2QDYB

Crystal structure of fe-type nhase from rhodococcus erythropolis aj270
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title High resolution X-ray molecular structure of the nitrile hydratase from Rhodococcus erythropolis AJ270 reveals posttranslational oxidation of two cysteines into sulfinic acids and a novel biocatalytic nitrile hydration mechanism
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2qdyB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qdyB02
3WVEB 4OB2B 3LW5E 3X25B 1PSFA 2PVGB 4FM4B 2WSEE 3A8MB 3A8HB 1QP3A 2DD5A 4KT0E 4XK8E 4OB3B 2ZZDA 5L8RE 2DD4B 2PUOB 4RKUE 2AHJB 2PVDB 2DD5B 3A8GB 3QZ5B 2DXCA 2DPPB 3QXEB 2O01E 1JB0E 2ZPHB 3A8OB 3QYHB 2ZPIB 3QYGB 4ZGJB 1UGSB 4OB0B 3VYHB 2DXCB 4ZGDB 4Y28E 1UGRB 2ZCFB 4OB1B 2ZPBB 1DJ7B 3X26B 2WSFE 2ZPFB 2CZ0B 2ZZDB 1AHJB 3X20B 4L6V5 2DXBA 3X28B 2PU9B 1IREB 2D0QB 3QZ9B 3A8LB 2QDYB 3X24B 1UGQB 1UGPB 3VYGA 1V29B 2DXBB 3WVDB 1QP2A 2PUKB 2CZ1B 2DD4A 2PVOB 2CZ6B 3HHTB 2ZPEB 2CZ7B 2CYZB 2ZPGB 3VYGB 1PSEA 1GXIE 4ZGEB 2WSCE
chains in the Genus database with same CATH superfamily
4DBFA 5DM7R 3G71A 1OU8A 1IHVA 2KYBA 4M7DF 3POMA 1E7OA 1I8FA 4EIKA 2X9HA 2MPXC 3NPFA 1PG5B 3CMET 2RQWA 1H92A 5C6SA 1G3WA 1ZUKA 2NUTB 3TU4K 2JMCA 4EC8B 1RUWA 3PMTA 1VQ6Q 2BKDN 3UT1A 2K5FA 4CFUB 2GQIA 2PUOB 1PHTA 2RA2A 1U06A 2HNIA 1B3QA 3OYLA 1X6BA 2DTHA 3KBGA 1AZEA 1VQLT 1EFNA 2F2CA 4KUIA 2F5TX 2KY9A 5GAN8 2SRCA 1OKVB 4FYYB 3MJXA 2DJQA 3MKDA 2OTJQ 2EBPA 2DBMA 2DO3A 5HNBB 4JRQA 1PWTA 1SSFA 4QVDA 1UJ0A 2GFAA 1VYUA 1M5Q1 2G9XB 1YIJQ 2VXEA 2W2HA 4MMLA 3HO8A 3HRTA 1S72A 4JDSA 3GOXA 2HL3A 3I56Q 3CC4A 2HQHA 3BLHB 1QCNA 2F1LA 1WJRA 1P5EB 1VUBA 2YLBA 2C06A 1C9BA 2MF2A 4DBHA 4AFQC 1G3NC 1Q81C 3M59A 2C5VB 2KMTA 4ROCA 1V1CA 4EOOB 1H8KA 3G4SA 4PJOG 4M7AF 7AT1B 3SB2A 4RTXA 2FB7A 2A3LA 1X69A 4HVUA 1TWBA 4B9XA 4BCMB 3C4SA 1WIEA 4LDUA 4QW2A 2RMOA 3S3OA 2RM4A 4PFPA 4ZGEB 5IHKA 4L59A 2YT6A 1D3UB 4C5EA 1OPLA 5GAN4 4GLKA 1YCSB 2BTTA 4FW2A 2PVGB 2C5OB 5DQWA 4IUQA 3P8DA 1YN8A 2AKLA 1AWJA 3V8KA 3HBLA 1VQPQ 3VS2A 4A53A 1NG2A 4EMKB 4BI3A 1M1KU 4EMHA 2JJ9A 4CRLB 1VQLQ 1WA7A 4ATOA 1OZ2A 3RMQA 2K3YA 2VV5A 4V2SA 3U23A 2PVDB 4MMKA 1WLPB 2DKGA 4M7DA 1TFBA 2ROLA 2FZGB 1D09B 1ZSZA 3QYBA 2RF0A 3EHQA 3QHRB 2HAXA 2XG8D 5FWBA 3VRZA 4J7FA 3JB9D 1H28B 2R7GA 1WFWA 4LUEA 1KHCA 2XU8A 2PK2A 1NJIU 1FX7A 1FMWA 1WYXA 1X6GA 1H4LD 2A08A 2WPAB 1FMVA 1VQ5A 4G6LB 3H4CA 2QA4Q 3M0TA 1AHJB 2M02A 2QXFA 4Z8AA 4ELYC 1JJ2A 1YHQT 2P0PA 4C8QC 1YI2T 1YJNQ 2BS4A 3H0FA 1SRMA 1K8AR 1OX8A 3JCMd 3CC2A 3JCMJ 2KAFA 3G7ZA 5FROA 1D0XA 4XAXB 5GMKl 2IG0A 1Y57A 4PLLA 1MMNA 4RMOA 5KYUA 1MMDA 3CCRA 3CD6A 5IXFA 3L42A 1UJYA 4MZTA 3OYNA 3SD4A 2EAYA 5CR2A 1WXUA 2HEQA 4BCPB 2JVVA 4M4ZA 2CZ7B 4AFSC 2OI3A 1OL2B 2UZEB 2YRCA 1Q7YC 1IRXA 1TG0A 2DIGA 2HDAA 4J6WA 1K9MC 2D1XA 3JB9I 2M51A 5GJVB 1YJ9A 3DDQB 1MNDA 3BW1A 4F16A 4HCBA 1WX6A 1BK2A 5I2SA 5GAN2 2O9SA 4M7AA 1KFZA 5AT1B 2IW9B 1GFCA 3LYIA 1BI1A 4RTVA 2UZBB 3GTMS 1AWWA 3HKSA 2FO0A 2EJ9A 3VUZA 3M0RA 2J7IA 1MV0B 1N8RU 1KQ1A 1RLQC 3TREA 3UPUA 2XICA 2K79A 5FLXE 3KHIA 2F5KA 1M8VA 2BKZB 1Q86R 2DM1A 2RI2A 4JX4A 3I55Q 3INZA 5CKHA 5GMKm 4OMNA 3NGPA 3RBBB 3V8JA 1VQ7Q 3M0QA 2XMFA 4EPCA 2FZCB 2MMPA 2K4YA 3ULRB 1UB4A 2KYMA 4E7KA 4IUTA 1VIEA 1H1RB 5I2MA 2DETA 1IGQA 2P4TA 4BCFB 3OS0A 4RUGA 5A2QE 2A28A 2QK0A 2JN0A 2LCLA 1RAIB 2DL7A 3QPHA 2EVRA 1NM7A 4X34A 3CMAT 1DJ7B 1NYFA 1D3BA 2GQVA 2LQNA 2F2WA 1QVFS 3PO3S 1Y7XA 3JCMb 1RI0A 2K5LA 3DLLA 3AHUA 3A98A 1X2QA 4R56A 4IIMA 3H41A 2QQ8A 1Z9QA 2XDDA 2Z0WA 2PHGA 3EFOA 1VQ4Q 2QDYB 3GBQA 1B34B 4XU3A 4N0AA 4E7SA 4J9GA 2VVKA 4BY1X 2CH4A 2VWFA 4MZPA 3OYGA 3L2RA 1VQ9T 2A7YA 4KH1B 2I40B 4C5GA 1VQ8T 4R0KA 2DZ9A 1SF9A 4RTZA 4IKFA 1Y0MA 5FU7C 9ATCB 2NWMA 3QWYA 3LQ5B 2EQJA 2J6FA 2YUNA 3MY1B 4D8KA 5LJ5e 2NUTA 4KRTA 2FL7A 2DRMA 1VQOA 2WIHB 4XTVA 2IPOB 4F7UE 4GLMA 2WHBB 1Y96B 2JM8A 3BHUB 3WXMB 3G6ET 2CH4W 2NLUA 1KQSS 2V1RA 4JRKA 4DEYA 1EX4A 1ABOA 2BS2A 4CFNB 4BACA 2DL8A 3EGDB 2KXCA 2QF7A 3H9NA 3T9NA 2HSPA 4QT7A 1WQWA 3DJBA 4RKUE 3CCQT 4CFVB 3QO3A 1X75C 3A8GB 3SWNB 4MFDA 1OV3A 2W9ZA 1ZLMA 4X9DA 1XNIA 3DKMA 1U1SA 2I2LA 2A36A 1UEBA 2BPMB 1AISB 4J5YA 1GRIA 1G8XA 3OA6A 2DXCB 1UFFA 2HL5C 1OPKA 2F69A 3URGA 3NDQA 1WJQA 3OS2A 3CXCP 3JCMX 2WSFE 3VS4A 3P8BB 4MIMA 3GNGA 4BCQD 3CCLT 3GP8A 2V22B 1N6AA 4OVAA 3H6ZA 4BE1A 4BI4A 2CKKA 1QLBA 2NUZA 1K73C 1K4US 2EIFA 4EMGA 2HD0A 1VYVA 2J05A 3I9QA 4FL6A 4CXAB 4FT4A 2AZSA 1YITA 1RACB 4M7DB 5LJ3e 3CPWP 3S3NA 1YFNA 3GPLA 3FJPA 1HSQA 3KFVA 3CC7Q 4IUPA 2EYXA 3TW7A 2K2VA 1ZP2A 4F7UB 1M9SA 1MHNA 2ZPGB 3RGFB 4BCOB 1I0CA 4NOYA 4DBRA 2RJFA 3HP9A 1MNEA 4OMPA 4M7DG 1FXXA 1UNLD 2BZXA 3O5ZA 4HA8A 3MO8A 4LE9A 1LCKA 4EOJB 4ME7A 2LRQA 2FG0A 5I21A 2QEXT 3OS5A 4DA4A 1AD6A 4C0DC 2G77A 1UUEA 1XO2A 1FKMA 3LH0A 1BI3A 4F7UG 1AVZC 4JUVA 3M03A 2KRMA 1KQSP 2ED1A 6AT1B 2LDMA 4BBRM 1E7PA 1RAGB 3JCMP 2GNCA 3BLQB 3PVLA 2DILA 1JBMA 2SEMA 2XIDA 2DL4A 2MOXA 1UTIA 4OGCA 2DPPB 3FJ5A 2JTMA 4KGVB 3QIIA 4PFZA 3CCVA 5FGKB 1VQKA 1K8AU 4L5GA 2EGAA 1OX9A 3CCUQ 3TN8B 1JO8A 3VYHB 2V1QA 1K1ZA 2K3XA 5LJ3j 4XQ3A 2KE9A 3CCEA 2CSQA 2KR6A 3K7AM 2QQSA 4M78D 1I07A 1VYWB 1VQ6T 4OMMA 1BIAA 2FYKA 2E64A 2FRWA 2KDSA 5L23A 4M77C 3EH2A 4Y92A 2E12A 4L6V5 1ZA1B 1WGSA 3EJ1B 2MYSA 3L2UA 5GAN5 4BI8B 2EWNA 1K9MR 1Q86C 3RESA 2BIVA 4DOWA 3A8LB 2OTJT 1M3AA 3C12A 4MDXA 3MHXA 4IIOA 2X1NB 2JGZB 1KQ2A 5IN1A 4M77E 2CZ6B 1QW1A 4J6YA 4IUUA 4II5B 2BS3A 2ZPEB 3JSCA 1UECA 1N27A 2D0NA 1VQNA 2ZGWA 3OMGA 3UATA 1KC8R 1JSUB 3D7SB 3I56T 3C95A 2W99A 4HXJA 3QUIA 5DLOA 1WXBA 4QQGA 4KRDB 4C0GA 2O9VA 1PRLC 2CSIA 2KVQG 4N4GA 3ZFJA 2IW6B 2CGHA 3TNHB 4NL3A 4OB2B 3LW5E 1W98B 3BHTB 3UA7A 2WSEE 1I5OB 2K7AA 4D8DA 2QI2A 1KG1A 4OB3B 2CP6A 4FX3B 3FB9A 3NTKA 4RTWA 1W2BP 4HT9A 2VGMA 5GANj 3AT1B 5KCHA 2OTLQ 1PD1A 2M0YA 1H1PB 4LN2A 2EW3A 3CXCA 2E41A 4FW1A 2AHJB 3G71Q 1M1GA 2I0NA 5CKFA 1X2KA 5LJ5g 4JLGA 4LDVA 4BY6B 2MK5A 5CO7A 2JTFA 2JTEA 4J8OA 1W4SA 2KNBB 3QYGB 1JSTB 1GCPA 2YDLA 3MPUB 4C92C 1UGSB 3OBYA 3J81E 3CPWA 5LJ3h 3CCMA 5GMKe 4F7UF 5J26A 2EKHA 4AT1B 5J39A 5GAN6 1VQPT 2HBPA 1RLPC 2V8KA 3TEEA 4ANJA 5DLQE 4JJNK 3PNWC 1TOVA 1CKAA 2DX1A 2EQIA 2LP5A 1AEYA 3X20B 4M77B 1B34A 5CK9A 4C92E 1YWOA 2QDJA 4F17A 4FSXA 1FYNA 2KEAA 1HK9A 1VQMT 4JRPA 3L1AA 3DTOA 1UDLA 4GY5A 3CCSA 2LZ6B 3LH5A 5FRMA 1UGPB 2PJQA 2JZ2A 2OAUA 1S72Q 3A1PA 4CRIA 3CC4Q 1TU0B 2LQKA 2DZCA 1TH7A 1E9HB 1KK7A 4M77G 1UGVA 2DYBA 4HNVA 2C4GB 1H25B 3I5RA 1PSEA 2QFZA 4O5VA 2XKOC 5GANf 2QA4T 5HVYB 4JX5A 1OIUB 3G33B 5KCOA 2DJZA 1Y96A 2K3BA 4XTWA 2O2OA 3G4SQ 2RPNA 1YJNT 1WHJA 3WVEB 1GBRA 2LCCA 5LJ3g 3CC2T 3HRSA 3EGDA 4RCBA 4M75C 1ZHIA 2EFIA 1UE9A 2RO0A 1W6XA 2VASA 1WJSA 3DL1A 3SWNA 3CQTA 3VJPA 5GANh 2IVWA 3GLXA 2RB6A 5IDPB 4RG2A 1Q81U 2B8AA 5GMKj 3RIRA 4JS4A 1W70A 3B57A 4JLIA 2PMIB 1CSKA 1RI9A 2D9TA 4ELZC 2M0OA 4M75E 1YJ9T 3BE3A 2DXCA 1RAHB 2OJ2A 4PJMA 2DYIA 4EOQB 3JCMW 4EDUA 1GCQC 4M78C 4C92B 4ZN3A 1K73R 1W1FA 2H3JA 2LJ0A 2QGSA 1JQQA 3JAME 2CUBA 2E65A 2V8JA 4EOLB 1WNLA 3CMEA 1Y71A 2ZPBB 2WACA 3UF4A 2E5KA 2RHIA 1Q82R 3F70A 2OX7A 3X26B 