3A8GB

Crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8gB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8gB02
2ZPGB 3A8HB 5L8RE 4ZGJB 3X26B 3X20B 2ZCFB 4XK8E 1AHJB 2CYZB 2DD4B 2CZ1B 3QZ5B 4OB2B 3X25B 4RKUE 3VYGA 3QYGB 1PSEA 3WVEB 2AHJB 2CZ7B 2PVDB 3X24B 2ZPBB 2DXBA 2O01E 4OB1B 4L6V5 2PVOB 2WSEE 3WVDB 2PUKB 2D0QB 2PU9B 1V29B 2CZ0B 2ZPHB 2WSCE 1DJ7B 3A8GB 2ZPIB 1UGQB 3VYGB 3QXEB 4OB3B 2PVGB 3A8OB 1UGSB 1UGPB 4Y28E 2ZZDA 3VYHB 2DXBB 1PSFA 2CZ6B 1QP2A 2DD5A 3HHTB 1IREB 4KT0E 2QDYB 3A8MB 2DXCA 1GXIE 2ZPFB 3X28B 3A8LB 2ZPEB 4ZGEB 2PUOB 2DD4A 3QYHB 4FM4B 2ZZDB 1QP3A 4ZGDB 2DD5B 3LW5E 1JB0E 4OB0B 2WSFE 2DPPB 1UGRB 3QZ9B 2DXCB
chains in the Genus database with same CATH superfamily
1I1JA 2YRCA 4PJLA 4GLMA 1VQ4Q 1NBEB 5GANg 2RI2A 4JDSA 1U06A 1VQMA 3MIAB 4O5VA 3CCST 2QI2A 4KGZB 4MDXA 1TSFA 3V8JA 3OMCA 1EX4A 4M75E 2RJCA 1VQNQ 5I22A 3B57A 2C5VB 1M8MA 2CKKA 2JMAA 3VS1A 2DMOA 3CC4T 1BI3A 4OMOA 5EC7A 4CC4B 1BI1A 1Y57A 4PL6A 1PSEA 5GAN7 1PHTA 3MEWA 1OQKA 3GIBA 2JGZB 3QDRB 4AFSC 2JS2A 1AWXA 3URGA 2KBTA 3HFNA 3OSSC 2KAFA 3BDUA 3TN8B 2LNHB 4ELLA 1ZSZC 2DE0X 4J9DA 4AG2C 1X01A 1ZLMA 5HKCA 3NTHA 2YUOA 3NTKA 1YCSB 2ZPIB 2CP0A 5GAOr 1HYOA 1OOTA 1WJRA 2PQWA 2EKHA 1R0CB 1WFWA 2SEMA 4II1A 2KRSA 2JNGA 1UGPB 2VXEA 3PE0A 1GFDA 3GPLA 1VQ8T 1AWOA 1KXUA 1ZA2B 2PHGA 2NLUA 4BCFB 1IGUA 2EVRA 3PVQA 2OTJT 2RJFA 4HXJA 4LDUA 3UA7A 2IPOB 4BCIB 2EYYA 4M77B 2LJ3A 3X28B 3CPWA 5GAMf 2HMAA 2HNIA 1H92A 2YT6A 2NWMA 4NSTB 3H0IA 3QPHA 2IVXA 5KYYB 1UE9A 2A37A 4D8DA 2J6KA 2K4YA 4M7AG 2RI5A 1GBQA 1XNIA 3C95A 3CEYA 4QT7A 4M6VA 4DBQA 1YJNQ 1WJQA 3CC2T 2EUFA 1ABQA 2LCLA 2KXCA 5GAN6 2LT1A 4PJOE 4PLLA 4ELYC 2EQUA 3QYEA 5GAN8 2BTTA 2B9RA 2VGNA 4EMHA 1KQSS 1K73R 2MK5A 2X4XA 2XU8A 3CD6T 4II5B 1R8OB 2CT4A 3RMSA 3CCQT 4CXAB 2QQRA 2K57A 4C8QG 5GANh 4BI3A 4RCCA 4JLGA 4C5HA 1U3OA 3FC3A 2CT3A 4IUVA 5GANe 1G8XA 1WLPB 3OW2S 2K79A 2O01E 2WPAB 3E2UA 1KC8U 2V8KA 5CCAA 3DB3A 4F7UG 3JCMX 2QEXA 2X4JA 4XU0A 4ANJA 4PJOC 2RH2A 3CCMA 2FVUA 1UGQB 4XAXB 3QXEB 2WIPB 3NFCA 4EMKB 4FT4A 4BCKB 1FVVB 2VC8A 3A8OB 4A4EA 1Q7YC 3S3MA 4CC2A 2ZAEA 3H8ZA 4J7FA 4N0AA 5DM7R 4HCZA 3VYHB 4JLIA 2UUEB 1UB4A 2DD5A 3EFSA 4HCCA 1URCB 2AIRB 3LGLA 4KT0E 2F1LA 3VUZA 4Z02A 4PJOF 1JSUB 2EAYA 2W10A 2YDLA 2QASA 4F7JB 2WHBB 4YTLA 3GF5A 3CCVQ 4B9WA 4EOIB 2VV5A 2QEXQ 3CXCP 2KR6A 4CFMB 2K3YA 3SEMA 4FSSA 2PUOB 3H0FA 1SEMA 4F7NB 2EQMA 4C0ZA 3CCLT 1T0JA 4N4IA 1OZ3A 1MMGA 1VQKT 1EFNA 2F2CA 1PD1A 4C5GA 1IO6A 2D1XA 1AD5A 1JXMA 4OR5B 3L2WA 1K0XA 1G3YA 5LJ5j 5D6XA 3G7ZA 4BUGA 1Q82U 4PJOD 4HVUA 2KMGA 2KXDA 3HL8A 2RA2A 4MZTA 3RKXA 4AKHA 1RAAB 1AZGB 2WXVB 4I3ZB 2QDLA 2KY9A 1YNZA 1O9SA 2KSSA 1W6XA 1TUGB 2E6ZA 3UF4A 4E7JA 2RD1A 5D6YA 3MEVA 3G71T 1X2KA 1UHCA 1WXBA 4XU3A 2HBPA 1TH7A 4A53A 1M2OA 1SSFA 1XTDA 4G6LB 4BI8B 2RQWA 2HSEB 3GBQA 5HQ0B 1PD0A 1M2VA 1M90U 2PVDB 4QQDA 1UJ0A 2YUPA 1YHQA 2K7AA 2O31A 3M0PA 3KUFA 4R56A 2BZXA 3CCRT 3GLXA 2IW8B 4MMLA 3RERA 3H41A 1HK9A 2KRNA 2L3QA 2QGFB 5LJ5g 1G3NC 2VYTA 2XD0A 3TQ7P 4ROCA 1JJ2P 3CXCA 3P8HA 1SG5A 3EHRA 4EMGA 3M0SA 3G33B 1KHCA 1WX6A 5ICPB 3MP1A 2E41A 3EG2A 3E9FA 1VYWB 3M0QA 1ZSZB 2ENMA 2LX7A 2DX1A 2CH4W 3OMGA 2DKGA 1OPKA 2CUBA 4M78E 4PKCC 5FWCA 3QJYA 3DLLA 4RTXA 3TCJA 3VKIA 4J8OA 4M75B 4EOPB 3VV0A 2C5NB 3LQ5B 2RI3A 2IW9B 2ROLA 2D8JA 4Q5WA 2W9ZA 4C92C 2V22B 1OU8A 2X4YA 1X6OA 3JB9I 2XI9A 1MMAA 4AFQC 1KD1U 2XICA 5HY6A 5FROA 1GBRA 3OYMA 1OX9A 2K6DA 2DXUA 3JCMh 3OYJA 5KYWB 2ZPGB 1WQ7A 2FYKA 1K9MR 5J3BA 1QKWA 3BG9A 4CC7A 5HBEB 2GTJA 1XOVA 1YJ9T 3JCMe 1YBYA 3G4SA 2F5TX 3OS5A 2DLPA 2JTFA 4M78C 1VYUA 5HNBB 4KRTA 4C92F 2LC4A 1AWWA 1D3UB 3EGUA 3M54A 2DRMA 2RJDA 2WEVB 5FRMA 1GL5A 3M58A 2YUQA 1VQ7A 3A98A 4FIBA 2IG0A 3CC7T 2HQHA 2YLCA 3OYBA 1RI9A 3RGFB 4OGCA 4HVWA 4XU1A 4M78F 2QF7A 4C92D 2EPDA 2JZ2A 2E70A 4M77A 3VYGB 2HEQA 1B07A 4JS5A 3S3NA 4A4HA 1I0CA 1RAEB 4F7SB 2AKKA 3G4SQ 2KK4A 3KHIA 3CD6Q 3PNWC 1VYTA 2PVGB 5FU6B 2NYSA 3M56A 2L3PA 4AG1C 1H1PB 4QVZA 2EJGA 3S3OA 1IHWA 2KROA 5I2SA 1TWBA 2CZ6B 1QVGP 1QP2A 2YRDA 3HO8A 1LPLA 2BE9B 4F6WB 4M78D 2HDAA 4PJOB 2JUFA 1JOWA 1BCMA 3D7SB 2ED0A 1VQ7Q 3JSCA 1M30A 1VQPA 4KUIA 2ATCB 1OEBA 1C9BA 1FMVA 3THKA 1H3HA 3GNFB 4JS4A 1VQOA 3Q1JA 4CC3A 4M7DG 1YCYA 1JXOA 3CCUT 2RMOA 2ABLA 1D3BA 1F5QB 3OYNA 2G9XB 1JJ2S 3SFMA 2DBMA 1Y71A 3QG1A 2DL7A 5CIUA 4NOYA 1RL2A 1YWOA 4IKFA 4CFUD 3OYHA 3A8HB 1G3WA 1N8RU 4M7AE 2GQVA 4QW2A 1SRMA 1Q86U 1FX7A 1X43A 4F7LB 4WF2A 4QQ6A 2IW6B 5A2QE 1I81A 1O9KB 3RESA 1H3ZA 5GMKe 2K9GA 1VQ5T 5EG2A 5DLOA 1IHVA 2DILA 4PFOA 3EGXB 3UPUA 5IT9E 3CCLQ 4EMKA 1UNGD 4LD9K 1BI0A 1UTIA 2DBKA 1VQKQ 2KRMA 5KYUB 1OPLA 4PJNA 2JN0A 4BCQD 3OSVA 2WJ9A 3P8BB 4O6JA 2OTLT 4J9FA 2LNVA 1KQ2A 1X69A 2K2VA 4JRQA 4ELJA 4A4KA 5ECAA 2FHDA 4F16A 2J7IA 2PVOB 2FEIA 1QCOA 3MEUA 1AZEA 1FKMA 3AHUA 4HA8A 1QVGA 4M7AC 2PMIB 4HVVA 2ZPHB 2DMEA 3HB9A 1D1AA 3V7CA 5LJ3f 3JB9J 1AD6A 4FX3B 5CYIB 2Z0WA 4F7UE 4EPCA 2CUDA 2Y4XA 3G71Q 2FRYA 4L5GA 3M9QA 5GJVB 2B86A 4BI4A 1GCPA 2P0KA 4EOSB 1VQ6A 3H9NA 4JJDA 1GFCA 4LN2A 1C6VX 1PRMC 2EKOA 4X1VA 4LUDA 2PK9B 2QYZA 4E2FB 4M7AF 2UZDB 3VS2A 2VKNA 3TEEA 4QSHA 3I55Q 3HBLA 1AISB 3A8LB 3CCET 4RTZA 1YP5A 5KCOA 1UEBA 1T0HA 5BNJB 2RHXA 5CQXA 1Y0MA 2LTOA 5D6WA 2YUNA 3I5SA 2LCSA 1RADB 3EH1A 4HT8A 2X1NB 4CFVB 1JB0E 1VQ4A 4Y72B 4M7AD 4BE1A 8AT1B 2C0TA 1M5Q1 2EQKA 1VQ6Q 1I5OB 4FSXA 4MDWA 4HCKA 3QIIA 1NEBA 2EJFA 2LJ0A 2EBPA 4FW2A 1KQ1A 4FYXB 1SRLA 3I9QA 5AT1B 5DQVA 2DYIA 4BBRM 3SB2A 1QVFS 4F7UF 5GAN3 3OW2P 3PMIA 4FW1A 1BU1A 1NLOC 4CFXB 2QK0A 3SWNB 5GAMj 1ZQ1A 2MI6A 1RAFB 2QG9B 2IIMA 3TW7A 1QKXA 1AEYA 3TVTA 3WVDB 1QLBA 2CP5A 1OI1A 4Y92A 1ZSZA 2W96A 2XMFA 3GP8A 3SDZA 5GAN2 2RQTA 4M78B 2M1HA 5LJ3d 1E7OA 1FMKA 2VGMA 1HD3A 4IUUA 1NE8A 2PZ1A 1YJ9Q 1ARKA 5DY9A 3CCJT 3OYYA 4KBMB 4M75A 1VQ9T 1UGSB 2E10A 3INZA 2C5XB 2CDTA 4LNPA 1PSFA 4BY6C 1M8VA 2A3LA 4AT1B 5KYWA 3M53A 3FJ5A 4AMCA 3C0CA 1KQSA 3L2UA 3OYKA 1RABB 2CH4A 5GAMg 3ULRB 1K0SA 1UFFA 2C6TB 3R6OA 1YJNA 3QYHB 5I11A 1K9MC 5AYFA 2P4RA 2XKOC 1G83A 4EOOB 3LW5E 1HSQA 1WYXA 2XDPA 3OW2A 5HBHB 1BCOA 2O9VA 4BCQB 1ZBXA 1BKBA 3RKYA 1FYNA 4BCPB 3JCMc 1G5VA 1JO8A 4AFZC 5IXFA 1YITT 1KSWA 4KUDK 2ZCFB 4XK8E 2CYZB 3MCAB 2KE9A 3N5BB 3PT9A 2MWPA 1RACB 1UNLD 2CP7A 1H1RB 3PTAA 1TS9A 3VS7A 3VYGA 1IZ6A 3V7RA 1QWFA 2DM1A 2C5OB 5KE2A 3QYGB 2RHZA 4A54A 4FYYB 1VYVA 2VB6A 1VA7A 4BY1X 3LLRA 2D0NA 3H6ZA 2DAQA 2QQBA 4OMPA 2MIOA 1BIBA 4JPBW 1XJWB 2C0IA 1D3BB 2PNIA 1YJWT 4PJOA 2YSQA 1Q81C 3ASKA 2K5FA 2COWA 2JOYA 2KGTA 1B7TA 4OVAA 5FRNA 2GCXA 3OA6A 1NZ9A 1W4SA 4C0DC 2KMTA 1U8RA 4EOKB 1VQ5Q 3NGPA 3OYEA 2CP6A 1S72T 4FCYA 4KGXB 5FU7C 1X75C 4DBRA 2DXBB 3CCVA 2G77A 2CGHA 1K8AC 1OL2B 2BE7D 3BW1A 1SHGA 4RMOA 4M7AB 1TFBA 1A0NB 5A0GA 1TTHB 1PC0A 5GANd 3MP8A 4QQGA 4JZ3A 4M4ZA 4YOSA 1PRLC 4DEXA 4J6WA 1UDLA 3RKWA 4J9EA 3CPWS 3R6NA 3OS1A 2RNAA 5CKDA 1O9KA 1Z9ZA 1YI2T 1QWEA 1YN8A 1VOMA 3EGXA 3OYGA 1NJIC 4DBHA 5GAMh 3QWLA 4J9HA 4HCBA 2QAZA 2WSFE 3HTRA 3QUIA 3M0TA 3PIPA 1HXDA 5KYUA 2O2OA 4IUQA 4M7DE 3UA6A 3VJPA 4X34A 5IF1B 3DOGB 5GAMe 3JV3A 