2QDYB

Crystal structure of fe-type nhase from rhodococcus erythropolis aj270
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title High resolution X-ray molecular structure of the nitrile hydratase from Rhodococcus erythropolis AJ270 reveals posttranslational oxidation of two cysteines into sulfinic acids and a novel biocatalytic nitrile hydration mechanism
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2qdyB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qdyB02
2WSCE 1PSFA 3A8GB 2ZCFB 1AHJB 3X24B 3A8LB 2WSEE 3QZ9B 3LW5E 3WVEB 1UGRB 2DXCB 2ZZDA 2ZPIB 2DD4A 2PU9B 2ZPHB 4ZGEB 2AHJB 4Y28E 3VYGB 4ZGDB 3QZ5B 1DJ7B 2CZ7B 4FM4B 2ZPFB 4KT0E 3VYHB 1GXIE 5L8RE 2DXBA 2DPPB 3X26B 2ZZDB 2DD4B 2PVDB 1UGPB 2DD5A 2CZ0B 2WSFE 1QP2A 2ZPGB 1V29B 4ZGJB 2CZ1B 3X25B 1QP3A 2QDYB 4OB0B 2PVGB 1JB0E 4OB2B 2CYZB 1UGSB 2DXBB 2PVOB 3X28B 3QYHB 2D0QB 3QXEB 2PUKB 2CZ6B 4OB3B 2DD5B 4RKUE 2O01E 2PUOB 1UGQB 1IREB 3A8HB 4L6V5 2ZPBB 3X20B 3WVDB 3A8MB 4OB1B 3QYGB 4XK8E 3A8OB 2ZPEB 2DXCA 3HHTB 1PSEA 3VYGA
chains in the Genus database with same CATH superfamily
1UGVA 1QVFS 1YITA 2E1HA 2CT3A 1VQPA 4BACA 5LMKB 4EIKA 3OY9A 3BLRB 1WDXA 2IW9B 3L2WA 1JSTB 1Y71A 2XKOC 1IO6A 4LD9K 2RQTA 5GAMe 1I0CA 1GFDA 4M78D 2DM1A 5FU7C 1YCSB 3OYNA 1AWOA 1E6HA 5GMKm 4M78A 2NUPA 3I55A 1VQOT 2L3QA 4BCNB 3CPWP 2XDPA 4JRPA 5HQ0B 1H92A 2AKKA 5KCOA 3CCUA 1JJ2P 5CO7A 4RODA 1B3QA 1ZX6A 1LNXA 4F7UE 1C9BA 1BU2A 4FM4B 1TSFA 4NS5A 2YT6A 2A08A 1BB9A 2KR6A 3DDPB 2KBTA 3A5ZB 1OIUB 1HJDA 4M78G 3NTHA 3OYDA 1N6AA 1ENWA 1QKWA 2C0TA 3TSWA 1H1SB 1QP2A 1NLPC 1M9SA 1K73C 1N5ZA 2RHUA 2CUBA 2GQVA 2VC8A 3DL1A 2JM9A 4C92D 4CFNB 1AT1B 1BCMA 1WI7A 4RUGA 4F7JB 4HCZA 4C92A 4Y91A 3QYHB 2JS2A 1NJIU 3BY7A 1YJNT 4D8KA 1TU0B 1VQ6A 3E19A 4LXCA 1YI2A 4RKUE 5HBHB 3LWIA 2DAQA 1VQLQ 4J9FA 4FYVB 2HL3A 3DLLA 1WHHA 1FMVA 2K5LA 2BS3A 1H8KA 5DQWA 4CC4B 4C8QC 4CRIA 1KJWA 1KD1R 1J3TA 5CQXA 2C6TB 3F70A 2PHGA 3SEMA 9ATCB 3ZBDA 4HNTA 2RM4A 2XI9A 2PNIA 1FMWA 4C92G 2OTLA 2EJFA 3CCUQ 3UA7A 3HHTB 1OYXA 3S6WA 3HO8A 1M1GA 3RMQA 2KK4A 5IT9E 3LH5A 1WXTA 3A8GB 4M77D 1ZLMA 3VS3A 1OIYB 3F5XB 2DBMA 2HQEA 4PFOA 1VYWB 4RTTA 4XAXB 1URCB 3QZ9B 2EGEA 1PM3A 2QQRA 4E7IA 4OVAA 2QQ9A 1SRMA 3H8ZA 3SB2A 4II5B 1ACMB 2KXDA 3I5RA 2ZPHB 2G3RA 4FX3B 2XG8D 5GAMd 3CCJT 1PC0A 4JZ3A 2RQVA 4D8DA 3M03A 4RCCA 2BIVA 4M6VA 3I5SA 1KQ2A 1WXBA 1Q81R 4OMMA 4HKEA 2DL4A 3DLMA 2OTJT 4D6WA 3CXCS 4E7KA 2G9XB 1KG1A 3TU4K 5LJ5j 2BTTA 5IDPB 1V76A 4LOCA 1Z9QA 4M77G 2KDSA 3M0SA 2EFIA 2QQSA 3A98A 3EH2A 3QPHA 3WXMB 1UJ0A 1VQ6Q 1VQ9A 4M78B 7AT1B 5GJVB 3MP1A 2NUPB 3JB9H 1ARKA 1N8RR 1IGUA 2DF6A 5BNJB 4LUDA 4M7DA 4X9CA 4ZGJB 1ZUUA 3QIIA 3JCMP 1RI0A 3X25B 1D0ZA 2VKNA 5IHKA 1MMDA 5A0DA 2VV5A 4BCJB 2I40B 1VQOQ 2OTLQ 3CC2A 1WPYA 1JOWA 4JZ4A 1MHNA 2HL5C 3FJPA 2E70A 1GY3B 2WMBB 5HBEB 2FZGB 4CFMB 3CMEA 4FT2A 1M1FA 4OB3B 5LJ5e 4M75D 4JRKA 2RN8A 2F2CA 3QYEA 1BI0A 4J6YA 5C6SA 3B57A 4M7AC 3RESA 3DDQB 1B34A 1Q82C 2CCIB 3NFCA 3OYYA 2D0NA 2JTMA 4C92B 4QSHA 1QVGA 2LQ8A 2DL5A 1KQSA 1NYGA 1SRLA 4EOKB 4M75G 3MEWA 1LJOA 1UHFA 1IGQA 5CIUA 3N5BB 3TN8B 3L2RA 1OX9A 1VQ9Q 1YJNQ 1GFCA 4F16A 5A2QE 5CR2A 2EQJA 2FRYA 2GQIA 2LT1A 2DRMA 3MEUA 2ZZDA 2DLPA 2DD4A 3CPWS 2WIHB 3OSSC 2PU9B 4EC8B 2WIPB 1BI2A 3UATA 4EOJB 1VYUA 2WFYB 3GF5A 4ZTJA 3MHXA 3OB9A 4LDWA 3CC2Q 2QQAA 2MCNA 1W6XA 2MI6A 3G71T 2OJ2A 1BYMA 2E6ZA 2D8JA 5EFQB 3OBYA 3CMEQ 4J9IA 2W2HA 2X3WD 4CC2A 3QHRB 2KRSA 3VS0A 1XOVA 2J06A 4E7ZA 2F2VA 1QVGP 4PJOA 5M9OA 5D6WA 5GANg 3TNWB 1KQSP 4EC9B 3SWNC 3L2UA 3P8HA 2RQRA 1VQ4T 2O2OA 1VQNA 3UT1A 2LQNA 1M1KR 1JB0E 2GCXA 4BBSM 3VKGA 2KROA 3META 1VIEA 2EQUA 4RTUA 3JCMJ 1GCQC 3JAME 4XTYA 1IHWA 2OTJQ 1KC8R 3LLRA 3GNGA 4HNVA 4TVRA 2LC4A 2MMPA 4DQ2A 4Y72B 4ZTFA 4M7DB 2DTOA 1YIJA 3L2VA 1UJYA 3C0CA 4CFWB 2ROLA 1WYXA 3WVDB 1JU5C 5LJ5d 1PHTA 5CKDA 2RD1A 1SPKA 2FPFA 1OOTA 5CKBA 3NTKA 2LJ0A 1H27B 2L2PA 2DXCA 2W99A 1ZSZA 5L2WB 2DIQA 5ECAA 5KYXA 1U1SA 3UF4A 4RTZA 2EJ9A 1Q86R 1WQ7A 1SG5A 3FRNA 2G77A 2NYSA 3TNHB 4BY6B 2LX9A 3CCVA 3CC7T 2DO3A 2WSEE 1B34B 2QTXA 4RMOA 2SEMA 2YXYA 3QDRB 4F7UA 2KSSA 3MIAB 2ZPIB 2WJ9A 4MZMA 1VQNQ 2COZA 4N4IA 2HSEB 2UZDB 2AHJB 1K8AC 2CS7A 4F04B 4R55A 3M0TA 2J7IA 5FLXE 4ATOA 1TUCA 1UTIA 4F6WB 2WHBB 1PD1A 2X4XA 2P84A 1NLOC 2AZSA 3U23A 1OU8A 2EYXA 5GANh 1AOJA 1BI3A 4F7UG 2ZZDB 2DD4B 1YIJQ 2VWFA 1TH7A 1ZUKA 1D0YA 2AK5A 5GMKh 4N0AA 2HQHA 3ZL7C 1G8XA 2K3BA 4CXAB 3CCQA 3OYKA 1M30A 1AD5A 2QDYB 4OB0B 3HP9A 2QQBA 2L3PA 2DYIA 1RI9A 4YOSA 5A0GA 2JZ2A 2LQWA 1UG1A 2RK2A 1YJ9A 2LCSA 3S3MA 4Z6YA 2CYZB 2HEQA 1K76A 1MV3A 3DJBA 1SHFA 2DJZA 2Y4YA 4PJOB 3KHIA 4C8QF 2NLUA 2CP0A 2A28A 1G2BA 2DKGA 1VQ5A 2YWWA 2CP7A 4XU3A 4Z8AA 5GANf 3OYFA 1YCYA 2RO0A 2JMCA 4J5YA 2RJFA 4CC7A 4KGZB 2R5MA 2WPAB 3M0PA 1W70A 3V7RA 3V8LA 4PJLA 4F6SB 3G4ST 3KFVA 4OGCA 2J6FA 2PQWA 5LL6S 2RA2A 1YWOA 4F6UB 2EVRA 1ABOA 4E7HA 2OI3A 1TFBA 2KR3A 2EKOA 4A63B 3A8LB 3POMA 4HA8A 4HVWA 2ZGWA 4ORZA 4OF1A 2DXCB 1ZSZB 5DQVA 5KYXB 2UUEB 3CCQQ 1VA7A 3L42A 2KI7A 2XHCA 3MY1B 2EYWA 4L59A 2C5OB 1YJ9Q 3CCRA 2ZAEA 1AWXA 4KULA 1XQHA 3PTAA 1CSKA 1AWJA 5FWBA 2KYMA 1YBYA 2GFAA 4F7UB 1W2BA 4E7JA 2DPPB 8AT1B 4LDYA 4Z89A 2KT8A 1K8AU 3INZA 3BG3A 4QVDA 4GY5A 3OYBA 3CC7Q 4JUVA 4NL3A 3P8BB 2IN3A 4HNUA 1NM7A 4FSSA 1YITT 1UHCA 4JJNK 1VQPT 1AZGB 5KYYA 5IDNB 1JQQA 1W1FA 3M53A 2CJMB 1NJIR 2YSQA 4IKFA 3CCEA 2ED0A 3BFMA 3MY5B 4AKIA 2J05A 2CH4W 2QK0A 1TD6A 5KH6A 1M2OA 2X4JA 2XD0A 2F69A 2LQKA 1M90C 3I55T 2LRQA 1TG0A 3I35A 3TVTA 3SD4A 3CMAQ 2GTJA 4M7AF 3S3OA 3TW6A 5HK0A 4X1VA 4QT7A 3CCUT 2KQWA 3HSBA 4BCQD 2DK3A 1QCNA 3EJ1B 3NTIA 4AFZC 4V2SA 1R0BG 5GMKl 1F5QB 4KH1B 3LH0A 4AI6A 1MNEA 4EOSB 4IUTA 2RQUA 1W2BP 5CEIB 1VOMA 5KYWA 4J7FA 4ROCA 2KAFA 1W4SA 4EMGA 2CP5A 3CCRQ 3RKYA 1KFZA 1D0XA 3REAB 1WQWA 2BPMB 1JJ2A 3JB9I 2V1QA 5LJ3g 2W9ZA 1WLPB 4CFUD 1WXUA 5I21A 4JJDA 2F1LA 2FPDA 5DY9A 2G6FX 3EG2A 4BI4A 2E6NA 2DMOA 2YRVA 1X69A 1Y07A 1SSHA 1WHKA 2EKHA 2A7YA 4Y28E 4M4ZA 4WF2A 1VQ6T 3JCMV 3CCEQ 2DERA 1YI2T 4MDWA 3HKSA 2FZCB 5FWCA 4BCMD 3H0FA 2WACA 2JN0A 3MJXA 2R5AA 2FZKB 3G4SQ 5GAOl 2C06A 4IIMA 3MEAA 4JLGA 3REBB 1MMAA 3OYHA 2V8IA 1U3OA 4LN2A 2OTLT 2VXFA 2WSFE 5KE3A 2LCLA 1H4LD 1NPPA 2P4RA 3RMSA 4FU6A 4CFVB 2QI2A 2NUZA 2UZBB 2LDMA 3H9NA 2O31A 1JXMA 4C0DB 3EG1A 2DL8A 4J9EA 2HKQB 4AT1B 2CZ6B 5KCHA 2DZ9A 3ER0A 3JSCA 1PG5B 2VB6A 2J6OA 1G3NC 3EGUA 1IREB 1OL2B 6AT1B 1PKSA 1UUEA 1HSQA 3GOXA 2R7GA 5KYYB 1M3BA 2VGMA 1ZA1B 4JPBW 2DIGA 1NZ9A 1YNZA 1E7OA 1M90U 5GAOm 1YITQ 3Q1JA 3C95A 2RPNA 1VQPQ 5LJ3h 1VQ9T 2DETA 1K0SA 5DM7R 3OYMA 4C0GA 1Q95G 4YC3B 3OS1A 2SRCA 2K7AA 1GBRA 4XQ3A 1VQ8A 4DA4A 3PO3S 4OMOA 2F5TX 2DXUA 2A36A 5I5ZB 1Q7YC 4FT4A 4J6WA 2XDDA 1M2VA 2PK9B 1JSUB 3JB9F 3I55Q 4BCQB 1UDLA 3CC2T 3LW5E 3EHRA 2MK5A 1M4ZA 1PRMC 5KYWB 2K6DA 2HKNA 4JS5A 5D6XA 1OL1B 3M4GA 3CMET 4ME7A 3RERA 1ZHIA 2QGSA 1KSWA 2I0NA 3CC4A 3I9QA 1QW1A 3QG1A 1WJSA 1KHIA 4QVZA 3GLXA 4UN0A 2J6KA 3TW7A 2KMTA 4KT0E 4M77A 4AMCA 4XTWA 1NYFA 5LJ3f 1QWEA 2PK2A 3X26B 5I2MA 1S1NA 4M7DC 4EMKA 2X51A 2CT4A 2ROTA 1KD1C 4A54A 2CZ0B 3EH1A 5IF1B 3PT9A 2YLBA 