  1OQK A;  4F14 A;  3SWN A;  3JCM b;  2DM1 A;  1VQ5 Q;  2HEQ A;  3SWN B;  3OBY A;  3OYL A;  4M7D G;  2DJZ A;  3V8J A;  1VYT A;  3JCM X;  3DLM A;  4E47 A;  1E7P A;  2UZE B;  4F7S B;  4EC8 B;  2E1H A;  3HP9 A;  4I3Z B;  2RJD A;  2QDL A;  1R0B G;  2I53 A;  1XNI A;  2JS2 A;  4IUT A;  2EQU A;  3VS2 A;  5GJW B;  1NE8 A;  4HKE A;  1UJY A;  1XOV A;  1OGU B;  4D8D A;  3KFV A;  2DAQ A;  2DL3 A;  1JKW A;  3M5A A;  3REB B;  5GAN f;  1WFW A;  3MY1 B;  1OZ3 A;  2RB6 A;  4BAC A;  1LJO A;  5A0L A;  2X3X D;  1KK7 A;  3I55 T;  3S3M A;  1T3L A;  1QQJ A;  1OV3 A;  3EG3 A;  2RI3 A;  1N8R R;  3PVL A;  4Z88 A;  3CQT A;  2YUN A;  2MOX A;  2OI3 A;  4C5I A;  2LC4 A;  4E7Z A;  4J9E A;  4M78 B;  5FRN A;  2XD0 A;  5KYW B;  4JJD A;  2KYM A;  5KCO A;  2DXB A;  1RAF B;  2EYX A;  4M77 E;  4BBR M;  1PWT A;  2CCI B;  3QG1 A;  1FMV A;  2LX7 A;  1B7T A;  3OMC A;  1B34 B;  4PLL A;  3QSU A;  5GAN g;  1IGU A;  3H4C A;  3J80 E;  1I07 A;  1QMC A;  1ZP2 A;  3RKW A;  2F1L A;  4KGX B;  4BCM B;  4PJO E;  3CCU A;  3KXT A;  4DBQ A;  1JU5 C;  1AZG B;  3L2Q A;  2K4Y A;  3LYI A;  2MI6 A;  2PQW A;  3EJ1 B;  2DD4 B;  3KUF A;  1NEG A;  5IT9 E;  2RQT A;  1NJI R;  1WGS A;  3RMQ A;  2CZ7 B;  5GAN h;  4ROE A;  2RO0 A;  3BHU B;  1JOW A;  4GLM A;  4QVC A;  1AWO A;  1WX6 A;  2DL4 A;  2P0P A;  3I35 A;  4CFV B;  1IGQ A;  2IIM A;  2DX1 A;  1Q81 U;  4M7D C;  2HMA A;  2RA2 A;  2RQR A;  2DF6 A;  4JPB W;  4F6U B;  3EID B;  4ZGJ B;  1Y57 A;  2LNH B;  3G4S T;  2DXU A;  3E1S A;  2J6K A;  1MND A;  2EYW A;  1Q7Y C;  3OYB A;  3CPW A;  4NST B;  3CCS T;  1H1R B;  3CCE T;  2WAC A;  4BCN D;  2KMG A;  2NUT B;  5D6W A;  2EGA A;  3UDC A;  2CZ1 B;  3M0T A;  1U1S A;  2C0T A;  1F5Q B;  1OU8 A;  1YJN Q;  1GL5 A;  2WJ9 A;  4M75 A;  4JZ4 A;  2D1X A;  1O9K A;  1P5E B;  2JTF A;  2M02 A;  2CZ6 B;  4PLI A;  4BCI B;  2ABL A;  1PKT A;  1SRL A;  2FHD A;  5FU7 C;  1Q86 R;  4JX4 A;  2PVO B;  1K0X A;  5I22 A;  3G6E Q;  3VS4 A;  2LX9 A;  4M75 D;  2EQI A;  5GMK j;  5FU6 B;  4D8K A;  1SKU B;  1K73 U;  5M9O A;  1RAB B;  3OW2 P;  1QP3 A;  2XDB A;  1YIT T;  2FPD A;  5FRM A;  3OQ5 A;  3RR6 A;  4Y28 E;  1AHJ B;  2HQH A;  4A63 B;  2GTJ A;  2YRC A;  5D6X A;  2WIH B;  3QII A;  4Z8A A;  3CCE Q;  5GMK h;  1R8O B;  4KRC B;  5A0G A;  2PUO B;  3JCM V;  1BU2 A;  3I5R A;  4ZN1 A;  1PCX A;  4X1V A;  2EPD A;  4PJJ A;  1YCS B;  5IN1 A;  4BE1 A;  1K1Z A;  1WJS A;  3M55 A;  4F7J B;  3UF4 A;  5BNJ B;  3OYG A;  1VQ6 T;  4EOO B;  1GCQ A;  3T9N A;  3CCR A;  2L89 A;  3M0U A;  3I55 Q;  2IW6 B;  4BD3 A;  3CXC S;  3V7S A;  5DQV A;  3MP6 A;  2DD5 B;  4N0A A;  3MHX A;  3JCM P;  1C0M A;  3MEU A;  2DKG A;  2KE9 A;  3EFS A;  4C8Q E;  3QPH A;  1QCF A;  3BDL A;  4MML A;  1TTH B;  4WF2 A;  2E6N A;  1D1B A;  1M3B A;  2XKO C;  8AT1 B;  2ZPF B;  4AT1 B;  4UC4 A;  3CME T;  2SEM A;  5CIU A;  2EYZ A;  4LUD A;  1VQ4 Q;  2ROL A;  2LJ1 A;  2YSQ A;  4YOS A;  1YIJ A;  1VQL T;  2K3X A;  3EHQ A;  1RL2 A;  1OL2 B;  1VQK T;  1KFZ A;  2KRM A;  3ULR B;  1Q81 R;  1QLY A;  2O31 A;  3S6W A;  4BY1 X;  3OSV A;  3PIO A;  3CC7 T;  3CMA T;  3IQL A;  4F04 B;  2YUP A;  3OA6 A;  1MUZ A;  4JLI A;  3QDR B;  1KC8 C;  1H28 B;  2JOY A;  4J9G A;  5LJ3 e;  1H1S B;  2FEI A;  1QLB A;  5L8R E;  1W70 A;  1GUX A;  1YJ9 Q;  1P92 A;  3G6E A;  1NLO C;  4AKH A;  2JUF A;  3LGL A;  1WXB A;  4M7D D;  1YHQ Q;  3OW2 A;  2F5K A;  4AFS C;  4HVW A;  3M0S A;  3OY9 A;  1TS9 A;  2DLP A;  1O9K B;  3WVE B;  1D0Y A;  1VQN Q;  4F7U E;  2R7G A;  3EFO A;  3FJP A;  4FYV B;  3CD6 A;  2RM4 A;  1MV3 A;  3VUZ A;  4Y72 B;  4XTU A;  3JCM e;  2HD0 A;  5EFQ B;  3CD6 T;  4BCG B;  2VGM A;  1H92 A;  5LJ5 j;  4C0Z A;  1IXD A;  1SRM A;  3PMI A;  4J6W A;  2W9F A;  