2QDYB

Crystal structure of fe-type nhase from rhodococcus erythropolis aj270
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title High resolution X-ray molecular structure of the nitrile hydratase from Rhodococcus erythropolis AJ270 reveals posttranslational oxidation of two cysteines into sulfinic acids and a novel biocatalytic nitrile hydration mechanism
pubmed doi rcsb
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2qdyB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qdyB02
2D0QB 4OB2B 3X25B 3VYGB 3QZ5B 2AHJB 5L8RE 3LW5E 2ZPFB 4Y28E 2O01E 3WVDB 2WSEE 3X20B 2DD4A 1AHJB 3HHTB 2CZ6B 2DXBA 4OB1B 1V29B 2ZPIB 4RKUE 3QYHB 2ZCFB 4ZGJB 3A8GB 2WSCE 3QYGB 2DD5A 3X28B 1GXIE 1UGSB 3A8OB 2PU9B 3QXEB 2DD4B 2ZZDA 3A8MB 2ZPBB 2ZPEB 2DXBB 1DJ7B 2ZPHB 2CZ0B 3VYHB 1UGPB 1QP3A 3QZ9B 1PSEA 2PVOB 2DD5B 3A8HB 2CZ1B 4KT0E 2PVDB 2ZZDB 2PVGB 4L6V5 2DXCA 2CZ7B 4OB0B 2PUOB 2PUKB 1PSFA 2ZPGB 4OB3B 3VYGA 1IREB 1UGQB 2DPPB 2QDYB 4ZGDB 1QP2A 1UGRB 2CYZB 3WVEB 4ZGEB 3A8LB 4XK8E 4FM4B 3X26B 1JB0E 2WSFE 2DXCB 3X24B
chains in the Genus database with same CATH superfamily
5IF1B 2OTLT 5GAN6 2HKNA 1M9SA 3G33B 4CRIA 2R57A 2O88A 1YCYA 2RN8A 5KCHA 3CQTA 2QAZA 4MZMA 3TCJA 1X2KA 3OYDA 1YIJT 4CFUD 2A3LA 4F14A 4I3ZB 4MFDA 3OYBA 3CCLQ 2KR6A 2LP5A 3EFSA 1JJ2S 1NE8A 1MHNA 2LRQA 1BKBA 4E7IA 2VB6A 1WFWA 2DMOA 2PQWA 1YJNA 4EMGA 4JX5A 2YWWA 2UZLB 4X1VA 2DAQA 4ORZA 1KQSA 4RTXA 1YJ9Q 4A63B 2CP7A 2QASA 4HVUA 4C8QG 1KD1U 4M78C 2C5OB 3DTOA 2LVMA 2PZ1A 2YDLA 2D1XA 1AD5A 3G6ET 3B57A 2ZPBB 2E41A 2CCIB 1Y96B 3OSVA 2IG0A 1OI1A 3S3NA 3H41A 3VV0A 1AISB 4TTHA 1UHCA 3PTAA 2JJ9A 3G71Q 2DD5B 4RCBA 2GBQA 3CPWS 2RMOA 1NEBA 2PNIA 2SRCA 4KT0E 4QW2A 4AKIA 1E6GA 3VS5A 5CKEA 3OYLA 2H3EB 2D0NA 2J06A 1E9HB 5A0GA 1U5SA 1E7OA 4ZNXA 3LX7A 4LN2A 2IVWA 5IHNA 2M0OA 3H9NA 5GAMe 1JO8A 3L2WA 3BHUB 1PRMC 1WHMA 4BDYA 1PKTA 4C8QE 1MNDA 1JXOA 1JXMA 3GNFB 2JVVA 2CYZB 3MEWA 3M9QA 2B86A 2MWOA 3QUIA 3V8KA 4E7JA 1Y71A 3JCMc 3TN8B 5GAN8 2RHIA 3DDPB 3SD4A 2LJ1A 1UNHD 4Z02A 3RESA 4M75A 3KHIA 5IAYA 2DXUA 4IIOA 4RMOA 1OEBA 3QBYA 1FINB 2D8HA 5AT1B 1OKVB 3CCET 3UATA 3M03A 1D1BA 1WGSA 4LDWA 3VS3A 1K76A 1VQOT 1S72A 4E7KA 2JUFA 2LCSA 1G5VA 5I21A 3JB9H 4PJOF 1TD6A 5GAOn 5FU7B 3CCSQ 5A0DA 3ME9A 2EGAA 3FJ5A 5DQWA 4E2FB 4C0DB 2QQ8A 4B6MA 1MV3A 3CCLT 5LJ5f 1KQSS 2OTJT 1AWWA 1FYNA 4NL2A 4M7DF 3UF4A 3CMEQ 2EBPA 4J9BA 3FEOA 3M53A 2C5NB 3CMAT 2I0NA 4F16A 3I56A 2ROTA 1VINA 1NPRA 4CC4B 1OL2B 3EG9A 2C0IA 1QP3A 1SSHA 4BY1X 3KXTA 2O31A 1OX8A 3E9FA 3HZJA 3MI9B 2F2WA 5KYYA 1K4US 2CP6A 4J7IA 4QQDA 2NUTA 2CCHB 3BHVB 2LC4A 2K2MA 2DRKA 4EOIB 2LQKA 2PVGB 2RI2A 4F7NB 4OMMA 1WDXA 4OB0B 4JS4A 2X9HA 4FIBA 3PIOA 3VRYA 1RI9A 1MUZA 3UT1A 4J6XA 5FGKB 1NBEB 4ESRA 3DL1A 4YC3B 3G6EA 2RA2A 5I2SA 2BUDA 2DO3A 1PG5B 1QP2A 1U1TA 5FRMA 1MV0B 4M7AA 2HAXA 4C8QF 7AT1B 1WA7A 5GAMf 2CP3A 4V2SA 3CCRT 2RQTA 1I8FA 5LJ3f 4N4IA 3VKIA 4BCJB 1ZA1B 3TNIB 3EG2A 4XAXB 2LT1A 5KYWA 5KE2A 3X25B 1VIFA 1EX4A 4HXJA 4M77E 1GY3B 1YHQQ 4Y28E 3SEMA 2DYIA 3BDLA 4AKGA 4BB7A 4UN0A 2MIOA 4C5GA 3INZA 4BI3A 1YFNA 5GAN7 4NSTB 3RGFB 2FRYA 4RKUE 4C8QD 3PO3S 4DA4A 5LJ5g 3F70A 1I07A 2PJQA 2DZ9A 5D6WA 4EORB 4FCYA 1VQNQ 2MAMA 2C0OA 4M75B 3E9GA 3JCMX 3CCUA 3M5AA 3J80E 1VQ7T 5FU6B 2ZZDA 5KYNA 2VUBA 1AVZC 1PWTA 3JCMh 2HQHA 4Y92A 1SKUB 4MZPA 2RD1A 2MMPA 3VS4A 2HDAA 1PSEA 1D0ZA 3CXCA 1XOVA 3CMET 1TTHB 4PFZA 2WMAB 4Z88A 5DLOA 3LH0A 2F69A 2DK3A 2JNGA 2X3XD 3FC3A 2KYMA 3V8LA 5DQVA 4PFOA 2BE7D 2C0TA 1FVVB 2P84A 3CCLA 5CKHA 3BY7A 1NLPC 2JMCA 3EG9B 4EMKA 1BI2A 1BK2A 5HVYB 2VWFA 4JDSA 4L59A 2D8JA 3LWHA 4E47A 2IIMA 2FZKB 4LXCA 5LJ3g 5KYYB 4AFUC 3OS2A 1YJ9A 3MY1B 2MOXA 3SFMA 2NUTB 3LLRA 2E6ZA 2LX7A 2PK2A 1G3TA 4JJBA 4NC6A 1M3AA 3X26B 1JB0E 2OAUA 5GAOq 2JTMA 4FSXA 2DL3A 5GANh 1QVFP 3OBWA 2WXVB 1QMCA 1FMWA 3NFCA 1LPLA 2DL4A 3LQ5B 2K3XA 1X27A 3V7CA 1R0CB 2YSQA 1R77A 5LQFB 1UFFA 2LCLA 2P0PA 2CDTA 3G71A 3M0RA 4M7AB 4FT4A 4P5NA 3EGXA 3BFMA 3PVQA 1H28B 5FWCA 5FRNA 4KH0B 2FO0A 1V29B 2M02A 2RJDA 3OY9A 1D0YA 1Q86C 1W2BA 5GMKh 5KYWB 4C92G 4IUPA 3TREA 3BE3A 1WJSA 2A36A 4JRKA 1JQQA 3M57A 1U1SA 2E3IA 9ATCB 2YXYA 4M77D 1OGUB 5HBJB 4HKEA 4ATOA 3OYJA 1VQNT 5D6YA 2XDDA 5CCAA 1M8MA 3HPWA 3TSWA 4J9EA 8AT1B 3FJPA 1H1PB 2LQ8A 2YRDA 1VQ8Q 3OYCA 1Y7XA 5HQ0B 3OA6A 3M4GA 1NJIU 3CXCS 3NDQA 2L3RA 4EONB 2J6KA 4RTTA 2ZZDB 4J9CA 5GJVB 2KSSA 1YN8A 3CC2T 4KRTA 5GAN4 5J26A 3ASKA 3VYGA 1YCSB 3CCSA 3PGGA 4C92E 4IMYB 2PTKA 3A98A 1KQ2A 2VGNA 5GAMj 2UUEB 3SHWA 2UZBB 5LJ3j 4R56A 1G83A 5CQXA 5GANd 2V26A 3EHQA 1N9RA 2B8AA 1OIUB 1D1AA 4C8QC 2IVXA 1GBQA 1TSFA 3H4CA 2QA4Q 3VUBA 3CMEA 2K5FA 3ULRB 1SHFA 2KMGA 1P92A 4C0ZA 4EMKB 2G3RA 5L8RE 1W2BP 1VYVA 1K1ZA 1WHJA 1TUGB 2GF7A 1IGUA 2DD4A 2IPOB 2DTOA 4HLQA 4OMQA 2EJGA 3P8BB 1NPPA 1ZLMA 2X51A 2BIVA 2LCCA 3C4SA 1FWZA 1TXQA 4F6SB 1QLBA 2NUPA 2DEQA 2D9TA 4RTVA 3OYHA 1GXIE 2XKOC 1CKBA 2EFIA 2QQAA 3QJYA 3GPLA 3L2UA 3I35A 1BI1A 2O9VA 5CQYA 2JT4A 3EGXB 1Q86R 2ATCB 4QQGA 2RO0A 3REBB 2YHTA 2AZSA 4HCZA 3H6ZA 4RCCA 5KCOA 1KK7A 1UHFA 1H24B 4Z89A 2RI5A 2XU8A 3JV3A 3J7AF 3OS1A 4JPBW 4DBFA 1K73U 2DVEA 3VRZA 1VQ9Q 4CC2A 5EFQB 1YHQA 1LVKA 2XK0A 1I5LA 3JB9J 2FPFA 5GAN2 2LZ6B 2J7IA 1C0MA 4AFQC 2WPAB 1WLPB 1M8VA 3L2VA 2HNIA 3CCVQ 2CZ7B 4CFVB 1UECA 2DE0X 4JUVA 3P8HA 4OMLA 3LYIA 1BIAA 5M9OA 1UUEA 4BCFB 3VU3C 4BBSM 3GLXA 4JLIA 1M1GA 1VQ6T 3RMQA 4C92F 1ZBXA 1VQNA 4KRCB 2BKZB 2VASA 1VUBA 1N4MA 4LDXA 2LNVA 3BHTB 2WIPB 1X01A 5L2WB 2PMIB 2KEAA 4PJMA 1RLPC 1IHVA 1BI0A 4AMCA 5HBEB 3OS0A 2L0AA 4OMOA 4J9HA 1S72T 4XU0A 3VYGB 4LNPA 3A1PA 2JGZB 2RPNA 4Y72B 4IUTA 1Q82U 4MIMA 2DA9A 5GANe 1X75C 1FXXA 4OMNA 1PKDB 1M27C 2DZCA 3OB9A 1QVGP 2CZ6B 1VYWB 3M4YA 2NWMA 2ABLA 2VV5A 2E70A 2DX1A 3P8DA 2C5VB 2GFUA 2EUFA 3OYMA 1K9MU 1RAAB 1ZP2A 5CKBA 3I56T 2LW4A 1SPKA 2F2XA 1D3UB 3REAB 1ZHIA 3I55Q 1M90U 4HT9A 4HNVA 1ZBJA 2MCNA 2FPDA 5GMKe 3QXEB 4IURA 3GNGA 3HFNA 2DD4B 2DF6A 4F7UF 5GJWB 3NTIA 1ARKA 2MWPA 2WEVB 2FEIA 2CH4W 4F70B 4C5IA 2RK2A 2GNCA 5D6XA 5DLQE 2C5XB 4CRLB 1YITQ 4BCQB 2DERA 3DOGB 2QFZA 2W99A 4A53A 3S6WA 3CCJQ 4OGCA 1Q81C 2QDLA 3O8VA 3UA7A 1K8AC 3QDRB 3QKJA 2NUPB 4LOCA 4AG2C 4DBQA 1I0CA 3JCMb 3JCMf 2E12A 2R5AA 2KDSA 2QXFA 5KE3A 4C5HA 1S1NA 2OI3A 4XTYA 4PJOA 4HA8A 2K2VA 2P0QA 2DXCA 4LD6A 2BE9B 1PCXA 2QGFB 2YUQA 3CD6Q 1I5OB 2V8JA 2AKKA 2WMBB 4GLKA 2V8KA 4OB3B 2J6FA 4N0AC 3QWYA 2ED0A 3QDFA 2M16A 1SSFA 3VS6A 1UGQB 3NTKA 2YUPA 1UGRB 4M7DA 1Q7YC 1X6BA 4LDUA 4PK4A 2XHCA 1NYFA 1NLOC 4JRPA 3N5BB 1H92A 3PMIA 3JCMW 1YP5A 4OGRB 4KBMB 1H4LD 4D6WA 4DEXA 3ZBDA 2CJMB 1WPYA 5DM7R 5I5ZB 3D7SB 2DJZA 1VQ8A 4BCHB 2QQBA 1HYOA 4D8DA 2VVKA 2CP5A 1OULA 2OX7A 3JCMQ 2EAYA 5GANf 1OU8A 2ZGWA 4BD3A 1VQ6A 4MMKA 3CCUT 3M55A 1VIEA 3JRZA 1BIBA 2X4WA 3BG5A 2EYWA 2YLBA 5KYXA 4F04B 1ZQ1A 3I9QA 1N5ZA 3C0CA 2HMAA 4PLIA 1VOMA 3CC7Q 5CO7A 3MHXA 1SEMA 2RHUA 5IHKA 4DBRA 3OYGA 2W96A 1HJDA 4M6VA 4EPCA 1H1RB 2M51A 1DJ7B 3OSSC 5I11A 3DKMA 