2FEIA 2DYBA 1LCKA 2QF7A 4F70B 2RHYA 4C8QD 2PVGB 1ZUYA 1MMGA 1ZBXA 4HT8A 1S72A 4LDVA 5GAN3 3M0RA 2E64A 2LP5A 3NPFA 1YI2Q 4OGEA 1HD3A 1XO2A 1Z9ZA 1OU9A 1M3CA 2BKDN 1VQ8Q 4OGRB 2CH4A 1H1QB 4MMKA 3J7AF 2QTVA 1MNDA 2P0KA 5IXBA 2K5IA 3PVQA 3CD6A 1U1TA 2EYZA 4L6V5 1E9HB 2FYKA 3JCMX 2WEVB 5AYFA 4PLIA 4C8QG 3H0IA 1YWPA 2DL7A 5AT1B 1W2BS 2KMGA 3TEEA 1Q81C 2EQIA 2X1NB 1RAIB 2CUDA 3JCMe 3JCMQ 3CC4Q 4RTXA 1E7PA 4YTLA 1K73U 3GIBA 2W10A 1UEBA 1BKBA 1OGUB 3PIPA 5FROA 4M75A 1YP5A 2RHZA 3BHVB 5CQYA 1VQNT 1IRXA 3EGXA 1N8RC 2E3HA 1VYTA 3OS2A 4X9DA 1UGRB 1R0CB 1TTHB 3SDZA 5GAMg 1X6BA 3HFNA 2LNVA 3CCMA 4DOVA 1AISB 2QA4A 1Q7YU 1AVZC 3QZ5B 2W9FA 1WHGA 3EFSA 1YIJT 3VS7A 1G5VA 1WNLA 1M2VB 3PMIA 2E12A 4J9DA 3L2QA 4PJOC 5L8RE 4II1A 3VKHA 5GMKi 1D3BA 2RK1A 3AT1B 3HZJA 3EGDA 2M9UA 1UNLD 3M58A 3MP6A 1OI9B 1K9MC 4RCBA 3E1SA 2AZVA 1JJ2S 2YDLA 3H4CA 2FO0A 3OYIA 1JBMA 4BXXX 3EOCB 1PKDB 2JW4A 4M77B 3I56A 1H1PB 3CCVT 4PKCC 1SKUB 1KQ1A 4XU1A 2Y4XA 4EOOB 3X28B 2D0QB 4EMKB 1X2KA 2KEAA 4F7NB 4HT9A 1WJQA 1YN8A 1QMCA 4E2FB 2ECZA 5HK3A 4CC3A 3HRSA 2CGHA 1WJRA 5HNBB 2EQKA 1ZA2B 4JS4A 1VQKA 3H0HA 1E6GA 2KT1A 4A4FA 2UZEB 4EOIB 4HXJA 4PJNA 3A8MB 3M4YA 4KGXB 4XK8E 4M7AG 4R56A 3EFRA 3CCMQ 1NEGA 2I53A 2QA4Q 2C5XB 2CREA 2XU8A 1WFWA 3CCLA 1SF9A 2QAZA 2BS2A 4ZN3A 4EDUA 3GPLA 1QCOA 4M78F 3BG5A 3JCMd 3BLQB 2QEXA 3CCQT 3OMCA 2KY9A 4GLMA 4GBQA 5GAMh 5J3BA 4MDXA 4JX4A 2GFUA 2FPEA 1I8FA 1KHCA 2A3LA 1YJ9T 2QXFA 1T0JA 1G3TA 1M1KC 3MPUB 3EG9A 3QKJA 5LQFB 1QVFA 2LT4A 1SHGA 2EAYA 4M75B 2VVKA 3NMZC 4HVVA 1YHQA 1Q82U 1RAFB 3OMGA 2C4GB 1K8AR 3EGXB 3RNJA 2VGNA 2HSPA 4BCKB 1U06A 2XK0A 2DXBA 1WIEA 3GBQA 2IIMA 4KRDB 2M0YA 5D7UA 4BD3A 3ULRB 1LOJA 1VQKQ 1FKMA 2DXTA 2COYA 1QKXA 1VQ7A 1V29B 3OYEA 5GAOn 1YJWA 4C92F 5GAMf 1IB8A 3OA6A 3E9FA 3EG3A 4F17A 4BY1X 3E9GA 3EHQA 4ZN1A 1UNGD 3EIDB 1Q86C 3CMAT 1PRLC 1D3BB 1K9MU 1IHVA 2EGAA 3EGDB 5GAN8 2E4HA 1H28B 4WCIA 2PUKB 4EORB 4EOMB 2BZXA 5EC7A 3QJ6A 3RBBB 5I11A 3G7ZA 2QEXQ 1QVFP 1UGQB 3G33B 2RB6A 1VQMA 2FRWA 4AKHA 1RADB 4E7LA 5LJ5g 2LJ1A 2JXBA 3CCRT 1VIFA 1K9AA 1FINB 1TWBA 3MI9B 3GP8A 2Z0WA 4LE9A 4RG2A 1T3LA 3TNIB 3GNFB 4EOLB 1MV0B 3PIOA 4OMFB 2EGCA 3MO8A 2L5QA 3CCVQ 1RUWA 4BE2A 3PMTA 2JUFA 4C8QE 3O8VA 2HBPA 3OYJA 2GGRA 2HZYA 3X24B 1GRIA 1NG2A 2D6FA 2DZCA 4BE0A 2E5KA 2LX7A 3HPWA 3CCET 2RI2A 2I2LA 3SFMA 3FLGA 1X2QA 4QVCA 1UFFA 2P0QA 3PFSA 3CCSA 1K0XA 2IG0A 1DJ7B 4UC4A 3RIRA 1BI1A 1FX7A 4WTOB 3G6EA 1D1AA 5HVYB 2DE0X 4XTUA 4C0DC 4M7DF 1JEGA 3VYHB 4DOWA 1I4K1 1B07A 2V8JA 2QGGA 3DKMA 2HBWA 1QVPA 2B86A 1I1JA 2RHXA 3QWYA 2E3IA 1OZ2A 2X4WA 1VQMQ 1H25B 2CP3A 3EG9B 1Y96A 1BIAA 3LQ5B 2CZ1B 2QDJA 1EZZB 1T0HA 3M0UA 5KYUA 2DBKA 1MGQA 3FB9A 3OYLA 4M75F 1UGSB 2DXBB 4AKGA 4HL4A 2A0FB 3DB3A 5HBJB 1QVGS 3R6OA 4PK4A 1KQSS 4A4HA 1BK2A 1VQ5Q 5LJ5h 2WXVB 1H641 2EBPA 1WGSA 2RNAA 2K5FA 3S3NA 2X4YA 4PJMA 2EUFA 4C0FA 2OAUA 4A4GA 1M90R 1EIFA 4JRIA 1AWWA 3V7SA 2IW8B 4MFEA 3HTRA 4XTVA 4RTVA 3BHUB 1R8OB 5CKHA 3RGFB 2GBQA 2JMAA 1X01A 4BY7X 4JDSA 2EW3A 2LW4A 3T9NA 2X35A 2KE9A 3G6EQ 4BI8B 5GAOr 2MWOA 1MUZA 3OBWA 4C5HA 4ELJA 5FRMA 1K4US 4M7AE 2YUNA 2ED1A 1WX6A 3QDFA 3LGFA 3OS5A 5LJ5f 1I5OB 1X27A 4A53A 3QSUA 5HKCA 2JM8A 3OYCA 2ATCB 2MIOA 3LYIA 1NJIC 2MOXA 1FYNA 2JOYA 3JRZA 3GTMS 1C1AA 3JV3A 4AG2C 4FYXB 2JJ9A 4PJOF 4OMNA 1TUGB 4C5IA 4RTYA 3V8KA 4F14A 3H6ZA 1X75C 3J81E 4M78C 3KXTA 2DEUA 2HQXA 2DTHA 3M54A 4OMPA 5EG2A 2CCHB 4QW2A 4EOPB 4J9GA 2C5NB 1B7TA 4XU2A 4BB7A 2L3RA 1UGPB 2ZPGB 1G3YA 2HNIA 3CBMA 4N4HA 2E41A 4X34A 4QQDA 4EPCA 3TCJA 1VQ8T 4HCCA 5FU6B 3QWLA 1AEYA 3OW2A 2ESWA 5IXFA 3NDQA 3QYBA 1CKAA 1UECA 2K3XA 3MP8A 4FSXA 2YHTA 2OX7A 1Y96B 1O75A 4JRQA 1I07A 1Y0MA 3NHNA 4AG1C 3J80E 4KBMB 1H26B 3ZFJA 1VQLA 3CC4T 1VOLA 4C92C 2RH2A 5KYUB 2EJGA 2W96A 1K73R 2NUTA 1SSFA 4PLLA 2D8HA 5D6YA 4IUVA 1IZ6A 2EYYA 2ZPEB 4EOQB 5CK9A 2DL3A 2K4YA 1JRIA 4Z02A 4OP0A 4E47A 5FGKB 5GANj 4JLIA 1I5LA 5I22A 2M16A 1PSFA 2DX1A 4F7UF 3AHUA 3HBLA 4CFXB 1WHLA 5GMKj 4C5GA 4PJJA 1ABQA 3DTOA 2HCKA 3PE0A 3WVEB 5IH2A 3OW2P 3R6NA 2HD0A 1S72T 2EQMA 1Q7YR 2VYTA 4C0ZA 4MZPA 1GH6B 1R77A 4F7LB 5KYNA 5CKEA 4BCPB 4FYWB 4M77C 4J9BA 2QYZA 2QASA 2LCCA 2CZ7B 4BUGA 1N9RA 4IUQA 1NPRA 2EIFA 2KGTA 3ZEHA 2C0OA 3CD6T 2ZPFB 4EMKC 5DLOA 1QQJA 4L5GA 5GANe 4K11A 2RI3A 5DLQE 2K2MA 3DOGB 1XNIA 3QO3A 5GMKe 3KBGA 4N4GA 3QHSA 2O4XA 1BBZA 4LUEA 2YRDA 3VKIA 1W98B 2JTEA 5CCAA 1EFNA 4OB2B 4AFUC 4KUIA 1ZQ1A 4CFUB 1H3ZA 1ZBJA 1FXXA 3FIFA 3LWHA 1VQOA 1BCOA 2GNCA 3V7CA 1OULA 4NC6A 5CYIB 2V22B 2EYQA 2DMEA 1OV3A 3BDUA 1OEBA 1T3SA 1ZP2A 1XJWB 2M1HA 3TQ7P 4BCOB 3CCMT 2QA4T 2CSIA 2ZPBB 3THKA 5FRNA 1JXOA 3P8DA 3UA6A 2W0ZA 4IMYB 1IXDA 4C8QA 4KGVB 1G3SA 3QYGB 4BCMB 5IHIA 2LVMA 2R58A 4BCGB 2HDAA 3M57A 4B9XA 4M75C 1KIKA 4Z88A 3VYGA 4A4KA 5C0MA 2RJEA 2D1XA 4BY6C 2E5QA 2JNGA 4Q5WA 1AD6A 1WHJA 1M8MA 2CP2A 2M02A 4E6RA 1QMZB 1UB4A 2RJCA 2VASA 4PFPA 2PJQA 1X6OA 4MMLA 2NUTB 3I56T 1YJNA 2KVQG 4NSTB 4M7DD 4CI0C 1RAHB 3M55A 3FC3A 1Q82R 2WMAB 4JX5A 1FVVB 3OSVA 5GAN5 1KXUA 2IVXA 4OMQA 3BLHB 1I81A 2YRCA 4HCBA 3FDRA 5KE2A 3VRYA 3VS6A 3H41A 1QLBA 4FIBA 3C12A 1VQKT 3QWXX 1WA7A 3K7AM 1QWFA 5J26A 4BBRM 2XIDA 2H3EB 1N4MA 1OPKA 3LGLA 4FW2A 5FU7B 3VRZA 2DILA 4HCKA 1LVKA 5IHYA 2K3YA 4M7DG 5GANd 3CBPA 3CCLT 2MF2A 2KRMA 1QP3A 1G3WA 1S72Q 1K9MR 2KXCA 1RAGB 2BE9B 4J9HA 5GAN2 2E65A 2O88A 4P5NA 2BS4A 5GAN6 4E7SA 4BCHB 4ELZC 1VYVA 2QEXT 1RABB 4KH0B 4YOZA 3PVLA 3CCJA 1U5SA 1U8RA 3VS5A 4BCFB 1RL2A 5I2SA 4LDUA 2DA9A 5A0LA 4FCYA 2MPXC 5IHNA 2OTJA 4B6MA 4AFSC 3CD6Q 2O4XB 1GBQA 1GL5A 4KRCB 1PNJA 3VUBA 2JT4A 3URGA 3MKDA 4M7AD 2Y90A 1YHQT 2IW6B 5CAIA 1AZEA 2DJQA 4M7AA 1KD1U 3V8JA 3UPUA 4CRLB 3QHWB 4J8OA 3KUFA 1OZ3A 4LD6A 1H3HA 2KYBA 3L2ZA 4J6XA 4DBRA 5CVIA 2WSCE 3CPFA 3O0GD 5GAOq 3EFOA 2H8HA 1VQ7T 3M9QA 2MYSA 1YJWT 4O6JA 3JCMc 1PD0A 2FVUA 4C8QB 4O5VA 2DEQA 3OW2S 1ZSZC 1P92A 2F5KA 2K2VA 4PJOD 3OYGA 4TTHA 4IIOA 4DBQA 4BCIB 2XDBA 5EJCA 1Y7XA 1PWTA 2IVWA 3VYGB 4ZGDB 3CBOA 2L89A 3VU3C 1ZSGA 3VS4A 3RKWA 2PTKA 1VQMT 4M78E 5FW9A 4PNOA 3CCJQ 1Q81U 2FB7A 2JVVA 4BE1A 3MEVA 1GXIE 1X6GA 1LPLA 3QUIA 2JS0A 2DVEA 2PVDB 4PJOG 2K79A 4IUPA 4ELYC 2MAMA 2DD5A 2NWMA 1NE8A 2DVJA 2X3XD 2YUQA 4JX6A 2P0PA 3DB4A 3I56Q 1JKWA 1N8RU 5LJ3j 5GAN7 3SWNA 3VV0A 1KC8C 1VQ5T 5GJWB 4LDXA 4RTWA 2L8DA 1NEBA 2O9SA 2PVOB 4N0AC 2O9VA 4NL2A 1UE9A 1VUBA 1GCQA 4GLKA 1QCFA 4OMLA 3VS2A 1N9SA 2ABLA 4KUDK 1OI1A 2RJDA 4VUBA 3RUXA 2O01E 2M0OA 3G71A 1M3AA 4EMHA 4AFQC 1HXDA 3CCST 3L1AA 2P4TA 1GCPA 4C92E 2MWPA 4G6LB 2IPOB 1OX8A 3O5ZA 5IAYA 2RI5A 1XTDA 3G6ET 2BZ8A 1TXQA 2XMFA 3CQTA 3CCLQ 1JO8A 4YOOA 2L3SA 3BHTB 2K57A 5LJ3e 1RLPC 2E10A 1VQ4A 1C6VX 3UDCA 1GUXA 1PSEA 1X43A 3PNWC 1WHMA 3JCMg 2RHIA 2R57A 4J9CA 2ZCFB 2RMOA 1AHJB 3OS0A 4RG8A 4QQ6A 4ELLA 4C5EA 3PGGA 3M59A 1QLYA 4M7AB 1FWZA 4IUUA 1UNHD 1WZOA 4XTZA 3RDVA 4NOYA 3JB9D 4IURA 4ZGEB 4M77F 3RR6A 2DFUA 4QKUA 4B9WA 2VUBA 4M77E 1YHQQ 2YUOA 5FU6C 4J7IA 1O9KA 1Y57A 2LJ3A 3EFOB 1N27A 3IQLA 1BU1A 1TS9A 1H1RB 2GF7A 3TSZA 4PL6A 4XU0A 3EG0A 3VUZA 1V1CA 5GAOp 1M27C 4OR5B 2BZYA 2LNHB 3C4SA 3ME9A 3G71Q 1D1CA 1VQ7Q 1YJWQ 4F7SB 