2K2M A;  1QWE A;  2KRN A;  3MJX A;  4DBR A;  2C5O B;  5GAN 6;  5CQY A;  1KHC A;  2WHB B;  2KEA A;  1VIN A;  1RLP C;  2DTI A;  1KHI A;  2QQ9 A;  4RTY A;  4IKF A;  2GGR A;  4XTX A;  2CUD A;  2L3Q A;  1QP2 A;  3CCJ Q;  5J3B A;  1WHH A;  1N4M A;  3LH5 A;  2W0Z A;  4M78 E;  5D6Y A;  3V7R A;  5EG2 A;  1UNH D;  3CCR Q;  4AKI A;  2XDP A;  1I4K 1;  1VQ8 T;  4EOP B;  2PMI B;  4M78 G;  2QQS A;  2K6D A;  1WYX A;  2EJF A;  2BZY A;  1GUX B;  4B9X A;  3CC2 A;  1QW1 A;  3UAT A;  2JGZ B;  2H8H A;  2HSP A;  4X9C A;  5GAO m;  2ZCF B;  5GAN 7;  4HCC A;  2K7A A;  4M6V A;  4JJC A;  3BLH B;  2JZ2 A;  1S72 A;  4RTW A;  1F1B B;  4OP0 A;  2ZAE A;  1VIE A;  2CP3 A;  3FC3 A;  2DIQ A;  5HBJ B;  1VQ4 A;  4BCH B;  2DXC B;  2LCC A;  3BG3 A;  2RPN A;  5DLQ E;  1YIJ Q;  2C4G B;  2ZPE B;  3OW2 S;  1BK2 A;  4M7A C;  1XTD A;  2DZC A;  3OS5 A;  2X51 A;  1K76 A;  4M77 F;  4HNV A;  4ELY C;  4YOO A;  1RAI B;  5LL6 S;  1TUD A;  4PJN A;  4BCK B;  3X28 B;  1BI3 A;  1B07 A;  1G2B A;  3OS1 A;  5DM7 R;  4XU0 A;  1VQ6 A;  2C5V B;  1YHQ T;  4NC6 A;  3L2Z A;  3J7A F;  4WCI A;  2ZPB B;  2CT4 A;  1N9S A;  2C5N B;  1UGV A;  4BCQ B;  1D1C A;  1NEB A;  2E12 A;  3BHV B;  5FU7 B;  1I8F A;  3G71 Q;  4EIK A;  4BUG A;  1AIS B;  2EBP A;  4BI3 A;  1D0X A;  4OGE A;  2ED0 A;  2VB6 A;  3DB3 A;  3FDR A;  1U5S A;  4F6W B;  1UEC A;  4M7D A;  4M7D F;  4PJO C;  1PD0 A;  1YBY A;  2G77 A;  1M1G A;  1SSF A;  2BKD N;  2Y4Y A;  1BKB A;  2E65 A;  5FWB A;  2OTJ A;  3VV0 A;  1B3Q A;  3CCJ T;  2DXC A;  1KSW A;  2KNB B;  3DB4 A;  3NTI A;  4A4K A;  3VS0 A;  3OYK A;  4EOJ B;  1VA7 A;  4F7U A;  3JCM J;  5L2W B;  1NJI C;  2EIF A;  1E6G A;  1WHK A;  2OTJ T;  4BCF B;  1LOJ A;  2I2L A;  3CCJ A;  3P8D A;  4C8Q D;  2AZS A;  4ELZ C;  5J39 A;  3G7Z A;  3QWY A;  1QVF P;  4EOL B;  3CCL Q;  3V8L A;  1W1F A;  3CC2 Q;  3AHU A;  2BS2 A;  3TVT A;  1GH6 B;  4LOC A;  2O4X A;  1BI1 A;  3L2W A;  4MIM A;  2LNV A;  3FIF A;  4RCC A;  4PFP A;  3VYG A;  3VKH A;  2MCN A;  1N8R C;  3DTO A;  2PHG A;  5CVI A;  5LJ5 d;  3MPU B;  3NGP A;  1SF9 A;  3QYB A;  2G3R A;  1SHF A;  2KT8 A;  2KK4 A;  1I5L A;  1VQP T;  2OTL Q;  1ZHI A;  2V22 B;  2O9V A;  1Y07 A;  4F7U F;  3M0R A;  2KI7 A;  2A08 A;  2F2V A;  3QHW B;  4QQ6 A;  4R56 A;  4F7N B;  2M16 A;  4HCZ A;  2HBP A;  4KGV B;  5KYY B;  3BY7 A;  3JCM c;  4IIO A;  2FB7 A;  1DJ7 B;  4PK4 A;  1FWZ A;  4ORZ A;  1ABQ A;  5EC7 A;  2NUP A;  1Y71 A;  2GQI A;  1VQO Q;  3TEE A;  1YJ9 T;  2COY A;  1PRM C;  4XU2 A;  4R0K A;  2LZ6 B;  1YJN T;  4ROC A;  3VU3 C;  3UA6 A;  2LW4 A;  3P8B B;  4OB2 B;  4MZT A;  1QKX A;  3FRN A;  1PHT A;  4RKU E;  1NG2 A;  1VQN T;  3VS1 A;  1I81 A;  3VUB A;  2OTJ Q;  4OMP A;  1IHV A;  4FYX B;  5GAN j;  2HKN A;  2DJQ A;  2DER A;  1VQK Q;  3A8L B;  4J7F A;  1NJI U;  2NUT A;  3GPL A;  4NOY A;  3C95 A;  3OS2 A;  3EOC B;  4F7U G;  3DOG B;  4M77 A;  4J7I A;  4QW2 A;  4HNT A;  1TSF A;  1K9M U;  1VOL A;  4M78 A;  2CSI A;  4E7S A;  3JB9 H;  2YRV A;  3FLG A;  2RHI A;  3U23 A;  1C1A A;  2DVJ A;  3EG9 A;  4RMO A;  5LJ3 h;  2AKL A;  1H8K A;  3G71 T;  1OPL A;  1SHG A;  4EMG A;  2KVQ G;  1IO6 A;  1M3C A;  4OMF B;  2R57 A;  1WJR A;  1VQO T;  1YI2 A;  3V8K A;  4C0D B;  4M75 B;  2O88 A;  2RK1 A;  2DIG A;  2R5M A;  1WI7 A;  5CR2 A;  3OS0 A;  1U1T A;  2L0A A;  4RTV A;  4R55 A;  2GF7 A;  2CUB A;  2E6Z A;  4C92 G;  2LJ0 A;  2HL5 C;  2DL7 A;  1PNJ A;  3M03 A;  4QVD A;  2YWW A;  5D7U A;  3TSW A;  4M4Z A;  3QJY A;  2OTL A;  4RG8 A;  3VS7 A;  1JSU B;  2CP6 A;  1EIF A;  3EH2 A;  4HT8 A;  1K0S A;  3QYE A;  5GAO l;  1OUL A;  4ESR A;  5ACB A;  4BI8 B;  4GY5 A;  1Q86 U;  1V1C A;  3H0H A;  3EG2 A;  4X34 A;  3TNI B;  4EOQ B;  1VQ8 A;  2DET A;  