2QDYB

Crystal structure of fe-type nhase from rhodococcus erythropolis aj270
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution X-ray molecular structure of the nitrile hydratase from Rhodococcus erythropolis AJ270 reveals posttranslational oxidation of two cysteines into sulfinic acids and a novel biocatalytic nitrile hydration mechanism
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2qdyB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qdyB02
3QYHB 2DPPB 4RKUE 2DXBB 1IREB 2ZPBB 4OB2B 3QZ5B 3X24B 2ZPIB 2ZPFB 2CZ1B 2ZCFB 2DXCA 2CZ0B 2DD4B 2DD5B 2CZ7B 3QXEB 4OB0B 2ZPEB 2DXCB 4XK8E 3A8HB 4Y28E 2WSFE 1UGSB 1QP3A 3A8LB 2D0QB 4ZGEB 2ZPGB 4FM4B 2ZZDA 3VYHB 2ZPHB 3X25B 1JB0E 3A8MB 3A8OB 2WSEE 3X20B 3QZ9B 4L6V5 3A8GB 1UGQB 1PSEA 3WVDB 2CZ6B 2ZZDB 1UGPB 2PVGB 2CYZB 3VYGB 4ZGDB 2PVDB 5L8RE 2WSCE 4ZGJB 2AHJB 3VYGA 1AHJB 2PUKB 2PU9B 4OB1B 3X28B 1GXIE 2DXBA 1UGRB 2PUOB 2O01E 2PVOB 3LW5E 3X26B 4OB3B 4KT0E 3QYGB 1DJ7B 3WVEB 2DD4A 2DD5A 3HHTB 1QP2A 2QDYB 1PSFA 1V29B
chains in the Genus database with same CATH superfamily
4C0DC 5DQVA 4JPBW 1WQ7A 3G1JA 1IREB 2ZPFB 3O0GD 4EOLB 3QIIA 1WHGA 2RQUA 4II1A 2HEQA 1PKTA 3REBB 3RIRA 3JCMV 4NC6A 1ENWA 2DLPA 3OS0A 2HBPA 2Y4YA 1BI3A 3HPWA 4F6UB 3E9GA 3K7AM 2K2MA 1OOTA 2E6NA 1QP3A 4JX4A 3JB9H 4JX6A 4DEXA 4C8QB 4HT9A 1J3TA 2HKNA 1GL5A 3TNIB 3LWHA 2XDBA 4M77A 1N8RC 1VQ5T 3M5AA 3SHWA 3I55T 1MMGA 4LXCA 2H8HA 4CFXB 3EFOA 2KT8A 3I5RA 4IURA 2P4TA 2GCXA 4ZN1A 3TCJA 3WXMB 4YTLA 3PMIA 3CCJQ 1BBZA 2MK5A 4E7SA 1OPKA 2JXBA 2QXFA 1MV0B 3VYGA 2YLBA 4A4GA 2K9GA 2PMIB 4OGCA 2JTEA 4BE2A 2ED0A 4E7ZA 3VUZA 2CCIB 2L3QA 2CP3A 3UDCA 1K9MR 1GXIE 4MZMA 1KSWA 2OI3A 1M8MA 2VGNA 1V1CA 5GAN2 1N5ZA 3OYKA 4AFUC 3X26B 2FO0A 3CCRT 1VQ6T 1QLYA 1VQ8Q 2YLCA 3BG3A 3VS7A 1IO6A 1AWJA 3TW6A 2WIPB 4M6VA 4YC3B 1FMKA 3JCMW 3EIDB 3VS6A 1QVFP 2W9ZA 2FVUA 1DJ7B 2C0OA 2DD4A 2EYXA 4F7UB 3QDRB 4RCBA 3VRYA 4AFZC 4N4IA 1YJNA 4IIMA 5A0LA 2OTLQ 4RKUE 4UC4A 2IIMA 1F5QB 3UPUA 3KBGA 4TTHA 2O9SA 3DLLA 2QEXT 3GF5A 1VYVA 5LJ5f 3V8JA 5LJ3g 1IHVA 1W2BS 2WEVB 2PJQA 2DYIA 4HL4A 2X4XA 1BI0A 3A8HB 1KK7A 3CCRQ 1E7OA 1SPKA 5I5ZB 3CPWS 1G2BA 2OTJQ 3OS2A 1X6GA 4JLIA 3I9QA 2BZ8A 3LGFA 2J6OA 3A8MB 2A3LA 1UNGD 1VQ9T 3QZ9B 4QVCA 2OTJA 2XHCA 1PNJA 4EMKC 3FJ5A 2V22B 1ZLMA 1XJWB 4EC8B 3LLRA 5AT1B 3RUXA 3CEYA 1UNLD 1NJIC 1WJRA 3URGA 4A4FA 1JKWA 1QLBA 1H1PB 5HBJB 1UG1A 1OU9A 4M7DD 1S72Q 4FX3B 2A0FB 2OTLA 3NTKA 1Q7YC 2HMAA 3OYFA 3HFOA 4JZ3A 5FWCA 9ATCB 2F2CA 4CC2A 2XDDA 3OYIA 3FEOA 5KYWA 2PUOB 3NTHA 1VQ8A 2HD0A 2C5XB 1IGQA 4RG2A 3BHVB 1H26B 5CKDA 1MUZA 2LP5A 2AKKA 4EOOB 3JCMf 3JB9G 4LOCA 1B3QA 1MNDA 5LJ5e 3CCQT 3QYGB 2LTOA 2W0ZA 4M4ZA 2K57A 5GAN8 1PM3A 2DL8A 4XTZA 4OMLA 3M0QA 3MKDA 3QJ6A 2RQWA 4HNUA 5GANf 2UZBB 5KYXA 4X9CA 4ELLA 2WPAB 1RLPC 2BPMB 2VVKA 5CKHA 5GAOp 2RD1A 5IF1B 1IHWA 3HRSA 4R0KA 3CCEQ 4F7UE 2XK0A 3IQLA 3OYYA 4JRKA 1UHFA 4BCIB 5HKCA 1FKMA 2FPDA 4DOWA 3OYLA 5I2MA 3JCMg 4B9WA 1E9HB 2EPDA 4LUDA 2DFUA 1VYTA 1M2VA 3CXCA 2ZZDA 1WHLA 2P84A 1ZSZC 3EFRA 5LL6S 3JB9I 3CPWA 4M7DB 2JGZB 3MO8A 4PLIA 5LJ5j 1GUXA 3I55A 2C4GB 1Q95G 3AHUA 1O9KA 4O5VA 2L5QA 2EQIA 2P4RA 3CC4A 3TW7A 3CQTA 2F2XA 3CCET 1LVKA 5IXBA 5FU6B 4E7KA 1VOLA 4AKHA 4CC3A 2I2LA 2ROTA 2P0QA 4RODA 2RJFA 1TOVA 3TQ7P 5M9OA 4PJJA 2LCCA 1YHQQ 2MIOA 1OI1A 2LCSA 4HCCA 3CMAQ 4CFNB 4JJBA 2OTLT 2GTOA 4AG2C 1WA7A 2VKNA 1H27B 3P8DA 2DL7A 2WXVB 5A2QE 4C8QE 3GTMS 3OBYA 4M75B 2EYQA 5CIUA 3C95A 3G6EQ 2YUQA 4PL6A 1RUWA 1QVFA 2D8JA 1M1KC 3UWNA 3V7RA 1P5EB 3PVQA 4AFSC 2RJEA 2PNIA 1IGUA 3WVEB 3HTRA 3BHTB 1JU5C 4EPCA 4JRQA 4BB7A 2KY9A 2JNGA 1PSFA 5HVYB 2QGGA 2J6KA 2JW4A 1JO8A 1GH6B 1OIYB 1N9RA 1PWTA 3U23A 2EBPA 2R7GA 4XTXA 2LRQA 3CCLQ 2MI6A 4M75C 2ZCFB 5IXFA 2FHDA 2DETA 3LGLA 2CZ0B 4OMFB 2DD4B 1FWZA 1W2BA 1FYNA 5GAMj 3QXEB 2BE9B 1I8FA 2AZVA 1H4LD 4V2SA 4CRIA 2J6FA 3OQ5A 2GF7A 4BBRM 2DK3A 1G3YA 4II5B 2XKOC 5DM7R 2KGTA 3OYEA 5HK3A 3CCSA 1FVVB 4BXXX 2X9HA 3LQ5B 3BDUA 3QHSA 3VU3C 2AK5A 2NUPA 1NEBA 2RQRA 4LD6A 5GMKi 2ABLA 3J7AF 3C0CA 1D0YA 1IRXA 3EH1A 3JCMh 4MDXA 1OPLA 2H3EB 1TTHB 4XTYA 2JM8A 4AKGA 1BYMA 1KD1R 2JZ2A 3G4SQ 1UJYA 3NPFA 5C6SA 4IUUA 3CCRA 2RF0A 4HT8A 3MHXA 4F7NB 4J6YA 3HB9A 3VS0A 2AHJB 2DL5A 2BKZB 3OYDA 5DY9A 4PJNA 2G9XB 3NHNA 3O5ZA 5GMKj 4E47A 4M7AC 1YI2T 1K0XA 4F7UG 2V8JA 3OA6A 4D8KA 2EJGA 3V8KA 1SF9A 5GJWB 3L1AA 1PCXA 3UATA 5LJ5d 3QWYA 4FCYA 1ZBXA 2DXBA 4MDWA 3M9QA 4NSTB 1RAHB 2O01E 3M0SA 3I56T 3M03A 5HCKA 2I40B 2JOYA 4RTVA 4BCGB 5CKFA 1PD0A 1JRIA 3OYCA 3CPWP 3CMAT 1U1TA 1WJQA 4OMMA 1GRIA 5CK9A 1ZUKA 2QA4Q 5IHIA 4BI8B 2RJDA 2QYZA 3B57A 2BS4A 4LN2A 5CR2A 3QYBA 2YRVA 2DPPB 4QQ6A 3R6NA 3QYEA 3EG3A 3EG9A 2DXBB 1QVGA 3VS2A 1VQPT 2BKDN 1FMVA 3M4GA 5L23A 4RTWA 2O4XB 2LQKA 2DXCA 2DIQA 3M55A 5HBEB 1O9SA 1JSUB 1HXDA 4EOSB 2L3RA 3OYJA 5C0MA 1PHTA 4LDYA 4F6SB 5HBHB 4BE0A 5CYIB 4GBQA 2CS7A 2CDTA 3SEMA 3A1PA 4MMKA 2JS0A 1OI9B 1QVGP 4JRPA 4Z02A 3RR6A 5IAYA 4M7AA 3SFMA 3DTOA 2WFYB 1X01A 1MMDA 3ZFJA 3CC7A 1YJWQ 1H8KA 2PTKA 1OL1B 1TG0A 1AWWA 2EAYA 1ZUYA 4FL6A 1RI9A 3L2WA 4MIMA 2ZZDB 1ABOA 1Z9QA 2M1HA 1UTIA 3G33B 2IN3A 1I81A 4HNTA 1OZ3A 2UZLB 1KFZA 2KT1A 1ZA2B 4C92E 1TD6A 1KD1U 1O9KB 3OYNA 1R0BG 2O2OA 4M7AE 2KYBA 3EG0A 2FEIA 2XI9A 1AHJB 2YDLA 1OL2B 4HCZA 4EOMB 1OV3A 4BCMB 2DTIA 1AT1B 3QDFA 3CC2A 3FC3A 2GNCA 1UGRB 1WHJA 1BI2A 1B34B 1H28B 1E6HA 5KYXB 4M78A 4M7DC 3H0FA 3EOCB 1YN8A 2BE7D 4HA8A 1YIJT 4ZTJA 2UUEB 1VQNT 5CEIB 2V1RA 5GMKh 1BIAA 4KRTA 1IXDA 3EHQA 4JRIA 2V26A 1WJSA 1QP2A 1M90U 3EGUA 4QT7A 3VS4A 2EGCA 4CC7A 2YT6A 5ECAA 2CUDA 4C92A 3EG1A 1H1SB 1OYXA 4BY1X 1FX7A 1URCB 4ATOA 2DA9A 2J05A 3INZA 1SRMA 2K5FA 1EIFA 3QHWB 3CMEQ 4QSHA 2F2VA 4HLQA 4OB0B 2ZPEB 2QQ8A 3GIBA 4Y72B 1HSQA 3HSBA 3PIOA 3LH0A 2IVXA 2MAMA 4EMGA 4ORZA 4E7IA 1T0HA 2RQTA 4DBRA 4FSSA 2LC4A 2UZEB 2OJ2A 1WHHA 4QKUA 1Y96A 4EIKA 3JCMP 3OYHA 3FRNA 4ZGEB 1WFWA 2EW3A 2QAZA 2WACA 2SRCA 2ZGWA 2EQJA 3SWNB 4Z88A 4J5YA 3RNJA 2I53A 1M90R 3X20B 1LCKA 5I2SA 1K0SA 4YOZA 2COWA 3QKJA 2ZAEA 3PFSA 2MPXC 3POMA 4XAXB 3NTIA 2EFIA 3A5ZB 4PJOC 3CD6T 1QCFA 4JS4A 3UA7A 2RO0A 5GAN5 3MY1B 3JRZA 3HBLA 2RM4A 5GAOm 2DYBA 1KXUA 5DQWA 4ZGDB 2RB6A 2O9VA 2PVDB 2E70A 1K8AU 2FZGB 2I0NA 2EWNA 1PKDB 4Z6YA 4EORB 3JV3A 2QFZA 4KUIA 4ZTFA 1ZSZA 4LUEA 2C06A 4EOKB 3L2UA 3THKA 5GMKe 2RMOA 1VQPQ 2FYKA 2XDPA 2E3HA 3CCMA 4ZNXA 1K9MU 3EAEA 4C0DB 2SEMA 2NUTA 1B07A 1SRLA 4BCNB 1P92A 1XNIA 2DMOA 4JX5A 4PJOF 1V29B 1Q81C 2CT3A 4PJOG 4E6RA 4A4EA 1NG2A 1UB4A 4M75D 5KCOA 1TUCA 2EGAA 2NUPB 4HNVA 3CCMQ 2LNHB 3OW2P 2K6DA 4M77E 3G71A 5CVIA 3MP8A 4F7LB 3V7SA 1W1FA 4XK8E 1ZSGA 3OMCA 5HK0A 2DRKA 3M0RA 4J9DA 1YNZA 1D1AA 2C5OB 2ZPGB 4A4KA 1WLPB 1CKAA 2DRMA 1PC0A 2IPOB 4EC9B 5GMKm 2FB7A 4EMHA 5J26A 2DL4A 1AZEA 2EQMA 4PJMA 3V8LA 2W9FA 2VC8A 5KYWB 3JB9F 3HO8A 1I0CA 2WIHB 4BCKB 2QTXA 1KQSP 4OMPA 1OX9A 2VV5A 4LDUA 2WMAB 2MMPA 1VQMT 3EFSA 4ZN3A 2GQIA 3DKMA 3HZJA 3C12A 4LDXA 1VIFA 2KQWA 4J9CA 2O88A 1KQSA 1LPLA 3HFNA 1M3BA 4J6WA 1XO2A 1OULA 4B6MA 1JXOA 3BLQB 4OR5B 2PK9B 2RK1A 3MP1A 3CD6Q 2JMAA 1C1AA 4M7AD 1IB8A 3CCVT 3PO3S 3FB9A 3HP9A 2LCLA 