3HRUA 3F70A 4NS5A 4ZNXA 1GY3B 1YIJT 2QGSA 3BLRB 2I0NA 2CZ1B 3CCEQ 4IUPA 1H26B 1EIFA 4JX5A 1H641 1PKSA 2JM9A 1OI9B 5I21A 1J3TA 4EORB 3HPWA 2M02A 5CQYA 1M1KC 1RAGB 1X6GA 3CMAA 3JCMP 1V1CA 3QSUA 3HP9A 2HSPA 4YC3B 2DYBA 4EDUA 2X51A 2F2VA 3L1AA 5KE3A 1MMNA 2QA4T 2W0ZA 4M7DC 5HK3A 3OBWA 2WSEE 3GOXA 2WIHB 3CCSA 3I56T 1AWJA 4AKGA 3G6ET 1FWZA 2DF6A 2FZGB 3MO8A 3CC4A 1R77A 3FB9A 2PK2A 2JTEA 1SKUB 1LNXA 1UG1A 4BDZA 2I40B 1WXUA 1E9HB 4A63B 2F69A 2E65A 2KT8A 2D6FA 4J9CA 2PJQA 3JCMf 3L2VA 3EFRA 1R0BG 2K3XA 2YLBA 3CMAQ 4M7DF 3LWIA 3QJ6A 2P4TA 4LE9A 3VKGA 1C0MA 3MI9B 1RUWA 1IREB 2XDDA 3DL1A 4PJMA 3C94A 2OAWA 3CCSQ 4M75G 3META 4C92E 4PK4A 3RR6A 3ZL7C 5IXBA 1E6GA 5I2MA 3CC4Q 1VQ8A 1ENWA 3CCJQ 1OYXA 1H1QB 4C92A 4M7DD 3MHXA 1NPPA 5GMKl 1VQ9Q 4BY6B 2OTJA 4LOCA 4F17A 4BCGB 3SWNA 2BUDA 1H1SB 2EJ9A 4ATOA 1D0ZA 2KYBA 4TTHA 3LX7A 3PO3S 1M3AA 1QMCA 1KFZA 4WTOB 3QZ5B 2FRWA 4M78A 1XO2A 2X3XD 2P84A 4E7SA 3VS3A 3EJ1B 2CP3A 4QVCA 3L2ZA 5L23A 1C1AA 5IN1A 3QHRB 1XQHA 1OIUB 3CC2A 1VQ8Q 2RHYA 3J81E 2AHJB 3UDCA 1LOJA 1W98B 4RTVA 3OYDA 1I8FA 1TUCA 3RUXA 2LT4A 3RDVA 1GCQA 2EFIA 5LL6S 2OTJQ 5GMKi 3H0HA 1VQLT 2XHCA 2CSQA 4C5IA 4E47A 1W2BS 4A4GA 4MZPA 1VINA 3OYAA 3JCMQ 3CD6A 1VQ4T 1K76A 5J39A 1AOJA 3CCQA 2MPXC 2KDSA 1MV3A 2J05A 4KH1B 2CREA 4DOVA 2R5AA 1VQNT 2DFUA 2AT1B 2FPDA 2V8JA 3EG0A 1JJ2A 3JCMd 1WDXA 2RQRA 1ZBJA 2W9FA 4JJCA 1UNHD 1GUXA 2K5LA 5CO7A 2F5KA 2BS3A 3CC2Q 3GNGA 1OGUB 4BXXX 2DZ9A 4QVDA 4F04B 1UUEA 4J7IA 3A8MB 1ZUKA 2X4WA 1GXIE 2JS0A 1H24B 2DTIA 5GMKm 3A5ZB 3CMET 1WXTA 4CI0C 5IDPB 2ECZA 1U1SA 4MIMA 4ZGEB 4ESRA 3QHWB 1UECA 1WIEA 4C0DB 3CCQQ 2DL5A 2RJEA 1VQMT 2KVQG 2F2WA 4HNTA 5LJ5h 3VS6A 1Q81R 2X9HA 2L3RA 3BE3A 3JCMJ 4QKUA 2EGEA 1N8RR 3BG5A 1Y96B 4JZ4A 5LJ5e 5LJ3j 3GTMS 1WHJA 2G6FX 3NDQA 2HZYA 2OI3A 5I5ZB 4OGRB 5CR2A 1QVFP 1KC8C 2F2XA 3CCLA 1K8AR 3MY5B 3C12A 1N4MA 1BK2A 1VQKA 1OU9A 3HSBA 4E7LA 5LJ5d 2BS4A 2D9TA 2QDJA 1O75A 2KQWA 1Q95G 4KH0B 3O5ZA 2QQSA 3M4YA 4JX4A 2I2LA 4MFDA 1KJWA 3QO3A 4XTYA 2LQNA 2ZPBB 2DXBA 1QLYA 2IVWA 4Z89A 3U23A 1TG0A 1NJIR 1GH6B 2PTKA 4F14A 2PUKB 3LH0A 1T3LA 4BD3A 4M7AA 3G71A 1V76A 2FZCB 2CZ0B 3V8LA 4ZN3A 3A8GB 5KCHA 2BKDN 2DL4A 2EWNA 2RHIA 3QKJA 4RG8A 3UT1A 1HJDA 2NUPB 5LJ3g 1NG2A 2EQJA 3RMQA 4ME7A 4CRLB 1B34B 1K1ZA 5GAOl 2J6FA 4C8QE 4GLKA 1AT1B 3KXTA 5CK9A 2L3SA 3I55A 1CKAA 2RK2A 4M7DB 3CCRA 4X9DA 1IXDA 1M1KR 1TU0B 1H4LD 3LGFA 1Q82C 2QA4Q 2I53A 2RQVA 2ZPFB 2DVEA 3I56Q 1BIAA 2QQAA 4R0KA 2DETA 3OBYA 5HVYB 3G6EQ 3DJBA 3OB9A 1ZA1B 2EYWA 1QVFA 1Q7YU 4B6MA 2JXBA 2HL5C 2EYQA 4F7UA 3DKMA 3BHUB 5FLXE 1F1BB 2VVKA 1QP3A 3HZJA 1D0XA 4OB0B 2BZYA 3NMZC 4EMKC 4ZTJA 4LDWA 1QQJA 4C8QC 2C06A 3OS0A 4CFWB 1NM7A 3KBGA 1M90C 4DOWA 3IQLA 3CCRQ 5GAOp 5L8RE 1VUBA 2HQEA 4IURA 4J9GA 1T3SA 3E1SA 1GRIA 3G1JA 5HCKA 4HKEA 3E19A 3EHQA 2QEXT 2DD4B 1TOVA 4OB2B 2GTOA 4UC4A 4CRIA 3M5AA 3V8KA 3VRZA 3CCMT 2X3WD 5EFQB 2COZA 1ZX6A 3JCMW 2WFYB 2LCCA 1UHFA 2P0QA 4C8QF 2MMPA 4DA4A 3LYIA 7AT1B 2CZ7B 4VUBA 2KI7A 1WHGA 4GBQA 2YXYA 5IHNA 2EGAA 2J06A 5CKHA 1YJ9A 1N6AA 3FRNA 2D0QB 1OULA 5GAOm 2FB7A 3TNIB 4V2SA 3OYLA 2H3JA 2QFZA 1MNDA 4C92B 2DL8A 3EG9B 2UZEB 4OF1A 2COYA 1H8KA 2O88A 3QDFA 1UJYA 2RB6A 2WMAB 2H8HA 1TUDA 4C8QD 3HKSA 3UWNA 4BE0A 4BCOB 5GAN5 1LJOA 1WI7A 2E3IA 4BCMD 2DZCA 2FZKB 4E6RA 3ZEHA 4JRPA 1KD1C 3FJPA 1MMDA 5HBJB 1M9SA 4PFPA 1E7PA 3I5RA 4MZMA 3CPWP 3MEAA 1VQLQ 4IMYB 1B3QA 2GBQA 1RI0A 2EYXA 4FM4B 5CEIB 2ZZDB 1MHNA 1Y07A 4XQ3A 3RNJA 1IRXA 4M77G 2RHUA 5GAOn 4CFUB 1UGRB 3QZ9B 1RAHB 2RPNA 2DTHA 1JKWA 4EOLB 2RK1A 3M57A 3CC7Q 5GANf 4PFZA 5IHYA 1YHQT 3JB9G 4IIOA 2GFAA 2XIDA 3X20B 1JBMA 3EGDB 2D8HA 4E7IA 3FEOA 3HRTA 2BZ8A 4NL2A 5IH2A 3CCUA 1AHJB 2E3HA 3CMEQ 1GUXB 4LUEA 4RKUE 4FL6A 1NEGA 2R5MA 4BCND 4CFNB 4PNOA 1FINB 2LX9A 3RIRA 1VQMQ 1M4ZA 4M75C 5M9OA 1P5EB 4EONB 3AT1B 3EOCB 3QBYA 2DVJA 3OS2A 2HQXA 1PKDB 4N4GA 4OB1B 2DA9A 1U5SA 1IGQA 2PU9B 1NPRA 2V8IA 1OZ2A 1I4K1 1VQ5A 2GF7A 2HCKA 1WHMA 4RUGA 2X35A 2B8AA 1MUZA 4J9IA 3UATA 1BBZA 4EC8B 3CCUQ 1BYMA 1D0YA 1KC8R 4XTZA 5CKBA 2JVVA 2OTLA 1YFNA 3MKDA 4M75F 1H28B 1M1GA 4K11A 2FPFA 2Y4YA 3A1PA 2LJ1A 1I5LA 3TNWB 1Y96A 4EOQB 2V1RA 2AKLA 2O9SA 2JMCA 4IUTA 5IHIA 1WHKA 4OMNA 4E7KA 1KG1A 1N8RC 1FXXA 4J6XA 1Q86C 1M3BA 2L5QA 2OX7A 4ZN1A 4HL4A 4AKIA 4LDYA 5IAYA 4M75D 3G4ST 2Y90A 2DEUA 2OTLQ 1OX8A 3I35A 4OMMA 1WNLA 5FWBA 1RAIB 3ME9A 3BFMA 4GY5A 5FU6C 2DXCB 1OKWB 1M1FA 4JJBA 3CCEA 5KYNA 4E7HA 3ZBDA 1KK7A 4Y91A 2DJZA 4XTUA 2P0PA 3DB4A 2MWOA 1VQ7T 1ZUYA 2KT1A 3BHTB 4E7ZA 3EIDB 1Q82R 3L2RA 2CCHB 1RLQC 2QTXA 4IIMA 3MJXA 3TU4K 5CKFA 2RO0A 4ROEA 4DQ2A 2BKZB 2BS2A 3S6WA 1H25B 2HD0A 2KYMA 2NUPA 5L2WB 2KEAA 2NUTA 4FYVB 1PNJA 5FW9A 1K73U 4C8QB 2JJ9A 4N4HA 1ACMB 4BDYA 2JW4A 1B34A 1W2BP 2W99A 3P8DA 3PIOA 3X24B 2JTMA 4BBSM 4M7DA 4BCMB 1WHLA 2HKQB 2ED1A 1Y7XA 2LMJA 4BCHB 3BLHB 4HNVA 2JT4A 4FT2A 1M90R 2WSCE 3JAME 1QVPA 4F7UB 2DIQA 5GAN4 5CKEA 2LRQA 5GAMd 1VQPT 1M27C 3CBPA 1CSKA 1M3CA 4LXCA 4DEYA 2HL3A 4DBFA 2HAXA 2XG8D 2A7YA 1VQOT 4XTXA 3PGGA 2RM4A 3CCMQ 2MCNA 2DERA 4N0AC 3WXMB 3NPFA 3JCMg 3BY7A 4C5EA 4EIKA 2M0OA 3JB9H 2NUZA 3HHTB 1WHHA 4D6WA 4KRDB 3MPUB 1I07A 2QDYB 2K2MA 4LDXA 1BI2A 2A08A 2L2PA 3CCJA 1QMZB 1EZZB 2ZPEB 5GAOq 2VWFA 1VQ9A 4NC6A 2EGCA 2DD4A 3M0RA 4Z88A 1ZP2A 1YWPA 1D1BA 5KH6A 2CJMB 5KYXA 2E5QA 4BCNB 3EFOB 1FMWA 2V1QA 4RTTA 4L59A 2DPPB 2C4GB 2R58A 3BHVB 2CS7A 2E4HA 4UN0A 1WPYA 6AT1B 3EG3A 1W2BA 1X27A 2EW3A 4J83A 1KIKA 4EOJB 3I55T 1ZHIA 3TSWA 2E12A 1KD1R 2O4XB 4RTUA 1JQQA 2L8DA 5GMKj 2XDBA 3VS5A 2UZBB 2M16A 3O0GD 3EG9A 3BDLA 3NHNA 3HRSA 4XTWA 3WVEB 3JRZA 1MNEA 4OMFB 3QYBA 4RG2A 4FYWB 3EAEA 1SHFA 4X9CA 2DL3A 1UGVA 1OKVB 1LVKA 2C0OA 3VU3C 2GGRA 1ABOA 1VQ6T 1YITA 4KULA 2MF2A 4J9BA 1SPKA 3PFSA 2OAUA 2M51A 5LJ5f 2AZSA 3MY1B 1YHQQ 2E5KA 1TD6A 2QGGA 2V26A 1JU5C 3FDRA 4ELZC 2A0FB 2DK3A 4D8KA 4YOZA 2BIVA 2DO3A 3CPFA 1KHIA 2RN8A 2VASA 4Z6YA 2W2HA 3BG3A 4JX6A 4C0FA 2ZZDA 5HK0A 4BY7X 3H4CA 4ZTFA 3M0UA 5LQFB 8ATCB 3POMA 3TSZA 4F6SB 1YJWA 2E6NA 3VKHA 3SWNC 4OP0A 1YITQ 3ZFJA 2DTOA 3CBMA 1JSTB 4PLIA 2A28A 4Z8AA 1WGSA 3EGDA 3EH2A 5CVIA 1S72A 1P92A 2CSIA 2YWWA 3M03A 3CXCS 1WZOA 4A4FA 4PJOG 4EC9B 4ZGDB 4JJNK 2BPMB 4TVRA 1G3SA 4XU2A 2ROTA 2ESWA 1VIFA 5DQWA 2MAMA 1PCXA 1WQWA 4B9XA 1GCQC 2WMBB 4ZGJB 3X26B 4HNUA 1YJWQ 1RLPC 5GJWB 4M77E 2CP2A 1E6HA 1ZUUA 2LW4A 1OV3A 3C4SA 4BACA 1YI2A 5ACBA 1K9MU 3X25B 5FU7B 2QTVA 1NYFA 2RQUA 1G2BA 2E1HA 2JM8A 1Q86R 1JRIA 4JRKA 1S72Q 4OMQA 2E64A 2QXFA 4P5NA 1CKBA 3RBBB 2QQ8A 2CCIB 3OQ5A 5KYYA 2A36A 1LCKA 1VIEA 1AVZC 1YIJA 3E9GA 5IDNB 1V29B 1OL1B 1DJ7B 2J6OA 4OGEA 4M77C 3OYIA 4OB3B 4MFEA 4XTVA 2ZGWA 2FO0A 2DJQA 2DEQA 1YI2Q 2LDMA 2WACA 4LD6A 2LQKA 4LDVA 1ZSGA 2QQ9A 1U1TA 3CQTA 3HFOA 2R7GA 4AI6A 4Y28E 1YJNT 2QA4A 4JRIA 2VXFA 1BB9A 2M9UA 2EQIA 2L89A 3I56A 3NTIA 2LVMA 3TW6A 3G6EA 1PG5B 3JCMb 1BU2A 1K73C 2DXCA 1MGQA 1N9RA 4J6YA 1Q81U 4WCIA 1Q7YR 1YIJQ 4M77F 2KR3A 3T9NA 1WA7A 3QWYA 3EG1A 2NUTB 4RODA 4YOOA 3FIFA 5GMKh 3KFVA 1MV0B 3M4GA 4JUVA 1X2QA 1N5ZA 2FL7A 4PJJA 3JB9F 1N27A 5DLQE 1VQPQ 2SRCA 9ATCB 2RF0A 1NYGA 3VRYA 3V7SA 3PMTA 1W70A 3QHSA 2DD5B 3OY9A 1VQOQ 1QCNA 1G3TA 1K8AU 4C8QA 3VS4A 1VOLA 3JCMV 3K7AM 2K3BA 1JEGA 4M77D 2R57A 2DNUA 3LH5A 1K4US 2OJ2A 3LWHA 4BE2A 2IN3A 2H3EB 4OMLA 5D7UA 4BB7A 2AZVA 3TREA 5LMKB 3JB9D 2XK0A 3QWXX 3L2QA 1QCFA 4HT9A 3F5XB 1S1NA 3VUBA 4KGVB 3DDPB 1NJIU 2UZLB 3BLQB 1WJSA 2VUBA 4J5YA 5J26A 1N9SA 3MP6A 3L42A 3REAB 3DTOA 2GFUA 3TNHB 4F70B 5IHKA 4C0GA 1PKTA 5C0MA 2DXTA 3M55A 1QW1A 4L6V5 4ORZA 1TXQA 5A0DA 3CBOA 3CCVT 4F6UB 3FLGA 4EOMB 4C92G 3DDQB 1IB8A 2GNCA 2LQWA 1X6BA 3J80E 4AFUC 2HBWA 5A0LA 2LZ6B 3PVLA 5KYXB 4MMKA 3VS0A 2DRKA 2YHTA 4RCBA 1Z9QA 4BCJB 1M1KU 2G3RA 5GANj 4KRCB 2FG0A 3SD4A 5C6SA 1M2VB 1NLPC 2GQIA 5EJCA 2KNBB 1VQLA 4M78G 1D09B 3EFOA 1PWTA 1D1CA 4NL3A 1SSHA 2M0YA 2MYSA 1OIYB 3O8VA 2LP5A 1QVGS 1KQSP 2FPEA 2L0AA 1VQNA 3OYFA 4RTWA 4RTYA 1H27B 2HKNA 5FGKB 2O4XA 3ER0A 3M59A 2EYZA 3SHWA 3OYCA 1PM3A 1SF9A 1K9AA 3J7AF 2YRVA 5LJ3h 2K5IA 3CC7A 2MOXA 2EIFA 3DLMA 2AK5A 2DIGA 3REBB 2LQ8A 4R55A 4FU6A 5CAIA 3CMAT 5LJ3e 1W1FA 4HLQA 3CMEA
