2QDYB

Crystal structure of fe-type nhase from rhodococcus erythropolis aj270
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution X-ray molecular structure of the nitrile hydratase from Rhodococcus erythropolis AJ270 reveals posttranslational oxidation of two cysteines into sulfinic acids and a novel biocatalytic nitrile hydration mechanism
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2qdyB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qdyB02
3A8OB 2DXBB 2PU9B 2DD4A 5L8RE 2ZPEB 1PSFA 2PVGB 3VYHB 3A8HB 3X20B 2ZPGB 2DXBA 4OB0B 3A8LB 1JB0E 3WVDB 2D0QB 2WSEE 1UGPB 4ZGEB 2ZZDB 2ZZDA 3X28B 2DD5B 2ZPFB 4XK8E 1QP3A 4ZGDB 4KT0E 4RKUE 4ZGJB 3A8GB 3QXEB 2PUOB 1GXIE 3A8MB 2PVOB 1PSEA 3WVEB 2ZPIB 4OB2B 3VYGA 2CZ6B 2CYZB 2DD5A 2DXCB 2DD4B 1QP2A 3X24B 2ZPHB 3HHTB 4Y28E 4FM4B 3X26B 2PVDB 2CZ1B 3QYGB 2DXCA 2O01E 1UGSB 1UGRB 2AHJB 3VYGB 3QZ9B 3QZ5B 2DPPB 2PUKB 4OB1B 2WSCE 1UGQB 1DJ7B 2WSFE 3QYHB 4OB3B 2CZ7B 3X25B 2CZ0B 1AHJB 2ZPBB 2QDYB 4L6V5 1V29B 1IREB 3LW5E 2ZCFB
chains in the Genus database with same CATH superfamily
1ZA2B 4F7UF 1FMWA 2RPNA 3QO3A 1VQ6Q 1AT1B 1H1SB 3BLRB 1NE8A 1HJDA 3M0SA 2FO0A 4F7NB 1W6XA 1I07A 2UZBB 2E64A 4OMLA 4M7AE 2JTEA 3H6ZA 4XU3A 2RMOA 2YSQA 2BUDA 4GY5A 4BCOB 5GAOm 2LCSA 2EQKA 1QKXA 1A0NB 3G71T 2QA4Q 1S1NA 1QQJA 2DBMA 3OYKA 2FZGB 3CCVT 1W70A 3VUZA 2DL7A 3HB9A 1G3SA 2K3BA 4BCIB 2L3PA 3CCVQ 1U3OA 1VQ4A 4E7SA 2KGTA 4HCCA 3V7CA 2QYZA 5GAN7 3QKJA 3CCUQ 2A3LA 2KMTA 1C0MA 2DL5A 3UPUA 1X43A 1N6AA 1OPLA 1YCYA 4NC6A 1YJ9T 5GAN6 4XTWA 2J06A 3SWNB 3HL8A 2X4XA 4M75G 1E7PA 2RN8A 5GANg 2LW4A 2NYSA 1Y07A 4Z02A 2G3RA 4BCHB 3ZFJA 3M53A 3M54A 4C92A 2F5KA 2YHTA 4CFUB 1VA7A 3ZBDA 1FKMA 1TWBA 2DPPB 2BS4A 4PLIA 1QVGP 1AZEA 5LJ5f 1U06A 3CEYA 4MMKA 4R55A 1H28B 2E70A 2WSCE 3M56A 2KVQG 5CYIB 5KYUB 5DLQE 2O31A 1AWJA 5FROA 3TN8B 2RQVA 1S72T 1TUCA 4KGXB 1M3BA 3GLXA 3PVLA 4QQGA 3B57A 5IXFA 1B3QA 2DF6A 1Z9QA 2C5OB 3AT1B 4KRTA 3L2ZA 2JW4A 2DD4A 2E3IA 5CEIB 1PSFA 5KYYA 1WIEA 2KSSA 4F04B 3QJYA 1QVFS 1JU5C 1YHQA 2UZDB 2W10A 6AT1B 3CCSA 1QW1A 3VS6A 3NGPA 4PNOA 4OB0B 1QWFA 4XAXB 3REBB 3BHUB 1RABB 4C8QA 1GRIA 1BBZA 2X9HA 4ATOA 1SRMA 3OYDA 2QA4T 3JCMP 3EOCB 2BZ8A 2KR3A 2F69A 4E7JA 1OX9A 4J9BA 2QQAA 1K73R 3EHQA 4M75F 4EOSB 2LNHB 3QXEB 3OSVA 1EIFA 2MMPA 1BB9A 2ZPIB 1MNEA 2O9SA 4OB2B 2GQVA 2M16A 3MEVA 3QHSA 1ZUKA 2CZ6B 1N9RA 3HRUA 4AMCA 1H24B 2CT4A 1D0ZA 4J7IA 4JJNK 3QSUA 2QI2A 1VQLT 1BKBA 1YJWA 2GGRA 2GFAA 3WXMB 5KYXB 2LDMA 3EFOA 2UZLB 2HL3A 1GUXA 2EJ9A 1NJIC 1BYMA 1XOVA 4LNPA 3QWLA 5KYNA 1VIEA 4OMQA 4PJMA 5GAMd 3F70A 1KD1C 2QASA 4QT7A 2AZVA 2K4YA 3V8JA 1BI3A 4RTWA 4C8QD 1VQ9Q 2VKNA 5LL6S 2WJ9A 2KMGA 2DO3A 1PNJA 2WSFE 2PK9B 1N9SA 2DNUA 1LPLA 3POMA 4DA4A 2IW6B 4EDUA 3OYBA 2RNAA 4J9FA 5HCKA 2A28A 3H9NA 3OYGA 4ZN3A 3E9GA 2VYTA 1FINB 1IREB 1ARKA 5FU6C 2CJMB 1IZ6A 2LQWA 2MPXC 3SD4A 1WHHA 2LJ3A 3BFMA 1URCB 3CCMA 2DVJA 4EOOB 2QA4A 2CCIB 2MAMA 2DZ9A 1WFWA 3THKA 1XO2A 2QDJA 1NLOC 4DEXA 3I56A 4A4GA 3U23A 1ZQ1A 1IXDA 1ZSZA 2IPOB 1QVGA 3MO8A 2RQWA 4V2SA 2DKGA 2DA9A 4C8QC 5EC7A 5HK0A 1VQKT 1WQ7A 2ZPFB 2MIOA 1GCPA 3L2RA 4HT8A 3SB2A 2W9FA 4M7DA 5FU7B 1OL2B 2X3XD 2JT4A 4F7JB 2QTVA 5A0DA 1QMZB 4BCQD 3JAME 3ER0A 3HSBA 4OMNA 2M1HA 1C1AA 5FU6B 5KYWA 5GAOn 3CC2Q 4LDWA 3CMEA 3CPWS 1OPKA 2VWFA 3JCMW 1QP2A 3P8DA 1AWOA 2FB7A 5KCHA 4BDZA 4M7DG 4JJDA 2EQJA 1G5VA 3JCMf 1G3NC 1D3UB 1OU8A 2LQKA 4F16A 3JCMJ 4M7DC 4M6VA 2BIVA 4XTVA 2XDPA 2RM4A 3I55A 1K8AU 1UHCA 2C5XB 4M7AF 4X1VA 4J9CA 4YC3B 2QQBA 3LLRA 2RJFA 3RERA 1K9MU 2VVKA 1QCNA 4IMYB 3RNJA 2D8JA 2CDTA 3HPWA 1UGQB 2EQUA 2J6OA 2HSEB 2ZPBB 1WX6A 1H4LD 3H0FA 2NUPB 1V29B 5CKDA 2EYXA 3CCQT 3V8KA 4BB7A 5IDNB 4JRKA 4JX4A 2ZPEB 1PRMC 4ZTJA 3G71A 4E6RA 3MKDA 2EUFA 1AEYA 1JEGA 2K7AA 4MDXA 2EVRA 3TNWB 4KH1B 2DETA 3CCRA 3EHRA 4J5YA 1WHMA 2I0NA 2RF0A 4XQ3A 1WZOA 3Q1JA 3UT1A 4M78E 3VUBA 2V8IA 2JM9A 1M2VA 1M8VA 2E6NA 3JSCA 1YI2T 5GANd 2GCXA 4X34A 1EZZB 4EONB 1TXQA 2H3EB 4DQ2A 2D1XA 4M7DF 3OQ5A 1YI2Q 2CP2A 4AKIA 3VKHA 2BS3A 2BKZB 1RUWA 1X01A 1ZHIA 1UNGD 2OTJQ 3CBMA 1U5SA 3NTIA 1K4US 4O6JA 1OZ3A 2CYZB 1JQQA 2BKDN 2AKLA 4RTTA 2KEAA 3CCJT 2OJ2A 2C5NB 1QLBA 4CC7A 4M7AA 3LX7A 3DLMA 1OQKA 4JS5A 4J8OA 1NPRA 3X26B 3LGFA 1ZLMA 3CCST 1AD5A 4M77C 1NG2A 1XNIA 5A0LA 4FW2A 1H92A 1WLPB 2LJ0A 1BI0A 1LVKA 1NM7A 5I22A 2QAZA 1YJ9A 3GNGA 2VXFA 1N4MA 2C5VB 1WDXA 1M1KU 1QKWA 5CQYA 2RK1A 4IUTA 4BD3A 2DILA 1VQPQ 3TNHB 2QFZA 1TU0B 3F5XB 3JCMQ 5CR2A 3CCQQ 2BPMB 3JCMc 3CD6A 3BG5A 4EMHA 1M90U 1VQMQ 1AD6A 1F1BB 2J6KA 1H1PB 3CMET 1PCXA 3A98A 4J9HA 1W1FA 3VKIA 3PE0A 3VRYA 4B9WA 3MEUA 4D6WA 3OMCA 1JJ2S 4FL6A 2OTLQ 3PFSA 2RQRA 2P0QA 3M9QA 2XHCA 2VGMA 4EMKA 3A8LB 4F7SB 1OULA 2R5AA 4FT4A 3RDVA 1LCKA 1BI1A 1R77A 3RGFB 2ED1A 2ZZDB 4R56A 3HBLA 4HNVA 1U1TA 4M75A 2CH4W 4ZGDB 1Q95G 1NYFA 4FSSA 4KT0E 4QQDA 1FVVB 3CPWA 4GLMA 4OGEA 5GMKi 4J6XA 2E4HA 2M9UA 1GBRA 4C5GA 5GAN5 2LT4A 3VYGA 1AWWA 3C95A 3J80E 1EX4A 3CBPA 1RAGB 2RD1A 2M51A 1WHKA 4A4EA 4PKCC 1PM3A 3CCLA 3HHTB 2A0FB 2D0NA 1V76A 2AK5A 4J9IA 2OI3A 3OY9A 1IHWA 3BHVB 2QQSA 2K79A 1Q81U 1JJ2P 2DM1A 2DXCA 2KRMA 1WJQA 4M75C 1M30A 1YHQT 3LH0A 1G3YA 1VQOT 3UATA 1WQWA 2KRSA 3JCMg 3QZ9B 3QZ5B 1RLPC 1ZSGA 2FZCB 4ANJA 5IHIA 1NEBA 3NPFA 4BE1A 2G77A 2LVMA 5HY6A 2MCNA 2FRYA 4LXCA 4IUUA 3JB9J 3JCMe 4M7AC 3BLQB 2MYSA 2R58A 5HBHB 4E7HA 4PJOB 2KI7A 3GNFB 2LX7A 2NUPA 4F14A 2DXBB 4EOJB 4LDUA 2KAFA 1M90R 2GBQA 2W9ZA 2O9VA 1ZP2A 3M55A 1TS9A 1TUDA 1UJ0A 3G4ST 1VQNQ 2V8JA 4PJNA 4JRPA 5J3BA 3DKMA 1OKVB 4G6LB 1N8RC 2JS0A 1TFBA 1OEBA 5C6SA 1M27C 3G4SQ 4BDYA 3FC3A 4HXJA 3VS1A 5DY9A 1WXTA 1TUGB 5CKEA 1M1KR 2D0QB 2EGAA 1PD0A 2KXCA 1PKSA 2EKHA 3I55T 4XK8E 2COYA 3M0RA 2F2XA 3FRNA 5LJ3g 1B34A 3PMIA 1X6GA 3M5AA 4MZPA 5CKBA 5I21A 3FJ5A 2CREA 3REAB 2V22B 4AFSC 1OOTA 3TW6A 2D8HA 2CGHA 3EGXB 3V7RA 2QGGA 1CKBA 3VS7A 4PK4A 3A5ZB 4HVWA 8ATCB 4JRQA 2DXTA 3MEAA 1TH7A 4Y28E 5LJ5h 1D1BA 2CKKA 3QWYA 1QWEA 2WHBB 3AHUA 1WGSA 1Z9ZA 2H8HA 4LD6A 2DL8A 3SEMA 3R6NA 1H641 5KE3A 5J39A 4M78G 4IKFA 2LTOA 3I9QA 1C6VX 4EOKB 4FYWB 5KE2A 2XI9A 3LWHA 3CC7T 2XKOC 2DYIA 1YITA 4LUDA 4OMPA 4D8KA 2EJFA 3QYBA 3ZL7C 1FMKA 4ELJA 4FYXB 4QVZA 4CRIA 3CC4A 3JB9H 1YJNQ 2GFUA 1P92A 1MV0B 1VQ8A 1AHJB 2QDYB 3ASKA 2KYBA 2L5QA 2ATCB 1SHFA 2XMFA 3SHWA 1VQ5Q 4ROEA 3CPWP 2L3SA 1MHNA 2DVEA 3RR6A 4JX6A 1VQ7T 4F7UE 4DBRA 1UECA 1VQ5T 3SDZA 3A1PA 1IGUA 2XG8D 2A37A 1VQ4T 2FHDA 4AKGA 3CCEQ 4M77E 5CO7A 4DOWA 1OI9B 1VQ4Q 3CCVA 1D3BA 1VYVA 3OW2A 2IW8B 3OS2A 4RG8A 1X27A 2LX9A 4RCBA 1OGUB 1MMDA 2AIRB 4BCKB 1H27B 2DD5B 1M4ZA 4Y92A 1VUBA 4QVDA 1Y7XA 2VB6A 1WNLA 1SRLA 1K8AR 3MY1B 2G9XB 5ECAA 4BCNB 1VQLQ 3A8MB 1PRLC 2DTIA 3OYEA 1OX8A 4EORB 1PSEA 4M77D 3WVEB 4OMFB 4UN0A 3EGDB 1P5EB 4JX5A 1KJWA 5KH6A 1VQ7A 2ABLA 4JUVA 2XDDA 1KQSP 4J6YA 4BY7X 4IUVA 4E7KA 3X24B 1SEMA 1I5OB 2E6ZA 3EJ1B 2IVWA 3TEEA 5HK3A 2P4RA 4Z89A 5GJVB 3HP9A 3TQ7P 5HBJB 1AWXA 1UTIA 3RIRA 3QYGB 2YLBA 3FLGA 4Z6YA 4HCZA 5IH2A 2DK3A 2WPAB 1LJOA 1UFFA 2DMOA 4CXAB 1XQHA 1YJWQ 5EFQB 1T0JA 1VQ6A 1H1RB 3RUXA 3PGGA 4II5B 2DIGA 5CKFA 2YUQA 4KH0B 2A36A 2GNCA 2AKKA 