3EFOA 3EH1A 3VYHB 3I55T 2XG8D 2QA4A 1ZUUA 3JCMg 1GCPA 2GTOA 4CI0C 1BU1A 4KUIA 4M7AG 5GAOr 3MY5B 2KY9A 4ZTJA 1IZ6A 2RHZA 3OMCA 1WQ7A 2FZCB 2JN0A 1P5EB 1O75A 1CKAA 1YJWQ 1Q81R 1XTDA 1VYUA 3OMGA 4FU6A 4E7SA 1YJ9T 1K8AR 1UTIA 2W9FA 3TSZA 4M77G 2GFAA 4J9IA 1UJYA 4A54A 3DJBA 1GCQA 4DQ2A 1MMGA 4C92C 3QHSA 2DILA 2DTHA 2DKGA 2VC8A 3A5ZB 3CD6T 1M3BA 3A8LB 1T0JA 4AT1B 4F7JB 2VXFA 4XK8E 4PJOB 2KXDA 2AIRB 2ENMA 2DXCB 1JU5C 5GAOm 2EIFA 3G71T 2E6NA 2E64A 1TOVA 4WTOB 2HL5C 1SG5A 1VYTA 1Q7YR 1ZSGA 2K9GA 5GAOl 4OF1A 2RQRA 3TU4K 3OW2A 1QCNA 3EHRA 1OQKA 5HBHB 1PKSA 3QJ6A 1RAFB 4M7AE 3X20B 1W6XA 4M7DB 4XQ3A 5HKCA 1KIKA 1VQ9A 1QMZB 2CT4A 4PL6A 2K3YA 1YWOA 1R0BG 1WIEA 5CR2A 3QHRB 3CCVA 4MZTA 4IUVA 1XQHA 3UPUA 1M90C 3QG1A 1VQ4Q 4N4HA 4IUUA 3PFSA 4RODA 2RJEA 4HT8A 3FLGA 2ED1A 5IN1A 2MF2A 3HP9A 3MKDA 1QVFA 1WXTA 1JBMA 2V8IA 3ZL7C 1M1FA 2J05A 2BS3A 1SHGA 4BE0A 1H1QB 2COZA 4BY6C 3DB3A 2BZ8A 5KYXB 1NEGA 1ABQA 3TQ7P 3TW6A 2EJ9A 1KD1C 4J9GA 2CP0A 5C6SA 1M1KU 2HD0A 2VKNA 3CCST 1UNLD 2XMFA 4EDUA 3G1JA 1H27B 1RAHB 1QKXA 1VQKQ 4RTWA 2SEMA 2P4TA 2E65A 3EFOB 4BCND 1F5QB 1YI2Q 5DY9A 2A37A 3EG3A 1RAIB 2A28A 3M0PA 3OBYA 3OW2P 2FZGB 3ZEHA 2X3WD 3I55A 4PJNA 3HO8A 2O4XA 2Z0WA 3HBLA 2KT1A 3VS7A 2KMTA 1JSTB 2PHGA 1OIYB 3FRNA 1N6AA 4J9FA 4M78A 2UZEB 1BBZA 5GAMg 5GANj 3MJXA 4BCIB 3CCJA 5CKFA 2LNHB 2B9RA 4BCMB 2X1NB 3M59A 4E7LA 1B07A 4ANJA 3CCQQ 4EOKB 2DXBA 3QPHA 1GFDA 1UE9A 1G3NC 4XU2A 3SDZA 4N0AA 1UG1A 2KE9A 3H8ZA 2CH4A 4ZGJB 1UGVA 1VQPQ 2DIGA 2HQXA 1JEGA 1VA7A 4XU3A 4FYVB 1QKWA 3CD6A 3AHUA 1IGQA 2AK5A 1YWPA 3MP1A 4ME7A 1JKWA 4AKHA 4Z8AA 4EC9B 4M77F 5GMKj 4A4EA 3GOXA 3HFOA 4FSSA 4O6JA 1QWFA 4KRDB 4F7LB 3C94A 3MEAA 5CK9A 1TU0B 1KXUA 2V1RA 2FL7A 1GFCA 1TUCA 2JTEA 4M7AD 1M90R 2KBTA 4XTUA 1W70A 1QVFS 1MGQA 2L89A 1YHQT 3RERA 1PRLC 1UB4A 3C12A 3NPFA 2G9XB 1LJOA 2DEUA 5I22A 2PVDB 3JSCA 4JJDA 2COYA 3I5RA 3I5SA 4HVVA 4GLMA 2RQUA 4J6YA 2Y90A 4GBQA 2WIHB 3HTRA 1KD1R 3DLMA 3SWNC 1OV3A 3RMSA 2P0KA 3M54A 3OYFA 1OKWB 1AWJA 3URGA 4CFWB 2KRSA 1CSKA 2DPPB 1VQKT 3MIAB 5IH2A 2H3JA 1V76A 5LJ5h 2QYZA 3QYEA 3JCMV 1VQ5Q 1O9KA 1VQLQ 3G4SQ 1C9BA 4A4HA 3CC7A 2BTTA 3OYYA 3O0GD 3NMZC 2W9ZA 1AOJA 4CC3A 5A2QE 1WHHA 5CEIB 5KYUA 2WACA 3MEVA 2YRVA 1T0HA 2A7YA 4DOWA 1Q95G 3ER0A 4QQ6A 4QT7A 3UA6A 3OYAA 4JX4A 2O4XB 3MP6A 4DOVA 3DLLA 5IXFA 2W0ZA 1YJWA 1K9AA 3GP8A 1WZOA 4M78B 1RL2A 4C92A 2C6TB 1AT1B 5GAN5 5FROA 2KRMA 1OPLA 1M5Q1 2OJ2A 3CCQT 1MMNA 1UGSB 4B9WA 1VQPT 5GMKm 2YT6A 1QVPA 5I2MA 1I1JA 3M0TA 5EJCA 2ZPEB 5GAN3 3EGDA 2DXBB 5GMKl 4BCOB 1X2QA 2YRCA 3NHNA 3TVTA 1JRIA 4J83A 4CFXB 1IB8A 3JCMP 2FHDA 2OTLQ 1W2BS 2K3BA 3M56A 3J81E 5GAOp 2E3HA 4BE2A 1SF9A 3A8HB 1QVGA 1M1KC 2K5LA 2EYQA 4XTVA 5LL6S 1ZUYA 4RTZA 2RI3A 4L6V5 1YIJQ 3BG3A 1FMVA 1MMDA 2LTOA 2CUDA 4JRQA 1ENWA 3HB9A 2X4JA 5ICPB 3EFRA 1HD3A 4FX3B 3ZFJA 3FIFA 5LJ5d 5L23A 1O9SA 3PIPA 4KGZB 1GRIA 4MFEA 4EOMB 2RNAA 2HZYA 4PFPA 4F7UA 3CCMQ 1VQ4A 4ZGEB 1JJ2A 3TNWB 1VQ8T 2E10A 3X24B 3G6EQ 2D0QB 1AEYA 2HL3A 2QTVA 3QZ5B 1KHIA 3EH2A 1RI0A 2J6OA 4D8KA 1OI9B 2CGHA 1AZEA 2RF0A 2HEQA 1RADB 1FX7A 1WJQA 4EOQB 4M7AC 1WXUA 1YBYA 1O9KB 3RIRA 2FPEA 1MMAA 2ZPIB 3OYNA 4N4GA 3PVLA 3R6OA 1VQKA 3CC4Q 3GF5A 2XDPA 4CFNB 3CPWA 2E5QA 5HK3A 3QYGB 2DM1A 1F1BB 1Z9QA 2CS7A 2CUBA 2MPXC 5KYUB 2YUOA 3OYEA 3X28B 1SRLA 1J3TA 2JOYA 1WHKA 1YI2A 3L2ZA 1RAEB 4PJOG 1E7PA 2QA4T 4M77C 3GBQA 1C6VX 2H8HA 3E19A 4PJJA 3BW1A 2JW4A 2ESWA 5LJ3d 3JB9G 1PD0A 1H3ZA 3QO3A 3NTHA 2EQKA 3QWXX 4RG8A 1PNJA 1UGPB 1NM7A 4BCPB 2NYSA 1W1FA 2KQWA 4C5EA 2F5KA 5CIUA 3RR6A 2DTIA 4JJCA 2BS4A 5AYFA 3VJPA 4C92B 1AZGB 2G77A 4JS5A 5CVIA 2EGEA 1QVGS 4VUBA 3CCEQ 1IXDA 3EGDB 1W98B 1VQOQ 1PD1A 1JJ2P 5IDNB 4BI8B 2DFUA 2PUOB 4KGXB 3CCQA 4UC4A 3RKYA 3PT9A 1A0NB 2FG0A 1QLYA 1M1KR 3CBOA 1VQPA 1N8RU 4CFUB 2IW6B 1QCFA 2FB7A 1NJIC 1GBRA 4PKCC 1B3QA 4BCQD 1AWOA 4ZGDB 3PMTA 1G3WA 2DL5A 2CSIA 1G8XA 2K7AA 4ELLA 1BYMA 4RG2A 1KJWA 3WVEB 4IUQA 4PJOE 3H0FA 2DL7A 2OTJQ 1H3HA 4ZTFA 1BCOA 1HK9A 5LJ5e 3CMAQ 4M75G 2MI6A 1VQ9T 2IN3A 2F1LA 1B34A 4EMKC 3LW5E 3CCMT 2KK4A 1C1AA 3OS5A 4JZ4A 5KH6A 1D09B 3CPWP 2D6FA 2MK5A 3LGLA 4AFZC 4M7DE 1OX9A 2BZYA 3CCVT 1QCOA 4F7UB 2RHYA 4J9DA 3H0HA 2CKKA 1PHTA 1G2BA 3SWNA 3POMA 2RB6A 4EOJB 1X6OA 3CPFA 1H8KA 4BY6B 2EW3A 2RQVA 2JS0A 1ABOA 2EYXA 4TVRA 4Q5WA 4LE9A 5LMKB 4EOSB 2PU9B 1ZA2B 3PE0A 3Q1JA 2WJ9A 4FL6A 2M0YA 4FW1A 2V1QA 2DBKA 4OGEA 3UWNA 3CC4T 2K57A 1JSUB 1FMKA 2HCKA 1KHCA 1SRMA 1XJWB 3EJ1B 3EIDB 1VQ5A 1VQLA 3G4SA 1Y0MA 2VGMA 1KC8U 1T3LA 2I2LA 3CCRQ 5BNJB 4M75E 4FYXB 4QVZA 3RKWA 3AT1B 2XD0A 5LJ3e 1HSQA 4YOZA 2QQRA 2CZ1B 1U8RA 4BUGA 4C8QA 3VS1A 4RTYA 1WYXA 1FKMA 2LT4A 3E1SA 2DBMA 4LD9K 2EWNA 4WCIA 3MCAB 1D0XA 4ZN3A 2RQWA 2PUKB 3DB4A 4O5VA 4G6LB 1W4SA 2RK1A 1TFBA 1K73C 3QWLA 1EZZB 5FLXE 3SB2A 8ATCB 2KVQG 2QDYB 4EC8B 1KQSP 2DNUA 4HNTA 1RLQC 4YOOA 2F2VA 2AZVA 3NGPA 2WFYB 1H641 1VQ7Q 1YITT 3LWIA 1ZSZC 4II5B 3CCJT 2E4HA 1NJIR 2DRMA 3QYBA 4ELZC 4CC7A 5IXBA 3JB9F 4FT2A 1ACMB 4M4ZA 4OB2B 4CXAB 1Q86U 4JX6A 2OAWA 2V22B 5ECAA 2XDBA 4J5YA 3RBBB 4QKUA 2HBPA 3M0UA 4BDZA 3HL8A 2EKOA 2OTLA 2XICA 4KH1B 1AHJB 3DDQB 2KRNA 3BDUA 4PNOA 2DMEA 1WJRA 2LQNA 3META 4A4FA 4DEYA 4BE1A 3CBMA 4BI4A 2ZCFB 2RH2A 2QK0A 2QGSA 2BPMB 1YIJA 4PJOD 3EGUA 2EQUA 3TW7A 3MO8A 1XNIA 1AWXA 1B34B 3EOCB 4FYYB 1Q82C 3HSBA 3JB9D 5GANg 3CBPA 1TH7A 1LCKA 4ROEA 2DETA 1AD6A 3THKA 4BY7X 4EMHA 1TS9A 4M7DD 3SWNB 3MP8A 3CCMA 3RNJA 2DJQA 2JZ2A 1K9MC 2QTXA 1JOWA 3GTMS 2RM4A 1UEBA 1D3BA 1M30A 2KYBA 4M75F 3PNWC 4KGVB 1I81A 4R55A 1OPKA 4CFMB 1OOTA 2BZXA 5EG2A 1Y57A 2DYBA 2KNBB 4M78G 4ELYC 4X9CA 1N8RC 4FW2A 4BBRM 2X4YA 4RTUA 4MMLA 2FRWA 1KQ1A 2L3PA 3CC7T 4M77A 1G3SA 5IHYA 3CC4A 2KROA 2ZAEA 1IO6A 2G6FX 2L3SA 4M75D 1WQWA 1WX6A 3JCMJ 2MYSA 2LJ3A 2AKLA 4C8QB 2FYKA 3VS2A 1RABB 4FM4B 2QQSA 3U23A 2WSFE 1Y07A 2RHXA 1K73R 1VOLA 1WHLA 2QQ9A 4B9XA 2RJFA 3L1AA 3RUXA 2AHJB 2QEXQ 1PC0A 2ZPFB 2K79A 4J7FA 3VKGA 2A0FB 4K11A 4ELJA 3M58A 4OVAA 2GQIA 1URCB 2R58A 1YJWT 1VQMQ 1BU2A 2QDJA 4BCNB 2JXBA 2M9UA 4BCKB 2JM9A 3MEUA 4IKFA 1N9SA 3CCEA 1GUXA 5A0LA 3A8GB 4LDVA 4JJNK 2K5IA 1VQOA 1ZUKA 3CC2Q 4M78E 4L5GA 1KSWA 2KR3A 4OR5B 3EG1A 1I4K1 3S3OA 1YITA 4F6UB 1QW1A 3HRSA 1H26B 4AI6A 3O5ZA 3OW2S 4J6WA 3RKXA 1NYGA 5HK0A 3EAEA 4J8OA 4M7AF 1WI7A 1H25B 5HNBB 1TG0A 1Q82R 1KC8C 3IQLA 2OTJA 4BCMD 3V7SA 2GTJA 1PM3A 5FU7C 3L42A 2CSQA 5CKDA 2IW9B 3CMAA 1G3YA 5HCKA 2CT3A 3FB9A 1UDLA 4C0DC 4C0FA 1K9MR 2CREA 3LGFA 4XTWA 1K0XA 2XIDA 1M2VA 2P4RA 1YJNQ 1EFNA 5EC7A 1R8OB 3T9NA 3M0SA 1VQ4T 2R7GA 1OZ3A 4HCBA 1D3BB 1M3CA 5D7UA 3JAME 2X4XA 2LMJA 2QF7A 4Y91A 2DXTA 2IW8B 4LDYA 3TEEA 4X9DA 2GGRA 4IIMA 3VS0A 4YTLA 1QQJA 1N8RR 2KI7A 2UZDB 2HKQB 5CYIB 2EQIA 6AT1B 4PJOC 4KULA 1T3SA 4HCKA 5LJ5j 4RUGA 4NOYA 2DIQA 2KXCA 3WXMB 3JB9I 1X43A 4WF2A 4QSHA 3CCRA 2JM8A 4M77B 3JCMd 2O01E 3WVDB 2WSEE 5FW9A 3OYKA 3CXCP 4E6RA 2E5KA 1TWBA 4JRIA 4PJLA 2K6DA 4HL4A 4M7DC 3VUZA 2EQMA 2HQEA 1D1CA 4OB1B 5FWBA 4XTZA 1GL5A 