1OL1 B;  2IVW A;  5IHN A;  4HXJ A;  3RNJ A;  4LDX A;  4Y91 A;  4BB7 A;  3EFR A;  2QDJ A;  1UGP B;  3AT1 B;  1PKD B;  4HT9 A;  1O75 A;  1JST B;  3NPF A;  4HCK A;  4LN2 A;  3CPW S;  3DLL A;  1GY3 B;  3REA B;  1LVK A;  4M77 C;  1X01 A;  4C92 A;  3KHI A;  3CMA A;  4PFO A;  3VS3 A;  1X2Q A;  1YCY A;  4Z6Y A;  5KE2 A;  2L3P A;  1QVF S;  2C0I A;  1VQM T;  2KR6 A;  3V7C A;  2PZ1 A;  1AVZ C;  2KR3 A;  2GFU A;  2IW9 B;  3X24 B;  2DL8 A;  3VRZ A;  2A3L A;  4M78 C;  4QVZ A;  3TU4 K;  1KC8 R;  1QVG S;  5CKD A;  1MHN A;  5DQW A;  1N8R U;  4YC3 B;  2JMC A;  3CC4 T;  2D8J A;  1I5O B;  1WHM A;  2NLU A;  1QWF A;  4NL2 A;  2HCK A;  4KRT A;  1Q81 C;  4XAX B;  2LCS A;  2NUZ A;  1X69 A;  2CKK A;  1OOT A;  3ME9 A;  3CCV Q;  2KY9 A;  3HHT B;  4FU6 A;  2NYS A;  3EHR A;  2EGC A;  1JEG A;  2F2C A;  1HD3 A;  3MKD A;  2V8I A;  2COZ A;  5IDP B;  2X9H A;  4D6W A;  2YUQ A;  3G4S A;  1YJW A;  3CCQ A;  2D8H A;  4HA8 A;  3JB9 G;  3DKM A;  1OI1 A;  4MZP A;  2K5I A;  4E7L A;  3QDF A;  1QKW A;  2DK3 A;  2GTO A;  2RQU A;  3RGF B;  2DD4 A;  5CCA A;  4HNU A;  2VKN A;  3TQ7 P;  2CH4 W;  5C0M A;  2VV5 A;  1M1K R;  3E19 A;  1ZBJ A;  1UB4 A;  1BIB A;  3H6Z A;  3CPF A;  1YWP A;  3RMS A;  2AKK A;  3EG0 A;  1ZX6 A;  4IUP A;  1WDX A;  1QCN A;  4OGR B;  1G5V A;  3I56 Q;  1XJW B;  2EKO A;  2EQK A;  1AZE A;  3DJB A;  1NZ9 A;  2WMA B;  2CP2 A;  2MAM A;  1WPY A;  4ELJ A;  2BZ8 A;  2QA4 A;  3JB9 I;  1K8A R;  4EPC A;  2VAS A;  2QGG A;  3JSC A;  2VC8 A;  2DXT A;  3O0G D;  3QWL A;  1Y0M A;  3LQ5 B;  1KQS A;  1TU0 B;  4J9D A;  3R6O A;  4XTZ A;  5GAN 3;  3L2R A;  1ZA2 B;  1BCO A;  4M77 G;  5GAO r;  1U3O A;  3M9Q A;  3M4G A;  4OR5 B;  3BDU A;  5CKF A;  3M0P A;  3NFC A;  3I9Q A;  2QAZ A;  1HXD A;  4EMK C;  1YIJ T;  4QQD A;  3LW5 E;  2IG0 A;  4AFU C;  1QCO A;  3OB9 A;  2FO0 A;  1X43 A;  2QTX A;  2CYZ B;  3G33 B;  2RHZ A;  4J9B A;  1JJ2 A;  3H8Z A;  2DTO A;  3QZ5 B;  1M90 U;  2DFU A;  1TUG B;  4CFX B;  1VQ5 A;  2EQJ A;  2RJC A;  3JCM Q;  1OX9 A;  2QTV A;  4PKC C;  1GCP A;  1K9A A;  4YOZ A;  5GAN e;  3P8H A;  2E70 A;  1UHC A;  1RAG B;  2DRK A;  4CI0 C;  3H0I A;  3G4S Q;  3TNW B;  2BPM B;  4HLQ A;  3C0C A;  1S1N A;  1M2V A;  3CBO A;  1VQM A;  2CCH B;  3NTH A;  1X6G A;  2J6O A;  2LVM A;  4LDW A;  4CC2 A;  2P4T A;  4M7A A;  4X9D A;  2MWP A;  1UG1 A;  1JQQ A;  1OIY B;  3CBP A;  5LMK B;  5DY9 A;  4ELL A;  5GMK l;  4VUB A;  4IUU A;  3X26 B;  3CC4 A;  2KBT A;  3I5S A;  2WFY B;  1OX8 A;  3QWX X;  5FRO A;  1CSK A;  4JS5 A;  4OB0 B;  1W2B A;  2EUF A;  4N4G A;  4BE2 A;  1PSF A;  2SRC A;  2HSE B;  3HRT A;  4BDZ A;  1GRI A;  1FX7 A;  1N5Z A;  2RHY A;  3GNF B;  3BHT B;  4BXX X;  5GAM e;  5HBH B;  2K3B A;  4CRI A;  2QK0 A;  3OYD A;  1IRX A;  2XU8 A;  1IHW A;  2HBW A;  1X27 A;  4KRD B;  1ZA1 B;  5ICP B;  1PC0 A;  2RK2 A;  1ZSZ A;  2DEQ A;  2DNU A;  1AT1 B;  3QKJ A;  1LNX A;  3DDQ B;  3OYJ A;  5HK0 A;  1MMA A;  1TOV A;  4IUV A;  3OYM A;  3A8O B;  3K7A M;  2JW4 A;  2V26 A;  4PL6 A;  1KC8 U;  4C8Q A;  4Y92 A;  2E10 A;  4N4I A;  4ZGE B;  4C0D C;  2PNI A;  2DMO A;  3TW6 A;  2LJ3 A;  4C5E A;  2A37 A;  2K9G A;  1VQ7 T;  1C6V X;  1U06 A;  3M4Y A;  4PJO G;  3JB9 F;  1MNE A;  3VYH B;  1EZZ B;  4FCY A;  3JCM g;  5IHK A;  1MMD A;  2ENM A;  4KH0 B;  1OEB A;  3MP1 A;  1RUW A;  3OYF A;  2EQM A;  3A8M B;  3SHW A;  3ZL7 C;  5KYW A;  1Z9Q A;  2KMT A;  4PJO A;  3J81 E;  4ROD A;  2ROT A;  3PNW C;  2WSC E;  1LPL A;  3JB9 D;  2ZGW A;  4OMO A;  5IHI A;  5LJ5 f;  3PO3 S;  2D0N A;  3L2V A;  2FPF A;  5CQX A;  4BCQ D;  4FM4 B;  2JTE A;  4EOM B;  2K57 A;  2ZZD B;  2A0F B;  4LDU A;  2IN3 A;  1VQM Q;  2E3H A;  2WPA B;  4C8Q B;  4AFQ C;  2E5Q A;  1VOM A;  4M78 F;  