1VQMQ 3OBWA 1KSWA 3BDUA 2J6OA 2ZPFB 2CUDA 1TUCA 1M30A 3DOGB 3UWNA 1G3TA 3I55T 2GFUA 4F7JB 4Y91A 2DA9A 1VQ7T 3O0GD 5EG2A 4XU0A 1M90C 1M3CA 1X27A 2BZ8A 2OAWA 4C92G 1WPYA 5KYNA 3MY5B 4KUDK 4F7UA 3EGXB 1BCOA 3HB9A 5GANg 1WHGA 4NS5A 3JCMV 1VQ5Q 1RAFB 1XTDA 4BUGA 1OULA 1OI9B 1TXQA 3LX7A 1W2BA 5IF1B 3E9GA 1G5VA 1K0SA 1K9AA 2DBKA 3CC2Q 4C5HA 2PQWA 4I3ZB 2HQEA 1ZUYA 2NUPA 3VS1A 3CCRQ 1H26B 4YOOA 3LGFA 3CD6Q 2QQRA 4E7HA 2QTXA 1HD3A 4M7AD 4C8QE 2CP0A 4M75B 4J9FA 5BNJB 3QSUA 3V7RA 4F04B 2RI3A 1VQ4T 2X3XD 4QQ6A 3L2QA 3OW2S 5A0DA 1EIFA 4AG1C 1SRLA 4M77F 3JV3A 2R5MA 1YJ9Q 5IH2A 4AKGA 4Z89A 5GMKh 4QVZA 4DBQA 4TVRA 2CCIB 1UHFA 1YP5A 1OYXA 4J9CA 2JUFA 2W9FA 2KROA 4OMLA 1JOWA 2JM9A 4AKHA 4OMQA 2ABLA 3THKA 4BD3A 2WMBB 1F1BB 1YJWT 2PZ1A 3N5BB 1Q7YU 1KC8C 4HKEA 1K9MU 3TSWA 4HNTA 4YC3B 4UC4A 2XD0A 4F6SB 5EJCA 2CP5A 4NSTB 4CFWB 3NHNA 4B9WA 2QGGA 2ED0A 1SKUB 2E10A 1VOLA 3GNFB 2DF6A 4F14A 1UHCA 4LDWA 1R8OB 3PVQA 4J9DA 4PL6A 1H3HA 2VB6A 2KK4A 2AKKA 1OGUB 2WFYB 2E3IA 2ROTA 3C94A 2M16A 1VOMA 2DMOA 1UGQB 1GH6B 4F6WB 1KHIA 3HSBA 3EG9A 2KRNA 4EOPB 3EG0A 3OSSC 4UN0A 2Y90A 1OOTA 2RQVA 3VS7A 4C8QB 2E6ZA 4LXCA 5LJ5d 4BCND 1U5SA 3RKXA 5GAOn 2CYZB 1Q95G 2CT4A 2RH2A 1YNZA 4AFUC 2HBWA 5GMKi 1IXDA 1YHQA 4PLIA 1D1AA 2QGFB 4C92F 2F2VA 3OQ5A 1YI2A 2LT4A 3Q1JA 3OYJA 1QKXA 3PTAA 4CC4B 3M0SA 5I22A 3PE0A 5GAMj 4CFUD 1OKWB 4BDYA 2DXTA 4J9BA 3JB9J 4C8QG 1WHMA 4QQDA 4PJLA 4LNPA 4DEXA 3CC7T 1FINB 1T0HA 5LL6S 1ZSZC 5GAOp 1YJWQ 1VQOQ 3RKYA 3M4GA 2RD1A 3KXTA 2KSSA 3TQ7P 3LLRA 3OYAA 2FZKB 2FVUA 4PJOD 3RDVA 1ZBJA 1OEBA 4M77A 1OZ3A 2LQWA 2YUPA 1G2BA 1ZA2B 2EGEA 4PKCC 2GBQA 3MCAB 5A0LA 3PIOA 1PKDB 4OGRB 1G83A 1I81A 3MEVA 3VS0A 5KE3A 4JJCA 1IHWA 2H3EB 2DE0X 5LJ3d 5J3BA 3E2UA 1RAAB 2VKNA 2AT1B 1Y07A 2DTIA 3DB3A 4M75F 4YTLA 2RQUA 3SEMA 4C0FA 1NZ9A 1T0JA 2DEQA 2MI6A 4BCMD 2HMAA 3JB9H 3MEUA 3OYBA 2XDBA 2DXBB 1LJOA 3CCUT 3HRUA 1I5LA 3OYEA 3M55A 4Z88A 4BCJB 5GAMf 1ABQA 3EOCB 1ZUUA 1QVFP 2O4XB 2A0FB 4XTXA 3VS3A 3CMAA 1GXIE 1BU2A 4M7AC 4CFMB 4E7ZA 1YITQ 3CBPA 2C0IA 1Q82C 2CREA 3MP8A 2QQAA 1KD1C 2VUBA 4QKUA 4ROEA 3JCMf 3QDFA 1HJDA 5GAMh 3HFNA 1TUDA 4FM4B 1KJWA 1MMGA 2V8IA 2RJCA 2ENMA 4XTUA 3RKWA 1BKBA 4A4GA 1K73U 1LVKA 4XK8E 5FU7B 2WJ9A 2Y4XA 2COYA 2KGTA 2L2PA 5IDNB 3CCJT 2YWWA 1M1KR 1VQ9A 5EFQB 2JT4A 1VQ8A 4C92A 2KBTA 3PIPA 3OY9A 2QTVA 3VV0A 2DD5B 2JNGA 2KMGA 5GANd 4LDXA 1QCOA 3OYMA 1SG5A 1XQHA 4LUDA 2NUPB 5I5ZB 1M90R 2DERA 2XHCA 1H1QB 4FYWB 4J83A 4OB0B 1E6HA 4C8QF 4Y28E 3VS6A 2RHXA 2DRKA 1BI2A 3L2VA 1NJIR 1I4K1 2JS0A 3EHRA 1D0YA 5CVIA 3G6EA 5KYWA 4QSHA 1JJ2S 2CZ0B 2OTLT 1PKSA 3REAB 1BU1A 3EGXA 2DIQA 2K57A 3CCVQ 1M27C 1ACMB 5FU6C 1VQKQ 3PFSA 1JXOA 3G71T 5GAMg 1HXDA 4F7SB 3CCQA 5HBHB 2KI7A 4E7JA 3DB4A 2D0QB 5GANe 1IO6A 2P84A 3JRZA 2EJGA 2I53A 1JRIA 1WZOA 1PRMC 2PNIA 4AG2C 3CCEQ 4EOIB 2X51A 1V29B 2EQUA 5KH6A 4E7LA 2WMAB 3SDZA 1OQKA 2PVOB 5HBJB 2LMJA 2G6FX 5HKCA 2EUFA 8AT1B 3I35A 2DAQA 4HL4A 2YHTA 3VYGB 1VYTA 4M75A 2V26A 2BE7D 4O6JA 3CCLA 1GL5A 4BCGB 2MIOA 1ZSGA 4KBMB 3LWIA 2WSCE 2B86A 2IN3A 2RQRA 2PTKA 4AMCA 2WXVB 1SSHA 4RODA 3QYEA 1IZ6A 3X25B 3UA6A 3REBB 3CCJQ 2QYZA 3M57A 2FPFA 1VQNQ 2CT3A 2W10A 5KYYB 4BCKB 1S72T 2LX7A 1H27B 2ZZDA 2DL3A 3V8LA 2QASA 2QDLA 3CC4T 2H8HA 5CQXA 2L89A 1Q86U 3EG9B 1GCQA 5L8RE 2B9RA 1CKBA 3RR6A 4PJOC 5GAOr 2CS7A 3M53A 2WEVB 3QZ5B 1TTHB 1YWPA 5GJWB 2UZDB 4LD6A 2MWPA 4C0DB 2LC4A 3G4ST 5HCKA 1JB0E 2LW4A 2LJ1A 4RTTA 4A54A 3A8OB 2J06A 1AZGB 2BUDA 2QG9B 4ZGJB 4OGEA 4PJOE 3MEWA 3M9QA 2QEXA 2XDPA 4IURA 3BHVB 2ZCFB 2COZA 3EFSA 1Z9ZA 2E70A 1QWEA 3TNIB 3H8ZA 1P92A 3NFCA 1QVFA 3EG2A 1AD5A 2MWOA 1D1CA 3BG5A 2RJEA 2EGCA 1E6GA 2X4JA 4J6XA 4OR5B 4C8QA 3CCMQ 3QZ9B 2CP2A 3L2ZA 2L0AA 2R58A 1SEMA 1RABB 4FYXB 1PCXA 2RI5A 4YOSA 3PMIA 5CKEA 1IGUA 1QVGS 3QBYA 3M54A 2DFUA 1D0ZA 4Y72B 2LCSA 1MV3A 4EOSB 3M5AA 1NPPA 3EG3A 1GUXB 4EMKC 1M3BA 2AIRB 2K2MA 2BZYA 2Y4YA 3CCSQ 1VQ6A 4BDZA 1AOJA 2C0OA 4J9IA 2HQXA 1H1SB 2EKOA 3OB9A 1OI1A 3CEYA 2CP3A 4HCKA 4A4EA 3A8MB 3QDRB 4BE2A 2P0QA 2OTJA 3JB9F 2VXFA 4JZ3A 4XTZA 4N4IA 1VQ5T 3TVTA 2D6FA 1TD6A 2AZVA 3OYFA 2FPDA 3S6WA 4CC2A 2NYSA 1KQSA 3JCMQ 4XU2A 1M1FA 1H24B 4Z6YA 3DLMA 4PJOB 4ZNXA 4EONB 1YIJA 1FWZA 3EG1A 2JXBA 1X01A 4KRCB 3I56A 4E7IA 2JOYA 3CCRT 5EC7A 3CD6T 1FVVB 3QYHB 2M1HA 4PJJA 4B6MA 4ZN1A 5D6WA 1TUGB 4JRIA 2E1HA 4JPBW 5HY6A 5A0GA 4MDWA 3HFOA 2RHUA 3L2WA 4FSSA 4BY7X 3ZEHA 2YUQA 2JW4A 4A63B 1EZZB 4M7DD 5GAN7 2K6DA 2HZYA 2DXBA 3X28B 2PU9B 1N9RA 3SHWA 1U8RA 4DOVA 3LWHA 4BCQB 1M2OA 4Q5WA 1MUZA 5FWCA 2C5XB 4CI0C 4RTUA 1M1KC 3TSZA 2O4XA 3CMEQ 2JMAA 3VKGA 1ENWA 4HT8A 1QQJA 2YRVA 2DL5A 1KD1R 2PUKB 5LMKB 2DD4A 2LQ8A 3HHTB 3PT9A 1QVGP 4M78E 4R55A 1A0NB 2GF7A 1T3SA 1VQPA 5CQYA 8ATCB 2HKQB 4BCHB 1M8MA 3E9FA 5KYWB 1VQLA 2W0ZA 3EFRA 3FLGA 5FRNA 1O9KB 4TTHA 1NJIC 2LVMA 3FDRA 1VQMA 2DTOA 2RHYA 3M58A 3HZJA 3GIBA 2IIMA 2YUOA 2HSEB 1PSFA 3OYHA 3OYYA 5L2WB 3VU3C 2DD5A 1XOVA 3J80E 4HLQA 1M90U 5LQFB 1LNXA 3VRYA 2FEIA 5GAMd 1OU9A 4RG8A 2PK9B 4JX6A 1NYGA 1R77A 1NEBA 3IQLA 3QKJA 4RTYA 4BB7A 2QA4A 3V7CA 3OYKA 4OMFB 4RCCA 4NC6A 5CCAA 1VINA 3HPWA 1UG1A 1SHGA 1YJNA 4M6VA 2EYWA 4F7NB 1K76A 2KT8A 3NMZC 1F5QB 3QG1A 2C5NB 2ATCB 2CJMB 2DNUA 3NTIA 3A5ZB 2X4WA 2ESWA 4D6WA 1O75A 2QAZA 3CBOA 1WDXA 2ZZDB 5HBEB 5DY9A 4ZTJA 2JS2A 1QMCA 3ME9A 2KXDA 2L3RA 5KYXA 4M75G 1IB8A 5GAMe 1N8RC 2X3WD 3BG9A 4M78B 1VQOT 3QJYA 1T3LA 4ZTFA 3JCMc 1PM3A 2MAMA 4EORB 4NL2A 3UDCA 1BB9A 1M2VA 1PKTA 4BCIB 3QWLA 3BLRB 3VYGA 2D8JA 1QP2A 3WVDB 1LPLA 1MGQA 5AYFA 3MP6A 4PJOF 4AKIA 4A4FA 5CKDA 4EC9B 3JCMe 2COWA 1UNHD 2K5IA 5IHYA 1KC8U 3J7AF 4M78G 4ESRA 2GTJA 4LD9K 3VKHA 5KYYA 3I55A 2E6NA 1WXTA 2P0KA 1YBYA 4WTOB 1VQ7A 3SWNC 1J3TA 2WIPB 2A37A 2EYQA 1H641 4WCIA 3CPFA 2IVXA 5ICPB 3RNJA 3MP1A 3QJ6A 4XTYA 2RK1A 3VUBA 3DDPB 4LDYA 2LX9A 5D6YA 2IW8B 2R5AA 1WQ7A 3P8HA 4PFOA 3OS1A 4ELJA 1YHQQ 5CKBA 5HQ0B 3CXCS 1YI2Q 2VGNA 1TSFA 2QQBA 3RERA 1OIYB 4Z02A 1B7TA 4KGXB 4EOKB 3FC3A 1YITT 4F70B 1WHHA 4P5NA 2D8HA 2EYYA 1NBEB 1NE8A 3HL8A 5D6XA 3I5SA 1JKWA 4PNOA 2C0TA 2KQWA 3M56A 4AI6A 4OF1A 4C0ZA 3OW2P 3EIDB 2VC8A 4ZGDB 3CPWS 5GAOq 2ZAEA 4M77D 4HCCA 3TW6A 4M7DC 3ER0A 4OB1B 5DQVA 1VQ4A 3M0PA 3SFMA 1XJWB 2X35A 4E6RA 2O31A 1S1NA 1QVGA 1C1AA 2X4YA 4MFEA 5GAN3 5IAYA 1K0XA 3FRNA 1WHLA 1G3SA 4ORZA 2P4RA 2RNAA 1AWXA 4M7DE 2RJDA 2CCHB 1BIBA 2GGRA 3M4YA 4PK4A 1O9SA 5KE2A 5IT9E 3EH1A 4II1A 2DVEA 4F6UB 1C0MA 1GUXA 2F2XA 1YJWA 2E4HA 1C6VX 1RADB 1JU5C 2EPDA 3QHWB 4FCYA 1M4ZA 1AWOA 2EQMA 3BFMA 2MCNA 5I11A 2KR3A 2DLPA 3QWXX 3BDLA 1ZX6A 4J9EA 1QLYA 2AK5A 2DMEA 1V76A 3CCVT 1VQKT 2KRSA 4HVVA 4FYVB 3MIAB 3MI9B 3OSVA 3H0HA 4PJOA 2L3PA 4HVWA 3CCET 5HK3A 3A8HB 3CMAQ 4VUBA 2CP7A 5M9OA 1YCYA 1GY3B 1QCFA 4J7IA 1D1BA 1NPRA 2E3HA 4YOZA 3G1JA 4HCZA 4QVCA 1Q81R 2DD4B 5IHIA 1RAEB 4GBQA 1AT1B 4M78F 4AFZC 4CC7A 1U1TA 4KGZB 2VYTA 4C92D 3R6OA 1PC0A 5IHNA 3QXEB 2RHZA 1QWFA 4A4KA 3VS5A 3OYIA 1X43A 4M7AE 3GF5A 2ZPIB 5ECAA 1GBQA 1KXUA 2LT1A 2DEUA 3BG3A 1QVPA 2E5QA 1VQ9Q 2RQTA 5LJ5j 1ZSZB 5GAOl 1VQNT 1VQ8Q 1LOJA 1Q82U 1TS9A 1OL1B 1KD1U 3C0CA 1PD0A 3E19A 3F5XB 4XU1A 2LNHB 4E47A 