2HBWA 1UUEA 4C0FA 2KK4A 3DJBA 1SEMA 2LW4A 2QI2A 3BLHB 3SWNC 2YUPA 3E9FA 1CSKA 5HQ0B 2FPFA 5KCHA 3EG9B 1F1BB 3CCEA 4X34A 2CUBA 3LW5E 2QQ9A 4HCBA 2JTMA 2OX7A 3QJYA 1VIEA 4M78F 4WTOB 2RHXA 4F7UA 1VQKA 3OW2A 2DF6A 2KNBB 1GBQA 3MCAB 3CCQQ 4M78G 5IHKA 1NJIU 4F04B 2GFUA 1M1GA 5L2WB 4C0GA 4AMCA 4OMOA 1I4K1 4PJOE 4KRDB 2XD0A 1ZA1B 2E3IA 3DOGB 4JJNK 2DAQA 2KSSA 1H1RB 1Q81U 3QBYA 5KYUA 5I11A 1N27A 4DOVA 2QDLA 1KQ2A 2DZ9A 4HKEA 1G3SA 4XTWA 4AFQC 8ATCB 3JAME 5GANg 4M75F 3O8VA 2WMBB 5GAN3 1K9MC 4Y28E 2KI7A 1X27A 5FU7B 1Y57A 3UT1A 1VQ8T 4FM4B 2L3SA 1ZBJA 4ME7A 1VYWB 1I5LA 3JB9J 2XIDA 3LX7A 4BBSM 3MJXA 4JJDA 2G3RA 2IW9B 1H25B 5FW9A 4PFZA 1YP5A 2IW8B 3WVDB 3H41A 2EIFA 2DZCA 4KULA 2V8IA 1N8RR 4CFMB 4BCOB 3RKXA 1Q86C 1M9SA 2EYWA 4EOPB 2EVRA 3CBMA 2X4JA 1KQSS 1K4US 5KYYA 2C0IA 3H4CA 5FLXE 2P0KA 2RQVA 4M7AG 2Y90A 2ED1A 4BY7X 1BI1A 1T0JA 1QWEA 3X28B 4XU0A 4C5GA 2J7IA 1YJ9T 1X69A 4AT1B 3KHIA 1X75C 4PFOA 3OYBA 1ZP2A 1VQ9Q 5LQFB 1OZ2A 1OQKA 2H3JA 2FZCB 3PE0A 4FSXA 1O75A 1WPYA 1NYFA 4HXJA 3ZEHA 2VYTA 2PQWA 2HL5C 4I3ZB 3OW2S 1VA7A 4Y91A 2CKKA 1EFNA 2PUKB 2F2WA 2KRMA 2B8AA 3NMZC 4C5IA 4IMYB 2AKLA 2QQSA 1TH7A 2DERA 1YJNT 5LJ3f 2RA2A 4FYWB 1X2KA 4FU6A 1Q81R 1D3BA 4M78E 1UHCA 1MGQA 1G3WA 1U5SA 5IHNA 1OX8A 2D9TA 3CXCS 4PK4A 4RTXA 4BCQB 1VQOQ 2PZ1A 1LOJA 4EDUA 3L2QA 2FG0A 2HDAA 4OGEA 4TVRA 1YI2A 2HAXA 2DXTA 2WSEE 1K73R 2YRCA 4L59A 4BCHB 3A8GB 2M9UA 1YJNQ 2E5KA 3M54A 1GFCA 2BIVA 5IDPB 1VQ6A 1NE8A 3LH5A 3TREA 2OAWA 1B7TA 4LE9A 1BU2A 1TXQA 1UJ0A 4D6WA 4BI4A 2CT4A 2LNVA 1Y7XA 3MEUA 1ARKA 3TEEA 2LQWA 1VQKT 4MZTA 2YXYA 5CAIA 5LJ3e 2VGMA 3M57A 4BCPB 4D8DA 3CMEA 3DDPB 4ANJA 2R57A 3OSVA 2J06A 2PU9B 3BY7A 3LYIA 1W98B 1M3CA 2D8HA 2CP0A 2F69A 2QA4T 2HL3A 3CC2T 5D6WA 1TWBA 1QVFS 1VQKQ 2A7YA 3L2RA 2M0OA 3EFOB 2L0AA 3OS5A 1AOJA 2E6ZA 3HHTB 4C8QC 5HY6A 2X3XD 3GBQA 4AG1C 4N4HA 4M7AB 1RLQC 1RAEB 3ASKA 2X4YA 4CI0C 4JJCA 4ELJA 3OYAA 2XMFA 4PNOA 1HK9A 1X6OA 3BG9A 4QVZA 3HRUA 3M0PA 4EMKB 4Z89A 3BHUB 3NGPA 2YUNA 1C0MA 4IIOA 1D0ZA 3QHRB 2VASA 2W10A 4J8OA 3OYMA 2KRSA 3OY9A 1Y0MA 1PG5B 2HCKA 4IUVA 1UFFA 1RADB 2PK2A 2HQEA 4RTTA 5EG2A 2HSEB 2RJCA 3S6WA 4CRLB 1RABB 2RHYA 4PJOA 3VYHB 1D1CA 1R77A 4JDSA 4BCQD 4MFDA 1EX4A 1VUBA 4E2FB 1AVZC 2QASA 2QK0A 2JS2A 2KR6A 4EOIB 2WHBB 1K73U 1MMAA 2K79A 2KDSA 1Q86U 4G6LB 3FLGA 3VS3A 2A37A 4OMNA 3VYGB 1D1BA 2XU8A 2CCHB 2R5AA 3EGXA 3F5XB 4PJOB 2AIRB 1K76A 4HCKA 1Z9ZA 1GBRA 6AT1B 2YWWA 3KXTA 3BLRB 3HL8A 1VQLT 1AWOA 1QQJA 3JCMe 5IDNB 4NL2A 1M90C 4N4GA 4ROEA 3J80E 5GAOr 2VUBA 4C92F 4J6XA 3DLMA 4HVWA 3MIAB 1XTDA 2PVOB 2OAUA 1ZQ1A 2VB6A 2X4WA 1G83A 4FYXB 5CKEA 3CC4T 1W2BP 4QQGA 4BDYA 1U3OA 1X2QA 1FMWA 4KT0E 5GANd 2CH4A 3G4ST 3SDZA 1BIBA 4LD9K 5AYFA 1Y96B 4KGZB 1MV3A 2DILA 1VQPA 4C8QF 1UGVA 3EHRA 4J9IA 2V8KA 1YJWA 3CC7Q 2K7AA 4PFPA 1UEBA 2KROA 2LDMA 3GLXA 3E19A 2HQXA 3QYHB 1VQ4A 3CCUQ 4F6WB 2O31A 3RMSA 4UN0A 1WXUA 2BTTA 2VXEA 1VQLQ 5D7UA 4M77D 2K5LA 1NPRA 2NUZA 2FRWA 3CCJT 2RPNA 2BZXA 1HJDA 1MHNA 5GAOl 1QVPA 5IT9E 5A0GA 4DEYA 3CC4Q 1UGSB 4BACA 5CQYA 4BY6B 2GFAA 2KAFA 4FIBA 4N0AC 1KG1A 4WF2A 1WYXA 2KVQG 2CP6A 1ZSZB 4OMQA 2AT1B 1M5Q1 3CCQA 1GFDA 4CC4B 1H3HA 1JJ2A 2BS3A 4L6V5 2KYMA 2LVMA 3PIPA 3AT1B 4X1VA 5DLOA 3GP8A 2HNIA 3REAB 2CP5A 4M77B 3G7ZA 1VQMA 5D6YA 1WIEA 2MWPA 2JN0A 2CYZB 2JVVA 3SWNA 3PMTA 4F7UF 4VUBA 1VQ7A 2B9RA 2ATCB 3RKYA 1VQNA 5HNBB 3EGDB 1SHGA 3KFVA 3R6OA 1NZ9A 2KR3A 4J9GA 4XU1A 2RHIA 3JB9D 1VQ5Q 2E12A 3RERA 1WXBA 3CXCP 3G6EA 1VQLA 1WI7A 2KBTA 2RI3A 3JCMQ 4HVUA 4BI3A 2FRYA 1YHQT 3MY5B 3BW1A 5GMKl 2P0PA 1KHCA 3N5BB 1AISB 4M75E 2E10A 3I35A 1U8RA 2HZYA 4BCFB 2KE9A 3HRTA 3VV0A 4JS5A 2IW6B 2UZDB 4J7IA 4OB3B 5FRMA 1WX6A 1T3LA 5CQXA 5GAMe 1S1NA 1WZOA 4RUGA 1VQ9A 4RTUA 2C5NB 4RCCA 1AZGB 3L2VA 2RI5A 1M27C 2NWMA 4PJOD 1W4SA 1K8AC 3X24B 2G6FX 4J7FA 3MP6A 5GJVB 1QCOA 2JTFA 3BFMA 3F70A 3CPFA 3CC7T 1M8VA 4FT2A 3CCMT 4C8QA 1WGSA 1YCSB 5CCAA 1QKXA 3E1SA 4QW2A 2A36A 2DXCB 2KXCA 1KJWA 3ME9A 5KH6A 2QF7A 5BNJB 1YFNA 1BU1A 2LQ8A 2GGRA 1KHIA 1AD6A 4A53A 1TUGB 4CFWB 4FYYB 2YUOA 1YIJQ 4N0AA 3ULRB 2K3BA 1TSFA 4QVDA 2LT4A 3S3NA 5GAN4 2DJQA 2FPEA 4CXAB 1JQQA 1I5OB 1I07A 5LJ3h 2YHTA 1JJ2S 1E6GA 1KQ1A 4FW2A 1PRMC 2JJ9A 2DJZA 1GCQA 3PTAA 2IG0A 1D0XA 2CZ6B 5GAN7 1JBMA 3SD4A 3DB3A 1H92A 2QGFB 2DVEA 3VS5A 4JLGA 2M0YA 1WXTA 2DMEA 4IUTA 4C5EA 2C5VB 3FJPA 4PJLA 4OP0A 3CMAA 2M16A 2EJ9A 4ZGJB 3I55Q 1AWXA 5IHYA 3CBOA 2CJMB 2K3YA 1M1FA 3I56A 4KUDK 4WCIA 1WHMA 4OVAA 4M75A 2MCNA 4R55A 2E4HA 1SKUB 1TUDA 1NYGA 3NFCA 2QDJA 4XTUA 3H0IA 1ACMB 4KH1B 3GNGA 2WJ9A 2DIGA 3H9NA 2VXFA 1WNLA 1VQ6Q 2AZSA 5EFQB 1B34A 4XU2A 1M3AA 1YWPA 5I21A 1Q82R 4R56A 4Z8AA 1S72A 3P8BB 1T3SA 3I5SA 2EKHA 2R58A 2QDYB 4EOQB 3GNFB 4P5NA 1MMNA 4ESRA 2ESWA 3D7SB 2ZPBB 3QZ5B 2ZPIB 1UE9A 5FROA 2L2PA 2LQNA 1LJOA 3M59A 4F16A 3KUFA 2RI2A 1GY3B 3QO3A 1EZZB 4C92B 1NPPA 2LZ6B 1H641 1FINB 3H0HA 1WQWA 2DX1A 1RAGB 1G8XA 2JUFA 3OB9A 4ROCA 4HVVA 4LNPA 4C92D 2K4YA 3CC2Q 3A8LB 3RBBB 1OU8A 1Q7YU 1G3TA 5FRNA 2DNUA 3EGXB 3DB4A 3CCLA 1CKBA 2KMGA 1M2VB 3A8OB 1OIUB 3LWIA 2JM9A 3GOXA 4M78C 4M7DA 1KD1C 5IN1A 2O4XA 4CFUB 1C6VX 2YSQA 4M78B 3RESA 4RMOA 1OEBA 1BB9A 3TSWA 3DL1A 1GCQC 2LJ1A 2PHGA 2GBQA 2DXUA 1JOWA 2D6FA 1X6BA 2WSCE 1YCYA 2V1QA 4DA4A 4O6JA 2CH4W 4JZ4A 2L3PA 3VKHA 1PRLC 2DTHA 4F70B 5EJCA 2KXDA 4KGVB 4NL3A 3VRZA 4PKCC 5FU7C 5GANh 2RN8A 4LDWA 4KGXB 4EOJB 3V7CA 1VQMQ 2Z0WA 1BCMA 4IKFA 5GAOq 3NDQA 2QTVA 4PLLA 2QEXQ 1OKWB 3E2UA 1H1QB 4XTVA 2X1NB 4BD3A 2MWOA 3C94A 2D0NA 4GY5A 2ROLA 2VWFA 3OS1A 1I1JA 1JEGA 3VS1A 2RH2A 2DD5A 1VQNQ 1M4ZA 4BCJB 1Q82U 2NUTB 4QQDA 3GPLA 1VQ4Q 2B86A 2DVJA 2C6TB 1YHQA 3H8ZA 4OB2B 2DO3A 1W70A 2CZ1B 1YBYA 3CCVQ 2EQKA 2QA4A 1VQ5A 2DKGA 3TSZA 4J9BA 1PKSA 2XICA 4E7HA 3VKGA 1N6AA 3CBPA 2CZ7B 1UECA 5EC7A 1MNEA 2E1HA 1U06A 2M02A 1K8AR 4L5GA 3CCJA 3CMET 2WSFE 5GAMh 3CCSQ 3I56Q 1N4MA 1YWOA 2D0QB 3QWXX 1ZHIA 4C92G 1BK2A 1UDLA 3EG2A 1WHKA 2JMCA 1K73C 1M30A 2LMJA 2BZYA 5LMKB 3EGDA 1ZX6A 1JSTB 2X51A 1S72T 1Y07A 5KE2A 2G77A 1JB0E 5GAN6 1VQ4T 3CD6A 1H3ZA 3HKSA 1D09B 1GCPA 4C8QD 5GAMg 2R5MA 1V76A 4FYVB 1UGQB 4KH0B 1PD1A 4Q5WA 5LJ3d 2K2VA 1M2OA 2RNAA 3M4YA 1OGUB 4F7JB 1YITA 3DDQB 4BY6C 1SSFA 5KYYB 2QQRA 2K5IA 2Y4XA 4IUQA 3UA6A 1TU0B 7AT1B 4JUVA 2BUDA 4BE1A 1OKVB 1NLPC 1W6XA 2A28A 2F1LA 3TNWB 3CCVA 2L89A 2W96A 2DTOA 2MF2A 5FGKB 3FIFA 3SB2A 5ACBA 3M0TA 1QMCA 3P8HA 2EQUA 3QPHA 1TS9A 1Y71A 5LJ5h 4YOOA 1AD5A 2CP7A 2L8DA 4OF1A 3VKIA 4BUGA 1YJWT 4M75G 3QG1A 1G3NC 4YOSA 3FDRA 2CSIA 2EKOA 4NOYA 5CO7A 1KC8R 1BCOA 2DEUA 3A98A 2K3XA 4FT4A 3MI9B 3L2ZA 4KBMB 4LDVA 3J81E 4F17A 1JJ2P 3TN8B 3M58A 1FXXA 1WDXA 3ZL7C 1QWFA 2EYZA 4ELZC 5KYNA 1XQHA 1Q82C 5J3BA 1VQ7Q 3OBWA 5KE3A 1YJ9A 4GLKA 1QVGS 1KIKA 2IVWA 3QSUA 5DLQE 5LJ3j 2JT4A 2DBMA 1BKBA 2D1XA 4M78D 1JXMA 4EONB 1KC8C 4NS5A 5KYUB 2EYYA 3PGGA 4GLMA 3VJPA 4F14A 3CCLT 4C0ZA 3ER0A 3PT9A 3G71T 5D6XA 3JCMb 1D3UB 4J9FA 3TVTA 1NBEB 2QGSA 1RAAB 3CCUT 2ENMA 4BDZA 2LX7A 4EMKA 4A63B 3JCMd 1ABQA 1SSHA 2A08A 2E41A 1RL2A 2GTJA 3X25B 4K11A 3MEVA 4M77C 2MYSA 3TNHB 2M51A 4IUPA 2F5KA 2XG8D 5GAMd 1UGPB 1RI0A 2ECZA 2CGHA 