2CSIA 1MGQA 2OTLA 1YHQQ 3TVTA 1VQ9A 4J83A 3FEOA 3S3MA 3OYYA 3OA6A 4NOYA 1EFNA 5GAOp 3EAEA 4F7LB 1Q82R 2K5FA 2HSPA 2W0ZA 1VQMA 2JOYA 3ULRB 1OL1B 1QVGS 4TTHA 4X9CA 5GAN2 2CSQA 3KFVA 5DLOA 4KUDK 2JZ2A 2BE7D 1YJNA 2K2VA 2JM8A 4RG2A 5CCAA 3S3NA 1S72Q 1GFDA 2QTXA 3JB9I 1VQ6T 2JMAA 3I5SA 1JB0E 2OX7A 2QEXT 4AFUC 1UEBA 4EIKA 1VQKA 1YWOA 1K9MC 2WSEE 3HO8A 1VQKQ 2V8KA 4M78F 4B6MA 1N5ZA 3H0HA 3VS4A 2LRQA 2JGZB 4KRCB 1UHFA 2DJZA 3OW2S 2DIQA 3M59A 5A2QE 3G7ZA 3VV0A 4EMKB 4BY1X 4RUGA 3QG1A 2H3JA 2EGEA 2B8AA 2NUTB 4QW2A 1N8RU 2DL3A 1O75A 5GAN8 5GAN3 3OYMA 1UDLA 2ECZA 3RESA 3L2WA 2XICA 2X4WA 1U8RA 3O0GD 2RA2A 2X1NB 2KT1A 3CQTA 3VU3C 3OYCA 4K11A 4KUIA 1YIJQ 2RI2A 3CCSQ 2DX1A 4C8QE 3TCJA 4EC8B 5C0MA 4MDWA 3CCRT 4RODA 2WIPB 2WMAB 1I8FA 5IAYA 2AT1B 3I56Q 2F5TX 4LE9A 4C0ZA 1H3HA 1YJWT 1KK7A 2KY9A 2EQIA 2E5QA 3MIAB 1OYXA 3QPHA 2QEXA 2PUKB 3BY7A 4ROCA 4DEYA 3E2UA 4PJOG 3OSSC 1VQPA 4OMMA 1M90C 1UUEA 1KQSA 3CCUA 2FRWA 4JDSA 2LJ1A 4OP0A 3PTAA 3KHIA 3HKSA 5CAIA 4LD9K 4XTZA 4PJOC 2GTOA 3CCEA 4FU6A 5HBEB 4M7AB 3NFCA 1MNDA 5GAOq 4MIMA 4AFZC 3UA6A 3E1SA 4BCMD 4FIBA 4MZTA 4F17A 4HNTA 2C0TA 2OTLT 1K8AC 3CMAQ 3DL1A 5I11A 1NJIR 2COZA 3A8HB 3BG9A 4AG1C 3X20B 4OR5B 3JB9G 2C0IA 2WMBB 5GANh 4I3ZB 4GBQA 1LNXA 4QVCA 3OS1A 2F2WA 3CCMQ 3QJ6A 4Y72B 3L42A 1UGPB 2OTJT 1M9SA 1Q81R 3LH5A 4J9EA 5CVIA 5D7UA 1SSFA 4M77G 1VYWB 2RQUA 4RKUE 1MV3A 2EAYA 2W99A 3EGUA 2C0OA 2X3WD 2SRCA 1VYUA 1YIJA 1K76A 1H25B 2PTKA 2VXEA 2LMJA 2I40B 1HD3A 3OYLA 3MI9B 2I2LA 5KYUA 1WPYA 1SHGA 2ENMA 4O5VA 2ZPHB 4R0KA 1UE9A 3EG9A 4C92C 2A08A 3EFSA 2W96A 4GLKA 3GOXA 1Q82C 3QYEA 2E3HA 3PVQA 5IT9E 3LGLA 3PIOA 3CC4Q 3VJPA 1JSTB 4CFVB 1OZ2A 2DLPA 3C0CA 4HCBA 4QSHA 4OVAA 3JRZA 3G6EQ 3S3OA 2DE0X 4OMOA 3CC2T 1SSHA 4M78D 2COWA 5IHKA 1ZX6A 2EIFA 4NS5A 3EFRA 1K73C 1IB8A 4EMGA 1K0SA 1WHLA 3ZEHA 5ICPB 4J9DA 4NL3A 5LJ3h 1FX7A 4ELZC 1JKWA 4JS4A 2CZ7B 2DEUA 3INZA 1BI2A 4JPBW 3CCJA 5DM7R 4F6UB 2R7GA 3GTMS 2K2MA 3LW5E 4BI3A 2D6FA 3A8OB 5GAMh 1QVFA 2P84A 1FWZA 2PZ1A 1NYGA 4BCJB 5HVYB 3OYAA 2QG9B 2NWMA 3CMAT 5J26A 2VASA 3CPFA 1Q7YR 1BU2A 1O9KA 3URGA 2L3RA 1K0XA 1QVPA 1WYXA 2V1RA 2HKNA 2WEVB 3GIBA 1YI2A 5IDPB 3MPUB 4BCMB 4BBSM 4QKUA 4EOPB 2CUDA 4FX3B 2FZKB 4M7AG 2JUFA 2QGFB 1QVFP 5BNJB 2VUBA 1AOJA 2PUOB 5AYFA 1ZBXA 2O4XB 2WXVB 2QQ9A 3DDQB 1WA7A 9ATCB 4BCPB 2HQHA 1KD1R 4RTVA 2K5LA 3LQ5B 3QDRB 4EOMB 4BE0A 2C06A 4C8QF 2XU8A 1JRIA 2RI3A 4A63B 1KD1U 4XTXA 2LCLA 4ELLA 1W2BP 1G83A 4M78A 4DBQA 1KQ2A 3UWNA 1BIBA 3OYJA 1NLPC 2RHIA 1UGSB 3FJPA 3OB9A 3EG1A 2E5KA 1BU1A 3EGDA 2HCKA 2L2PA 1W2BA 5CIUA 1X6BA 1H3ZA 2DJQA 2V1QA 1FXXA 2YRVA 1SF9A 2BZYA 2JS2A 1N8RR 1Q86C 1UGVA 1ZBJA 1RAEB 3MHXA 4HA8A 1VQNT 1U1SA 3JCMd 3SFMA 3META 2I53A 1S72A 3V7SA 2K3YA 1D3BB 2J6FA 2MI6A 5GAOl 2KXDA 4E2FB 5HQ0B 1ACMB 1ZA1B 5FWBA 5GANj 2X35A 1M5Q1 1UNHD 4BE2A 3CCET 4C5IA 1NPPA 5GJWB 4TVRA 1NEGA 4AT1B 3BLHB 2MF2A 3DLLA 2P4TA 4XTUA 1C9BA 4II1A 2K3XA 4YOOA 2IVXA 1HXDA 1VQPT 2IN3A 2YWWA 1M3AA 1M2OA 1IRXA 2Y4YA 3MY5B 1RADB 2RHZA 5FGKB 3WVDB 5LQFB 4VUBA 4AKHA 4N4GA 4M7DB 4PFOA 2QQ8A 2ROTA 2BS2A 2E12A 4E47A 5EG2A 1QLYA 2WFYB 2R5MA 3TU4K 3SWNC 1QMCA 1SPKA 2KE9A 2GQIA 2PVOB 1VOMA 1YP5A 3TSWA 4CC3A 3HFOA 3OBYA 2FPDA 4BI4A 1D09B 1K1ZA 1GBQA 2IW9B 2RK2A 4HVVA 3CXCP 5EJCA 1H8KA 2HMAA 4MMLA 2DL4A 4IIOA 3G33B 3C94A 2UZEB 2EKOA 3MJXA 4CC4B 3JCMX 4NL2A 3MP8A 5I5ZB 2LZ6B 4FM4B 2MWPA 3C12A 4E7LA 4N0AC 3KUFA 2X4YA 2P0PA 2O2OA 1WJRA 5IF1B 1Q86U 2G6FX 4IURA 4HT9A 2HDAA 1BCOA 2RHUA 3PT9A 2E1HA 2JTFA 4C0FA 4JLGA 5HKCA 4FYYB 4JZ3A 4F7UG 3JCMh 2LP5A 5DQVA 2X51A 2IG0A 1ZUUA 4J7FA 4DOVA 3QYHB 4Q5WA 1KC8C 4IIMA 1CKAA 2EYQA 3DTOA 1ZUYA 3PMTA 1WJSA 5KYWB 3CCLT 3V8LA 3G6ET 1VQOQ 2RH2A 4Z8AA 5LJ5d 2JTMA 3OBWA 2PU9B 5D6YA 2FPFA 5IHNA 2DEQA 3PIPA 1VQ7Q 1KHCA 4A54A 5L2WB 3S6WA 2OTJA 5GMKl 1JOWA 4KULA 4BI8B 4M77F 5CK9A 1Y96B 1PC0A 4CFMB 1WI7A 2ESWA 3TW7A 1RAFB 4PJJA 3UF4A 1KIKA 1VQ8Q 1I81A 4RMOA 1RACB 4BUGA 2QF7A 3CC7A 2GF7A 4PJOA 1GFCA 2EYZA 5D6XA 2K6DA 4BACA 1GCQC 3KXTA 1I0CA 3C4SA 5D6WA 1G3TA 2E10A 1JXOA 3CD6Q 3A8GB 1GXIE 4RTXA 4RCCA 4NSTB 2EQMA 3E9FA 1BK2A 3G71Q 1Q7YU 5GAOr 5GAMg 3QBYA 1PKDB 2K5IA 4XTYA 4WF2A 1IGQA 2DFUA 3M4YA 2DXCB 2M0OA 1X69A 1YJ9Q 4M4ZA 4BCQB 3EG3A 1UJYA 4JJBA 2YT6A 3JB9D 1YN8A 1AISB 2RJCA 1VQOA 2DTHA 3LYIA 3EG2A 3CCUT 2LC4A 4HCKA 1W2BS 4A4KA 7AT1B 2PVDB 2L8DA 2CZ1B 1NBEB 4A4HA 2BZXA 4ESRA 1KG1A 1PKTA 1AVZC 3FIFA 1YWPA 2KNBB 4PJOD 3H41A 4KGZB 1T3SA 2PHGA 2KQWA 2QK0A 1KSWA 3HRSA 5FW9A 4YOZA 4C5HA 2YDLA 1B34B 3DB4A 3EH1A 1M8MA 3QDFA 4LOCA 4C92B 3QHRB 1SKUB 2HQXA 4M7DE 4Z88A 3MCAB 3H4CA 5IXBA 2B86A 3NMZC 3RKYA 2EYWA 3G4SA 2RI5A 2F2VA 4N0AA 2K57A 1E9HB 2R57A 1OIUB 5L8RE 2HKQB 1J3TA 4FW1A 2QEXQ 1O9KB 2E41A 2HNIA 1R0CB 3M57A 4M78C 2ZPGB 3EG0A 2GTJA 2DXBA 2FL7A 2CP6A 2FG0A 1OKWB 5FRNA 3CXCA 4C8QB 1YITT 3EG9B 2L3QA 4M75B 1MMAA 1JJ2A 4MFDA 3OYFA 4OGRB 2KT8A 2ZZDA 2KR6A 3CC2A 2CUBA 4C0GA 4CFWB 1K73U 1R0BG 2EGCA 4CRLB 4C8QG 2X4JA 3CD6T 3CBOA 5KYYB 3CCJQ 2B9RA 1YIJT 2C6TB 1Y71A 2EBPA 2HBPA 2UUEB 2MK5A 3O5ZA 4JJCA 5GMKe 4AI6A 2L89A 3RKXA 1AZGB 3R6OA 1VOLA 2JJ9A 2HD0A 2DXUA 4L5GA 1OV3A 4M77A 5LJ3e 1KXUA 2LQ8A 4UC4A 3JCMb 2HBWA 2HZYA 4M7DD 1E7OA 1CSKA 2C4GB 4C92G 5FRMA 2HEQA 3M58A 5GAMe 2BTTA 1LOJA 2EFIA 3BG3A 2KRNA 2HL5C 3JCMV 5LMKB 1JXMA 2PNIA 1XJWB 2HAXA 1RAHB 3EH2A 1KQSS 3BDLA 2J05A 5IN1A 4WTOB 4FT2A 5LJ3f 2NLUA 3J7AF 1Y96A 4OB1B 1G3WA 3SWNA 4F70B 1HSQA 1RL2A 1DJ7B 2E65A 4BCGB 5KCOA 1ABOA 3CMEQ 3IQLA 3RKWA 3GP8A 1X2QA 2FEIA 3X25B 2RB6A 1T0HA 5ACBA 2JMCA 3BHTB 1HYOA 2M02A 4PL6A 2ZCFB 2EYYA 4ELYC 4FSXA 5LJ5e 3O8VA 1E6GA 2EWNA 4C0DB 2LT1A 4EMKC 5I2SA 3J81E 1GH6B 4BY6C 2A7YA 4KRDB 1M1GA 2XIDA 3OYNA 1M1KC 5LJ5g 3QIIA 4ORZA 1YITQ 2MOXA 4M77B 4C92F 4D8DA 2M0YA 2K9GA 3QUIA 3HZJA 2QDLA 5GMKh 4LUEA 1KC8R 3CMAA 2FPEA 4C92E 1M2VB 3VS5A 2PJQA 4JRIA 5I2MA 4ME7A 4C5EA 5GMKm 2QXFA 3HFNA 4FYVB 3NHNA 1ENWA 1O9SA 4PLLA 3RBBB 4RTUA 1MMGA 2LQNA 1WXUA 3G1JA 4J9GA 2QGSA 3CC4T 2DZCA 2YUOA 4XU0A 5GANf 3MEWA 1IHVA 1WHJA 3N5BB 3CCQA 1KFZA 2PK2A 1OI1A 3T9NA 1PHTA 1X6OA 3D7SB 1W98B 4E7IA 2CS7A 4HLQA 1ABQA 3P8HA 4PFZA 3TREA 1IO6A 2O01E 1D0XA 1K9AA 1PD1A 1UGRB 1RAAB 2V26A 2CH4A 4OF1A 2NUTA 4B9XA 4F7UB 4Y91A 1VQMT 4L59A 2CP7A 1GCQA 2VC8A 2Z0WA 4LDXA 3DOGB 2CCHB 2NUZA 2HQEA 4QQ6A 4EPCA 5M9OA 2CP0A 1Q7YC 2RQTA 1VQ9T 4AFQC 4HVUA 3L2VA 1FYNA 1W4SA 2P0KA 1Y0MA 1ZSZC 4M75E 3CCRQ 1VQNA 1KQ1A 1YBYA 4L6V5 4F6WB 1GUXB 1I5LA 1HK9A 1XTDA 2XD0A 1FMVA 3L1AA 3VS0A 2W2HA 1PWTA 2FVUA 2DRMA 4BBRM 1KHIA 4J6WA 3OW2P 3OYIA 3VYHB 3CXCS 4PJOF 4CFXB 4HNUA 4HKEA 4YTLA 2ZGWA 2OAWA 3I55Q 4KGVB 1T3LA 3NTKA 2F2CA 3K7AM 1D0YA 4PJLA 3HTRA 2DTOA 4IUQA 1G2BA 3VRZA 2D9TA 1JBMA 2JNGA 3DJBA 2IIMA 2EJGA 1VQ5A 1TOVA 4CFUD 1VYTA 3X28B 4C92D 5GANe 1JO8A 1RI9A 1TSFA 4M78B 4DBFA 4E7ZA 3KBGA 3L2QA 4CC2A 2BE9B 4ZGJB 5DQWA 3HRTA 2YXYA 5AT1B 1OIYB 1YNZA 5CKHA 8AT1B 4P5NA 3M0TA 1V1CA 4LDVA 2XDBA 1GY3B 1KC8U 1TG0A 1NZ9A 3CCMT 4XU1A 1BCMA 3DDPB 2DD5A 1M3CA 2O4XA 2VV5A 2O88A 3G6EA 2RHYA 4N4HA 5FU7C 1VIFA 2LNVA 5LJ3d 1Q86R 1UB4A 4HL4A 3EFOB 3E19A 1NJIU 5KYXA 