2L3SA 2J6KA 4BXXX 4MZMA 4K11A 3JCMh 3CC7A 1BCMA 1WI7A 2YRDA 3RUXA 2FPEA 1QMZB 2BE9B 5CEIB 4LOCA 4JJBA 4CC3A 1VIFA 4WF2A 1N5ZA 4F7LB 1U3OA 1SPKA 1BI0A 3EAEA 2K9GA 2M9UA 2R57A 3O8VA 2YSQA 4BBSM 3X24B 3QHSA 4EMKA 1SHFA 3G6EQ 3S3MA 3FEOA 2DXUA 2L5QA 3CBMA 1JEGA 2RN8A 4A4HA 1O9KA 3ZBDA 1W2BS 2GCXA 3CCQQ 4EOMB 2YXYA 5KYUB 3PGGA 1VA7A 4N0AC 1G3YA 4OP0A 3OYDA 1K8AC 1BBZA 3H0IA 2XK0A 4M75D 4ELLA 2EQKA 2FRYA 5GAOm 2L3QA 3NTHA 5IXBA 5KYXB 4C5IA 5C0MA 4FT2A 3ASKA 4KH0B 2UUEB 1X6OA 2C6TB 3JB9G 3CCMT 4BY6C 2KT1A 3EGUA 2FHDA 1B07A 4HNUA 2ECZA 4DQ2A 1QP3A 1M2VB 4KT0E 5FW9A 3JCMg 3OW2A 3CCLQ 2QQ9A 2LTOA 3BY7A 1ZQ1A 2X4XA 4M7AB 3M0UA 3CCUA 1BYMA 4E2FB 3HTRA 3OYCA 5ACBA 5LJ5f 2UZLB 5HK0A 5CYIB 1NEGA 3CCST 4X9CA 2HCKA 3R6NA 4X1VA 2O88A 2O01E 4N4HA 1URCB 1I1JA 5CAIA 2ZPHB 1N8RR 4KULA 4BE0A 2DK3A 2GTOA 1NLOC 3LGLA 1Q7YR 2W96A 2CDTA 4M7AG 1N9SA 1UGRB 1PNJA 5LJ5h 1KIKA 2EYZA 4IMYB 4M78A 1NLPC 1R0CB 3OMCA 4PJNA 1R0BG 2LNVA 3VKIA 3TNWB 3CCJA 4FIBA 4CFXB 5D7UA 1MMAA 1YIJT 1UNGD 1QKWA 2RK2A 2LJ3A 4J9HA 1D3BB 2QEXQ 1IREB 1ARKA 3RMSA 1WHKA 1GFDA 4C8QD 2DVJA 2YLCA 4IUVA 4JZ4A 1FMKA 4OMOA 4JS5A 4JJDA 2G3RA 2CZ1B 2L8DA 3META 3MEAA 3TCJA 1JJ2P 3ZL7C 5FU6B 1HYOA 3EFOB 3KUFA 3E1SA 2EJFA 1RL2A 3V7SA 1N4MA 4FU6A 1H3ZA 3FIFA 5CIUA 2XI9A 5LJ3f 2OTLA 2HKNA 1JXMA 4BCNB 1ZBXA
chains in the Genus database with same CATH topology
3OQ5A 2LT4A 3Q1JA 3MO8A 4HA8A 3OYJA 2LVMA 3FDRA 1VQMA 5DM7R 2DTOA 2RHYA 3M58A 3HZJA 3G71A 3GIBA 4ME7A 2LRQA 5I21A 3PTAA 2QEXT 4M7DF 3OS5A 1PSFA 1I8FA 1KQ2A 4DA4A 5GAMj 3OYHA 3CMET 3OYYA 4C0DC 4BDYA 2DXTA 3JB9J 2G77A 3VU3C 4C8QG 2DD5A 1G3WA 1XOVA 5C6SA 3J80E 4HLQA 1FKMA 1M90U 4QQDA 3LH0A 1BI3A 4F7UG 3TU4K 1LNXA 3PMTA 4JUVA 2BKDN 3UT1A 2K5FA 3CC7T 5GAMd 5LL6S 2LDMA 4BBRM 2PUOB 4RG8A 2RA2A 4JX6A 1E7PA 3JCMP 5GAOp 2HNIA 3OYLA 3RKYA 2DTHA 1JBMA 3KBGA 2XIDA 1VQLT 3M4GA 3QKJA 2RD1A 4KUIA 2F5TX 4OGCA 2DPPB 2KSSA 2KY9A 3V7CA 4OMFB 4RCCA 4BB7A 4NC6A 5GAN8 3OYKA 3LLRA 5CCAA 3OYAA 2JTMA 2FVUA 3HPWA 4PJOD 3QIIA 3CCVA 1VQKA 1YJNA 4M6VA 1K8AU 4L5GA 3QG1A 2DO3A 4M77A 3VYHB 1OZ3A 4JRQA 2K3XA 3NTIA 5LJ3j 1SSFA 4XQ3A 4QVDA 4PKCC 3A5ZB 3PIOA 2X4WA 3MCAB 5A0LA 2GFAA 3JB9F 1M5Q1 3CCEA 4D6WA 2KR6A 1O75A 2QQSA 4M78D 3CBOA 2VXEA 4MMLA 1I81A 3HO8A 3HRTA 3MEVA 5KE3A 1S72A 1VQ6T 1BIAA 4JDSA 2FYKA 3GOXA 2E64A 2ZZDB 3CC4A 5DY9A 4ZTJA 5LJ3d 5J3BA 3ME9A 2KDSA 2L3RA 4M75G 4M77C 5GAMe 1Y07A 1WJRA 2E12A 3BG9A 1VUBA 1N8RC 2YLBA 4L6V5 2C06A 1WGSA 4M78B 1VQOT 2DTIA 3DB3A 3QJYA 3L2UA 5GAN5 4M75F 4ZTFA 4YTLA 3JCMc 2MF2A 4BI8B 2MAMA 4NL2A 2EWNA 4C0FA 1Q86C 3RESA 2BIVA 3UDCA 3A8LB 1NZ9A 2DEQA 2MI6A 3M59A 4DOWA 2KMTA 1Q81C 2OTJT 3JB9H 3QWLA 3C12A 4MDXA 3MHXA 3G4SA 3MEUA 3VYGA 3OYBA 4PJOG 4M7AF 3SB2A 2XDBA 2DXBB 3WVDB 1QP2A 1LJOA 2FB7A 1MGQA 4M77E 3HRUA 5IN1A 2A3LA 3CCUT 5AYFA 3MP6A 3OYEA 1I5LA 2CZ6B 1QW1A 4PJOF 4AKIA 4J6YA 4A4FA 3M55A 4IUUA 4B9XA 5GAMf 5CKDA 3JCMe 2BS3A 2ZPEB 3C4SA 3JSCA 1N27A 4LDUA 2O4XB 1VQNA 2ZGWA 4XTXA 2K5IA 3CMAA 1KC8U 3J7AF 3OMGA 4QW2A 1GXIE 4M78G 3S3OA 4M7AC 3I56T 2RM4A 3C95A 4ZGEB 4LD9K 3CBPA 3VKHA 4L59A 3QUIA 4C5EA 5DLOA 4QQGA 4C0GA 3I55A 2KVQG 4N4GA 4GLKA 2E6NA 5GAN4 1Q82C 3ZFJA 2CGHA 2P0KA 1YBYA 2QQAA 3MP8A 4OB2B 4NL3A 1KD1C 2VUBA 3LW5E 3SWNC 1VQ7A 3JCMf 2PVGB 2EYQA 1H641 5GAMh 3CPFA 3HFNA 4FM4B 3P8DA 4IUQA 2WSEE 3V8KA 2V8IA 3RKWA 2RJCA 4M7DG 4XTUA 3HBLA 1BKBA 4A4GA 2QI2A 1K73U 4XK8E 4A53A 5FU7B 1KG1A 2WJ9A 4OB3B 3MP1A 3QJ6A 2RK1A 2Y4XA 3FB9A 3NTKA 4XTYA 3VUBA 4BI3A 4EMKB 4HT9A 4LDYA 2LX9A 2VGMA 5D6YA 5GANj 1M1KU 4EMHA 3CCJT 2R5AA 5KCHA 1WQ7A 3P8HA 3OS1A 4ATOA 4ELJA 1OZ2A 5CKBA 1VQ9A 3CXCS 3RMQA 2K3YA 2VGNA 2E41A 2VV5A 3CXCA 1VQ8A 4C92A 4V2SA 2AHJB 2QQBA 2PVDB 3RERA 4MMKA 3PIPA 3OY9A 3VV0A 1M1GA 2DD5B 2JNGA 4Z02A 2KMGA 5CKFA 5GANd 5LJ5g 2DKGA 4M7DA 3FC3A 1YITT 1K73C 4JLGA 4LDVA 4P5NA 4BY6B 4LDXA 5CO7A 3QYBA 3OYMA 2JTFA 1NE8A 3HL8A 4J8OA 5D6XA 1XQHA 1W4SA 2HAXA 2XG8D 3QYGB 3JB9D 4J7FA 4PNOA 2KQWA 4C92C 2XHCA 3M56A 1UGSB 4AI6A 4J83A 4OF1A 4C0ZA 4OB0B 3OBYA 2VC8A 4ZGDB 4C8QF 5GAOq 3J81E 1KHCA 4Y28E 2XU8A 3CPWS 2RHXA 4M77D 5LJ3h 5GMKe 3CPWA 3CCMA 4F7UF 3TW6A 5J26A 2QA4A 1BI2A 5J39A 5GAN6 1FX7A 2HBPA 3ER0A 3L2VA 1VQPT 4OB1B 1I4K1 1VQ4A 2V8KA 3SFMA 2X35A 3TEEA 5CVIA 4JJNK 5DLQE 3G6EA 1VQ5A 3PNWC 3H4CA 4QSHA 1QVGA 1JJ2S 2CZ0B 1JJ2A 1AHJB 4MFEA 2QXFA 2X4YA 4ELYC 2OTLT 1YHQT 3X20B 4M77B 2DIQA 5GAN3 1B34A 2K57A 5IAYA 5CK9A 2P0PA 4C8QC 4C92E 3FRNA 1YI2T 1FXXA 5FU6C 2QDJA 4FSXA 3PFSA 1HK9A 1VQMT 3G71T 5GAMg 1G3SA 2BS4A 1HXDA 4JRPA 3CCQA 3L1AA 4M7DE 4E7JA 2RJDA 3JCMd 3CCSA 4GY5A 3CC2A 1BIBA 3JCMJ 3DB4A 2D0QB 5GANe 2KAFA 3G7ZA 3JRZA 3M4YA 1O9SA 5KE2A 5FROA 4XAXB 2EJGA 1JRIA 2DVEA 4II1A 2IG0A 5GMKl 4PLLA 3CCRA 4RMOA 3CD6A 5FRMA 1UGPB 1V29B 2EQUA 1YJWA 2JZ2A 3L42A 5KH6A 2OAUA 4E7LA 4CRIA 3SDZA 4MZTA 3OYNA 3SD4A 2EAYA 2PVOB 2LQKA 2DZCA 5CR2A 5HKCA 1TH7A 2JVVA 2DAQA 2CZ7B 4M77G 1M4ZA 4HL4A 4HNVA 2EQMA 3BFMA 2YHTA 3VYGB 1PSEA 3BDLA 4M75A 1Q7YC 4O6JA 3CCLA 2QFZA 4J6WA 2DIGA 2XKOC 4O5VA 5GANf 2QA4T 4JX5A 1K9MC 3JB9I 1YJ9A 3BW1A 2DJZA 1Y96A 4KBMB 2WSCE 4XTWA 5KCOA 5I2SA 3LWIA 3CCVT 1VQKT 1YJNT 3WVEB 5GAN2 4M7AA 2LCCA 5LJ3g 3CC2T 3QYEA 3LYIA 1IZ6A 3X25B 1BI1A 3HRSA 3OSVA 4RCBA 3HKSA 4M75C 4PJOA 2EJ9A 1ZHIA 3VUZA 2EFIA 3M57A 1N8RU 1KQ1A 3TREA 3UPUA 3CCET 2RO0A 5HK3A 3A8HB 1WJSA 3DL1A 4VUBA 2XICA 3SWNA 5M9OA 5FLXE 1S72T 1YCYA 2ZZDA 3KHIA 3V8LA 2F5KA 3VJPA 5GANh 3CC4T 1M8VA 4J7IA 1NPRA 5CQXA 2IVWA 2L89A 3GLXA 4HCZA 5L8RE 2RB6A 1Q86U 4RG2A 1Q81U 2B8AA 5GMKj 3RIRA 2RI2A 4JS4A 4QVCA 2DD4B 4JX4A 4M78F 3INZA 4JLIA 5CKHA 5GMKm 3CCLT 4PJOC 2D9TA 1U1TA 4ELZC 2CS7A 2M0OA 4M75E 3V8JA 5GAOr 3M53A 2VYTA 4EPCA 4C92D 3QZ5B 2MMPA 3R6OA 1YJ9T 2DXCA 4HCCA 2K4YA 4LD6A 2MWPA 1UB4A 3JCMW 3QXEB 2RHZA 4EDUA 4C0DB 4E7KA 2LC4A 4A4KA 3OYIA 4IUTA 1VIEA 1JB0E 5I2MA 3G4ST 4M7AE 4A54A 3GF5A 2P4TA 3A8OB 4M78C 4C92B 4ZN3A 2ZPIB 3OS0A 2BUDA 5A2QE 4ZGJB 2H3JA 4OGEA 2JN0A 2LT1A 4PJOE 3MEWA 3M9QA 2LCLA 3BG3A 1QVPA 2QEXA 2XDPA 1NJIU 2E5QA 3JAME 3QPHA 2E65A 4IURA 5LJ5j 5GAOl 1VQNT 1LOJA 2ZCFB 1WNLA 2V8JA 3CMEA 4X34A 1Q82U 1Y71A 2ZPBB 1DJ7B 2WACA 3EFSA 3CMAT 2E70A 2RHIA 3F70A 1KD1U 1D3BA 3X26B 3E19A 3OBWA 4XU1A 2GQVA 3BDUA 4E47A 2ZPFB 3H8ZA 1P92A 4MZMA 1QVFS 3JCMh 3NFCA 1QVFA 1Y7XA 3CC7A 3UWNA 1G3TA 3JCMb 1RI0A 2K5LA 2MWOA 3I55T 3DLLA 2GFUA 3BG5A 2RJEA 3RUXA 4Y91A 3AHUA 1VQ7T 4R56A 2X4JA 4LOCA 4XU0A 5EG2A 1M90C 4J6XA 1VIFA 4C92G 2QQ8A 1WPYA 4WF2A 1BI0A 3EAEA 2M9UA 3QZ9B 3L2ZA 4C8QA 2XDDA 2R58A 2R57A 3O8VA 4KUDK 4F7UA 3HB9A 2QDYB 4BBSM 1B34B 4XU3A 4N0AA 3X24B 3QHSA 4EMKA 5GANg 2RI5A 4NS5A 3PMIA 3JCMV 3S3MA 3FEOA 2DXUA 2L5QA 1XTDA 3CBMA 5CKEA 4BUGA 1QVGS 4MZPA 3QBYA 3M54A 3LX7A 3OYGA 3L2RA 1VQ9T 4A4HA 2A7YA 3ZBDA 4C5GA 1VQ8T 3M5AA 2DZ9A 1W2BS 1NPPA 2GCXA 1W2BA 4IKFA 3E9GA 1G5VA 5FU7C 3PGGA 1K8AC 4N0AC 1G3YA 4OP0A 4EMKC 3OYDA 2Y4YA 2EQJA 1VQ6A 2XK0A 4M75D 4C5HA 4BDZA 2PQWA 2HQEA 2EQKA 2HQXA 3LGFA 5GAOm 2QQRA 5LJ5e 4E7HA 3NTHA 4C5IA 5C0MA 2EKOA 2QTXA 4FT2A 2FL7A 3OB9A 3ASKA 1VQOA 4M7AD 4C8QE 1OI1A 3CEYA 1X6OA 4M75B 3JB9G 3CCMT 