chains in the Genus database with same CATH topology
3OYHA 3A8HB 1M1FA 3CCEA 1G3WA 1N8RU 4M7AE 2GQVA 4QW2A 3ZBDA 4E7HA 4Y91A 2DJZA 4XTUA 1FX7A 1Q86U 5GANg 2P0PA 2RI2A 3DB4A 4JDSA 3LX7A 2MWOA 1VQ7T 1VQMA 4O5VA 4WF2A 3CCST 2QI2A 4MDXA 4QQ6A 3QZ5B 5A2QE 3L2RA 1I81A 4M78A 3RESA 3V8JA 1H3ZA 5GMKe 3OMCA 4M75E 2QTXA 2RJCA 1VQ5T 3TU4K 5CKFA 2CKKA 2RO0A 5EG2A 4DQ2A 5DLOA 4QVCA 2BS2A 3L2ZA 3CC4T 3S6WA 3UPUA 5IT9E 4EMKA 1BI3A 2HD0A 4LD9K 5IN1A 1BI0A 1XQHA 1BI1A 4PL6A 4C8QB 1PSEA 2JN0A 4N4HA 5GAN7 2RHYA 3J81E 3OSVA 3MEWA 2AHJB 2WJ9A 3P8BB 4O6JA 1B34A 3UDCA 4BDYA 1LOJA 2LNVA 3P8DA 3OYDA 3QDRB 1I8FA 3PIOA 3RUXA 1KQ2A 3X24B 2LT4A 2K2VA 4JRQA 2EFIA 2JTMA 5LL6S 4ELJA 3URGA 4A4KA 5GMKi 4BBSM 3HFNA 4M7DA 2FHDA 3OSSC 2PVOB 1VQLT 2KAFA 2XHCA 3BDUA 4C5IA 1W2BS 4E47A 3MEUA 4A4GA 1FKMA 1Y7XA 4MZPA 3OYAA 3JCMQ 4HA8A 1QVGA 3AHUA 3CD6A 4HNVA 1X01A 1VQ4T 4M7AC 5J39A 4FT2A 3CCQA 2ZPHB 2WSCE 3NTHA 1QVPA 2KDSA 2DIQA 4F7UB 5HKCA 5GAN4 3JAME 3HB9A 3NTKA 5LJ3f 5CKEA 2ZPIB 3V7CA 5GAOr 2LRQA 3JB9J 1WJRA 4DOVA 2PQWA 5GAMd 1VQPT 3CBPA 2R5AA 4F7UE 1VQNT 4EPCA 2HAXA 2XG8D 2Y4XA 2A7YA 1VQOT 4XTXA 4II1A 2V8JA 3PGGA 2JNGA 1UGPB 2RM4A 2VXEA 4L5GA 3M9QA 3JCMd 1JJ2A 4BI4A 3GPLA 2K5LA 2P0KA 5CO7A 1VQ8T 4N0AC 3WXMB 2F5KA 1VQ6A 2BS3A 3JCMg 2NLUA 3BY7A 4C5EA 3JB9H 2M0OA 2EKOA 3GNGA 3HHTB 4D6WA 2DZ9A 2OTJT 2RJFA 4QVDA 4J7IA 2QDYB 3A8MB 2X4WA 4LDUA 4M7AF 1GXIE 4LDXA 2DTIA 3TEEA 5GMKm 3A5ZB 1BI2A 4QSHA 3CMET 3HBLA 4M77B 3CCJA 3X28B 3CPWA 3A8LB 5GAMf 4CI0C 3CCET 1U1SA 2ZPEB 4MIMA 4ZGEB 2HNIA 5GAOq 5KCOA 1UEBA 1VQ9A 4C0DB 4NC6A 2RHXA 3QPHA 5CQXA 2RJEA 2LTOA 1VQMT 5D6WA 2DD4A 2KVQG 4HNTA 5LJ5h 5KH6A 2L3RA 2K4YA 2E5QA 3JCMJ 4HT8A 4M7AG 2RI5A 1JB0E 3BG5A 1Y96B 1XNIA 3C95A 3CEYA 1VQ4A 5LJ5e 4M6VA 4M7AD 5LJ3j 4BE1A 4L59A 2DPPB 1M5Q1 1WJQA 2EQKA 2R58A 3CC2T 2CS7A 4FSXA 1WPYA 4MDWA 2LCLA 5GAN6 2LT1A 3QIIA 2EJFA 1W2BA 4PJOE 4PLLA 4ELYC 5CR2A 4J83A 2EQUA 3QYEA 1KQ1A 5GAN8 1KC8C 3CCLA 2VGNA 3I55T 4EMHA 1ZHIA 1KQSS 2E12A 3C12A 2O4XB 1VQKA 3HSBA 2L8DA 5GMKj 4BBRM 4E7LA 2XDBA 2X4XA 2M16A 2XU8A 3SB2A 3CD6T 5LJ5d 1R8OB 3RMSA 2BS4A 3CCQT 1QVFS 3BDLA 4F7UF 2QQRA 2D9TA 2K57A 2QDJA 4C8QG 5GANh 5GAN3 1O75A 4BI3A 2KQWA 4RCCA 3PMIA 4JLGA 4C5HA 3HRSA 4XTWA 2QQSA 3FC3A 3SWNB 3WVEB 3JRZA 4OMFB 3M4YA 3QYBA 4IUVA 5GAMj 1ZQ1A 5GANe 4JX4A 4RG2A 2MI6A 3EAEA 2I2LA 4X9CA 3OW2S 4MFDA 3QO3A 3VU3C 4XTYA 2ZPBB 2DXBA 3TW7A 2IVWA 2O01E 1VQ6T 1YITA 4KULA 3WVDB 1KC8U 2V8KA 2PUKB 1QLBA 5CCAA 2MF2A 3DB3A 1OI1A 4F7UG 3JCMX 2QEXA 2X4JA 3LH0A 4BD3A 3PFSA 4M7AA 2OAUA 4XU0A 3GP8A 3G71A 3SDZA 3V8LA 2CZ0B 4M78B 5LJ5f 5GAN2 2M1HA 4ZN3A 4PJOC 2RH2A 5LJ3d 3CCMA 2FVUA 3A8GB 2VGMA 4IUUA 1NE8A 5KCHA 1UGQB 2BKDN 3FDRA 4XAXB 3QXEB 2DK3A 2EWNA 2RHIA 3NFCA 3QKJA 4RG8A 5DY9A 3UT1A 4FT4A 3OYYA 4EMKB 2BIVA 4KBMB 2EQJA 2DO3A 5LJ3g 3RMQA 4M75A 1VQ9T 3CPFA 2VC8A 1KHIA 4ME7A 3A8OB 4A4EA 1Q7YC 1UGSB 1B34B 2E10A 3S3MA 3INZA 5GAOl 4Z6YA 4C8QE 4GLKA 3H8ZA 4J7FA 4N0AA 3BG3A 4JX6A 4C0FA 2ZZDA 5CK9A 5HK0A 5DM7R 3KXTA 3I55A 4HCZA 3VYHB 3H4CA 2RK2A 1PSFA 3CCRA 4ZTFA 4JLIA 1UB4A 4M7DB 2DD5A 4BY6C 3EFSA 4X9DA 1M8VA 4HCCA 3LGLA 1YJWA 2E6NA 4KT0E 3LGFA 1Q82C 2A3LA 3VKHA 3SWNC 3VUZA 4OP0A 4Z02A 4PJOF 2EAYA 3M53A 3ZFJA 2DTOA 3CBMA 2ZPFB 4YTLA 2DVEA 3GF5A 1KQSA 1BIAA 2QQAA 4PLIA 2VV5A 4B9WA 3L2UA 3OBYA 2KR6A 2K3YA 1WGSA 2PUOB 3OYKA 3OB9A 5GAMg 2EQMA 4C0ZA 3CCLT 5CVIA 1QVFA 1S72A 1Q7YU 3R6OA 4N4IA 1P92A 1OZ3A 1YJNA 1VQKT 3QYHB 1K9MC 5AYFA 2EYQA 2XKOC 4C5GA 4F7UA 3DKMA 3CXCS 5FLXE 4A4FA 1QP3A 4PJOG 3HZJA 3L2WA 4ZGDB 4JJNK 1G3YA 3LW5E 5LJ5j 4OB0B 4TVRA 4EMKC 1G3SA 4ZTJA 5D6XA 4LDWA 4XU2A 4C8QC 2XDPA 2C06A 3G7ZA 4BUGA 3OW2A 1Q82U 3OS0A 3CC2A 4PJOD 1M90C 3KBGA 2KMGA 1ZBXA 4DOWA 1BKBA 1VIFA 2MAMA 3RKYA 3HL8A 2RA2A 5GAOp 5L8RE 4MZTA 3RKXA 4AKHA 1VUBA 1WQWA 2HQEA 4IURA 3JCMc 4B9XA 4ZGJB 3E1SA 3X26B 4HNUA 2KY9A 1G5VA 1O9SA 2KSSA 1YITT 4M77E 4KUDK 4HKEA 2ZCFB 4XK8E 3CCJT 2CYZB 2E6ZA 3E19A 3C4SA 3MCAB 2QEXT 2DD4B 2RD1A 4BACA 4E7JA 5D6YA 4OB2B 4UC4A 4CRIA 1YI2A 1K9MU 3MEVA 3X25B 3M5AA 3N5BB 3PT9A 2MWPA 5FU7B 3V8KA 3G71T 3PTAA 4XU3A 4A53A 2HBPA 1TH7A 3VYGA 3CCMT 1SSFA 1IZ6A 3V7RA 1XTDA 3JCMW 2E1HA 1JRIA 2LCCA 4JRKA 2P0QA 5KE2A 4BI8B 3QYGB 2RHZA 4A54A 4C8QF 2MMPA 4DA4A 2E64A 2QXFA 3LYIA 4P5NA 2CZ7B 1M90U 2PVDB 4VUBA 4QQDA 2QQ8A 3OQ5A 4ELZC 3LLRA 1YHQA 1VIEA 1YIJA 3KUFA 5CKHA 4R56A 1YJ9A 1N6AA 3CCRT 3FRNA 2DAQA 2QQBA 3H6ZA 2D0QB 5GAOm 3E9GA 3GLXA 2FB7A 1BIBA 3OYLA 2H3JA 4MMLA 4V2SA 2QFZA 3RERA 1D3BB 1V29B 1YJWT 4PJOA 1Q81C 1HK9A 3ASKA 1DJ7B 4HLQA 4C92B 2K5FA 2JOYA 4OGEA 4M77C 4OVAA 5FRNA 4OF1A 5LJ5g 3OYIA 2VYTA 2GCXA 2RB6A 2XD0A 4OB3B 4MFEA 4XTVA 2ZGWA 3OA6A 1NZ9A 2DEQA 1W4SA 4C0DC 2KMTA 2LDMA 4C8QD 1U8RA 2WACA 3HKSA 2LQKA 4LDVA 4LD6A 2QQ9A 1U1TA 3P8HA 3UWNA 3CXCA 3HFOA 4BE0A 3OYEA 4EMGA 1S72T 4AI6A 4Y28E 1YJNT 2QA4A 5GAN5 1LJOA 4JRIA 5FU7C 2VXFA 1KHCA 1X75C 2DZCA 2M9UA 2DXBB 2L89A 3ZEHA 3I56A 3MP1A 3CCVA 3NTIA 2E41A 2G77A 3TW6A 2CGHA 2LVMA 4JRPA 3E9FA 1K8AC 3G6EA 3BW1A 3FJPA 1KD1C 3JCMb 4RMOA 1K73C 4M7AB 1M9SA 2DXCA 1E7PA 1MGQA 1N9RA 4J6YA 5A0GA 1Q81U 4MZMA 3MEAA 3OMGA 5GANd 2DKGA 3MP8A 4M77F 4QQGA 3T9NA 4M78E 4PKCC 3QJYA 3DLLA 3TCJA 3FIFA 5GMKh 3VKIA 4J6WA 4J8OA 1RI0A 3M4GA 4M75B 3VV0A 3RKWA 4JUVA 3CPWS 3OS1A 5CKDA 2RI3A 2FL7A 4FM4B 1YI2T 3JB9F 1N27A 4Q5WA 5DLQE 4C92C 2ZZDB 1MHNA 3V7SA 3PMTA 2X4YA 3OYGA 1NJIC 1Y07A 4XQ3A 3QHSA 3OY9A 2DD5B 5GAMh 1X6OA 3QWLA 3JB9I 4HCBA 1G3TA 2WSFE 2XI9A 3QUIA 1K8AU 3PIPA 1HXDA 4M77G 1KD1U 2XICA 4IUQA 4C8QA 2RHUA 5HY6A 4M7DE 5FROA 5GAOn 3OYMA 3JCMV 1UGRB 3QZ9B 3VJPA 4X34A 2DXUA 2DTHA 3JCMh 2RK1A 2R57A 3M57A 2ZPGB 1WQ7A 4M77D 5GAMe 5GANf 2FYKA 3LWHA 5J3BA 4BE2A 3BG9A 3HRUA 3F70A 1YHQT 4BB7A 3JB9G 2GFAA 2XIDA 4NS5A 1YIJT 3X20B 1JBMA 3TREA 4E7IA 1K73U 3FEOA 1XOVA 1YJ9T 3HRTA 4NL2A 3JCMe 3CCUA 1AHJB 1YBYA 3G4SA 2F5TX 2CZ1B 3OS5A 3JB9D 2JTFA 2XK0A 4M78C 3L2QA 4IUPA 4HT9A 1EIFA 4RKUE 4JX5A 1H641 4FL6A 4C92F 5I21A 2R5MA 4PNOA 3VUBA 2LC4A 1NJIU 