2EAY A;  1QVP A;  3UT1 A;  1BYM A;  1U8R A;  4XK8 E;  1YJN A;  5CK9 A;  4AFZ C;  4Z02 A;  4IMY B;  1KQ1 A;  3TCJ A;  5KYU B;  4N4H A;  2L2P A;  2XID A;  2BE9 B;  4F70 B;  1ZSZ B;  2K2V A;  3A98 A;  4BCO B;  5IHY A;  3CC4 Q;  3QZ9 B;  1AD6 A;  3ZFJ A;  2COW A;  1V29 B;  3BFM A;  1IRE B;  3G1J A;  4E6R A;  1ZBX A;  1KD1 C;  4JRQ A;  2O2O A;  1KXU A;  4JX6 A;  2CDT A;  3E9F A;  2HDA A;  3THK A;  1M1K U;  4EMK A;  1UJ0 A;  2LDM A;  3VKG A;  2MIO A;  1X6O A;  5CKE A;  2PU9 B;  3BE3 A;  1G3Y A;  3H9N A;  3OBW A;  1ZSG A;  2F2W A;  3PTA A;  4G6L B;  4C0F A;  2C06 A;  4QQG A;  1ACM B;  3OYA A;  4OVA A;  4HVU A;  3URG A;  4M77 D;  4C92 C;  1K9M R;  2J6F A;  4OMQ A;  5I5Z B;  3CCE A;  5HQ0 B;  5LJ3 j;  3FJ5 A;  4MDW A;  4HCB A;  1M8M A;  2PUK B;  3VS5 A;  3DDP B;  1WQ7 A;  4XU1 A;  1G3T A;  2XK0 A;  5LJ3 g;  1UFF A;  8ATC B;  1G3N C;  4KUL A;  1EFN A;  2IW8 B;  4AG1 C;  2KRS A;  2XMF A;  1FKM A;  1OPK A;  1M4Z A;  1OKV B;  3GOX A;  4Z89 A;  2VYT A;  2QQ8 A;  9ATC B;  4BBS M;  1VQP A;  1OZ2 A;  2MYS A;  2MWO A;  5LQF B;  2DPP B;  1HJD A;  2DME A;  2DTH A;  4PJO D;  4RTU A;  1FVV B;  3M0Q A;  2DYI A;  2LTO A;  2CZ0 B;  2P84 A;  2PK2 A;  1GFC A;  3ER0 A;  1PG5 B;  1SG5 A;  3PMT A;  3CCU T;  2B9R A;  2KXC A;  4LXC A;  2PVG B;  4NS5 A;  2QQB A;  4CC4 B;  2ZPH B;  4XTY A;  2H3J A;  2VGN A;  3NTK A;  4AMC A;  4F6S B;  3RUX A;  1NLP C;  2WXV B;  2V8J A;  1RLQ C;  1PRL C;  2X4Y A;  2JNG A;  3QBY A;  2HAX A;  5C6S A;  1M5Q 1;  3CCQ T;  2B86 A;  1Q95 G;  1KQ2 A;  1B34 A;  3QUI A;  2X1N B;  1TD6 A;  4DOV A;  1H3H A;  1ZUY A;  2P4R A;  3EGX B;  1XO2 A;  3CEY A;  5KYX A;  2CH4 A;  1YHQ A;  4KBM B;  3TW7 A;  3C12 A;  2F69 A;  2A7Y A;  1OKW B;  2E41 A;  3RES A;  1OIU B;  2CSQ A;  3GNG A;  5KYU A;  2AT1 B;  4C0G A;  5HBE B;  4M7A B;  1BI2 A;  4MDX A;  3EGU A;  1K73 R;  3MIA B;  4C92 F;  2ED1 A;  1BB9 A;  2UUE B;  3CCU Q;  1JXO A;  1OYX A;  5GAM j;  3L42 A;  3S3O A;  3FB9 A;  2DVE A;  2PVD B;  4EOI B;  2QA4 T;  4HL4 A;  1AWX A;  4A4H A;  2ESW A;  4KT0 E;  1QVG P;  2RI5 A;  3PVQ A;  1KIK A;  3QYG B;  4J9F A;  3PFS A;  3NHN A;  3SEM A;  1AD5 A;  4KGZ B;  4CXA B;  4ATO A;  2W96 A;  4EOR B;  2QAS A;  4FW2 A;  5I2S A;  4II1 A;  1Q82 U;  1OU9 A;  1A0N B;  5FW9 A;  5GJV B;  3S3N A;  4RTZ A;  3C94 A;  1M2O A;  4BY6 C;  1YNZ A;  3M58 A;  2M9U A;  2W10 A;  1PKS A;  4RTT A;  1GFD A;  4LD9 K;  3ASK A;  1UGR B;  1S72 Q;  1YJW T;  1CKB A;  1SEM A;  4OB3 B;  2FL7 A;  2H3E B;  1GXI E;  2WIP B;  2DL5 A;  3M54 A;  3H41 A;  3EAE A;  4LUE A;  2DBM A;  4M7D E;  1AOJ A;  5HY6 A;  3WXM B;  3FEO A;  2YLB A;  3CCR T;  1G8X A;  5HCK A;  3MEA A;  1JO8 A;  1YFN A;  3JCM d;  1K4U S;  3PGG A;  2KQW A;  1RAC B;  2BS4 A;  2L8D A;  3VYG B;  1M9S A;  1G83 A;  1MGQ A;  4CFU B;  1W2B S;  3RBB B;  3A1P A;  2LMJ A;  3HSB A;  2VUB A;  3MEV A;  4DEY A;  4BCN B;  2V1Q A;  1YI2 T;  3WVD B;  2F2X A;  4ZTJ A;  1W2B P;  1Q7Y U;  3G71 A;  1UTI A;  4M75 C;  2BZX A;  4CFM B;  4DEX A;  3HZJ A;  1WNL A;  2LRQ A;  4PJO B;  2EGE A;  2RI2 A;  1VQ9 T;  2LT1 A;  3BW1 A;  2M1H A;  1FMW A;  2BE7 D;  2RMO A;  4OMM A;  1PSE A;  2EW3 A;  4RTX A;  2KYB A;  4CFW B;  5EJC A;  1BU1 A;  1T3S A;  5GAN 4;  1Y96 B;  2IPO B;  2E5K A;  5GAN 8;  1Y96 A;  2HQE A;  1MMN A;  2WMB B;  1WJQ A;  3HFO A;  5GMK i;  4O5V A;  1W98 B;  4LE9 A;  2FRY A;  4C5G A;  4AG2 C;  4F17 A;  3MI9 B;  1O9S A;  2C5X B;  3E9G A;  2YDL A;  2CS7 A;  4FX3 B;  2JN0 A;  2PJQ A;  5GAM h;  2FRW A;  1WA7 A;  1D3U B;  1SPK A;  3TRE A;  4FT4 A;  1Z9Z A;  2ZPI B;  5GAN d;  1GCQ C;  4CFN B;  3I55 A;  2XDD A;  4PJO F;  1NM7 A;  1UUE A;  4UN0 A;  3R6N A;  5GAM g;  1UNL D;  3MY5 B;  1W4S A;  