4BY6C 4XTVA 3QSUA 4F7UE 3V7RA 2FHDA 2RI3A 1VQ4T 4A4EA 3A8MB 4HNUA 3QDRB 4DQ2A 1Y96B 4BE2A 2P0QA 1QP3A 2OTJA 4KT0E 3JCMg 2VXFA 4XTZA 4QQ6A 4N4IA 3WXMB 3L2QA 3G6ET 3OW2S 1VQ5T 3OW2A 2D6FA 5A0DA 2QQ9A 2NLUA 2LTOA 3OYFA 1EIFA 3BY7A 1ZQ1A 2X4XA 4M7AB 3S6WA 1KQSS 1KQSA 4M77F 3CCUA 2R5MA 4JRKA 3JCMQ 4XU2A 4AKGA 1M1FA 1BYMA 2BS2A 5GMKh 4BACA 2QF7A 4Z6YA 3DLMA 3T9NA 5LJ5f 3OYCA 1YI2A 4PJOB 1WQWA 5HK0A 4QVZA 4RKUE 4TVRA 3CCQT 3QO3A 1X75C 3A8GB 1FWZA 3SWNB 4MFDA 1YIJA 3CCST 4X9CA 4M7DC 1OYXA 2JUFA 1X01A 3KXTA 3I56A 4AKHA 4E7IA 2JOYA 3CCRT 4X9DA 4BD3A 2O01E 3CD6T 4N4HA 1XNIA 1YJWT 3DKMA 1U1SA 2I2LA 2ZPHB 5CAIA 4KULA 3N5BB 3QYHB 4BE0A 2DK3A 2M1HA 1Q7YU 4HCBA 1UEBA 3LGLA 4HKEA 1KC8C 4J5YA 5D6WA 4ZN1A 1K9MU 3OA6A 4JRIA 4HNTA 2DXCB 4M7AG 2E1HA 4UC4A 1N9SA 1UGRB 2F69A 3URGA 5LJ5h 5HY6A 5EJCA 5A0GA 2XD0A 1WJQA 4M78A 3OS2A 4MDWA 5IT9E 3OMCA 3JCMX 2WSFE 3HFOA 2RHUA 4MIMA 3GNGA 3P8BB 4B9WA 3L2WA 3GP8A 2LNVA 1N6AA 2E10A 3VKIA 3ZEHA 4OVAA 3H6ZA 4BE1A 3CCJA 4FIBA 3GNFB 4M7DD 5GAN7 4BI4A 2CKKA 1YIJT 1QLBA 2DXBA 3X28B 2PU9B 2RK2A 1N9RA 2EIFA 1R8OB 4LDWA 4PL6A 4DOVA 2HD0A 4EMGA 3LWHA 1U8RA 4Q5WA 1D3BB 2KK4A 4FL6A 1IREB 4FT4A 4CI0C 1M1KC 1YITA 3C94A 3RMSA 4M7DB 2O4XA 4C8QD 2M16A 5LJ3e 2YLCA 4IUVA 3S3NA 1UGQB 3VKGA 1KHIA 4HT8A 3HSBA 2YRVA 3GPLA 4JS5A 2PUKB 2G3RA 2CZ1B 2L8DA 2DD4A 3FJPA 3META 3OSSC 2LQ8A 2Y90A 3HHTB 4IUPA 3PT9A 3MEAA 4M78E 3TCJA 4R55A 4C8QB 2E6ZA 5LJ5d 3TW7A 2K2VA 5FU6B 3KUFA 3RKXA 5GAOn 2GF7A 2CYZB 2EJFA 3E1SA 4F7UB 1VQPA 1M9SA 1MHNA 2ZPGB 1RL2A 2RH2A 5CQYA 3V7SA 4FU6A 4NOYA 1H3ZA 3FIFA 2RJFA 3HP9A 5CIUA 3E9FA 2XI9A 5LJ3f 5GMKi 1VQLA 2OTLA 3EFRA 1YHQA 3FLGA 4PLIA 5FRNA 1NJIC 4C92F 1ZBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVE B;  4OB2 B;  3LW5 E;  3X25 B;  1PSF A;  2PVG B;  4FM4 B;  2WSE E;  3A8M B;  3A8H B;  1QP3 A;  2DD5 A;  4KT0 E;  4XK8 E;  4OB3 B;  2ZZD A;  5L8R E;  2DD4 B;  2PUO B;  4RKU E;  2AHJ B;  2PVD B;  2DD5 B;  3A8G B;  3QZ5 B;  2DXC A;  2DPP B;  3QXE B;  2O01 E;  1JB0 E;  2ZPH B;  3A8O B;  3QYH B;  2ZPI B;  3QYG B;  4ZGJ B;  1UGS B;  4OB0 B;  3VYH B;  2DXC B;  4ZGD B;  4Y28 E;  1UGR B;  2ZCF B;  4OB1 B;  2ZPB B;  1DJ7 B;  3X26 B;  2WSF E;  2ZPF B;  2CZ0 B;  2ZZD B;  1AHJ B;  3X20 B;  4L6V 5;  2DXB A;  3X28 B;  2PU9 B;  1IRE B;  2D0Q B;  3QZ9 B;  3A8L B;  2QDY B;  3X24 B;  1UGQ B;  1UGP B;  3VYG A;  1V29 B;  2DXB B;  3WVD B;  1QP2 A;  2PUK B;  2CZ1 B;  2DD4 A;  2PVO B;  2CZ6 B;  3HHT B;  2ZPE B;  2CZ7 B;  2CYZ B;  2ZPG B;  3VYG B;  1PSE A;  1GXI E;  4ZGE B;  2WSC E; 
#chains in the Genus database with same CATH topology
 4DBF A;  5DM7 R;  3G71 A;  1OU8 A;  1IHV A;  2KYB A;  4M7D F;  3POM A;  1E7O A;  1I8F A;  4EIK A;  2X9H A;  2MPX C;  3NPF A;  1PG5 B;  3CME T;  2RQW A;  1H92 A;  5C6S A;  1G3W A;  1ZUK A;  2NUT B;  3TU4 K;  2JMC A;  4EC8 B;  1RUW A;  3PMT A;  1VQ6 Q;  2BKD N;  3UT1 A;  2K5F A;  4CFU B;  2GQI A;  2PUO B;  1PHT A;  2RA2 A;  1U06 A;  2HNI A;  1B3Q A;  3OYL A;  1X6B A;  2DTH A;  3KBG A;  1AZE A;  1VQL T;  1EFN A;  2F2C A;  4KUI A;  2F5T X;  2KY9 A;  5GAN 8;  2SRC A;  1OKV B;  4FYY B;  3MJX A;  2DJQ A;  3MKD A;  2OTJ Q;  2EBP A;  2DBM A;  2DO3 A;  5HNB B;  4JRQ A;  1PWT A;  1SSF A;  4QVD A;  1UJ0 A;  2GFA A;  1VYU A;  1M5Q 1;  2G9X B;  1YIJ Q;  2VXE A;  2W2H A;  4MML A;  3HO8 A;  3HRT A;  1S72 A;  4JDS A;  3GOX A;  2HL3 A;  3I56 Q;  3CC4 A;  2HQH A;  3BLH B;  1QCN A;  2F1L A;  1WJR A;  1P5E B;  1VUB A;  2YLB A;  2C06 A;  1C9B A;  2MF2 A;  4DBH A;  4AFQ C;  1G3N C;  1Q81 C;  3M59 A;  2C5V B;  2KMT A;  4ROC A;  1V1C A;  4EOO B;  1H8K A;  3G4S A;  4PJO G;  4M7A F;  7AT1 B;  3SB2 A;  4RTX A;  2FB7 A;  2A3L A;  1X69 A;  4HVU A;  1TWB A;  4B9X A;  4BCM B;  3C4S A;  1WIE A;  4LDU A;  4QW2 A;  2RMO A;  3S3O A;  2RM4 A;  4PFP A;  4ZGE B;  5IHK A;  4L59 A;  2YT6 A;  1D3U B;  4C5E A;  1OPL A;  5GAN 4;  4GLK A;  1YCS B;  2BTT A;  4FW2 A;  2PVG B;  2C5O B;  5DQW A;  4IUQ A;  3P8D A;  1YN8 A;  2AKL A;  1AWJ A;  3V8K A;  3HBL A;  1VQP Q;  3VS2 A;  4A53 A;  1NG2 A;  4EMK B;  4BI3 A;  1M1K U;  4EMH A;  2JJ9 A;  4CRL B;  1VQL Q;  1WA7 A;  4ATO A;  1OZ2 A;  3RMQ A;  2K3Y A;  2VV5 A;  4V2S A;  3U23 A;  2PVD B;  4MMK A;  1WLP B;  2DKG A;  4M7D A;  1TFB A;  2ROL A;  2FZG B;  1D09 B;  1ZSZ A;  3QYB A;  2RF0 A;  3EHQ A;  3QHR B;  2HAX A;  2XG8 D;  5FWB A;  3VRZ A;  4J7F A;  3JB9 D;  1H28 B;  2R7G A;  1WFW A;  4LUE A;  1KHC A;  2XU8 A;  2PK2 A;  1NJI U;  1FX7 A;  1FMW A;  1WYX A;  1X6G A;  1H4L D;  2A08 A;  2WPA B;  1FMV A;  1VQ5 A;  4G6L B;  3H4C A;  2QA4 Q;  3M0T A;  1AHJ B;  2M02 A;  2QXF A;  4Z8A A;  4ELY C;  1JJ2 A;  1YHQ T;  2P0P A;  4C8Q C;  1YI2 T;  1YJN Q;  2BS4 A;  3H0F A;  1SRM A;  1K8A R;  1OX8 A;  3JCM d;  3CC2 A;  3JCM J;  2KAF A;  3G7Z A;  5FRO A;  1D0X A;  4XAX B;  5GMK l;  2IG0 A;  1Y57 A;  4PLL A;  1MMN A;  4RMO A;  5KYU A;  1MMD A;  3CCR A;  3CD6 A;  5IXF A;  3L42 A;  1UJY A;  4MZT A;  3OYN A;  3SD4 A;  2EAY A;  5CR2 A;  1WXU A;  2HEQ A;  4BCP B;  2JVV A;  4M4Z A;  2CZ7 B;  4AFS C;  2OI3 A;  1OL2 B;  2UZE B;  2YRC A;  1Q7Y C;  1IRX A;  1TG0 A;  2DIG A;  2HDA A;  4J6W A;  1K9M C;  2D1X A;  3JB9 I;  2M51 A;  5GJV B;  1YJ9 A;  3DDQ B;  1MND A;  3BW1 A;  4F16 A;  4HCB A;  1WX6 A;  1BK2 A;  5I2S A;  5GAN 2;  2O9S A;  4M7A A;  1KFZ A;  5AT1 B;  2IW9 B;  1GFC A;  3LYI A;  1BI1 A;  4RTV A;  2UZB B;  3GTM S;  1AWW A;  3HKS A;  2FO0 A;  2EJ9 A;  3VUZ A;  3M0R A;  2J7I A;  1MV0 B;  1N8R U;  1KQ1 A;  1RLQ C;  3TRE A;  3UPU A;  2XIC A;  2K79 A;  5FLX E;  3KHI A;  2F5K A;  1M8V A;  2BKZ B;  1Q86 R;  2DM1 A;  2RI2 A;  4JX4 A;  3I55 Q;  3INZ A;  5CKH A;  5GMK m;  4OMN A;  3NGP A;  3RBB B;  3V8J A;  1VQ7 Q;  3M0Q A;  2XMF A;  4EPC A;  2FZC B;  2MMP A;  2K4Y A;  3ULR B;  1UB4 A;  2KYM A;  4E7K A;  4IUT A;  1VIE A;  1H1R B;  5I2M A;  2DET A;  1IGQ A;  2P4T A;  4BCF B;  3OS0 A;  4RUG A;  5A2Q E;  2A28 A;  2QK0 A;  2JN0 A;  2LCL A;  1RAI B;  2DL7 A;  3QPH A;  2EVR A;  1NM7 A;  4X34 A;  3CMA T;  1DJ7 B;  1NYF A;  1D3B A;  2GQV A;  2LQN A;  2F2W A;  1QVF S;  3PO3 S;  1Y7X A;  3JCM b;  1RI0 A;  2K5L A;  3DLL A;  3AHU A;  3A98 A;  1X2Q A;  4R56 A;  4IIM A;  3H41 A;  2QQ8 A;  1Z9Q A;  2XDD A;  2Z0W A;  2PHG A;  3EFO A;  1VQ4 Q;  2QDY B;  3GBQ A;  1B34 B;  4XU3 A;  4N0A A;  4E7S A;  4J9G A;  2VVK A;  4BY1 X;  2CH4 A;  2VWF A;  4MZP A;  3OYG A;  3L2R A;  1VQ9 T;  2A7Y A;  4KH1 B;  2I40 B;  4C5G A;  1VQ8 T;  4R0K A;  2DZ9 A;  1SF9 A;  4RTZ A;  4IKF A;  1Y0M A;  5FU7 C;  9ATC B;  2NWM A;  3QWY A;  3LQ5 B;  2EQJ A;  2J6F A;  2YUN A;  3MY1 B;  4D8K A;  5LJ5 e;  2NUT A;  4KRT A;  2FL7 A;  2DRM A;  1VQO A;  2WIH B;  4XTV A;  2IPO B;  4F7U E;  4GLM A;  2WHB B;  1Y96 B;  2JM8 A;  3BHU B;  3WXM B;  3G6E T;  2CH4 W;  2NLU A;  1KQS S;  2V1R A;  4JRK A;  4DEY A;  1EX4 A;  1ABO A;  2BS2 A;  4CFN B;  4BAC A;  2DL8 A;  3EGD B;  2KXC A;  2QF7 A;  3H9N A;  3T9N A;  2HSP A;  4QT7 A;  1WQW A;  3DJB A;  4RKU E;  3CCQ T;  4CFV B;  3QO3 A;  1X75 C;  3A8G