3MCAB 1G83A 3D7SB 2DNUA 2CDTA 2UZLB 3JB9G 3TREA 3CC7A 5L23A 1MMNA 2JGZB 4MZTA 2RF0A 3EAEA 2CP6A 2BE7D 4J83A 4DBHA 5HY6A 3HL8A 4FL6A 2AIRB 4FYYB 1VQ4Q 2OAWA 4M7DE 1M1KU 4I3ZB 3QXEB 2DD5B 1BIBA 2PUOB 1KC8U 5HCKA 1OQKA 2KNBB 5CKFA 1A0NB 3A8HB 2KRNA 3CXCA 3SWNB 3CMAA 4JJCA 3VS1A 1KK7A 2EWNA 3UWNA 1OPLA 4JJBA 2CKKA 2H3JA 2L0AA 5ICPB 2FL7A 2V26A 4OB1B 5ACBA 2PZ1A 4MFDA 3C94A 4HLQA 3QJYA 4BCND 3M5AA 3JCMW 3OQ5A 3JCMh 2A37A 2PMIB 2D9TA 4M75E 1M8VA 4ZNXA 1F1BB 4FW1A 3A1PA 2V1RA 2QFZA 3BG9A 4EONB 4Y92A 1HK9A 4BDZA 2B8AA 5LJ3d 3VJPA 1RACB 1Q86U 4ANJA 2YUPA 4KRTA 2ENMA 2F2XA 3OYAA 1RAAB 4ESRA 2C5VB 2COWA 1TUDA 2F2WA 3CCSQ 2BKZB 4XTXA 4DEYA 2LMJA 1GUXB 2AKLA 1RLQC 2EPDA 3JCMb 2FG0A 2QGFB 3CXCP 2DRKA 1HYOA 3BW1A 2GTOA 5GAN4 2HMAA 3G1JA 3JCMf 1VQLT 4ROEA 2VXEA 2B9RA 2M51A 3QBYA 3E2UA 2XICA 1H24B 1EX4A 3G4SA 1NBEB 1SEMA 3CEYA 2DTIA 1CKBA 3HB9A 3LX7A 1C0MA 3ASKA 1D1BA 4R0KA 2X9HA 1P5EB 2JTFA 1O9KB 2C0IA 4DBFA 4HVUA 1PKTA 4DEXA 3RKXA 1YFNA 2AT1B 4BI3A 2LZ6B 1OKWB 4PJOE 5J39A 4LNPA 1D3UB 1VINA 2RQWA 2QQ8A 3M56A 3CPWA 4A4EA 2HAXA 3SHWA 5IN1A 5GAMj 1K1ZA 3HFOA 1RAEB 8ATCB 1FMKA 2V8KA 3BE3A 2QG9B 2YLCA 2FHDA 2BUDA 1O9SA 3X20B 2QDLA 3M0QA 1M5Q1 2K9GA 4BDYA 1TOVA 1OKVB 2CSQA 3JB9J 3A8OB 2LTOA 1D09B 3HRUA 3HRTA 3BDLA 4QQGA 3FJ5A 4PFZA 3FEOA 3NGPA 1PCXA 4MIMA
chains in the Genus database with same CATH topology
2PQWA 3CCLA 1QVFS 5LL6S 2RA2A 2BS2A 2RJEA 4ZN3A 2E1HA 1YITA 4BY6C 1VQPA 4BACA 2E5QA 2JNGA 4Q5WA 4EDUA 3OY9A 3GPLA 4M78F 4E7HA 3BG5A 3JCMd 3L2WA 2QEXA 3CCQT 1UB4A 1Y71A 2EKOA 2RJCA 2KY9A 2XKOC 1X6OA 3A8LB 3OMCA 4LD9K 4MMLA 5GAMe 5GAMh 5J3BA 4M78D 4HA8A 4MDXA 5FU7C 2ZGWA 3I56T 4JX4A 4OF1A 3OYNA 2GFUA 1YJNA 2KVQG 1I8FA 1KHCA 2A3LA 2DXCB 4M78A 5GMKm 1YJ9T 4CI0C 4M7DD 2QXFA 3I55A 1VQOT 1G3TA 3M55A 3FC3A 1M1KC 2XDPA 4JRPA 3QKJA 4JX5A 3L42A 1QVFA 2LT4A 2EAYA 3OSVA 5KCOA 5GAN5 3CCUA 2XHCA 1I81A 5CO7A 4L59A 4M75B 4HCBA 3FDRA 5KE2A 3CCRA 1YHQA 1Q82U 1LNXA 3OMGA 4F7UE 4FIBA 1QLBA 3C12A 4KULA 4FM4B 1VQKT 2VGNA 4NS5A 5J26A 4BBRM 1XQHA 2KR6A 2XIDA 3PTAA 2XK0A 1YBYA 2DXBA 2GFAA 3A5ZB 4F7UB 2DPPB 4E7JA 1W2BA 3LGLA 4LDYA 4M78G 3NTHA 1K8AU 3INZA 3OYDA 3BG3A 4BD3A 4QVDA 1N6AA 5FU7B 1LOJA 4GY5A 3OYBA 1FKMA 2DXTA 2K3YA 4JUVA 4NL3A 4M7DG 3P8BB 1QP2A 5GANd 1VQ7A 1V29B 1M9SA 3OYEA 5GAOn 4HNUA 1YJWA 3CBPA 4C92F 1K73C 3CCLT 5GAMf 2RHUA 2MF2A 1YITT 1QP3A 1G3WA 2GQVA 3E9FA 2VC8A 3OA6A 4JJNK 1VQPT 5GAN2 2E65A 4P5NA 2BS4A 5GAN6 3M53A 4IKFA 3DL1A 3E9GA 4C92D 4ELZC 4ZN1A 3CCEA 3BFMA 2QEXT 4AKIA 1Q86C 3CMAT 1D3BB 4HCZA 4C92A 4Y91A 1K9MU 3QYHB 5GAN8 3CCJA 1U8RA 5KH6A 1NJIU 1RL2A 2X4JA 3BY7A 5I2SA 1YJNT 4LDUA 2PUKB 5A0LA 1VQ6A 3E19A 2XD0A 2OTJA 2F69A 2LQKA 1M90C 3I55T 3QJ6A 1YI2A 4RKUE 2LRQA 3LWIA 2DAQA 2O4XB 3G7ZA 3SD4A 4M7AF 1UGQB 3S3OA 3TW6A 2RB6A 1VQMA 5HK0A 3DLLA 4AKHA 4E7LA 2K5LA 4B9XA 2BS3A 4C8QC 4CRIA 5LJ5g 3CCUT 3VUBA 2KQWA 3URGA 3HSBA 5CQXA 2DK3A 3F70A 5C0MA 3CCRT 1VIFA 4M7AD 2Y90A 3NTIA 3ZBDA 4HNTA 2RM4A 1YHQT 4V2SA 5CAIA 2XI9A 5GMKl 3LH0A 4M7AA 4AI6A 1KD1U 4IUTA 4C92G 2OTLA 2EJFA 3GP8A 3V8JA 3UPUA 4RG2A 4J7FA 3HHTB 1OYXA 1W4SA 2KAFA 3GNFB 4EMGA 3S6WA 3PIOA 2D6FA 1M1GA 3HO8A 3KUFA 1OZ3A 4J8OA 4OMFB 2KK4A 3MO8A 4LD6A 3RKYA 2L5QA 3RMQA 5IT9E 3L2ZA 4J6XA 4BE2A 3PMTA 5CVIA 1WQWA 2WSCE 3CPFA 1JJ2A 2JUFA 3JB9I 4C8QE 3A8GB 3O8VA 4M77D 5LJ3g 5GAOq 2HBPA 1VQ7T 3M9QA 1YJWT 3OYJA 4O6JA 2HQEA 5I21A 3JCMc 4XAXB 3X24B 2FVUA 4C8QB 4O5VA 2DEQA 3QZ9B 5DY9A 3OW2S 2DZCA 4BE0A 2F5KA 1P92A 2K2VA 2QQRA 3HPWA 4E7IA 4PJOD 4BI4A 4OVAA 3OYGA 3CCET 2E6NA 2RI2A 2QQ9A 2YRVA 2I2LA 3H8ZA 3SB2A 3SFMA 3FLGA 1Y07A 2XDBA 5EJCA 2ZPHB 4QVCA 2G3RA 2A7YA 1Y7XA 2XG8D 5GAMd 2IVWA 2P0QA 3VYGB 4Y28E 4ZGDB 3CBOA 2L89A 3PFSA 3CCJT 3CCSA 4RCCA 2BIVA 4M6VA 1KQ2A 4WF2A 4HKEA 2IG0A 1VQ6T 3VU3C 2OTJT 3DLMA 3JCMV 1DJ7B 4D6WA 4UC4A 1YI2T 4MDWA 3CXCS 3HKSA 4E7KA 1KG1A 3RIRA 3RKWA 3TU4K 1BI1A 1FX7A 5LJ5j 3G6EA 2WACA 1VQMT 4M78E 2JN0A 4PNOA 4LOCA 4M77G 2R5AA 2KDSA 4XTUA 4C0DC 2EFIA 1Q81U 4M7DF 3VYHB 2FB7A 2QQSA 4DOWA 1I4K1 2JVVA 5GAOl 3MEVA 2V8JA 3QPHA 4BE1A 3WXMB 3DKMA 1GXIE 3QUIA 2C06A 1VQ9A 1QVPA 4M78B 2RHXA 3MEAA 4JLGA 3MP1A 2DVEA 3JB9H 2PVDB 4PJOG 3OYHA 1OZ2A 2V8IA 4IUPA 2OTLT 2X4WA 2VXFA 4ELYC 2MAMA 2DD5A 2WSFE 1Y96A 1NE8A 5KE3A 4X9CA 2LCLA 4M7DA 1BIAA 1NPPA 4ZGJB 4JX6A 2CZ1B 3QIIA 2P0PA 3JCMP 1RI0A 3RMSA 3X25B 4FU6A 3DB4A 5A0DA 2VV5A 2QDJA 1N8RU 5LJ3j 5GAN7 3SWNA 3VV0A 2QI2A 1KC8C 1VQ5T 3CC2A 4LDXA 1WPYA 1MHNA 3FJPA 2E70A 1MGQA 2LDMA 2L8DA 3FB9A 3OYLA 4M75F 1UGSB 2DXBB 2PVOB 4C0DB 4AKGA 4HL4A 4N0AC 3DB3A 3CMEA 1QVGS 4NL2A 3R6OA 4FT2A 1VUBA 4GLKA 1KQSS 2CZ6B 4OB3B 1M1FA 4A4HA 5KCHA 2DZ9A 3ER0A 5LJ5h 5LJ5e 1H641 4M75D 1N9SA 4KUDK 1WGSA 1OI1A 2K5FA 2RJDA 3JSCA 4JRKA 2O01E 2M0OA 4VUBA 2X4YA 3RUXA 4EMHA 3G71A 3S3NA 1HXDA 3QYEA 1IREB 3L1AA 1BI0A 4J6YA 4C0FA 5C6SA 2P4TA 3CCST 4M75C 2OAUA 3GOXA 4A4GA 4C92E 2MWPA 1EIFA 4M7AC 2VGMA 4JRIA 3RESA 2DIGA 3V7SA 4MFEA 1B34A 1NZ9A 2RI5A 4XTVA 5IAYA 1Q82C 3NFCA 1XTDA 3OYYA 3G6ET 2JTMA 1R8OB 5CKHA 4C92B 1X01A 4JDSA 4QSHA 1M90U 5GAOm 3Q1JA 3C95A 1QVGA 2K57A 5LJ3e 2LQ8A 5LJ3h 1VQ9T 1KQSA 2E10A 3T9NA 1VQ4A 5DM7R 2X35A 3UDCA 1PSEA 3OYMA 4C0GA 3PNWC 3OS1A 4BI8B 3JCMg 2RHIA 5GAOr 4XQ3A 2MWOA 4M75G 1VQ8A 2R57A 4DA4A 2ZCFB 3OBWA 4C5HA 2F5TX 4ELJA 1LJOA 2DXUA 3MEWA 1AHJB 5FRMA 5CIUA 4M7AE 3N5BB 3OS0A 3L2RA 1Q7YC 4FT4A 4J6WA 2XDDA 4RG8A 4QQ6A 3LGFA 5A2QE 5CR2A 3OS5A 3JB9F 2EQJA 3CC2T 3LW5E 2LT1A 3PGGA 4C5EA 3M59A 4M7AB 5LJ5f 1FWZA 4IUUA 1M4ZA 3MEUA 2ZZDA 2DD4A 3CPWS 3OSSC 4XTZA 2PU9B 4A53A 3QSUA 5HKCA 4JS5A 4NOYA 5D6XA 3JB9D 4IURA 4ZGEB 4M77F 3OYCA 1BI2A 3LYIA 3M4GA 3CMET 4ME7A 3RERA 1NJIC 3GF5A 1ZHIA 4B9WA 3MHXA 2VUBA 4M77E 3OB9A 4ZTJA 4LDWA 2JOYA 3CC4A 5FU6C 3JRZA 4J7IA 2QQAA 1QW1A 2MI6A 3G71T 1N27A 3QG1A 1WJSA 1KHIA 4QVZA 1BYMA 3GLXA 4PJOF 2GF7A 2E6ZA 4PL6A 4C5IA 3TW7A 2KMTA 3OBYA 4KT0E 4M77A 4XU0A 3V8KA 3H6ZA 4XTWA 3VUZA 1X75C 5GAOp 3J81E 4M78C 5LJ3f 3KXTA 2HQXA 2DTHA 3M54A 1XOVA 5EG2A 3X26B 5I2MA 4M7DC 3ME9A 3C4SA 4EMKA 4QW2A 3MCAB 4XU2A 4BB7A 5D6WA 4A54A 5M9OA 2L3RA 1UGPB 5GANg 1KD1C 2CZ0B 3PT9A 2YLBA 2ZPGB 1G3YA 2HNIA 3CBMA 4N4HA 3SWNC 3P8HA 3L2UA 2E41A 3JB9G 1VQ4T 3TREA 1VQNA 4X34A 4QQDA 3UT1A 3CC7A 2QF7A 2RHYA 4C8QD 4EPCA 4MZTA 2PVGB 1JB0E 2GCXA 3TCJA 1VQ8T 4HCCA 3EAEA 5FU6B 3QWLA 1ZBXA 4J83A 5HY6A 4HT8A 4BBSM 3VKGA 1S72A 3HL8A 3META 1VIEA 4FL6A 2EQUA 3JCMJ 4LDVA 3OW2A 3JAME 4XTYA 5GAN3 4M7DE 2E64A 1M1KU 3QYBA 3LLRA 3GNGA 4HNVA 4TVRA 4OGEA 2LC4A 3QXEB 2K3XA 3MP8A 4FSXA 2BKDN 2MMPA 4DQ2A 2YHTA 2DD5B 4ZTFA 1BIBA 1Y96B 2DTOA 4MMKA 4M7DB 1YIJA 3J7AF 1O75A 4JRQA 2PUOB 1KC8U 2P0KA 3L2VA 2K5IA 5CKFA 3J80E 3A8HB 4KBMB 3ZFJA 3CD6A 1U1TA 3CXCA 1VQLA 4L6V5 3SWNB 3CC4T 3CMAA 3WVDB 5LJ5d 2EWNA 2FYKA 3UWNA 3JCMX 4C92C 2CKKA 2H3JA 2RD1A 2RH2A 2EJGA 4PLIA 5AYFA 4C8QG 2FL7A 5CKDA 1SSFA 4PLLA 4OB1B 1W2BS 2KMGA 4MFDA 3C94A 4HLQA 3QJYA 5CKBA 5D6YA 3TEEA 1Q81C 3M5AA 3NTKA 4IUVA 3JCMW 1IZ6A 2ZPEB 2DXCA 3OQ5A 3JCMh 5CK9A 3JCMe 2K4YA 2D9TA 4M75E 3JCMQ 2DIQA 1M8VA 1JRIA 1U1SA 4Z02A 1E7PA 4YTLA 4OP0A 4E47A 1K73U 