1Q81C 3CC7Q 3H8ZA 1UG1A 4PJOE 2MWOA 4M75D 1E6HA 4LDYA 2JVVA 3BE3A 2AHJB 4EC9B 1YJNT 4BXXX 1D1AA 2KYMA 3RMSA 3EGXA 3OS5A 4KBMB 2WIHB 3VS2A 5LJ3j 5HNBB 2DAQA 4A4FA 1I1JA 2LCCA 4FCYA 3I5RA 4M7AD 1VINA 3RMQA 1TTHB 4OGCA 3I35A 1Y57A 1N27A 5GAMj 2YUPA 2XK0A 2WACA 5LJ5j 3I56T 1K9MR 4ZN1A 2YLCA 3H0IA 1TD6A 2YRCA 2DBKA 2AZSA 2FYKA 3OYHA 4EOQB 2DMEA 4EOIB 1VQLA 1ZSZB 3DB3A 1GL5A 2QQRA 2RJDA 2OAUA 3MP1A 4ZTFA 3QHWB 3GF5A 2PVGB 3VKGA 1RAIB 1VQ8T 3BW1A 3EIDB 3ME9A 1MMNA 4RTYA 2L0AA 1H1QB 1RLQC 4JLIA 2CP5A 2YRDA 4WCIA 3GBQA 3P8BB 2SEMA 2CP3A 2JXBA 1OU9A 3M03A 1WHGA 3M0QA 3TNIB 1M1FA 2ZAEA 2KROA 3UA7A 2KBTA 3M4GA 2J7IA 3OS0A 4ZGEB 2KK4A 3GPLA 2JN0A 2DRKA 3PNWC 1JSUB 1B07A 4F6SB 5GAN4 1YFNA 4MFEA 1QP3A 2EW3A 3FB9A 2ED0A 2EPDA 1R8OB 2YUNA 3L2UA 3LWIA 2VGNA 4MZMA 4RTZA 2PQWA 5L23A 1PG5B 3TSZA 1BIAA 3NTHA 5GMKj 4X9DA 3NDQA 3PO3S 1QCFA 4BCFB 1SG5A 3MP6A 1MUZA 4CFNB 2F1LA 4IUPA 2KDSA 2DD4B 1UNLD 4JZ4A 4BCND 1QCOA 5FWCA 3M0UA 3UDCA 1D1CA 4AG2C 1I4K1 5IHYA 3BDUA 1Q82U 2DERA 4ZNXA 4PFPA 2RHXA 4YOSA 1B7TA 3VS3A 3OMGA 3M0PA 4F7UA 2CT3A 2DYBA 2PMIB 1G8XA 4CI0C 1WXBA 4A53A 3VYGB 3FDRA 2RO0A 2Y90A 4LN2A 4XU2A 1RI0A 4BY6B 1X2KA 4C0DC 5A0GA 5CQXA 1H26B 1F5QB 4EOLB 2ROLA 4OB3B 5GAMf 1X75C 2Y4XA 3JB9F 2CZ0B 4N4IA 5FLXE 3CCLQ 3QWXX 3JV3A 1YCSB 4DBHA 2RJEA
chains in the Genus database with same CATH topology
2K57A 4F7UF 5GAOq 3BG5A 4MIMA 4EMHA 2R57A 3QO3A 1M90U 5L8RE 3E1SA 4FIBA 1NE8A 3CMET 4MZTA 3CD6A 2OTLT 4HNTA 2E41A 2HNIA 1K8AC 3VKIA 3DL1A 4B9WA 3A8HB 3BG9A 3MEUA 4D6WA 3OMCA 3M57A 3X20B 2ZPGB 4FL6A 4M78C 3JB9G 1JJ2S 3PFSA 2DXBA 5GANh 2E64A 2P0QA 2FL7A 3M9QA 4M7AE 2XHCA 2VGMA 3H6ZA 3A8LB 4EMKA 3CXCA 1LNXA 2R5AA 4XU3A 4FT4A 4QVCA 5FRNA 1BI1A 4C8QB 2BUDA 3OS1A 1YITT 4GY5A 3QJ6A 4M75B 5GAOm 1JJ2A 2EQKA 4MFDA 3L42A 1UGPB 3OYFA 3G71T 1M9SA 2OTJT 2ZZDB 4R56A 2ZZDA 2KR6A 3OYKA 3CC2A 5CVIA 4C0GA 3CCVT 3HBLA 4HNVA 1U1TA 1K73U 4M75A 1SSFA 4M77G 3VUZA 4ZGDB 3HB9A 4KT0E 2X4JA 4QQDA 1G3SA 3CBOA 2EAYA 4RKUE 4C8QG 3CD6T 3CPWA 4OGEA 5GMKi 4J6XA 1YIJT 1VQ4A 1Y71A 2M9UA 2HBPA 4C5GA 1YIJA 5GAN5 2LT4A 3V7CA 5GMKe 4AI6A 3VYGA 2L89A 4HCCA 5GAN7 3QKJA 3RKXA 2A3LA 2KMTA 3C95A 3J80E 3CBPA 2VXEA 3UPUA 2RD1A 3R6OA 1N6AA 4A4EA 3OYLA 4PKCC 1YCYA 4NC6A 2HD0A 1YJ9T 5GAN6 2I2LA 4XTWA 3CCLA 1WPYA 2DXUA 4L5GA 3HL8A 4O5VA 2ZPHB 3HHTB 4M77A 2X4XA 4M75G 3SWNB 4C92C 5LJ3e 1E7PA 2LQ8A 3EFSA 4GLKA 3GOXA 1Q82C 3QYEA 5GANg 4UC4A 3JCMb 5IT9E 3LGLA 3PIOA 1Y07A 4Z02A 3VJPA 3OY9A 2QQSA 2G3RA 1Q81U 4M7DD 2DXCA 1WJQA 4M75C 3ZFJA 3M53A 1OZ2A 3M54A 4C92G 4C92A 4HCBA 2F5KA 3M58A 2YHTA 5GAMe 3LH0A 1YHQT 4QSHA 1LOJA 4OVAA 3JRZA 3ZBDA 3S3OA 1G3YA 1VQOT 3CC2T 1WQWA 2EFIA 3JCMg 1FKMA 3QZ9B 3QZ5B 4M78D 3BG3A 3JCMV 2EIFA 2DPPB 2HAXA 4NS5A 1KQSS 3EFRA 3BDLA 2BS4A 4PLIA 5IN1A 1K73C 4FT2A 5LJ3f 2NLUA 4EMGA 5LJ5f 3J7AF 4BE1A 3CEYA 4MMKA 4R55A 1Y96A 2G77A 2E70A 2LVMA 4OB1B 1G3WA 2WSCE 3M56A 3SWNA 5GAOp 2KVQG 5HY6A 3ZEHA 1RL2A 1DJ7B 2E65A 5DLQE 5KCOA 5FROA 4IUUA 4NL3A 5LJ3h 3JB9J 1S72T 3JCMe 1FX7A 4ELZC 3RKWA 4JS4A 3GP8A 2CZ7B 3GLXA 4M7AC 3X25B 2R58A 2RB6A 3INZA 4E7HA 4PJOB 1BI2A 3GNFB 4QQGA 3CCJA 5DM7R 4BI3A 3LW5E 4PL6A 2ZCFB 2D6FA 3A8OB 3L2ZA 5GAMh 1QVFA 2DXBB 4ELYC 4FSXA 2DD4A 4LDUA 3O8VA 1FWZA 2KAFA 5LJ5e 1PSFA 3M55A 3OYAA 2EWNA 2KSSA 4C0DB 2LT1A 4EMKC 2V8JA 5J26A 5I2SA 5J3BA 3J81E 3G4ST 4JRPA 3DKMA 3CPFA 4BY6C 2A7YA 1N8RC 3URGA 3JB9F 3QJYA 1QVFS 1M1GA 2L3RA 1YHQA 5C6SA 2XIDA 4BDYA 3FC3A 3CCSA 1QVPA 1QW1A 3OYNA 4PNOA 1M1KC 4OB0B 4XAXB 5LJ5g 3QIIA 5DY9A 4C8QA 3GIBA 1YI2A 4M77B 4C92F 3QUIA 4BBSM 5CKEA 3HZJA 4ATOA 3OYDA 2D0QB 5GMKh 2QA4T 3CMAA 4C92E 3JCMP 2F69A 4E7JA 3I55T 4JRIA 4XK8E 4ME7A 5I2MA 4M7AG 3FRNA 2JUFA 5LJ3g 4C5EA 1B34A 2QQAA 3PMIA 3M5AA 4MZPA 5CKBA 2QXFA 5I21A 5GMKm 4M75F 2VUBA 3QXEB 3HFNA 2PUOB 3OSVA 1O9SA 4PLLA 1EIFA 5AYFA 1ZBXA 2MMPA 2O4XB 2ZPIB 3TW6A 4OB2B 2QQ9A 2CGHA 2GQVA 2M16A 3V7RA 3MEVA 3CC4T 3QHSA 2CZ6B 1N9RA 3HRUA 2DZCA 2K5LA 4J7IA 4JJNK 3QSUA 4XU0A 3PIPA 3QDRB 4BE0A 3A5ZB 5GANf 2QI2A 3MEWA 3CCQA 3N5BB 4C8QF 2XU8A 1BKBA 2C06A 1VQLT 1OI1A 1JRIA 2RI3A 2GFAA 3T9NA 3WXMB 1YJWA 2LDMA 4JRQA 2DXTA 1KD1U 4XTXA 1X6OA 2LCLA 3MEAA 1TH7A 2EJ9A 3CMAT 4Y28E 4E7IA 4M78A 5LJ5h 1NJIC 2CKKA 4HLQA 2CS7A 3P8HA 1XOVA 3UWNA 1KQ2A 3QWLA 1BIBA 3TREA 3OYJA 1BYMA 3AHUA 1WGSA 1VIEA 2O01E 2RHIA 4LD6A 1UGSB 3FJPA 1UGRB 5GAMd 1H641 3OB9A 5KE3A 5J39A 3F70A 4OF1A 4M78G 4IKFA 2LTOA 1KD1C 4B9XA 4F7UB 1W2BA 5CIUA 4Y91A 2K4YA 3V8JA 1BI3A 4L59A 1VQMT 4C8QD 2XI9A 5KE2A 3LWHA 5FRMA 1H3ZA 5LL6S 3CC7T 2WJ9A 2XKOC 1YITA 1FXXA 2VC8A 2YRVA 4LDXA 2KMGA 2DO3A 2HQEA 4QQ6A 4EPCA 5M9OA 2EJFA 1Q7YC 3QYBA 1Q86C 4QVZA 4ELJA 4CRIA 2WSFE 1VQ9T 1N9SA 3CC4A 3JB9H 3MHXA 4HA8A 3L2VA 1W4SA 2GFUA 1U1SA 3JCMd 1P92A 3SFMA 4DA4A 1VQNT 2P0KA 3META 4EDUA 4M75E 3OYBA 1VQ8A 1AHJB 1VQNA 2QDYB 1KQ1A 1YBYA 3ASKA 4L6V5 1S72A 3OYGA 4ZN3A 3V7SA 2K3YA 1D3BB 2VYTA 3E9GA 2MI6A 5GAOl 1I5LA 2L5QA 1HK9A 1XTDA 2XD0A 1IREB 5FU6C 1IZ6A 3SD4A 5GANj 1MHNA 2DVEA 2X35A 3L1AA 4JX6A 2FVUA 3BFMA 3CCMA 4BBRM 1KHIA 1M5Q1 4J6WA 1VQ7T 4BE2A 3CCET 4F7UE 4C5IA 1NPPA 3OYIA 4TVRA 3VYHB 3CXCS 2MAMA 2QA4A 3SDZA 4PJOF 1VQ5T 4HNUA 2DZ9A 2MF2A 4HKEA 2XG8D 2P4TA 4XTUA 3DLLA 4II1A 2K3XA 4YTLA 2QDJA 2ZGWA 1VQ4T 2FHDA 4AKGA 3I56A 1HXDA 4A4GA 1VQPT 3NTKA 4M77E 1ZQ1A 5CO7A 2DTOA 2Y4YA 4DOWA 1QVGA 4IUQA 3MO8A 2RHZA 3CCVA 2D9TA 1D3BA 1JBMA 2JNGA 3WVDB 2DKGA 4VUBA 4AKHA 4N4GA 3JCMQ 3OW2A 3OS2A 4RG8A 4C8QC 4M7DB 2QQ8A 2EJGA 2LX9A 1VQ5A 4RCBA 2BS2A 2E12A 5HK0A 1VQKT 1WQ7A 4E47A 3X28B 2DD5B 5EG2A 2ZPFB 3L2RA 4C92D 1M4ZA 5GANe 1VUBA 4HT8A 3SB2A 4M78B 4QVDA 2R5MA 3TU4K 1Y7XA 3KBGA 1WNLA 3L2QA 5FU7B 3SWNC 4M7DA 4ZGJB 5A0DA 3HRTA 3JAME 3ER0A 3A8MB 2DTIA 2PVOB 3HSBA 5CKHA 3OYEA 3HFOA 1PSEA 4LDVA 3WVEB 4M77D 4OMFB 3OBYA 4P5NA 2XDBA 1KC8U 2M1HA 4BI4A 5FU6B 4JX5A 5GAOn 1NZ9A 5KH6A 4LDWA 3CMEA 1VQ7A 4JUVA 3CPWS 4XU1A 3CCMT 2XDDA 2RK2A 2DD5A 3JCMW 2O4XA 4J6YA 2VV5A 1QP2A 3G6EA 2RHYA 3P8DA 4IUVA 4E7KA 5EJCA 2FB7A 3X24B 4N4HA 5FU7C 2E6ZA 1VIFA 5KCHA 4BDZA 2IVWA 4MMLA 4M7DG 2LNVA 5LJ3d 3TEEA 3C94A 1UB4A 4HL4A 5HK3A 2EKOA 2EQJA 3E19A 3JCMX 4NL2A 3MP8A 1NJIU 1G5VA 3JCMf 3HP9A 1Q81C 3H8ZA 4FM4B 2MWPA 4PJOE 3C12A 2MWOA 4M75D 4E7LA 3RIRA 2LQKA 3QYGB 4N0AC 3JCMJ 2YLBA 4LDYA 3FLGA 2X4YA 2JVVA 2P0PA 3KUFA 4Z6YA 4M7DC 4M6VA 2AHJB 2BIVA 4XTVA 1WJRA 4HCZA 1Q86U 1YJNT 4IURA 4HT9A 2XDPA 2RM4A 3I55A 2DK3A 1K8AU 2RHUA 3RMSA 4M7AF 3OS5A 4KBMB 5LJ3j 3PT9A 1LJOA 2E1HA 2QQBA 2RJFA 2JTFA 2DAQA 3LLRA 2LCCA 4JLGA 4A4FA 4C0FA 1XQHA 5HKCA 1K9MU 3RERA 4M7AD 3RMQA 4F7UG 3JCMh 4OGCA 1VQ6A 3HPWA 1N27A 5GAMj 1UGQB 2IG0A 2EQUA 2XK0A 2WACA 3PGGA 3RUXA 5LJ5j 3I56T 4J7FA 4DOVA 3QYHB 2DIGA 5CKFA 4Q5WA 1KC8C 4ZN1A 2EYQA 2YLCA 2ZPBB 3PMTA 1WJSA 1V29B 1MGQA 2OTLA 2FYKA 3OYHA 5CKDA 3CCLT 3V8LA 3CCQT 1VQ9A 1VQLA 3V8KA 4J83A 3G6ET 3FEOA 3S3MA 3OYYA 3OA6A 4BB7A 4NOYA 3DB3A 2RH2A 2QQRA 2RJDA 2OAUA 5LJ5d 2JTMA 2PU9B 3EAEA 4JX4A 2ZPEB 3OBWA 2DEQA 3MP1A 4JRKA 1KHCA 2K5FA 5D6YA 3JCMc 4ZTFA 4ZTJA 4A54A 1VQMA 3GF5A 2JOYA 2PVGB 3VKGA 3S6WA 3G71A 1QVGS 5GMKl 2OTJA 1VQ8T 