1WJSA 2LX9A 3RIRA 3HPWA 5CQYA 3M54A 2VUBA 1M1KC 1M4ZA 4J5YA 5J26A 1N9SA 3CMAA 3JCMP 3MP6A 2RJDA 3QSUA 3HP9A 3L42A 4M75C 5M9OA 2GFUA 4EDUA 3QBYA 5FRMA 4C0GA 3L1AA 5KE3A 3M58A 5C0MA 2DXTA 3M55A 2QA4T 4M7DC 3OS2A 1QW1A 5HK3A 2HQXA 1VQ7A 4FIBA 4OB1B 4L6V5 3OBWA 2IG0A 4N4GA 2WSEE 3GOXA 3GIBA 5A0DA 3CCSA 3CC7T 3CBOA 2YLCA 3I56T 3FLGA 4C92G 3OYBA 3CCVT 4OGCA 2PU9B 4AKGA 3G6ET 4XU1A 3J80E 1NPRA 1FWZA 1OZ2A 1I4K1 2V8IA 1VQ5A 2GF7A 4M78F 5A0LA 2QF7A 4C92D 2JZ2A 2E70A 2X35A 2B8AA 3MO8A 4M77A 4MMKA 2OTLT 3CC4A 3VYGB 2YHTA 4RCBA 4JS5A 3FB9A 3S3NA 4A4HA 1LNXA 1BYMA 2KK4A 1M1KU 3KHIA 4BDZA 2G3RA 4XTZA 5CKBA 2JVVA 3PNWC 5FU6B 2PVGB 5GANj 2OTLA 3SD4A 2F69A 2E65A 2D6FA 4M75F 3M56A 5C6SA 5EJCA 3JCMf 1M1GA 4QVZA 3L2VA 3EFRA 2K3XA 2EJGA 3S3OA 5I2SA 2Y4YA 2YLBA 1VQLA 4M7DF 2CZ6B 4M78G 1QP2A 3OYJA 3LWIA 3QJ6A 2P4TA 1I5LA 1Y96A 3VKGA 4NL3A 3HO8A 1IREB 2XDDA 3DL1A 4M78D 4PJOB 3O8VA 2JUFA 4IUTA 3C94A 1QVGS 3JSCA 4E7KA 1KG1A 1N8RC 1VQPA 4KUIA 4M75G 1FXXA 4J6XA 3META 4C92E 1Q86C 3OYFA 2L5QA 3GNFB 1VQNA 4ZN1A 4HL4A 4AKIA 4JS4A 1VQOA 4LDYA 5IAYA 3Q1JA 3M59A 2O4XA 3ER0A 4M75D 4M7DG 5I2MA 1YCYA 3OYCA 3CCUT 3G4ST 2Y90A 1D3BA 1VQ8A 3OYNA 1OYXA 3J7AF 2YRVA 4C92A 4M7DD 5LJ3h 2K5IA 3CC7A 1JJ2S 2EIFA 1NPPA 3MHXA 3DLMA 3SFMA 5GMKl 4BY6B 1Y71A 3QG1A 2OTJA 4LOCA 1WNLA 2DIGA 2LQ8A 4R55A 4FU6A 4NOYA 3ME9A 4GY5A 1RL2A 2BUDA 3BFMA 5CIUA 3SWNA 5CAIA 5FU6C 5LJ3e 3CMAT 2EJ9A 2DXCB 4IKFA 3CMEA 4ATOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPG B;  3A8H B;  5L8R E;  4ZGJ B;  3X26 B;  3X20 B;  2ZCF B;  4XK8 E;  1AHJ B;  2CYZ B;  2DD4 B;  2CZ1 B;  3QZ5 B;  4OB2 B;  3X25 B;  4RKU E;  3VYG A;  3QYG B;  1PSE A;  3WVE B;  2AHJ B;  2CZ7 B;  2PVD B;  3X24 B;  2ZPB B;  2DXB A;  2O01 E;  4OB1 B;  4L6V 5;  2PVO B;  2WSE E;  3WVD B;  2PUK B;  2D0Q B;  2PU9 B;  1V29 B;  2CZ0 B;  2ZPH B;  2WSC E;  1DJ7 B;  3A8G B;  2ZPI B;  1UGQ B;  3VYG B;  3QXE B;  4OB3 B;  2PVG B;  3A8O B;  1UGS B;  1UGP B;  4Y28 E;  2ZZD A;  3VYH B;  2DXB B;  1PSF A;  2CZ6 B;  1QP2 A;  2DD5 A;  3HHT B;  1IRE B;  4KT0 E;  2QDY B;  3A8M B;  2DXC A;  1GXI E;  2ZPF B;  3X28 B;  3A8L B;  2ZPE B;  4ZGE B;  2PUO B;  2DD4 A;  3QYH B;  4FM4 B;  2ZZD B;  1QP3 A;  4ZGD B;  2DD5 B;  3LW5 E;  1JB0 E;  4OB0 B;  2WSF E;  2DPP B;  1UGR B;  3QZ9 B;  2DXC B; 
#chains in the Genus database with same CATH topology
 1I1J A;  2YRC A;  4PJL A;  4GLM A;  1VQ4 Q;  1NBE B;  5GAN g;  2RI2 A;  4JDS A;  1U06 A;  1VQM A;  3MIA B;  4O5V A;  3CCS T;  2QI2 A;  4KGZ B;  4MDX A;  1TSF A;  3V8J A;  3OMC A;  1EX4 A;  4M75 E;  2RJC A;  1VQN Q;  5I22 A;  3B57 A;  2C5V B;  1M8M A;  2CKK A;  2JMA A;  3VS1 A;  2DMO A;  3CC4 T;  1BI3 A;  4OMO A;  5EC7 A;  4CC4 B;  1BI1 A;  1Y57 A;  4PL6 A;  1PSE A;  5GAN 7;  1PHT A;  3MEW A;  1OQK A;  3GIB A;  2JGZ B;  3QDR B;  4AFS C;  2JS2 A;  1AWX A;  3URG A;  2KBT A;  3HFN A;  3OSS C;  2KAF A;  3BDU A;  3TN8 B;  2LNH B;  4ELL A;  1ZSZ C;  2DE0 X;  4J9D A;  4AG2 C;  1X01 A;  1ZLM A;  5HKC A;  3NTH A;  2YUO A;  3NTK A;  1YCS B;  2ZPI B;  2CP0 A;  5GAO r;  1HYO A;  1OOT A;  1WJR A;  2PQW A;  2EKH A;  1R0C B;  1WFW A;  2SEM A;  4II1 A;  2KRS A;  2JNG A;  1UGP B;  2VXE A;  3PE0 A;  1GFD A;  3GPL A;  1VQ8 T;  1AWO A;  1KXU A;  1ZA2 B;  2PHG A;  2NLU A;  4BCF B;  1IGU A;  2EVR A;  3PVQ A;  2OTJ T;  2RJF A;  4HXJ A;  4LDU A;  3UA7 A;  2IPO B;  4BCI B;  2EYY A;  4M77 B;  2LJ3 A;  3X28 B;  3CPW A;  5GAM f;  2HMA A;  2HNI A;  1H92 A;  2YT6 A;  2NWM A;  4NST B;  3H0I A;  3QPH A;  2IVX A;  5KYY B;  1UE9 A;  2A37 A;  4D8D A;  2J6K A;  2K4Y A;  4M7A G;  2RI5 A;  1GBQ A;  1XNI A;  3C95 A;  3CEY A;  4QT7 A;  4M6V A;  4DBQ A;  1YJN Q;  1WJQ A;  3CC2 T;  2EUF A;  1ABQ A;  2LCL A;  2KXC A;  5GAN 6;  2LT1 A;  4PJO E;  4PLL A;  4ELY C;  2EQU A;  3QYE A;  5GAN 8;  2BTT A;  2B9R A;  2VGN A;  4EMH A;  1KQS S;  1K73 R;  2MK5 A;  2X4X A;  2XU8 A;  3CD6 T;  4II5 B;  1R8O B;  2CT4 A;  3RMS A;  3CCQ T;  4CXA B;  2QQR A;  2K57 A;  4C8Q G;  5GAN h;  4BI3 A;  4RCC A;  4JLG A;  4C5H A;  1U3O A;  3FC3 A;  2CT3 A;  4IUV A;  5GAN e;  1G8X A;  1WLP B;  3OW2 S;  2K79 A;  2O01 E;  2WPA B;  3E2U A;  1KC8 U;  2V8K A;  5CCA A;  3DB3 A;  4F7U G;  3JCM X;  2QEX A;  2X4J A;  4XU0 A;  4ANJ A;  4PJO C;  2RH2 A;  3CCM A;  2FVU A;  1UGQ B;  4XAX B;  3QXE B;  2WIP B;  3NFC A;  4EMK B;  4FT4 A;  4BCK B;  1FVV B;  2VC8 A;  3A8O B;  4A4E A;  1Q7Y C;  3S3M A;  4CC2 A;  2ZAE A;  3H8Z A;  4J7F A;  4N0A A;  5DM7 R;  4HCZ A;  3VYH B;  4JLI A;  2UUE B;  1UB4 A;  2DD5 A;  3EFS A;  4HCC A;  1URC B;  2AIR B;  3LGL A;  4KT0 E;  2F1L A;  3VUZ A;  4Z02 A;  4PJO F;  1JSU B;  2EAY A;  2W10 A;  2YDL A;  2QAS A;  4F7J B;  2WHB B;  4YTL A;  3GF5 A;  3CCV Q;  4B9W A;  4EOI B;  2VV5 A;  2QEX Q;  3CXC P;  2KR6 A;  4CFM B;  2K3Y A;  3SEM A;  4FSS A;  2PUO B;  3H0F A;  1SEM A;  4F7N B;  2EQM A;  4C0Z A;  3CCL T;  1T0J A;  4N4I A;  1OZ3 A;  1MMG A;  1VQK T;  1EFN A;  2F2C A;  1PD1 A;  4C5G A;  1IO6 A;  2D1X A;  1AD5 A;  1JXM A;  4OR5 B;  3L2W A;  1K0X A;  1G3Y A;  5LJ5 j;  5D6X A;  3G7Z A;  4BUG A;  1Q82 U;  4PJO D;  4HVU A;  2KMG A;  2KXD A;  3HL8 A;  2RA2 A;  4MZT A;  3RKX A;  4AKH A;  1RAA B;  1AZG B;  2WXV B;  4I3Z B;  2QDL A;  2KY9 A;  1YNZ A;  1O9S A;  2KSS A;  1W6X A;  1TUG B;  2E6Z A;  3UF4 A;  4E7J A;  2RD1 A;  5D6Y A;  3MEV A;  3G71 T;  1X2K A;  1UHC A;  1WXB A;  4XU3 A;  2HBP A;  1TH7 A;  4A53 A;  1M2O A;  1SSF A;  1XTD A;  4G6L B;  4BI8 B;  2RQW A;  2HSE B;  3GBQ A;  5HQ0 B;  1PD0 A;  1M2V A;  1M90 U;  2PVD B;  4QQD A;  1UJ0 A;  2YUP A;  1YHQ A;  2K7A A;  2O31 A;  3M0P A;  3KUF A;  4R56 A;  2BZX A;  3CCR T;  3GLX A;  2IW8 B;  4MML A;  3RER A;  3H41 A;  1HK9 A;  2KRN A;  2L3Q A;  2QGF B;  5LJ5 g;  1G3N C;  2VYT A;  2XD0 A;  3TQ7 P;  4ROC A;  1JJ2 P;  3CXC A;  3P8H A;  1SG5 A;  3EHR A;  4EMG A;  3M0S A;  3G33 B;  1KHC A;  1WX6 A;  5ICP B;  3MP1 A;  2E41 A;  3EG2 A;  3E9F A;  1VYW B;  3M0Q A;  1ZSZ B;  2ENM A;  2LX7 A;  2DX1 A;  2CH4 W;  3OMG A;  2DKG A;  1OPK A;  2CUB A;  4M78 E;  4PKC C;  5FWC A;  3QJY A;  3DLL A;  4RTX A;  3TCJ A;  3VKI A;  4J8O A;  4M75 B;  4EOP B;  3VV0 A;  2C5N B;  3LQ5 B;  2RI3 A;  2IW9 B;  2ROL A;  2D8J A;  4Q5W A;  2W9Z A;  4C92 C;  2V22 B;  1OU8 A;  2X4Y A;  1X6O A;  3JB9 I;  2XI9 A;  1MMA A;  4AFQ C;  1KD1 U;  2XIC A;  5HY6 A;  5FRO A;  1GBR A;  3OYM A;  1OX9 A;  2K6D A;  2DXU A;  3JCM h;  3OYJ A;  5KYW B;  2ZPG B;  1WQ7 A;  2FYK A;  1K9M R;  5J3B A;  1QKW A;  3BG9 A;  4CC7 A;  5HBE B;  2GTJ A;  1XOV A;  1YJ9 T;  3JCM e;  1YBY A;  3G4S A;  2F5T X;  3OS5 A;  2DLP A;  2JTF A;  4M78 C;  1VYU A;  5HNB B;  4KRT A;  4C92 F;  2LC4 A;  1AWW A;  1D3U B;  3EGU A;  3M54 A;  2DRM A;  2RJD A;  2WEV B;  5FRM A;  1GL5 A;  3M58 A;  2YUQ A;  1VQ7 A;  3A98 A;  4FIB A;  2IG0 A;  3CC7 T;  2HQH A;  2YLC A;  3OYB A;  1RI9 A;  3RGF B;  4OGC A;  4HVW A;  4XU1 A;  4M78 F;  2QF7 A;  4C92 D;  2EPD A;  2JZ2 A;  2E70 A;  4M77 A;  3VYG