2C6T B;  2YUO A;  3X20 B;  1BCM A;  2M51 A;  2K5F A;  4OMN A;  1RAH B;  1VUB A;  3PIP A;  3GP8 A;  1AEY A;  2FZK B;  2JS0 A;  1Q7Y R;  2GQV A;  4MFD A;  2QQR A;  2YLC A;  4AKG A;  2YXY A;  2P0K A;  4JS4 A;  3L2U A;  5CKH A;  5KE3 A;  3LWI A;  1MMG A;  4ZN3 A;  2XG8 D;  1AWJ A;  1D0Z A;  1ENW A;  1X75 C;  1URC B;  2O01 E;  4A53 A;  2EJG A;  3RKY A;  5I11 A;  2FZG B;  3EGD B;  3TNH B;  5HKC A;  4II5 B;  2E3I A;  2RHU A;  2OAW A;  1TXQ A;  3EFO B;  3NMZ C;  1BBZ A;  3VS6 A;  2WSE E;  4M75 G;  2W99 A;  2O4X B;  1SSH A;  4LNP A;  2W2H A;  4BCM D;  3E2U A;  2D6F A;  2LQ8 A;  2M0O A;  2OAU A;  4OGC A;  2D9T A;  1KD1 R;  1NYG A;  3GIB A;  1YJ9 A;  1AWW A;  3OYY A;  4DOW A;  4RCB A;  1GBQ A;  1KD1 U;  2QF7 A;  4EOK B;  5AYF A;  3PE0 A;  3BG5 A;  2BTT A;  3ZEH A;  5IXF A;  5LJ5 h;  1VQN A;  1CKA A;  3VRY A;  4ZNX A;  3CD6 Q;  1ZQ1 A;  1D09 B;  5IAY A;  3F5X B;  3SD4 A;  1H64 1;  3B57 A;  2FPE A;  1QMZ B;  3UA7 A;  3JCM h;  1Q82 C;  2YT6 A;  1IZ6 A;  5LJ3 d;  4M7A D;  4M75 E;  5CEI B;  3OYH A;  2JM8 A;  4C8Q F;  3CXC A;  1ARK A;  1UGQ B;  2AIR B;  1H4L D;  1WLP B;  4JRP A;  3RKX A;  1H25 B;  2BUD A;  4E7H A;  5J26 A;  4OB1 B;  4C8Q G;  1E7O A;  2RHX A;  4A54 A;  1K8A U;  1K9M C;  5DLO A;  4DBF A;  2DEU A;  1TH7 A;  1ABO A;  3POM A;  2K79 A;  3HRS A;  5CYI B;  2HKQ B;  1WXU A;  2EYQ A;  3MO8 A;  1M1F A;  2DRM A;  3RER A;  2DE0 X;  2BKZ B;  2DYB A;  1KQS S;  2AHJ B;  1JJ2 P;  2IVX A;  2L3S A;  2JVV A;  2LQN A;  4TVR A;  1GBR A;  2W9Z A;  3HBL A;  3CPW P;  2CT3 A;  4KH1 B;  4GBQ A;  2J06 A;  2MF2 A;  4FT2 A;  1H3Z A;  1VQ7 Q;  4XTW A;  1R77 A;  3PT9 A;  2XI9 A;  5GAN 5;  3JAM E;  2KRO A;  3QXE B;  1WHG A;  3JCM W;  1TFB A;  4L6V 5;  3CC7 Q;  1Q82 R;  1E9H B;  4M7A F;  4CFU D;  1PD1 A;  2AZV A;  3QYH B;  2NWM A;  2X3W D;  2YHT A;  4F7U B;  2QG9 B;  4J9C A;  1VQ5 T;  1VYU A;  2CP0 A;  4JRI A;  3CBM A;  4JUV A;  1VQ4 T;  5GAO q;  3MCA B;  1VQ6 Q;  4BCP B;  4ZTF A;  4J9I A;  3A8H B;  1Y7X A;  2PTK A;  1Q86 C;  1JXM A;  2UZD B;  3HPW A;  3F70 A;  3NDQ A;  2QQA A;  1VQ8 Q;  3RIR A;  1VIF A;  1N27 A;  2BIV A;  2RN8 A;  4J6X A;  4XTV A;  4F16 A;  2DO3 A;  2UZB B;  4V2S A;  1H27 B;  1EX4 A;  2QI2 A;  3OMG A;  4LD6 A;  5CO7 A;  2I0N A;  2JMA A;  4ZGD B;  5FU6 C;  1D3B B;  3O5Z A;  1C9B A;  2CGH A;  3RDV A;  3MET A;  1UHF A;  3I56 T;  4FYY B;  3LGF A;  2VWF A;  1TUC A;  1RAE B;  4BE0 A;  2ZPG B;  2VXE A;  2XIC A;  3KBG A;  4L59 A;  5IH2 A;  4J83 A;  3M56 A;  4MZM A;  2UZL B;  1R0C B;  1KJW A;  1FIN B;  2GBQ A;  2X4X A;  3SWN C;  2PK9 B;  5I2M A;  6AT1 B;  2HQX A;  3HL8 A;  1S72 T;  3TN8 B;  1HSQ A;  1M90 C;  2YRD A;  5LJ5 g;  1UGS B;  2HL3 A;  2QXF A;  2QEX A;  3CCL A;  3HFN A;  3SFM A;  2NUP B;  3H0F A;  1QVF A;  1X6B A;  3CCV A;  1M30 A;  4JZ3 A;  2JJ9 A;  3CCM T;  3UPU A;  3HO8 A;  2QYZ A;  3EGX A;  2XHC A;  3GF5 A;  4J8O A;  4M75 F;  1XQH A;  4ANJ A;  2KT1 A;  2EYY A;  1G3W A;  2GFA A;  4BCJ B;  4MMK A;  1VQ7 A;  4JJB A;  1YJW Q;  5IDN B;  3BLQ B;  4OML A;  1H1Q B;  4FW1 A;  1N6A A;  2L5Q A;  2E64 A;  3QJ6 A;  3C4S A;  4FIB A;  1BIA A;  5FWC A;  2DZ9 A;  4C92 D;  1HK9 A;  3CC7 A;  2G9X B;  4MFE A;  4L5G A;  5L23 A;  1LCK A;  3HRU A;  5AT1 B;  5FGK B;  4NL3 A;  2RJF A;  3L1A A;  4KUI A;  2KXD A;  2F5T X;  2R58 A;  4QKU A;  5GMK m;  4JX5 A;  1H1P B;  3GLX A;  4M7D B;  1VYV A;  4N0A C;  1I1J A;  3DL1 A;  3CME A;  2X35 A;  1M3A A;  2LQW A;  2FYK A;  1VQO A;  4BY7 X;  2D0Q B;  2KDS A;  3VJP A;  3EH1 A;  5FLX E;  5I21 A;  2HZY A;  4K11 A;  4M7A E;  4BY6 B;  2J05 A;  5GAO p;  4HVV A;  2JT4 A;  4LDV A;  4OF1 A;  4PNO A;  1W6X A;  1ZUU A;  2Z0W A;  2JTM A;  3OSS C;  3JRZ A;  1OI9 B;  1JB0 E;  2EFI A;  1VQK A;  4E7I A; 