2EJ9A 3GIBA 5GANj 2QFZA 1UEBA 1WQ7A 4JLIA 1I5LA 3BG9A 1BKBA 3PIPA 2M16A 1PSFA 4F7UF 5FROA 1HK9A 3FRNA 2G77A 4M75A 3AHUA 3HBLA 4BY6B 2LX9A 2RHZA 2B8AA 3CCVA 4BDZA 5CQYA 5LJ3d 5GMKj 1VQNT 3CC7T 3VJPA 2DO3A 1Q86U 1N8RC 4C5GA 2WSEE 1B34B 2QTXA 4RMOA 3OYAA 3OS2A 3QDRB 3WVEB 2HD0A 4X9DA 4F7UA 1S72T 2EQMA 2KSSA 1UGRB 2ZPIB 2WJ9A 2VYTA 4MZMA 4C0ZA 3SDZA 4XTXA 5GAMg 4MZPA 4N4IA 3HFNA 2AHJB 2LNVA 1K8AC 2CS7A 3CCMA 5CKEA 4DOVA 2QA4A 1Q7YU 3QZ5B 3EFSA 3JCMb 4M77C 4R55A 5FLXE 1YIJT 2LCCA 4ATOA 2CZ7B 4BUGA 1N9RA 4IUQA 1NPRA 2EIFA 2X4XA 3BW1A 3ZEHA 1G5VA 1WNLA 3PMIA 4A4KA 2ZPFB 3JCMf 2E12A 5GAN4 4EMKC 5DLOA 4L5GA 1VQLT 3CD6T 5GANe 5GANh 2VXEA 3L2QA 4PJOC 5L8RE 2RI3A 4II1A 3QBYA 3VKHA 5DLQE 1D3BA 1BI3A 5GMKi 2RK1A 4F7UG 3G4SA 3HZJA 2ZZDB 2XICA 2DD4B 4PJOA 2M9UA 1TH7A 1XNIA 3CEYA 3QO3A 5GMKe 2DTIA 5GMKh 3KBGA 3HB9A 3M58A 3MP6A 3LX7A 3ASKA 4N0AA 4N4GA 1K9MC 4RCBA 3E1SA 3QHSA 1JJ2S 2O4XA 3H4CA 2JTFA 3OYIA 3CCQA 3VKIA 3OYKA 1JBMA 2QDYB 4OB0B 5CCAA 3HP9A 2QQBA 3RKXA 4OB2B 4KUIA 1ZQ1A 4M77B 4BI3A 3I56A 3CCVT 4PKCC 5A0GA 1KQ1A 2JZ2A 4PJOE 1YJ9A 2RK2A 4XU1A 1H3ZA 2Y4XA 1FXXA 3FIFA 2CYZB 4Z6YA 5J39A 3LWHA 3S3MA 1VQOA 3X28B 2D0QB 4EMKB 2QQ8A 3M56A 4HT9A 3V7CA 2DJZA 1WJQA 3CPWA 4A4EA 4NC6A 2Y4YA 3KHIA 2HAXA 4PJOB 5HK3A 5IN1A 5GAMj 3HRSA 2EYQA 4C8QF 3HFOA 2NLUA 3BDUA 2V8KA 2M1HA 2CGHA 2DKGA 1WJRA 1VQ5A 2YLCA 2FHDA 2BUDA 2EQKA 4JS4A 4XU3A 1VQKA 1O9SA 3CCMT 5GANf 2QA4T 4A4FA 2ZPBB 3OYFA 3X20B 1YCYA 2RO0A 5FRNA 1M5Q1 3P8DA 4J5YA 4BDYA 2RJFA 3A8MB 3M4YA 4C8QA 1G3SA 3QYGB 3JB9J 4XK8E 3A8OB 2R5MA 4M7AG 4R56A 3EFRA 2LTOA 3HRUA 3V7RA 2LVMA 2R58A 3HRTA 3V8LA 3BDLA 4QQGA 3M57A 2XU8A 3FEOA 3G4ST 4OGCA 4MIMA 3VYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC E;  1PSF A;  3A8G B;  2ZCF B;  1AHJ B;  3X24 B;  3A8L B;  2WSE E;  3QZ9 B;  3LW5 E;  3WVE B;  1UGR B;  2DXC B;  2ZZD A;  2ZPI B;  2DD4 A;  2PU9 B;  2ZPH B;  4ZGE B;  2AHJ B;  4Y28 E;  3VYG B;  4ZGD B;  3QZ5 B;  1DJ7 B;  2CZ7 B;  4FM4 B;  2ZPF B;  4KT0 E;  3VYH B;  1GXI E;  5L8R E;  2DXB A;  2DPP B;  3X26 B;  2ZZD B;  2DD4 B;  2PVD B;  1UGP B;  2DD5 A;  2CZ0 B;  2WSF E;  1QP2 A;  2ZPG B;  1V29 B;  4ZGJ B;  2CZ1 B;  3X25 B;  1QP3 A;  2QDY B;  4OB0 B;  2PVG B;  1JB0 E;  4OB2 B;  2CYZ B;  1UGS B;  2DXB B;  2PVO B;  3X28 B;  3QYH B;  2D0Q B;  3QXE B;  2PUK B;  2CZ6 B;  4OB3 B;  2DD5 B;  4RKU E;  2O01 E;  2PUO B;  1UGQ B;  1IRE B;  3A8H B;  4L6V 5;  2ZPB B;  3X20 B;  3WVD B;  3A8M B;  4OB1 B;  3QYG B;  4XK8 E;  3A8O B;  2ZPE B;  2DXC A;  3HHT B;  1PSE A;  3VYG A; 
#chains in the Genus database with same CATH topology
 1UGV A;  1QVF S;  1YIT A;  2E1H A;  2CT3 A;  1VQP A;  4BAC A;  5LMK B;  4EIK A;  3OY9 A;  3BLR B;  1WDX A;  2IW9 B;  3L2W A;  1JST B;  1Y71 A;  2XKO C;  1IO6 A;  4LD9 K;  2RQT A;  5GAM e;  1I0C A;  1GFD A;  4M78 D;  2DM1 A;  5FU7 C;  1YCS B;  3OYN A;  1AWO A;  1E6H A;  5GMK m;  4M78 A;  2NUP A;  3I55 A;  1VQO T;  2L3Q A;  4BCN B;  3CPW P;  2XDP A;  4JRP A;  5HQ0 B;  1H92 A;  2AKK A;  5KCO A;  3CCU A;  1JJ2 P;  5CO7 A;  4ROD A;  1B3Q A;  1ZX6 A;  1LNX A;  4F7U E;  1C9B A;  1BU2 A;  4FM4 B;  1TSF A;  4NS5 A;  2YT6 A;  2A08 A;  1BB9 A;  2KR6 A;  3DDP B;  2KBT A;  3A5Z B;  1OIU B;  1HJD A;  4M78 G;  3NTH A;  3OYD A;  1N6A A;  1ENW A;  1QKW A;  2C0T A;  3TSW A;  1H1S B;  1QP2 A;  1NLP C;  1M9S A;  1K73 C;  1N5Z A;  2RHU A;  2CUB A;  2GQV A;  2VC8 A;  3DL1 A;  2JM9 A;  4C92 D;  4CFN B;  1AT1 B;  1BCM A;  1WI7 A;  4RUG A;  4F7J B;  4HCZ A;  4C92 A;  4Y91 A;  3QYH B;  2JS2 A;  1NJI U;  3BY7 A;  1YJN T;  4D8K A;  1TU0 B;  1VQ6 A;  3E19 A;  4LXC A;  1YI2 A;  4RKU E;  5HBH B;  3LWI A;  2DAQ A;  1VQL Q;  4J9F A;  4FYV B;  2HL3 A;  3DLL A;  1WHH A;  1FMV A;  2K5L A;  2BS3 A;  1H8K A;  5DQW A;  4CC4 B;  4C8Q C;  4CRI A;  1KJW A;  1KD1 R;  1J3T A;  5CQX A;  2C6T B;  3F70 A;  2PHG A;  3SEM A;  9ATC B;  3ZBD A;  4HNT A;  2RM4 A;  2XI9 A;  2PNI A;  1FMW A;  4C92 G;  2OTL A;  2EJF A;  3CCU Q;  3UA7 A;  3HHT B;  1OYX A;  3S6W A;  3HO8 A;  1M1G A;  3RMQ A;  2KK4 A;  5IT9 E;  3LH5 A;  1WXT A;  3A8G B;  4M77 D;  1ZLM A;  3VS3 A;  1OIY B;  3F5X B;  2DBM A;  2HQE A;  4PFO A;  1VYW B;  4RTT A;  4XAX B;  1URC B;  3QZ9 B;  2EGE A;  1PM3 A;  2QQR A;  4E7I A;  4OVA A;  2QQ9 A;  1SRM A;  3H8Z A;  3SB2 A;  4II5 B;  1ACM B;  2KXD A;  3I5R A;  2ZPH B;  2G3R A;  4FX3 B;  2XG8 D;  5GAM d;  3CCJ T;  1PC0 A;  4JZ3 A;  2RQV A;  4D8D A;  3M03 A;  4RCC A;  2BIV A;  4M6V A;  3I5S A;  1KQ2 A;  1WXB A;  1Q81 R;  4OMM A;  4HKE A;  2DL4 A;  3DLM A;  2OTJ T;  4D6W A;  3CXC S;  4E7K A;  2G9X B;  1KG1 A;  3TU4 K;  5LJ5 j;  2BTT A;  5IDP B;  1V76 A;  4LOC A;  1Z9Q A;  4M77 G;  2KDS A;  3M0S A;  2EFI A;  2QQS A;  3A98 A;  3EH2 A;  3QPH A;  3WXM B;  1UJ0 A;  1VQ6 Q;  1VQ9 A;  4M78 B;  7AT1 B;  5GJV B;  3MP1 A;  2NUP B;  3JB9 H;  1ARK A;  1N8R R;  1IGU A;  2DF6 A;  5BNJ B;  4LUD A;  4M7D A;  4X9C A;  4ZGJ B;  1ZUU A;  3QII A;  3JCM P;  1RI0 A;  3X25 B;  1D0Z A;  2VKN A;  5IHK A;  1MMD A;  5A0D A;  2VV5 A;  4BCJ B;  2I40 B;  1VQO Q;  2OTL Q;  3CC2 A;  1WPY A;  1JOW A;  4JZ4 A;  1MHN A;  2HL5 C;  3FJP A;  2E70 A;  1GY3 B;  2WMB B;  5HBE B;  2FZG B;  4CFM B;  3CME A;  4FT2 A;  1M1F A;  4OB3 B;  5LJ5 e;  4M75 D;  4JRK A;  2RN8 A;  2F2C A;  3QYE A;  1BI0 A;  4J6Y A;  5C6S A;  3B57 A;  4M7A C;  3RES A;  3DDQ B;  1B34 A;  1Q82 C;  2CCI B;  3NFC A;  3OYY A;  2D0N A;  2JTM A;  4C92 B;  4QSH A;  1QVG A;  2LQ8 A;  2DL5 A;  1KQS A;  1NYG A;  1SRL A;  4EOK B;  4M75 G;  3MEW A;  1LJO A;  1UHF A;  1IGQ A;  5CIU A;  3N5B B;  3TN8 B;  3L2R A;  1OX9 A;  1VQ9 Q;  1YJN Q;  1GFC A;  4F16 A;  5A2Q E;  5CR2 A;  2EQJ A;  2FRY A;  2GQI A;  2LT1 A;  2DRM A;  3MEU A;  2ZZD A;  2DLP A;  2DD4 A;  3CPW S;  2WIH B;  3OSS C;  2PU9 B;  4EC8 B;  2WIP B;  1BI2 A;  3UAT A;  4EOJ B;  1VYU A;  2WFY B;  3GF5 A;  4ZTJ A;  3MHX A;  3OB9 A;  4LDW A;  3CC2 Q;  2QQA A;  2MCN A;  1W6X A;  2MI6 A;  3G71 T;  2OJ2 A;  1BYM A;  2E6Z A;  2D8J A;  5EFQ B;  3OBY A;  3CME Q;  4J9I A;  2W2H A;  2X3W D;  4CC2 A;  3QHR B;  2KRS A;  3VS0 A;  1XOV A;  2J06 A;  4E7Z A;  2F2V A;  1QVG P;  4PJO A;  5M9O A;  5D6W A;  5GAN g;  3TNW B;  1KQS P;  4EC9 B;  3SWN C;  3L2U A;  3P8H A;  2RQR A;  1VQ4 T;  2O2O A;  1VQN A;  3UT1 A;  2LQN A;  1M1K R;  1JB0 E;  2GCX A;  4BBS M;  3VKG A;  2KRO A;  3MET A;  1VIE A;  2EQU A;  4RTU A;  3JCM J;  1GCQ C;  3JAM E;  4XTY A;  1IHW A;  2OTJ Q;  1KC8 R;  3LLR A;  3GNG A;  4HNV A;  4TVR A;  2LC4 A;  2MMP A;  4DQ2 A;  4Y72 B;  4ZTF A;  4M7D B;  2DTO A;  1YIJ A;  3L2V A;  1UJY A;  3C0C A;  4CFW B;  2ROL A;  1WYX A;  3WVD B;  1JU5 C;  5LJ5 d;  1PHT A;  5CKD A;  2RD1 A;  1SPK A;  2FPF A;  1OOT A;  5CKB A;  3NTK A;  2LJ0 A;  1H27 B;  2L2P A;  2DXC A;  2W99 A;  1ZSZ A;  5L2W B;  2DIQ A;  5ECA A;  5KYX A;  1U1S A;  3UF4 A;  4RTZ A;  2EJ9 A;  1Q86 R;  1WQ7 A;  1SG5 A;  3FRN A;  2G77 A;  2NYS A;  3TNH B;  4BY6 B;  2LX9 A;  3CCV A;  3CC7 T;  2DO3 A;  2WSE E;  1B34 B;  2QTX A;  4RMO A;  2SEM