B;  2HEQ A;  1B07 A;  4JS5 A;  3S3N A;  4A4H A;  1I0C A;  1RAE B;  4F7S B;  2AKK A;  3G4S Q;  2KK4 A;  3KHI A;  3CD6 Q;  3PNW C;  1VYT A;  2PVG B;  5FU6 B;  2NYS A;  3M56 A;  2L3P A;  4AG1 C;  1H1P B;  4QVZ A;  2EJG A;  3S3O A;  1IHW A;  2KRO A;  5I2S A;  1TWB A;  2CZ6 B;  1QVG P;  1QP2 A;  2YRD A;  3HO8 A;  1LPL A;  2BE9 B;  4F6W B;  4M78 D;  2HDA A;  4PJO B;  2JUF A;  1JOW A;  1BCM A;  3D7S B;  2ED0 A;  1VQ7 Q;  3JSC A;  1M30 A;  1VQP A;  4KUI A;  2ATC B;  1OEB A;  1C9B A;  1FMV A;  3THK A;  1H3H A;  3GNF B;  4JS4 A;  1VQO A;  3Q1J A;  4CC3 A;  4M7D G;  1YCY A;  1JXO A;  3CCU T;  2RMO A;  2ABL A;  1D3B A;  1F5Q B;  3OYN A;  2G9X B;  1JJ2 S;  3SFM A;  2DBM A;  1Y71 A;  3QG1 A;  2DL7 A;  5CIU A;  4NOY A;  1RL2 A;  1YWO A;  4IKF A;  4CFU D;  3OYH A;  3A8H B;  1G3W A;  1N8R U;  4M7A E;  2GQV A;  4QW2 A;  1SRM A;  1Q86 U;  1FX7 A;  1X43 A;  4F7L B;  4WF2 A;  4QQ6 A;  2IW6 B;  5A2Q E;  1I81 A;  1O9K B;  3RES A;  1H3Z A;  5GMK e;  2K9G A;  1VQ5 T;  5EG2 A;  5DLO A;  1IHV A;  2DIL A;  4PFO A;  3EGX B;  3UPU A;  5IT9 E;  3CCL Q;  4EMK A;  1UNG D;  4LD9 K;  1BI0 A;  1UTI A;  2DBK A;  1VQK Q;  2KRM A;  5KYU B;  1OPL A;  4PJN A;  2JN0 A;  4BCQ D;  3OSV A;  2WJ9 A;  3P8B B;  4O6J A;  2OTL T;  4J9F A;  2LNV A;  1KQ2 A;  1X69 A;  2K2V A;  4JRQ A;  4ELJ A;  4A4K A;  5ECA A;  2FHD A;  4F16 A;  2J7I A;  2PVO B;  2FEI A;  1QCO A;  3MEU A;  1AZE A;  1FKM A;  3AHU A;  4HA8 A;  1QVG A;  4M7A C;  2PMI B;  4HVV A;  2ZPH B;  2DME A;  3HB9 A;  1D1A A;  3V7C A;  5LJ3 f;  3JB9 J;  1AD6 A;  4FX3 B;  5CYI B;  2Z0W A;  4F7U E;  4EPC A;  2CUD A;  2Y4X A;  3G71 Q;  2FRY A;  4L5G A;  3M9Q A;  5GJV B;  2B86 A;  4BI4 A;  1GCP A;  2P0K A;  4EOS B;  1VQ6 A;  3H9N A;  4JJD A;  1GFC A;  4LN2 A;  1C6V X;  1PRM C;  2EKO A;  4X1V A;  4LUD A;  2PK9 B;  2QYZ A;  4E2F B;  4M7A F;  2UZD B;  3VS2 A;  2VKN A;  3TEE A;  4QSH A;  3I55 Q;  3HBL A;  1AIS B;  3A8L B;  3CCE T;  4RTZ A;  1YP5 A;  5KCO A;  1UEB A;  1T0H A;  5BNJ B;  2RHX A;  5CQX A;  1Y0M A;  2LTO A;  5D6W A;  2YUN A;  3I5S A;  2LCS A;  1RAD B;  3EH1 A;  4HT8 A;  2X1N B;  4CFV B;  1JB0 E;  1VQ4 A;  4Y72 B;  4M7A D;  4BE1 A;  8AT1 B;  2C0T A;  1M5Q 1;  2EQK A;  1VQ6 Q;  1I5O B;  4FSX A;  4MDW A;  4HCK A;  3QII A;  1NEB A;  2EJF A;  2LJ0 A;  2EBP A;  4FW2 A;  1KQ1 A;  4FYX B;  1SRL A;  3I9Q A;  5AT1 B;  5DQV A;  2DYI A;  4BBR M;  3SB2 A;  1QVF S;  4F7U F;  5GAN 3;  3OW2 P;  3PMI A;  4FW1 A;  1BU1 A;  1NLO C;  4CFX B;  2QK0 A;  3SWN B;  5GAM j;  1ZQ1 A;  2MI6 A;  1RAF B;  2QG9 B;  2IIM A;  3TW7 A;  1QKX A;  1AEY A;  3TVT A;  3WVD B;  1QLB A;  2CP5 A;  1OI1 A;  4Y92 A;  1ZSZ A;  2W96 A;  2XMF A;  3GP8 A;  3SDZ A;  5GAN 2;  2RQT A;  4M78 B;  2M1H A;  5LJ3 d;  1E7O A;  1FMK A;  2VGM A;  1HD3 A;  4IUU A;  1NE8 A;  2PZ1 A;  1YJ9 Q;  1ARK A;  5DY9 A;  3CCJ T;  3OYY A;  4KBM B;  4M75 A;  1VQ9 T;  1UGS B;  2E10 A;  3INZ A;  2C5X B;  2CDT A;  4LNP A;  1PSF A;  4BY6 C;  1M8V A;  2A3L A;  4AT1 B;  5KYW A;  3M53 A;  3FJ5 A;  4AMC A;  3C0C A;  1KQS A;  3L2U A;  3OYK A;  1RAB B;  2CH4 A;  5GAM g;  3ULR B;  1K0S A;  1UFF A;  2C6T B;  3R6O A;  1YJN A;  3QYH B;  5I11 A;  1K9M C;  5AYF A;  2P4R A;  2XKO C;  1G83 A;  4EOO B;  3LW5 E;  1HSQ A;  1WYX A;  2XDP A;  3OW2 A;  5HBH B;  1BCO A;  2O9V A;  4BCQ B;  1ZBX A;  1BKB A;  3RKY A;  1FYN A;  4BCP B;  3JCM c;  1G5V A;  1JO8 A;  4AFZ C;  5IXF A;  1YIT T;  1KSW A;  4KUD K;  2ZCF B;  4XK8 E;  2CYZ B;  3MCA B;  2KE9 A;  3N5B B;  3PT9 A;  2MWP A;  1RAC B;  1UNL D;  2CP7 A;  1H1R B;  3PTA A;  1TS9 A;  3VS7 A;  3VYG A;  1IZ6 A;  3V7R A;  1QWF A;  2DM1 A;  2C5O B;  5KE2 A;  3QYG B;  2RHZ A;  4A54 A;  4FYY B;  1VYV A;  2VB6 A;  1VA7 A;  4BY1 X;  3LLR A;  2D0N A;  3H6Z A;  2DAQ A;  2QQB A;  4OMP A;  2MIO A;  1BIB A;  4JPB W;  1XJW B;  2C0I A;  1D3B B;  2PNI A;  1YJW T;  4PJO A;  2YSQ A;  1Q81 C;  3ASK A;  2K5F A;  2COW A;  2JOY A;  2KGT A;  1B7T A;  4OVA A;  5FRN A;  2GCX A;  3OA6 A;  1NZ9 A;  1W4S A;  4C0D C;  2KMT A;  1U8R A;  4EOK B;  1VQ5 Q;  3NGP A;  3OYE A;  2CP6 A;  1S72 T;  4FCY A;  4KGX B;  5FU7 C;  1X75 C;  4DBR A;  2DXB B;  3CCV A;  2G77 A;  2CGH A;  1K8A C;  1OL2 B;  2BE7 D;  3BW1 A;  1SHG A;  4RMO A;  4M7A B;  1TFB A;  1A0N B;  5A0G A;  1TTH B;  1PC0 A;  5GAN d;  3MP8 A;  4QQG A;  4JZ3 A;  4M4Z A;  4YOS A;  1PRL C;  4DEX A;  4J6W A;  1UDL A;  3RKW A;  4J9E A;  3CPW S;  3R6N A;  3OS1 A;  2RNA A;  5CKD A;  1O9K A;  1Z9Z A;  1YI2 T;  1QWE A;  1YN8 A;  1VOM A;  3EGX A;  3OYG A;  1NJI C;  4DBH A;  5GAM h;  3QWL A;  4J9H A;  4HCB A;  2QAZ A;  2WSF E;  3HTR A;  3QUI A;  3M0T A;  3PIP A;  1HXD A;  5KYU A;  2O2O A;  4IUQ A;  4M7D E;  3UA6 A;  3VJP A;  4X34 A;  5IF1 B;  3DOG B;  5GAM e;  3JV3 A;  3HRU A;  3F70 A;  4NS5 A;  4ZNX A;  1GY3 B;  1YIJ T;  2QGS A;  3BLR B;  2I0N A;  2CZ1 B;  3CCE Q;  4IUP A;  1H26 B;  1EIF A;  4JX5 A;  1H64 1;  1PKS A;  2JM9 A;  1OI9 B;  5I21 A;  1J3T A;  4EOR B;  3HPW A;  2M02 A;  5CQY A;  1M1K C;  1RAG B;  1X6G A;  3CMA A;  3JCM P;  1V1C A;  3QSU A;  3HP9 A;  2HSP A;  4YC3 B;  2DYB A;  4EDU A;  2X51 A;  2F2V A;  3L1A A;  5KE3 A;  1MMN A;  2QA4 T;  2W0Z A;  4M7D C;  5HK3 A;  3OBW A;  2WSE E;  3GOX A;  2WIH B;  3CCS A;  3I56 T;  1AWJ A;  4AKG A;  3G6E T;  1FWZ A;  2DF6 A;  2FZG B;  3MO8 A;  3CC4 A;  1R77 A;  3FB9 A;  2PK2 A;  2JTE A;  1SKU B;  1LNX A;  1UG1 A;  4BDZ A;  2I40 B;  1WXU A;  1E9H B;  4A63 B;  2F69 A;  2E65 A;  2KT8 A;  2D6F A;  4J9C A;  2PJQ A;  3JCM f;  3L2V A;  3EFR A;  1R0B G;  2K3X A;  2YLB A;  3CMA Q;  4M7D F;  3LWI A;  3QJ6 A;  2P4T A;  4LE9 A;  3VKG A;  1C0M A;  3MI9 B;  1RUW A;  1IRE B;  2XDD A;  3DL1 A;  4PJM A;  3C94 A;  2OAW A;  3CCS Q;  4M75 G;  3MET A;  4C92 E;  4PK4 A;  3RR6 A;  3ZL7 C;  5IXB A;  1E6G A;  5I2M A;  3CC4 Q;  1VQ8 A;  1ENW A;  3CCJ Q;  1OYX A;  1H1Q B;  4C92 A;  4M7D D;  3MHX A;  1NPP A;  5GMK l;  1VQ9 Q;  4BY6 B;  2OTJ A;  4LOC A;  4F17 A;  4BCG B;  3SWN A;  2BUD A;  1H1S B;  2EJ9 A;  4ATO A;  1D0Z A;  2KYB A;  4TTH A;  3LX7 A;  3PO3 S;  1M3A A;  1QMC A;  1KFZ A;  4WTO B;  3QZ5 B;  2FRW A;  4M78 A;  1XO2 A;  2X3X D;  2P84 A;  4E7S A;  3VS3 A;  3EJ1 B;  2CP3 A;  4QVC A;  3L2Z A;  5L23 A;  1C1A A;  5IN1 A;  3QHR B;  1XQH A;  1OIU B;  3CC2 A;  1VQ8 Q;  2RHY A;  3J81 E;  2AHJ B;  3UDC A;  1LOJ A;  1W98 B;  4RTV A;  3OYD A;  1I8F A;  1TUC A;  3RUX A;  2LT4 A;  3RDV A;  1GCQ A;  2EFI A;  5LL6 S;  2OTJ Q;  5GMK i;  3H0H A;  1VQL T;  2XHC A;  2CSQ A;  4C5I A;  4E47 A;  1W2B S;  4A4G A;  4MZP A;  1VIN A;  3OYA A;  3JCM Q;  3CD6 A;  1VQ4 T;  1K76 A;  5J39 A;  1AOJ A;  3CCQ A;  2MPX C;  2KDS A;  1MV3 A;  2J05 A;  4KH1 B;  2CRE A;  4DOV A;  2R5A A;  1VQN T;  2DFU A;  2AT1 B;  2FPD A;  2V8J A;  3EG0 A;  1JJ2 A;  3JCM d;  1WDX A;  2RQR A;  1ZBJ A;  2W9F A;  4JJC A;  1UNH D;  1GUX A;  2K5L A;  5CO7 A;  2F5K A;  2BS3 A;  3CC2 Q;  3GNG A;  1OGU B;  4BXX X;  2DZ9 A;  4QVD A;  4F04 B;  1UUE A;  