2QQBA 4ELYC 3MPUB 1M1KR 4F7SB 3G6ET 2DBKA 4M7AF 4Y92A 1E7PA 1RAIB 5L8RE 1Q86R 4J83A 4A4HA 1H24B 4E7LA 3G71Q 1R0CB 5GAMf 4BCND 1R8OB 1VQOT 4X9DA 1QMZB 2DM1A 2RHZA 4OB1B 4B9XA 3JCMJ 4M7DF 1LNXA 1K1ZA 1YITT 2NLUA 4BCMD 1QKWA 3EH2A 3L42A 5FU6C 4FW1A 3H6ZA 2BS2A 1N9SA 3M0UA 4M77F 1VOMA 4M77G 2LJ0A 4CFVB 2E64A 2X35A 2FL7A 4AI6A 2NYSA 2KMTA 3C4SA 2EGEA 3S3OA 1AEYA 1HYOA 3M53A 2YRDA 2CP2A 2LX9A 2QG9B 4C92C 3BE3A 2CREA 1N8RU 1UNHD 1ZUUA 5IH2A 5FWBA 2GQVA 2DD5B 4OGRB 5CKBA 4RG8A 4RTZA 4DBFA 3CCST 1C9BA 1Q7YR 3Q1JA 1YITQ 3UF4A 4E7JA 3RKWA 4MMLA 1KC8U 2RHUA 2RK2A 2DEQA 3RDVA 2LT1A 2W99A 2X3WD 5GANj 3M56A 3PVLA 3PNWC 3QWLA 2KEAA 1VQOA 1TFBA 3ZBDA 2DL3A 1NLOC 2QQAA 1K9AA 2ZPHB 3EJ1B 4RTYA 5LJ5g 5I22A 2HKQB 2LJ3A 1SHFA 1NJIR 2E5QA 3G4SA 4AKIA 4CFUD 1HD3A 1X43A 3T9NA 3JCMX 5GAOn 1YI2Q 4C8QG 1PSEA 1VINA 1QW1A 8AT1B 4DBQA 2FZKB 1YIJA 2PVGB 4XQ3A 4C5HA 3QUIA 2E65A 5A0DA 2OTJT 4MFEA 1QCNA 1NM7A 3TU4K 4M7DG 1NEGA 3OYGA 3MEAA 4KRCB 3BDLA 3JSCA 4J9EA 5J39A 1XOVA 2MOXA 4J9HA 1M1KU 2EUFA 3OSSC 4XU3A 1G5VA 1GUXB 2W2HA 2DE0X 3CCUA 1RACB 3JCMc 1YJ9Q 5GANe 1RAFB 2C0TA 3VUBA 2COZA 1D3BB 1SG5A 2CSQA 4DQ2A 4DBHA 2HSPA 1VYUA 4A54A 1U1SA 1A0NB 2QEXA 4MZPA 2EJFA 4M7DE 3RGFB 3BG5A 3OMGA 3RMQA 2F5TX 2COYA 3MEWA 2HQHA 1IZ6A 5ICPB 2KRNA 3S3MA 1VQ7T 3META
chains in the Genus database with same CATH topology
4C0DC 1WQ7A 3QYBA 2B8AA 2YRVA 2DPPB 4E7JA 4QQ6A 3QYEA 4C5IA 2DXBB 1IREB 2ZPBB 5CR2A 1VQPT 1QVGA 3QZ5B 2BKDN 3M4GA 2ZPIB 2ZPFB 2QQSA 1TH7A 3QIIA 1YJNT 5FROA 2O4XB 2LQKA 5LJ3f 1LJOA 2DXCA 2RA2A 3M59A 4II1A 3KUFA 2DIQA 2RI2A 3RIRA 3JCMV 3QO3A 4FU6A 4NC6A 4C92B 1NPPA 1O9SA 3M55A 1D3BA 3OS0A 1HXDA 4M78E 2HBPA 2Y4YA 1BI3A 3HPWA 2L3RA 1H641 1MGQA 1G3WA 1WQWA 3OYJA 5C0MA 4LDYA 3E9GA 2JUFA 3OB9A 4BE0A 2D9TA 3CXCS 2CS7A 2E6NA 4C92D 1QP3A 2K4YA 3A8LB 4JX4A 3JB9H 4MMKA 1Q7YU 1G3TA 4JX6A 1LOJA 5FRNA 4C8QB 4EDUA 3L2QA 4JRPA 4HT9A 3DB4A 4Z02A 3CCLA 4OGEA 4TVRA 5IAYA 4M7AA 3SFMA 1X01A 3ZFJA 1YI2A 2KMGA 2HAXA 3CC7A 3A8OB 2DXTA 2WSEE 3LWHA 3LWIA 4L59A 2XDBA 4M77A 3A8GB 2M9UA 3GOXA 4M78C 3M54A 1N8RC 4M7DA 1KD1C 1VQ5T 5IN1A 2O4XA 2BIVA 4M78B 2EAYA 4FL6A 1VQ6A 1NE8A 3M5AA 3RESA 3L2WA 4RMOA 4MIMA 2ZZDB 3I55T 3TREA 2M1HA 4IURA 4D6WA 4BI4A 2LNVA 3DL1A 1Y7XA 2P4TA 2GCXA 3MEUA 4ZN1A 1I81A 3TCJA 2DXUA 3WXMB 4HNTA 1OZ3A 3TEEA 1VQKT 4YTLA 3PMIA 4MZTA 4C92E 5CAIA 2VGMA 5LJ3e 1KD1U 2D6FA 3M57A 2WSCE 3OYNA 2QXFA 3VYGA 1YCYA 2YLBA 4DA4A 3CMEA 4M7AE 4A4GA 4O6JA 4OGCA 2XI9A 1AHJB 4BE2A 3VUZA 4HCZA 3VKHA 2DTIA 2R57A 2DTHA 3OSVA 2PU9B 3UDCA 5EJCA 3BY7A 3LYIA 4NL3A 4MZMA 1GXIE 4PKCC 5FU7C 2F69A 5GANh 2QA4T 3CC2A 3FC3A 4LDWA 1UGRB 1BI2A 1B34B 3CC2T 2VGNA 3V7CA 5GAN2 5D6WA 3OYKA 3CCRT 1QVFS 3X26B 1VQ6T 2A7YA 4M78A 4M7DC 4IKFA 5GAOq 4HA8A 4PLLA 1YIJT 2YLCA 3BG3A 4ZTJA 3L2RA 4XTVA 3TW6A 2M0OA 4M6VA 2MWOA 3C94A 4BD3A 4GY5A 3JCMW 1VQNT 3OS5A 5GMKh 3OS1A 2FVUA 1BIAA 2RH2A 1DJ7B 2E6ZA 2DD4A 2DD5A 4F7UB 3HHTB 3QDRB 5HY6A 1M4ZA 4JRIA 4RCBA 1WJSA 1QP2A 4C8QC 4N4HA 1M90U 4M7AB 1Q82U 1YJNA 3ASKA 2X4YA 4N4IA 4CI0C 5FRMA 5A0LA 4ELJA 4QQDA 3OYAA 3GPLA 4PNOA 1YHQA 4RKUE 3H8ZA 4C92A 4OB2B 1HK9A 4UC4A 2DO3A 1X6OA 1OYXA 1FX7A 3UPUA 3KBGA 2CZ1B 3BG9A 1YBYA 4QVZA 4ATOA 2EQKA 3HRUA 3DLLA 2QEXT 2QA4A 3GF5A 4EMKB 3INZA 2DKGA 1VQ5A 2K5FA 1EIFA 5LJ5f 4E7HA 2XICA 3VKGA 3V8JA 1N6AA 3CBPA 5LJ3g 2CZ7B 4QSHA 4HLQA 1W2BS 4OB0B 2ZPEB 2QQ8A 3GIBA 2E1HA 4J8OA 3OYMA 3HSBA 4HL4A 3PIOA 3LH0A 2MAMA 2X4XA 1BI0A 4IUVA 4L5GA 4EMGA 3A8HB 3OY9A 3CCJA 3CMET 2LC4A 2WSFE 5GAMh 2HQEA 2D0QB 5EG2A 1ZHIA 1Y96A 4C92G 3CPWS 3OYHA 3JCMP 2RJCA 4ZGEB 3FRNA 3S6WA 3OS2A 1K73C 2RHYA 4PJOA 3VYHB 2WACA 4JLIA 4JDSA 1S72T 4MFDA 1Y07A 2G77A 1JB0E 2ZGWA 2EQJA 1VUBA 3LGFA 3SWNB 5GAN6 1VQ4T 3A8MB 4J5YA 3CD6A 1H3ZA 2A3LA 2KR6A 1VQ9T 3HKSA 3X20B 3QZ9B 5I2SA 4QVCA 2OTJA 4C8QD 5GAMg 2R5MA 2XHCA 3QKJA 1UGQB 3PFSA 1K73U 4Q5WA 5LJ3d 4XAXB 4EMKC 2K2VA 3NTIA 2KDSA 2EFIA 3A5ZB 3M4YA 3CD6T 4PJOC 4JS4A 1Q86U 3LLRA 2RO0A 1YITA 5GAN5 3RUXA 4BY6C 3CEYA 1SSFA 3FLGA 3JRZA 3HBLA 1NJIC 2RM4A 3VYGB 1WJRA 2QQRA 1QLBA 3URGA 4A4FA 5GAOm 2K5IA 2XU8A 4ZGDB 2RB6A 2Y4XA 4IUQA 2R5AA 4PJOB 2PVDB 2E70A 4M7DD 1K8AU 2OTLA 3NTKA 1Q7YC 2EWNA 3OYFA 3KXTA 3HFOA 4Z6YA 3HL8A 4JUVA 1VQLT 2BUDA 2PUKB 3JCMe 4BE1A 4NL2A 1M90C 2QFZA 4KUIA 4N4GA 3CCVA 4ZTFA 3J80E 2L89A 2DTOA 2MF2A 2C06A 3FIFA 3SB2A 5GAOr 2XDDA 2VUBA 4C92F 3OYIA 4J6XA 3P8HA 3L2UA 2EQUA 3DLMA 3FEOA 3QPHA 5GMKe 2PUOB 1Y71A 3NTHA 5LJ5h 1VQ8A 1XTDA 2PVOB 2OAUA 2FYKA 2HD0A 1ZQ1A 2X4WA 5CKEA 3CC4T 2L8DA 2XDPA 4OF1A 3VKIA 4BUGA 4QQGA 4BDYA 1YJWT 4M75G 3CCMA 3QG1A 4KT0E 5CO7A 3FDRA 2EKOA 4NOYA 4RG2A 1K9MU 5CKDA 3EAEA 5GANd 3JCMf 3G4ST 3SDZA 3JB9G 4LOCA 1BIBA 2K3XA 4FT4A 4C0DB 5LJ5e 5AYFA 3CCQT 1Y96B 4LD9K 3L2ZA 3QYGB 2LTOA 1VQPA 4C8QF 4KBMB 2K57A 4LDVA 2V8KA 1YJWA 3J81E 1P92A 1XNIA 5GAN8 4JX5A 1UEBA 2LDMA 3GLXA 1V29B 4PJOF 3E19A 4XTZA 2HQXA 3M58A 1Q81C 1FXXA 4PJOG 3QYHB 1VQ4A 4A4EA 1UB4A 4ELZC 3QJ6A 3RMSA 4HNUA 5GANf 4M75D 1XQHA 1Q82C 5J3BA 5KCOA 3OBWA 5KE3A 1YJ9A 4HNVA 2VXEA 4GLKA 1QVGS 4X9CA 2IVWA 3QSUA 4M77D 2K5LA 4M77E 5DLQE 5CKHA 5LJ3j 5GAOp 3G71A 2RD1A 5CVIA 1BKBA 3MP8A 1NPRA 4M78D 1KC8C 3HRSA 4F7UE 3V7SA 2XK0A 3CCJT 3OYYA 4E7IA 4JRKA 4NS5A 4XK8E 1MHNA 3PGGA 5GAOl 5HKCA 1QVPA 5IT9E 1FKMA 3VJPA 3OMCA 5A0GA 4DOWA 3OYLA 5I2MA 3CCLT 3JCMg 4B9WA 4C0ZA 1UGSB 4BACA 5CQYA 4BY6B 3ER0A 5HK0A 2GFAA 3PT9A 3G71T 5D6XA 3JCMb 2KAFA 4FIBA 3CCUT 4N0AC 4A4KA 2ZPGB 3CXCA 4BDZA 4EMKA 2ZZDA 3EFRA 4WF2A 5GMKm 3JCMd 5LL6S 3JB9I 3CPWA 1KG1A 2E41A 2FB7A 2KVQG 1RL2A 4M7DB 3X25B 4EMHA 3MO8A 4PLIA 3MEVA 5J26A 5LJ5j 1M5Q1 3CCQA 3I55A 2EQMA 4M77C 3V8LA 2VC8A 1JJ2A 3AHUA 2BS3A 4L6V5 3JB9F 3HO8A 2LVMA 2QTXA 3PIPA 4O5VA 2L5QA 4IUPA 2VV5A 4LDUA 2MMPA 1VQMT 3EFSA 3TW7A 4ZN3A 5DLOA 3GP8A 3CC4A 2HNIA 2F5KA 1VQMA 2XG8D 3G7ZA 4M77B 5D6YA 3CCET 5GAMd 3DKMA 1UGPB 3HZJA 3C12A 2MWPA 2JN0A 4LDXA 1RI0A 2CYZB 2JVVA 1VIFA 2CGHA 2KQWA 2QQBA 5FU6B 3SWNA 4ELYC 3PMTA 1KQSA 4F7UF 4VUBA 4E7KA 1VQ7A 3G6ET 4AKHA 3HFNA 3RKYA 4M7AF 2I2LA 1VQNA 4J6WA 1E7PA 5L8RE 2P0QA 2RJFA 3R6OA 1NZ9A 4XU1A 3MP1A 2RK1A 4J83A 5M9OA 2RHIA 4A4HA 4M7AD 2LCCA 3CCVT 3FB9A 4E7LA 3HP9A 3JB9D 2LCLA 5KE2A 5GAMf 1R8OB 2E12A 1VQOT 4C0FA 1OI1A 2KK4A 3RERA 4HCCA 3G6EA 1VQLA 2QI2A 4X9DA 3SWNC 4B9XA 2RHZA 4OB1B 2RI3A 3JCMQ 3JCMJ 4M7DF 3E9FA 4BI3A 1LNXA 1YHQT 2OTLT 5KCHA 1YITT 2NLUA 3BW1A 2P0PA 5GMKl 3CCEA 3P8DA 1KHCA 3N5BB 4X34A 4HCBA 4M75E 2E10A 4C8QE 5A2QE 1U8RA 3L42A 3OBYA 2QQ9A 3HRTA 3LW5E 2JTMA 4M75B 5FU6C 3VV0A 4JS5A 2EYQA 4OB3B 2BS2A 3H6ZA 1VIEA 3C95A 3QJYA 4J7IA 4PL6A 4M78F 5CIUA 2RHXA 4F7UA 1QVFA 5CQXA 1N9SA 3UWNA 5GAMe 1M1KC 3V7RA 1VQKA 4M77F 1VQ9A 3OW2A 4M77G 2X35A 2E64A 2RJEA 2FL7A 3MCAB 4RCCA 4AI6A 3WVEB 4M78G 2KMTA 3C4SA 4EPCA 4BB7A 4JRQA 2GFUA 2KY9A 2JNGA 1M1GA 3L2VA 1PSFA 1NJIU 3S3OA 2RI5A 4C0GA 3M53A 1I4K1 1N9RA 4PJOE 4PJOD 1W4SA 2XD0A 2LX9A 4C92C 4JJNK 2DAQA 2KSSA 4XTXA 3X24B 1K8AC 2LRQA 4J7FA 3MP6A 1Q81U 3QBYA 3BFMA 2JTFA 2MI6A 4M75C 1N8RU 2ZCFB 3CPFA 2FHDA 3F70A 3CC7T 3LGLA 1M8VA 2CZ0B 2GQVA 4OMFB 1N27A 4FT2A 