A;  2YXY A;  3QDR B;  4F7U A;  2KSS A;  3MIA B;  2ZPI B;  2WJ9 A;  4MZM A;  1VQN Q;  2COZ A;  4N4I A;  2HSE B;  2UZD B;  2AHJ B;  1K8A C;  2CS7 A;  4F04 B;  4R55 A;  3M0T A;  2J7I A;  5FLX E;  4ATO A;  1TUC A;  1UTI A;  4F6W B;  2WHB B;  1PD1 A;  2X4X A;  2P84 A;  1NLO C;  2AZS A;  3U23 A;  1OU8 A;  2EYX A;  5GAN h;  1AOJ A;  1BI3 A;  4F7U G;  2ZZD B;  2DD4 B;  1YIJ Q;  2VWF A;  1TH7 A;  1ZUK A;  1D0Y A;  2AK5 A;  5GMK h;  4N0A A;  2HQH A;  3ZL7 C;  1G8X A;  2K3B A;  4CXA B;  3CCQ A;  3OYK A;  1M30 A;  1AD5 A;  2QDY B;  4OB0 B;  3HP9 A;  2QQB A;  2L3P A;  2DYI A;  1RI9 A;  4YOS A;  5A0G A;  2JZ2 A;  2LQW A;  1UG1 A;  2RK2 A;  1YJ9 A;  2LCS A;  3S3M A;  4Z6Y A;  2CYZ B;  2HEQ A;  1K76 A;  1MV3 A;  3DJB A;  1SHF A;  2DJZ A;  2Y4Y A;  4PJO B;  3KHI A;  4C8Q F;  2NLU A;  2CP0 A;  2A28 A;  1G2B A;  2DKG A;  1VQ5 A;  2YWW A;  2CP7 A;  4XU3 A;  4Z8A A;  5GAN f;  3OYF A;  1YCY A;  2RO0 A;  2JMC A;  4J5Y A;  2RJF A;  4CC7 A;  4KGZ B;  2R5M A;  2WPA B;  3M0P A;  1W70 A;  3V7R A;  3V8L A;  4PJL A;  4F6S B;  3G4S T;  3KFV A;  4OGC A;  2J6F A;  2PQW A;  5LL6 S;  2RA2 A;  1YWO A;  4F6U B;  2EVR A;  1ABO A;  4E7H A;  2OI3 A;  1TFB A;  2KR3 A;  2EKO A;  4A63 B;  3A8L B;  3POM A;  4HA8 A;  4HVW A;  2ZGW A;  4ORZ A;  4OF1 A;  2DXC B;  1ZSZ B;  5DQV A;  5KYX B;  2UUE B;  3CCQ Q;  1VA7 A;  3L42 A;  2KI7 A;  2XHC A;  3MY1 B;  2EYW A;  4L59 A;  2C5O B;  1YJ9 Q;  3CCR A;  2ZAE A;  1AWX A;  4KUL A;  1XQH A;  3PTA A;  1CSK A;  1AWJ A;  5FWB A;  2KYM A;  1YBY A;  2GFA A;  4F7U B;  1W2B A;  4E7J A;  2DPP B;  8AT1 B;  4LDY A;  4Z89 A;  2KT8 A;  1K8A U;  3INZ A;  3BG3 A;  4QVD A;  4GY5 A;  3OYB A;  3CC7 Q;  4JUV A;  4NL3 A;  3P8B B;  2IN3 A;  4HNU A;  1NM7 A;  4FSS A;  1YIT T;  1UHC A;  4JJN K;  1VQP T;  1AZG B;  5KYY A;  5IDN B;  1JQQ A;  1W1F A;  3M53 A;  2CJM B;  1NJI R;  2YSQ A;  4IKF A;  3CCE A;  2ED0 A;  3BFM A;  3MY5 B;  4AKI A;  2J05 A;  2CH4 W;  2QK0 A;  1TD6 A;  5KH6 A;  1M2O A;  2X4J A;  2XD0 A;  2F69 A;  2LQK A;  1M90 C;  3I55 T;  2LRQ A;  1TG0 A;  3I35 A;  3TVT A;  3SD4 A;  3CMA Q;  2GTJ A;  4M7A F;  3S3O A;  3TW6 A;  5HK0 A;  4X1V A;  4QT7 A;  3CCU T;  2KQW A;  3HSB A;  4BCQ D;  2DK3 A;  1QCN A;  3EJ1 B;  3NTI A;  4AFZ C;  4V2S A;  1R0B G;  5GMK l;  1F5Q B;  4KH1 B;  3LH0 A;  4AI6 A;  1MNE A;  4EOS B;  4IUT A;  2RQU A;  1W2B P;  5CEI B;  1VOM A;  5KYW A;  4J7F A;  4ROC A;  2KAF A;  1W4S A;  4EMG A;  2CP5 A;  3CCR Q;  3RKY A;  1KFZ A;  1D0X A;  3REA B;  1WQW A;  2BPM B;  1JJ2 A;  3JB9 I;  2V1Q A;  5LJ3 g;  2W9Z A;  1WLP B;  4CFU D;  1WXU A;  5I21 A;  4JJD A;  2F1L A;  2FPD A;  5DY9 A;  2G6F X;  3EG2 A;  4BI4 A;  2E6N A;  2DMO A;  2YRV A;  1X69 A;  1Y07 A;  1SSH A;  1WHK A;  2EKH A;  2A7Y A;  4Y28 E;  4M4Z A;  4WF2 A;  1VQ6 T;  3JCM V;  3CCE Q;  2DER A;  1YI2 T;  4MDW A;  3HKS A;  2FZC B;  5FWC A;  4BCM D;  3H0F A;  2WAC A;  2JN0 A;  3MJX A;  2R5A A;  2FZK B;  3G4S Q;  5GAO l;  2C06 A;  4IIM A;  3MEA A;  4JLG A;  3REB B;  1MMA A;  3OYH A;  2V8I A;  1U3O A;  4LN2 A;  2OTL T;  2VXF A;  2WSF E;  5KE3 A;  2LCL A;  1H4L D;  1NPP A;  2P4R A;  3RMS A;  4FU6 A;  4CFV B;  2QI2 A;  2NUZ A;  2UZB B;  2LDM A;  3H9N A;  2O31 A;  1JXM A;  4C0D B;  3EG1 A;  2DL8 A;  4J9E A;  2HKQ B;  4AT1 B;  2CZ6 B;  5KCH A;  2DZ9 A;  3ER0 A;  3JSC A;  1PG5 B;  2VB6 A;  2J6O A;  1G3N C;  3EGU A;  1IRE B;  1OL2 B;  6AT1 B;  1PKS A;  1UUE A;  1HSQ A;  3GOX A;  2R7G A;  5KYY B;  1M3B A;  2VGM A;  1ZA1 B;  4JPB W;  2DIG A;  1NZ9 A;  1YNZ A;  1E7O A;  1M90 U;  5GAO m;  1YIT Q;  3Q1J A;  3C95 A;  2RPN A;  1VQP Q;  5LJ3 h;  1VQ9 T;  2DET A;  1K0S A;  5DM7 R;  3OYM A;  4C0G A;  1Q95 G;  4YC3 B;  3OS1 A;  2SRC A;  2K7A A;  1GBR A;  4XQ3 A;  1VQ8 A;  4DA4 A;  3PO3 S;  4OMO A;  2F5T X;  2DXU A;  2A36 A;  5I5Z B;  1Q7Y C;  4FT4 A;  4J6W A;  2XDD A;  1M2V A;  2PK9 B;  1JSU B;  3JB9 F;  3I55 Q;  4BCQ B;  1UDL A;  3CC2 T;  3LW5 E;  3EHR A;  2MK5 A;  1M4Z A;  1PRM C;  5KYW B;  2K6D A;  2HKN A;  4JS5 A;  5D6X A;  1OL1 B;  3M4G A;  3CME T;  4ME7 A;  3RER A;  1ZHI A;  2QGS A;  1KSW A;  2I0N A;  3CC4 A;  3I9Q A;  1QW1 A;  3QG1 A;  1WJS A;  1KHI A;  4QVZ A;  3GLX A;  4UN0 A;  2J6K A;  3TW7 A;  2KMT A;  4KT0 E;  4M77 A;  4AMC A;  4XTW A;  1NYF A;  5LJ3 f;  1QWE A;  2PK2 A;  3X26 B;  5I2M A;  1S1N A;  4M7D C;  4EMK A;  2X51 A;  2CT4 A;  2ROT A;  1KD1 C;  4A54 A;  2CZ0 B;  3EH1 A;  5IF1 B;  3PT9 A;  2YLB A;  2FEI A;  2DYB A;  1LCK A;  2QF7 A;  4F70 B;  2RHY A;  4C8Q D;  2PVG B;  1ZUY A;  1MMG A;  1ZBX A;  4HT8 A;  1S72 A;  4LDV A;  5GAN 3;  3M0R A;  2E64 A;  2LP5 A;  3NPF A;  1YI2 Q;  4OGE A;  1HD3 A;  1XO2 A;  1Z9Z A;  1OU9 A;  1M3C A;  2BKD N;  1VQ8 Q;  4OGR B;  2CH4 A;  1H1Q B;  4MMK A;  3J7A F;  2QTV A;  1MND A;  2P0K A;  5IXB A;  2K5I A;  3PVQ A;  3CD6 A;  1U1T A;  2EYZ A;  4L6V 5;  1E9H B;  2FYK A;  3JCM X;  2WEV B;  5AYF A;  4PLI A;  4C8Q G;  3H0I A;  1YWP A;  2DL7 A;  5AT1 B;  1W2B S;  2KMG A;  3TEE A;  1Q81 C;  2EQI A;  2X1N B;  1RAI B;  2CUD A;  3JCM e;  3JCM Q;  3CC4 Q;  4RTX A;  1E7P A;  4YTL A;  1K73 U;  3GIB A;  2W10 A;  1UEB A;  1BKB A;  1OGU B;  3PIP A;  5FRO A;  4M75 A;  1YP5 A;  2RHZ A;  3BHV B;  5CQY A;  1VQN T;  1IRX A;  3EGX A;  1N8R C;  2E3H A;  1VYT A;  3OS2 A;  4X9D A;  1UGR B;  1R0C B;  1TTH B;  3SDZ A;  5GAM g;  1X6B A;  3HFN A;  2LNV A;  3CCM A;  4DOV A;  1AIS B;  2QA4 A;  1Q7Y U;  1AVZ C;  3QZ5 B;  2W9F A;  1WHG A;  3EFS A;  1YIJ T;  3VS7 A;  1G5V A;  1WNL A;  1M2V B;  3PMI A;  2E12 A;  4J9D A;  3L2Q A;  4PJO C;  5L8R E;  4II1 A;  3VKH A;  5GMK i;  1D3B A;  2RK1 A;  3AT1 B;  3HZJ A;  3EGD A;  2M9U A;  1UNL D;  3M58 A;  3MP6 A;  1OI9 B;  1K9M C;  4RCB A;  3E1S A;  2AZV A;  1JJ2 S;  2YDL A;  3H4C A;  2FO0 A;  3OYI A;  1JBM A;  4BXX X;  3EOC B;  1PKD B;  2JW4 A;  4M77 B;  3I56 A;  1H1P B;  3CCV T;  4PKC C;  1SKU B;  1KQ1 A;  4XU1 A;  2Y4X A;  4EOO B;  3X28 B;  2D0Q B;  4EMK B;  1X2K A;  2KEA A;  4F7N B;  4HT9 A;  1WJQ A;  1YN8 A;  1QMC A;  4E2F B;  2ECZ A;  5HK3 A;  4CC3 A;  3HRS A;  2CGH A;  1WJR A;  5HNB B;  2EQK A;  1ZA2 B;  4JS4 A;  1VQK A;  3H0H A;  1E6G A;  2KT1 A;  4A4F A;  2UZE B;  4EOI B;  4HXJ A;  4PJN A;  3A8M B;  3M4Y A;  4KGX B;  4XK8 E;  4M7A G;  4R56 A;  3EFR A;  3CCM Q;  1NEG A;  2I53 A;  2QA4 Q;  2C5X B;  2CRE A;  2XU8 A;  1WFW A;  3CCL A;  1SF9 A;  2QAZ A;  2BS2 A;  4ZN3 A;  4EDU A;  3GPL A;  1QCO A;  4M78 F;  3BG5 A;  3JCM d;  3BLQ B;  2QEX A;  3CCQ T;  3OMC A;  2KY9 A;  4GLM A;  4GBQ A;  5GAM h;  5J3B A;  4MDX A;  4JX4 A;  2GFU A;  2FPE A;  1I8F A;  1KHC A;  2A3L A;  1YJ9 T;  2QXF A;  1T0J A;  1G3T A;  1M1K C;  3MPU B;  3EG9 A;  3QKJ A;  5LQF B;  1QVF A;  2LT4 A;  1SHG A;  2EAY A;  4M75 B;  2VVK A;  3NMZ C;  4HVV A;  1YHQ A;  1Q82 U;  1RAF B;  3OMG A;  2C4G B;  1K8A R;  3EGX B;  3RNJ A;  2VGN A;  2HSP A;  4BCK B;  1U06 A;  2XK0 A;  2DXB A;  1WIE A;  3GBQ A;  2IIM A;  4KRD B;  2M0Y A;  5D7U A;  4BD3 A;  3ULR B;  1LOJ A;  1VQK Q;  1FKM A;  2DXT A;  