5GAN2 4X9CA 4KULA 4BI8B 3BW1A 3ME9A 4M77F 2JZ2A 5DLOA 4KUDK 5CK9A 1Y96B 1YJNA 2K2VA 4MDXA 4RG2A 4JLIA 5CCAA 3S3NA 3TW7A 3P8BB 3CCRA 1I81A 4J5YA 4RMOA 2QTXA 3JB9I 1VQ6T 4V2SA 4XQ3A 4BUGA 1JB0E 3Q1JA 3UT1A 4M78E 2QEXT 2QF7A 3VUBA 3CC7A 1M1FA 2GF7A 4PJOA 1UEBA 3M4GA 1VQKA 3OS0A 1K9MC 2WSEE 3HO8A 4ZGEB 2V8IA 2KK4A 3GPLA 2JN0A 2V8KA 4M78F 1M8VA 3PNWC 5D6XA 2E6NA 3JSCA 2LRQA 4BACA 5GAN4 3KXTA 1YI2T 4MFEA 5GANd 1QP3A 2GCXA 3C4SA 4X34A 5D6WA 3FB9A 1G3TA 2DJZA 1R8OB 3OW2S 2DIQA 3L2UA 2E10A 3M59A 3LWIA 4DQ2A 2VGNA 4MZMA 4M7DF 3OQ5A 5A2QE 3A8GB 2PQWA 3G7ZA 3VV0A 4EMKB 1GXIE 4AKIA 1BIAA 3VKHA 3NTHA 2BS3A 4X9DA 4RCCA 5GMKj 2EQMA 3E9FA 1ZHIA 1X01A 2H3JA 3QG1A 2B8AA 1Q7YU 4QW2A 5GAOr 3CBMA 5GAMg 3QBYA 1N8RU 1O75A 3NTIA 2K5IA 5GAN8 5GAN3 4O6JA 4XTYA 3OYMA 1OZ3A 3MP6A 4M7DE 3RESA 3L2WA 2XICA 2CYZB 4WF2A 2BKDN 3M4YA 4IUPA 2DXCB 2KDSA 2M0OA 2DD4B 2X4WA 1U8RA 2RA2A 3VU3C 3CCJT 3OYCA 4KUIA 1QLBA 2RI2A 4M7AA 3LX7A 3UDCA 3DLMA 3JB9D 2RJCA 1I4K1 4C8QE 3BDUA 3TCJA 1VQOA 2DTHA 1Q82U 3LYIA 4JS5A 4J8OA 3CCUT 2LC4A 1NPRA 2RHXA 3X26B 5C0MA 4A4KA 1W2BS 3LGFA 2PVDB 2L8DA 2CZ1B 3OMGA 4MDWA 4F7UA 3CCRT 4A4HA 3CCST 1KG1A 4M77C 1I8FA 5IAYA 1XNIA 5A0LA 4CI0C 2F5TX 3FIFA 4A53A 4C0ZA 3VYGB 3FDRA 4PJOD 2RO0A 2Y90A 1YJWT 2KQWA 1BI0A 2KY9A 4XU2A 2E5QA 1OYXA 3HRSA 3QPHA 1RI0A 2QEXA 1YJ9A 4C5HA 2PUKB 3BY7A 2VXFA 3GNGA 4BY6B 1M1KU 5CQYA 1B34B 3DB4A 4C0DC 2RK1A 4IUTA 5A0GA 4PJOG 5CQXA 3OSSC 1VQPA 1M90C 4LOCA 4BD3A 4C92B 1KQSA 3CCUA 4JDSA 2QFZA 4OB3B 5GAMf 1X75C 2HQXA 2Y4XA 4OP0A 2CZ0B 3KHIA 3H4CA 3MCAB 4N4IA 3HKSA 5CAIA 5CR2A 3PTAA 4LD9K 4XTZA 5FLXE 3RKYA 3G4SA 4PJOC 3CCEA 4FU6A 2RJEA 4M7AB 2RI5A 4N0AA 3NFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8O B;  2DXB B;  2PU9 B;  2DD4 A;  5L8R E;  2ZPE B;  1PSF A;  2PVG B;  3VYH B;  3A8H B;  3X20 B;  2ZPG B;  2DXB A;  4OB0 B;  3A8L B;  1JB0 E;  3WVD B;  2D0Q B;  2WSE E;  1UGP B;  4ZGE B;  2ZZD B;  2ZZD A;  3X28 B;  2DD5 B;  2ZPF B;  4XK8 E;  1QP3 A;  4ZGD B;  4KT0 E;  4RKU E;  4ZGJ B;  3A8G B;  3QXE B;  2PUO B;  1GXI E;  3A8M B;  2PVO B;  1PSE A;  3WVE B;  2ZPI B;  4OB2 B;  3VYG A;  2CZ6 B;  2CYZ B;  2DD5 A;  2DXC B;  2DD4 B;  1QP2 A;  3X24 B;  2ZPH B;  3HHT B;  4Y28 E;  4FM4 B;  3X26 B;  2PVD B;  2CZ1 B;  3QYG B;  2DXC A;  2O01 E;  1UGS B;  1UGR B;  2AHJ B;  3VYG B;  3QZ9 B;  3QZ5 B;  2DPP B;  2PUK B;  4OB1 B;  2WSC E;  1UGQ B;  1DJ7 B;  2WSF E;  3QYH B;  4OB3 B;  2CZ7 B;  3X25 B;  2CZ0 B;  1AHJ B;  2ZPB B;  2QDY B;  4L6V 5;  1V29 B;  1IRE B;  3LW5 E;  2ZCF B; 
#chains in the Genus database with same CATH topology
 1ZA2 B;  4F7U F;  1FMW A;  2RPN A;  3QO3 A;  1VQ6 Q;  1AT1 B;  1H1S B;  3BLR B;  1NE8 A;  1HJD A;  3M0S A;  2FO0 A;  4F7N B;  1W6X A;  1I07 A;  2UZB B;  2E64 A;  4OML A;  4M7A E;  2JTE A;  3H6Z A;  4XU3 A;  2RMO A;  2YSQ A;  2BUD A;  4GY5 A;  4BCO B;  5GAO m;  2LCS A;  2EQK A;  1QKX A;  1A0N B;  3G71 T;  2QA4 Q;  1S1N A;  1QQJ A;  2DBM A;  3OYK A;  2FZG B;  3CCV T;  1W70 A;  3VUZ A;  2DL7 A;  3HB9 A;  1G3S A;  2K3B A;  4BCI B;  2L3P A;  3CCV Q;  1U3O A;  1VQ4 A;  4E7S A;  2KGT A;  4HCC A;  3V7C A;  2QYZ A;  5GAN 7;  3QKJ A;  3CCU Q;  2A3L A;  2KMT A;  1C0M A;  2DL5 A;  3UPU A;  1X43 A;  1N6A A;  1OPL A;  1YCY A;  4NC6 A;  1YJ9 T;  5GAN 6;  4XTW A;  2J06 A;  3SWN B;  3HL8 A;  2X4X A;  4M75 G;  1E7P A;  2RN8 A;  5GAN g;  2LW4 A;  2NYS A;  1Y07 A;  4Z02 A;  2G3R A;  4BCH B;  3ZFJ A;  3M53 A;  3M54 A;  4C92 A;  2F5K A;  2YHT A;  4CFU B;  1VA7 A;  3ZBD A;  1FKM A;  1TWB A;  2DPP B;  2BS4 A;  4PLI A;  1QVG P;  1AZE A;  5LJ5 f;  1U06 A;  3CEY A;  4MMK A;  4R55 A;  1H28 B;  2E70 A;  2WSC E;  3M56 A;  2KVQ G;  5CYI B;  5KYU B;  5DLQ E;  2O31 A;  1AWJ A;  5FRO A;  3TN8 B;  2RQV A;  1S72 T;  1TUC A;  4KGX B;  1M3B A;  3GLX A;  3PVL A;  4QQG A;  3B57 A;  5IXF A;  1B3Q A;  2DF6 A;  1Z9Q A;  2C5O B;  3AT1 B;  4KRT A;  3L2Z A;  2JW4 A;  2DD4 A;  2E3I A;  5CEI B;  1PSF A;  5KYY A;  1WIE A;  2KSS A;  4F04 B;  3QJY A;  1QVF S;  1JU5 C;  1YHQ A;  2UZD B;  2W10 A;  6AT1 B;  3CCS A;  1QW1 A;  3VS6 A;  3NGP A;  4PNO A;  4OB0 B;  1QWF A;  4XAX B;  3REB B;  3BHU B;  1RAB B;  4C8Q A;  1GRI A;  1BBZ A;  2X9H A;  4ATO A;  1SRM A;  3OYD A;  2QA4 T;  3JCM P;  3EOC B;  2BZ8 A;  2KR3 A;  2F69 A;  4E7J A;  1OX9 A;  4J9B A;  2QQA A;  1K73 R;  3EHQ A;  4M75 F;  4EOS B;  2LNH B;  3QXE B;  3OSV A;  1EIF A;  2MMP A;  1BB9 A;  2ZPI B;  1MNE A;  2O9S A;  4OB2 B;  2GQV A;  2M16 A;  3MEV A;  3QHS A;  1ZUK A;  2CZ6 B;  1N9R A;  3HRU A;  4AMC A;  1H24 B;  2CT4 A;  1D0Z A;  4J7I A;  4JJN K;  3QSU A;  2QI2 A;  1VQL T;  1BKB A;  1YJW A;  2GGR A;  2GFA A;  3WXM B;  5KYX B;  2LDM A;  3EFO A;  2UZL B;  2HL3 A;  1GUX A;  2EJ9 A;  1NJI C;  1BYM A;  1XOV A;  4LNP A;  3QWL A;  5KYN A;  1VIE A;  4OMQ A;  4PJM A;  5GAM d;  3F70 A;  1KD1 C;  2QAS A;  4QT7 A;  2AZV A;  2K4Y A;  3V8J A;  1BI3 A;  4RTW A;  4C8Q D;  1VQ9 Q;  2VKN A;  5LL6 S;  2WJ9 A;  2KMG A;  2DO3 A;  1PNJ A;  2WSF E;  2PK9 B;  1N9S A;  2DNU A;  1LPL A;  3POM A;  4DA4 A;  2IW6 B;  4EDU A;  3OYB A;  2RNA A;  4J9F A;  5HCK A;  2A28 A;  3H9N A;  3OYG A;  4ZN3 A;  3E9G A;  2VYT A;  1FIN B;  1IRE B;  1ARK A;  5FU6 C;  2CJM B;  1IZ6 A;  2LQW A;  2MPX C;  3SD4 A;  1WHH A;  2LJ3 A;  3BFM A;  1URC B;  3CCM A;  2DVJ A;  4EOO B;  2QA4 A;  2CCI B;  2MAM A;  2DZ9 A;  1WFW A;  3THK A;  1XO2 A;  2QDJ A;  1NLO C;  4DEX A;  3I56 A;  4A4G A;  3U23 A;  1ZQ1 A;  1IXD A;  1ZSZ A;  2IPO B;  1QVG A;  3MO8 A;  2RQW A;  4V2S A;  2DKG A;  2DA9 A;  4C8Q C;  5EC7 A;  5HK0 A;  1VQK T;  1WQ7 A;  2ZPF B;  2MIO A;  1GCP A;  3L2R A;  4HT8 A;  3SB2 A;  2W9F A;  4M7D A;  5FU7 B;  1OL2 B;  2X3X D;  2JT4 A;  4F7J B;  2QTV A;  5A0D A;  1QMZ B;  4BCQ D;  3JAM E;  3ER0 A;  3HSB A;  4OMN A;  2M1H A;  1C1A A;  5FU6 B;  5KYW A;  5GAO n;  3CC2 Q;  4LDW A;  3CME A;  3CPW S;  1OPK A;  2VWF A;  3JCM W;  1QP2 A;  3P8D A;  1AWO A;  2FB7 A;  5KCH A;  4BDZ A;  4M7D G;  4JJD A;  2EQJ A;  1G5V A;  3JCM f;  1G3N C;  1D3U B;  1OU8 A;  2LQK A;  4F16 A;  3JCM J;  4M7D C;  4M6V A;  2BIV A;  4XTV A;  2XDP A;  2RM4 A;  3I55 A;  1K8A U;  1UHC A;  2C5X B;  4M7A F;  4X1V A;  4J9C A;  4YC3 B;  2QQB A;  3LLR A;  2RJF A;  3RER A;  1K9M U;  2VVK A;  1QCN A;  4IMY B;  3RNJ A;  2D8J A;  2CDT A;  3HPW A;  1UGQ B;  2EQU A;  2J6O A;  2HSE B;  2ZPB B;  1WX6 A;  1H4L D;  3H0F A;  2NUP B;  1V29 B;  5CKD A;  2EYX A;  3CCQ T;  3V8K A;  4BB7 A;  5IDN B;  4JRK A;  4JX4 A;  2ZPE B;  1PRM C;  4ZTJ A;  3G71 A;  4E6R A;  3MKD A;  2EUF A;  1AEY A;  1JEG A;  2K7A A;  4MDX A;  2EVR A;  3TNW B;  4KH1 B;  2DET A;  3CCR A;  3EHR A;  4J5Y A;  1WHM A;  2I0N A;  2RF0 A;  4XQ3 A;  1WZO A;  3Q1J A;  3UT1 A;  4M78 E;  3VUB A;  2V8I A;  2JM9 A;  1M2V A;  1M8V A;  2E6N A;  3JSC A;  1YI2 T;  5GAN d;  2GCX A;  4X34 A;  1EZZ B;  4EON B;  1TXQ A;  2H3E B;  4DQ2 A;  2D1X A;  4M7D F;  3OQ5 A;  1YI2 Q;  2CP2 A;  4AKI A;  3VKH A;  2BS3 A;  2BKZ B;  1RUW A;  1X01 A;  1ZHI A;  1UNG D;  2OTJ Q;  