3QYHB 3HKSA 2QEXT 1YI2T 4E7ZA 1OZ2A 4NL3A 3L2RA 4ROCA 2WSCE 2RJCA 4OMPA 2LDMA 4F17A 2LJ0A 2C4GB 4M78F 1VQMT 1Q81U 5J39A 1EIFA 4X34A 4XTXA 2JMAA 4MDWA 1K8AU 4OP0A 4E7HA 3A8OB 2Y4XA 2EJFA 1RAGB 3VKHA 1VQ6Q 3K7AM 1ZSZA 5ACBA 1X69A 1MNEA 2BS2A 1BB9A 4YOSA 2KAFA 3V7RA 2DL8A 4QVCA 5GMKi 1GUXB 1VQ7A 1OL1B 4F6WB 5IHIA 1GH6B 2ECZA 1NZ9A 2PVOB 1WNLA 2W2HA 1U06A 2AT1B 4MDXA 1OYXA 2FVUA 2YLCA 1S72Q 3KFVA 4F7UG 4M75C 2I40B 1M4ZA 3BLRB 4EOOB 2EKHA 4M78D 4R0KA 1Q7YU 1KC8R 1LNXA 3TNHB 5J3BA 1TUDA 3V8JA 2QG9B 2A08A 1H1SB 2K4YA 5HY6A 5FU6C 2L8DA 1K0SA 2EPDA 3HRTA 1N27A 4JZ3A 3OYIA 5GAMh 2X35A 2Y4YA 4EOPB 5LJ3h 3M0QA 1IREB 3R6NA 2VXEA 4OMFB 2C06A 3QHWB 2QGGA 3I56Q 1YJNT 1NG2A 2L5QA 2XI9A 2KT8A 2GCXA 1WXBA 3EG0A 2NUZA 3H0IA 1M2VB 5IT9E 4GY5A 2YUNA 1ZX6A 4AG1C 1B7TA 4PLLA 3GIBA 1U3OA 3LH5A 2CP2A 2EYZA 2JTFA 4F7UE 4HNUA 4BXXX 3S3MA 3QSUA 2F5TX 3HHTB 1GCQC 4A4KA 2I53A 2DLPA 2GQVA 4A4GA 2R5MA 2HBWA 2NLUA 1Y96A 1BCMA 2EYYA 3KBGA 3F5XB 1KG1A 2F2CA 3L2QA 4ZN1A 1QWEA 3FDRA 3BG9A 1X6GA 3BLHB 1UNGD 5IDPB 2PK9B 2LQWA 3JCMe 2L2PA 2DD5A 2W10A 2EVRA 3OQ5A 2DVJA 4II1A 3KUFA 4HCCA 4KUDK 1VQ5T 1VQLT 3G4ST 1OU9A 1BI3A 2L3QA 4FYWB 3A8MB 4XU1A 4EOLB 4DBHA 5C0MA 2EQJA 2VYTA 2EGCA 2ZPHB 2CZ0B 2LX9A 1E6HA 4LUEA 4QVDA 3QZ9B 3UDCA 1Z9ZA 4HVWA 1XO2A 2QI2A 1IHWA 3E2UA 4NS5A 3BLQB 2QEXA 2M1HA 3RDVA 2COWA 1KFZA 5GAMd 1ZSZB 4BCGB 4AFSC 1V1CA 2E1HA 4C0GA 1WHGA 2HSEB 4BACA 1RACB 1VQMA 2WHBB 4JLGA 1PSFA 2ZPGB 3G7ZA 1IRXA 2BKDN 1M2OA 2JS2A 3CCUQ 1LOJA 4Z6YA 1YNZA 4M7DG 3CEYA 4F7SB 3CC2A 2O2OA 3C95A 2O9SA 4EIKA 3HRUA 3QIIA 1RUWA 4C92D 3MPUB 2KGTA 2ROLA 1HXDA 5CAIA 1UJ0A 4LUDA 2HSPA
chains in the Genus database with same CATH topology
2K5FA 3CCJT 2OTLT 5GAN6 3QYBA 4ELZC 3HBLA 3JB9F 4FT2A 2KMGA 1M9SA 4OB2B 4CRIA 1P92A 4JX6A 2R57A 4C0ZA 2KMTA 4EMKB 4BE1A 1Q86U 2XDBA 4J5YA 3FRNA 1N6AA 1YCYA 4M78A 5KCHA 2G3RA 5L8RE 2HBPA 5GAMg 4MZMA 4BDZA 3HL8A 5GANj 3TCJA 2EKOA 2GF7A 3CCJA 3OYDA 2OTLA 5CKFA 2XICA 2A3LA 1YIJT 2DD4A 1AHJB 2DTOA 4MFDA 3M59A 3OYBA 3BDUA 4HLQA 4PNOA 4E7LA 1WJRA 2DXBA 2KR6A 3QPHA 4A4FA 3META 2EJGA 3EFSA 4XU2A 3SDZA 4N0AA 1JJ2S 1NE8A 1MHNA 3CBMA 3P8BB 1NPPA 3H8ZA 2LRQA 4BI4A 2ZCFB 2RH2A 4ZGJB 1BKBA 4E7IA 2DIGA 2HQXA 1YIJA 2BIVA 2LCCA 3C4SA 1FWZA 4XU3A 4PJOD 2PQWA 2EQUA 3TW7A 1YJNA 3MO8A 4JX5A 4EMGA 1XNIA 3CD6A 3AHUA 2DAQA 1B34B 1Q82C 3HSBA 1KQSA 3JB9D 1QLBA 3MP1A 5GANg 4ME7A 4AKHA 2D9TA 2DEQA 4C8QG 4M78C 3CBPA 4M77F 3OYHA 1KD1U 1GXIE 2XKOC 2QQAA 2EFIA 4A4EA 2LVMA 5GMKj 1TH7A 3HFOA 3QJYA 3GPLA 3GOXA 4O6JA 3L2UA 1BI1A 5CQYA 3C94A 3G6ET 2E41A 2ZPBB 3MEAA 5CK9A 4QQGA 4EMHA 4MDXA 1Y96B 2RO0A 2FL7A 3OSVA 3SWNB 3MP8A 2YHTA 3CCMA 4HCZA 4M7DD 2JZ2A 2IG0A 3H6ZA 4M7AD 4RCCA 5KCOA 1K9MC 4XTUA 1QVFS 2QTXA 1OI1A 1MGQA 2L89A 3S3NA 1YHQT 3RERA 2RM4A 1UB4A 3C12A 3VV0A 1UEBA 3PTAA 1D3BA 2RI5A 2XU8A 1LJOA 4M75F 3J7AF 2DD5B 4RCBA 3PNWC 3OS1A 3CPWS 2DVEA 1K73U 1YHQA 4QW2A 4KT0E 1I81A 2XK0A 2PVDB 3JSCA 4R55A 3JB9J 5GAN2 1I5LA 4AKIA 5CKEA 3OYLA 5EG2A 1M8VA 4J6YA 3L2VA 2Y90A 2HNIA 2CZ7B 4JUVA 3P8HA 5A0GA 3DLMA 4M78G 3LYIA 3SWNC 4ELYC 1BIAA 3LWIA 3RMSA 5M9OA 4X9CA 2P0KA 1N8RC 4BBRM 2X4YA 3M54A 3OYFA 3VU3C 4BBSM 3GLXA 3LX7A 4MMLA 2IVWA 4JLIA 1M1GA 3URGA 1KQ1A 3CC7T 4M77A 1VQ6T 1G3SA 2M0OA 3RMQA 3CC4A 2DPPB 4C92F 1ZBXA 5GAMe 4BDYA 3L2WA 1VQNA 1VQKT 4C8QE 1VUBA 2H3JA 3GNFB 4M75D 1WQWA 2CYZB 2JVVA 5LJ5h 2LNVA 3JCMJ 4LDXA 3QYEA 3MEWA 3M9QA 4C8QB 1X01A 2FYKA 3JCMV 4FM4B 2MWOA 4A4HA 2QQSA 1BI0A 3QUIA 3V8KA 3CC7A 2WSFE 4E7JA 1Y07A 2RHXA 3OYYA 1Y71A 3JCMc 5GAN8 2RHIA 3OS0A 3SD4A 2QQ9A 1S72T 4B9XA 4XU0A 5A2QE 3VYGB 2RJFA 4Z02A 3RESA 4M75A 3L1AA 3KHIA 3RUXA 2AHJB 2DXUA 5IAYA 4RMOA 2ZPFB 2WACA 3QBYA 4IUTA 1Q82U 4J7FA 4MIMA 3VKGA 3CCET 4ELJA 3MEVA 5GANe 1X75C 3M58A 4OVAA 2YRVA 1FXXA 4LDWA 1WGSA 2DZCA 2A7YA 1VQOT 2R58A 1S72A 4E7KA 1YJWT 3OB9A 4DOWA 2JUFA 2CZ6B 2QDJA 3ER0A 4QQ6A 1G5VA 3M4YA 5I21A 3JB9H 2M9UA 2E70A 2VV5A 4PJOF 3OYAA 4JX4A 3P8DA 2O4XB 3MEUA 3MP6A 2GFUA 5FU7B 1N9SA 5GAOn 3CCEA 4IKFA 4DOVA 5A0LA 5A0DA 3A8GB 3OYMA 1K9MU 3ME9A 4LDVA 3DLLA 4JJNK 2K5IA 1VQOA 1YJWA 4M78E 3GP8A 5CKBA 4L5GA 3I56T 4M78B 4C0DB 2QQ8A 1RL2A 4C92A 5GAN5 1I4K1 1ZHIA 5FROA 3CCLT 5LJ5f 3S3OA 1M5Q1 3CCQT 1YITA 4HNVA 1M90U 1KQSS 4HT9A 1QW1A 3HRSA 3OW2S 1UGSB 4AI6A 4B9WA 3QXEB 4IURA 4J6WA 5GMKe 5CAIA 3GNGA 4NL2A 3HFNA 3RKXA 5HK0A 3EAEA 2DD4B 4J8OA 1VQPT 5GMKm 4M7DF 4M7AF 1QVPA 3FEOA 3M53A 5I2MA 4F7UF 1VQ6A 2ZPEB 5EJCA 3NTIA 5GAN3 3CMAT 2MWPA 3I56A 2DXBB 3CCUT 5GMKl 1NPRA 4C5IA 1KC8C 2RK2A 2OTJA 3V7SA 5D6XA 5DLQE 1JRIA 5FU7C 3L42A 1QP3A 4J83A 5CKDA 3KXTA 3JCMP 2QFZA 4A53A 2FHDA 3E9FA 4OGCA 3S6WA 1W2BS 1Q81C 3O8VA 3CMAA 3M56A 3HZJA 1G3YA 3J81E 5GAOp 3QDRB 3QKJA 1K8AC 3FB9A 4BE2A 4C0DC 3A8HB 4LOCA 1QVGA 1M1KC 3JCMb 2K5LA 3JCMf 2E12A 4J7IA 2EYQA 4QQDA 2R5AA 4XTVA 2KDSA 2LC4A 2QXFA 4C0FA 5LL6S 4C5HA 5KE3A 3LGFA 2RI3A 2LQKA 2PVGB 2RI2A 4XTWA 4L6V5 4XTYA 4HA8A 2K2VA 2P0QA 4PJOA 2XIDA 3BG3A 2DXCA 4LD6A 4OB0B 2LTOA 4JRQA 1R8OB 2V8JA 4FIBA 2X4JA 3HB9A 4GLKA 3T9NA 3PIOA 2V8KA 4JS4A 4OB3B 4N0AC 3EFRA 1VQ4T 3UT1A 4J6XA 1OZ3A 3ZFJA 2M16A 1SSFA 1D3BB 3DL1A 3FIFA 5LJ5d 4HCBA 3G6EA 2RA2A 5I2SA 3JAME 1UGQB 1O9SA 2BUDA 2X4XA 3NTKA 2DO3A 3PIPA 2QF7A 1QP2A 1U1TA 4Y91A 1UGRB 5FRMA 4MFEA 2DXTA 4M7DA 1Q7YC 4LDYA 4M7AA 4LDUA 3TEEA 4X9DA 2HAXA 2XHCA 4F7UA 1VQ4A 4ZGEB 4C8QF 1JJ2A 4YTLA 4JRPA 3N5BB 5GAMf 1VQ8T 4V2SA 3CCRT 3PMIA 1I8FA 5LJ3f 2E10A 3X24B 4N4IA 4KULA 3JCMW 4PJOC 4KBMB 3VKIA 5LJ5j 4D6WA 2D0QB 4XAXB 2LT1A 4NOYA 5KE2A 2DIQA 3ZBDA 3X25B 3QZ5B 3WXMB 3JB9I 1VIFA 1WPYA 5DM7R 1KHIA 4M77E 4WF2A 1RI0A 4QSHA 2DJZA 1VQ8A 3CCRA 4M77B 4Y28E 3JCMd 2CGHA 2O01E 3WVDB 2WSEE 3OYKA 3BDLA 2QQBA 4AKGA 4BB7A 4JRIA 1FX7A 4C5GA 1WJQA 3INZA 4HL4A 4M7DC 3VUZA 2EQMA 2HQEA 2EAYA 3JCMQ 4M7AC 1YBYA 4BI3A 4OB1B 5GANf 3RIRA 5GAN7 2ZGWA 4XTZA 4BD3A 2ZPIB 4RKUE 3QYHB 3HKSA 4N4GA 4MMKA 3OYNA 3M55A 3R6OA 1VIEA 3JRZA 1BIBA 1OZ2A 2X4WA 4C8QD 5LJ5g 4DA4A 3BG5A 3F70A 4NL3A 3L2RA 1VQKA 3GF5A 2DZ9A 2WSCE 2YLBA 2RJCA 2XDPA 5D6WA 3CPWA 2LDMA 2MAMA 4M75B 2E5QA 3E9GA 5HK3A 4M78F 3QYGB 3JCMX 2CS7A 1VQMT 1Q81U 3OYEA 5J39A 1EIFA 3X28B 4X34A 4XTXA 4MDWA 1ZQ1A 2JOYA 1YI2A 3L2ZA 3CCUA 4OP0A 3M5AA 1K8AU 4E7HA 3A8OB 2Y4XA 3J80E 4PJOG 1VQ7T 1E7PA 4PLIA 2EJFA 4M77C 2QA4T 5CO7A 3VKHA 3E19A 3MHXA 5FU6B 3BW1A 2ZZDA 2RHUA 3OYGA 5LJ3d 2BS2A 2VUBA 2KAFA 3JB9G 4M6VA 3JCMh 4EPCA 1H3ZA 1DJ7B 3V7RA 3OSSC 3QO3A 3NTHA 2EQKA 4MZPA 3DKMA 4RG8A 4QVCA 5GMKi 1VQ7A 3VYHB 2RD1A 1UGPB 2MMPA 2XG8D 3I55T 2QA4A 3JCMg 2KQWA 4C5EA 1NZ9A 2F5KA 5CIUA 1PSEA 2PVOB 2DTIA 4CI0C 3CXCA 1WNLA 1XOVA 4KUIA 3CMET 2BS4A 5AYFA 1OYXA 2FVUA 2YLCA 3VJPA 4C92B 4F7UG 5DLOA 4M7AG 5GAOr 4M75C 3LH0A 1M4ZA 2F69A 2DK3A 2G77A 4JS5A 2JNGA 2KY9A 4M78D 1Q7YU 5CVIA 3FC3A 1LNXA 4ZTJA 1QVGS 1IZ6A 4VUBA 5J3BA 2QEXT 2RHZA 3V8JA 3V8LA 3OMCA 1WQ7A 2JN0A 2K4YA 5FU6C 2L8DA 5HY6A 1O75A 4BI8B 3HRTA 1XTDA 1N27A 2PUOB 3OYIA 