2DD5B 2DD4B 1FWZA 4DOVA 4C8QA 5CKBA 1WGSA 3CCMT 1W2BA 1KQ2A 5CCAA 2DZ9A 4HKEA 1G3SA 4RG8A 3QXEB 4XTWA 5GAMj 3E1SA 1I8FA 4QW2A 3CCST 4V2SA 4CRIA 2DXCB 3JAME 5GANg 3OQ5A 3Q1JA 3ME9A 4M75F 3O8VA 1K9MC 2GF7A 4BBRM 2QF7A 2DK3A 5KH6A 5GAN3 1G3YA 3RKWA 4MMLA 4Y28E 1KC8U 2LQ8A 2RHUA 2RK2A 2XKOC 5FU7B 2DEQA 2LT1A 1KHIA 5GANj 3M56A 5DM7R 3PNWC 3QWLA 3UT1A 4A53A 1VQOA 1VQ8T 3ZBDA 3OYEA 4FM4B 5HK3A 3CCSA 4N0AA 2QQAA 4ME7A 3BDUA 3QHSA 3VU3C 3JB9J 1I5LA 2XIDA 2ZPHB 5LJ5g 3LX7A 4LD6A 4QVDA 5GMKi 4BBSM 2LT4A 3J7AF 3S3NA 5GAN4 2E5QA 3G4SA 4AKIA 3T9NA 3JCMX 5GAOn 2G3RA 3JCMh 5LJ3h 2YHTA 4C8QG 1JJ2S 1KQ1A 4MDXA 1PSEA 3WVDB 2EIFA 2DJZA 3PTAA 2DZCA 1QW1A 2IG0A 4KULA 2CZ6B 5GAN7 1JBMA 2V8IA 3SD4A 3DB3A 4XTYA 4AKGA 1BYMA 2DVEA 1YIJA 3RKXA 2JZ2A 4JLGA 2PVGB 4XQ3A 1M9SA 3QUIA 2E65A 4C5HA 5A0DA 1Q86C 2OTJT 5C6SA 4IUUA 4IUTA 4C5EA 3CCRA 4MFEA 3CBMA 3FJPA 4HT8A 4M7DG 3TU4K 4OP0A 3MHXA 2X4JA 3MEAA 2M16A 3BDLA 3OYGA 3CMAA 1KQSS 2EJ9A 4J6YA 3HB9A 3JSCA 3H4CA 5FLXE 4ZGJB 2AHJB 1XOVA 5J39A 4XU3A 3OSSC 3OYDA 1M1KU 1G5VA 3CBOA 2P0KA 5DY9A 2K3YA 1M1FA 5GMKj 3I56A 4KUDK 4M7AG 2Y90A 4E47A 3CCUA 4M7AC 1YI2T 4F7UG 3JCMc 2V8JA 1BI1A 3OA6A 4OVAA 4M75A 3X28B 2EJGA 3V8KA 5GANe 4R55A 4XU0A 3L1AA 5LJ5d 3NFCA 4C5GA 2QDJA 1ZBXA 2DXBA 4MDWA 4XTUA 3VUBA 1D3BB 2O01E 3M9QA 3I56T 1YJ9T 3OYBA 3KHIA 1X75C 4DQ2A 2JOYA 2WJ9A 2DIGA 3GNGA 2VXFA 1OZ2A 1WNLA 5CKFA 1U1SA 4A54A 1JRIA 2H3JA 3OYCA 2QEXA 3CMAT 4MZPA 1B34A 4FSXA 2EJFA 4M7DE 4XU2A 1O75A 1WPYA 1U1TA 3ZEHA 1WJQA 3BG5A 3OMGA 5CK9A 2VYTA 5I21A 3RMQA 4R56A 2PQWA 2F5TX 1S72A 3OW2S 3MEWA 3P8BB 1IZ6A 4BI8B 2RJDA 2R58A 4Y91A 2QDYB 3S3MA 2CKKA 3GNFB 2BS4A 4P5NA 1VQ7T 3META
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYH B;  2DPP B;  4RKU E;  2DXB B;  1IRE B;  2ZPB B;  4OB2 B;  3QZ5 B;  3X24 B;  2ZPI B;  2ZPF B;  2CZ1 B;  2ZCF B;  2DXC A;  2CZ0 B;  2DD4 B;  2DD5 B;  2CZ7 B;  3QXE B;  4OB0 B;  2ZPE B;  2DXC B;  4XK8 E;  3A8H B;  4Y28 E;  2WSF E;  1UGS B;  1QP3 A;  3A8L B;  2D0Q B;  4ZGE B;  2ZPG B;  4FM4 B;  2ZZD A;  3VYH B;  2ZPH B;  3X25 B;  1JB0 E;  3A8M B;  3A8O B;  2WSE E;  3X20 B;  3QZ9 B;  4L6V 5;  3A8G B;  1UGQ B;  1PSE A;  3WVD B;  2CZ6 B;  2ZZD B;  1UGP B;  2PVG B;  2CYZ B;  3VYG B;  4ZGD B;  2PVD B;  5L8R E;  2WSC E;  4ZGJ B;  2AHJ B;  3VYG A;  1AHJ B;  2PUK B;  2PU9 B;  4OB1 B;  3X28 B;  1GXI E;  2DXB A;  1UGR B;  2PUO B;  2O01 E;  2PVO B;  3LW5 E;  3X26 B;  4OB3 B;  4KT0 E;  3QYG B;  1DJ7 B;  3WVE B;  2DD4 A;  2DD5 A;  3HHT B;  1QP2 A;  2QDY B;  1PSF A;  1V29 B; 
#chains in the Genus database with same CATH topology
 4C0D C;  5DQV A;  4JPB W;  1WQ7 A;  3G1J A;  1IRE B;  2ZPF B;  3O0G D;  4EOL B;  3QII A;  1WHG A;  2RQU A;  4II1 A;  2HEQ A;  1PKT A;  3REB B;  3RIR A;  3JCM V;  4NC6 A;  1ENW A;  2DLP A;  3OS0 A;  2HBP A;  2Y4Y A;  1BI3 A;  3HPW A;  4F6U B;  3E9G A;  3K7A M;  2K2M A;  1OOT A;  2E6N A;  1QP3 A;  4JX4 A;  3JB9 H;  4JX6 A;  4DEX A;  4C8Q B;  4HT9 A;  1J3T A;  2HKN A;  1GL5 A;  3TNI B;  3LWH A;  2XDB A;  4M77 A;  1N8R C;  1VQ5 T;  3M5A A;  3SHW A;  3I55 T;  1MMG A;  4LXC A;  2H8H A;  4CFX B;  3EFO A;  2KT8 A;  3I5R A;  4IUR A;  2P4T A;  2GCX A;  4ZN1 A;  3TCJ A;  3WXM B;  4YTL A;  3PMI A;  3CCJ Q;  1BBZ A;  2MK5 A;  4E7S A;  1OPK A;  2JXB A;  2QXF A;  1MV0 B;  3VYG A;  2YLB A;  4A4G A;  2K9G A;  2PMI B;  4OGC A;  2JTE A;  4BE2 A;  2ED0 A;  4E7Z A;  3VUZ A;  2CCI B;  2L3Q A;  2CP3 A;  3UDC A;  1K9M R;  1GXI E;  4MZM A;  1KSW A;  2OI3 A;  1M8M A;  2VGN A;  1V1C A;  5GAN 2;  1N5Z A;  3OYK A;  4AFU C;  3X26 B;  2FO0 A;  3CCR T;  1VQ6 T;  1QLY A;  1VQ8 Q;  2YLC A;  3BG3 A;  3VS7 A;  1IO6 A;  1AWJ A;  3TW6 A;  2WIP B;  4M6V A;  4YC3 B;  1FMK A;  3JCM W;  3EID B;  3VS6 A;  1QVF P;  2W9Z A;  2FVU A;  1DJ7 B;  2C0O A;  2DD4 A;  2EYX A;  4F7U B;  3QDR B;  4RCB A;  3VRY A;  4AFZ C;  4N4I A;  1YJN A;  4IIM A;  5A0L A;  2OTL Q;  4RKU E;  4UC4 A;  2IIM A;  1F5Q B;  3UPU A;  3KBG A;  4TTH A;  2O9S A;  3DLL A;  2QEX T;  3GF5 A;  1VYV A;  5LJ5 f;  3V8J A;  5LJ3 g;  1IHV A;  1W2B S;  2WEV B;  2PJQ A;  2DYI A;  4HL4 A;  2X4X A;  1BI0 A;  3A8H B;  1KK7 A;  3CCR Q;  1E7O A;  1SPK A;  5I5Z B;  3CPW S;  1G2B A;  2OTJ Q;  3OS2 A;  1X6G A;  4JLI A;  3I9Q A;  2BZ8 A;  3LGF A;  2J6O A;  3A8M B;  2A3L A;  1UNG D;  1VQ9 T;  3QZ9 B;  4QVC A;  2OTJ A;  2XHC A;  1PNJ A;  4EMK C;  3FJ5 A;  2V22 B;  1ZLM A;  1XJW B;  4EC8 B;  3LLR A;  5AT1 B;  3RUX A;  3CEY A;  1UNL D;  1NJI C;  1WJR A;  3URG A;  4A4F A;  1JKW A;  1QLB A;  1H1P B;  5HBJ B;  1UG1 A;  1OU9 A;  4M7D D;  1S72 Q;  4FX3 B;  2A0F B;  2OTL A;  3NTK A;  1Q7Y C;  2HMA A;  3OYF A;  3HFO A;  4JZ3 A;  5FWC A;  9ATC B;  2F2C A;  4CC2 A;  2XDD A;  3OYI A;  3FEO A;  5KYW A;  2PUO B;  3NTH A;  1VQ8 A;  2HD0 A;  2C5X B;  1IGQ A;  4RG2 A;  3BHV B;  1H26 B;  5CKD A;  1MUZ A;  2LP5 A;  2AKK A;  4EOO B;  3JCM f;  3JB9 G;  4LOC A;  1B3Q A;  1MND A;  5LJ5 e;  3CCQ T;  3QYG B;  2LTO A;  2W0Z A;  4M4Z A;  2K57 A;  5GAN 8;  1PM3 A;  2DL8 A;  4XTZ A;  4OML A;  3M0Q A;  3MKD A;  3QJ6 A;  2RQW A;  4HNU A;  5GAN f;  2UZB B;  5KYX A;  4X9C A;  4ELL A;  2WPA B;  1RLP C;  2BPM B;  2VVK A;  5CKH A;  5GAO p;  2RD1 A;  5IF1 B;  1IHW A;  3HRS A;  4R0K A;  3CCE Q;  4F7U E;  2XK0 A;  3IQL A;  3OYY A;  4JRK A;  1UHF A;  4BCI B;  5HKC A;  1FKM A;  2FPD A;  4DOW A;  3OYL A;  5I2M A;  3JCM g;  4B9W A;  1E9H B;  2EPD A;  4LUD A;  2DFU A;  1VYT A;  1M2V A;  3CXC A;  2ZZD A;  1WHL A;  2P84 A;  1ZSZ C;  3EFR A;  5LL6 S;  3JB9 I;  3CPW A;  4M7D B;  2JGZ B;  3MO8 A;  4PLI A;  5LJ5 j;  1GUX A;  3I55 A;  2C4G B;  1Q95 G;  3AHU A;  1O9K A;  4O5V A;  2L5Q A;  2EQI A;  2P4R A;  3CC4 A;  3TW7 A;  3CQT A;  2F2X A;  3CCE T;  1LVK A;  5IXB A;  5FU6 B;  4E7K A;  1VOL A;  4AKH A;  4CC3 A;  2I2L A;  2ROT A;  2P0Q A;  4ROD A;  2RJF A;  1TOV A;  3TQ7 P;  5M9O A;  4PJJ A;  2LCC A;  1YHQ Q;  2MIO A;  1OI1 A;  2LCS A;  4HCC A;  3CMA Q;  4CFN B;  4JJB A;  2OTL T;  2GTO A;  4AG2 C;  1WA7 A;  2VKN A;  1H27 B;  3P8D A;  2DL7 A;  2WXV B;  5A2Q E;  4C8Q E;  3GTM S;  3OBY A;  4M75 B;  2EYQ A;  5CIU A;  3C95 A;  3G6E Q;  2YUQ A;  4PL6 A;  1RUW A;  1QVF A;  2D8J A;  1M1K C;  3UWN A;  3V7R A;  1P5E B;  3PVQ A;  4AFS C;  2RJE A;  2PNI A;  1IGU A;  3WVE B;  3HTR A;  3BHT B;  1JU5 C;  4EPC A;  4JRQ A;  4BB7 A;  2KY9 A;  2JNG A;  1PSF A;  5HVY B;  2QGG A;  2J6K A;  2JW4 A;  1JO8 A;  1GH6 B;  1OIY B;  1N9R A;  1PWT A;  3U23 A;  2EBP A;  2R7G A;  4XTX A;  2LRQ A;  3CCL Q;  2MI6 A;  4M75 C;  2ZCF B;  5IXF A;  2FHD A;  2DET A;  3LGL A;  2CZ0 B;  4OMF B;  2DD4 B;  1FWZ A;  1W2B A;  1FYN A;  5GAM j;  3QXE B;  2BE9 B;  1I8F A;  2AZV A;  1H4L D;  4V2S A;  4CRI A;  2J6F A;  3OQ5 A;  2GF7 A;  4BBR M;  2DK3 A;  1G3Y A;  4II5 B;  2XKO C;  5DM7 R;  2KGT A;  3OYE A;  5HK3 A;  3CCS A;  1FVV B;  4BXX X;  2X9H A;  3LQ5 B;  3BDU A;  3QHS A;  3VU3 C;  2AK5 A;  2NUP A;  1NEB A;  2RQR A;  4LD6 A;  5GMK i;  2ABL A;  3J7A F;  3C0C A;  1D0Y A;  1IRX A;  3EH1 A;  3JCM h;  