#chains in the Genus database with same CATH homology
 4HL4 A;  4ZN1 A;  4A4H A;  4EMH A;  2GFU A;  4KT0 E;  3X24 B;  2RI5 A;  3M53 A;  5IN1 A;  4BE1 A;  5LJ5 e;  2A3L A;  4M78 C;  4QVZ A;  3TU4 K;  1WJS A;  3M55 A;  1QVG S;  5CKD A;  1MHN A;  2WSF E;  3A5Z B;  3OYG A;  3QYG B;  1N8R U;  3PFS A;  3CC4 T;  1VQ6 T;  2VXF A;  3T9N A;  3CCR A;  4ATO A;  2NLU A;  2L89 A;  4NL2 A;  4A4G A;  1FXX A;  4BI4 A;  2MMP A;  4II1 A;  5I2S A;  1Q82 U;  4O6J A;  4BD3 A;  1Q81 C;  3CXC S;  4XAX B;  3V7S A;  3MP6 A;  2CKK A;  1K8A C;  2DXB B;  3S3N A;  4EMK B;  2DD5 B;  1WQW A;  4N0A A;  3MHX A;  2K5L A;  3C94 A;  3ME9 A;  4BY6 C;  3MEU A;  3JCM P;  3M58 A;  3SDZ A;  2KY9 A;  2M9U A;  2DKG A;  3HHT B;  3EFS A;  4FU6 A;  4C8Q E;  4C5H A;  3QPH A;  3BDL A;  4MML A;  1VQL A;  2LT4 A;  5HK3 A;  4WF2 A;  4AI6 A;  4LD9 K;  3ASK A;  1UGR B;  4P5N A;  2E6N A;  4EDU A;  2XKO C;  3OYN A;  4QSH A;  1YJW T;  4OB3 B;  2FL7 A;  2V8I A;  4Q5W A;  1GXI E;  2ZPF B;  4D6W A;  4UC4 A;  3CME T;  3M54 A;  3JB9 J;  3G4S A;  1YJW A;  5CIU A;  3CCQ A;  3EAE A;  4HA8 A;  3JB9 G;  3INZ A;  3DKM A;  1OI1 A;  4MZP A;  2K5I A;  4JDS A;  4E7L A;  1YIJ A;  1VQL T;  5HY6 A;  4M7D E;  3WXM B;  3FEO A;  2K3X A;  2YLB A;  2DK3 A;  3CCR T;  3MEA A;  1RL2 A;  1VQK T;  2DD4 A;  5CCA A;  3JCM d;  1G3S A;  3UWN A;  4HNU A;  3LH0 A;  3LWH A;  3S6W A;  5C0M A;  2VV5 A;  3OSV A;  2KQW A;  3PGG A;  4JRK A;  3E19 A;  2BS4 A;  2FVU A;  3PIO A;  2L8D A;  3CC7 T;  3VYG B;  1M9S A;  1MGQ A;  1UB4 A;  3CMA T;  1BIB A;  3OA6 A;  3H6Z A;  4JLI A;  4DA4 A;  1W2B S;  3QDR B;  1KC8 C;  2RJE A;  3Q1J A;  3CPF A;  2JOY A;  2K3Y A;  3LX7 A;  5LJ3 e;  3HSB A;  4GLK A;  4E7K A;  3RMS A;  2KSS A;  2VUB A;  2HNI A;  1QLB A;  3MEV A;  3QHS A;  1D3B A;  5L8R E;  3CCL T;  4BDY A;  1YI2 T;  3WVD B;  4KUD K;  4IUP A;  5GAM f;  2QDY B;  1P92 A;  3G6E A;  4ZTJ A;  1Q7Y U;  4AKH A;  2JUF A;  1G5V A;  3BG9 A;  3LGL A;  2EKO A;  2EQK A;  3O8V A;  4M75 C;  5CKB A;  3G71 A;  2RD1 A;  4M7D D;  3HZJ A;  1K73 C;  3OW2 A;  1WNL A;  1NZ9 A;  2LRQ A;  4PJO B;  2F5K A;  2RI2 A;  3SB2 A;  3OY9 A;  2MAM A;  1WPY A;  4B9W A;  1VQ9 T;  2LT1 A;  4ELJ A;  3WVE B;  3BW1 A;  3MP8 A;  2QA4 A;  4F7U E;  3FJP A;  3JB9 I;  2M1H A;  3CD6 A;  1PSE A;  2RM4 A;  3VUZ A;  4EPC A;  4XTU A;  3HKS A;  3JCM e;  2HD0 A;  3CD6 T;  5EJC A;  3JSC A;  2B8A A;  2VGM A;  2VC8 A;  2DXT A;  5GAN 4;  3G6E T;  5LJ3 f;  1Y96 B;  3N5B B;  3QWL A;  5LJ5 j;  4C0Z A;  5GAN 8;  1Y96 A;  1KQS A;  2LCL A;  3PMI A;  4J6W A;  2HQE A;  3R6O A;  1JJ2 S;  1WJQ A;  1NPP A;  4XTZ A;  3HFO A;  5GAN 3;  3L2R A;  5GMK i;  4O5V A;  4M77 G;  5GAN 6;  5GAO r;  2V8K A;  5CQY A;  1KHC A;  3LLR A;  3M9Q A;  4C5G A;  3M4G A;  1O9S A;  2GCX A;  2DTI A;  3E9G A;  1KHI A;  3BDU A;  2QQ9 A;  3QO3 A;  2CS7 A;  2JN0 A;  2ZZD A;  4DQ2 A;  5CKF A;  5GAM h;  1VQ4 A;  3NFC A;  4XTX A;  5KCH A;  4IKF A;  1QP2 A;  4J5Y A;  5J3B A;  4M78 E;  1HXD A;  4EMK C;  4M7A G;  5D6Y A;  3TRE A;  4J6Y A;  5EG2 A;  4FT4 A;  3V7R A;  4AKI A;  2ZPI B;  2XDP A;  4C92 B;  3OYE A;  1I4K 1;  4YTL A;  2Y4X A;  1YIJ T;  1VQ8 T;  5GAN d;  4QQD A;  3LW5 E;  4M78 G;  2IG0 A;  2QQS A;  3I55 A;  2XDD A;  3OB9 A;  2EJF A;  2CYZ B;  2QTX A;  2RHZ A;  4B9X A;  4PJO F;  1JJ2 A;  3CC2 A;  1QW1 A;  3H8Z A;  2DTO A;  5GAM g;  3QZ5 B;  1M90 U;  5A2Q E;  4X9C A;  1W4S A;  1VQ5 A;  5GAO m;  2EQJ A;  2RJC A;  2ZCF B;  4IUQ A;  3X20 B;  3JCM Q;  5GAN 7;  1KG1 A;  4HCC A;  2R5A A;  4M6V A;  4PKC C;  4FL6 A;  2K5F A;  5CAI A;  5GMK e;  1VUB A;  2JZ2 A;  3PIP A;  3GP8 A;  2BS3 A;  5GAN e;  1S72 A;  3P8H A;  2E70 A;  4OP0 A;  4RG2 