4J7I A;  3A8M B;  1ZUK A;  2X4W A;  1GXI E;  2JS0 A;  1H24 B;  2DTI A;  5GMK m;  3A5Z B;  3CME T;  1WXT A;  4CI0 C;  5IDP B;  2ECZ A;  1U1S A;  4MIM A;  4ZGE B;  4ESR A;  3QHW B;  1UEC A;  1WIE A;  4C0D B;  3CCQ Q;  2DL5 A;  2RJE A;  1VQM T;  2KVQ G;  2F2W A;  4HNT A;  5LJ5 h;  3VS6 A;  1Q81 R;  2X9H A;  2L3R A;  3BE3 A;  3JCM J;  4QKU A;  2EGE A;  1N8R R;  3BG5 A;  1Y96 B;  4JZ4 A;  5LJ5 e;  5LJ3 j;  3GTM S;  1WHJ A;  2G6F X;  3NDQ A;  2HZY A;  2OI3 A;  5I5Z B;  4OGR B;  5CR2 A;  1QVF P;  1KC8 C;  2F2X A;  3CCL A;  1K8A R;  3MY5 B;  3C12 A;  1N4M A;  1BK2 A;  1VQK A;  1OU9 A;  3HSB A;  4E7L A;  5LJ5 d;  2BS4 A;  2D9T A;  2QDJ A;  1O75 A;  2KQW A;  1Q95 G;  4KH0 B;  3O5Z A;  2QQS A;  3M4Y A;  4JX4 A;  2I2L A;  4MFD A;  1KJW A;  3QO3 A;  4XTY A;  2LQN A;  2ZPB B;  2DXB A;  1QLY A;  2IVW A;  4Z89 A;  3U23 A;  1TG0 A;  1NJI R;  1GH6 B;  2PTK A;  4F14 A;  2PUK B;  3LH0 A;  1T3L A;  4BD3 A;  4M7A A;  3G71 A;  1V76 A;  2FZC B;  2CZ0 B;  3V8L A;  4ZN3 A;  3A8G B;  5KCH A;  2BKD N;  2DL4 A;  2EWN A;  2RHI A;  3QKJ A;  4RG8 A;  3UT1 A;  1HJD A;  2NUP B;  5LJ3 g;  1NG2 A;  2EQJ A;  3RMQ A;  4ME7 A;  4CRL B;  1B34 B;  1K1Z A;  5GAO l;  2J6F A;  4C8Q E;  4GLK A;  1AT1 B;  3KXT A;  5CK9 A;  2L3S A;  3I55 A;  1CKA A;  2RK2 A;  4M7D B;  3CCR A;  4X9D A;  1IXD A;  1M1K R;  1TU0 B;  1H4L D;  3LGF A;  1Q82 C;  2QA4 Q;  2I53 A;  2RQV A;  2ZPF B;  2DVE A;  3I56 Q;  1BIA A;  2QQA A;  4R0K A;  2DET A;  3OBY A;  5HVY B;  3G6E Q;  3DJB A;  3OB9 A;  1ZA1 B;  2EYW A;  1QVF A;  1Q7Y U;  4B6M A;  2JXB A;  2HL5 C;  2EYQ A;  4F7U A;  3DKM A;  3BHU B;  5FLX E;  1F1B B;  2VVK A;  1QP3 A;  3HZJ A;  1D0X A;  4OB0 B;  2BZY A;  3NMZ C;  4EMK C;  4ZTJ A;  4LDW A;  1QQJ A;  4C8Q C;  2C06 A;  3OS0 A;  4CFW B;  1NM7 A;  3KBG A;  1M90 C;  4DOW A;  3IQL A;  3CCR Q;  5GAO p;  5L8R E;  1VUB A;  2HQE A;  4IUR A;  4J9G A;  1T3S A;  3E1S A;  1GRI A;  3G1J A;  5HCK A;  4HKE A;  3E19 A;  3EHQ A;  2QEX T;  2DD4 B;  1TOV A;  4OB2 B;  2GTO A;  4UC4 A;  4CRI A;  3M5A A;  3V8K A;  3VRZ A;  3CCM T;  2X3W D;  5EFQ B;  2COZ A;  1ZX6 A;  3JCM W;  2WFY B;  2LCC A;  1UHF A;  2P0Q A;  4C8Q F;  2MMP A;  4DA4 A;  3LYI A;  7AT1 B;  2CZ7 B;  4VUB A;  2KI7 A;  1WHG A;  4GBQ A;  2YXY A;  5IHN A;  2EGA A;  2J06 A;  5CKH A;  1YJ9 A;  1N6A A;  3FRN A;  2D0Q B;  1OUL A;  5GAO m;  2FB7 A;  3TNI B;  4V2S A;  3OYL A;  2H3J A;  2QFZ A;  1MND A;  4C92 B;  2DL8 A;  3EG9 B;  2UZE B;  4OF1 A;  2COY A;  1H8K A;  2O88 A;  3QDF A;  1UJY A;  2RB6 A;  2WMA B;  2H8H A;  1TUD A;  4C8Q D;  3HKS A;  3UWN A;  4BE0 A;  4BCO B;  5GAN 5;  1LJO A;  1WI7 A;  2E3I A;  4BCM D;  2DZC A;  2FZK B;  4E6R A;  3ZEH A;  4JRP A;  1KD1 C;  3FJP A;  1MMD A;  5HBJ B;  1M9S A;  4PFP A;  1E7P A;  3I5R A;  4MZM A;  3CPW P;  3MEA A;  1VQL Q;  4IMY B;  1B3Q A;  2GBQ A;  1RI0 A;  2EYX A;  4FM4 B;  5CEI B;  2ZZD B;  1MHN A;  1Y07 A;  4XQ3 A;  3RNJ A;  1IRX A;  4M77 G;  2RHU A;  5GAO n;  4CFU B;  1UGR B;  3QZ9 B;  1RAH B;  2RPN A;  2DTH A;  1JKW A;  4EOL B;  2RK1 A;  3M57 A;  3CC7 Q;  5GAN f;  4PFZ A;  5IHY A;  1YHQ T;  3JB9 G;  4IIO A;  2GFA A;  2XID A;  3X20 B;  1JBM A;  3EGD B;  2D8H A;  4E7I A;  3FEO A;  3HRT A;  2BZ8 A;  4NL2 A;  5IH2 A;  3CCU A;  1AHJ B;  2E3H A;  3CME Q;  1GUX B;  4LUE A;  4RKU E;  4FL6 A;  1NEG A;  2R5M A;  4BCN D;  4CFN B;  4PNO A;  1FIN B;  2LX9 A;  3RIR A;  1VQM Q;  1M4Z A;  4M75 C;  5M9O A;  1P5E B;  4EON B;  3AT1 B;  3EOC B;  3QBY A;  2DVJ A;  3OS2 A;  2HQX A;  1PKD B;  4N4G A;  4OB1 B;  2DA9 A;  1U5S A;  1IGQ A;  2PU9 B;  1NPR A;  2V8I A;  1OZ2 A;  1I4K 1;  1VQ5 A;  2GF7 A;  2HCK A;  1WHM A;  4RUG A;  2X35 A;  2B8A A;  1MUZ A;  4J9I A;  3UAT A;  1BBZ A;  4EC8 B;  3CCU Q;  1BYM A;  1D0Y A;  1KC8 R;  4XTZ A;  5CKB A;  2JVV A;  2OTL A;  1YFN A;  3MKD A;  4M75 F;  1H28 B;  1M1G A;  4K11 A;  2FPF A;  2Y4Y A;  3A1P A;  2LJ1 A;  1I5L A;  3TNW B;  1Y96 A;  4EOQ B;  2V1R A;  2AKL A;  2O9S A;  2JMC A;  4IUT A;  5IHI A;  1WHK A;  4OMN A;  4E7K A;  1KG1 A;  1N8R C;  1FXX A;  4J6X A;  1Q86 C;  1M3B A;  2L5Q A;  2OX7 A;  4ZN1 A;  4HL4 A;  4AKI A;  4LDY A;  5IAY A;  4M75 D;  3G4S T;  2Y90 A;  2DEU A;  2OTL Q;  1OX8 A;  3I35 A;  4OMM A;  1WNL A;  5FWB A;  1RAI B;  3ME9 A;  3BFM A;  4GY5 A;  5FU6 C;  2DXC B;  1OKW B;  1M1F A;  4JJB A;  3CCE A;  5KYN A;  4E7H A;  3ZBD A;  1KK7 A;  4Y91 A;  2DJZ A;  4XTU A;  2P0P A;  3DB4 A;  2MWO A;  1VQ7 T;  1ZUY A;  2KT1 A;  3BHT B;  4E7Z A;  3EID B;  1Q82 R;  3L2R A;  2CCH B;  1RLQ C;  2QTX A;  4IIM A;  3MJX A;  3TU4 K;  5CKF A;  2RO0 A;  4ROE A;  4DQ2 A;  2BKZ B;  2BS2 A;  3S6W A;  1H25 B;  2HD0 A;  2KYM A;  2NUP A;  5L2W B;  2KEA A;  2NUT A;  4FYV B;  1PNJ A;  5FW9 A;  1K73 U;  4C8Q B;  2JJ9 A;  4N4H A;  1ACM B;  4BDY A;  2JW4 A;  1B34 A;  1W2B P;  2W99 A;  3P8D A;  3PIO A;  3X24 B;  2JTM A;  4BBS M;  4M7D A;  4BCM B;  1WHL A;  2HKQ B;  2ED1 A;  1Y7X A;  2LMJ A;  4BCH B;  3BLH B;  4HNV A;  2JT4 A;  4FT2 A;  1M90 R;  2WSC E;  3JAM E;  1QVP A;  4F7U B;  2DIQ A;  5GAN 4;  5CKE A;  2LRQ A;  5GAM d;  1VQP T;  1M27 C;  3CBP A;  1CSK A;  1M3C A;  4LXC A;  4DEY A;  2HL3 A;  4DBF A;  2HAX A;  2XG8 D;  2A7Y A;  1VQO T;  4XTX A;  3PGG A;  2RM4 A;  3CCM Q;  2MCN A;  2DER A;  4N0A C;  3WXM B;  3NPF A;  3JCM g;  3BY7 A;  4C5E A;  4EIK A;  2M0O A;  3JB9 H;  2NUZ A;  3HHT B;  1WHH A;  4D6W A;  4KRD B;  3MPU B;  1I07 A;  2QDY B;  2K2M A;  4LDX A;  1BI2 A;  2A08 A;  2L2P A;  3CCJ A;  1QMZ B;  1EZZ B;  2ZPE B;  5GAO q;  2VWF A;  1VQ9 A;  4NC6 A;  2EGC A;  2DD4 A;  3M0R A;  4Z88 A;  1ZP2 A;  1YWP A;  1D1B A;  5KH6 A;  2CJM B;  5KYX A;  2E5Q A;  4BCN B;  3EFO B;  1FMW A;  2V1Q A;  4RTT A;  4L59 A;  2DPP B;  2C4G B;  2R58 A;  3BHV B;  2CS7 A;  2E4H A;  4UN0 A;  1WPY A;  6AT1 B;  3EG3 A;  1W2B A;  1X27 A;  2EW3 A;  4J83 A;  1KIK A;  4EOJ B;  3I55 T;  1ZHI A;  3TSW A;  2E12 A;  1KD1 R;  2O4X B;  4RTU A;  1JQQ A;  2L8D A;  5GMK j;  2XDB A;  3VS5 A;  2UZB B;  2M16 A;  3O0G D;  3EG9 A;  3BDL A;  3NHN A;  3HRS A;  4XTW A;  3WVE B;  3JRZ A;  1MNE A;  4OMF B;  3QYB A;  4RG2 A;  4FYW B;  3EAE A;  1SHF A;  4X9C A;  2DL3 A;  1UGV A;  1OKV B;  1LVK A;  2C0O A;  3VU3 C;  2GGR A;  1ABO A;  1VQ6 T;  1YIT A;  4KUL A;  2MF2 A;  4J9B A;  1SPK A;  3PFS A;  2OAU A;  2M51 A;  5LJ5 f;  2AZS A;  3MY1 B;  1YHQ Q;  2E5K A;  1TD6 A;  2QGG A;  2V26 A;  1JU5 C;  3FDR A;  4ELZ C;  2A0F B;  2DK3 A;  4D8K A;  4YOZ A;  2BIV A;  2DO3 A;  3CPF A;  1KHI A;  2RN8 A;  2VAS A;  4Z6Y A;  2W2H A;  3BG3 A;  4JX6 A;  4C0F A;  2ZZD A;  5HK0 A;  4BY7 X;  3H4C A;  4ZTF A;  3M0U A;  5LQF B;  8ATC B;  3POM A;  3TSZ A;  4F6S B;  1YJW A;  2E6N A;  3VKH A;  3SWN C;  4OP0 A;  1YIT Q;  3ZFJ A;  2DTO A;  3CBM A;  1JST B;  4PLI A;  2A28 A;  4Z8A A;  1WGS A;  3EGD A;  3EH2 A;  5CVI A;  1S72 A;  1P92 A;  2CSI A;  2YWW A;  3M03 A;  3CXC S;  1WZO A;  4A4F A;  4PJO G;  4EC9 B;  4ZGD B;  4JJN K;  2BPM B;  4TVR A;  1G3S A;  