4MDX A;  1OPL A;  2H3E B;  1TTH B;  4XTY A;  2JM8 A;  4AKG A;  1BYM A;  1KD1 R;  2JZ2 A;  3G4S Q;  1UJY A;  3NPF A;  5C6S A;  4IUU A;  3CCR A;  2RF0 A;  4HT8 A;  3MHX A;  4F7N B;  4J6Y A;  3HB9 A;  3VS0 A;  2AHJ B;  2DL5 A;  2BKZ B;  3OYD A;  5DY9 A;  4PJN A;  2G9X B;  3NHN A;  3O5Z A;  5GMK j;  4E47 A;  4M7A C;  1YI2 T;  1K0X A;  4F7U G;  2V8J A;  3OA6 A;  4D8K A;  2EJG A;  3V8K A;  1SF9 A;  5GJW B;  3L1A A;  1PCX A;  3UAT A;  5LJ5 d;  3QWY A;  4FCY A;  1ZBX A;  2DXB A;  4MDW A;  3M9Q A;  4NST B;  1RAH B;  2O01 E;  3M0S A;  3I56 T;  3M03 A;  5HCK A;  2I40 B;  2JOY A;  4RTV A;  4BCG B;  5CKF A;  1PD0 A;  1JRI A;  3OYC A;  3CPW P;  3CMA T;  1U1T A;  1WJQ A;  4OMM A;  1GRI A;  5CK9 A;  1ZUK A;  2QA4 Q;  5IHI A;  4BI8 B;  2RJD A;  2QYZ A;  3B57 A;  2BS4 A;  4LN2 A;  5CR2 A;  3QYB A;  2YRV A;  2DPP B;  4QQ6 A;  3R6N A;  3QYE A;  3EG3 A;  3EG9 A;  2DXB B;  1QVG A;  3VS2 A;  1VQP T;  2BKD N;  1FMV A;  3M4G A;  5L23 A;  4RTW A;  2O4X B;  2LQK A;  2DXC A;  2DIQ A;  3M55 A;  5HBE B;  1O9S A;  1JSU B;  1HXD A;  4EOS B;  2L3R A;  3OYJ A;  5C0M A;  1PHT A;  4LDY A;  4F6S B;  5HBH B;  4BE0 A;  5CYI B;  4GBQ A;  2CS7 A;  2CDT A;  3SEM A;  3A1P A;  4MMK A;  2JS0 A;  1OI9 B;  1QVG P;  4JRP A;  4Z02 A;  3RR6 A;  5IAY A;  4M7A A;  3SFM A;  3DTO A;  2WFY B;  1X01 A;  1MMD A;  3ZFJ A;  3CC7 A;  1YJW Q;  1H8K A;  2PTK A;  1OL1 B;  1TG0 A;  1AWW A;  2EAY A;  1ZUY A;  4FL6 A;  1RI9 A;  3L2W A;  4MIM A;  2ZZD B;  1ABO A;  1Z9Q A;  2M1H A;  1UTI A;  3G33 B;  2IN3 A;  1I81 A;  4HNT A;  1OZ3 A;  2UZL B;  1KFZ A;  2KT1 A;  1ZA2 B;  4C92 E;  1TD6 A;  1KD1 U;  1O9K B;  3OYN A;  1R0B G;  2O2O A;  4M7A E;  2KYB A;  3EG0 A;  2FEI A;  2XI9 A;  1AHJ B;  2YDL A;  1OL2 B;  4HCZ A;  4EOM B;  1OV3 A;  4BCM B;  2DTI A;  1AT1 B;  3QDF A;  3CC2 A;  3FC3 A;  2GNC A;  1UGR B;  1WHJ A;  1BI2 A;  1B34 B;  1H28 B;  1E6H A;  5KYX B;  4M78 A;  4M7D C;  3H0F A;  3EOC B;  1YN8 A;  2BE7 D;  4HA8 A;  1YIJ T;  4ZTJ A;  2UUE B;  1VQN T;  5CEI B;  2V1R A;  5GMK h;  1BIA A;  4KRT A;  1IXD A;  3EHQ A;  4JRI A;  2V26 A;  1WJS A;  1QP2 A;  1M90 U;  3EGU A;  4QT7 A;  3VS4 A;  2EGC A;  4CC7 A;  2YT6 A;  5ECA A;  2CUD A;  4C92 A;  3EG1 A;  1H1S B;  1OYX A;  4BY1 X;  1FX7 A;  1URC B;  4ATO A;  2DA9 A;  2J05 A;  3INZ A;  1SRM A;  2K5F A;  1EIF A;  3QHW B;  3CME Q;  4QSH A;  2F2V A;  4HLQ A;  4OB0 B;  2ZPE B;  2QQ8 A;  3GIB A;  4Y72 B;  1HSQ A;  3HSB A;  3PIO A;  3LH0 A;  2IVX A;  2MAM A;  4EMG A;  4ORZ A;  4E7I A;  1T0H A;  2RQT A;  4DBR A;  4FSS A;  2LC4 A;  2UZE B;  2OJ2 A;  1WHH A;  4QKU A;  1Y96 A;  4EIK A;  3JCM P;  3OYH A;  3FRN A;  4ZGE B;  1WFW A;  2EW3 A;  2QAZ A;  2WAC A;  2SRC A;  2ZGW A;  2EQJ A;  3SWN B;  4Z88 A;  4J5Y A;  3RNJ A;  2I53 A;  1M90 R;  3X20 B;  1LCK A;  5I2S A;  1K0S A;  4YOZ A;  2COW A;  3QKJ A;  2ZAE A;  3PFS A;  2MPX C;  3POM A;  4XAX B;  3NTI A;  2EFI A;  3A5Z B;  4PJO C;  3CD6 T;  1QCF A;  4JS4 A;  3UA7 A;  2RO0 A;  5GAN 5;  3MY1 B;  3JRZ A;  3HBL A;  2RM4 A;  5GAO m;  2DYB A;  1KXU A;  5DQW A;  4ZGD B;  2RB6 A;  2O9V A;  2PVD B;  2E70 A;  1K8A U;  2FZG B;  2I0N A;  2EWN A;  1PKD B;  4Z6Y A;  4EOR B;  3JV3 A;  2QFZ A;  4KUI A;  4ZTF A;  1ZSZ A;  4LUE A;  2C06 A;  4EOK B;  3L2U A;  3THK A;  5GMK e;  2RMO A;  1VQP Q;  2FYK A;  2XDP A;  2E3H A;  3CCM A;  4ZNX A;  1K9M U;  3EAE A;  4C0D B;  2SEM A;  2NUT A;  1B07 A;  1SRL A;  4BCN B;  1P92 A;  1XNI A;  2DMO A;  4JX5 A;  4PJO F;  1V29 B;  1Q81 C;  2CT3 A;  4PJO G;  4E6R A;  4A4E A;  1NG2 A;  1UB4 A;  4M75 D;  5KCO A;  1TUC A;  2EGA A;  2NUP B;  4HNV A;  3CCM Q;  2LNH B;  3OW2 P;  2K6D A;  4M77 E;  3G71 A;  5CVI A;  3MP8 A;  4F7L B;  3V7S A;  1W1F A;  4XK8 E;  1ZSG A;  3OMC A;  5HK0 A;  2DRK A;  3M0R A;  4J9D A;  1YNZ A;  1D1A A;  2C5O B;  2ZPG B;  4A4K A;  1WLP B;  1CKA A;  2DRM A;  1PC0 A;  2IPO B;  4EC9 B;  5GMK m;  2FB7 A;  4EMH A;  5J26 A;  2DL4 A;  1AZE A;  2EQM A;  4PJM A;  3V8L A;  2W9F A;  2VC8 A;  5KYW B;  3JB9 F;  3HO8 A;  1I0C A;  2WIH B;  4BCK B;  2QTX A;  1KQS P;  4OMP A;  1OX9 A;  2VV5 A;  4LDU A;  2WMA B;  2MMP A;  1VQM T;  3EFS A;  4ZN3 A;  2GQI A;  3DKM A;  3HZJ A;  3C12 A;  4LDX A;  1VIF A;  2KQW A;  4J9C A;  2O88 A;  1KQS A;  1LPL A;  3HFN A;  1M3B A;  4J6W A;  1XO2 A;  1OUL A;  4B6M A;  1JXO A;  3BLQ B;  4OR5 B;  2PK9 B;  2RK1 A;  3MP1 A;  3CD6 Q;  2JMA A;  1C1A A;  4M7A D;  1IB8 A;  3CCV T;  3PO3 S;  3FB9 A;  3HP9 A;  2LCL A;  2HBW A;  1UUE A;  4C0F A;  2KK4 A;  3DJB A;  1SEM A;  2LW4 A;  2QI2 A;  3BLH B;  3SWN C;  2YUP A;  3E9F A;  1CSK A;  5HQ0 B;  2FPF A;  5KCH A;  3EG9 B;  1F1B B;  3CCE A;  4X34 A;  2CUB A;  3LW5 E;  2QQ9 A;  4HCB A;  2JTM A;  2OX7 A;  3QJY A;  1VIE A;  4M78 F;  4WTO B;  2RHX A;  4F7U A;  1VQK A;  3OW2 A;  2DF6 A;  2KNB B;  1GBQ A;  3MCA B;  3CCQ Q;  4M78 G;  5IHK A;  1NJI U;  4F04 B;  2GFU A;  1M1G A;  5L2W B;  4C0G A;  4AMC A;  4OMO A;  1I4K 1;  4PJO E;  4KRD B;  2XD0 A;  1ZA1 B;  2E3I A;  3DOG B;  4JJN K;  2DAQ A;  2KSS A;  1H1R B;  1Q81 U;  3QBY A;  5KYU A;  5I11 A;  1N27 A;  4DOV A;  2QDL A;  1KQ2 A;  2DZ9 A;  4HKE A;  1G3S A;  4XTW A;  4AFQ C;  8ATC B;  3JAM E;  5GAN g;  4M75 F;  3O8V A;  2WMB B;  5GAN 3;  1K9M C;  4Y28 E;  2KI7 A;  1X27 A;  5FU7 B;  1Y57 A;  3UT1 A;  1VQ8 T;  4FM4 B;  2L3S A;  1ZBJ A;  4ME7 A;  1VYW B;  1I5L A;  3JB9 J;  2XID A;  3LX7 A;  4BBS M;  3MJX A;  4JJD A;  2G3R A;  2IW9 B;  1H25 B;  5FW9 A;  4PFZ A;  1YP5 A;  2IW8 B;  3WVD B;  3H41 A;  2EIF A;  2DZC A;  4KUL A;  2V8I A;  1N8R R;  4CFM B;  4BCO B;  3RKX A;  1Q86 C;  1M9S A;  2EYW A;  4EOP B;  2EVR A;  3CBM A;  2X4J A;  1KQS S;  1K4U S;  5KYY A;  2C0I A;  3H4C A;  5FLX E;  2P0K A;  2RQV A;  4M7A G;  2Y90 A;  2ED1 A;  4BY7 X;  1BI1 A;  1T0J A;  1QWE A;  3X28 B;  4XU0 A;  4C5G A;  2J7I A;  1YJ9 T;  1X69 A;  4AT1 B;  3KHI A;  1X75 C;  4PFO A;  3OYB A;  1ZP2 A;  1VQ9 Q;  5LQF B;  1OZ2 A;  1OQK A;  2H3J A;  2FZC B;  3PE0 A;  4FSX A;  1O75 A;  1WPY A;  1NYF A;  4HXJ A;  3ZEH A;  2VYT A;  2PQW A;  2HL5 C;  4I3Z B;  3OW2 S;  1VA7 A;  4Y91 A;  2CKK A;  1EFN A;  2PUK B;  2F2W A;  2KRM A;  2B8A A;  3NMZ C;  4C5I A;  4IMY B;  2AKL A;  2QQS A;  1TH7 A;  2DER A;  1YJN T;  5LJ3 f;  2RA2 A;  4FYW B;  1X2K A;  4FU6 A;  1Q81 R;  1D3B A;  4M78 E;  1UHC A;  1MGQ A;  1G3W A;  1U5S A;  5IHN A;  1OX8 A;  2D9T A;  3CXC S;  4PK4 A;  4RTX A;  4BCQ B;  1VQO Q;  2PZ1 A;  1LOJ A;  4EDU A;  3L2Q A;  2FG0 A;  2HDA A;  4OGE A;  4TVR A;  1YI2 A;  2HAX A;  2DXT A;  2WSE E;  1K73 R;  2YRC A;  4L59 A;  4BCH B;  3A8G B;  2M9U A;  1YJN Q;  2E5K A;  3M54 A;  1GFC A;  2BIV A;  5IDP B;  1VQ6 A;  1NE8 A;  3LH5 A;  3TRE A;  2OAW A;  1B7T A;  4LE9 A;  1BU2 A;  1TXQ A;  1UJ0 A;  4D6W A;  4BI4 A;  2CT4 A;  2LNV A;  1Y7X A;  3MEU A;  1ARK A;  3TEE A;  2LQW A;  1VQK T;  4MZT A;  2YXY A;  5CAI A;  5LJ3 e;  2VGM A;  3M57 A;  4BCP B;  4D8D A;  3CME A;  3DDP B;  4ANJ A;  2R57 A;  3OSV A;  2J06 A;  2PU9 B;  3BY7 A;  3LYI A;  1W98 B;  1M3C