A;  4CI0 C;  4JLG A;  1VIE A;  2GQV A;  4ME7 A;  3FC3 A;  4MFD A;  2DIQ A;  2QQR A;  2YLC A;  1M1K C;  4AKG A;  2P0K A;  5KH6 A;  4HLQ A;  3L2U A;  5CKH A;  4JS4 A;  2LCC A;  2DXC B;  2QEX T;  3BG3 A;  5DLQ E;  5KE3 A;  3LWI A;  2ZPE B;  3CBO A;  4XU3 A;  4ZN3 A;  2XG8 D;  1VQM A;  3OW2 S;  4M77 B;  3NTH A;  4M7A C;  1X75 C;  1XTD A;  2LVM A;  2P4T A;  4LDW A;  2DZC A;  2O01 E;  3OS5 A;  2EJG A;  4M77 F;  3RKY A;  4A53 A;  3X25 B;  4HNV A;  4X9D A;  4ELY C;  4M7A A;  2MWP A;  5HKC A;  2RHU A;  5LL6 S;  1VQ9 A;  3CBP A;  5DY9 A;  1JRI A;  2Y90 A;  2RH2 A;  3X28 B;  3M57 A;  1BI3 A;  5A0D A;  5GMK l;  5GAN 2;  2WSE E;  4VUB A;  3OS1 A;  3HB9 A;  4IUU A;  3X26 B;  5DM7 R;  4XU0 A;  4M75 G;  3ZBD A;  1YHQ T;  2O4X B;  3CC4 A;  1VQ6 A;  4NC6 A;  2P0Q A;  4C8Q C;  4JS5 A;  3L2Z A;  2QFZ A;  5FRO A;  3J7A F;  4OB0 B;  1W2B A;  2D6F A;  4BE2 A;  3A8G B;  4N4G A;  2KAF A;  2ZPB B;  2LQ8 A;  1N9S A;  2M0O A;  1PSF A;  2OAU A;  2D9T A;  4FSX A;  4OGC A;  3GIB A;  2EJ9 A;  1YJ9 A;  2E12 A;  4JJN K;  3OYY A;  2DD5 A;  5FU7 B;  4RCB A;  3HRT A;  4DOW A;  5GAO n;  3I56 A;  4BDZ A;  3M59 A;  1KD1 U;  1I8F A;  1FX7 A;  2QF7 A;  2RHY A;  3OYC A;  1BI0 A;  3GNF B;  3CCV T;  4BUG A;  5GAM e;  4BI3 A;  4CRI A;  1M8V A;  4OGE A;  3OYD A;  1YIT A;  5AYF A;  3DB3 A;  2XU8 A;  3FDR A;  4M7D A;  4M7D F;  3BG5 A;  3ZEH A;  3MEW A;  4PJO C;  1YBY A;  4XQ3 A;  5LJ5 h;  3OYI A;  1VQN A;  2G77 A;  1M1G A;  1SSF A;  2DEQ A;  2RK2 A;  1ZQ1 A;  3QKJ A;  3CC2 T;  2BKD N;  1LNX A;  5IAY A;  3SD4 A;  1JBM A;  1H64 1;  2Y4Y A;  3OYJ A;  1BKB A;  2E65 A;  5HK0 A;  4IUV A;  3JCM h;  4A4E A;  3OYM A;  3A8O B;  4E7J A;  1Q82 C;  2OTJ A;  3VKI A;  3VV0 A;  1IZ6 A;  4PL6 A;  1KC8 U;  5LJ3 d;  4M7A D;  4M75 E;  4C8Q A;  3CCJ T;  2DXC A;  4A4K A;  3DB4 A;  3NTI A;  3OYH A;  1UEB A;  2E10 A;  4N4I A;  4IUR A;  4LDY A;  4ZGE B;  1RI0 A;  4A4F A;  4C0D C;  4C8Q F;  3OYK A;  3CXC A;  4F7U A;  1NJI C;  3JCM J;  1UGQ B;  1NPR A;  2EIF A;  3TW6 A;  1N9R A;  4C5E A;  2L3R A;  4M78 D;  1VQ7 T;  2OTJ T;  4JRP A;  3RKX A;  5GAM d;  3M4Y A;  2BUD A;  3CCM A;  4PJO G;  4E7H A;  1LOJ A;  5J26 A;  3JB9 F;  4OB1 B;  2I2L A;  2X4W A;  3VYH B;  2RHX A;  2X4J A;  4A54 A;  4C8Q G;  3CCJ A;  3JCM g;  1QVG A;  5DLO A;  1K8A U;  1K9M C;  3JCM f;  3P8D A;  4C8Q D;  1TH7 A;  4ELZ C;  5J39 A;  2LQK A;  3G7Z A;  3HRS A;  3MP1 A;  3OYF A;  2EQM A;  3A8M B;  3V8L A;  4C92 E;  2OTL T;  2EYQ A;  3MO8 A;  2KMT A;  1M1F A;  4PJO A;  3CCS A;  2EWN A;  3AHU A;  3J81 E;  3RER A;  3SWN A;  1KQS S;  2BS2 A;  3JCM b;  2AHJ B;  3PNW C;  3SWN B;  2JVV A;  4LOC A;  2WSC E;  3OBY A;  3OYL A;  4TVR A;  3HBL A;  4M7D G;  2DJZ A;  3JB9 D;  2ZGW A;  2O4X A;  1BI1 A;  3V8J A;  5LJ5 f;  3L2W A;  3L2V A;  4MIM A;  2LNV A;  3FIF A;  4RCC A;  5CQX A;  3JCM X;  3DLM A;  4E47 A;  2MF2 A;  4FT2 A;  1E7P A;  1H3Z A;  4FM4 B;  4XTW A;  3VYG A;  3PT9 A;  3VKH A;  2XI9 A;  2K57 A;  1N8R C;  2ZZD B;  2E1H A;  3HP9 A;  5GAN 5;  3JAM E;  3QXE B;  5CVI A;  2RJD A;  4LDU A;  3JCM W;  5LJ5 d;  4L6V 5;  3QYB A;  1XNI A;  2G3R A;  4IUT A;  4M7A F;  4C8Q B;  2EQU A;  2E5Q A;  4M78 F;  2EAY A;  1QVP A;  2KK4 A;  3UT1 A;  1NE8 A;  1BYM A;  3QYH B;  1U8R A;  4XK8 E;  4HKE A;  1XOV A;  2YHT A;  1YJN A;  5CK9 A;  4F7U B;  1VQP T;  1I5L A;  4Z02 A;  1KQ1 A;  3TCJ A;  4N4H A;  1VQ5 T;  1ZHI A;  2DAQ A;  2XID A;  1Y07 A;  4F7U F;  3M5A A;  2K2V A;  5GAN f;  4JRI A;  3CBM A;  4JUV A;  1VQ4 T;  5GAO q;  3MCA B;  1OZ3 A;  4QQ6 A;  3QZ9 B;  2RB6 A;  3ZFJ A;  3A8H B;  4BAC A;  4ZTF A;  1Y7X A;  1V29 B;  1LJO A;  2M16 A;  4R56 A;  5A0L A;  3BFM A;  1Q86 C;  3HPW A;  1IRE B;  3I55 