3CCLA 5CKHA 5GAMh 3OMGA 4FU6A 3CCQA 3BY7A 1YJ9T 2X35A 2Y4YA 4UC4A 3RKYA 3PT9A 4EMKA 5LJ3h 1BI2A 1IREB 3CBOA 4M77G 2GFAA 1VQPA 1N8RU 4JDSA 4L59A 3LWHA 2FB7A 1NJIC 4PKCC 4E47A 2VXEA 4ZGDB 3PMTA 4OMFB 5LJ3g 4A54A 2C06A 1G3WA 4DQ2A 3OS2A 1BYMA 1YJ9A 4RG2A 4C92C 3QHSA 1YJNT 2DTHA 2DKGA 3WVEB 2VC8A 3A5ZB 4IUQA 3CD6T 3SFMA 4PJOE 3A8LB 2L5QA 3LLRA 2XI9A 2GCXA 2E6ZA 2VXFA 1G3TA 4XK8E 4PJOB 4NC6A 3X26B 1JB0E 2OAUA 4ZTFA 5GAOq 2JTMA 2DXCB 4FSXA 5IT9E 4GY5A 5GANh 1HK9A 3OBWA 5LJ5e 4M75G 2EIFA 5GAOm 2MI6A 2E6NA 2E64A 3G71T 1VQ9T 3NFCA 4PLLA 3GIBA 1B34A 5GAOl 4OF1A 4EMKC 2K3XA 3TU4K 3LW5E 3CCMT 3OW2A 2KK4A 3V7CA 3OS5A 5KH6A 2D6FA 3QJ6A 3LGLA 4M7DE 2LCLA 4M7AE 2JTFA 2P0PA 3X20B 4HNUA 4F7UE 3S3MA 4M7DB 4XQ3A 3G71A 3CCVT 3QSUA 4M7AB 5HKCA 2F5TX 3HHTB 4FT4A 4P5NA 4F7UB 2RHYA 3BFMA 1YI2T 4A4KA 1VQ9A 2GQVA 4A4GA 5FRNA 2CKKA 2R5MA 1Y96A 2NLUA 1KG1A 1V29B 3KBGA 4PL6A 3SWNA 2RB6A 2RJDA 3L2QA 4ZN1A 2K3YA 1X6OA 3CPFA 3FDRA 3BG9A 4BY6B 3OY9A 1Q86C 5CR2A 1W2BA 5GMKh 3CCVA 4MZTA 4IUVA 4IUPA 4C92G 1XQHA 3JCMe 3UPUA 3TREA 4TVRA 1M90C 2DD5A 1WJSA 3OQ5A 3QG1A 4N4HA 4IUUA 4Q5WA 3PFSA 4II1A 3KUFA 2RJEA 4HCCA 1VQ5T 4KUDK 1VQLT 4HT8A 3G4ST 2PU9B 4JRKA 3M57A 3FLGA 1U1SA 5IN1A 3Q1JA 2MF2A 1BI3A 4M77D 2WJ9A 3HP9A 4FL6A 3A8MB 4XU1A 4OGEA 4HKEA 3UWNA 3CC4T 4ATOA 2K57A 3OYJA 1QVFA 1VQNT 5D6YA 1JBMA 5C0MA 2EQJA 2V8IA 2VYTA 1KHCA 5CCAA 3HPWA 2XDDA 2ZPHB 1M1FA 1VQ5A 1VQLA 3G4SA 3FJPA 2CZ0B 2LQ8A 2LX9A 2VGMA 4QVDA 1KC8U 2BS3A 2I2LA 3OYCA 4BE0A 1Y7XA 3QZ9B 4M75E 4BY6C 3DB3A 3UDCA 3OA6A 3M4GA 3TW6A 4QVZA 2EJ9A 3CMEA 1KD1C 2QI2A 3RKWA 3CXCS 1NJIU 4NS5A 5C6SA 2XD0A 5LJ3e 2QEXA 2QQRA 2L3RA 2M1HA 2CZ1B 1U8RA 4BUGA 4C8QA 1M1KU 5GAMd 2HD0A 1FKMA 2ZZDB 3CCST 2LT4A 3E1SA 4EDUA 2E1HA 4LD9K 2EWNA 4C0GA 3MCAB 2KSSA 3CC2T 4BACA 1VQMA 4ZN3A 4JLGA 5GAN4 5J26A 3ASKA 2P4TA 2PUKB 1PSFA 3DB4A 2E65A 2ZPGB 4O5VA 3VYGA 3G7ZA 2BKDN 1W4SA 2RK1A 1LOJA 4Z6YA 5DY9A 3CCSA 3PGGA 1K73C 4C92E 3QWLA 4M7DG 5FLXE 1KQ2A 2VGNA 3CEYA 3OBYA 3SB2A 2KVQG 2QDYB 5GAMj 3CC2A 3C95A 4HNTA 5LJ3j 4R56A 3ZEHA 2OTJT 3HRUA 3QIIA 3I55A 4C92D 5CQXA 5GANd 1N9RA 3HO8A 1H641 2B8AA 4C8QC 2O4XA 1YITT 1HXDA 3H4CA 3VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0Q B;  4OB2 B;  3X25 B;  3VYG B;  3QZ5 B;  2AHJ B;  5L8R E;  3LW5 E;  2ZPF B;  4Y28 E;  2O01 E;  3WVD B;  2WSE E;  3X20 B;  2DD4 A;  1AHJ B;  3HHT B;  2CZ6 B;  2DXB A;  4OB1 B;  1V29 B;  2ZPI B;  4RKU E;  3QYH B;  2ZCF B;  4ZGJ B;  3A8G B;  2WSC E;  3QYG B;  2DD5 A;  3X28 B;  1GXI E;  1UGS B;  3A8O B;  2PU9 B;  3QXE B;  2DD4 B;  2ZZD A;  3A8M B;  2ZPB B;  2ZPE B;  2DXB B;  1DJ7 B;  2ZPH B;  2CZ0 B;  3VYH B;  1UGP B;  1QP3 A;  3QZ9 B;  1PSE A;  2PVO B;  2DD5 B;  3A8H B;  2CZ1 B;  4KT0 E;  2PVD B;  2ZZD B;  2PVG B;  4L6V 5;  2DXC A;  2CZ7 B;  4OB0 B;  2PUO B;  2PUK B;  1PSF A;  2ZPG B;  4OB3 B;  3VYG A;  1IRE B;  1UGQ B;  2DPP B;  2QDY B;  4ZGD B;  1QP2 A;  1UGR B;  2CYZ B;  3WVE B;  4ZGE B;  3A8L B;  4XK8 E;  4FM4 B;  3X26 B;  1JB0 E;  2WSF E;  2DXC B;  3X24 B; 
#chains in the Genus database with same CATH topology
 5IF1 B;  2OTL T;  5GAN 6;  2HKN A;  1M9S A;  3G33 B;  4CRI A;  2R57 A;  2O88 A;  1YCY A;  2RN8 A;  5KCH A;  3CQT A;  2QAZ A;  4MZM A;  3TCJ A;  1X2K A;  3OYD A;  1YIJ T;  4CFU D;  2A3L A;  4F14 A;  4I3Z B;  4MFD A;  3OYB A;  3CCL Q;  2KR6 A;  2LP5 A;  3EFS A;  1JJ2 S;  1NE8 A;  1MHN A;  2LRQ A;  1BKB A;  4E7I A;  2VB6 A;  1WFW A;  2DMO A;  2PQW A;  1YJN A;  4EMG A;  4JX5 A;  2YWW A;  2UZL B;  4X1V A;  2DAQ A;  4ORZ A;  1KQS A;  4RTX A;  1YJ9 Q;  4A63 B;  2CP7 A;  2QAS A;  4HVU A;  4C8Q G;  1KD1 U;  4M78 C;  2C5O B;  3DTO A;  2LVM A;  2PZ1 A;  2YDL A;  2D1X A;  1AD5 A;  3G6E T;  3B57 A;  2ZPB B;  2E41 A;  2CCI B;  1Y96 B;  3OSV A;  2IG0 A;  1OI1 A;  3S3N A;  3H41 A;  3VV0 A;  1AIS B;  4TTH A;  1UHC A;  3PTA A;  2JJ9 A;  3G71 Q;  2DD5 B;  4RCB A;  2GBQ A;  3CPW S;  2RMO A;  1NEB A;  2PNI A;  2SRC A;  4KT0 E;  4QW2 A;  4AKI A;  1E6G A;  3VS5 A;  5CKE A;  3OYL A;  2H3E B;  2D0N A;  2J06 A;  1E9H B;  5A0G A;  1U5S A;  1E7O A;  4ZNX A;  3LX7 A;  4LN2 A;  2IVW A;  5IHN A;  2M0O A;  3H9N A;  5GAM e;  1JO8 A;  3L2W A;  3BHU B;  1PRM C;  1WHM A;  4BDY A;  1PKT A;  4C8Q E;  1MND A;  1JXO A;  1JXM A;  3GNF B;  2JVV A;  2CYZ B;  3MEW A;  3M9Q A;  2B86 A;  2MWO A;  3QUI A;  3V8K A;  4E7J A;  1Y71 A;  3JCM c;  3TN8 B;  5GAN 8;  2RHI A;  3DDP B;  3SD4 A;  2LJ1 A;  1UNH D;  4Z02 A;  3RES A;  4M75 A;  3KHI A;  5IAY A;  2DXU A;  4IIO A;  4RMO A;  1OEB A;  3QBY A;  1FIN B;  2D8H A;  5AT1 B;  1OKV B;  3CCE T;  3UAT A;  3M03 A;  1D1B A;  1WGS A;  4LDW A;  3VS3 A;  1K76 A;  1VQO T;  1S72 A;  4E7K A;  2JUF A;  2LCS A;  1G5V A;  5I21 A;  3JB9 H;  4PJO F;  1TD6 A;  5GAO n;  5FU7 B;  3CCS Q;  5A0D A;  3ME9 A;  2EGA A;  3FJ5 A;  5DQW A;  4E2F B;  4C0D B;  2QQ8 A;  4B6M A;  1MV3 A;  3CCL T;  5LJ5 f;  1KQS S;  2OTJ T;  1AWW A;  1FYN A;  4NL2 A;  4M7D F;  3UF4 A;  3CME Q;  2EBP A;  4J9B A;  3FEO A;  3M53 A;  2C5N B;  3CMA T;  2I0N A;  4F16 A;  3I56 A;  2ROT A;  1VIN A;  1NPR A;  4CC4 B;  1OL2 B;  3EG9 A;  2C0I A;  1QP3 A;  1SSH A;  4BY1 X;  3KXT A;  2O31 A;  1OX8 A;  3E9F A;  3HZJ A;  3MI9 B;  2F2W A;  5KYY A;  1K4U S;  2CP6 A;  4J7I A;  4QQD A;  2NUT A;  2CCH B;  3BHV B;  2LC4 A;  2K2M A;  2DRK A;  4EOI B;  2LQK A;  2PVG B;  2RI2 A;  4F7N B;  4OMM A;  1WDX A;  4OB0 B;  4JS4 A;  2X9H A;  4FIB A;  3PIO A;  3VRY A;  1RI9 A;  1MUZ A;  3UT1 A;  4J6X A;  5FGK B;  1NBE B;  4ESR A;  3DL1 A;  4YC3 B;  3G6E A;  2RA2 A;  5I2S A;  2BUD A;  2DO3 A;  1PG5 B;  1QP2 A;  1U1T A;  5FRM A;  1MV0 B;  4M7A A;  2HAX A;  4C8Q F;  7AT1 B;  1WA7 A;  5GAM f;  2CP3 A;  4V2S A;  3CCR T;  2RQT A;  1I8F A;  5LJ3 f;  4N4I A;  3VKI A;  4BCJ B;  1ZA1 B;  3TNI B;  3EG2 A;  4XAX B;  2LT1 A;  5KYW A;  5KE2 A;  3X25 B;  1VIF A;  1EX4 A;  4HXJ A;  4M77 E;  1GY3 B;  1YHQ Q;  4Y28 E;  3SEM A;  2DYI A;  3BDL A;  4AKG A;  4BB7 A;  4UN0 A;  2MIO A;  4C5G A;  3INZ A;  4BI3 A;  1YFN A;  5GAN 7;  4NST B;  3RGF B;  2FRY A;  4RKU E;  4C8Q D;  3PO3 S;  4DA4 A;  5LJ5 g;  3F70 A;  1I07 A;  2PJQ A;  2DZ9 A;  5D6W A;  4EOR B;  4FCY A;  1VQN Q;  2MAM A;  2C0O A;  4M75 B;  3E9G A;  3JCM X;  3CCU A;  3M5A A;  3J80 E;  1VQ7 T;  5FU6 B;  2ZZD A;  5KYN A;  2VUB A;  1AVZ C;  1PWT A;  3JCM h;  2HQH A;  4Y92 A;  1SKU B;  4MZP A;  2RD1 A;  2MMP A;  3VS4 A;  2HDA A;  1PSE A;  1D0Z A;  3CXC A;  1XOV A;  3CME T;  1TTH B;  4PFZ A;  2WMA B;  4Z88 A;  5DLO A;  3LH0 A;  2F69 A;  2DK3 A;  2JNG A;  2X3X D;  3FC3 A;  2KYM A;  3V8L A;  5DQV A;  4PFO A;  2BE7 D;  2C0T A;  1FVV B;  2P84 A;  3CCL A;  5CKH A;  3BY7 A;  1NLP C;  2JMC A;  3EG9 B;  4EMK A;  1BI2 A;  1BK2 A;  5HVY B;  2VWF A;  4JDS A;  4L59 A;  2D8J A;  3LWH A;  4E47 A;  2IIM A;  2FZK B;  4LXC A;  5LJ3 g;  5KYY B;  4AFU C;  3OS2 A;  1YJ9 A;  3MY1 B;  2MOX