A;  2D8H A;  2CP0 A;  2F69 A;  2QA4 T;  2HL3 A;  3CC2 T;  5D6W A;  1TWB A;  1QVF S;  1VQK Q;  2A7Y A;  3L2R A;  2M0O A;  3EFO B;  2L0A A;  3OS5 A;  1AOJ A;  2E6Z A;  3HHT B;  4C8Q C;  5HY6 A;  2X3X D;  3GBQ A;  4AG1 C;  4N4H A;  4M7A B;  1RLQ C;  1RAE B;  3ASK A;  2X4Y A;  4CI0 C;  4JJC A;  4ELJ A;  3OYA A;  2XMF A;  4PNO A;  1HK9 A;  1X6O A;  3BG9 A;  4QVZ A;  3HRU A;  3M0P A;  4EMK B;  4Z89 A;  3BHU B;  3NGP A;  2YUN A;  1C0M A;  4IIO A;  1D0Z A;  3QHR B;  2VAS A;  2W10 A;  4J8O A;  3OYM A;  2KRS A;  3OY9 A;  1Y0M A;  1PG5 B;  2HCK A;  4IUV A;  1UFF A;  1RAD B;  2PK2 A;  2HQE A;  4RTT A;  5EG2 A;  2HSE B;  2RJC A;  3S6W A;  4CRL B;  1RAB B;  2RHY A;  4PJO A;  3VYH B;  1D1C A;  1R77 A;  4JDS A;  4BCQ D;  4MFD A;  1EX4 A;  1VUB A;  4E2F B;  1AVZ C;  2QAS A;  2QK0 A;  2JS2 A;  2KR6 A;  4EOI B;  2WHB B;  1K73 U;  1MMA A;  2K79 A;  2KDS A;  1Q86 U;  4G6L B;  3FLG A;  3VS3 A;  2A37 A;  4OMN A;  3VYG B;  1D1B A;  2XU8 A;  2CCH B;  2R5A A;  3EGX A;  3F5X B;  4PJO B;  2AIR B;  1K76 A;  4HCK A;  1Z9Z A;  1GBR A;  6AT1 B;  2YWW A;  3KXT A;  3BLR B;  3HL8 A;  1VQL T;  1AWO A;  1QQJ A;  3JCM e;  5IDN B;  4NL2 A;  1M90 C;  4N4G A;  4ROE A;  3J80 E;  5GAO r;  2VUB A;  4C92 F;  4J6X A;  3DLM A;  4HVW A;  3MIA B;  1XTD A;  2PVO B;  2OAU A;  1ZQ1 A;  2VB6 A;  2X4W A;  1G83 A;  4FYX B;  5CKE A;  3CC4 T;  1W2B P;  4QQG A;  4BDY A;  1U3O A;  1X2Q A;  1FMW A;  4KT0 E;  5GAN d;  2CH4 A;  3G4S T;  3SDZ A;  1BIB A;  4LD9 K;  5AYF A;  1Y96 B;  4KGZ B;  1MV3 A;  2DIL A;  1VQP A;  4C8Q F;  1UGV A;  3EHR A;  4J9I A;  2V8K A;  1YJW A;  3CC7 Q;  2K7A A;  4PFP A;  1UEB A;  2KRO A;  2LDM A;  3GLX A;  3E19 A;  2HQX A;  3QYH B;  1VQ4 A;  3CCU Q;  4F6W B;  2O31 A;  3RMS A;  4UN0 A;  1WXU A;  2BTT A;  2VXE A;  1VQL Q;  5D7U A;  4M77 D;  2K5L A;  1NPR A;  2NUZ A;  2FRW A;  3CCJ T;  2RPN A;  2BZX A;  1HJD A;  1MHN A;  5GAO l;  1QVP A;  5IT9 E;  5A0G A;  4DEY A;  3CC4 Q;  1UGS B;  4BAC A;  5CQY A;  4BY6 B;  2GFA A;  2KAF A;  4FIB A;  4N0A C;  1KG1 A;  4WF2 A;  1WYX A;  2KVQ G;  2CP6 A;  1ZSZ B;  4OMQ A;  2AT1 B;  1M5Q 1;  3CCQ A;  1GFD A;  4CC4 B;  1H3H A;  1JJ2 A;  2BS3 A;  4L6V 5;  2KYM A;  2LVM A;  3PIP A;  3AT1 B;  4X1V A;  5DLO A;  3GP8 A;  2HNI A;  3REA B;  2CP5 A;  4M77 B;  3G7Z A;  1VQM A;  5D6Y A;  1WIE A;  2MWP A;  2JN0 A;  2CYZ B;  2JVV A;  3SWN A;  3PMT A;  4F7U F;  4VUB A;  1VQ7 A;  2B9R A;  2ATC B;  3RKY A;  1VQN A;  5HNB B;  3EGD B;  1SHG A;  3KFV A;  3R6O A;  1NZ9 A;  2KR3 A;  4J9G A;  4XU1 A;  2RHI A;  3JB9 D;  1VQ5 Q;  2E12 A;  3RER A;  1WXB A;  3CXC P;  3G6E A;  1VQL A;  1WI7 A;  2KBT A;  2RI3 A;  3JCM Q;  4HVU A;  4BI3 A;  2FRY A;  1YHQ T;  3MY5 B;  3BW1 A;  5GMK l;  2P0P A;  1KHC A;  3N5B B;  1AIS B;  4M75 E;  2E10 A;  3I35 A;  1U8R A;  2HZY A;  4BCF B;  2KE9 A;  3HRT A;  3VV0 A;  4JS5 A;  2IW6 B;  2UZD B;  4J7I A;  4OB3 B;  5FRM A;  1WX6 A;  1T3L A;  5CQX A;  5GAM e;  1S1N A;  1WZO A;  4RUG A;  1VQ9 A;  4RTU A;  2C5N B;  4RCC A;  1AZG B;  3L2V A;  2RI5 A;  1M27 C;  2NWM A;  4PJO D;  1W4S A;  1K8A C;  3X24 B;  2G6F X;  4J7F A;  3MP6 A;  5GJV B;  1QCO A;  2JTF A;  3BFM A;  3F70 A;  3CPF A;  3CC7 T;  1M8V A;  4FT2 A;  3CCM T;  4C8Q A;  1WGS A;  1YCS B;  5CCA A;  1QKX A;  3E1S A;  4QW2 A;  2A36 A;  2DXC B;  2KXC A;  1KJW A;  3ME9 A;  5KH6 A;  2QF7 A;  5BNJ B;  1YFN A;  1BU1 A;  2LQ8 A;  2GGR A;  1KHI A;  1AD6 A;  4A53 A;  1TUG B;  4CFW B;  4FYY B;  2YUO A;  1YIJ Q;  4N0A A;  3ULR B;  2K3B A;  1TSF A;  4QVD A;  2LT4 A;  3S3N A;  5GAN 4;  2DJQ A;  2FPE A;  4CXA B;  1JQQ A;  1I5O B;  1I07 A;  5LJ3 h;  2YHT A;  1JJ2 S;  1E6G A;  1KQ1 A;  4FW2 A;  1PRM C;  2JJ9 A;  2DJZ A;  1GCQ A;  3PTA A;  2IG0 A;  1D0X A;  2CZ6 B;  5GAN 7;  1JBM A;  3SD4 A;  3DB3 A;  1H92 A;  2QGF B;  2DVE A;  3VS5 A;  4JLG A;  2M0Y A;  1WXT A;  2DME A;  4IUT A;  4C5E A;  2C5V B;  3FJP A;  4PJL A;  4OP0 A;  3CMA A;  2M16 A;  2EJ9 A;  4ZGJ B;  3I55 Q;  1AWX A;  5IHY A;  3CBO A;  2CJM B;  2K3Y A;  1M1F A;  3I56 A;  4KUD K;  4WCI A;  1WHM A;  4OVA A;  4M75 A;  2MCN A;  4R55 A;  2E4H A;  1SKU B;  1TUD A;  1NYG A;  3NFC A;  2QDJ A;  4XTU A;  3H0I A;  1ACM B;  4KH1 B;  3GNG A;  2WJ9 A;  2DIG A;  3H9N A;  2VXF A;  1WNL A;  1VQ6 Q;  2AZS A;  5EFQ B;  1B34 A;  4XU2 A;  1M3A A;  1YWP A;  5I21 A;  1Q82 R;  4R56 A;  4Z8A A;  1S72 A;  3P8B B;  1T3S A;  3I5S A;  2EKH A;  2R58 A;  2QDY B;  4EOQ B;  3GNF B;  4P5N A;  1MMN A;  4ESR A;  2ESW A;  3D7S B;  2ZPB B;  3QZ5 B;  2ZPI B;  1UE9 A;  5FRO A;  2L2P A;  2LQN A;  1LJO A;  3M59 A;  4F16 A;  3KUF A;  2RI2 A;  1GY3 B;  3QO3 A;  1EZZ B;  4C92 B;  1NPP A;  2LZ6 B;  1H64 1;  1FIN B;  3H0H A;  1WQW A;  2DX1 A;  1RAG B;  1G8X A;  2JUF A;  3OB9 A;  4ROC A;  4HVV A;  4LNP A;  4C92 D;  2K4Y A;  3CC2 Q;  3A8L B;  3RBB B;  1OU8 A;  1Q7Y U;  1G3T A;  5FRN A;  2DNU A;  3EGX B;  3DB4 A;  3CCL A;  1CKB A;  2KMG A;  1M2V B;  3A8O B;  1OIU B;  3LWI A;  2JM9 A;  3GOX A;  4M78 C;  4M7D A;  1KD1 C;  5IN1 A;  2O4X A;  4CFU B;  1C6V X;  2YSQ A;  4M78 B;  3RES A;  4RMO A;  1OEB A;  1BB9 A;  3TSW A;  3DL1 A;  1GCQ C;  2LJ1 A;  2PHG A;  2GBQ A;  2DXU A;  1JOW A;  2D6F A;  1X6B A;  2WSC E;  1YCY A;  2V1Q A;  4DA4 A;  4O6J A;  2CH4 W;  4JZ4 A;  2L3P A;  3VKH A;  1PRL C;  2DTH A;  4F70 B;  5EJC A;  2KXD A;  4KGV B;  4NL3 A;  3VRZ A;  4PKC C;  5FU7 C;  5GAN h;  2RN8 A;  4LDW A;  4KGX B;  4EOJ B;  3V7C A;  1VQM Q;  2Z0W A;  1BCM A;  4IKF A;  5GAO q;  3NDQ A;  2QTV A;  4PLL A;  2QEX Q;  1OKW B;  3E2U A;  1H1Q B;  4XTV A;  2X1N B;  4BD3 A;  2MWO A;  3C94 A;  2D0N A;  4GY5 A;  2ROL A;  2VWF A;  3OS1 A;  1I1J A;  1JEG A;  3VS1 A;  2RH2 A;  2DD5 A;  1VQN Q;  1M4Z A;  4BCJ B;  1Q82 U;  2NUT B;  4QQD A;  3GPL A;  1VQ4 Q;  2B86 A;  2DVJ A;  2C6T B;  1YHQ A;  3H8Z A;  4OB2 B;  2DO3 A;  1W70 A;  2CZ1 B;  1YBY A;  3CCV Q;  2EQK A;  2QA4 A;  1VQ5 A;  2DKG A;  3TSZ A;  4J9B A;  1PKS A;  2XIC A;  4E7H A;  3VKG A;  1N6A A;  3CBP A;  2CZ7 B;  1UEC A;  5EC7 A;  1MNE A;  2E1H A;  1U06 A;  2M02 A;  1K8A R;  4L5G A;  3CCJ A;  3CME T;  2WSF E;  5GAM h;  3CCS Q;  3I56 Q;  1N4M A;  1YWO A;  2D0Q B;  3QWX X;  1ZHI A;  4C92 G;  1BK2 A;  1UDL A;  3EG2 A;  1WHK A;  2JMC A;  1K73 C;  1M30 A;  2LMJ A;  2BZY A;  5LMK B;  3EGD A;  1ZX6 A;  1JST B;  2X51 A;  1S72 T;  1Y07 A;  5KE2 A;  2G77 A;  1JB0 E;  5GAN 6;  1VQ4 T;  3CD6 A;  1H3Z A;  3HKS A;  1D09 B;  1GCP A;  4C8Q D;  5GAM g;  2R5M A;  1V76 A;  4FYV B;  1UGQ B;  4KH0 B;  1PD1 A;  4Q5W A;  5LJ3 d;  2K2V A;  1M2O A;  2RNA A;  3M4Y A;  1OGU B;  4F7J B;  1YIT A;  3DDQ B;  4BY6 C;  1SSF A;  5KYY B;  2QQR A;  2K5I A;  2Y4X A;  4IUQ A;  3UA6 A;  1TU0 B;  7AT1 B;  4JUV A;  2BUD A;  4BE1 A;  1OKV B;  1NLP C;  1W6X A;  2A28 A;  2F1L A;  3TNW B;  3CCV A;  2L89 A;  2W96 A;  2DTO A;  2MF2 A;  5FGK B;  3FIF A;  3SB2 A;  5ACB A;  3M0T A;  1QMC A;  3P8H A;  2EQU A;  3QPH A;  1TS9 A;  1Y71 A;  5LJ5 h;  4YOO A;  1AD5 A;  2CP7 A;  2L8D A;  4OF1 A;  3VKI A;  4BUG A;  1YJW