B;  3SWN B;  4MFD A;  1OV3 A;  2W9Z A;  1ZLM A;  4X9D A;  1XNI A;  3DKM A;  1U1S A;  2I2L A;  2A36 A;  1UEB A;  2BPM B;  1AIS B;  4J5Y A;  1GRI A;  1G8X A;  3OA6 A;  2DXC B;  1UFF A;  2HL5 C;  1OPK A;  2F69 A;  3URG A;  3NDQ A;  1WJQ A;  3OS2 A;  3CXC P;  3JCM X;  2WSF E;  3VS4 A;  3P8B B;  4MIM A;  3GNG A;  4BCQ D;  3CCL T;  3GP8 A;  2V22 B;  1N6A A;  4OVA A;  3H6Z A;  4BE1 A;  4BI4 A;  2CKK A;  1QLB A;  2NUZ A;  1K73 C;  1K4U S;  2EIF A;  4EMG A;  2HD0 A;  1VYV A;  2J05 A;  3I9Q A;  4FL6 A;  4CXA B;  4FT4 A;  2AZS A;  1YIT A;  1RAC B;  4M7D B;  5LJ3 e;  3CPW P;  3S3N A;  1YFN A;  3GPL A;  3FJP A;  1HSQ A;  3KFV A;  3CC7 Q;  4IUP A;  2EYX A;  3TW7 A;  2K2V A;  1ZP2 A;  4F7U B;  1M9S A;  1MHN A;  2ZPG B;  3RGF B;  4BCO B;  1I0C A;  4NOY A;  4DBR A;  2RJF A;  3HP9 A;  1MNE A;  4OMP A;  4M7D G;  1FXX A;  1UNL D;  2BZX A;  3O5Z A;  4HA8 A;  3MO8 A;  4LE9 A;  1LCK A;  4EOJ B;  4ME7 A;  2LRQ A;  2FG0 A;  5I21 A;  2QEX T;  3OS5 A;  4DA4 A;  1AD6 A;  4C0D C;  2G77 A;  1UUE A;  1XO2 A;  1FKM A;  3LH0 A;  1BI3 A;  4F7U G;  1AVZ C;  4JUV A;  3M03 A;  2KRM A;  1KQS P;  2ED1 A;  6AT1 B;  2LDM A;  4BBR M;  1E7P A;  1RAG B;  3JCM P;  2GNC A;  3BLQ B;  3PVL A;  2DIL A;  1JBM A;  2SEM A;  2XID A;  2DL4 A;  2MOX A;  1UTI A;  4OGC A;  2DPP B;  3FJ5 A;  2JTM A;  4KGV B;  3QII A;  4PFZ A;  3CCV A;  5FGK B;  1VQK A;  1K8A U;  4L5G A;  2EGA A;  1OX9 A;  3CCU Q;  3TN8 B;  1JO8 A;  3VYH B;  2V1Q A;  1K1Z A;  2K3X A;  5LJ3 j;  4XQ3 A;  2KE9 A;  3CCE A;  2CSQ A;  2KR6 A;  3K7A M;  2QQS A;  4M78 D;  1I07 A;  1VYW B;  1VQ6 T;  4OMM A;  1BIA A;  2FYK A;  2E64 A;  2FRW A;  2KDS A;  5L23 A;  4M77 C;  3EH2 A;  4Y92 A;  2E12 A;  4L6V 5;  1ZA1 B;  1WGS A;  3EJ1 B;  2MYS A;  3L2U A;  5GAN 5;  4BI8 B;  2EWN A;  1K9M R;  1Q86 C;  3RES A;  2BIV A;  4DOW A;  3A8L B;  2OTJ T;  1M3A A;  3C12 A;  4MDX A;  3MHX A;  4IIO A;  2X1N B;  2JGZ B;  1KQ2 A;  5IN1 A;  4M77 E;  2CZ6 B;  1QW1 A;  4J6Y A;  4IUU A;  4II5 B;  2BS3 A;  2ZPE B;  3JSC A;  1UEC A;  1N27 A;  2D0N A;  1VQN A;  2ZGW A;  3OMG A;  3UAT A;  1KC8 R;  1JSU B;  3D7S B;  3I56 T;  3C95 A;  2W99 A;  4HXJ A;  3QUI A;  5DLO A;  1WXB A;  4QQG A;  4KRD B;  4C0G A;  2O9V A;  1PRL C;  2CSI A;  2KVQ G;  4N4G A;  3ZFJ A;  2IW6 B;  2CGH A;  3TNH B;  4NL3 A;  4OB2 B;  3LW5 E;  1W98 B;  3BHT B;  3UA7 A;  2WSE E;  1I5O B;  2K7A A;  4D8D A;  2QI2 A;  1KG1 A;  4OB3 B;  2CP6 A;  4FX3 B;  3FB9 A;  3NTK A;  4RTW A;  1W2B P;  4HT9 A;  2VGM A;  5GAN j;  3AT1 B;  5KCH A;  2OTL Q;  1PD1 A;  2M0Y A;  1H1P B;  4LN2 A;  2EW3 A;  3CXC A;  2E41 A;  4FW1 A;  2AHJ B;  3G71 Q;  1M1G A;  2I0N A;  5CKF A;  1X2K A;  5LJ5 g;  4JLG A;  4LDV A;  4BY6 B;  2MK5 A;  5CO7 A;  2JTF A;  2JTE A;  4J8O A;  1W4S A;  2KNB B;  3QYG B;  1JST B;  1GCP A;  2YDL A;  3MPU B;  4C92 C;  1UGS B;  3OBY A;  3J81 E;  3CPW A;  5LJ3 h;  3CCM A;  5GMK e;  4F7U F;  5J26 A;  2EKH A;  4AT1 B;  5J39 A;  5GAN 6;  1VQP T;  2HBP A;  1RLP C;  2V8K A;  3TEE A;  4ANJ A;  5DLQ E;  4JJN K;  3PNW C;  1TOV A;  1CKA A;  2DX1 A;  2EQI A;  2LP5 A;  1AEY A;  3X20 B;  4M77 B;  1B34 A;  5CK9 A;  4C92 E;  1YWO A;  2QDJ A;  4F17 A;  4FSX A;  1FYN A;  2KEA A;  1HK9 A;  1VQM T;  4JRP A;  3L1A A;  3DTO A;  1UDL A;  4GY5 A;  3CCS A;  2LZ6 B;  3LH5 A;  5FRM A;  1UGP B;  2PJQ A;  2JZ2 A;  2OAU A;  1S72 Q;  3A1P A;  4CRI A;  3CC4 Q;  1TU0 B;  2LQK A;  2DZC A;  1TH7 A;  1E9H B;  1KK7 A;  4M77 G;  1UGV A;  2DYB A;  4HNV A;  2C4G B;  1H25 B;  3I5R A;  1PSE A;  2QFZ A;  4O5V A;  2XKO C;  5GAN f;  2QA4 T;  5HVY B;  4JX5 A;  1OIU B;  3G33 B;  5KCO A;  2DJZ A;  1Y96 A;  2K3B A;  4XTW A;  2O2O A;  3G4S Q;  2RPN A;  1YJN T;  1WHJ A;  3WVE B;  1GBR A;  2LCC A;  5LJ3 g;  3CC2 T;  3HRS A;  3EGD A;  4RCB A;  4M75 C;  1ZHI A;  2EFI A;  1UE9 A;  2RO0 A;  1W6X A;  2VAS A;  1WJS A;  3DL1 A;  3SWN A;  3CQT A;  3VJP A;  5GAN h;  2IVW A;  3GLX A;  2RB6 A;  5IDP B;  4RG2 A;  1Q81 U;  2B8A A;  5GMK j;  3RIR A;  4JS4 A;  1W70 A;  3B57 A;  4JLI A;  2PMI B;  1CSK A;  1RI9 A;  2D9T A;  4ELZ C;  2M0O A;  4M75 E;  1YJ9 T;  3BE3 A;  2DXC A;  1RAH B;  2OJ2 A;  4PJM A;  2DYI A;  4EOQ B;  3JCM W;  4EDU A;  1GCQ C;  4M78 C;  4C92 B;  4ZN3 A;  1K73 R;  1W1F A;  2H3J A;  2LJ0 A;  2QGS A;  1JQQ A;  3JAM E;  2CUB A;  2E65 A;  2V8J A;  4EOL B;  1WNL A;  3CME A;  1Y71 A;  2ZPB B;  2WAC A;  3UF4 A;  2E5K A;  2RHI A;  1Q82 R;  3F70 A;  2OX7 A;  3X26 B;  1VQM Q;  3OBW A;  1KSW A;  3BDU A;  2J6O A;  2ZPF B;  2CUD A;  1TUC A;  1M30 A;  3DOG B;  3UWN A;  1G3T A;  3I55 T;  2GFU A;  4F7J B;  4Y91 A;  2DA9 A;  1VQ7 T;  3O0G D;  5EG2 A;  4XU0 A;  1M90 C;  1M3C A;  1X27 A;  2BZ8 A;  2OAW A;  4C92 G;  1WPY A;  5KYN A;  3MY5 B;  4KUD K;  4F7U A;  3EGX B;  1BCO A;  3HB9 A;  5GAN g;  1WHG A;  4NS5 A;  3JCM V;  1VQ5 Q;  1RAF B;  1XTD A;  4BUG A;  1OUL A;  1OI9 B;  1TXQ A;  3LX7 A;  1W2B A;  5IF1 B;  3E9G A;  1G5V A;  1K0S A;  1K9A A;  2DBK A;  3CC2 Q;  4C5H A;  2PQW A;  4I3Z B;  2HQE A;  1ZUY A;  2NUP A;  3VS1 A;  3CCR Q;  1H26 B;  4YOO A;  3LGF A;  3CD6 Q;  2QQR A;  4E7H A;  2QTX A;  1HD3 A;  4M7A D;  4C8Q E;  2CP0 A;  4M75 B;  4J9F A;  5BNJ B;  3QSU A;  3V7R A;  4F04 B;  2RI3 A;  1VQ4 T;  2X3X D;  4QQ6 A;  3L2Q A;  3OW2 S;  5A0D A;  1EIF A;  4AG1 C;  1SRL A;  4M77 F;  3JV3 A;  2R5M A;  1YJ9 Q;  5IH2 A;  4AKG A;  4Z89 A;  5GMK h;  4QVZ A;  4DBQ A;  4TVR A;  2CCI B;  1UHF A;  1YP5 A;  1OYX A;  4J9C A;  2JUF A;  2W9F A;  2KRO A;  4OML A;  1JOW A;  2JM9 A;  4AKH A;  4OMQ A;  2ABL A;  3THK A;  4BD3 A;  2WMB B;  1F1B B;  1YJW T;  2PZ1 A;  3N5B B;  1Q7Y U;  1KC8 C;  4HKE A;  1K9M U;  3TSW A;  4HNT A;  4YC3 B;  4UC4 A;  2XD0 A;  4F6S B;  5EJC A;  2CP5 A;  4NST B;  4CFW B;  3NHN A;  4B9W A;  2QGG A;  2ED0 A;  1SKU B;  2E10 A;  1VOL A;  3GNF B;  2DF6 A;  4F14 A;  1UHC A;  4LDW A;  1R8O B;  3PVQ A;  4J9D A;  4PL6 A;  1H3H A;  2VB6 A;  2KK4 A;  2AKK A;  1OGU B;  2WFY B;  2E3I A;  2ROT A;  3C94 A;  2M16 A;  1VOM A;  2DMO A;  1UGQ B;  1GH6 B;  4F6W B;  1KHI A;  3HSB A;  3EG9 A;  2KRN A;  4EOP B;  3EG0 A;  3OSS C;  4UN0 A;  2Y90 A;  1OOT A;  2RQV A;  3VS7 A;  4C8Q B;  2E6Z A;  4LXC A;  5LJ5 d;  4BCN D;  1U5S A;  3RKX A;  5GAO n;  2CYZ B;  1Q95 G;  2CT4 A;  2RH2 A;  1YNZ A;  4AFU C;  2HBW A;  5GMK i;  1IXD A;  1YHQ A;  4PLI A;  1D1A A;  2QGF B;  4C92 F;  2F2V A;  3OQ5 A;  1YI2 A;  2LT4 A;  3Q1J A;  3OYJ A;  1QKX A;  3PTA A;  4CC4 B;  3M0S A;  5I22 A;  3PE0 A;  5GAM j;  4CFU D;  1OKW B;  4BDY A;  2DXT A;  4J9B A;  3JB9 J;  4C8Q G;  1WHM A;  4QQD A;  4PJL A;  4LNP A;  4DEX A;  3CC7 T;  1FIN B;  1T0H A;  5LL6 S;  1ZSZ C;  5GAO p;  1YJW Q;  1VQO Q;  3RKY A;  3M4G A;  2RD1 A;  3KXT A;  2KSS A;  3TQ7 P;  3LLR A;  3OYA A;  2FZK B;  2FVU A;  4PJO D;  3RDV A;  1ZBJ A;  1OEB A;  4M77 A;  1OZ3 A;  2LQW A;  2YUP A;  1G2B A;  1ZA2 B;  2EGE A;  4PKC C;  2GBQ A;  3MCA B;  5A0L A;  3PIO A;  1PKD B;  4OGR B;  1G83 A;  1I81 A;  3MEV A;  3VS0 A;  5KE3 A;  4JJC A;  1IHW A;  2H3E B;  