T;  4HCZ A;  3S3M A;  2HBP A;  2QQA A;  3F70 A;  3BY7 A;  3JCM c;  3RIR A;  2RI3 A;  1VIF A;  1ZBX A;  2FB7 A;  1DJ7 B;  1N27 A;  2BIV A;  1FWZ A;  1KD1 C;  4J6X A;  4JRQ A;  4XTV A;  4C5I A;  4JX6 A;  1Y71 A;  2LC4 A;  2DO3 A;  3E9F A;  1M1K U;  4V2S A;  3TEE A;  1YJ9 T;  4EMK A;  4M78 B;  5FRN A;  2XD0 A;  2LDM A;  3VKG A;  1X6O A;  5CKE A;  2PU9 B;  4XU2 A;  5KCO A;  1G3Y A;  2DXB A;  2QI2 A;  3OBW A;  3OMG A;  4LD6 A;  5CO7 A;  1YJN T;  3VU3 C;  3PTA A;  4C0F A;  4ZGD B;  2C06 A;  5FU6 C;  1D3B B;  3P8B B;  4M77 E;  4BBR M;  4QQG A;  3QG1 A;  3OYA A;  2CGH A;  4OB2 B;  3MET A;  4MZT A;  3FRN A;  1B34 B;  3OMC A;  4OVA A;  4PLL A;  4RKU E;  3I56 T;  5GAN g;  3QSU A;  3URG A;  1VQN T;  3H4C A;  4M77 D;  3J80 E;  1I81 A;  3VUB A;  3LGF A;  3RKW A;  4C92 C;  4BE0 A;  5GAN j;  4PJO E;  2ZPG B;  3CCE A;  3CCU A;  2VXE A;  2XIC A;  5LJ3 j;  3KBG A;  4L59 A;  4MDW A;  3KXT A;  3L2Q A;  3A8L B;  2K4Y A;  3LYI A;  4HCB A;  4J7F A;  2MI6 A;  2PQW A;  1NJI U;  4J83 A;  2PUK B;  2DD4 B;  3KUF A;  1WQ7 A;  4XU1 A;  1G3T A;  2XK0 A;  3M56 A;  5LJ3 g;  3GPL A;  4NOY A;  5IT9 E;  3C95 A;  4MZM A;  1WGS A;  4F7U G;  3OS2 A;  3RMQ A;  2CZ7 B;  4KUL A;  5GAN h;  2X4X A;  3SWN C;  2RO0 A;  5I2M A;  2HQX A;  4M77 A;  4J7I A;  4QW2 A;  4HNT A;  3JCM V;  1FKM A;  3HL8 A;  1K9M U;  1M4Z A;  1S72 T;  4M78 A;  4QVC A;  2P0P A;  3JB9 H;  3GOX A;  2YRV A;  1M90 C;  5LJ5 g;  2VYT A;  1UGS B;  2QQ8 A;  2QXF A;  2RHI A;  3FLG A;  4BBS M;  2QEX A;  3CCL A;  3HFN A;  3SFM A;  1VQP A;  1Q81 U;  4M7D C;  1OZ2 A;  1QVF A;  4RMO A;  2RA2 A;  2MWO A;  5LJ3 h;  3CCV A;  2DPP B;  3G71 T;  3CCM T;  3UPU A;  4ZGJ B;  3HO8 A;  2DTH A;  4PJO D;  2XHC A;  3G4S T;  3GF5 A;  2DXU A;  3E1S A;  2KVQ G;  4J8O A;  4M75 F;  2LTO A;  1XQH A;  4OMF B;  4EMG A;  2R57 A;  2CZ0 B;  1WJR A;  1VQO T;  1YI2 A;  3V8K A;  4C0D B;  3OYB A;  1Q7Y C;  2QA4 T;  1G3W A;  4M75 B;  2GFA A;  3CPW A;  3CCS T;  4MMK A;  3ER0 A;  1VQ7 A;  2RK1 A;  3PMT A;  2DIG A;  3CCU T;  3CCE T;  2WAC A;  2R5M A;  5CR2 A;  3OS0 A;  1U1T A;  2PVG B;  4R55 A;  2KMG A;  2GF7 A;  1N6A A;  2QQB A;  2E6Z A;  4NS5 A;  5D6W A;  4C92 G;  2L5Q A;  2E64 A;  3QJ6 A;  3UDC A;  3C4S A;  4FIB A;  2CZ1 B;  2ZPH B;  1BIA A;  2DZ9 A;  4C92 D;  1HK9 A;  3CC7 A;  4MFE A;  2H3J A;  4XTY A;  1U1S A;  4L5G A;  2VGN A;  3NTK A;  4QVD A;  3RUX A;  3HRU A;  3QJY A;  2OTL A;  4RG8 A;  2WJ9 A;  4M75 A;  4NL3 A;  2V8J A;  2RJF A;  3L1A A;  2X4Y A;  2JNG A;  3QBY A;  4KUI A;  2F5T X;  2HAX A;  1EIF A;  5C6S A;  4HT8 A;  1M5Q 1;  3QYE A;  2R58 A;  5GMK m;  4JX5 A;  2JTF A;  5GAO l;  3CCQ T;  2CZ6 B;  4BI8 B;  4PLI A;  1KQ2 A;  4GY5 A;  1B34 A;  1Q86 U;  3QUI A;  3GLX A;  4M7D B;  4X34 A;  4DOV A;  2FHD A;  4N0A C;  5FU7 C;  4JX4 A;  2PVO B;  1VQ8 A;  3DL1 A;  2LX9 A;  3CME A;  2X35 A;  4M75 D;  5GMK j;  5FU6 B;  2IVW A;  3CEY A;  2FYK A;  1YHQ A;  1VQO A;  4LDX A;  4Y91 A;  4KBM B;  2D0Q B;  2KDS A;  3VJP A;  4BB7 A;  3TW7 A;  5FLX E;  3C12 A;  3EFR A;  5I21 A;  5M9O A;  2QDJ A;  2F69 A;  1K73 U;  1UGP B;  1QP3 A;  2XDB A;  2A7Y A;  1YIT T;  4HT9 A;  4M7A E;  1O75 A;  2E41 A;  4BY6 B;  3RES A;  5FRM A;  3GNG A;  3OQ5 A;  4C0G A;  3CPW S;  4Y28 E;  1AHJ B;  5GAO p;  3DLL A;  4M7A B;  1BI2 A;  4MDX A;  4LDV A;  4M77 C;  1X01 A;  4C92 A;  3KHI A;  4OF1 A;  3CMA A;  5D6X A;  4PNO A;  2JTM A;  3OSS C;  4C92 F;  3QII A;  1YCY A;  4Z6Y A;  3JRZ A;  1JB0 E;  2EFI A;  5KE2 A;  1OYX A;  5GMK h;  5GAM j;  1VQK A;  1R8O B;  3L42 A;  4E7I A;  3S3O A;  1QVF S;  3FB9 A;  1VQM T;  2DVE A;  2PVD B;  5A0G A;  2PUO B;  2KR6 A;  3V7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...