A;  3SFM A;  2NUT B;  3LLR A;  2E6Z A;  2LX7 A;  2PK2 A;  1G3T A;  4JJB A;  4NC6 A;  1M3A A;  3X26 B;  1JB0 E;  2OAU A;  5GAO q;  2JTM A;  4FSX A;  2DL3 A;  5GAN h;  1QVF P;  3OBW A;  2WXV B;  1QMC A;  1FMW A;  3NFC A;  1LPL A;  2DL4 A;  3LQ5 B;  2K3X A;  1X27 A;  3V7C A;  1R0C B;  2YSQ A;  1R77 A;  5LQF B;  1UFF A;  2LCL A;  2P0P A;  2CDT A;  3G71 A;  3M0R A;  4M7A B;  4FT4 A;  4P5N A;  3EGX A;  3BFM A;  3PVQ A;  1H28 B;  5FWC A;  5FRN A;  4KH0 B;  2FO0 A;  1V29 B;  2M02 A;  2RJD A;  3OY9 A;  1D0Y A;  1Q86 C;  1W2B A;  5GMK h;  5KYW B;  4C92 G;  4IUP A;  3TRE A;  3BE3 A;  1WJS A;  2A36 A;  4JRK A;  1JQQ A;  3M57 A;  1U1S A;  2E3I A;  9ATC B;  2YXY A;  4M77 D;  1OGU B;  5HBJ B;  4HKE A;  4ATO A;  3OYJ A;  1VQN T;  5D6Y A;  2XDD A;  5CCA A;  1M8M A;  3HPW A;  3TSW A;  4J9E A;  8AT1 B;  3FJP A;  1H1P B;  2LQ8 A;  2YRD A;  1VQ8 Q;  3OYC A;  1Y7X A;  5HQ0 B;  3OA6 A;  3M4G A;  1NJI U;  3CXC S;  3NDQ A;  2L3R A;  4EON B;  2J6K A;  4RTT A;  2ZZD B;  4J9C A;  5GJV B;  2KSS A;  1YN8 A;  3CC2 T;  4KRT A;  5GAN 4;  5J26 A;  3ASK A;  3VYG A;  1YCS B;  3CCS A;  3PGG A;  4C92 E;  4IMY B;  2PTK A;  3A98 A;  1KQ2 A;  2VGN A;  5GAM j;  2UUE B;  3SHW A;  2UZB B;  5LJ3 j;  4R56 A;  1G83 A;  5CQX A;  5GAN d;  2V26 A;  3EHQ A;  1N9R A;  2B8A A;  1OIU B;  1D1A A;  4C8Q C;  2IVX A;  1GBQ A;  1TSF A;  3H4C A;  2QA4 Q;  3VUB A;  3CME A;  2K5F A;  3ULR B;  1SHF A;  2KMG A;  1P92 A;  4C0Z A;  4EMK B;  2G3R A;  5L8R E;  1W2B P;  1VYV A;  1K1Z A;  1WHJ A;  1TUG B;  2GF7 A;  1IGU A;  2DD4 A;  2IPO B;  2DTO A;  4HLQ A;  4OMQ A;  2EJG A;  3P8B B;  1NPP A;  1ZLM A;  2X51 A;  2BIV A;  2LCC A;  3C4S A;  1FWZ A;  1TXQ A;  4F6S B;  1QLB A;  2NUP A;  2DEQ A;  2D9T A;  4RTV A;  3OYH A;  1GXI E;  2XKO C;  1CKB A;  2EFI A;  2QQA A;  3QJY A;  3GPL A;  3L2U A;  3I35 A;  1BI1 A;  2O9V A;  5CQY A;  2JT4 A;  3EGX B;  1Q86 R;  2ATC B;  4QQG A;  2RO0 A;  3REB B;  2YHT A;  2AZS A;  4HCZ A;  3H6Z A;  4RCC A;  5KCO A;  1KK7 A;  1UHF A;  1H24 B;  4Z89 A;  2RI5 A;  2XU8 A;  3JV3 A;  3J7A F;  3OS1 A;  4JPB W;  4DBF A;  1K73 U;  2DVE A;  3VRZ A;  1VQ9 Q;  4CC2 A;  5EFQ B;  1YHQ A;  1LVK A;  2XK0 A;  1I5L A;  3JB9 J;  2FPF A;  5GAN 2;  2LZ6 B;  2J7I A;  1C0M A;  4AFQ C;  2WPA B;  1WLP B;  1M8V A;  3L2V A;  2HNI A;  3CCV Q;  2CZ7 B;  4CFV B;  1UEC A;  2DE0 X;  4JUV A;  3P8H A;  4OML A;  3LYI A;  1BIA A;  5M9O A;  1UUE A;  4BCF B;  3VU3 C;  4BBS M;  3GLX A;  4JLI A;  1M1G A;  1VQ6 T;  3RMQ A;  4C92 F;  1ZBX A;  1VQN A;  4KRC B;  2BKZ B;  2VAS A;  1VUB A;  1N4M A;  4LDX A;  2LNV A;  3BHT B;  2WIP B;  1X01 A;  5L2W B;  2PMI B;  2KEA A;  4PJM A;  1RLP C;  1IHV A;  1BI0 A;  4AMC A;  5HBE B;  3OS0 A;  2L0A A;  4OMO A;  4J9H A;  1S72 T;  4XU0 A;  3VYG B;  4LNP A;  3A1P A;  2JGZ B;  2RPN A;  4Y72 B;  4IUT A;  1Q82 U;  4MIM A;  2DA9 A;  5GAN e;  1X75 C;  1FXX A;  4OMN A;  1PKD B;  1M27 C;  2DZC A;  3OB9 A;  1QVG P;  2CZ6 B;  1VYW B;  3M4Y A;  2NWM A;  2ABL A;  2VV5 A;  2E70 A;  2DX1 A;  3P8D A;  2C5V B;  2GFU A;  2EUF A;  3OYM A;  1K9M U;  1RAA B;  1ZP2 A;  5CKB A;  3I56 T;  2LW4 A;  1SPK A;  2F2X A;  1D3U B;  3REA B;  1ZHI A;  3I55 Q;  1M90 U;  4HT9 A;  4HNV A;  1ZBJ A;  2MCN A;  2FPD A;  5GMK e;  3QXE B;  4IUR A;  3GNG A;  3HFN A;  2DD4 B;  2DF6 A;  4F7U F;  5GJW B;  3NTI A;  1ARK A;  2MWP A;  2WEV B;  2FEI A;  2CH4 W;  4F70 B;  4C5I A;  2RK2 A;  2GNC A;  5D6X A;  5DLQ E;  2C5X B;  4CRL B;  1YIT Q;  4BCQ B;  2DER A;  3DOG B;  2QFZ A;  2W99 A;  4A53 A;  3S6W A;  3CCJ Q;  4OGC A;  1Q81 C;  2QDL A;  3O8V A;  3UA7 A;  1K8A C;  3QDR B;  3QKJ A;  2NUP B;  4LOC A;  4AG2 C;  4DBQ A;  1I0C A;  3JCM b;  3JCM f;  2E12 A;  2R5A A;  2KDS A;  2QXF A;  5KE3 A;  4C5H A;  1S1N A;  2OI3 A;  4XTY A;  4PJO A;  4HA8 A;  2K2V A;  2P0Q A;  2DXC A;  4LD6 A;  2BE9 B;  1PCX A;  2QGF B;  2YUQ A;  3CD6 Q;  1I5O B;  2V8J A;  2AKK A;  2WMB B;  4GLK A;  2V8K A;  4OB3 B;  2J6F A;  4N0A C;  3QWY A;  2ED0 A;  3QDF A;  2M16 A;  1SSF A;  3VS6 A;  1UGQ B;  3NTK A;  2YUP A;  1UGR B;  4M7D A;  1Q7Y C;  1X6B A;  4LDU A;  4PK4 A;  2XHC A;  1NYF A;  1NLO C;  4JRP A;  3N5B B;  1H92 A;  3PMI A;  3JCM W;  1YP5 A;  4OGR B;  4KBM B;  1H4L D;  4D6W A;  4DEX A;  3ZBD A;  2CJM B;  1WPY A;  5DM7 R;  5I5Z B;  3D7S B;  2DJZ A;  1VQ8 A;  4BCH B;  2QQB A;  1HYO A;  4D8D A;  2VVK A;  2CP5 A;  1OUL A;  2OX7 A;  3JCM Q;  2EAY A;  5GAN f;  1OU8 A;  2ZGW A;  4BD3 A;  1VQ6 A;  4MMK A;  3CCU T;  3M55 A;  1VIE A;  3JRZ A;  1BIB A;  2X4W A;  3BG5 A;  2EYW A;  2YLB A;  5KYX A;  4F04 B;  1ZQ1 A;  3I9Q A;  1N5Z A;  3C0C A;  2HMA A;  4PLI A;  1VOM A;  3CC7 Q;  5CO7 A;  3MHX A;  1SEM A;  2RHU A;  5IHK A;  4DBR A;  3OYG A;  2W96 A;  1HJD A;  4M6V A;  4EPC A;  1H1R B;  2M51 A;  1DJ7 B;  3OSS C;  5I11 A;  3DKM A;  3EFO A;  3EH1 A;  3VYH B;  3I55 T;  2XG8 D;  2QA4 A;  1ZUU A;  3JCM g;  1GCP A;  2GTO A;  4CI0 C;  1BU1 A;  4KUI A;  4M7A G;  5GAO r;  3MY5 B;  2KY9 A;  4ZTJ A;  1IZ6 A;  2RHZ A;  3OMC A;  1WQ7 A;  2FZC B;  2JN0 A;  1P5E B;  1O75 A;  1CKA A;  1YJW Q;  1Q81 R;  1XTD A;  1VYU A;  3OMG A;  4FU6 A;  4E7S A;  1YJ9 T;  1K8A R;  1UTI A;  2W9F A;  3TSZ A;  4M77 G;  2GFA A;  4J9I A;  1UJY A;  4A54 A;  3DJB A;  1GCQ A;  4DQ2 A;  1MMG A;  4C92 C;  3QHS A;  2DIL A;  2DTH A;  2DKG A;  2VC8 A;  3A5Z B;  3CD6 T;  1M3B A;  3A8L B;  1T0J A;  4AT1 B;  4F7J B;  2VXF A;  4XK8 E;  4PJO B;  2KXD A;  2AIR B;  2ENM A;  2DXC B;  1JU5 C;  5GAO m;  2EIF A;  3G71 T;  2E6N A;  2E64 A;  1TOV A;  4WTO B;  2HL5 C;  1SG5 A;  1VYT A;  1Q7Y R;  1ZSG A;  2K9G A;  5GAO l;  4OF1 A;  2RQR A;  3TU4 K;  3OW2 A;  1QCN A;  3EHR A;  1OQK A;  5HBH B;  1PKS A;  3QJ6 A;  1RAF B;  4M7A E;  3X20 B;  1W6X A;  4M7D B;  4XQ3 A;  5HKC A;  1KIK A;  1VQ9 A;  1QMZ B;  2CT4 A;  4PL6 A;  2K3Y A;  1YWO A;  1R0B G;  1WIE A;  5CR2 A;  3QHR B;  3CCV A;  4MZT A;  4IUV A;  1XQH A;  3UPU A;  1M90 C;  3QG1 A;  1VQ4 Q;  4N4H A;  4IUU A;  3PFS A;  4ROD A;  2RJE A;  4HT8 A;  3FLG A;  2ED1 A;  5IN1 A;  2MF2 A;  3HP9 A;  3MKD A;  1QVF A;  1WXT A;  1JBM A;  2V8I A;  3ZL7 C;  1M1F A;  2J05 A;  2BS3 A;  1SHG A;  4BE0 A;  1H1Q B;  2COZ A;  4BY6 C;  3DB3 A;  2BZ8 A;  5KYX B;  1NEG A;  1ABQ A;  3TQ7 P;  3TW6 A;  2EJ9 A;  1KD1 C;  4J9G A;  2CP0 A;  5C6S A;  1M1K U;  2HD0 A;  2VKN A;  3CCS T;  1UNL D;  2XMF A;  4EDU A;  3G1J A;  1H27 B;  1RAH B;  1QKX A;  1VQK Q;  4RTW A;  2SEM A;  2P4T A;  2E65 A;  3EFO B;  4BCN D;  1F5Q B;  1YI2 Q;  5DY9 A;  2A37 A;  3EG3 A;  1RAI B;  2A28 A;  3M0P A;  3OBY A;  3OW2 P;  2FZG B;  3ZEH A;  2X3W D;  3I55 A;  4PJN A;  3HO8 A;  2O4X A;  2Z0W A;  3HBL A;  2KT1 A;  3VS7 A;  2KMT A;  1JST B;  2PHG A;  1OIY B;  3FRN A;  1N6A A;  4J9F A;  4M78 A;  2UZE B;  1BBZ A;  5GAM g;  5GAN j;  3MJX A;  4BCI B;  3CCJ A;  5CKF A;  2LNH B;  2B9R A;  4BCM B;  2X1N B;  