2DE0 X;  5LJ3 d;  5J3B A;  3E2U A;  1RAA B;  2VKN A;  2AT1 B;  1Y07 A;  2DTI A;  3DB3 A;  4M75 F;  4YTL A;  2RQU A;  3SEM A;  4C0F A;  1NZ9 A;  1T0J A;  2DEQ A;  2MI6 A;  4BCM D;  2HMA A;  3JB9 H;  3MEU A;  3OYB A;  2XDB A;  2DXB B;  1LJO A;  3CCU T;  3HRU A;  1I5L A;  3OYE A;  3M55 A;  4Z88 A;  4BCJ B;  5GAM f;  1ABQ A;  3EOC B;  1ZUU A;  1QVF P;  2O4X B;  2A0F B;  4XTX A;  3VS3 A;  3CMA A;  1GXI E;  1BU2 A;  4M7A C;  4CFM B;  4E7Z A;  1YIT Q;  3CBP A;  2C0I A;  1Q82 C;  2CRE A;  3MP8 A;  2QQA A;  1KD1 C;  2VUB A;  4QKU A;  4ROE A;  3JCM f;  3QDF A;  1HJD A;  5GAM h;  3HFN A;  1TUD A;  4FM4 B;  1KJW A;  1MMG A;  2V8I A;  2RJC A;  2ENM A;  4XTU A;  3RKW A;  1BKB A;  4A4G A;  1K73 U;  1LVK A;  4XK8 E;  5FU7 B;  2WJ9 A;  2Y4X A;  2COY A;  2KGT A;  2L2P A;  5IDN B;  3CCJ T;  2YWW A;  1M1K R;  1VQ9 A;  5EFQ B;  2JT4 A;  1VQ8 A;  4C92 A;  2KBT A;  3PIP A;  3OY9 A;  2QTV A;  3VV0 A;  2DD5 B;  2JNG A;  2KMG A;  5GAN d;  4LDX A;  1QCO A;  3OYM A;  1SG5 A;  1XQH A;  4LUD A;  2NUP B;  5I5Z B;  1M90 R;  2DER A;  2XHC A;  1H1Q B;  4FYW B;  4J83 A;  4OB0 B;  1E6H A;  4C8Q F;  4Y28 E;  3VS6 A;  2RHX A;  2DRK A;  1BI2 A;  3L2V A;  1NJI R;  1I4K 1;  2JS0 A;  3EHR A;  1D0Y A;  5CVI A;  3G6E A;  5KYW A;  4QSH A;  1JJ2 S;  2CZ0 B;  2OTL T;  1PKS A;  3REA B;  1BU1 A;  3EGX A;  2DIQ A;  2K57 A;  3CCV Q;  1M27 C;  1ACM B;  5FU6 C;  1VQK Q;  3PFS A;  1JXO A;  3G71 T;  5GAM g;  1HXD A;  4F7S B;  3CCQ A;  5HBH B;  2KI7 A;  4E7J A;  3DB4 A;  2D0Q B;  5GAN e;  1IO6 A;  2P84 A;  3JRZ A;  2EJG A;  2I53 A;  1JRI A;  1WZO A;  1PRM C;  2PNI A;  4AG2 C;  3CCE Q;  4EOI B;  2X51 A;  1V29 B;  2EQU A;  5KH6 A;  4E7L A;  2WMA B;  3SDZ A;  1OQK A;  2PVO B;  5HBJ B;  2LMJ A;  2G6F X;  5HKC A;  2EUF A;  8AT1 B;  3I35 A;  2DAQ A;  4HL4 A;  2YHT A;  3VYG B;  1VYT A;  4M75 A;  2V26 A;  2BE7 D;  4O6J A;  3CCL A;  1GL5 A;  4BCG B;  2MIO A;  1ZSG A;  4KBM B;  3LWI A;  2WSC E;  2B86 A;  2IN3 A;  2RQR A;  2PTK A;  4AMC A;  2WXV B;  1SSH A;  4ROD A;  3QYE A;  1IZ6 A;  3X25 B;  3UA6 A;  3REB B;  3CCJ Q;  2QYZ A;  3M57 A;  2FPF A;  1VQN Q;  2CT3 A;  2W10 A;  5KYY B;  4BCK B;  1S72 T;  2LX7 A;  1H27 B;  2ZZD A;  2DL3 A;  3V8L A;  2QAS A;  2QDL A;  3CC4 T;  2H8H A;  5CQX A;  2L89 A;  1Q86 U;  3EG9 B;  1GCQ A;  5L8R E;  2B9R A;  1CKB A;  3RR6 A;  4PJO C;  5GAO r;  2CS7 A;  3M53 A;  2WEV B;  3QZ5 B;  1TTH B;  1YWP A;  5GJW B;  2UZD B;  4LD6 A;  2MWP A;  4C0D B;  2LC4 A;  3G4S T;  5HCK A;  1JB0 E;  2LW4 A;  2LJ1 A;  4RTT A;  4A54 A;  3A8O B;  2J06 A;  1AZG B;  2BUD A;  2QG9 B;  4ZGJ B;  4OGE A;  4PJO E;  3MEW A;  3M9Q A;  2QEX A;  2XDP A;  4IUR A;  3BHV B;  2ZCF B;  2COZ A;  3EFS A;  1Z9Z A;  2E70 A;  1QWE A;  3TNI B;  3H8Z A;  1P92 A;  3NFC A;  1QVF A;  3EG2 A;  1AD5 A;  2MWO A;  1D1C A;  3BG5 A;  2RJE A;  2EGC A;  1E6G A;  2X4J A;  4J6X A;  4OR5 B;  4C8Q A;  3CCM Q;  3QZ9 B;  2CP2 A;  3L2Z A;  2L0A A;  2R58 A;  1SEM A;  1RAB B;  4FYX B;  1PCX A;  2RI5 A;  4YOS A;  3PMI A;  5CKE A;  1IGU A;  1QVG S;  3QBY A;  3M54 A;  2DFU A;  1D0Z A;  4Y72 B;  2LCS A;  1MV3 A;  4EOS B;  3M5A A;  1NPP A;  3EG3 A;  1GUX B;  4EMK C;  1M3B A;  2AIR B;  2K2M A;  2BZY A;  2Y4Y A;  3CCS Q;  1VQ6 A;  4BDZ A;  1AOJ A;  2C0O A;  4J9I A;  2HQX A;  1H1S B;  2EKO A;  3OB9 A;  1OI1 A;  3CEY A;  2CP3 A;  4HCK A;  4A4E A;  3A8M B;  3QDR B;  4BE2 A;  2P0Q A;  2OTJ A;  3JB9 F;  2VXF A;  4JZ3 A;  4XTZ A;  4N4I A;  1VQ5 T;  3TVT A;  2D6F A;  1TD6 A;  2AZV A;  3OYF A;  2FPD A;  3S6W A;  4CC2 A;  2NYS A;  1KQS A;  3JCM Q;  4XU2 A;  1M1F A;  1H24 B;  4Z6Y A;  3DLM A;  4PJO B;  4ZNX A;  4EON B;  1YIJ A;  1FWZ A;  3EG1 A;  2JXB A;  1X01 A;  4KRC B;  3I56 A;  4E7I A;  2JOY A;  3CCR T;  5EC7 A;  3CD6 T;  1FVV B;  3QYH B;  2M1H A;  4PJJ A;  4B6M A;  4ZN1 A;  5D6W A;  1TUG B;  4JRI A;  2E1H A;  4JPB W;  5HY6 A;  5A0G A;  4MDW A;  3HFO A;  2RHU A;  3L2W A;  4FSS A;  4BY7 X;  3ZEH A;  2YUQ A;  2JW4 A;  4A63 B;  1EZZ B;  4M7D D;  5GAN 7;  2K6D A;  2HZY A;  2DXB A;  3X28 B;  2PU9 B;  1N9R A;  3SHW A;  1U8R A;  4DOV A;  3LWH A;  4BCQ B;  1M2O A;  4Q5W A;  1MUZ A;  5FWC A;  2C5X B;  4CI0 C;  4RTU A;  1M1K C;  3TSZ A;  2O4X A;  3CME Q;  2JMA A;  3VKG A;  1ENW A;  4HT8 A;  1QQJ A;  2YRV A;  2DL5 A;  1KD1 R;  2PUK B;  5LMK B;  2DD4 A;  2LQ8 A;  3HHT B;  3PT9 A;  1QVG P;  4M78 E;  4R55 A;  1A0N B;  2GF7 A;  1T3S A;  1VQP A;  5CQY A;  8ATC B;  2HKQ B;  4BCH B;  1M8M A;  3E9F A;  5KYW B;  1VQL A;  2W0Z A;  3EFR A;  3FLG A;  5FRN A;  1O9K B;  4TTH A;  1NJI C;  2LVM A;  3FDR A;  1VQM A;  2DTO A;  2RHY A;  3M58 A;  3HZJ A;  3GIB A;  2IIM A;  2YUO A;  2HSE B;  1PSF A;  3OYH A;  3OYY A;  5L2W B;  3VU3 C;  2DD5 A;  1XOV A;  3J80 E;  4HLQ A;  1M90 U;  5LQF B;  1LNX A;  3VRY A;  2FEI A;  5GAM d;  1OU9 A;  4RG8 A;  2PK9 B;  4JX6 A;  1NYG A;  1R77 A;  1NEB A;  3IQL A;  3QKJ A;  4RTY A;  4BB7 A;  2QA4 A;  3V7C A;  3OYK A;  4OMF B;  4RCC A;  4NC6 A;  5CCA A;  1VIN A;  3HPW A;  1UG1 A;  1SHG A;  1YJN A;  4M6V A;  2EYW A;  4F7N B;  1K76 A;  2KT8 A;  3NMZ C;  1F5Q B;  3QG1 A;  2C5N B;  2ATC B;  2CJM B;  2DNU A;  3NTI A;  3A5Z B;  2X4W A;  2ESW A;  4D6W A;  1O75 A;  2QAZ A;  3CBO A;  1WDX A;  2ZZD B;  5HBE B;  5DY9 A;  4ZTJ A;  2JS2 A;  1QMC A;  3ME9 A;  2KXD A;  2L3R A;  5KYX A;  4M75 G;  1IB8 A;  5GAM e;  1N8R C;  2X3W D;  3BG9 A;  4M78 B;  1VQO T;  3QJY A;  1T3L A;  4ZTF A;  3JCM c;  1PM3 A;  2MAM A;  4EOR B;  4NL2 A;  3UDC A;  1BB9 A;  1M2V A;  1PKT A;  4BCI B;  3QWL A;  3BLR B;  3VYG A;  2D8J A;  1QP2 A;  3WVD B;  1LPL A;  1MGQ A;  5AYF A;  3MP6 A;  4PJO F;  4AKI A;  4A4F A;  5CKD A;  4EC9 B;  3JCM e;  2COW A;  1UNH D;  2K5I A;  5IHY A;  1KC8 U;  3J7A F;  4M78 G;  4ESR A;  2GTJ A;  4LD9 K;  3VKH A;  5KYY A;  3I55 A;  2E6N A;  1WXT A;  2P0K A;  1YBY A;  4WTO B;  1VQ7 A;  3SWN C;  1J3T A;  2WIP B;  2A37 A;  2EYQ A;  1H64 1;  4WCI A;  3CPF A;  2IVX A;  5ICP B;  3RNJ A;  3MP1 A;  3QJ6 A;  4XTY A;  2RK1 A;  3VUB A;  3DDP B;  4LDY A;  2LX9 A;  5D6Y A;  2IW8 B;  2R5A A;  1WQ7 A;  3P8H A;  4PFO A;  3OS1 A;  4ELJ A;  1YHQ Q;  5CKB A;  5HQ0 B;  3CXC S;  1YI2 Q;  2VGN A;  1TSF A;  2QQB A;  3RER A;  1OIY B;  4Z02 A;  1B7T A;  4KGX B;  4EOK B;  3FC3 A;  1YIT T;  4F70 B;  1WHH A;  4P5N A;  2D8H A;  2EYY A;  1NBE B;  1NE8 A;  3HL8 A;  5D6X A;  3I5S A;  1JKW A;  4PNO A;  2C0T A;  2KQW A;  3M56 A;  4AI6 A;  4OF1 A;  4C0Z A;  3OW2 P;  3EID B;  2VC8 A;  4ZGD B;  3CPW S;  5GAO q;  2ZAE A;  4M77 D;  4HCC A;  3TW6 A;  4M7D C;  3ER0 A;  4OB1 B;  5DQV A;  1VQ4 A;  3M0P A;  3SFM A;  1XJW B;  2X35 A;  4E6R A;  2O31 A;  1S1N A;  1QVG A;  1C1A A;  2X4Y A;  4MFE A;  5GAN 3;  5IAY A;  1K0X A;  3FRN A;  1WHL A;  1G3S A;  4ORZ A;  2P4R A;  2RNA A;  1AWX A;  4M7D E;  2RJD A;  2CCH B;  1BIB A;  2GGR A;  3M4Y A;  4PK4 A;  1O9S A;  5KE2 A;  5IT9 E;  3EH1 A;  4II1 A;  2DVE A;  4F6U B;  1C0M A;  1GUX A;  2F2X A;  1YJW A;  2E4H A;  1C6V X;  1RAD B;  1JU5 C;  2EPD A;  3QHW B;  4FCY A;  