3CBM A;  1U5S A;  3NTI A;  1K4U S;  4O6J A;  1OZ3 A;  2CYZ B;  1JQQ A;  2BKD N;  2AKL A;  4RTT A;  2KEA A;  3CCJ T;  2OJ2 A;  2C5N B;  1QLB A;  4CC7 A;  4M7A A;  3LX7 A;  3DLM A;  1OQK A;  4JS5 A;  4J8O A;  1NPR A;  3X26 B;  3LGF A;  1ZLM A;  3CCS T;  1AD5 A;  4M77 C;  1NG2 A;  1XNI A;  5A0L A;  4FW2 A;  1H92 A;  1WLP B;  2LJ0 A;  1BI0 A;  1LVK A;  1NM7 A;  5I22 A;  2QAZ A;  1YJ9 A;  3GNG A;  2VXF A;  1N4M A;  2C5V B;  1WDX A;  1M1K U;  1QKW A;  5CQY A;  2RK1 A;  4IUT A;  4BD3 A;  2DIL A;  1VQP Q;  3TNH B;  2QFZ A;  1TU0 B;  3F5X B;  3JCM Q;  5CR2 A;  3CCQ Q;  2BPM B;  3JCM c;  3CD6 A;  3BG5 A;  4EMH A;  1M90 U;  1VQM Q;  1AD6 A;  1F1B B;  2J6K A;  1H1P B;  3CME T;  1PCX A;  3A98 A;  4J9H A;  1W1F A;  3VKI A;  3PE0 A;  3VRY A;  4B9W A;  3MEU A;  4D6W A;  3OMC A;  1JJ2 S;  4FL6 A;  2OTL Q;  3PFS A;  2RQR A;  2P0Q A;  3M9Q A;  2XHC A;  2VGM A;  4EMK A;  3A8L B;  4F7S B;  1OUL A;  2R5A A;  4FT4 A;  3RDV A;  1LCK A;  1BI1 A;  1R77 A;  3RGF B;  2ED1 A;  2ZZD B;  4R56 A;  3HBL A;  4HNV A;  1U1T A;  4M75 A;  2CH4 W;  4ZGD B;  1Q95 G;  1NYF A;  4FSS A;  4KT0 E;  4QQD A;  1FVV B;  3CPW A;  4GLM A;  4OGE A;  5GMK i;  4J6X A;  2E4H A;  2M9U A;  1GBR A;  4C5G A;  5GAN 5;  2LT4 A;  3VYG A;  1AWW A;  3C95 A;  3J80 E;  1EX4 A;  3CBP A;  1RAG B;  2RD1 A;  2M51 A;  1WHK A;  4A4E A;  4PKC C;  1PM3 A;  3CCL A;  3HHT B;  2A0F B;  2D0N A;  1V76 A;  2AK5 A;  4J9I A;  2OI3 A;  3OY9 A;  1IHW A;  3BHV B;  2QQS A;  2K79 A;  1Q81 U;  1JJ2 P;  2DM1 A;  2DXC A;  2KRM A;  1WJQ A;  4M75 C;  1M30 A;  1YHQ T;  3LH0 A;  1G3Y A;  1VQO T;  3UAT A;  1WQW A;  2KRS A;  3JCM g;  3QZ9 B;  3QZ5 B;  1RLP C;  1ZSG A;  2FZC B;  4ANJ A;  5IHI A;  1NEB A;  3NPF A;  4BE1 A;  2G77 A;  2LVM A;  5HY6 A;  2MCN A;  2FRY A;  4LXC A;  4IUU A;  3JB9 J;  3JCM e;  4M7A C;  3BLQ B;  2MYS A;  2R58 A;  5HBH B;  4E7H A;  4PJO B;  2KI7 A;  3GNF B;  2LX7 A;  2NUP A;  4F14 A;  2DXB B;  4EOJ B;  4LDU A;  2KAF A;  1M90 R;  2GBQ A;  2W9Z A;  2O9V A;  1ZP2 A;  3M55 A;  1TS9 A;  1TUD A;  1UJ0 A;  3G4S T;  1VQN Q;  2V8J A;  4PJN A;  4JRP A;  5J3B A;  3DKM A;  1OKV B;  4G6L B;  1N8R C;  2JS0 A;  1TFB A;  1OEB A;  5C6S A;  1M27 C;  3G4S Q;  4BDY A;  3FC3 A;  4HXJ A;  3VS1 A;  5DY9 A;  1WXT A;  1TUG B;  5CKE A;  1M1K R;  2D0Q B;  2EGA A;  1PD0 A;  2KXC A;  1PKS A;  2EKH A;  3I55 T;  4XK8 E;  2COY A;  3M0R A;  2F2X A;  3FRN A;  5LJ3 g;  1B34 A;  3PMI A;  1X6G A;  3M5A A;  4MZP A;  5CKB A;  5I21 A;  3FJ5 A;  2CRE A;  3REA B;  2V22 B;  4AFS C;  1OOT A;  3TW6 A;  2D8H A;  2CGH A;  3EGX B;  3V7R A;  2QGG A;  1CKB A;  3VS7 A;  4PK4 A;  3A5Z B;  4HVW A;  8ATC B;  4JRQ A;  2DXT A;  3MEA A;  1TH7 A;  4Y28 E;  5LJ5 h;  1D1B A;  2CKK A;  3QWY A;  1QWE A;  2WHB B;  3AHU A;  1WGS A;  1Z9Z A;  2H8H A;  4LD6 A;  2DL8 A;  3SEM A;  3R6N A;  1H64 1;  5KE3 A;  5J39 A;  4M78 G;  4IKF A;  2LTO A;  3I9Q A;  1C6V X;  4EOK B;  4FYW B;  5KE2 A;  2XI9 A;  3LWH A;  3CC7 T;  2XKO C;  2DYI A;  1YIT A;  4LUD A;  4OMP A;  4D8K A;  2EJF A;  3QYB A;  3ZL7 C;  1FMK A;  4ELJ A;  4FYX B;  4QVZ A;  4CRI A;  3CC4 A;  3JB9 H;  1YJN Q;  2GFU A;  1P92 A;  1MV0 B;  1VQ8 A;  1AHJ B;  2QDY B;  3ASK A;  2KYB A;  2L5Q A;  2ATC B;  1SHF A;  2XMF A;  3SHW A;  1VQ5 Q;  4ROE A;  3CPW P;  2L3S A;  1MHN A;  2DVE A;  3RR6 A;  4JX6 A;  1VQ7 T;  4F7U E;  4DBR A;  1UEC A;  1VQ5 T;  3SDZ A;  3A1P A;  1IGU A;  2XG8 D;  2A37 A;  1VQ4 T;  2FHD A;  4AKG A;  3CCE Q;  4M77 E;  5CO7 A;  4DOW A;  1OI9 B;  1VQ4 Q;  3CCV A;  1D3B A;  1VYV A;  3OW2 A;  2IW8 B;  3OS2 A;  4RG8 A;  1X27 A;  2LX9 A;  4RCB A;  1OGU B;  1MMD A;  2AIR B;  4BCK B;  1H27 B;  2DD5 B;  1M4Z A;  4Y92 A;  1VUB A;  4QVD A;  1Y7X A;  2VB6 A;  1WNL A;  1SRL A;  1K8A R;  3MY1 B;  2G9X B;  5ECA A;  4BCN B;  1VQL Q;  3A8M B;  1PRL C;  2DTI A;  3OYE A;  1OX8 A;  4EOR B;  1PSE A;  4M77 D;  3WVE B;  4OMF B;  4UN0 A;  3EGD B;  1P5E B;  4JX5 A;  1KJW A;  5KH6 A;  1VQ7 A;  2ABL A;  4JUV A;  2XDD A;  1KQS P;  4J6Y A;  4BY7 X;  4IUV A;  4E7K A;  3X24 B;  1SEM A;  1I5O B;  2E6Z A;  3EJ1 B;  2IVW A;  3TEE A;  5HK3 A;  2P4R A;  4Z89 A;  5GJV B;  3HP9 A;  3TQ7 P;  5HBJ B;  1AWX A;  1UTI A;  3RIR A;  3QYG B;  2YLB A;  3FLG A;  4Z6Y A;  4HCZ A;  5IH2 A;  2DK3 A;  2WPA B;  1LJO A;  1UFF A;  2DMO A;  4CXA B;  1XQH A;  1YJW Q;  5EFQ B;  1T0J A;  1VQ6 A;  1H1R B;  3RUX A;  3PGG A;  4II5 B;  2DIG A;  5CKF A;  2YUQ A;  4KH0 B;  2A36 A;  2GNC A;  2AKK A;  2CSI A;  1MGQ A;  2OTL A;  1YHQ Q;  3TVT A;  1VQ9 A;  4J83 A;  3FEO A;  3S3M A;  3OYY A;  3OA6 A;  4NOY A;  1EFN A;  5GAO p;  3EAE A;  4F7L B;  1Q82 R;  2K5F A;  2HSP A;  2W0Z A;  1VQM A;  2JOY A;  3ULR B;  1OL1 B;  1QVG S;  4TTH A;  4X9C A;  5GAN 2;  2CSQ A;  3KFV A;  5DLO A;  4KUD K;  2JZ2 A;  2BE7 D;  1YJN A;  2K2V A;  2JM8 A;  4RG2 A;  5CCA A;  3S3N A;  1S72 Q;  1GFD A;  2QTX A;  3JB9 I;  1VQ6 T;  2JMA A;  3I5S A;  1JB0 E;  2OX7 A;  2QEX T;  4AFU C;  1UEB A;  4EIK A;  1VQK A;  1YWO A;  1K9M C;  2WSE E;  3HO8 A;  1VQK Q;  2V8K A;  4M78 F;  4B6M A;  1N5Z A;  3H0H A;  3VS4 A;  2LRQ A;  2JGZ B;  4KRC B;  1UHF A;  2DJZ A;  3OW2 S;  2DIQ A;  3M59 A;  5A2Q E;  3G7Z A;  3VV0 A;  4EMK B;  4BY1 X;  4RUG A;  3QG1 A;  2H3J A;  2EGE A;  2B8A A;  2NUT B;  4QW2 A;  1N8R U;  2DL3 A;  1O75 A;  5GAN 8;  5GAN 3;  3OYM A;  1UDL A;  2ECZ A;  3RES A;  3L2W A;  2XIC A;  2X4W A;  1U8R A;  3O0G D;  2RA2 A;  2X1N B;  2KT1 A;  3CQT A;  3VU3 C;  3OYC A;  4K11 A;  4KUI A;  1YIJ Q;  2RI2 A;  3CCS Q;  2DX1 A;  4C8Q E;  3TCJ A;  4EC8 B;  5C0M A;  4MDW A;  3CCR T;  4ROD A;  2WIP B;  2WMA B;  1I8F A;  5IAY A;  2AT1 B;  3I56 Q;  2F5T X;  4LE9 A;  4C0Z A;  1H3H A;  1YJW T;  1KK7 A;  2KY9 A;  2EQI A;  2E5Q A;  3MIA B;  1OYX A;  3QPH A;  2QEX A;  2PUK B;  3BY7 A;  4ROC A;  4DEY A;  3E2U A;  4PJO G;  3OSS C;  1VQP A;  4OMM A;  1M90 C;  1UUE A;  1KQS A;  3CCU A;  2FRW A;  4JDS A;  2LJ1 A;  4OP0 A;  3PTA A;  3KHI A;  3HKS A;  5CAI A;  4LD9 K;  4XTZ A;  4PJO C;  2GTO A;  3CCE A;  4FU6 A;  5HBE B;  4M7A B;  3NFC A;  1MND A;  5GAO q;  4MIM A;  4AFZ C;  3UA6 A;  3E1S A;  4BCM D;  4FIB A;  4MZT A;  4F17 A;  4HNT A;  2C0T A;  2OTL T;  1K8A C;  3CMA Q;  3DL1 A;  5I11 A;  1NJI R;  2COZ A;  3A8H B;  3BG9 A;  4AG1 C;  3X20 B;  4OR5 B;  3JB9 G;  2C0I A;  2WMB B;  5GAN h;  4I3Z B;  4GBQ A;  1LNX A;  4QVC A;  3OS1 A;  2F2W A;  3CCM Q;  3QJ6 A;  4Y72 B;  3L42 A;  1UGP B;  2OTJ T;  1M9S A;  1Q81 R;  3LH5 A;  4J9E A;  5CVI A;  5D7U A;  1SSF A;  4M77 G;  1VYW B;  2RQU A;  4RKU E;  1MV3 A;  2EAY A;  2W99 A;  3EGU A;  2C0O A;  2X3W D;  2SRC A;  1VYU A;  1YIJ A;  1K76 A;  1H25 B;  2PTK A;  2VXE A;  2LMJ A;  2I40 B;  1HD3 A;  3OYL A;  3MI9 B;  2I2L A;  5KYU A;  1WPY A;  1SHG A;  2ENM A;  4O5V A;  2ZPH B;  4R0K A;  1UE9 A;  3EG9 A;  4C92 C;  2A08 A;  3EFS A;  2W96 A;  4GLK A;  3GOX A;  1Q82 C;  3QYE A;  2E3H A;  3PVQ A;  5IT9 E;  3LGL A;  3PIO A;  3CC4 Q;  3VJP A;  1JST B;  4CFV B;  1OZ2 A;  2DLP A;  3C0C A;  4HCB A;  4QSH A;  