T;  4M75 G;  3QG1 A;  1G3N C;  4YOS A;  3FDR A;  2CSI A;  2EKO A;  4NOY A;  5CO7 A;  1KC8 R;  1BCO A;  2DEU A;  3A98 A;  2K3X A;  4FT4 A;  3MI9 B;  3L2Z A;  4KBM B;  4LDV A;  3J81 E;  4F17 A;  1JJ2 P;  3TN8 B;  3M58 A;  1FXX A;  1WDX A;  3ZL7 C;  1QWF A;  2EYZ A;  4ELZ C;  5KYN A;  1XQH A;  1Q82 C;  5J3B A;  1VQ7 Q;  3OBW A;  5KE3 A;  1YJ9 A;  4GLK A;  1QVG S;  1KIK A;  2IVW A;  3QSU A;  5DLQ E;  5LJ3 j;  2JT4 A;  2DBM A;  1BKB A;  2D1X A;  4M78 D;  1JXM A;  4EON B;  1KC8 C;  4NS5 A;  5KYU B;  2EYY A;  3PGG A;  4GLM A;  3VJP A;  4F14 A;  3CCL T;  4C0Z A;  3ER0 A;  3PT9 A;  3G71 T;  5D6X A;  3JCM b;  1D3U B;  4J9F A;  3TVT A;  1NBE B;  2QGS A;  1RAA B;  3CCU T;  2ENM A;  4BDZ A;  2LX7 A;  4EMK A;  4A63 B;  3JCM d;  1ABQ A;  1SSH A;  2A08 A;  2E41 A;  1RL2 A;  2GTJ A;  3X25 B;  4K11 A;  3MEV A;  4M77 C;  2MYS A;  3TNH B;  2M51 A;  4IUP A;  2F5K A;  2XG8 D;  5GAM d;  1UGP B;  1RI0 A;  2ECZ A;  2CGH A;  2QQB A;  4ELY C;  3MPU B;  1M1K R;  4F7S B;  3G6E T;  2DBK A;  4M7A F;  4Y92 A;  1E7P A;  1RAI B;  5L8R E;  1Q86 R;  4J83 A;  4A4H A;  1H24 B;  4E7L A;  3G71 Q;  1R0C B;  5GAM f;  4BCN D;  1R8O B;  1VQO T;  4X9D A;  1QMZ B;  2DM1 A;  2RHZ A;  4OB1 B;  4B9X A;  3JCM J;  4M7D F;  1LNX A;  1K1Z A;  1YIT T;  2NLU A;  4BCM D;  1QKW A;  3EH2 A;  3L42 A;  5FU6 C;  4FW1 A;  3H6Z A;  2BS2 A;  1N9S A;  3M0U A;  4M77 F;  1VOM A;  4M77 G;  2LJ0 A;  4CFV B;  2E64 A;  2X35 A;  2FL7 A;  4AI6 A;  2NYS A;  2KMT A;  3C4S A;  2EGE A;  3S3O A;  1AEY A;  1HYO A;  3M53 A;  2YRD A;  2CP2 A;  2LX9 A;  2QG9 B;  4C92 C;  3BE3 A;  2CRE A;  1N8R U;  1UNH D;  1ZUU A;  5IH2 A;  5FWB A;  2GQV A;  2DD5 B;  4OGR B;  5CKB A;  4RG8 A;  4RTZ A;  4DBF A;  3CCS T;  1C9B A;  1Q7Y R;  3Q1J A;  1YIT Q;  3UF4 A;  4E7J A;  3RKW A;  4MML A;  1KC8 U;  2RHU A;  2RK2 A;  2DEQ A;  3RDV A;  2LT1 A;  2W99 A;  2X3W D;  5GAN j;  3M56 A;  3PVL A;  3PNW C;  3QWL A;  2KEA A;  1VQO A;  1TFB A;  3ZBD A;  2DL3 A;  1NLO C;  2QQA A;  1K9A A;  2ZPH B;  3EJ1 B;  4RTY A;  5LJ5 g;  5I22 A;  2HKQ B;  2LJ3 A;  1SHF A;  1NJI R;  2E5Q A;  3G4S A;  4AKI A;  4CFU D;  1HD3 A;  1X43 A;  3T9N A;  3JCM X;  5GAO n;  1YI2 Q;  4C8Q G;  1PSE A;  1VIN A;  1QW1 A;  8AT1 B;  4DBQ A;  2FZK B;  1YIJ A;  2PVG B;  4XQ3 A;  4C5H A;  3QUI A;  2E65 A;  5A0D A;  2OTJ T;  4MFE A;  1QCN A;  1NM7 A;  3TU4 K;  4M7D G;  1NEG A;  3OYG A;  3MEA A;  4KRC B;  3BDL A;  3JSC A;  4J9E A;  5J39 A;  1XOV A;  2MOX A;  4J9H A;  1M1K U;  2EUF A;  3OSS C;  4XU3 A;  1G5V A;  1GUX B;  2W2H A;  2DE0 X;  3CCU A;  1RAC B;  3JCM c;  1YJ9 Q;  5GAN e;  1RAF B;  2C0T A;  3VUB A;  2COZ A;  1D3B B;  1SG5 A;  2CSQ A;  4DQ2 A;  4DBH A;  2HSP A;  1VYU A;  4A54 A;  1U1S A;  1A0N B;  2QEX A;  4MZP A;  2EJF A;  4M7D E;  3RGF B;  3BG5 A;  3OMG A;  3RMQ A;  2F5T X;  2COY A;  3MEW A;  2HQH A;  1IZ6 A;  5ICP B;  2KRN A;  3S3M A;  1VQ7 T;  3MET A; 
#chains in the Genus database with same CATH homology
 4C0D C;  1WQ7 A;  3QYB A;  2B8A A;  2YRV A;  2DPP B;  4E7J A;  4QQ6 A;  3QYE A;  4C5I A;  2DXB B;  1IRE B;  2ZPB B;  5CR2 A;  1VQP T;  1QVG A;  3QZ5 B;  2BKD N;  3M4G A;  2ZPI B;  2ZPF B;  2QQS A;  1TH7 A;  3QII A;  1YJN T;  5FRO A;  2O4X B;  2LQK A;  5LJ3 f;  1LJO A;  2DXC A;  2RA2 A;  3M59 A;  4II1 A;  3KUF A;  2DIQ A;  2RI2 A;  3RIR A;  3JCM V;  3QO3 A;  4FU6 A;  4NC6 A;  4C92 B;  1NPP A;  1O9S A;  3M55 A;  1D3B A;  3OS0 A;  1HXD A;  4M78 E;  2HBP A;  2Y4Y A;  1BI3 A;  3HPW A;  2L3R A;  1H64 1;  1MGQ A;  1G3W A;  1WQW A;  3OYJ A;  5C0M A;  4LDY A;  3E9G A;  2JUF A;  3OB9 A;  4BE0 A;  2D9T A;  3CXC S;  2CS7 A;  2E6N A;  4C92 D;  1QP3 A;  2K4Y A;  3A8L B;  4JX4 A;  3JB9 H;  4MMK A;  1Q7Y U;  1G3T A;  4JX6 A;  1LOJ A;  5FRN A;  4C8Q B;  4EDU A;  3L2Q A;  4JRP A;  4HT9 A;  3DB4 A;  4Z02 A;  3CCL A;  4OGE A;  4TVR A;  5IAY A;  4M7A A;  3SFM A;  1X01 A;  3ZFJ A;  1YI2 A;  2KMG A;  2HAX A;  3CC7 A;  3A8O B;  2DXT A;  2WSE E;  3LWH A;  3LWI A;  4L59 A;  2XDB A;  4M77 A;  3A8G B;  2M9U A;  3GOX A;  4M78 C;  3M54 A;  1N8R C;  4M7D A;  1KD1 C;  1VQ5 T;  5IN1 A;  2O4X A;  2BIV A;  4M78 B;  2EAY A;  4FL6 A;  1VQ6 A;  1NE8 A;  3M5A A;  3RES A;  3L2W A;  4RMO A;  4MIM A;  2ZZD B;  3I55 T;  3TRE A;  2M1H A;  4IUR A;  4D6W A;  4BI4 A;  2LNV A;  3DL1 A;  1Y7X A;  2P4T A;  2GCX A;  3MEU A;  4ZN1 A;  1I81 A;  3TCJ A;  2DXU A;  3WXM B;  4HNT A;  1OZ3 A;  3TEE A;  1VQK T;  4YTL A;  3PMI A;  4MZT A;  4C92 E;  5CAI A;  2VGM A;  5LJ3 e;  1KD1 U;  2D6F A;  3M57 A;  2WSC E;  3OYN A;  2QXF A;  3VYG A;  1YCY A;  2YLB A;  4DA4 A;  3CME A;  4M7A E;  4A4G A;  4O6J A;  4OGC A;  2XI9 A;  1AHJ B;  4BE2 A;  3VUZ A;  4HCZ A;  3VKH A;  2DTI A;  2R57 A;  2DTH A;  3OSV A;  2PU9 B;  3UDC A;  5EJC A;  3BY7 A;  3LYI A;  4NL3 A;  4MZM A;  1GXI E;  4PKC C;  5FU7 C;  2F69 A;  5GAN h;  2QA4 T;  3CC2 A;  3FC3 A;  4LDW A;  1UGR B;  1BI2 A;  1B34 B;  3CC2 T;  2VGN A;  3V7C A;  5GAN 2;  5D6W A;  3OYK A;  3CCR T;  1QVF S;  3X26 B;  1VQ6 T;  2A7Y A;  4M78 A;  4M7D C;  4IKF A;  5GAO q;  4HA8 A;  4PLL A;  1YIJ T;  2YLC A;  3BG3 A;  4ZTJ A;  3L2R A;  4XTV A;  3TW6 A;  2M0O A;  4M6V A;  2MWO A;  3C94 A;  4BD3 A;  4GY5 A;  3JCM W;  1VQN T;  3OS5 A;  5GMK h;  3OS1 A;  2FVU A;  1BIA A;  2RH2 A;  1DJ7 B;  2E6Z A;  2DD4 A;  2DD5 A;  4F7U B;  3HHT B;  3QDR B;  5HY6 A;  1M4Z A;  4JRI A;  4RCB A;  1WJS A;  1QP2 A;  4C8Q C;  4N4H A;  1M90 U;  4M7A B;  1Q82 U;  1YJN A;  3ASK A;  2X4Y A;  4N4I A;  4CI0 C;  5FRM A;  5A0L A;  4ELJ A;  4QQD A;  3OYA A;  3GPL A;  4PNO A;  1YHQ A;  4RKU E;  3H8Z A;  4C92 A;  4OB2 B;  1HK9 A;  4UC4 A;  2DO3 A;  1X6O A;  1OYX A;  1FX7 A;  3UPU A;  3KBG A;  2CZ1 B;  3BG9 A;  1YBY A;  4QVZ A;  4ATO A;  2EQK A;  3HRU A;  3DLL A;  2QEX T;  2QA4 A;  3GF5 A;  4EMK B;  3INZ A;  2DKG A;  1VQ5 A;  2K5F A;  1EIF A;  5LJ5 f;  4E7H A;  2XIC A;  3VKG A;  3V8J A;  1N6A A;  3CBP A;  5LJ3 g;  2CZ7 B;  4QSH A;  4HLQ A;  1W2B S;  4OB0 B;  2ZPE B;  2QQ8 A;  3GIB A;  2E1H A;  4J8O A;  3OYM A;  3HSB A;  4HL4 A;  3PIO A;  3LH0 A;  2MAM A;  2X4X A;  1BI0 A;  4IUV A;  4L5G A;  4EMG A;  3A8H B;  3OY9 A;  3CCJ A;  3CME T;  2LC4 A;  2WSF E;  5GAM h;  2HQE A;  2D0Q B;  5EG2 A;  1ZHI A;  1Y96 A;  4C92 G;  3CPW S;  3OYH A;  3JCM P;  2RJC A;  4ZGE B;  3FRN A;  3S6W A;  3OS2 A;  1K73 C;  2RHY A;  4PJO A;  3VYH B;  2WAC A;  4JLI A;  4JDS A;  1S72 T;  4MFD A;  1Y07 A;  2G77 A;  1JB0 E;  2ZGW A;  2EQJ A;  1VUB A;  3LGF A;  3SWN B;  5GAN 6;  1VQ4 T;  3A8M B;  4J5Y A;  3CD6 A;  1H3Z A;  2A3L A;  2KR6 A;  1VQ9 T;  3HKS A;  3X20 B;  3QZ9 B;  5I2S A;  4QVC A;  2OTJ A;  4C8Q D;  5GAM g;  2R5M A;  2XHC A;  3QKJ A;  1UGQ B;  3PFS A;  1K73 U;  4Q5W A;  5LJ3 d;  4XAX B;  4EMK C;  2K2V A;  3NTI A;  2KDS A;  2EFI A;  3A5Z B;  3M4Y A;  3CD6 T;  4PJO C;  4JS4 A;  1Q86 U;  3LLR A;  2RO0 A;  1YIT A;  5GAN 5;  3RUX A;  4BY6 C;  3CEY A;  1SSF A;  3FLG A;  3JRZ A;  3HBL A;  1NJI C;  2RM4 A;  3VYG B;  1WJR A;  2QQR A;  1QLB A;  3URG A;  4A4F A;  