2COY A;  1QKX A;  1VQ7 A;  1V29 B;  3OYE A;  5GAO n;  1YJW A;  4C92 F;  5GAM f;  1IB8 A;  3OA6 A;  3E9F A;  3EG3 A;  4F17 A;  4BY1 X;  3E9G A;  3EHQ A;  4ZN1 A;  1UNG D;  3EID B;  1Q86 C;  3CMA T;  1PRL C;  1D3B B;  1K9M U;  1IHV A;  2EGA A;  3EGD B;  5GAN 8;  2E4H A;  1H28 B;  4WCI A;  2PUK B;  4EOR B;  4EOM B;  2BZX A;  5EC7 A;  3QJ6 A;  3RBB B;  5I11 A;  3G7Z A;  2QEX Q;  1QVF P;  1UGQ B;  3G33 B;  2RB6 A;  1VQM A;  2FRW A;  4AKH A;  1RAD B;  4E7L A;  5LJ5 g;  2LJ1 A;  2JXB A;  3CCR T;  1VIF A;  1K9A A;  1FIN B;  1TWB A;  3MI9 B;  3GP8 A;  2Z0W A;  4LE9 A;  4RG2 A;  1T3L A;  3TNI B;  3GNF B;  4EOL B;  1MV0 B;  3PIO A;  4OMF B;  2EGC A;  3MO8 A;  2L5Q A;  3CCV Q;  1RUW A;  4BE2 A;  3PMT A;  2JUF A;  4C8Q E;  3O8V A;  2HBP A;  3OYJ A;  2GGR A;  2HZY A;  3X24 B;  1GRI A;  1NG2 A;  2D6F A;  2DZC A;  4BE0 A;  2E5K A;  2LX7 A;  3HPW A;  3CCE T;  2RI2 A;  2I2L A;  3SFM A;  3FLG A;  1X2Q A;  4QVC A;  1UFF A;  2P0Q A;  3PFS A;  3CCS A;  1K0X A;  2IG0 A;  1DJ7 B;  4UC4 A;  3RIR A;  1BI1 A;  1FX7 A;  4WTO B;  3G6E A;  1D1A A;  5HVY B;  2DE0 X;  4XTU A;  4C0D C;  4M7D F;  1JEG A;  3VYH B;  4DOW A;  1I4K 1;  1B07 A;  2V8J A;  2QGG A;  3DKM A;  2HBW A;  1QVP A;  2B86 A;  1I1J A;  2RHX A;  3QWY A;  2E3I A;  1OZ2 A;  2X4W A;  1VQM Q;  1H25 B;  2CP3 A;  3EG9 B;  1Y96 A;  1BIA A;  3LQ5 B;  2CZ1 B;  2QDJ A;  1EZZ B;  1T0H A;  3M0U A;  5KYU A;  2DBK A;  1MGQ A;  3FB9 A;  3OYL A;  4M75 F;  1UGS B;  2DXB B;  4AKG A;  4HL4 A;  2A0F B;  3DB3 A;  5HBJ B;  1QVG S;  3R6O A;  4PK4 A;  1KQS S;  4A4H A;  1BK2 A;  1VQ5 Q;  5LJ5 h;  2WXV B;  1H64 1;  2EBP A;  1WGS A;  2RNA A;  2K5F A;  3S3N A;  2X4Y A;  4PJM A;  2EUF A;  4C0F A;  2OAU A;  4A4G A;  1M90 R;  1EIF A;  4JRI A;  1AWW A;  3V7S A;  2IW8 B;  4MFE A;  3HTR A;  4XTV A;  4RTV A;  3BHU B;  1R8O B;  5CKH A;  3RGF B;  2GBQ A;  2JMA A;  1X01 A;  4BY7 X;  4JDS A;  2EW3 A;  2LW4 A;  3T9N A;  2X35 A;  2KE9 A;  3G6E Q;  4BI8 B;  5GAO r;  2MWO A;  1MUZ A;  3OBW A;  4C5H A;  4ELJ A;  5FRM A;  1K4U S;  4M7A E;  2YUN A;  2ED1 A;  1WX6 A;  3QDF A;  3LGF A;  3OS5 A;  5LJ5 f;  1I5O B;  1X27 A;  4A53 A;  3QSU A;  5HKC A;  2JM8 A;  3OYC A;  2ATC B;  2MIO A;  3LYI A;  1NJI C;  2MOX A;  1FYN A;  2JOY A;  3JRZ A;  3GTM S;  1C1A A;  3JV3 A;  4AG2 C;  4FYX B;  2JJ9 A;  4PJO F;  4OMN A;  1TUG B;  4C5I A;  4RTY A;  3V8K A;  4F14 A;  3H6Z A;  1X75 C;  3J81 E;  4M78 C;  3KXT A;  2DEU A;  2HQX A;  2DTH A;  3M54 A;  4OMP A;  5EG2 A;  2CCH B;  4QW2 A;  4EOP B;  4J9G A;  2C5N B;  1B7T A;  4XU2 A;  4BB7 A;  2L3R A;  1UGP B;  2ZPG B;  1G3Y A;  2HNI A;  3CBM A;  4N4H A;  2E41 A;  4X34 A;  4QQD A;  4EPC A;  3TCJ A;  1VQ8 T;  4HCC A;  5FU6 B;  3QWL A;  1AEY A;  3OW2 A;  2ESW A;  5IXF A;  3NDQ A;  3QYB A;  1CKA A;  1UEC A;  2K3X A;  3MP8 A;  4FSX A;  2YHT A;  2OX7 A;  1Y96 B;  1O75 A;  4JRQ A;  1I07 A;  1Y0M A;  3NHN A;  4AG1 C;  3J80 E;  4KBM B;  1H26 B;  3ZFJ A;  1VQL A;  3CC4 T;  1VOL A;  4C92 C;  2RH2 A;  5KYU B;  2EJG A;  2W96 A;  1K73 R;  2NUT A;  1SSF A;  4PLL A;  2D8H A;  5D6Y A;  4IUV A;  1IZ6 A;  2EYY A;  2ZPE B;  4EOQ B;  5CK9 A;  2DL3 A;  2K4Y A;  1JRI A;  4Z02 A;  4OP0 A;  4E47 A;  5FGK B;  5GAN j;  4JLI A;  1I5L A;  5I22 A;  2M16 A;  1PSF A;  2DX1 A;  4F7U F;  3AHU A;  3HBL A;  4CFX B;  1WHL A;  5GMK j;  4C5G A;  4PJJ A;  1ABQ A;  3DTO A;  2HCK A;  3PE0 A;  3WVE B;  5IH2 A;  3OW2 P;  3R6N A;  2HD0 A;  1S72 T;  2EQM A;  1Q7Y R;  2VYT A;  4C0Z A;  4MZP A;  1GH6 B;  1R77 A;  4F7L B;  5KYN A;  5CKE A;  4BCP B;  4FYW B;  4M77 C;  4J9B A;  2QYZ A;  2QAS A;  2LCC A;  2CZ7 B;  4BUG A;  1N9R A;  4IUQ A;  1NPR A;  2EIF A;  2KGT A;  3ZEH A;  2C0O A;  3CD6 T;  2ZPF B;  4EMK C;  5DLO A;  1QQJ A;  4L5G A;  5GAN e;  4K11 A;  2RI3 A;  5DLQ E;  2K2M A;  3DOG B;  1XNI A;  3QO3 A;  5GMK e;  3KBG A;  4N4G A;  3QHS A;  2O4X A;  1BBZ A;  4LUE A;  2YRD A;  3VKI A;  1W98 B;  2JTE A;  5CCA A;  1EFN A;  4OB2 B;  4AFU C;  4KUI A;  1ZQ1 A;  4CFU B;  1H3Z A;  1ZBJ A;  1FXX A;  3FIF A;  3LWH A;  1VQO A;  1BCO A;  2GNC A;  3V7C A;  1OUL A;  4NC6 A;  5CYI B;  2V22 B;  2EYQ A;  2DME A;  1OV3 A;  3BDU A;  1OEB A;  1T3S A;  1ZP2 A;  1XJW B;  2M1H A;  3TQ7 P;  4BCO B;  3CCM T;  2QA4 T;  2CSI A;  2ZPB B;  3THK A;  5FRN A;  1JXO A;  3P8D A;  3UA6 A;  2W0Z A;  4IMY B;  1IXD A;  4C8Q A;  4KGV B;  1G3S A;  3QYG B;  4BCM B;  5IHI A;  2LVM A;  2R58 A;  4BCG B;  2HDA A;  3M57 A;  4B9X A;  4M75 C;  1KIK A;  4Z88 A;  3VYG A;  4A4K A;  5C0M A;  2RJE A;  2D1X A;  4BY6 C;  2E5Q A;  2JNG A;  4Q5W A;  1AD6 A;  1WHJ A;  1M8M A;  2CP2 A;  2M02 A;  4E6R A;  1QMZ B;  1UB4 A;  2RJC A;  2VAS A;  4PFP A;  2PJQ A;  1X6O A;  4MML A;  2NUT B;  3I56 T;  1YJN A;  2KVQ G;  4NST B;  4M7D D;  4CI0 C;  1RAH B;  3M55 A;  3FC3 A;  1Q82 R;  2WMA B;  4JX5 A;  1FVV B;  3OSV A;  5GAN 5;  1KXU A;  2IVX A;  4OMQ A;  3BLH B;  1I81 A;  2YRC A;  4HCB A;  3FDR A;  5KE2 A;  3VRY A;  3VS6 A;  3H41 A;  1QLB A;  4FIB A;  3C12 A;  1VQK T;  3QWX X;  1WA7 A;  3K7A M;  1QWF A;  5J26 A;  4BBR M;  2XID A;  2H3E B;  1N4M A;  1OPK A;  3LGL A;  4FW2 A;  5FU7 B;  3VRZ A;  2DIL A;  4HCK A;  1LVK A;  5IHY A;  2K3Y A;  4M7D G;  5GAN d;  3CBP A;  3CCL T;  2MF2 A;  2KRM A;  1QP3 A;  1G3W A;  1S72 Q;  1K9M R;  2KXC A;  1RAG B;  2BE9 B;  4J9H A;  5GAN 2;  2E65 A;  2O88 A;  4P5N A;  2BS4 A;  5GAN 6;  4E7S A;  4BCH B;  4ELZ C;  1VYV A;  2QEX T;  1RAB B;  4KH0 B;  4YOZ A;  3PVL A;  3CCJ A;  1U5S A;  1U8R A;  3VS5 A;  4BCF B;  1RL2 A;  5I2S A;  4LDU A;  2DA9 A;  5A0L A;  4FCY A;  2MPX C;  5IHN A;  2OTJ A;  4B6M A;  4AFS C;  3CD6 Q;  2O4X B;  1GBQ A;  1GL5 A;  4KRC B;  1PNJ A;  3VUB A;  2JT4 A;  3URG A;  3MKD A;  4M7A D;  2Y90 A;  1YHQ T;  2IW6 B;  5CAI A;  1AZE A;  2DJQ A;  4M7A A;  1KD1 U;  3V8J A;  3UPU A;  4CRL B;  3QHW B;  4J8O A;  3KUF A;  1OZ3 A;  4LD6 A;  1H3H A;  2KYB A;  3L2Z A;  4J6X A;  4DBR A;  5CVI A;  2WSC E;  3CPF A;  3O0G D;  5GAO q;  3EFO A;  2H8H A;  1VQ7 T;  3M9Q A;  2MYS A;  1YJW T;  4O6J A;  3JCM c;  1PD0 A;  2FVU A;  4C8Q B;  4O5V A;  2DEQ A;  3OW2 S;  1ZSZ C;  1P92 A;  2F5K A;  2K2V A;  4PJO D;  3OYG A;  4TTH A;  4IIO A;  4DBQ A;  4BCI B;  2XDB A;  5EJC A;  1Y7X A;  1PWT A;  2IVW A;  3VYG B;  4ZGD B;  3CBO A;  2L89 A;  3VU3 C;  1ZSG A;  3VS4 A;  3RKW A;  2PTK A;  1VQM T;  4M78 E;  5FW9 A;  4PNO A;  3CCJ Q;  1Q81 U;  2FB7 A;  2JVV A;  4BE1 A;  3MEV A;  1GXI E;  1X6G A;  1LPL A;  3QUI A;  2JS0 A;  2DVE A;  2PVD B;  4PJO G;  2K79 A;  4IUP A;  4ELY C;  2MAM A;  2DD5 A;  2NWM A;  1NE8 A;  2DVJ A;  2X3X D;  2YUQ A;  4JX6 A;  2P0P A;  3DB4 A;  3I56 Q;  1JKW A;  1N8R U;  5LJ3 j;  5GAN 7;  3SWN A;  3VV0 A;  1KC8 C;  1VQ5 T;  5GJW B;  4LDX A;  4RTW A;  2L8D A;  1NEB A;  2O9S A;  2PVO B;  4N0A C;  2O9V A;  4NL2 A;  1UE9 A;  1VUB A;  1GCQ A;  4GLK A;  1QCF A;  4OML A;  3VS2 A;  1N9S A;  2ABL A;  4KUD K;  1OI1 A;  2RJD A;  4VUB A;  3RUX A;  2O01 E;  2M0O A;  3G71 A;  1M3A A;  4EMH A;  4AFQ C;  1HXD A;  3CCS T;  