4XU2 A;  2ROT A;  2ESW A;  1VIF A;  5DQW A;  2MAM A;  1PCX A;  1WQW A;  4B9X A;  1GCQ C;  2WMB B;  4ZGJ B;  3X26 B;  4HNU A;  1YJW Q;  1RLP C;  5GJW B;  4M77 E;  2CP2 A;  1E6H A;  1ZUU A;  2LW4 A;  1OV3 A;  3C4S A;  4BAC A;  1YI2 A;  5ACB A;  1K9M U;  3X25 B;  5FU7 B;  2QTV A;  1NYF A;  2RQU A;  1G2B A;  2E1H A;  2JM8 A;  1Q86 R;  1JRI A;  4JRK A;  1S72 Q;  4OMQ A;  2E64 A;  2QXF A;  4P5N A;  1CKB A;  3RBB B;  2QQ8 A;  2CCI B;  3OQ5 A;  5KYY A;  2A36 A;  1LCK A;  1VIE A;  1AVZ C;  1YIJ A;  3E9G A;  5IDN B;  1V29 B;  1OL1 B;  1DJ7 B;  2J6O A;  4OGE A;  4M77 C;  3OYI A;  4OB3 B;  4MFE A;  4XTV A;  2ZGW A;  2FO0 A;  2DJQ A;  2DEQ A;  1YI2 Q;  2LDM A;  2WAC A;  4LD6 A;  2LQK A;  4LDV A;  1ZSG A;  2QQ9 A;  1U1T A;  3CQT A;  3HFO A;  2R7G A;  4AI6 A;  4Y28 E;  1YJN T;  2QA4 A;  4JRI A;  2VXF A;  1BB9 A;  2M9U A;  2EQI A;  2L89 A;  3I56 A;  3NTI A;  2LVM A;  3TW6 A;  3G6E A;  1PG5 B;  3JCM b;  1BU2 A;  1K73 C;  2DXC A;  1MGQ A;  1N9R A;  4J6Y A;  1Q81 U;  4WCI A;  1Q7Y R;  1YIJ Q;  4M77 F;  2KR3 A;  3T9N A;  1WA7 A;  3QWY A;  3EG1 A;  2NUT B;  4ROD A;  4YOO A;  3FIF A;  5GMK h;  3KFV A;  1MV0 B;  3M4G A;  4JUV A;  1X2Q A;  1N5Z A;  2FL7 A;  4PJJ A;  3JB9 F;  1N27 A;  5DLQ E;  1VQP Q;  2SRC A;  9ATC B;  2RF0 A;  1NYG A;  3VRY A;  3V7S A;  3PMT A;  1W70 A;  3QHS A;  2DD5 B;  3OY9 A;  1VQO Q;  1QCN A;  1G3T A;  1K8A U;  4C8Q A;  3VS4 A;  1VOL A;  3JCM V;  3K7A M;  2K3B A;  1JEG A;  4M77 D;  2R57 A;  2DNU A;  3LH5 A;  1K4U S;  2OJ2 A;  3LWH A;  4BE2 A;  2IN3 A;  2H3E B;  4OML A;  5D7U A;  4BB7 A;  2AZV A;  3TRE A;  5LMK B;  3JB9 D;  2XK0 A;  3QWX X;  3L2Q A;  1QCF A;  4HT9 A;  3F5X B;  1S1N A;  3VUB A;  4KGV B;  3DDP B;  1NJI U;  2UZL B;  3BLQ B;  1WJS A;  2VUB A;  4J5Y A;  5J26 A;  1N9S A;  3MP6 A;  3L42 A;  3REA B;  3DTO A;  2GFU A;  3TNH B;  4F70 B;  5IHK A;  4C0G A;  1PKT A;  5C0M A;  2DXT A;  3M55 A;  1QW1 A;  4L6V 5;  4ORZ A;  1TXQ A;  5A0D A;  3CBO A;  3CCV T;  4F6U B;  3FLG A;  4EOM B;  4C92 G;  3DDQ B;  1IB8 A;  2GNC A;  2LQW A;  1X6B A;  3J80 E;  4AFU C;  2HBW A;  5A0L A;  2LZ6 B;  3PVL A;  5KYX B;  4MMK A;  3VS0 A;  2DRK A;  2YHT A;  4RCB A;  1Z9Q A;  4BCJ B;  1M1K U;  2G3R A;  5GAN j;  4KRC B;  2FG0 A;  3SD4 A;  5C6S A;  1M2V B;  1NLP C;  2GQI A;  5EJC A;  2KNB B;  1VQL A;  4M78 G;  1D09 B;  3EFO A;  1PWT A;  1D1C A;  4NL3 A;  1SSH A;  2M0Y A;  2MYS A;  1OIY B;  3O8V A;  2LP5 A;  1QVG S;  1KQS P;  2FPE A;  2L0A A;  1VQN A;  3OYF A;  4RTW A;  4RTY A;  1H27 B;  2HKN A;  5FGK B;  2O4X A;  3ER0 A;  3M59 A;  2EYZ A;  3SHW A;  3OYC A;  1PM3 A;  1SF9 A;  1K9A A;  3J7A F;  2YRV A;  5LJ3 h;  2K5I A;  3CC7 A;  2MOX A;  2EIF A;  3DLM A;  2AK5 A;  2DIG A;  3REB B;  2LQ8 A;  4R55 A;  4FU6 A;  5CAI A;  3CMA T;  5LJ3 e;  1W1F A;  4HLQ A;  3CME A; 
#chains in the Genus database with same CATH homology
 3OYH A;  3A8H B;  1M1F A;  3CCE A;  1G3W A;  1N8R U;  4M7A E;  2GQV A;  4QW2 A;  3ZBD A;  4E7H A;  4Y91 A;  2DJZ A;  4XTU A;  1FX7 A;  1Q86 U;  5GAN g;  2P0P A;  2RI2 A;  3DB4 A;  4JDS A;  3LX7 A;  2MWO A;  1VQ7 T;  1VQM A;  4O5V A;  4WF2 A;  3CCS T;  2QI2 A;  4MDX A;  4QQ6 A;  3QZ5 B;  5A2Q E;  3L2R A;  1I81 A;  4M78 A;  3RES A;  3V8J A;  1H3Z A;  5GMK e;  3OMC A;  4M75 E;  2QTX A;  2RJC A;  1VQ5 T;  3TU4 K;  5CKF A;  2CKK A;  2RO0 A;  5EG2 A;  4DQ2 A;  5DLO A;  4QVC A;  2BS2 A;  3L2Z A;  3CC4 T;  3S6W A;  3UPU A;  5IT9 E;  4EMK A;  1BI3 A;  2HD0 A;  4LD9 K;  5IN1 A;  1BI0 A;  1XQH A;  1BI1 A;  4PL6 A;  4C8Q B;  1PSE A;  2JN0 A;  4N4H A;  5GAN 7;  2RHY A;  3J81 E;  3OSV A;  3MEW A;  2AHJ B;  2WJ9 A;  3P8B B;  4O6J A;  1B34 A;  3UDC A;  4BDY A;  1LOJ A;  2LNV A;  3P8D A;  3OYD A;  3QDR B;  1I8F A;  3PIO A;  3RUX A;  1KQ2 A;  3X24 B;  2LT4 A;  2K2V A;  4JRQ A;  2EFI A;  2JTM A;  5LL6 S;  4ELJ A;  3URG A;  4A4K A;  5GMK i;  4BBS M;  3HFN A;  4M7D A;  2FHD A;  3OSS C;  2PVO B;  1VQL T;  2KAF A;  2XHC A;  3BDU A;  4C5I A;  1W2B S;  4E47 A;  3MEU A;  4A4G A;  1FKM A;  1Y7X A;  4MZP A;  3OYA A;  3JCM Q;  4HA8 A;  1QVG A;  3AHU A;  3CD6 A;  4HNV A;  1X01 A;  1VQ4 T;  4M7A C;  5J39 A;  4FT2 A;  3CCQ A;  2ZPH B;  2WSC E;  3NTH A;  1QVP A;  2KDS A;  2DIQ A;  4F7U B;  5HKC A;  5GAN 4;  3JAM E;  3HB9 A;  3NTK A;  5LJ3 f;  5CKE A;  2ZPI B;  3V7C A;  5GAO r;  2LRQ A;  3JB9 J;  1WJR A;  4DOV A;  2PQW A;  5GAM d;  1VQP T;  3CBP A;  2R5A A;  4F7U E;  1VQN T;  4EPC A;  2HAX A;  2XG8 D;  2Y4X A;  2A7Y A;  1VQO T;  4XTX A;  4II1 A;  2V8J A;  3PGG A;  2JNG A;  1UGP B;  2RM4 A;  2VXE A;  4L5G A;  3M9Q A;  3JCM d;  1JJ2 A;  4BI4 A;  3GPL A;  2K5L A;  2P0K A;  5CO7 A;  1VQ8 T;  4N0A C;  3WXM B;  2F5K A;  1VQ6 A;  2BS3 A;  3JCM g;  2NLU A;  3BY7 A;  4C5E A;  3JB9 H;  2M0O A;  2EKO A;  3GNG A;  3HHT B;  4D6W A;  2DZ9 A;  2OTJ T;  2RJF A;  4QVD A;  4J7I A;  2QDY B;  3A8M B;  2X4W A;  4LDU A;  4M7A F;  1GXI E;  4LDX A;  2DTI A;  3TEE A;  5GMK m;  3A5Z B;  1BI2 A;  4QSH A;  3CME T;  3HBL A;  4M77 B;  3CCJ A;  3X28 B;  3CPW A;  3A8L B;  5GAM f;  4CI0 C;  3CCE T;  1U1S A;  2ZPE B;  4MIM A;  4ZGE B;  2HNI A;  5GAO q;  5KCO A;  1UEB A;  1VQ9 A;  4C0D B;  4NC6 A;  2RHX A;  3QPH A;  5CQX A;  2RJE A;  2LTO A;  1VQM T;  5D6W A;  2DD4 A;  2KVQ G;  4HNT A;  5LJ5 h;  5KH6 A;  2L3R A;  2K4Y A;  2E5Q A;  3JCM J;  4HT8 A;  4M7A G;  2RI5 A;  1JB0 E;  3BG5 A;  1Y96 B;  1XNI A;  3C95 A;  3CEY A;  1VQ4 A;  5LJ5 e;  4M6V A;  4M7A D;  5LJ3 j;  4BE1 A;  4L59 A;  2DPP B;  1M5Q 1;  1WJQ A;  2EQK A;  2R58 A;  3CC2 T;  2CS7 A;  4FSX A;  1WPY A;  4MDW A;  2LCL A;  5GAN 6;  2LT1 A;  3QII A;  2EJF A;  1W2B A;  4PJO E;  4PLL A;  4ELY C;  5CR2 A;  4J83 A;  2EQU A;  3QYE A;  1KQ1 A;  5GAN 8;  1KC8 C;  3CCL A;  2VGN A;  3I55 T;  4EMH A;  1ZHI A;  1KQS S;  2E12 A;  3C12 A;  2O4X B;  1VQK A;  3HSB A;  2L8D A;  5GMK j;  4BBR M;  4E7L A;  2XDB A;  2X4X A;  2M16 A;  2XU8 A;  3SB2 A;  3CD6 T;  5LJ5 d;  1R8O B;  3RMS A;  2BS4 A;  3CCQ T;  1QVF S;  3BDL A;  4F7U F;  2QQR A;  2D9T A;  2K57 A;  2QDJ A;  4C8Q G;  5GAN h;  5GAN 3;  1O75 A;  4BI3 A;  2KQW A;  4RCC A;  3PMI A;  4JLG A;  4C5H A;  3HRS A;  4XTW A;  2QQS A;  3FC3 A;  3SWN B;  3WVE B;  3JRZ A;  4OMF B;  3M4Y A;  3QYB A;  4IUV A;  5GAM j;  1ZQ1 A;  5GAN e;  4JX4 A;  4RG2 A;  2MI6 A;  3EAE A;  2I2L A;  4X9C A;  3OW2 S;  4MFD A;  3QO3 A;  3VU3 C;  4XTY A;  2ZPB B;  2DXB A;  3TW7 A;  2IVW A;  2O01 E;  1VQ6 T;  1YIT A;  4KUL A;  3WVD B;  1KC8 U;  2V8K A;  2PUK B;  1QLB A;  5CCA A;  2MF2 A;  3DB3 A;  1OI1 A;  4F7U G;  3JCM X;  2QEX A;  2X4J A;  3LH0 A;  4BD3 A;  3PFS A;  4M7A A;  2OAU A;  4XU0 A;  3GP8 A;  3G71 A;  3SDZ A;  3V8L A;  2CZ0 B;  4M78 B;  5LJ5 f;  5GAN 2;  2M1H A;  4ZN3 A;  4PJO C;  2RH2 A;  5LJ3 d;  3CCM A;  2FVU A;  3A8G B;  2VGM A;  4IUU A;  1NE8 A;  5KCH A;  1UGQ B;  2BKD N;  3FDR A;  4XAX B;  3QXE B;  2DK3 A;  2EWN A;  2RHI A;  3NFC A;  3QKJ A;  4RG8 A;  5DY9 A;  3UT1 A;  4FT4 A;  3OYY A;  4EMK B;  