3M59 A;  4E7L A;  1B07 A;  4ANJ A;  3CCQ Q;  4EOK B;  2DXB A;  3QPH A;  1GFD A;  1UE9 A;  1G3N C;  4XU2 A;  3SDZ A;  4N0A A;  1UG1 A;  2KE9 A;  3H8Z A;  2CH4 A;  4ZGJ B;  1UGV A;  1VQP Q;  2DIG A;  2HQX A;  1JEG A;  1VA7 A;  4XU3 A;  4FYV B;  1QKW A;  3CD6 A;  3AHU A;  1IGQ A;  2AK5 A;  1YWP A;  3MP1 A;  4ME7 A;  1JKW A;  4AKH A;  4Z8A A;  4EC9 B;  4M77 F;  5GMK j;  4A4E A;  3GOX A;  3HFO A;  4FSS A;  4O6J A;  1QWF A;  4KRD B;  4F7L B;  3C94 A;  3MEA A;  5CK9 A;  1TU0 B;  1KXU A;  2V1R A;  2FL7 A;  1GFC A;  1TUC A;  2JTE A;  4M7A D;  1M90 R;  2KBT A;  4XTU A;  1W70 A;  1QVF S;  1MGQ A;  2L89 A;  1YHQ T;  3RER A;  1PRL C;  1UB4 A;  3C12 A;  3NPF A;  2G9X B;  1LJO A;  2DEU A;  5I22 A;  2PVD B;  3JSC A;  4JJD A;  2COY A;  3I5R A;  3I5S A;  4HVV A;  4GLM A;  2RQU A;  4J6Y A;  2Y90 A;  4GBQ A;  2WIH B;  3HTR A;  1KD1 R;  3DLM A;  3SWN C;  1OV3 A;  3RMS A;  2P0K A;  3M54 A;  3OYF A;  1OKW B;  1AWJ A;  3URG A;  4CFW B;  2KRS A;  1CSK A;  2DPP B;  1VQK T;  3MIA B;  5IH2 A;  2H3J A;  1V76 A;  5LJ5 h;  2QYZ A;  3QYE A;  3JCM V;  1VQ5 Q;  1O9K A;  1VQL Q;  3G4S Q;  1C9B A;  4A4H A;  3CC7 A;  2BTT A;  3OYY A;  3O0G D;  3NMZ C;  2W9Z A;  1AOJ A;  4CC3 A;  5A2Q E;  1WHH A;  5CEI B;  5KYU A;  2WAC A;  3MEV A;  2YRV A;  1T0H A;  2A7Y A;  4DOW A;  1Q95 G;  3ER0 A;  4QQ6 A;  4QT7 A;  3UA6 A;  3OYA A;  4JX4 A;  2O4X B;  3MP6 A;  4DOV A;  3DLL A;  5IXF A;  2W0Z A;  1YJW A;  1K9A A;  3GP8 A;  1WZO A;  4M78 B;  1RL2 A;  4C92 A;  2C6T B;  1AT1 B;  5GAN 5;  5FRO A;  2KRM A;  1OPL A;  1M5Q 1;  2OJ2 A;  3CCQ T;  1MMN A;  1UGS B;  4B9W A;  1VQP T;  5GMK m;  2YT6 A;  1QVP A;  5I2M A;  1I1J A;  3M0T A;  5EJC A;  2ZPE B;  5GAN 3;  3EGD A;  2DXB B;  5GMK l;  4BCO B;  1X2Q A;  2YRC A;  3NHN A;  3TVT A;  1JRI A;  4J83 A;  4CFX B;  1IB8 A;  3JCM P;  2FHD A;  2OTL Q;  1W2B S;  2K3B A;  3M56 A;  3J81 E;  5GAO p;  2E3H A;  4BE2 A;  1SF9 A;  3A8H B;  1QVG A;  1M1K C;  2K5L A;  2EYQ A;  4XTV A;  5LL6 S;  1ZUY A;  4RTZ A;  2RI3 A;  4L6V 5;  1YIJ Q;  3BG3 A;  1FMV A;  1MMD A;  2LTO A;  2CUD A;  4JRQ A;  1ENW A;  3HB9 A;  2X4J A;  5ICP B;  3EFR A;  1HD3 A;  4FX3 B;  3ZFJ A;  3FIF A;  5LJ5 d;  5L23 A;  1O9S A;  3PIP A;  4KGZ B;  1GRI A;  4MFE A;  4EOM B;  2RNA A;  2HZY A;  4PFP A;  4F7U A;  3CCM Q;  1VQ4 A;  4ZGE B;  1JJ2 A;  3TNW B;  1VQ8 T;  2E10 A;  3X24 B;  3G6E Q;  2D0Q B;  1AEY A;  2HL3 A;  2QTV A;  3QZ5 B;  1KHI A;  3EH2 A;  1RI0 A;  2J6O A;  4D8K A;  1OI9 B;  2CGH A;  1AZE A;  2RF0 A;  2HEQ A;  1RAD B;  1FX7 A;  1WJQ A;  4EOQ B;  4M7A C;  1WXU A;  1YBY A;  1O9K B;  3RIR A;  2FPE A;  1MMA A;  2ZPI B;  3OYN A;  4N4G A;  3PVL A;  3R6O A;  1VQK A;  3CC4 Q;  3GF5 A;  2XDP A;  4CFN B;  3CPW A;  2E5Q A;  5HK3 A;  3QYG B;  2DM1 A;  1F1B B;  1Z9Q A;  2CS7 A;  2CUB A;  2MPX C;  5KYU B;  2YUO A;  3OYE A;  3X28 B;  1SRL A;  1J3T A;  2JOY A;  1WHK A;  1YI2 A;  3L2Z A;  1RAE B;  4PJO G;  1E7P A;  2QA4 T;  4M77 C;  3GBQ A;  1C6V X;  2H8H A;  3E19 A;  4PJJ A;  3BW1 A;  2JW4 A;  2ESW A;  5LJ3 d;  3JB9 G;  1PD0 A;  1H3Z A;  3QO3 A;  3NTH A;  2EQK A;  3QWX X;  4RG8 A;  1PNJ A;  1UGP B;  1NM7 A;  4BCP B;  2NYS A;  1W1F A;  2KQW A;  4C5E A;  2F5K A;  5CIU A;  3RR6 A;  2DTI A;  4JJC A;  2BS4 A;  5AYF A;  3VJP A;  4C92 B;  1AZG B;  2G77 A;  4JS5 A;  5CVI A;  2EGE A;  1QVG S;  4VUB A;  3CCE Q;  1IXD A;  3EGD B;  1W98 B;  1VQO Q;  1PD1 A;  1JJ2 P;  5IDN B;  4BI8 B;  2DFU A;  2PUO B;  4KGX B;  3CCQ A;  4UC4 A;  3RKY A;  3PT9 A;  1A0N B;  2FG0 A;  1QLY A;  1M1K R;  3CBO A;  1VQP A;  1N8R U;  4CFU B;  2IW6 B;  1QCF A;  2FB7 A;  1NJI C;  1GBR A;  4PKC C;  1B3Q A;  4BCQ D;  1AWO A;  4ZGD B;  3PMT A;  1G3W A;  2DL5 A;  2CSI A;  1G8X A;  2K7A A;  4ELL A;  1BYM A;  4RG2 A;  1KJW A;  3WVE B;  4IUQ A;  4PJO E;  3H0F A;  2DL7 A;  2OTJ Q;  1H3H A;  4ZTF A;  1BCO A;  1HK9 A;  5LJ5 e;  3CMA Q;  4M75 G;  2MI6 A;  1VQ9 T;  2IN3 A;  2F1L A;  1B34 A;  4EMK C;  3LW5 E;  3CCM T;  2KK4 A;  1C1A A;  3OS5 A;  4JZ4 A;  5KH6 A;  1D09 B;  3CPW P;  2D6F A;  2MK5 A;  3LGL A;  4AFZ C;  4M7D E;  1OX9 A;  2BZY A;  3CCV T;  1QCO A;  4F7U B;  2RHY A;  4J9D A;  3H0H A;  2CKK A;  1PHT A;  1G2B A;  3SWN A;  3POM A;  2RB6 A;  4EOJ B;  1X6O A;  3CPF A;  1H8K A;  4BY6 B;  2EW3 A;  2RQV A;  2JS0 A;  1ABO A;  2EYX A;  4TVR A;  4Q5W A;  4LE9 A;  5LMK B;  4EOS B;  2PU9 B;  1ZA2 B;  3PE0 A;  3Q1J A;  2WJ9 A;  4FL6 A;  2M0Y A;  4FW1 A;  2V1Q A;  2DBK A;  4OGE A;  3UWN A;  3CC4 T;  2K57 A;  1JSU B;  1FMK A;  2HCK A;  1KHC A;  1SRM A;  1XJW B;  3EJ1 B;  3EID B;  1VQ5 A;  1VQL A;  3G4S A;  1Y0M A;  2VGM A;  1KC8 U;  1T3L A;  2I2L A;  3CCR Q;  5BNJ B;  4M75 E;  4FYX B;  4QVZ A;  3RKW A;  3AT1 B;  2XD0 A;  5LJ3 e;  1HSQ A;  4YOZ A;  2QQR A;  2CZ1 B;  1U8R A;  4BUG A;  4C8Q A;  3VS1 A;  4RTY A;  1WYX A;  1FKM A;  2LT4 A;  3E1S A;  2DBM A;  4LD9 K;  2EWN A;  4WCI A;  3MCA B;  1D0X A;  4ZN3 A;  2RQW A;  2PUK B;  3DB4 A;  4O5V A;  4G6L B;  1W4S A;  2RK1 A;  1TFB A;  1K73 C;  3QWL A;  1EZZ B;  5FLX E;  3SB2 A;  8ATC B;  2KVQ G;  2QDY B;  4EC8 B;  1KQS P;  2DNU A;  4HNT A;  1RLQ C;  4YOO A;  2F2V A;  2AZV A;  3NGP A;  2WFY B;  1H64 1;  1VQ7 Q;  1YIT T;  3LWI A;  1ZSZ C;  4II5 B;  3CCJ T;  2E4H A;  1NJI R;  2DRM A;  3QYB A;  4ELZ C;  4CC7 A;  5IXB A;  3JB9 F;  4FT2 A;  1ACM B;  4M4Z A;  4OB2 B;  4CXA B;  1Q86 U;  4JX6 A;  2OAW A;  2V22 B;  5ECA A;  2XDB A;  4J5Y A;  3RBB B;  4QKU A;  2HBP A;  3M0U A;  4BDZ A;  3HL8 A;  2EKO A;  2OTL A;  2XIC A;  4KH1 B;  1AHJ B;  3DDQ B;  2KRN A;  3BDU A;  4PNO A;  2DME A;  1WJR A;  2LQN A;  3MET A;  4A4F A;  4DEY A;  4BE1 A;  3CBM A;  4BI4 A;  2ZCF B;  2RH2 A;  2QK0 A;  2QGS A;  2BPM B;  1YIJ A;  4PJO D;  3EGU A;  2EQU A;  3TW7 A;  3MO8 A;  1XNI A;  1AWX A;  1B34 B;  3EOC B;  4FYY B;  1Q82 C;  3HSB A;  3JB9 D;  5GAN g;  3CBP A;  1TH7 A;  1LCK A;  4ROE A;  2DET A;  1AD6 A;  3THK A;  4BY7 X;  4EMH A;  1TS9 A;  4M7D D;  3SWN B;  3MP8 A;  3CCM A;  3RNJ A;  2DJQ A;  2JZ2 A;  1K9M C;  2QTX A;  1JOW A;  3GTM S;  2RM4 A;  1UEB A;  1D3B A;  1M30 A;  2KYB A;  4M75 F;  3PNW C;  4KGV B;  1I81 A;  4R55 A;  1OPK A;  4CFM B;  1OOT A;  2BZX A;  5EG2 A;  1Y57 A;  2DYB A;  2KNB B;  4M78 G;  4ELY C;  4X9C A;  1N8R C;  4FW2 A;  4BBR M;  2X4Y A;  4RTU A;  4MML A;  2FRW A;  1KQ1 A;  2L3P A;  3CC7 T;  4M77 A;  1G3S A;  5IHY A;  3CC4 A;  2KRO A;  2ZAE A;  1IO6 A;  2G6F X;  2L3S A;  4M75 D;  1WQW A;  1WX6 A;  3JCM J;  2MYS A;  2LJ3 A;  2AKL A;  4C8Q B;  2FYK A;  3VS2 A;  1RAB B;  4FM4 B;  2QQS A;  3U23 A;  2WSF E;  1Y07 A;  2RHX A;  1K73 R;  1VOL A;  1WHL A;  2QQ9 A;  4B9X A;  2RJF A;  3L1A A;  3RUX A;  2AHJ B;  2QEX Q;  1PC0 A;  2ZPF B;  2K79 A;  4J7F A;  3VKG A;  2A0F B;  4K11 A;  4ELJ A;  3M58 A;  4OVA A;  2GQI A;  1URC B;  2R58 A;  1YJW T;  1VQM Q;  1BU2 A;  2QDJ A;  4BCN B;  2JXB A;  