3L1A A;  2P4T A;  1GCP A;  4C92 E;  2MWP A;  4G6L B;  2IPO B;  1OX8 A;  3O5Z A;  5IAY A;  2RI5 A;  1XTD A;  3G6E T;  2BZ8 A;  1TXQ A;  2XMF A;  3CQT A;  3CCL Q;  1JO8 A;  4YOO A;  2L3S A;  3BHT B;  2K57 A;  5LJ3 e;  1RLP C;  2E10 A;  1VQ4 A;  1C6V X;  3UDC A;  1GUX A;  1PSE A;  1X43 A;  3PNW C;  1WHM A;  3JCM g;  2RHI A;  2R57 A;  4J9C A;  2ZCF B;  2RMO A;  1AHJ B;  3OS0 A;  4RG8 A;  4QQ6 A;  4ELL A;  4C5E A;  3PGG A;  3M59 A;  1QLY A;  4M7A B;  1FWZ A;  4IUU A;  1UNH D;  1WZO A;  4XTZ A;  3RDV A;  4NOY A;  3JB9 D;  4IUR A;  4ZGE B;  4M77 F;  3RR6 A;  2DFU A;  4QKU A;  4B9W A;  2VUB A;  4M77 E;  1YHQ Q;  2YUO A;  5FU6 C;  4J7I A;  1O9K A;  1Y57 A;  2LJ3 A;  3EFO B;  1N27 A;  3IQL A;  1BU1 A;  1TS9 A;  1H1R B;  2GF7 A;  3TSZ A;  4PL6 A;  4XU0 A;  3EG0 A;  3VUZ A;  1V1C A;  5GAO p;  1M27 C;  4OR5 B;  2BZY A;  2LNH B;  3C4S A;  3ME9 A;  3G71 Q;  1D1C A;  1VQ7 Q;  1YJW Q;  4F7S B;  3MCA B;  1G83 A;  3D7S B;  2DNU A;  2CDT A;  2UZL B;  3JB9 G;  3TRE A;  3CC7 A;  5L23 A;  1MMN A;  2JGZ B;  4MZT A;  2RF0 A;  3EAE A;  2CP6 A;  2BE7 D;  4J83 A;  4DBH A;  5HY6 A;  3HL8 A;  4FL6 A;  2AIR B;  4FYY B;  1VQ4 Q;  2OAW A;  4M7D E;  1M1K U;  4I3Z B;  3QXE B;  2DD5 B;  1BIB A;  2PUO B;  1KC8 U;  5HCK A;  1OQK A;  2KNB B;  5CKF A;  1A0N B;  3A8H B;  2KRN A;  3CXC A;  3SWN B;  3CMA A;  4JJC A;  3VS1 A;  1KK7 A;  2EWN A;  3UWN A;  1OPL A;  4JJB A;  2CKK A;  2H3J A;  2L0A A;  5ICP B;  2FL7 A;  2V26 A;  4OB1 B;  5ACB A;  2PZ1 A;  4MFD A;  3C94 A;  4HLQ A;  3QJY A;  4BCN D;  3M5A A;  3JCM W;  3OQ5 A;  3JCM h;  2A37 A;  2PMI B;  2D9T A;  4M75 E;  1M8V A;  4ZNX A;  1F1B B;  4FW1 A;  3A1P A;  2V1R A;  2QFZ A;  3BG9 A;  4EON B;  4Y92 A;  1HK9 A;  4BDZ A;  2B8A A;  5LJ3 d;  3VJP A;  1RAC B;  1Q86 U;  4ANJ A;  2YUP A;  4KRT A;  2ENM A;  2F2X A;  3OYA A;  1RAA B;  4ESR A;  2C5V B;  2COW A;  1TUD A;  2F2W A;  3CCS Q;  2BKZ B;  4XTX A;  4DEY A;  2LMJ A;  1GUX B;  2AKL A;  1RLQ C;  2EPD A;  3JCM b;  2FG0 A;  2QGF B;  3CXC P;  2DRK A;  1HYO A;  3BW1 A;  2GTO A;  5GAN 4;  2HMA A;  3G1J A;  3JCM f;  1VQL T;  4ROE A;  2VXE A;  2B9R A;  2M51 A;  3QBY A;  3E2U A;  2XIC A;  1H24 B;  1EX4 A;  3G4S A;  1NBE B;  1SEM A;  3CEY A;  2DTI A;  1CKB A;  3HB9 A;  3LX7 A;  1C0M A;  3ASK A;  1D1B A;  4R0K A;  2X9H A;  1P5E B;  2JTF A;  1O9K B;  2C0I A;  4DBF A;  4HVU A;  1PKT A;  4DEX A;  3RKX A;  1YFN A;  2AT1 B;  4BI3 A;  2LZ6 B;  1OKW B;  4PJO E;  5J39 A;  4LNP A;  1D3U B;  1VIN A;  2RQW A;  2QQ8 A;  3M56 A;  3CPW A;  4A4E A;  2HAX A;  3SHW A;  5IN1 A;  5GAM j;  1K1Z A;  3HFO A;  1RAE B;  8ATC B;  1FMK A;  2V8K A;  3BE3 A;  2QG9 B;  2YLC A;  2FHD A;  2BUD A;  1O9S A;  3X20 B;  2QDL A;  3M0Q A;  1M5Q 1;  2K9G A;  4BDY A;  1TOV A;  1OKV B;  2CSQ A;  3JB9 J;  3A8O B;  2LTO A;  1D09 B;  3HRU A;  3HRT A;  3BDL A;  4QQG A;  3FJ5 A;  4PFZ A;  3FEO A;  3NGP A;  1PCX A;  4MIM A; 
#chains in the Genus database with same CATH homology
 2PQW A;  3CCL A;  1QVF S;  5LL6 S;  2RA2 A;  2BS2 A;  2RJE A;  4ZN3 A;  2E1H A;  1YIT A;  4BY6 C;  1VQP A;  4BAC A;  2E5Q A;  2JNG A;  4Q5W A;  4EDU A;  3OY9 A;  3GPL A;  4M78 F;  4E7H A;  3BG5 A;  3JCM d;  3L2W A;  2QEX A;  3CCQ T;  1UB4 A;  1Y71 A;  2EKO A;  2RJC A;  2KY9 A;  2XKO C;  1X6O A;  3A8L B;  3OMC A;  4LD9 K;  4MML A;  5GAM e;  5GAM h;  5J3B A;  4M78 D;  4HA8 A;  4MDX A;  5FU7 C;  2ZGW A;  3I56 T;  4JX4 A;  4OF1 A;  3OYN A;  2GFU A;  1YJN A;  2KVQ G;  1I8F A;  1KHC A;  2A3L A;  2DXC B;  4M78 A;  5GMK m;  1YJ9 T;  4CI0 C;  4M7D D;  2QXF A;  3I55 A;  1VQO T;  1G3T A;  3M55 A;  3FC3 A;  1M1K C;  2XDP A;  4JRP A;  3QKJ A;  4JX5 A;  3L42 A;  1QVF A;  2LT4 A;  2EAY A;  3OSV A;  5KCO A;  5GAN 5;  3CCU A;  2XHC A;  1I81 A;  5CO7 A;  4L59 A;  4M75 B;  4HCB A;  3FDR A;  5KE2 A;  3CCR A;  1YHQ A;  1Q82 U;  1LNX A;  3OMG A;  4F7U E;  4FIB A;  1QLB A;  3C12 A;  4KUL A;  4FM4 B;  1VQK T;  2VGN A;  4NS5 A;  5J26 A;  4BBR M;  1XQH A;  2KR6 A;  2XID A;  3PTA A;  2XK0 A;  1YBY A;  2DXB A;  2GFA A;  3A5Z B;  4F7U B;  2DPP B;  4E7J A;  1W2B A;  3LGL A;  4LDY A;  4M78 G;  3NTH A;  1K8A U;  3INZ A;  3OYD A;  3BG3 A;  4BD3 A;  4QVD A;  1N6A A;  5FU7 B;  1LOJ A;  4GY5 A;  3OYB A;  1FKM A;  2DXT A;  2K3Y A;  4JUV A;  4NL3 A;  4M7D G;  3P8B B;  1QP2 A;  5GAN d;  1VQ7 A;  1V29 B;  1M9S A;  3OYE A;  5GAO n;  4HNU A;  1YJW A;  3CBP A;  4C92 F;  1K73 C;  3CCL T;  5GAM f;  2RHU A;  2MF2 A;  1YIT T;  1QP3 A;  1G3W A;  2GQV A;  3E9F A;  2VC8 A;  3OA6 A;  4JJN K;  1VQP T;  5GAN 2;  2E65 A;  4P5N A;  2BS4 A;  5GAN 6;  3M53 A;  4IKF A;  3DL1 A;  3E9G A;  4C92 D;  4ELZ C;  4ZN1 A;  3CCE A;  3BFM A;  2QEX T;  4AKI A;  1Q86 C;  3CMA T;  1D3B B;  4HCZ A;  4C92 A;  4Y91 A;  1K9M U;  3QYH B;  5GAN 8;  3CCJ A;  1U8R A;  5KH6 A;  1NJI U;  1RL2 A;  2X4J A;  3BY7 A;  5I2S A;  1YJN T;  4LDU A;  2PUK B;  5A0L A;  1VQ6 A;  3E19 A;  2XD0 A;  2OTJ A;  2F69 A;  2LQK A;  1M90 C;  3I55 T;  3QJ6 A;  1YI2 A;  4RKU E;  2LRQ A;  3LWI A;  2DAQ A;  2O4X B;  3G7Z A;  3SD4 A;  4M7A F;  1UGQ B;  3S3O A;  3TW6 A;  2RB6 A;  1VQM A;  5HK0 A;  3DLL A;  4AKH A;  4E7L A;  2K5L A;  4B9X A;  2BS3 A;  4C8Q C;  4CRI A;  5LJ5 g;  3CCU T;  3VUB A;  2KQW A;  3URG A;  3HSB A;  5CQX A;  2DK3 A;  3F70 A;  5C0M A;  3CCR T;  1VIF A;  4M7A D;  2Y90 A;  3NTI A;  3ZBD A;  4HNT A;  2RM4 A;  1YHQ T;  4V2S A;  5CAI A;  2XI9 A;  5GMK l;  3LH0 A;  4M7A A;  4AI6 A;  1KD1 U;  4IUT A;  4C92 G;  2OTL A;  2EJF A;  3GP8 A;  3V8J A;  3UPU A;  4RG2 A;  4J7F A;  3HHT B;  1OYX A;  1W4S A;  2KAF A;  3GNF B;  4EMG A;  3S6W A;  3PIO A;  2D6F A;  1M1G A;  3HO8 A;  3KUF A;  1OZ3 A;  4J8O A;  4OMF B;  2KK4 A;  3MO8 A;  4LD6 A;  3RKY A;  2L5Q A;  3RMQ A;  5IT9 E;  3L2Z A;  4J6X A;  4BE2 A;  3PMT A;  5CVI A;  1WQW A;  2WSC E;  3CPF A;  1JJ2 A;  2JUF A;  3JB9 I;  4C8Q E;  3A8G B;  3O8V A;  4M77 D;  5LJ3 g;  5GAO q;  2HBP A;  1VQ7 T;  3M9Q A;  1YJW T;  3OYJ A;  4O6J A;  2HQE A;  5I21 A;  3JCM c;  4XAX B;  3X24 B;  2FVU A;  4C8Q B;  4O5V A;  2DEQ A;  3QZ9 B;  5DY9 A;  3OW2 S;  2DZC A;  4BE0 A;  2F5K A;  1P92 A;  2K2V A;  2QQR A;  3HPW A;  4E7I A;  4PJO D;  4BI4 A;  4OVA A;  3OYG A;  3CCE T;  2E6N A;  2RI2 A;  2QQ9 A;  2YRV A;  2I2L A;  3H8Z A;  3SB2 A;  3SFM A;  3FLG A;  1Y07 A;  2XDB A;  5EJC A;  2ZPH B;  4QVC A;  2G3R A;  2A7Y A;  1Y7X A;  2XG8 D;  5GAM d;  2IVW A;  2P0Q A;  3VYG B;  4Y28 E;  4ZGD B;  3CBO A;  2L89 A;  3PFS A;  3CCJ T;  3CCS A;  4RCC A;  2BIV A;  4M6V A;  1KQ2 A;  4WF2 A;  4HKE A;  2IG0 A;  1VQ6 T;  3VU3 C;  2OTJ T;  3DLM A;  3JCM V;  1DJ7 B;  4D6W A;  4UC4 A;  1YI2 T;  4MDW A;  3CXC S;  3HKS A;  4E7K A;  1KG1 A;  3RIR A;  3RKW A;  3TU4 K;  1BI1 A;  1FX7 A;  5LJ5 j;  3G6E A;  2WAC A;  1VQM T;  4M78 E;  2JN0 A;  4PNO A;  4LOC A;  4M77 G;  2R5A A;  2KDS A;  4XTU A;  4C0D C;  2EFI A;  1Q81 U;  4M7D F;  3VYH B;  2FB7 A;  2QQS A;  4DOW A;  1I4K 1;  2JVV A;  5GAO l;  3MEV A;  2V8J A;  3QPH A;  4BE1 A;  3WXM B;  3DKM A;  1GXI E;  3QUI