2BIV A;  4KBM B;  2EQJ A;  2DO3 A;  5LJ3 g;  3RMQ A;  4M75 A;  1VQ9 T;  3CPF A;  2VC8 A;  1KHI A;  4ME7 A;  3A8O B;  4A4E A;  1Q7Y C;  1UGS B;  1B34 B;  2E10 A;  3S3M A;  3INZ A;  5GAO l;  4Z6Y A;  4C8Q E;  4GLK A;  3H8Z A;  4J7F A;  4N0A A;  3BG3 A;  4JX6 A;  4C0F A;  2ZZD A;  5CK9 A;  5HK0 A;  5DM7 R;  3KXT A;  3I55 A;  4HCZ A;  3VYH B;  3H4C A;  2RK2 A;  1PSF A;  3CCR A;  4ZTF A;  4JLI A;  1UB4 A;  4M7D B;  2DD5 A;  4BY6 C;  3EFS A;  4X9D A;  1M8V A;  4HCC A;  3LGL A;  1YJW A;  2E6N A;  4KT0 E;  3LGF A;  1Q82 C;  2A3L A;  3VKH A;  3SWN C;  3VUZ A;  4OP0 A;  4Z02 A;  4PJO F;  2EAY A;  3M53 A;  3ZFJ A;  2DTO A;  3CBM A;  2ZPF B;  4YTL A;  2DVE A;  3GF5 A;  1KQS A;  1BIA A;  2QQA A;  4PLI A;  2VV5 A;  4B9W A;  3L2U A;  3OBY A;  2KR6 A;  2K3Y A;  1WGS A;  2PUO B;  3OYK A;  3OB9 A;  5GAM g;  2EQM A;  4C0Z A;  3CCL T;  5CVI A;  1QVF A;  1S72 A;  1Q7Y U;  3R6O A;  4N4I A;  1P92 A;  1OZ3 A;  1YJN A;  1VQK T;  3QYH B;  1K9M C;  5AYF A;  2EYQ A;  2XKO C;  4C5G A;  4F7U A;  3DKM A;  3CXC S;  5FLX E;  4A4F A;  1QP3 A;  4PJO G;  3HZJ A;  3L2W A;  4ZGD B;  4JJN K;  1G3Y A;  3LW5 E;  5LJ5 j;  4OB0 B;  4TVR A;  4EMK C;  1G3S A;  4ZTJ A;  5D6X A;  4LDW A;  4XU2 A;  4C8Q C;  2XDP A;  2C06 A;  3G7Z A;  4BUG A;  3OW2 A;  1Q82 U;  3OS0 A;  3CC2 A;  4PJO D;  1M90 C;  3KBG A;  2KMG A;  1ZBX A;  4DOW A;  1BKB A;  1VIF A;  2MAM A;  3RKY A;  3HL8 A;  2RA2 A;  5GAO p;  5L8R E;  4MZT A;  3RKX A;  4AKH A;  1VUB A;  1WQW A;  2HQE A;  4IUR A;  3JCM c;  4B9X A;  4ZGJ B;  3E1S A;  3X26 B;  4HNU A;  2KY9 A;  1G5V A;  1O9S A;  2KSS A;  1YIT T;  4M77 E;  4KUD K;  4HKE A;  2ZCF B;  4XK8 E;  3CCJ T;  2CYZ B;  2E6Z A;  3E19 A;  3C4S A;  3MCA B;  2QEX T;  2DD4 B;  2RD1 A;  4BAC A;  4E7J A;  5D6Y A;  4OB2 B;  4UC4 A;  4CRI A;  1YI2 A;  1K9M U;  3MEV A;  3X25 B;  3M5A A;  3N5B B;  3PT9 A;  2MWP A;  5FU7 B;  3V8K A;  3G71 T;  3PTA A;  4XU3 A;  4A53 A;  2HBP A;  1TH7 A;  3VYG A;  3CCM T;  1SSF A;  1IZ6 A;  3V7R A;  1XTD A;  3JCM W;  2E1H A;  1JRI A;  2LCC A;  4JRK A;  2P0Q A;  5KE2 A;  4BI8 B;  3QYG B;  2RHZ A;  4A54 A;  4C8Q F;  2MMP A;  4DA4 A;  2E64 A;  2QXF A;  3LYI A;  4P5N A;  2CZ7 B;  1M90 U;  2PVD B;  4VUB A;  4QQD A;  2QQ8 A;  3OQ5 A;  4ELZ C;  3LLR A;  1YHQ A;  1VIE A;  1YIJ A;  3KUF A;  5CKH A;  4R56 A;  1YJ9 A;  1N6A A;  3CCR T;  3FRN A;  2DAQ A;  2QQB A;  3H6Z A;  2D0Q B;  5GAO m;  3E9G A;  3GLX A;  2FB7 A;  1BIB A;  3OYL A;  2H3J A;  4MML A;  4V2S A;  2QFZ A;  3RER A;  1D3B B;  1V29 B;  1YJW T;  4PJO A;  1Q81 C;  1HK9 A;  3ASK A;  1DJ7 B;  4HLQ A;  4C92 B;  2K5F A;  2JOY A;  4OGE A;  4M77 C;  4OVA A;  5FRN A;  4OF1 A;  5LJ5 g;  3OYI A;  2VYT A;  2GCX A;  2RB6 A;  2XD0 A;  4OB3 B;  4MFE A;  4XTV A;  2ZGW A;  3OA6 A;  1NZ9 A;  2DEQ A;  1W4S A;  4C0D C;  2KMT A;  2LDM A;  4C8Q D;  1U8R A;  2WAC A;  3HKS A;  2LQK A;  4LDV A;  4LD6 A;  2QQ9 A;  1U1T A;  3P8H A;  3UWN A;  3CXC A;  3HFO A;  4BE0 A;  3OYE A;  4EMG A;  1S72 T;  4AI6 A;  4Y28 E;  1YJN T;  2QA4 A;  5GAN 5;  1LJO A;  4JRI A;  5FU7 C;  2VXF A;  1KHC A;  1X75 C;  2DZC A;  2M9U A;  2DXB B;  2L89 A;  3ZEH A;  3I56 A;  3MP1 A;  3CCV A;  3NTI A;  2E41 A;  2G77 A;  3TW6 A;  2CGH A;  2LVM A;  4JRP A;  3E9F A;  1K8A C;  3G6E A;  3BW1 A;  3FJP A;  1KD1 C;  3JCM b;  4RMO A;  1K73 C;  4M7A B;  1M9S A;  2DXC A;  1E7P A;  1MGQ A;  1N9R A;  4J6Y A;  5A0G A;  1Q81 U;  4MZM A;  3MEA A;  3OMG A;  5GAN d;  2DKG A;  3MP8 A;  4M77 F;  4QQG A;  3T9N A;  4M78 E;  4PKC C;  3QJY A;  3DLL A;  3TCJ A;  3FIF A;  5GMK h;  3VKI A;  4J6W A;  4J8O A;  1RI0 A;  3M4G A;  4M75 B;  3VV0 A;  3RKW A;  4JUV A;  3CPW S;  3OS1 A;  5CKD A;  2RI3 A;  2FL7 A;  4FM4 B;  1YI2 T;  3JB9 F;  1N27 A;  4Q5W A;  5DLQ E;  4C92 C;  2ZZD B;  1MHN A;  3V7S A;  3PMT A;  2X4Y A;  3OYG A;  1NJI C;  1Y07 A;  4XQ3 A;  3QHS A;  3OY9 A;  2DD5 B;  5GAM h;  1X6O A;  3QWL A;  3JB9 I;  4HCB A;  1G3T A;  2WSF E;  2XI9 A;  3QUI A;  1K8A U;  3PIP A;  1HXD A;  4M77 G;  1KD1 U;  2XIC A;  4IUQ A;  4C8Q A;  2RHU A;  5HY6 A;  4M7D E;  5FRO A;  5GAO n;  3OYM A;  3JCM V;  1UGR B;  3QZ9 B;  3VJP A;  4X34 A;  2DXU A;  2DTH A;  3JCM h;  2RK1 A;  2R57 A;  3M57 A;  2ZPG B;  1WQ7 A;  4M77 D;  5GAM e;  5GAN f;  2FYK A;  3LWH A;  5J3B A;  4BE2 A;  3BG9 A;  3HRU A;  3F70 A;  1YHQ T;  4BB7 A;  3JB9 G;  2GFA A;  2XID A;  4NS5 A;  1YIJ T;  3X20 B;  1JBM A;  3TRE A;  4E7I A;  1K73 U;  3FEO A;  1XOV A;  1YJ9 T;  3HRT A;  4NL2 A;  3JCM e;  3CCU A;  1AHJ B;  1YBY A;  3G4S A;  2F5T X;  2CZ1 B;  3OS5 A;  3JB9 D;  2JTF A;  2XK0 A;  4M78 C;  3L2Q A;  4IUP A;  4HT9 A;  1EIF A;  4RKU E;  4JX5 A;  1H64 1;  4FL6 A;  4C92 F;  5I21 A;  2R5M A;  4PNO A;  3VUB A;  2LC4 A;  1NJI U;  1WJS A;  2LX9 A;  3RIR A;  3HPW A;  5CQY A;  3M54 A;  2VUB A;  1M1K C;  1M4Z A;  4J5Y A;  5J26 A;  1N9S A;  3CMA A;  3JCM P;  3MP6 A;  2RJD A;  3QSU A;  3HP9 A;  3L42 A;  4M75 C;  5M9O A;  2GFU A;  4EDU A;  3QBY A;  5FRM A;  4C0G A;  3L1A A;  5KE3 A;  3M58 A;  5C0M A;  2DXT A;  3M55 A;  2QA4 T;  4M7D C;  3OS2 A;  1QW1 A;  5HK3 A;  2HQX A;  1VQ7 A;  4FIB A;  4OB1 B;  4L6V 5;  3OBW A;  2IG0 A;  4N4G A;  2WSE E;  3GOX A;  3GIB A;  5A0D A;  3CCS A;  3CC7 T;  3CBO A;  2YLC A;  3I56 T;  3FLG A;  4C92 G;  3OYB A;  3CCV T;  4OGC A;  2PU9 B;  4AKG A;  3G6E T;  4XU1 A;  3J80 E;  1NPR A;  1FWZ A;  1OZ2 A;  1I4K 1;  2V8I A;  1VQ5 A;  2GF7 A;  4M78 F;  5A0L A;  2QF7 A;  4C92 D;  2JZ2 A;  2E70 A;  2X35 A;  2B8A A;  3MO8 A;  4M77 A;  4MMK A;  2OTL T;  3CC4 A;  3VYG B;  2YHT A;  4RCB A;  4JS5 A;  3FB9 A;  3S3N A;  4A4H A;  1LNX A;  1BYM A;  2KK4 A;  1M1K U;  3KHI A;  4BDZ A;  2G3R A;  4XTZ A;  5CKB A;  2JVV A;  3PNW C;  5FU6 B;  2PVG B;  5GAN j;  2OTL A;  3SD4 A;  2F69 A;  2E65 A;  2D6F A;  4M75 F;  3M56 A;  5C6S A;  5EJC A;  3JCM f;  1M1G A;  4QVZ A;  3L2V A;  3EFR A;  2K3X A;  2EJG A;  3S3O A;  5I2S A;  2Y4Y A;  2YLB A;  1VQL A;  4M7D F;  2CZ6 B;  4M78 G;  1QP2 A;  3OYJ A;  3LWI A;  3QJ6 A;  2P4T A;  1I5L A;  1Y96 A;  3VKG A;  4NL3 A;  3HO8 A;  1IRE B;  2XDD A;  3DL1 A;  4M78 D;  4PJO B;  3O8V A;  2JUF A;  4IUT A;  3C94 A;  1QVG S;  3JSC A;  4E7K A;  1KG1 A;  1N8R C;  1VQP A;  4KUI A;  4M75 G;  1FXX A;  4J6X A;  3MET A;  4C92 E;  1Q86 C;  3OYF A;  2L5Q A;  3GNF B;  1VQN A;  4ZN1 A;  4HL4 A;  4AKI A;  4JS4 A;  1VQO A;  4LDY A;  5IAY A;  3Q1J A;  3M59 A;  2O4X A;  3ER0 A;  4M75 D;  4M7D G;  5I2M A;  1YCY A;  3OYC A;  3CCU T;  3G4S T;  2Y90 A;  1D3B A;  1VQ8 A;  3OYN A;  1OYX A;  3J7A F;  2YRV A;  4C92 A;  4M7D D;  5LJ3 h;  2K5I A;  3CC7 A;  1JJ2 S;  2EIF A;  1NPP A;  3MHX A;  3DLM A;  3SFM A;  5GMK l;  4BY6 B;  1Y71 A;  3QG1 A;  2OTJ A;  4LOC A;  1WNL A;  2DIG A;  2LQ8 A;  4R55 A;  4FU6 A;  4NOY A;  3ME9 A;  4GY5 A;  1RL2 A;  2BUD A;  3BFM A;  5CIU A;  3SWN A;  5CAI A;  5FU6 C;  5LJ3 e;  3CMA T;  2EJ9 A;  2DXC B;  4IKF A;  3CME A;  4ATO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...