2M9U A;  4BCK B;  2JM9 A;  3MEU A;  4IKF A;  1N9S A;  3CCE A;  1GUX A;  5A0L A;  3A8G B;  4LDV A;  4JJN K;  2K5I A;  1VQO A;  1ZUK A;  3CC2 Q;  4M78 E;  4L5G A;  1KSW A;  2KR3 A;  4OR5 B;  3EG1 A;  1I4K 1;  3S3O A;  1YIT A;  4F6U B;  1QW1 A;  3HRS A;  1H26 B;  4AI6 A;  3O5Z A;  3OW2 S;  4J6W A;  3RKX A;  1NYG A;  5HK0 A;  3EAE A;  4J8O A;  4M7A F;  1WI7 A;  1H25 B;  5HNB B;  1TG0 A;  1Q82 R;  1KC8 C;  3IQL A;  2OTJ A;  4BCM D;  3V7S A;  2GTJ A;  1PM3 A;  5FU7 C;  3L42 A;  2CSQ A;  5CKD A;  2IW9 B;  3CMA A;  1G3Y A;  5HCK A;  2CT3 A;  3FB9 A;  1UDL A;  4C0D C;  4C0F A;  1K9M R;  2CRE A;  3LGF A;  4XTW A;  1K0X A;  2XID A;  1M2V A;  2P4R A;  1YJN Q;  1EFN A;  5EC7 A;  1R8O B;  3T9N A;  3M0S A;  1VQ4 T;  2R7G A;  1OZ3 A;  4HCB A;  1D3B B;  1M3C A;  5D7U A;  3JAM E;  2X4X A;  2LMJ A;  2QF7 A;  4Y91 A;  2DXT A;  2IW8 B;  4LDY A;  3TEE A;  4X9D A;  2GGR A;  4IIM A;  3VS0 A;  4YTL A;  1QQJ A;  1N8R R;  2KI7 A;  2UZD B;  2HKQ B;  5CYI B;  2EQI A;  6AT1 B;  4PJO C;  4KUL A;  1T3S A;  4HCK A;  5LJ5 j;  4RUG A;  4NOY A;  2DIQ A;  2KXC A;  3WXM B;  3JB9 I;  1X43 A;  4WF2 A;  4QSH A;  3CCR A;  2JM8 A;  4M77 B;  3JCM d;  2O01 E;  3WVD B;  2WSE E;  5FW9 A;  3OYK A;  3CXC P;  4E6R A;  2E5K A;  1TWB A;  4JRI A;  4PJL A;  2K6D A;  4HL4 A;  4M7D C;  3VUZ A;  2EQM A;  2HQE A;  1D1C A;  4OB1 B;  5FWB A;  4XTZ A;  1GL5 A;  3QYH B;  3HKS A;  2QEX T;  1YI2 T;  4E7Z A;  1OZ2 A;  4NL3 A;  3L2R A;  4ROC A;  2WSC E;  2RJC A;  4OMP A;  2LDM A;  4F17 A;  2LJ0 A;  2C4G B;  4M78 F;  1VQM T;  1Q81 U;  5J39 A;  1EIF A;  4X34 A;  4XTX A;  2JMA A;  4MDW A;  1K8A U;  4OP0 A;  4E7H A;  3A8O B;  2Y4X A;  2EJF A;  1RAG B;  3VKH A;  1VQ6 Q;  3K7A M;  1ZSZ A;  5ACB A;  1X69 A;  1MNE A;  2BS2 A;  1BB9 A;  4YOS A;  2KAF A;  3V7R A;  2DL8 A;  4QVC A;  5GMK i;  1GUX B;  1VQ7 A;  1OL1 B;  4F6W B;  5IHI A;  1GH6 B;  2ECZ A;  1NZ9 A;  2PVO B;  1WNL A;  2W2H A;  1U06 A;  2AT1 B;  4MDX A;  1OYX A;  2FVU A;  2YLC A;  1S72 Q;  3KFV A;  4F7U G;  4M75 C;  2I40 B;  1M4Z A;  3BLR B;  4EOO B;  2EKH A;  4M78 D;  4R0K A;  1Q7Y U;  1KC8 R;  1LNX A;  3TNH B;  5J3B A;  1TUD A;  3V8J A;  2QG9 B;  2A08 A;  1H1S B;  2K4Y A;  5HY6 A;  5FU6 C;  2L8D A;  1K0S A;  2EPD A;  3HRT A;  1N27 A;  4JZ3 A;  3OYI A;  5GAM h;  2X35 A;  2Y4Y A;  4EOP B;  5LJ3 h;  3M0Q A;  1IRE B;  3R6N A;  2VXE A;  4OMF B;  2C06 A;  3QHW B;  2QGG A;  3I56 Q;  1YJN T;  1NG2 A;  2L5Q A;  2XI9 A;  2KT8 A;  2GCX A;  1WXB A;  3EG0 A;  2NUZ A;  3H0I A;  1M2V B;  5IT9 E;  4GY5 A;  2YUN A;  1ZX6 A;  4AG1 C;  1B7T A;  4PLL A;  3GIB A;  1U3O A;  3LH5 A;  2CP2 A;  2EYZ A;  2JTF A;  4F7U E;  4HNU A;  4BXX X;  3S3M A;  3QSU A;  2F5T X;  3HHT B;  1GCQ C;  4A4K A;  2I53 A;  2DLP A;  2GQV A;  4A4G A;  2R5M A;  2HBW A;  2NLU A;  1Y96 A;  1BCM A;  2EYY A;  3KBG A;  3F5X B;  1KG1 A;  2F2C A;  3L2Q A;  4ZN1 A;  1QWE A;  3FDR A;  3BG9 A;  1X6G A;  3BLH B;  1UNG D;  5IDP B;  2PK9 B;  2LQW A;  3JCM e;  2L2P A;  2DD5 A;  2W10 A;  2EVR A;  3OQ5 A;  2DVJ A;  4II1 A;  3KUF A;  4HCC A;  4KUD K;  1VQ5 T;  1VQL T;  3G4S T;  1OU9 A;  1BI3 A;  2L3Q A;  4FYW B;  3A8M B;  4XU1 A;  4EOL B;  4DBH A;  5C0M A;  2EQJ A;  2VYT A;  2EGC A;  2ZPH B;  2CZ0 B;  2LX9 A;  1E6H A;  4LUE A;  4QVD A;  3QZ9 B;  3UDC A;  1Z9Z A;  4HVW A;  1XO2 A;  2QI2 A;  1IHW A;  3E2U A;  4NS5 A;  3BLQ B;  2QEX A;  2M1H A;  3RDV A;  2COW A;  1KFZ A;  5GAM d;  1ZSZ B;  4BCG B;  4AFS C;  1V1C A;  2E1H A;  4C0G A;  1WHG A;  2HSE B;  4BAC A;  1RAC B;  1VQM A;  2WHB B;  4JLG A;  1PSF A;  2ZPG B;  3G7Z A;  1IRX A;  2BKD N;  1M2O A;  2JS2 A;  3CCU Q;  1LOJ A;  4Z6Y A;  1YNZ A;  4M7D G;  3CEY A;  4F7S B;  3CC2 A;  2O2O A;  3C95 A;  2O9S A;  4EIK A;  3HRU A;  3QII A;  1RUW A;  4C92 D;  3MPU B;  2KGT A;  2ROL A;  1HXD A;  5CAI A;  1UJ0 A;  4LUD A;  2HSP A; 
#chains in the Genus database with same CATH homology
 2K5F A;  3CCJ T;  2OTL T;  5GAN 6;  3QYB A;  4ELZ C;  3HBL A;  3JB9 F;  4FT2 A;  2KMG A;  1M9S A;  4OB2 B;  4CRI A;  1P92 A;  4JX6 A;  2R57 A;  4C0Z A;  2KMT A;  4EMK B;  4BE1 A;  1Q86 U;  2XDB A;  4J5Y A;  3FRN A;  1N6A A;  1YCY A;  4M78 A;  5KCH A;  2G3R A;  5L8R E;  2HBP A;  5GAM g;  4MZM A;  4BDZ A;  3HL8 A;  5GAN j;  3TCJ A;  2EKO A;  2GF7 A;  3CCJ A;  3OYD A;  2OTL A;  5CKF A;  2XIC A;  2A3L A;  1YIJ T;  2DD4 A;  1AHJ B;  2DTO A;  4MFD A;  3M59 A;  3OYB A;  3BDU A;  4HLQ A;  4PNO A;  4E7L A;  1WJR A;  2DXB A;  2KR6 A;  3QPH A;  4A4F A;  3MET A;  2EJG A;  3EFS A;  4XU2 A;  3SDZ A;  4N0A A;  1JJ2 S;  1NE8 A;  1MHN A;  3CBM A;  3P8B B;  1NPP A;  3H8Z A;  2LRQ A;  4BI4 A;  2ZCF B;  2RH2 A;  4ZGJ B;  1BKB A;  4E7I A;  2DIG A;  2HQX A;  1YIJ A;  2BIV A;  2LCC A;  3C4S A;  1FWZ A;  4XU3 A;  4PJO D;  2PQW A;  2EQU A;  3TW7 A;  1YJN A;  3MO8 A;  4JX5 A;  4EMG A;  1XNI A;  3CD6 A;  3AHU A;  2DAQ A;  1B34 B;  1Q82 C;  3HSB A;  1KQS A;  3JB9 D;  1QLB A;  3MP1 A;  5GAN g;  4ME7 A;  4AKH A;  2D9T A;  2DEQ A;  4C8Q G;  4M78 C;  3CBP A;  4M77 F;  3OYH A;  1KD1 U;  1GXI E;  2XKO C;  2QQA A;  2EFI A;  4A4E A;  2LVM A;  5GMK j;  1TH7 A;  3HFO A;  3QJY A;  3GPL A;  3GOX A;  4O6J A;  3L2U A;  1BI1 A;  5CQY A;  3C94 A;  3G6E T;  2E41 A;  2ZPB B;  3MEA A;  5CK9 A;  4QQG A;  4EMH A;  4MDX A;  1Y96 B;  2RO0 A;  2FL7 A;  3OSV A;  3SWN B;  3MP8 A;  2YHT A;  3CCM A;  4HCZ A;  4M7D D;  2JZ2 A;  2IG0 A;  3H6Z A;  4M7A D;  4RCC A;  5KCO A;  1K9M C;  4XTU A;  1QVF S;  2QTX A;  1OI1 A;  1MGQ A;  2L89 A;  3S3N A;  1YHQ T;  3RER A;  2RM4 A;  1UB4 A;  3C12 A;  3VV0 A;  1UEB A;  3PTA A;  1D3B A;  2RI5 A;  2XU8 A;  1LJO A;  4M75 F;  3J7A F;  2DD5 B;  4RCB A;  3PNW C;  3OS1 A;  3CPW S;  2DVE A;  1K73 U;  1YHQ A;  4QW2 A;  4KT0 E;  1I81 A;  2XK0 A;  2PVD B;  3JSC A;  4R55 A;  3JB9 J;  5GAN 2;  1I5L A;  4AKI A;  5CKE A;  3OYL A;  5EG2 A;  1M8V A;  4J6Y A;  3L2V A;  2Y90 A;  2HNI A;  2CZ7 B;  4JUV A;  3P8H A;  5A0G A;  3DLM A;  4M78 G;  3LYI A;  3SWN C;  4ELY C;  1BIA A;  3LWI A;  3RMS A;  5M9O A;  4X9C A;  2P0K A;  1N8R C;  4BBR M;  2X4Y A;  3M54 A;  3OYF A;  3VU3 C;  4BBS M;  3GLX A;  3LX7 A;  4MML A;  2IVW A;  4JLI A;  1M1G A;  3URG A;  1KQ1 A;  3CC7 T;  4M77 A;  1VQ6 T;  1G3S A;  2M0O A;  3RMQ A;  3CC4 A;  2DPP B;  4C92 F;  1ZBX A;  5GAM e;  4BDY A;  3L2W A;  1VQN A;  1VQK T;  4C8Q E;  1VUB A;  2H3J A;  3GNF B;  4M75 D;  1WQW A;  2CYZ B;  2JVV A;  5LJ5 h;  2LNV A;  3JCM J;  4LDX A;  3QYE A;  3MEW A;  3M9Q A;  4C8Q B;  1X01 A;  2FYK A;  3JCM V;  4FM4 B;  2MWO A;  4A4H A;  2QQS A;  1BI0 A;  3QUI A;  3V8K A;  3CC7 A;  2WSF E;  4E7J A;  1Y07 A;  2RHX A;  3OYY A;  1Y71 A;  3JCM c;  5GAN 8;  2RHI A;  3OS0 A;  3SD4 A;  2QQ9 A;  1S72 T;  4B9X A;  4XU0 A;  5A2Q E;  3VYG B;  2RJF A;  4Z02 A;  3RES A;  4M75 A;  3L1A A;  3KHI A;  3RUX A;  2AHJ B;  2DXU A;  5IAY A;  4RMO A;  2ZPF B;  2WAC