A;  2C06 A;  1VQ9 A;  1QVP A;  4M78 B;  2RHX A;  3MEA A;  4JLG A;  3MP1 A;  2DVE A;  3JB9 H;  2PVD B;  4PJO G;  3OYH A;  1OZ2 A;  2V8I A;  4IUP A;  2OTL T;  2X4W A;  2VXF A;  4ELY C;  2MAM A;  2DD5 A;  2WSF E;  1Y96 A;  1NE8 A;  5KE3 A;  4X9C A;  2LCL A;  4M7D A;  1BIA A;  1NPP A;  4ZGJ B;  4JX6 A;  2CZ1 B;  3QII A;  2P0P A;  3JCM P;  1RI0 A;  3RMS A;  3X25 B;  4FU6 A;  3DB4 A;  5A0D A;  2VV5 A;  2QDJ A;  1N8R U;  5LJ3 j;  5GAN 7;  3SWN A;  3VV0 A;  2QI2 A;  1KC8 C;  1VQ5 T;  3CC2 A;  4LDX A;  1WPY A;  1MHN A;  3FJP A;  2E70 A;  1MGQ A;  2LDM A;  2L8D A;  3FB9 A;  3OYL A;  4M75 F;  1UGS B;  2DXB B;  2PVO B;  4C0D B;  4AKG A;  4HL4 A;  4N0A C;  3DB3 A;  3CME A;  1QVG S;  4NL2 A;  3R6O A;  4FT2 A;  1VUB A;  4GLK A;  1KQS S;  2CZ6 B;  4OB3 B;  1M1F A;  4A4H A;  5KCH A;  2DZ9 A;  3ER0 A;  5LJ5 h;  5LJ5 e;  1H64 1;  4M75 D;  1N9S A;  4KUD K;  1WGS A;  1OI1 A;  2K5F A;  2RJD A;  3JSC A;  4JRK A;  2O01 E;  2M0O A;  4VUB A;  2X4Y A;  3RUX A;  4EMH A;  3G71 A;  3S3N A;  1HXD A;  3QYE A;  1IRE B;  3L1A A;  1BI0 A;  4J6Y A;  4C0F A;  5C6S A;  2P4T A;  3CCS T;  4M75 C;  2OAU A;  3GOX A;  4A4G A;  4C92 E;  2MWP A;  1EIF A;  4M7A C;  2VGM A;  4JRI A;  3RES A;  2DIG A;  3V7S A;  4MFE A;  1B34 A;  1NZ9 A;  2RI5 A;  4XTV A;  5IAY A;  1Q82 C;  3NFC A;  1XTD A;  3OYY A;  3G6E T;  2JTM A;  1R8O B;  5CKH A;  4C92 B;  1X01 A;  4JDS A;  4QSH A;  1M90 U;  5GAO m;  3Q1J A;  3C95 A;  1QVG A;  2K57 A;  5LJ3 e;  2LQ8 A;  5LJ3 h;  1VQ9 T;  1KQS A;  2E10 A;  3T9N A;  1VQ4 A;  5DM7 R;  2X35 A;  3UDC A;  1PSE A;  3OYM A;  4C0G A;  3PNW C;  3OS1 A;  4BI8 B;  3JCM g;  2RHI A;  5GAO r;  4XQ3 A;  2MWO A;  4M75 G;  1VQ8 A;  2R57 A;  4DA4 A;  2ZCF B;  3OBW A;  4C5H A;  2F5T X;  4ELJ A;  1LJO A;  2DXU A;  3MEW A;  1AHJ B;  5FRM A;  5CIU A;  4M7A E;  3N5B B;  3OS0 A;  3L2R A;  1Q7Y C;  4FT4 A;  4J6W A;  2XDD A;  4RG8 A;  4QQ6 A;  3LGF A;  5A2Q E;  5CR2 A;  3OS5 A;  3JB9 F;  2EQJ A;  3CC2 T;  3LW5 E;  2LT1 A;  3PGG A;  4C5E A;  3M59 A;  4M7A B;  5LJ5 f;  1FWZ A;  4IUU A;  1M4Z A;  3MEU A;  2ZZD A;  2DD4 A;  3CPW S;  3OSS C;  4XTZ A;  2PU9 B;  4A53 A;  3QSU A;  5HKC A;  4JS5 A;  4NOY A;  5D6X A;  3JB9 D;  4IUR A;  4ZGE B;  4M77 F;  3OYC A;  1BI2 A;  3LYI A;  3M4G A;  3CME T;  4ME7 A;  3RER A;  1NJI C;  3GF5 A;  1ZHI A;  4B9W A;  3MHX A;  2VUB A;  4M77 E;  3OB9 A;  4ZTJ A;  4LDW A;  2JOY A;  3CC4 A;  5FU6 C;  3JRZ A;  4J7I A;  2QQA A;  1QW1 A;  2MI6 A;  3G71 T;  1N27 A;  3QG1 A;  1WJS A;  1KHI A;  4QVZ A;  1BYM A;  3GLX A;  4PJO F;  2GF7 A;  2E6Z A;  4PL6 A;  4C5I A;  3TW7 A;  2KMT A;  3OBY A;  4KT0 E;  4M77 A;  4XU0 A;  3V8K A;  3H6Z A;  4XTW A;  3VUZ A;  1X75 C;  5GAO p;  3J81 E;  4M78 C;  5LJ3 f;  3KXT A;  2HQX A;  2DTH A;  3M54 A;  1XOV A;  5EG2 A;  3X26 B;  5I2M A;  4M7D C;  3ME9 A;  3C4S A;  4EMK A;  4QW2 A;  3MCA B;  4XU2 A;  4BB7 A;  5D6W A;  4A54 A;  5M9O A;  2L3R A;  1UGP B;  5GAN g;  1KD1 C;  2CZ0 B;  3PT9 A;  2YLB A;  2ZPG B;  1G3Y A;  2HNI A;  3CBM A;  4N4H A;  3SWN C;  3P8H A;  3L2U A;  2E41 A;  3JB9 G;  1VQ4 T;  3TRE A;  1VQN A;  4X34 A;  4QQD A;  3UT1 A;  3CC7 A;  2QF7 A;  2RHY A;  4C8Q D;  4EPC A;  4MZT A;  2PVG B;  1JB0 E;  2GCX A;  3TCJ A;  1VQ8 T;  4HCC A;  3EAE A;  5FU6 B;  3QWL A;  1ZBX A;  4J83 A;  5HY6 A;  4HT8 A;  4BBS M;  3VKG A;  1S72 A;  3HL8 A;  3MET A;  1VIE A;  4FL6 A;  2EQU A;  3JCM J;  4LDV A;  3OW2 A;  3JAM E;  4XTY A;  5GAN 3;  4M7D E;  2E64 A;  1M1K U;  3QYB A;  3LLR A;  3GNG A;  4HNV A;  4TVR A;  4OGE A;  2LC4 A;  3QXE B;  2K3X A;  3MP8 A;  4FSX A;  2BKD N;  2MMP A;  4DQ2 A;  2YHT A;  2DD5 B;  4ZTF A;  1BIB A;  1Y96 B;  2DTO A;  4MMK A;  4M7D B;  1YIJ A;  3J7A F;  1O75 A;  4JRQ A;  2PUO B;  1KC8 U;  2P0K A;  3L2V A;  2K5I A;  5CKF A;  3J80 E;  3A8H B;  4KBM B;  3ZFJ A;  3CD6 A;  1U1T A;  3CXC A;  1VQL A;  4L6V 5;  3SWN B;  3CC4 T;  3CMA A;  3WVD B;  5LJ5 d;  2EWN A;  2FYK A;  3UWN A;  3JCM X;  4C92 C;  2CKK A;  2H3J A;  2RD1 A;  2RH2 A;  2EJG A;  4PLI A;  5AYF A;  4C8Q G;  2FL7 A;  5CKD A;  1SSF A;  4PLL A;  4OB1 B;  1W2B S;  2KMG A;  4MFD A;  3C94 A;  4HLQ A;  3QJY A;  5CKB A;  5D6Y A;  3TEE A;  1Q81 C;  3M5A A;  3NTK A;  4IUV A;  3JCM W;  1IZ6 A;  2ZPE B;  2DXC A;  3OQ5 A;  3JCM h;  5CK9 A;  3JCM e;  2K4Y A;  2D9T A;  4M75 E;  3JCM Q;  2DIQ A;  1M8V A;  1JRI A;  1U1S A;  4Z02 A;  1E7P A;  4YTL A;  4OP0 A;  4E47 A;  1K73 U;  2EJ9 A;  3GIB A;  5GAN j;  2QFZ A;  1UEB A;  1WQ7 A;  4JLI A;  1I5L A;  3BG9 A;  1BKB A;  3PIP A;  2M16 A;  1PSF A;  4F7U F;  5FRO A;  1HK9 A;  3FRN A;  2G77 A;  4M75 A;  3AHU A;  3HBL A;  4BY6 B;  2LX9 A;  2RHZ A;  2B8A A;  3CCV A;  4BDZ A;  5CQY A;  5LJ3 d;  5GMK j;  1VQN T;  3CC7 T;  3VJP A;  2DO3 A;  1Q86 U;  1N8R C;  4C5G A;  2WSE E;  1B34 B;  2QTX A;  4RMO A;  3OYA A;  3OS2 A;  3QDR B;  3WVE B;  2HD0 A;  4X9D A;  4F7U A;  1S72 T;  2EQM A;  2KSS A;  1UGR B;  2ZPI B;  2WJ9 A;  2VYT A;  4MZM A;  4C0Z A;  3SDZ A;  4XTX A;  5GAM g;  4MZP A;  4N4I A;  3HFN A;  2AHJ B;  2LNV A;  1K8A C;  2CS7 A;  3CCM A;  5CKE A;  4DOV A;  2QA4 A;  1Q7Y U;  3QZ5 B;  3EFS A;  3JCM b;  4M77 C;  4R55 A;  5FLX E;  1YIJ T;  2LCC A;  4ATO A;  2CZ7 B;  4BUG A;  1N9R A;  4IUQ A;  1NPR A;  2EIF A;  2X4X A;  3BW1 A;  3ZEH A;  1G5V A;  1WNL A;  3PMI A;  4A4K A;  2ZPF B;  3JCM f;  2E12 A;  5GAN 4;  4EMK C;  5DLO A;  4L5G A;  1VQL T;  3CD6 T;  5GAN e;  5GAN h;  2VXE A;  3L2Q A;  4PJO C;  5L8R E;  2RI3 A;  4II1 A;  3QBY A;  3VKH A;  5DLQ E;  1D3B A;  1BI3 A;  5GMK i;  2RK1 A;  4F7U G;  3G4S A;  3HZJ A;  2ZZD B;  2XIC A;  2DD4 B;  4PJO A;  2M9U A;  1TH7 A;  1XNI A;  3CEY A;  3QO3 A;  5GMK e;  2DTI A;  5GMK h;  3KBG A;  3HB9 A;  3M58 A;  3MP6 A;  3LX7 A;  3ASK A;  4N0A A;  4N4G A;  1K9M C;  4RCB A;  3E1S A;  3QHS A;  1JJ2 S;  2O4X A;  3H4C A;  2JTF A;  3OYI A;  3CCQ A;  3VKI A;  3OYK A;  1JBM A;  2QDY B;  4OB0 B;  5CCA A;  3HP9 A;  2QQB A;  3RKX A;  4OB2 B;  4KUI A;  1ZQ1 A;  4M77 B;  4BI3 A;  3I56 A;  3CCV T;  4PKC C;  5A0G A;  1KQ1 A;  2JZ2 A;  4PJO E;  1YJ9 A;  2RK2 A;  4XU1 A;  1H3Z A;  2Y4X A;  1FXX A;  3FIF A;  2CYZ B;  4Z6Y A;  5J39 A;  3LWH A;  3S3M A;  1VQO A;  3X28 B;  2D0Q B;  4EMK B;  2QQ8 A;  3M56 A;  4HT9 A;  3V7C A;  2DJZ A;  1WJQ A;  3CPW A;  4A4E A;  4NC6 A;  2Y4Y A;  3KHI A;  2HAX A;  4PJO B;  5HK3 A;  5IN1 A;  5GAM j;  3HRS A;  2EYQ A;  4C8Q F;  3HFO A;  2NLU A;  3BDU A;  2V8K A;  2M1H A;  2CGH A;  2DKG A;  1WJR A;  1VQ5 A;  2YLC A;  2FHD A;  2BUD A;  2EQK A;  4JS4 A;  4XU3 A;  1VQK A;  1O9S A;  3CCM T;  5GAN f;  2QA4 T;  4A4F A;  2ZPB B;  3OYF A;  3X20 B;  1YCY A;  2RO0 A;  5FRN A;  1M5Q 1;  3P8D A;  4J5Y A;  4BDY A;  2RJF A;  3A8M B;  3M4Y A;  4C8Q A;  1G3S A;  3QYG B;  3JB9 J;  4XK8 E;  3A8O B;  2R5M A;  4M7A G;  4R56 A;  3EFR A;  2LTO A;  3HRU A;  3V7R A;  2LVM A;  2R58 A;  3HRT A;  3V8L A;  3BDL A;  4QQG A;  3M57 A;  2XU8 A;  3FEO A;  3G4S T;  4OGC A;  4MIM A;  3VYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...