1M4Z A;  1AWO A;  2EQM A;  3BFM A;  2MCN A;  5I11 A;  2KR3 A;  2DLP A;  3QWX X;  3BDL A;  1ZX6 A;  4J9E A;  1QLY A;  2AK5 A;  2DME A;  1V76 A;  3CCV T;  1VQK T;  2KRS A;  4HVV A;  4FYV B;  3MIA B;  3MI9 B;  3OSV A;  3H0H A;  4PJO A;  2L3P A;  4HVW A;  3CCE T;  5HK3 A;  3A8H B;  3CMA Q;  4VUB A;  2CP7 A;  5M9O A;  1YCY A;  1GY3 B;  1QCF A;  4J7I A;  1D1B A;  1NPR A;  2E3H A;  4YOZ A;  3G1J A;  4HCZ A;  4QVC A;  1Q81 R;  2DD4 B;  5IHI A;  1RAE B;  4GBQ A;  1AT1 B;  4M78 F;  4AFZ C;  4CC7 A;  1U1T A;  4KGZ B;  2VYT A;  4C92 D;  3R6O A;  1PC0 A;  5IHN A;  3QXE B;  2RHZ A;  1QWF A;  4A4K A;  3VS5 A;  3OYI A;  1X43 A;  4M7A E;  3GF5 A;  2ZPI B;  5ECA A;  1GBQ A;  1KXU A;  2LT1 A;  2DEU A;  3BG3 A;  1QVP A;  2E5Q A;  1VQ9 Q;  2RQT A;  5LJ5 j;  1ZSZ B;  5GAO l;  1VQN T;  1VQ8 Q;  1LOJ A;  1Q82 U;  1TS9 A;  1OL1 B;  1KD1 U;  3C0C A;  1PD0 A;  3E19 A;  3F5X B;  4XU1 A;  2LNH B;  4E47 A;  2L3S A;  2J6K A;  4BXX X;  4MZM A;  4K11 A;  3JCM h;  3CC7 A;  1BCM A;  1WI7 A;  2YRD A;  3RUX A;  2FPE A;  1QMZ B;  2BE9 B;  5CEI B;  4LOC A;  4JJB A;  4CC3 A;  1VIF A;  4WF2 A;  1N5Z A;  4F7L B;  1U3O A;  1SPK A;  1BI0 A;  3EAE A;  2K9G A;  2M9U A;  2R57 A;  3O8V A;  2YSQ A;  4BBS M;  3X24 B;  3QHS A;  4EMK A;  1SHF A;  3G6E Q;  3S3M A;  3FEO A;  2DXU A;  2L5Q A;  3CBM A;  1JEG A;  2RN8 A;  4A4H A;  1O9K A;  3ZBD A;  1W2B S;  2GCX A;  3CCQ Q;  4EOM B;  2YXY A;  5KYU B;  3PGG A;  1VA7 A;  4N0A C;  1G3Y A;  4OP0 A;  3OYD A;  1K8A C;  1BBZ A;  3H0I A;  2XK0 A;  4M75 D;  4ELL A;  2EQK A;  2FRY A;  5GAO m;  2L3Q A;  3NTH A;  5IXB A;  5KYX B;  4C5I A;  5C0M A;  4FT2 A;  3ASK A;  4KH0 B;  2UUE B;  1X6O A;  2C6T B;  3JB9 G;  3CCM T;  4BY6 C;  2KT1 A;  3EGU A;  2FHD A;  1B07 A;  4HNU A;  2ECZ A;  4DQ2 A;  1QP3 A;  1M2V B;  4KT0 E;  5FW9 A;  3JCM g;  3OW2 A;  3CCL Q;  2QQ9 A;  2LTO A;  3BY7 A;  1ZQ1 A;  2X4X A;  4M7A B;  3M0U A;  3CCU A;  1BYM A;  4E2F B;  3HTR A;  3OYC A;  5ACB A;  5LJ5 f;  2UZL B;  5HK0 A;  5CYI B;  1NEG A;  3CCS T;  4X9C A;  2HCK A;  3R6N A;  4X1V A;  2O88 A;  2O01 E;  4N4H A;  1URC B;  1I1J A;  5CAI A;  2ZPH B;  1N8R R;  4KUL A;  4BE0 A;  2DK3 A;  2GTO A;  1NLO C;  3LGL A;  1Q7Y R;  2W96 A;  2CDT A;  4M7A G;  1N9S A;  1UGR B;  1PNJ A;  5LJ5 h;  1KIK A;  2EYZ A;  4IMY B;  4M78 A;  1NLP C;  1R0C B;  3OMC A;  4PJN A;  1R0B G;  2LNV A;  3VKI A;  3TNW B;  3CCJ A;  4FIB A;  4CFX B;  5D7U A;  1MMA A;  1YIJ T;  1UNG D;  1QKW A;  2RK2 A;  2LJ3 A;  4J9H A;  1D3B B;  2QEX Q;  1IRE B;  1ARK A;  3RMS A;  1WHK A;  1GFD A;  4C8Q D;  2DVJ A;  2YLC A;  4IUV A;  4JZ4 A;  1FMK A;  4OMO A;  4JS5 A;  4JJD A;  2G3R A;  2CZ1 B;  2L8D A;  3MET A;  3MEA A;  3TCJ A;  1JJ2 P;  3ZL7 C;  5FU6 B;  1HYO A;  3EFO B;  3KUF A;  3E1S A;  2EJF A;  1RL2 A;  3V7S A;  1N4M A;  4FU6 A;  1H3Z A;  3FIF A;  5CIU A;  2XI9 A;  5LJ3 f;  2OTL A;  2HKN A;  1JXM A;  4BCN B;  1ZBX A; 
#chains in the Genus database with same CATH homology
 3OQ5 A;  2LT4 A;  3Q1J A;  3MO8 A;  4HA8 A;  3OYJ A;  2LVM A;  3FDR A;  1VQM A;  5DM7 R;  2DTO A;  2RHY A;  3M58 A;  3HZJ A;  3G71 A;  3GIB A;  4ME7 A;  2LRQ A;  5I21 A;  3PTA A;  2QEX T;  4M7D F;  3OS5 A;  1PSF A;  1I8F A;  1KQ2 A;  4DA4 A;  5GAM j;  3OYH A;  3CME T;  3OYY A;  4C0D C;  4BDY A;  2DXT A;  3JB9 J;  2G77 A;  3VU3 C;  4C8Q G;  2DD5 A;  1G3W A;  1XOV A;  5C6S A;  3J80 E;  4HLQ A;  1FKM A;  1M90 U;  4QQD A;  3LH0 A;  1BI3 A;  4F7U G;  3TU4 K;  1LNX A;  3PMT A;  4JUV A;  2BKD N;  3UT1 A;  2K5F A;  3CC7 T;  5GAM d;  5LL6 S;  2LDM A;  4BBR M;  2PUO B;  4RG8 A;  2RA2 A;  4JX6 A;  1E7P A;  3JCM P;  5GAO p;  2HNI A;  3OYL A;  3RKY A;  2DTH A;  1JBM A;  3KBG A;  2XID A;  1VQL T;  3M4G A;  3QKJ A;  2RD1 A;  4KUI A;  2F5T X;  4OGC A;  2DPP B;  2KSS A;  2KY9 A;  3V7C A;  4OMF B;  4RCC A;  4BB7 A;  4NC6 A;  5GAN 8;  3OYK A;  3LLR A;  5CCA A;  3OYA A;  2JTM A;  2FVU A;  3HPW A;  4PJO D;  3QII A;  3CCV A;  1VQK A;  1YJN A;  4M6V A;  1K8A U;  4L5G A;  3QG1 A;  2DO3 A;  4M77 A;  3VYH B;  1OZ3 A;  4JRQ A;  2K3X A;  3NTI A;  5LJ3 j;  1SSF A;  4XQ3 A;  4QVD A;  4PKC C;  3A5Z B;  3PIO A;  2X4W A;  3MCA B;  5A0L A;  2GFA A;  3JB9 F;  1M5Q 1;  3CCE A;  4D6W A;  2KR6 A;  1O75 A;  2QQS A;  4M78 D;  3CBO A;  2VXE A;  4MML A;  1I81 A;  3HO8 A;  3HRT A;  3MEV A;  5KE3 A;  1S72 A;  1VQ6 T;  1BIA A;  4JDS A;  2FYK A;  3GOX A;  2E64 A;  2ZZD B;  3CC4 A;  5DY9 A;  4ZTJ A;  5LJ3 d;  5J3B A;  3ME9 A;  2KDS A;  2L3R A;  4M75 G;  4M77 C;  5GAM e;  1Y07 A;  1WJR A;  2E12 A;  3BG9 A;  1VUB A;  1N8R C;  2YLB A;  4L6V 5;  2C06 A;  1WGS A;  4M78 B;  1VQO T;  2DTI A;  3DB3 A;  3QJY A;  3L2U A;  5GAN 5;  4M75 F;  4ZTF A;  4YTL A;  3JCM c;  2MF2 A;  4BI8 B;  2MAM A;  4NL2 A;  2EWN A;  4C0F A;  1Q86 C;  3RES A;  2BIV A;  3UDC A;  3A8L B;  1NZ9 A;  2DEQ A;  2MI6 A;  3M59 A;  4DOW A;  2KMT A;  1Q81 C;  2OTJ T;  3JB9 H;  3QWL A;  3C12 A;  4MDX A;  3MHX A;  3G4S A;  3MEU A;  3VYG A;  3OYB A;  4PJO G;  4M7A F;  3SB2 A;  2XDB A;  2DXB B;  3WVD B;  1QP2 A;  1LJO A;  2FB7 A;  1MGQ A;  4M77 E;  3HRU A;  5IN1 A;  2A3L A;  3CCU T;  5AYF A;  3MP6 A;  3OYE A;  1I5L A;  2CZ6 B;  1QW1 A;  4PJO F;  4AKI A;  4J6Y A;  4A4F A;  3M55 A;  4IUU A;  4B9X A;  5GAM f;  5CKD A;  3JCM e;  2BS3 A;  2ZPE B;  3C4S A;  3JSC A;  1N27 A;  4LDU A;  2O4X B;  1VQN A;  2ZGW A;  4XTX A;  2K5I A;  3CMA A;  1KC8 U;  3J7A F;  3OMG A;  4QW2 A;  1GXI E;  4M78 G;  3S3O A;  4M7A C;  3I56 T;  2RM4 A;  3C95 A;  4ZGE B;  4LD9 K;  3CBP A;  3VKH A;  4L59 A;  3QUI A;  4C5E A;  5DLO A;  4QQG A;  4C0G A;  3I55 A;  2KVQ G;  4N4G A;  4GLK A;  2E6N A;  5GAN 4;  1Q82 C;  3ZFJ A;  2CGH A;  2P0K A;  1YBY A;  2QQA A;  3MP8 A;  4OB2 B;  4NL3 A;  1KD1 C;  2VUB A;  3LW5 E;  3SWN C;  1VQ7 A;  3JCM f;  2PVG B;  2EYQ A;  1H64 1;  5GAM h;  3CPF A;  3HFN A;  4FM4 B;  3P8D A;  4IUQ A;  2WSE E;  3V8K A;  2V8I A;  3RKW A;  2RJC A;  4M7D G;  4XTU A;  3HBL A;  1BKB A;  4A4G A;  2QI2 A;  1K73 U;  4XK8 E;  4A53 A;  5FU7 B;  1KG1 A;  2WJ9 A;  4OB3 B;  3MP1 A;  3QJ6 A;  2RK1 A;  2Y4X A;  3FB9 A;  3NTK A;  4XTY A;  3VUB A;  4BI3 A;  4EMK B;  4HT9 A;  4LDY A;  2LX9 A;  2VGM A;  5D6Y A;  5GAN j;  1M1K U;  4EMH A;  3CCJ T;  2R5A A;  5KCH A;  1WQ7 A;  3P8H A;  3OS1 A;  4ATO A;  4ELJ A;  1OZ2 A;  5CKB A;  1VQ9 A;  3CXC S;  3RMQ A;  2K3Y A;  2VGN A;  2E41 A;  2VV5 A;  3CXC A;  1VQ8 A;  4C92 A;  4V2S A;  2AHJ B;  2QQB A;  2PVD B;  3RER A;  4MMK A;  3PIP A;  3OY9 A;  3VV0 A;  1M1G A;  2DD5 B;  2JNG A;  4Z02 A;  2KMG A;  5CKF A;  5GAN d;  5LJ5 g;  2DKG A;  4M7D A;  3FC3 A;  1YIT T;  1K73 C;  4JLG A;  4LDV A;  4P5N A;  4BY6 B;  4LDX A;  5CO7 A;  3QYB A;  3OYM A;  2JTF A;  1NE8 A;  3HL8 A;  4J8O A;  5D6X A;  1XQH A;  1W4S A;  2HAX A;  2XG8 D;  3QYG B;  3JB9 D;  4J7F A;  4PNO A;  2KQW A;  4C92 C;  2XHC A;  3M56 A;  1UGS B;  4AI6 A;  4J83 A;  4OF1 A;  4C0Z A;  4OB0 B;  3OBY A;  2VC8 A;  4ZGD B;  4C8Q F;  5GAO q;  3J81 E;  1KHC A;  4Y28 E;  2XU8 A;  3CPW S;  2RHX A;  4M77 