4OVA A;  3JRZ A;  3G6E Q;  3S3O A;  2DE0 X;  4OMO A;  3CC2 T;  1SSH A;  4M78 D;  2COW A;  5IHK A;  1ZX6 A;  2EIF A;  4NS5 A;  3EFR A;  1K73 C;  1IB8 A;  4EMG A;  1K0S A;  1WHL A;  3ZEH A;  5ICP B;  4J9D A;  4NL3 A;  5LJ3 h;  1FX7 A;  4ELZ C;  1JKW A;  4JS4 A;  2CZ7 B;  2DEU A;  3INZ A;  1BI2 A;  4JPB W;  3CCJ A;  5DM7 R;  4F6U B;  2R7G A;  3GTM S;  2K2M A;  3LW5 E;  4BI3 A;  2D6F A;  3A8O B;  5GAM h;  1QVF A;  2P84 A;  1FWZ A;  2PZ1 A;  1NYG A;  4BCJ B;  5HVY B;  3OYA A;  2QG9 B;  2NWM A;  3CMA T;  5J26 A;  2VAS A;  3CPF A;  1Q7Y R;  1BU2 A;  1O9K A;  3URG A;  2L3R A;  1K0X A;  1QVP A;  1WYX A;  2V1R A;  2HKN A;  2WEV B;  3GIB A;  1YI2 A;  5IDP B;  3MPU B;  4BCM B;  4BBS M;  4QKU A;  4EOP B;  2CUD A;  4FX3 B;  2FZK B;  4M7A G;  2JUF A;  2QGF B;  1QVF P;  5BNJ B;  2VUB A;  1AOJ A;  2PUO B;  5AYF A;  1ZBX A;  2O4X B;  2WXV B;  2QQ9 A;  3DDQ B;  1WA7 A;  9ATC B;  4BCP B;  2HQH A;  1KD1 R;  4RTV A;  2K5L A;  3LQ5 B;  3QDR B;  4EOM B;  4BE0 A;  2C06 A;  4C8Q F;  2XU8 A;  1JRI A;  2RI3 A;  4A63 B;  1KD1 U;  4XTX A;  2LCL A;  4ELL A;  1W2B P;  1G83 A;  4M78 A;  4DBQ A;  1KQ2 A;  3UWN A;  1BIB A;  3OYJ A;  1NLP C;  2RHI A;  1UGS B;  3FJP A;  3OB9 A;  3EG1 A;  2E5K A;  1BU1 A;  3EGD A;  2HCK A;  2L2P A;  1W2B A;  5CIU A;  1X6B A;  1H3Z A;  2DJQ A;  2V1Q A;  1FXX A;  2YRV A;  1SF9 A;  2BZY A;  2JS2 A;  1N8R R;  1Q86 C;  1UGV A;  1ZBJ A;  1RAE B;  3MHX A;  4HA8 A;  1VQN T;  1U1S A;  3JCM d;  3SFM A;  3MET A;  2I53 A;  1S72 A;  3V7S A;  2K3Y A;  1D3B B;  2J6F A;  2MI6 A;  5GAO l;  2KXD A;  4E2F B;  5HQ0 B;  1ACM B;  1ZA1 B;  5FWB A;  5GAN j;  2X35 A;  1M5Q 1;  1UNH D;  4BE2 A;  3CCE T;  4C5I A;  1NPP A;  5GJW B;  4TVR A;  1NEG A;  4AT1 B;  3BLH B;  2MF2 A;  3DLL A;  2P4T A;  4XTU A;  1C9B A;  4II1 A;  2K3X A;  4YOO A;  2IVX A;  1HXD A;  1VQP T;  2IN3 A;  2YWW A;  1M3A A;  1M2O A;  1IRX A;  2Y4Y A;  3MY5 B;  1RAD B;  2RHZ A;  5FGK B;  3WVD B;  5LQF B;  4VUB A;  4AKH A;  4N4G A;  4M7D B;  4PFO A;  2QQ8 A;  2ROT A;  2BS2 A;  2E12 A;  4E47 A;  5EG2 A;  1QLY A;  2WFY B;  2R5M A;  3TU4 K;  3SWN C;  1QMC A;  1SPK A;  2KE9 A;  2GQI A;  2PVO B;  1VOM A;  1YP5 A;  3TSW A;  4CC3 A;  3HFO A;  3OBY A;  2FPD A;  4BI4 A;  1D09 B;  1K1Z A;  1GBQ A;  2IW9 B;  2RK2 A;  4HVV A;  3CXC P;  5EJC A;  1H8K A;  2HMA A;  4MML A;  2DL4 A;  4IIO A;  3G33 B;  3C94 A;  2UZE B;  2EKO A;  3MJX A;  4CC4 B;  3JCM X;  4NL2 A;  3MP8 A;  5I5Z B;  2LZ6 B;  4FM4 B;  2MWP A;  3C12 A;  4E7L A;  4N0A C;  3KUF A;  2X4Y A;  2P0P A;  2O2O A;  1WJR A;  5IF1 B;  1Q86 U;  2G6F X;  4IUR A;  4HT9 A;  2HDA A;  1BCO A;  2RHU A;  3PT9 A;  2E1H A;  2JTF A;  4C0F A;  4JLG A;  5HKC A;  4FYY B;  4JZ3 A;  4F7U G;  3JCM h;  2LP5 A;  5DQV A;  2X51 A;  2IG0 A;  1ZUU A;  4J7F A;  4DOV A;  3QYH B;  4Q5W A;  1KC8 C;  4IIM A;  1CKA A;  2EYQ A;  3DTO A;  1ZUY A;  3PMT A;  1WJS A;  5KYW B;  3CCL T;  3V8L A;  3G6E T;  1VQO Q;  2RH2 A;  4Z8A A;  5LJ5 d;  2JTM A;  3OBW A;  2PU9 B;  5D6Y A;  2FPF A;  5IHN A;  2DEQ A;  3PIP A;  1VQ7 Q;  1KHC A;  4A54 A;  5L2W B;  3S6W A;  2OTJ A;  5GMK l;  1JOW A;  4KUL A;  4BI8 B;  4M77 F;  5CK9 A;  1Y96 B;  1PC0 A;  4CFM B;  1WI7 A;  2ESW A;  3TW7 A;  1RAF B;  4PJJ A;  3UF4 A;  1KIK A;  1VQ8 Q;  1I81 A;  4RMO A;  1RAC B;  4BUG A;  2QF7 A;  3CC7 A;  2GF7 A;  4PJO A;  1GFC A;  2EYZ A;  5D6X A;  2K6D A;  4BAC A;  1GCQ C;  3KXT A;  1I0C A;  3C4S A;  5D6W A;  1G3T A;  2E10 A;  1JXO A;  3CD6 Q;  3A8G B;  1GXI E;  4RTX A;  4RCC A;  4NST B;  2EQM A;  3E9F A;  1BK2 A;  3G71 Q;  1Q7Y U;  5GAO r;  5GAM g;  3QBY A;  1PKD B;  2K5I A;  4XTY A;  4WF2 A;  1IGQ A;  2DFU A;  3M4Y A;  2DXC B;  2M0O A;  1X69 A;  1YJ9 Q;  4M4Z A;  4BCQ B;  3EG3 A;  1UJY A;  4JJB A;  2YT6 A;  3JB9 D;  1YN8 A;  1AIS B;  2RJC A;  1VQO A;  2DTH A;  3LYI A;  3EG2 A;  3CCU T;  2LC4 A;  4HCK A;  1W2B S;  4A4K A;  7AT1 B;  2PVD B;  2L8D A;  2CZ1 B;  1NBE B;  4A4H A;  2BZX A;  4ESR A;  1KG1 A;  1PKT A;  1AVZ C;  3FIF A;  1YWP A;  2KNB B;  4PJO D;  3H41 A;  4KGZ B;  1T3S A;  2PHG A;  2KQW A;  2QK0 A;  1KSW A;  3HRS A;  5FW9 A;  4YOZ A;  4C5H A;  2YDL A;  1B34 B;  3DB4 A;  3EH1 A;  1M8M A;  3QDF A;  4LOC A;  4C92 B;  3QHR B;  1SKU B;  2HQX A;  4M7D E;  4Z88 A;  3MCA B;  3H4C A;  5IXB A;  2B86 A;  3NMZ C;  3RKY A;  2EYW A;  3G4S A;  2RI5 A;  2F2V A;  4N0A A;  2K57 A;  1E9H B;  2R57 A;  1OIU B;  5L8R E;  2HKQ B;  1J3T A;  4FW1 A;  2QEX Q;  1O9K B;  2E41 A;  2HNI A;  1R0C B;  3M57 A;  4M78 C;  2ZPG B;  3EG0 A;  2GTJ A;  2DXB A;  2FL7 A;  2CP6 A;  2FG0 A;  1OKW B;  5FRN A;  3CXC A;  4C8Q B;  1YIT T;  3EG9 B;  2L3Q A;  4M75 B;  1MMA A;  1JJ2 A;  4MFD A;  3OYF A;  4OGR B;  2KT8 A;  2ZZD A;  2KR6 A;  3CC2 A;  2CUB A;  4C0G A;  4CFW B;  1K73 U;  1R0B G;  2EGC A;  4CRL B;  4C8Q G;  2X4J A;  3CD6 T;  3CBO A;  5KYY B;  3CCJ Q;  2B9R A;  1YIJ T;  2C6T B;  1Y71 A;  2EBP A;  2HBP A;  2UUE B;  2MK5 A;  3O5Z A;  4JJC A;  5GMK e;  4AI6 A;  2L89 A;  3RKX A;  1AZG B;  3R6O A;  1VOL A;  2JJ9 A;  2HD0 A;  2DXU A;  4L5G A;  1OV3 A;  4M77 A;  5LJ3 e;  1KXU A;  2LQ8 A;  4UC4 A;  3JCM b;  2HBW A;  2HZY A;  4M7D D;  1E7O A;  1CSK A;  2C4G B;  4C92 G;  5FRM A;  2HEQ A;  3M58 A;  5GAM e;  2BTT A;  1LOJ A;  2EFI A;  3BG3 A;  2KRN A;  2HL5 C;  3JCM V;  5LMK B;  1JXM A;  2PNI A;  1XJW B;  2HAX A;  1RAH B;  3EH2 A;  1KQS S;  3BDL A;  2J05 A;  5IN1 A;  4WTO B;  4FT2 A;  5LJ3 f;  2NLU A;  3J7A F;  1Y96 A;  4OB1 B;  1G3W A;  3SWN A;  4F70 B;  1HSQ A;  1RL2 A;  1DJ7 B;  2E65 A;  4BCG B;  5KCO A;  1ABO A;  3CME Q;  3IQL A;  3RKW A;  3GP8 A;  1X2Q A;  2FEI A;  3X25 B;  2RB6 A;  1T0H A;  5ACB A;  2JMC A;  3BHT B;  1HYO A;  2M02 A;  4PL6 A;  2ZCF B;  2EYY A;  4ELY C;  4FSX A;  5LJ5 e;  3O8V A;  1E6G A;  2EWN A;  4C0D B;  2LT1 A;  4EMK C;  5I2S A;  3J81 E;  1GH6 B;  4BY6 C;  2A7Y A;  4KRD B;  1M1G A;  2XID A;  3OYN A;  1M1K C;  5LJ5 g;  3QII A;  4ORZ A;  1YIT Q;  2MOX A;  4M77 B;  4C92 F;  4D8D A;  2M0Y A;  2K9G A;  3QUI A;  3HZJ A;  2QDL A;  5GMK h;  4LUE A;  1KC8 R;  3CMA A;  2FPE A;  4C92 E;  1M2V B;  3VS5 A;  2PJQ A;  4JRI A;  5I2M A;  4ME7 A;  4C5E A;  5GMK m;  2QXF A;  3HFN A;  4FYV B;  3NHN A;  1ENW A;  1O9S A;  4PLL A;  3RBB B;  4RTU A;  1MMG A;  2LQN A;  1WXU A;  3G1J A;  4J9G A;  2QGS A;  3CC4 T;  2DZC A;  2YUO A;  4XU0 A;  5GAN f;  3MEW A;  1IHV A;  1WHJ A;  3N5B B;  3CCQ A;  1KFZ A;  2PK2 A;  1OI1 A;  3T9N A;  1PHT A;  1X6O A;  3D7S B;  1W98 B;  4E7I A;  2CS7 A;  4HLQ A;  1ABQ A;  3P8H A;  4PFZ A;  3TRE A;  1IO6 A;  2O01 E;  1D0X A;  1K9A A;  1PD1 A;  1UGR B;  1RAA B;  2V26 A;  2CH4 A;  4OF1 A;  2NUT A;  4B9X A;  4F7U B;  4Y91 A;  1VQM T;  4L59 A;  2CP7 A;  1GCQ A;  2VC8 A;  2Z0W A;  4LDX A;  3DOG B;  2CCH B;  2NUZ A;  2HQE A;  4QQ6 A;  4EPC A;  5M9O A;  2CP0 A;  1Q7Y C;  2RQT A;  1VQ9 T;  4AFQ C;  4HVU A;  3L2V A;  1FYN A;  1W4S A;  2P0K A;  1Y0M A;  1ZSZ C;  4M75 E;  3CCR Q;  1VQN A;  1KQ1 A;  1YBY A;  4L6V 5;  4F6W B;  1GUX B;  1I5L A;  1HK9 