5GAO m;  2K5I A;  2XU8 A;  4ZGD B;  2RB6 A;  2Y4X A;  4IUQ A;  2R5A A;  4PJO B;  2PVD B;  2E70 A;  4M7D D;  1K8A U;  2OTL A;  3NTK A;  1Q7Y C;  2EWN A;  3OYF A;  3KXT A;  3HFO A;  4Z6Y A;  3HL8 A;  4JUV A;  1VQL T;  2BUD A;  2PUK B;  3JCM e;  4BE1 A;  4NL2 A;  1M90 C;  2QFZ A;  4KUI A;  4N4G A;  3CCV A;  4ZTF A;  3J80 E;  2L89 A;  2DTO A;  2MF2 A;  2C06 A;  3FIF A;  3SB2 A;  5GAO r;  2XDD A;  2VUB A;  4C92 F;  3OYI A;  4J6X A;  3P8H A;  3L2U A;  2EQU A;  3DLM A;  3FEO A;  3QPH A;  5GMK e;  2PUO B;  1Y71 A;  3NTH A;  5LJ5 h;  1VQ8 A;  1XTD A;  2PVO B;  2OAU A;  2FYK A;  2HD0 A;  1ZQ1 A;  2X4W A;  5CKE A;  3CC4 T;  2L8D A;  2XDP A;  4OF1 A;  3VKI A;  4BUG A;  4QQG A;  4BDY A;  1YJW T;  4M75 G;  3CCM A;  3QG1 A;  4KT0 E;  5CO7 A;  3FDR A;  2EKO A;  4NOY A;  4RG2 A;  1K9M U;  5CKD A;  3EAE A;  5GAN d;  3JCM f;  3G4S T;  3SDZ A;  3JB9 G;  4LOC A;  1BIB A;  2K3X A;  4FT4 A;  4C0D B;  5LJ5 e;  5AYF A;  3CCQ T;  1Y96 B;  4LD9 K;  3L2Z A;  3QYG B;  2LTO A;  1VQP A;  4C8Q F;  4KBM B;  2K57 A;  4LDV A;  2V8K A;  1YJW A;  3J81 E;  1P92 A;  1XNI A;  5GAN 8;  4JX5 A;  1UEB A;  2LDM A;  3GLX A;  1V29 B;  4PJO F;  3E19 A;  4XTZ A;  2HQX A;  3M58 A;  1Q81 C;  1FXX A;  4PJO G;  3QYH B;  1VQ4 A;  4A4E A;  1UB4 A;  4ELZ C;  3QJ6 A;  3RMS A;  4HNU A;  5GAN f;  4M75 D;  1XQH A;  1Q82 C;  5J3B A;  5KCO A;  3OBW A;  5KE3 A;  1YJ9 A;  4HNV A;  2VXE A;  4GLK A;  1QVG S;  4X9C A;  2IVW A;  3QSU A;  4M77 D;  2K5L A;  4M77 E;  5DLQ E;  5CKH A;  5LJ3 j;  5GAO p;  3G71 A;  2RD1 A;  5CVI A;  1BKB A;  3MP8 A;  1NPR A;  4M78 D;  1KC8 C;  3HRS A;  4F7U E;  3V7S A;  2XK0 A;  3CCJ T;  3OYY A;  4E7I A;  4JRK A;  4NS5 A;  4XK8 E;  1MHN A;  3PGG A;  5GAO l;  5HKC A;  1QVP A;  5IT9 E;  1FKM A;  3VJP A;  3OMC A;  5A0G A;  4DOW A;  3OYL A;  5I2M A;  3CCL T;  3JCM g;  4B9W A;  4C0Z A;  1UGS B;  4BAC A;  5CQY A;  4BY6 B;  3ER0 A;  5HK0 A;  2GFA A;  3PT9 A;  3G71 T;  5D6X A;  3JCM b;  2KAF A;  4FIB A;  3CCU T;  4N0A C;  4A4K A;  2ZPG B;  3CXC A;  4BDZ A;  4EMK A;  2ZZD A;  3EFR A;  4WF2 A;  5GMK m;  3JCM d;  5LL6 S;  3JB9 I;  3CPW A;  1KG1 A;  2E41 A;  2FB7 A;  2KVQ G;  1RL2 A;  4M7D B;  3X25 B;  4EMH A;  3MO8 A;  4PLI A;  3MEV A;  5J26 A;  5LJ5 j;  1M5Q 1;  3CCQ A;  3I55 A;  2EQM A;  4M77 C;  3V8L A;  2VC8 A;  1JJ2 A;  3AHU A;  2BS3 A;  4L6V 5;  3JB9 F;  3HO8 A;  2LVM A;  2QTX A;  3PIP A;  4O5V A;  2L5Q A;  4IUP A;  2VV5 A;  4LDU A;  2MMP A;  1VQM T;  3EFS A;  3TW7 A;  4ZN3 A;  5DLO A;  3GP8 A;  3CC4 A;  2HNI A;  2F5K A;  1VQM A;  2XG8 D;  3G7Z A;  4M77 B;  5D6Y A;  3CCE T;  5GAM d;  3DKM A;  1UGP B;  3HZJ A;  3C12 A;  2MWP A;  2JN0 A;  4LDX A;  1RI0 A;  2CYZ B;  2JVV A;  1VIF A;  2CGH A;  2KQW A;  2QQB A;  5FU6 B;  3SWN A;  4ELY C;  3PMT A;  1KQS A;  4F7U F;  4VUB A;  4E7K A;  1VQ7 A;  3G6E T;  4AKH A;  3HFN A;  3RKY A;  4M7A F;  2I2L A;  1VQN A;  4J6W A;  1E7P A;  5L8R E;  2P0Q A;  2RJF A;  3R6O A;  1NZ9 A;  4XU1 A;  3MP1 A;  2RK1 A;  4J83 A;  5M9O A;  2RHI A;  4A4H A;  4M7A D;  2LCC A;  3CCV T;  3FB9 A;  4E7L A;  3HP9 A;  3JB9 D;  2LCL A;  5KE2 A;  5GAM f;  1R8O B;  2E12 A;  1VQO T;  4C0F A;  1OI1 A;  2KK4 A;  3RER A;  4HCC A;  3G6E A;  1VQL A;  2QI2 A;  4X9D A;  3SWN C;  4B9X A;  2RHZ A;  4OB1 B;  2RI3 A;  3JCM Q;  3JCM J;  4M7D F;  3E9F A;  4BI3 A;  1LNX A;  1YHQ T;  2OTL T;  5KCH A;  1YIT T;  2NLU A;  3BW1 A;  2P0P A;  5GMK l;  3CCE A;  3P8D A;  1KHC A;  3N5B B;  4X34 A;  4HCB A;  4M75 E;  2E10 A;  4C8Q E;  5A2Q E;  1U8R A;  3L42 A;  3OBY A;  2QQ9 A;  3HRT A;  3LW5 E;  2JTM A;  4M75 B;  5FU6 C;  3VV0 A;  4JS5 A;  2EYQ A;  4OB3 B;  2BS2 A;  3H6Z A;  1VIE A;  3C95 A;  3QJY A;  4J7I A;  4PL6 A;  4M78 F;  5CIU A;  2RHX A;  4F7U A;  1QVF A;  5CQX A;  1N9S A;  3UWN A;  5GAM e;  1M1K C;  3V7R A;  1VQK A;  4M77 F;  1VQ9 A;  3OW2 A;  4M77 G;  2X35 A;  2E64 A;  2RJE A;  2FL7 A;  3MCA B;  4RCC A;  4AI6 A;  3WVE B;  4M78 G;  2KMT A;  3C4S A;  4EPC A;  4BB7 A;  4JRQ A;  2GFU A;  2KY9 A;  2JNG A;  1M1G A;  3L2V A;  1PSF A;  1NJI U;  3S3O A;  2RI5 A;  4C0G A;  3M53 A;  1I4K 1;  1N9R A;  4PJO E;  4PJO D;  1W4S A;  2XD0 A;  2LX9 A;  4C92 C;  4JJN K;  2DAQ A;  2KSS A;  4XTX A;  3X24 B;  1K8A C;  2LRQ A;  4J7F A;  3MP6 A;  1Q81 U;  3QBY A;  3BFM A;  2JTF A;  2MI6 A;  4M75 C;  1N8R U;  2ZCF B;  3CPF A;  2FHD A;  3F70 A;  3CC7 T;  3LGL A;  1M8V A;  2CZ0 B;  2GQV A;  4OMF B;  1N27 A;  4FT2 A;  2DD5 B;  2DD4 B;  1FWZ A;  4DOV A;  4C8Q A;  5CKB A;  1WGS A;  3CCM T;  1W2B A;  1KQ2 A;  5CCA A;  2DZ9 A;  4HKE A;  1G3S A;  4RG8 A;  3QXE B;  4XTW A;  5GAM j;  3E1S A;  1I8F A;  4QW2 A;  3CCS T;  4V2S A;  4CRI A;  2DXC B;  3JAM E;  5GAN g;  3OQ5 A;  3Q1J A;  3ME9 A;  4M75 F;  3O8V A;  1K9M C;  2GF7 A;  4BBR M;  2QF7 A;  2DK3 A;  5KH6 A;  5GAN 3;  1G3Y A;  3RKW A;  4MML A;  4Y28 E;  1KC8 U;  2LQ8 A;  2RHU A;  2RK2 A;  2XKO C;  5FU7 B;  2DEQ A;  2LT1 A;  1KHI A;  5GAN j;  3M56 A;  5DM7 R;  3PNW C;  3QWL A;  3UT1 A;  4A53 A;  1VQO A;  1VQ8 T;  3ZBD A;  3OYE A;  4FM4 B;  5HK3 A;  3CCS A;  4N0A A;  2QQA A;  4ME7 A;  3BDU A;  3QHS A;  3VU3 C;  3JB9 J;  1I5L A;  2XID A;  2ZPH B;  5LJ5 g;  3LX7 A;  4LD6 A;  4QVD A;  5GMK i;  4BBS M;  2LT4 A;  3J7A F;  3S3N A;  5GAN 4;  2E5Q A;  3G4S A;  4AKI A;  3T9N A;  3JCM X;  5GAO n;  2G3R A;  3JCM h;  5LJ3 h;  2YHT A;  4C8Q G;  1JJ2 S;  1KQ1 A;  4MDX A;  1PSE A;  3WVD B;  2EIF A;  2DJZ A;  3PTA A;  2DZC A;  1QW1 A;  2IG0 A;  4KUL A;  2CZ6 B;  5GAN 7;  1JBM A;  2V8I A;  3SD4 A;  3DB3 A;  4XTY A;  4AKG A;  1BYM A;  2DVE A;  1YIJ A;  3RKX A;  2JZ2 A;  4JLG A;  2PVG B;  4XQ3 A;  1M9S A;  3QUI A;  2E65 A;  4C5H A;  5A0D A;  1Q86 C;  2OTJ T;  5C6S A;  4IUU A;  4IUT A;  4C5E A;  3CCR A;  4MFE A;  3CBM A;  3FJP A;  4HT8 A;  4M7D G;  3TU4 K;  4OP0 A;  3MHX A;  2X4J A;  3MEA A;  2M16 A;  3BDL A;  3OYG A;  3CMA A;  1KQS S;  2EJ9 A;  4J6Y A;  3HB9 A;  3JSC A;  3H4C A;  5FLX E;  4ZGJ B;  2AHJ B;  1XOV A;  5J39 A;  4XU3 A;  3OSS C;  3OYD A;  1M1K U;  1G5V A;  3CBO A;  2P0K A;  5DY9 A;  2K3Y A;  1M1F A;  5GMK j;  3I56 A;  4KUD K;  4M7A G;  2Y90 A;  4E47 A;  3CCU A;  4M7A C;  1YI2 T;  4F7U G;  3JCM c;  2V8J A;  1BI1 A;  3OA6 A;  4OVA A;  4M75 A;  3X28 B;  2EJG A;  3V8K A;  5GAN e;  4R55 A;  4XU0 A;  3L1A A;  5LJ5 d;  3NFC A;  4C5G A;  2QDJ A;  1ZBX A;  2DXB A;  4MDW A;  4XTU A;  3VUB A;  1D3B B;  2O01 E;  3M9Q A;  3I56 T;  1YJ9 T;  3OYB A;  3KHI A;  1X75 C;  4DQ2 A;  2JOY A;  2WJ9 A;  2DIG A;  3GNG A;  2VXF A;  1OZ2 A;  1WNL A;  5CKF A;  1U1S A;  4A54 A;  1JRI A;  2H3J A;  3OYC A;  2QEX A;  3CMA T;  4MZP A;  1B34 A;  4FSX A;  2EJF A;  4M7D E;  4XU2 A;  1O75 A;  1WPY A;  1U1T A;  3ZEH A;  1WJQ A;  3BG5 A;  3OMG A;  5CK9 A;  2VYT A;  5I21 A;  3RMQ A;  4R56 A;  2PQW A;  2F5T X;  1S72 A;  3OW2 S;  3MEW A;  3P8B B;  1IZ6 A;  4BI8 B;  2RJD A;  2R58 A;  4Y91 A;  2QDY B;  3S3M A;  2CKK A;  3GNF B;  2BS4 A;  4P5N A;  1VQ7 T;  3MET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...