D;  5LJ3 h;  5GMK e;  3CPW A;  3CCM A;  4F7U F;  3TW6 A;  5J26 A;  2QA4 A;  1BI2 A;  5J39 A;  5GAN 6;  1FX7 A;  2HBP A;  3ER0 A;  3L2V A;  1VQP T;  4OB1 B;  1I4K 1;  1VQ4 A;  2V8K A;  3SFM A;  2X35 A;  3TEE A;  5CVI A;  4JJN K;  5DLQ E;  3G6E A;  1VQ5 A;  3PNW C;  3H4C A;  4QSH A;  1QVG A;  1JJ2 S;  2CZ0 B;  1JJ2 A;  1AHJ B;  4MFE A;  2QXF A;  2X4Y A;  4ELY C;  2OTL T;  1YHQ T;  3X20 B;  4M77 B;  2DIQ A;  5GAN 3;  1B34 A;  2K57 A;  5IAY A;  5CK9 A;  2P0P A;  4C8Q C;  4C92 E;  3FRN A;  1YI2 T;  1FXX A;  5FU6 C;  2QDJ A;  4FSX A;  3PFS A;  1HK9 A;  1VQM T;  3G71 T;  5GAM g;  1G3S A;  2BS4 A;  1HXD A;  4JRP A;  3CCQ A;  3L1A A;  4M7D E;  4E7J A;  2RJD A;  3JCM d;  3CCS A;  4GY5 A;  3CC2 A;  1BIB A;  3JCM J;  3DB4 A;  2D0Q B;  5GAN e;  2KAF A;  3G7Z A;  3JRZ A;  3M4Y A;  1O9S A;  5KE2 A;  5FRO A;  4XAX B;  2EJG A;  1JRI A;  2DVE A;  4II1 A;  2IG0 A;  5GMK l;  4PLL A;  3CCR A;  4RMO A;  3CD6 A;  5FRM A;  1UGP B;  1V29 B;  2EQU A;  1YJW A;  2JZ2 A;  3L42 A;  5KH6 A;  2OAU A;  4E7L A;  4CRI A;  3SDZ A;  4MZT A;  3OYN A;  3SD4 A;  2EAY A;  2PVO B;  2LQK A;  2DZC A;  5CR2 A;  5HKC A;  1TH7 A;  2JVV A;  2DAQ A;  2CZ7 B;  4M77 G;  1M4Z A;  4HL4 A;  4HNV A;  2EQM A;  3BFM A;  2YHT A;  3VYG B;  1PSE A;  3BDL A;  4M75 A;  1Q7Y C;  4O6J A;  3CCL A;  2QFZ A;  4J6W A;  2DIG A;  2XKO C;  4O5V A;  5GAN f;  2QA4 T;  4JX5 A;  1K9M C;  3JB9 I;  1YJ9 A;  3BW1 A;  2DJZ A;  1Y96 A;  4KBM B;  2WSC E;  4XTW A;  5KCO A;  5I2S A;  3LWI A;  3CCV T;  1VQK T;  1YJN T;  3WVE B;  5GAN 2;  4M7A A;  2LCC A;  5LJ3 g;  3CC2 T;  3QYE A;  3LYI A;  1IZ6 A;  3X25 B;  1BI1 A;  3HRS A;  3OSV A;  4RCB A;  3HKS A;  4M75 C;  4PJO A;  2EJ9 A;  1ZHI A;  3VUZ A;  2EFI A;  3M57 A;  1N8R U;  1KQ1 A;  3TRE A;  3UPU A;  3CCE T;  2RO0 A;  5HK3 A;  3A8H B;  1WJS A;  3DL1 A;  4VUB A;  2XIC A;  3SWN A;  5M9O A;  5FLX E;  1S72 T;  1YCY A;  2ZZD A;  3KHI A;  3V8L A;  2F5K A;  3VJP A;  5GAN h;  3CC4 T;  1M8V A;  4J7I A;  1NPR A;  5CQX A;  2IVW A;  2L89 A;  3GLX A;  4HCZ A;  5L8R E;  2RB6 A;  1Q86 U;  4RG2 A;  1Q81 U;  2B8A A;  5GMK j;  3RIR A;  2RI2 A;  4JS4 A;  4QVC A;  2DD4 B;  4JX4 A;  4M78 F;  3INZ A;  4JLI A;  5CKH A;  5GMK m;  3CCL T;  4PJO C;  2D9T A;  1U1T A;  4ELZ C;  2CS7 A;  2M0O A;  4M75 E;  3V8J A;  5GAO r;  3M53 A;  2VYT A;  4EPC A;  4C92 D;  3QZ5 B;  2MMP A;  3R6O A;  1YJ9 T;  2DXC A;  4HCC A;  2K4Y A;  4LD6 A;  2MWP A;  1UB4 A;  3JCM W;  3QXE B;  2RHZ A;  4EDU A;  4C0D B;  4E7K A;  2LC4 A;  4A4K A;  3OYI A;  4IUT A;  1VIE A;  1JB0 E;  5I2M A;  3G4S T;  4M7A E;  4A54 A;  3GF5 A;  2P4T A;  3A8O B;  4M78 C;  4C92 B;  4ZN3 A;  2ZPI B;  3OS0 A;  2BUD A;  5A2Q E;  4ZGJ B;  2H3J A;  4OGE A;  2JN0 A;  2LT1 A;  4PJO E;  3MEW A;  3M9Q A;  2LCL A;  3BG3 A;  1QVP A;  2QEX A;  2XDP A;  1NJI U;  2E5Q A;  3JAM E;  3QPH A;  2E65 A;  4IUR A;  5LJ5 j;  5GAO l;  1VQN T;  1LOJ A;  2ZCF B;  1WNL A;  2V8J A;  3CME A;  4X34 A;  1Q82 U;  1Y71 A;  2ZPB B;  1DJ7 B;  2WAC A;  3EFS A;  3CMA T;  2E70 A;  2RHI A;  3F70 A;  1KD1 U;  1D3B A;  3X26 B;  3E19 A;  3OBW A;  4XU1 A;  2GQV A;  3BDU A;  4E47 A;  2ZPF B;  3H8Z A;  1P92 A;  4MZM A;  1QVF S;  3JCM h;  3NFC A;  1QVF A;  1Y7X A;  3CC7 A;  3UWN A;  1G3T A;  3JCM b;  1RI0 A;  2K5L A;  2MWO A;  3I55 T;  3DLL A;  2GFU A;  3BG5 A;  2RJE A;  3RUX A;  4Y91 A;  3AHU A;  1VQ7 T;  4R56 A;  2X4J A;  4LOC A;  4XU0 A;  5EG2 A;  1M90 C;  4J6X A;  1VIF A;  4C92 G;  2QQ8 A;  1WPY A;  4WF2 A;  1BI0 A;  3EAE A;  2M9U A;  3QZ9 B;  3L2Z A;  4C8Q A;  2XDD A;  2R58 A;  2R57 A;  3O8V A;  4KUD K;  4F7U A;  3HB9 A;  2QDY B;  4BBS M;  1B34 B;  4XU3 A;  4N0A A;  3X24 B;  3QHS A;  4EMK A;  5GAN g;  2RI5 A;  4NS5 A;  3PMI A;  3JCM V;  3S3M A;  3FEO A;  2DXU A;  2L5Q A;  1XTD A;  3CBM A;  5CKE A;  4BUG A;  1QVG S;  4MZP A;  3QBY A;  3M54 A;  3LX7 A;  3OYG A;  3L2R A;  1VQ9 T;  4A4H A;  2A7Y A;  3ZBD A;  4C5G A;  1VQ8 T;  3M5A A;  2DZ9 A;  1W2B S;  1NPP A;  2GCX A;  1W2B A;  4IKF A;  3E9G A;  1G5V A;  5FU7 C;  3PGG A;  1K8A C;  4N0A C;  1G3Y A;  4OP0 A;  4EMK C;  3OYD A;  2Y4Y A;  2EQJ A;  1VQ6 A;  2XK0 A;  4M75 D;  4C5H A;  4BDZ A;  2PQW A;  2HQE A;  2EQK A;  2HQX A;  3LGF A;  5GAO m;  2QQR A;  5LJ5 e;  4E7H A;  3NTH A;  4C5I A;  5C0M A;  2EKO A;  2QTX A;  4FT2 A;  2FL7 A;  3OB9 A;  3ASK A;  1VQO A;  4M7A D;  4C8Q E;  1OI1 A;  3CEY A;  1X6O A;  4M75 B;  3JB9 G;  3CCM T;  4BY6 C;  4XTV A;  3QSU A;  4F7U E;  3V7R A;  2FHD A;  2RI3 A;  1VQ4 T;  4A4E A;  3A8M B;  4HNU A;  3QDR B;  4DQ2 A;  1Y96 B;  4BE2 A;  2P0Q A;  1QP3 A;  2OTJ A;  4KT0 E;  3JCM g;  2VXF A;  4XTZ A;  4QQ6 A;  4N4I A;  3WXM B;  3L2Q A;  3G6E T;  3OW2 S;  1VQ5 T;  3OW2 A;  2D6F A;  5A0D A;  2QQ9 A;  2NLU A;  2LTO A;  3OYF A;  1EIF A;  3BY7 A;  1ZQ1 A;  2X4X A;  4M7A B;  3S6W A;  1KQS S;  1KQS A;  4M77 F;  3CCU A;  2R5M A;  4JRK A;  3JCM Q;  4XU2 A;  4AKG A;  1M1F A;  1BYM A;  2BS2 A;  5GMK h;  4BAC A;  2QF7 A;  4Z6Y A;  3DLM A;  3T9N A;  5LJ5 f;  3OYC A;  1YI2 A;  4PJO B;  1WQW A;  5HK0 A;  4QVZ A;  4RKU E;  4TVR A;  3CCQ T;  3QO3 A;  1X75 C;  3A8G B;  1FWZ A;  3SWN B;  4MFD A;  1YIJ A;  3CCS T;  4X9C A;  4M7D C;  1OYX A;  2JUF A;  1X01 A;  3KXT A;  3I56 A;  4AKH A;  4E7I A;  2JOY A;  3CCR T;  4X9D A;  4BD3 A;  2O01 E;  3CD6 T;  4N4H A;  1XNI A;  1YJW T;  3DKM A;  1U1S A;  2I2L A;  2ZPH B;  5CAI A;  4KUL A;  3N5B B;  3QYH B;  4BE0 A;  2DK3 A;  2M1H A;  1Q7Y U;  4HCB A;  1UEB A;  3LGL A;  4HKE A;  1KC8 C;  4J5Y A;  5D6W A;  4ZN1 A;  1K9M U;  3OA6 A;  4JRI A;  4HNT A;  2DXC B;  4M7A G;  2E1H A;  4UC4 A;  1N9S A;  1UGR B;  2F69 A;  3URG A;  5LJ5 h;  5HY6 A;  5EJC A;  5A0G A;  2XD0 A;  1WJQ A;  4M78 A;  3OS2 A;  4MDW A;  5IT9 E;  3OMC A;  3JCM X;  2WSF E;  3HFO A;  2RHU A;  4MIM A;  3GNG A;  3P8B B;  4B9W A;  3L2W A;  3GP8 A;  2LNV A;  1N6A A;  2E10 A;  3VKI A;  3ZEH A;  4OVA A;  3H6Z A;  4BE1 A;  3CCJ A;  4FIB A;  3GNF B;  4M7D D;  5GAN 7;  4BI4 A;  2CKK A;  1YIJ T;  1QLB A;  2DXB A;  3X28 B;  2PU9 B;  2RK2 A;  1N9R A;  2EIF A;  1R8O B;  4LDW A;  4PL6 A;  4DOV A;  2HD0 A;  4EMG A;  3LWH A;  1U8R A;  4Q5W A;  1D3B B;  2KK4 A;  4FL6 A;  1IRE B;  4FT4 A;  4CI0 C;  1M1K C;  1YIT A;  3C94 A;  3RMS A;  4M7D B;  2O4X A;  4C8Q D;  2M16 A;  5LJ3 e;  2YLC A;  4IUV A;  3S3N A;  1UGQ B;  3VKG A;  1KHI A;  4HT8 A;  3HSB A;  2YRV A;  3GPL A;  4JS5 A;  2PUK B;  2G3R A;  2CZ1 B;  2L8D A;  2DD4 A;  3FJP A;  3MET A;  3OSS C;  2LQ8 A;  2Y90 A;  3HHT B;  4IUP A;  3PT9 A;  3MEA A;  4M78 E;  3TCJ A;  4R55 A;  4C8Q B;  2E6Z A;  5LJ5 d;  3TW7 A;  2K2V A;  5FU6 B;  3KUF A;  3RKX A;  5GAO n;  2GF7 A;  2CYZ B;  2EJF A;  3E1S A;  4F7U B;  1VQP A;  1M9S A;  1MHN A;  2ZPG B;  1RL2 A;  2RH2 A;  5CQY A;  3V7S A;  4FU6 A;  4NOY A;  1H3Z A;  3FIF A;  2RJF A;  3HP9 A;  5CIU A;  3E9F A;  2XI9 A;  5LJ3 f;  5GMK i;  1VQL A;  2OTL A;  3EFR A;  1YHQ A;  3FLG A;  4PLI A;  5FRN A;  1NJI C;  4C92 F;  1ZBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...