A;  1XTD A;  2XD0 A;  1FMV A;  3L1A A;  3VS0 A;  2W2H A;  1PWT A;  2FVU A;  2DRM A;  4BBR M;  1KHI A;  4J6W A;  3OW2 P;  3OYI A;  3VYH B;  3CXC S;  4PJO F;  4CFX B;  4HNU A;  4HKE A;  4YTL A;  2ZGW A;  2OAW A;  3I55 Q;  4KGV B;  1T3L A;  3NTK A;  2F2C A;  3K7A M;  1D0Y A;  4PJL A;  3HTR A;  2DTO A;  4IUQ A;  1G2B A;  3VRZ A;  2D9T A;  1JBM A;  2JNG A;  3DJB A;  2IIM A;  2EJG A;  1VQ5 A;  1TOV A;  4CFU D;  1VYT A;  3X28 B;  4C92 D;  5GAN e;  1JO8 A;  1RI9 A;  1TSF A;  4M78 B;  4DBF A;  4E7Z A;  3KBG A;  3L2Q A;  4CC2 A;  2BE9 B;  4ZGJ B;  5DQW A;  3HRT A;  2YXY A;  5AT1 B;  1OIY B;  1YNZ A;  5CKH A;  8AT1 B;  4P5N A;  3M0T A;  1V1C A;  4LDV A;  2XDB A;  1GY3 B;  1KC8 U;  1TG0 A;  1NZ9 A;  3CCM T;  4XU1 A;  1BCM A;  3DDP B;  2DD5 A;  1M3C A;  2O4X A;  2VV5 A;  2O88 A;  3G6E A;  2RHY A;  4N4H A;  5FU7 C;  1VIF A;  2LNV A;  5LJ3 d;  1Q86 R;  1UB4 A;  4HL4 A;  3EFO B;  3E19 A;  1NJI U;  5KYX A;  1Q81 C;  3CC7 Q;  3H8Z A;  1UG1 A;  4PJO E;  2MWO A;  4M75 D;  1E6H A;  4LDY A;  2JVV A;  3BE3 A;  2AHJ B;  4EC9 B;  1YJN T;  4BXX X;  1D1A A;  2KYM A;  3RMS A;  3EGX A;  3OS5 A;  4KBM B;  2WIH B;  3VS2 A;  5LJ3 j;  5HNB B;  2DAQ A;  4A4F A;  1I1J A;  2LCC A;  4FCY A;  3I5R A;  4M7A D;  1VIN A;  3RMQ A;  1TTH B;  4OGC A;  3I35 A;  1Y57 A;  1N27 A;  5GAM j;  2YUP A;  2XK0 A;  2WAC A;  5LJ5 j;  3I56 T;  1K9M R;  4ZN1 A;  2YLC A;  3H0I A;  1TD6 A;  2YRC A;  2DBK A;  2AZS A;  2FYK A;  3OYH A;  4EOQ B;  2DME A;  4EOI B;  1VQL A;  1ZSZ B;  3DB3 A;  1GL5 A;  2QQR A;  2RJD A;  2OAU A;  3MP1 A;  4ZTF A;  3QHW B;  3GF5 A;  2PVG B;  3VKG A;  1RAI B;  1VQ8 T;  3BW1 A;  3EID B;  3ME9 A;  1MMN A;  4RTY A;  2L0A A;  1H1Q B;  1RLQ C;  4JLI A;  2CP5 A;  2YRD A;  4WCI A;  3GBQ A;  3P8B B;  2SEM A;  2CP3 A;  2JXB A;  1OU9 A;  3M03 A;  1WHG A;  3M0Q A;  3TNI B;  1M1F A;  2ZAE A;  2KRO A;  3UA7 A;  2KBT A;  3M4G A;  2J7I A;  3OS0 A;  4ZGE B;  2KK4 A;  3GPL A;  2JN0 A;  2DRK A;  3PNW C;  1JSU B;  1B07 A;  4F6S B;  5GAN 4;  1YFN A;  4MFE A;  1QP3 A;  2EW3 A;  3FB9 A;  2ED0 A;  2EPD A;  1R8O B;  2YUN A;  3L2U A;  3LWI A;  2VGN A;  4MZM A;  4RTZ A;  2PQW A;  5L23 A;  1PG5 B;  3TSZ A;  1BIA A;  3NTH A;  5GMK j;  4X9D A;  3NDQ A;  3PO3 S;  1QCF A;  4BCF B;  1SG5 A;  3MP6 A;  1MUZ A;  4CFN B;  2F1L A;  4IUP A;  2KDS A;  2DD4 B;  1UNL D;  4JZ4 A;  4BCN D;  1QCO A;  5FWC A;  3M0U A;  3UDC A;  1D1C A;  4AG2 C;  1I4K 1;  5IHY A;  3BDU A;  1Q82 U;  2DER A;  4ZNX A;  4PFP A;  2RHX A;  4YOS A;  1B7T A;  3VS3 A;  3OMG A;  3M0P A;  4F7U A;  2CT3 A;  2DYB A;  2PMI B;  1G8X A;  4CI0 C;  1WXB A;  4A53 A;  3VYG B;  3FDR A;  2RO0 A;  2Y90 A;  4LN2 A;  4XU2 A;  1RI0 A;  4BY6 B;  1X2K A;  4C0D C;  5A0G A;  5CQX A;  1H26 B;  1F5Q B;  4EOL B;  2ROL A;  4OB3 B;  5GAM f;  1X75 C;  2Y4X A;  3JB9 F;  2CZ0 B;  4N4I A;  5FLX E;  3CCL Q;  3QWX X;  3JV3 A;  1YCS B;  4DBH A;  2RJE A; 
#chains in the Genus database with same CATH homology
 2K57 A;  4F7U F;  5GAO q;  3BG5 A;  4MIM A;  4EMH A;  2R57 A;  3QO3 A;  1M90 U;  5L8R E;  3E1S A;  4FIB A;  1NE8 A;  3CME T;  4MZT A;  3CD6 A;  2OTL T;  4HNT A;  2E41 A;  2HNI A;  1K8A C;  3VKI A;  3DL1 A;  4B9W A;  3A8H B;  3BG9 A;  3MEU A;  4D6W A;  3OMC A;  3M57 A;  3X20 B;  2ZPG B;  4FL6 A;  4M78 C;  3JB9 G;  1JJ2 S;  3PFS A;  2DXB A;  5GAN h;  2E64 A;  2P0Q A;  2FL7 A;  3M9Q A;  4M7A E;  2XHC A;  2VGM A;  3H6Z A;  3A8L B;  4EMK A;  3CXC A;  1LNX A;  2R5A A;  4XU3 A;  4FT4 A;  4QVC A;  5FRN A;  1BI1 A;  4C8Q B;  2BUD A;  3OS1 A;  1YIT T;  4GY5 A;  3QJ6 A;  4M75 B;  5GAO m;  1JJ2 A;  2EQK A;  4MFD A;  3L42 A;  1UGP B;  3OYF A;  3G71 T;  1M9S A;  2OTJ T;  2ZZD B;  4R56 A;  2ZZD A;  2KR6 A;  3OYK A;  3CC2 A;  5CVI A;  4C0G A;  3CCV T;  3HBL A;  4HNV A;  1U1T A;  1K73 U;  4M75 A;  1SSF A;  4M77 G;  3VUZ A;  4ZGD B;  3HB9 A;  4KT0 E;  2X4J A;  4QQD A;  1G3S A;  3CBO A;  2EAY A;  4RKU E;  4C8Q G;  3CD6 T;  3CPW A;  4OGE A;  5GMK i;  4J6X A;  1YIJ T;  1VQ4 A;  1Y71 A;  2M9U A;  2HBP A;  4C5G A;  1YIJ A;  5GAN 5;  2LT4 A;  3V7C A;  5GMK e;  4AI6 A;  3VYG A;  2L89 A;  4HCC A;  5GAN 7;  3QKJ A;  3RKX A;  2A3L A;  2KMT A;  3C95 A;  3J80 E;  3CBP A;  2VXE A;  3UPU A;  2RD1 A;  3R6O A;  1N6A A;  4A4E A;  3OYL A;  4PKC C;  1YCY A;  4NC6 A;  2HD0 A;  1YJ9 T;  5GAN 6;  2I2L A;  4XTW A;  3CCL A;  1WPY A;  2DXU A;  4L5G A;  3HL8 A;  4O5V A;  2ZPH B;  3HHT B;  4M77 A;  2X4X A;  4M75 G;  3SWN B;  4C92 C;  5LJ3 e;  1E7P A;  2LQ8 A;  3EFS A;  4GLK A;  3GOX A;  1Q82 C;  3QYE A;  5GAN g;  4UC4 A;  3JCM b;  5IT9 E;  3LGL A;  3PIO A;  1Y07 A;  4Z02 A;  3VJP A;  3OY9 A;  2QQS A;  2G3R A;  1Q81 U;  4M7D D;  2DXC A;  1WJQ A;  4M75 C;  3ZFJ A;  3M53 A;  1OZ2 A;  3M54 A;  4C92 G;  4C92 A;  4HCB A;  2F5K A;  3M58 A;  2YHT A;  5GAM e;  3LH0 A;  1YHQ T;  4QSH A;  1LOJ A;  4OVA A;  3JRZ A;  3ZBD A;  3S3O A;  1G3Y A;  1VQO T;  3CC2 T;  1WQW A;  2EFI A;  3JCM g;  1FKM A;  3QZ9 B;  3QZ5 B;  4M78 D;  3BG3 A;  3JCM V;  2EIF A;  2DPP B;  2HAX A;  4NS5 A;  1KQS S;  3EFR A;  3BDL A;  2BS4 A;  4PLI A;  5IN1 A;  1K73 C;  4FT2 A;  5LJ3 f;  2NLU A;  4EMG A;  5LJ5 f;  3J7A F;  4BE1 A;  3CEY A;  4MMK A;  4R55 A;  1Y96 A;  2G77 A;  2E70 A;  2LVM A;  4OB1 B;  1G3W A;  2WSC E;  3M56 A;  3SWN A;  5GAO p;  2KVQ G;  5HY6 A;  3ZEH A;  1RL2 A;  1DJ7 B;  2E65 A;  5DLQ E;  5KCO A;  5FRO A;  4IUU A;  4NL3 A;  5LJ3 h;  3JB9 J;  1S72 T;  3JCM e;  1FX7 A;  4ELZ C;  3RKW A;  4JS4 A;  3GP8 A;  2CZ7 B;  3GLX A;  4M7A C;  3X25 B;  2R58 A;  2RB6 A;  3INZ A;  4E7H A;  4PJO B;  1BI2 A;  3GNF B;  4QQG A;  3CCJ A;  5DM7 R;  4BI3 A;  3LW5 E;  4PL6 A;  2ZCF B;  2D6F A;  3A8O B;  3L2Z A;  5GAM h;  1QVF A;  2DXB B;  4ELY C;  4FSX A;  2DD4 A;  4LDU A;  3O8V A;  1FWZ A;  2KAF A;  5LJ5 e;  1PSF A;  3M55 A;  3OYA A;  2EWN A;  2KSS A;  4C0D B;  2LT1 A;  4EMK C;  2V8J A;  5J26 A;  5I2S A;  5J3B A;  3J81 E;  3G4S T;  4JRP A;  3DKM A;  3CPF A;  4BY6 C;  2A7Y A;  1N8R C;  3URG A;  3JB9 F;  3QJY A;  1QVF S;  1M1G A;  2L3R A;  1YHQ A;  5C6S A;  2XID A;  4BDY A;  3FC3 A;  3CCS A;  1QVP A;  1QW1 A;  3OYN A;  4PNO A;  1M1K C;  4OB0 B;  4XAX B;  5LJ5 g;  3QII A;  5DY9 A;  4C8Q A;  3GIB A;  1YI2 A;  4M77 B;  4C92 F;  3QUI A;  4BBS M;  5CKE A;  3HZJ A;  4ATO A;  3OYD A;  2D0Q B;  5GMK h;  2QA4 T;  3CMA A;  4C92 E;  3JCM P;  2F69 A;  4E7J A;  3I55 T;  4JRI A;  4XK8 E;  4ME7 A;  5I2M A;  4M7A G;  3FRN A;  2JUF A;  5LJ3 g;  4C5E A;  1B34 A;  2QQA A;  3PMI A;  3M5A A;  4MZP A;  5CKB A;  2QXF A;  5I21 A;  5GMK m;  4M75 F;  2VUB A;  3QXE B;  3HFN A;  2PUO B;  3OSV A;  1O9S A;  4PLL A;  1EIF A;  5AYF A;  1ZBX A;  2MMP A;  2O4X B;  2ZPI B;  3TW6 A;  4OB2 B;  2QQ9 A;  2CGH A;  2GQV A;  2M16 A;  3V7R A;  3MEV A;  3CC4 T;  3QHS A;  2CZ6 B;  1N9R A;  3HRU A;  2DZC A;  2K5L A;  4J7I A;  4JJN K;  3QSU A;  4XU0 A;  3PIP A;  3QDR B;  4BE0 A;  3A5Z B;  5GAN f;  2QI2 A;  3MEW A;  3CCQ A;  3N5B B;  4C8Q F;  2XU8 A;  1BKB A;  2C06 A;  1VQL T;  1OI1 A;  1JRI A;  2RI3 A;  2GFA A;  3T9N A;  3WXM B;  1YJW A;  2LDM A;  4JRQ A;  2DXT A;  1KD1 U;  4XTX A;  1X6O A;  2LCL A;  3MEA A;  1TH7 A;  2EJ9 A;  3CMA T;  4Y28 E;  4E7I A;  4M78 A;  5LJ5 h;  1NJI C;  2CKK A;  4HLQ A;  2CS7 A;  3P8H A;  1XOV A;  3UWN A;  1KQ2 A;  3QWL A;  1BIB A;  3TRE A;  3OYJ A;  1BYM A;  3AHU A;  1WGS A;  1VIE A;  2O01 E;  2RHI A;  4LD6 A;  1UGS B;  3FJP A;  1UGR B;  5GAM d;  1H64 1;  3OB9 A;  5KE3 A;  5J39 A;  3F70 A;  4OF1 A;  4M78 G;  4IKF A;  2LTO A;  1KD1 C;  4B9X A;  4F7U B;  1W2B A;  5CIU A;  4Y91 A;  2K4Y A;  3V8J A;  1BI3 A;  4L59 A;  1VQM T;  4C8Q D;  2XI9 A;  5KE2 A;  3LWH A;  5FRM A;  1H3Z A;  5LL6 S;  3CC7 T;  2WJ9 A;  2XKO C;  1YIT A;  1FXX A;  2VC8 A;  2YRV A;  4LDX A;  2KMG A;  2DO3 A;  2HQE A;  4QQ6 A;  4EPC A;  5M9O A;  2EJF A;  1Q7Y C;  3QYB A;  1Q86 C;  4QVZ A;  4ELJ A;  4CRI A;  2WSF E;  1VQ9 T;  1N9S A;  3CC4 A;  3JB9 H;  3MHX A;  4HA8 A;  3L2V A;  1W4S A;  2GFU A;  1U1S A;  3JCM d;  1P92 A;  3SFM A;  4DA4 A;  1VQN T;  2P0K A;  3MET A;  4EDU A;  4M75 E;  3OYB A;  1VQ8 A;  1AHJ B;  1VQN A;  2QDY B;  1KQ1 A;  1YBY A;  3ASK A;  4L6V 5;  1S72 A;  3OYG A;  4ZN3 A;  3V7S A;  2K3Y A;  1D3B B;  2VYT A;  3E9G A;  2MI6 A;  5GAO l;  1I5L A;  2L5Q A;  1HK9 A;  1XTD A;  2XD0 A;  1IRE B;  5FU6 C;  1IZ6 A;  3SD4 A;  5GAN j;  1MHN A;  2DVE A;  2X35 A;  3L1A A;  4JX6 A;  2FVU A;  3BFM A;  3CCM A;  4BBR M;  1KHI A;  1M5Q 1;  4J6W A;  1VQ7 T;  4BE2 A;  3CCE T;  4F7U E;  4C5I A;  1NPP A;  3OYI A;  4TVR A;  3VYH B;  3CXC S;  2MAM A;  2QA4 A;  3SDZ A;  4PJO F;  1VQ5 T;  4HNU A;  2DZ9 A;  2MF2 A;  4HKE A;  2XG8 D;  2P4T A;  4XTU A;  3DLL A;  4II1 A;  2K3X A;  4YTL A;  2QDJ A;  2ZGW A;  1VQ4 T;  2FHD A;  4AKG A;  3I56 A;  1HXD A;  4A4G A;  1VQP T;  3NTK A;  4M77 E;  1ZQ1 A;  5CO7 A;  2DTO A;  2Y4Y A;  4DOW A;  1QVG A;  4IUQ A;  3MO8 A;  2RHZ A;  3CCV A;  2D9T A;  1D3B A;  1JBM A;  2JNG A;  3WVD B;  2DKG A;  4VUB A;  4AKH A;  4N4G A;  3JCM Q;  3OW2 A;  3OS2 A;  4RG8 A;  4C8Q C;  4M7D B;  2QQ8 A;  2EJG A;  2LX9 A;  1VQ5 A;  4RCB A;  2BS2 A;  2E12 A;  5HK0 A;  1VQK T;  1WQ7 A;  4E47 A;  3X28 B;  2DD5 B;  5EG2 A;  2ZPF B;  3L2R A;  4C92 D;  1M4Z A;  5GAN e;  1VUB A;  4HT8 A;  3SB2 A;  4M78 B;  4QVD A;  2R5M A;  3TU4 K;  1Y7X A;  3KBG A;  1WNL A;  3L2Q A;  5FU7 B;  3SWN C;  4M7D A;  4ZGJ B;  5A0D A;  3HRT A;  3JAM E;  3ER0 A;  3A8M B;  2DTI A;  2PVO B;  3HSB A;  5CKH A;  3OYE A;  3HFO A;  1PSE A;  4LDV A;  3WVE B;  4M77 D;  4OMF B;  3OBY A;  4P5N A;  2XDB A;  1KC8 U;  2M1H A;  4BI4 A;  5FU6 B;  4JX5 A;  5GAO n;  1NZ9 A;  5KH6 A;  4LDW A;  3CME A;  1VQ7 A;  4JUV A;  3CPW S;  4XU1 A;  3CCM T;  2XDD A;  2RK2 A;  2DD5 A;  3JCM W;  2O4X A;  4J6Y A;  2VV5 A;  1QP2 A;  3G6E A;  2RHY A;  3P8D A;  4IUV A;  4E7K A;  5EJC A;  2FB7 A;  3X24 B;  4N4H A;  5FU7 C;  2E6Z A;  1VIF A;  5KCH A;  4BDZ A;  2IVW A;  4MML A;  4M7D G;  2LNV A;  5LJ3 d;  3TEE A;  3C94 A;  1UB4 A;  4HL4 A;  5HK3 A;  2EKO A;  2EQJ A;  3E19 A;  3JCM X;  4NL2 A;  3MP8 A;  1NJI U;  1G5V A;  3JCM f;  3HP9 A;  1Q81 C;  3H8Z A;  4FM4 B;  2MWP A;  4PJO E;  3C12 A;  2MWO A;  4M75 D;  4E7L A;  3RIR A;  2LQK A;  3QYG B;  4N0A C;  3JCM J;  2YLB A;  4LDY A;  3FLG A;  2X4Y A;  2JVV A;  2P0P A;  3KUF A;  4Z6Y A;  4M7D C;  4M6V A;  2AHJ B;  2BIV A;  4XTV A;  1WJR A;  4HCZ A;  1Q86 U;  1YJN T;  4IUR A;  4HT9 A;  2XDP A;  2RM4 A;  3I55 A;  2DK3 A;  1K8A U;  2RHU A;  3RMS A;  4M7A F;  3OS5 A;  4KBM B;  5LJ3 j;  3PT9 A;  1LJO A;  2E1H A;  2QQB A;  2RJF A;  2JTF A;  2DAQ A;  3LLR A;  2LCC A;  4JLG A;  4A4F A;  4C0F A;  1XQH A;  5HKC A;  1K9M U;  3RER A;  4M7A D;  3RMQ A;  4F7U G;  3JCM h;  4OGC A;  1VQ6 A;  3HPW A;  1N27 A;  5GAM j;  1UGQ B;  2IG0 A;  2EQU A;  2XK0 A;  2WAC A;  3PGG A;  3RUX A;  5LJ5 j;  3I56 T;  4J7F A;  4DOV A;  3QYH B;  2DIG A;  5CKF A;  4Q5W A;  1KC8 C;  4ZN1 A;  2EYQ A;  2YLC A;  2ZPB B;  3PMT A;  1WJS A;  1V29 B;  1MGQ A;  2OTL A;  2FYK A;  3OYH A;  5CKD A;  3CCL T;  3V8L A;  3CCQ T;  1VQ9 A;  1VQL A;  3V8K A;  4J83 A;  3G6E T;  3FEO A;  3S3M A;  3OYY A;  3OA6 A;  4BB7 A;  4NOY A;  3DB3 A;  2RH2 A;  2QQR A;  2RJD A;  2OAU A;  5LJ5 d;  2JTM A;  2PU9 B;  3EAE A;  4JX4 A;  2ZPE B;  3OBW A;  2DEQ A;  3MP1 A;  4JRK A;  1KHC A;  2K5F A;  5D6Y A;  3JCM c;  4ZTF A;  4ZTJ A;  4A54 A;  1VQM A;  3GF5 A;  2JOY A;  2PVG B;  3VKG A;  3S6W A;  3G71 A;  1QVG S;  5GMK l;  2OTJ A;  1VQ8 T;  5GAN 2;  4X9C A;  4KUL A;  4BI8 B;  3BW1 A;  3ME9 A;  4M77 F;  2JZ2 A;  5DLO A;  4KUD K;  5CK9 A;  1Y96 B;  1YJN A;  2K2V A;  4MDX A;  4RG2 A;  4JLI A;  5CCA A;  3S3N A;  3TW7 A;  3P8B B;  3CCR A;  1I81 A;  4J5Y A;  4RMO A;  2QTX A;  3JB9 I;  1VQ6 T;  4V2S A;  4XQ3 A;  4BUG A;  1JB0 E;  3Q1J A;  3UT1 A;  4M78 E;  2QEX T;  2QF7 A;  3VUB A;  3CC7 A;  1M1F A;  2GF7 A;  4PJO A;  1UEB A;  3M4G A;  1VQK A;  3OS0 A;  1K9M C;  2WSE E;  3HO8 A;  4ZGE B;  2V8I A;  2KK4 A;  3GPL A;  2JN0 A;  2V8K A;  4M78 F;  1M8V A;  3PNW C;  5D6X A;  2E6N A;  3JSC A;  2LRQ A;  4BAC A;  5GAN 4;  3KXT A;  1YI2 T;  4MFE A;  5GAN d;  1QP3 A;  2GCX A;  3C4S A;  4X34 A;  5D6W A;  3FB9 A;  1G3T A;  2DJZ A;  1R8O B;  3OW2 S;  2DIQ A;  3L2U A;  2E10 A;  3M59 A;  3LWI A;  4DQ2 A;  2VGN A;  4MZM A;  4M7D F;  3OQ5 A;  5A2Q E;  3A8G B;  2PQW A;  3G7Z A;  3VV0 A;  4EMK B;  1GXI E;  4AKI A;  1BIA A;  3VKH A;  3NTH A;  2BS3 A;  4X9D A;  4RCC A;  5GMK j;  2EQM A;  3E9F A;  1ZHI A;  1X01 A;  2H3J A;  3QG1 A;  2B8A A;  1Q7Y U;  4QW2 A;  5GAO r;  3CBM A;  5GAM g;  3QBY A;  1N8R U;  1O75 A;  3NTI A;  2K5I A;  5GAN 8;  5GAN 3;  4O6J A;  4XTY A;  3OYM A;  1OZ3 A;  3MP6 A;  4M7D E;  3RES A;  3L2W A;  2XIC A;  2CYZ B;  4WF2 A;  2BKD N;  3M4Y A;  4IUP A;  2DXC B;  2KDS A;  2M0O A;  2DD4 B;  2X4W A;  1U8R A;  2RA2 A;  3VU3 C;  3CCJ T;  3OYC A;  4KUI A;  1QLB A;  2RI2 A;  4M7A A;  3LX7 A;  3UDC A;  3DLM A;  3JB9 D;  2RJC A;  1I4K 1;  4C8Q E;  3BDU A;  3TCJ A;  1VQO A;  2DTH A;  1Q82 U;  3LYI A;  4JS5 A;  4J8O A;  3CCU T;  2LC4 A;  1NPR A;  2RHX A;  3X26 B;  5C0M A;  4A4K A;  1W2B S;  3LGF A;  2PVD B;  2L8D A;  2CZ1 B;  3OMG A;  4MDW A;  4F7U A;  3CCR T;  4A4H A;  3CCS T;  1KG1 A;  4M77 C;  1I8F A;  5IAY A;  1XNI A;  5A0L A;  4CI0 C;  2F5T X;  3FIF A;  4A53 A;  4C0Z A;  3VYG B;  3FDR A;  4PJO D;  2RO0 A;  2Y90 A;  1YJW T;  2KQW A;  1BI0 A;  2KY9 A;  4XU2 A;  2E5Q A;  1OYX A;  3HRS A;  3QPH A;  1RI0 A;  2QEX A;  1YJ9 A;  4C5H A;  2PUK B;  3BY7 A;  2VXF A;  3GNG A;  4BY6 B;  1M1K U;  5CQY A;  1B34 B;  3DB4 A;  4C0D C;  2RK1 A;  4IUT A;  5A0G A;  4PJO G;  5CQX A;  3OSS C;  1VQP A;  1M90 C;  4LOC A;  4BD3 A;  4C92 B;  1KQS A;  3CCU A;  4JDS A;  2QFZ A;  4OB3 B;  5GAM f;  1X75 C;  2HQX A;  2Y4X A;  4OP0 A;  2CZ0 B;  3KHI A;  3H4C A;  3MCA B;  4N4I A;  3HKS A;  5CAI A;  5CR2 A;  3PTA A;  4LD9 K;  4XTZ A;  5FLX E;  3RKY A;  3G4S A;  4PJO C;  3CCE A;  4FU6 A;  2RJE A;  4M7A B;  2RI5 A;  4N0A A;  3NFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...