A;  3QBY A;  4IUT A;  1Q82 U;  4J7F A;  4MIM A;  3VKG A;  3CCE T;  4ELJ A;  3MEV A;  5GAN e;  1X75 C;  3M58 A;  4OVA A;  2YRV A;  1FXX A;  4LDW A;  1WGS A;  2DZC A;  2A7Y A;  1VQO T;  2R58 A;  1S72 A;  4E7K A;  1YJW T;  3OB9 A;  4DOW A;  2JUF A;  2CZ6 B;  2QDJ A;  3ER0 A;  4QQ6 A;  1G5V A;  3M4Y A;  5I21 A;  3JB9 H;  2M9U A;  2E70 A;  2VV5 A;  4PJO F;  3OYA A;  4JX4 A;  3P8D A;  2O4X B;  3MEU A;  3MP6 A;  2GFU A;  5FU7 B;  1N9S A;  5GAO n;  3CCE A;  4IKF A;  4DOV A;  5A0L A;  5A0D A;  3A8G B;  3OYM A;  1K9M U;  3ME9 A;  4LDV A;  3DLL A;  4JJN K;  2K5I A;  1VQO A;  1YJW A;  4M78 E;  3GP8 A;  5CKB A;  4L5G A;  3I56 T;  4M78 B;  4C0D B;  2QQ8 A;  1RL2 A;  4C92 A;  5GAN 5;  1I4K 1;  1ZHI A;  5FRO A;  3CCL T;  5LJ5 f;  3S3O A;  1M5Q 1;  3CCQ T;  1YIT A;  4HNV A;  1M90 U;  1KQS S;  4HT9 A;  1QW1 A;  3HRS A;  3OW2 S;  1UGS B;  4AI6 A;  4B9W A;  3QXE B;  4IUR A;  4J6W A;  5GMK e;  5CAI A;  3GNG A;  4NL2 A;  3HFN A;  3RKX A;  5HK0 A;  3EAE A;  2DD4 B;  4J8O A;  1VQP T;  5GMK m;  4M7D F;  4M7A F;  1QVP A;  3FEO A;  3M53 A;  5I2M A;  4F7U F;  1VQ6 A;  2ZPE B;  5EJC A;  3NTI A;  5GAN 3;  3CMA T;  2MWP A;  3I56 A;  2DXB B;  3CCU T;  5GMK l;  1NPR A;  4C5I A;  1KC8 C;  2RK2 A;  2OTJ A;  3V7S A;  5D6X A;  5DLQ E;  1JRI A;  5FU7 C;  3L42 A;  1QP3 A;  4J83 A;  5CKD A;  3KXT A;  3JCM P;  2QFZ A;  4A53 A;  2FHD A;  3E9F A;  4OGC A;  3S6W A;  1W2B S;  1Q81 C;  3O8V A;  3CMA A;  3M56 A;  3HZJ A;  1G3Y A;  3J81 E;  5GAO p;  3QDR B;  3QKJ A;  1K8A C;  3FB9 A;  4BE2 A;  4C0D C;  3A8H B;  4LOC A;  1QVG A;  1M1K C;  3JCM b;  2K5L A;  3JCM f;  2E12 A;  4J7I A;  2EYQ A;  4QQD A;  2R5A A;  4XTV A;  2KDS A;  2LC4 A;  2QXF A;  4C0F A;  5LL6 S;  4C5H A;  5KE3 A;  3LGF A;  2RI3 A;  2LQK A;  2PVG B;  2RI2 A;  4XTW A;  4L6V 5;  4XTY A;  4HA8 A;  2K2V A;  2P0Q A;  4PJO A;  2XID A;  3BG3 A;  2DXC A;  4LD6 A;  4OB0 B;  2LTO A;  4JRQ A;  1R8O B;  2V8J A;  4FIB A;  2X4J A;  3HB9 A;  4GLK A;  3T9N A;  3PIO A;  2V8K A;  4JS4 A;  4OB3 B;  4N0A C;  3EFR A;  1VQ4 T;  3UT1 A;  4J6X A;  1OZ3 A;  3ZFJ A;  2M16 A;  1SSF A;  1D3B B;  3DL1 A;  3FIF A;  5LJ5 d;  4HCB A;  3G6E A;  2RA2 A;  5I2S A;  3JAM E;  1UGQ B;  1O9S A;  2BUD A;  2X4X A;  3NTK A;  2DO3 A;  3PIP A;  2QF7 A;  1QP2 A;  1U1T A;  4Y91 A;  1UGR B;  5FRM A;  4MFE A;  2DXT A;  4M7D A;  1Q7Y C;  4LDY A;  4M7A A;  4LDU A;  3TEE A;  4X9D A;  2HAX A;  2XHC A;  4F7U A;  1VQ4 A;  4ZGE B;  4C8Q F;  1JJ2 A;  4YTL A;  4JRP A;  3N5B B;  5GAM f;  1VQ8 T;  4V2S A;  3CCR T;  3PMI A;  1I8F A;  5LJ3 f;  2E10 A;  3X24 B;  4N4I A;  4KUL A;  3JCM W;  4PJO C;  4KBM B;  3VKI A;  5LJ5 j;  4D6W A;  2D0Q B;  4XAX B;  2LT1 A;  4NOY A;  5KE2 A;  2DIQ A;  3ZBD A;  3X25 B;  3QZ5 B;  3WXM B;  3JB9 I;  1VIF A;  1WPY A;  5DM7 R;  1KHI A;  4M77 E;  4WF2 A;  1RI0 A;  4QSH A;  2DJZ A;  1VQ8 A;  3CCR A;  4M77 B;  4Y28 E;  3JCM d;  2CGH A;  2O01 E;  3WVD B;  2WSE E;  3OYK A;  3BDL A;  2QQB A;  4AKG A;  4BB7 A;  4JRI A;  1FX7 A;  4C5G A;  1WJQ A;  3INZ A;  4HL4 A;  4M7D C;  3VUZ A;  2EQM A;  2HQE A;  2EAY A;  3JCM Q;  4M7A C;  1YBY A;  4BI3 A;  4OB1 B;  5GAN f;  3RIR A;  5GAN 7;  2ZGW A;  4XTZ A;  4BD3 A;  2ZPI B;  4RKU E;  3QYH B;  3HKS A;  4N4G A;  4MMK A;  3OYN A;  3M55 A;  3R6O A;  1VIE A;  3JRZ A;  1BIB A;  1OZ2 A;  2X4W A;  4C8Q D;  5LJ5 g;  4DA4 A;  3BG5 A;  3F70 A;  4NL3 A;  3L2R A;  1VQK A;  3GF5 A;  2DZ9 A;  2WSC E;  2YLB A;  2RJC A;  2XDP A;  5D6W A;  3CPW A;  2LDM A;  2MAM A;  4M75 B;  2E5Q A;  3E9G A;  5HK3 A;  4M78 F;  3QYG B;  3JCM X;  2CS7 A;  1VQM T;  1Q81 U;  3OYE A;  5J39 A;  1EIF A;  3X28 B;  4X34 A;  4XTX A;  4MDW A;  1ZQ1 A;  2JOY A;  1YI2 A;  3L2Z A;  3CCU A;  4OP0 A;  3M5A A;  1K8A U;  4E7H A;  3A8O B;  2Y4X A;  3J80 E;  4PJO G;  1VQ7 T;  1E7P A;  4PLI A;  2EJF A;  4M77 C;  2QA4 T;  5CO7 A;  3VKH A;  3E19 A;  3MHX A;  5FU6 B;  3BW1 A;  2ZZD A;  2RHU A;  3OYG A;  5LJ3 d;  2BS2 A;  2VUB A;  2KAF A;  3JB9 G;  4M6V A;  3JCM h;  4EPC A;  1H3Z A;  1DJ7 B;  3V7R A;  3OSS C;  3QO3 A;  3NTH A;  2EQK A;  4MZP A;  3DKM A;  4RG8 A;  4QVC A;  5GMK i;  1VQ7 A;  3VYH B;  2RD1 A;  1UGP B;  2MMP A;  2XG8 D;  3I55 T;  2QA4 A;  3JCM g;  2KQW A;  4C5E A;  1NZ9 A;  2F5K A;  5CIU A;  1PSE A;  2PVO B;  2DTI A;  4CI0 C;  3CXC A;  1WNL A;  1XOV A;  4KUI A;  3CME T;  2BS4 A;  5AYF A;  1OYX A;  2FVU A;  2YLC A;  3VJP A;  4C92 B;  4F7U G;  5DLO A;  4M7A G;  5GAO r;  4M75 C;  3LH0 A;  1M4Z A;  2F69 A;  2DK3 A;  2G77 A;  4JS5 A;  2JNG A;  2KY9 A;  4M78 D;  1Q7Y U;  5CVI A;  3FC3 A;  1LNX A;  4ZTJ A;  1QVG S;  1IZ6 A;  4VUB A;  5J3B A;  2QEX T;  2RHZ A;  3V8J A;  3V8L A;  3OMC A;  1WQ7 A;  2JN0 A;  2K4Y A;  5FU6 C;  2L8D A;  5HY6 A;  1O75 A;  4BI8 B;  3HRT A;  1XTD A;  1N27 A;  2PUO B;  3OYI A;  3CCL A;  5CKH A;  5GAM h;  3OMG A;  4FU6 A;  3CCQ A;  3BY7 A;  1YJ9 T;  2X35 A;  2Y4Y A;  4UC4 A;  3RKY A;  3PT9 A;  4EMK A;  5LJ3 h;  1BI2 A;  1IRE B;  3CBO A;  4M77 G;  2GFA A;  1VQP A;  1N8R U;  4JDS A;  4L59 A;  3LWH A;  2FB7 A;  1NJI C;  4PKC C;  4E47 A;  2VXE A;  4ZGD B;  3PMT A;  4OMF B;  5LJ3 g;  4A54 A;  2C06 A;  1G3W A;  4DQ2 A;  3OS2 A;  1BYM A;  1YJ9 A;  4RG2 A;  4C92 C;  3QHS A;  1YJN T;  2DTH A;  2DKG A;  3WVE B;  2VC8 A;  3A5Z B;  4IUQ A;  3CD6 T;  3SFM A;  4PJO E;  3A8L B;  2L5Q A;  3LLR A;  2XI9 A;  2GCX A;  2E6Z A;  2VXF A;  1G3T A;  4XK8 E;  4PJO B;  4NC6 A;  3X26 B;  1JB0 E;  2OAU A;  4ZTF A;  5GAO q;  2JTM A;  2DXC B;  4FSX A;  5IT9 E;  4GY5 A;  5GAN h;  1HK9 A;  3OBW A;  5LJ5 e;  4M75 G;  2EIF A;  5GAO m;  2MI6 A;  2E6N A;  2E64 A;  3G71 T;  1VQ9 T;  3NFC A;  4PLL A;  3GIB A;  1B34 A;  5GAO l;  4OF1 A;  4EMK C;  2K3X A;  3TU4 K;  3LW5 E;  3CCM T;  3OW2 A;  2KK4 A;  3V7C A;  3OS5 A;  5KH6 A;  2D6F A;  3QJ6 A;  3LGL A;  4M7D E;  2LCL A;  4M7A E;  2JTF A;  2P0P A;  3X20 B;  4HNU A;  4F7U E;  3S3M A;  4M7D B;  4XQ3 A;  3G71 A;  3CCV T;  3QSU A;  4M7A B;  5HKC A;  2F5T X;  3HHT B;  4FT4 A;  4P5N A;  4F7U B;  2RHY A;  3BFM A;  1YI2 T;  4A4K A;  1VQ9 A;  2GQV A;  4A4G A;  5FRN A;  2CKK A;  2R5M A;  1Y96 A;  2NLU A;  1KG1 A;  1V29 B;  3KBG A;  4PL6 A;  3SWN A;  2RB6 A;  2RJD A;  3L2Q A;  4ZN1 A;  2K3Y A;  1X6O A;  3CPF A;  3FDR A;  3BG9 A;  4BY6 B;  3OY9 A;  1Q86 C;  5CR2 A;  1W2B A;  5GMK h;  3CCV A;  4MZT A;  4IUV A;  4IUP A;  4C92 G;  1XQH A;  3JCM e;  3UPU A;  3TRE A;  4TVR A;  1M90 C;  2DD5 A;  1WJS A;  3OQ5 A;  3QG1 A;  4N4H A;  4IUU A;  4Q5W A;  3PFS A;  4II1 A;  3KUF A;  2RJE A;  4HCC A;  1VQ5 T;  4KUD K;  1VQL T;  4HT8 A;  3G4S T;  2PU9 B;  4JRK A;  3M57 A;  3FLG A;  1U1S A;  5IN1 A;  3Q1J A;  2MF2 A;  1BI3 A;  4M77 D;  2WJ9 A;  3HP9 A;  4FL6 A;  3A8M B;  4XU1 A;  4OGE A;  4HKE A;  3UWN A;  3CC4 T;  4ATO A;  2K57 A;  3OYJ A;  1QVF A;  1VQN T;  5D6Y A;  1JBM A;  5C0M A;  2EQJ A;  2V8I A;  2VYT A;  1KHC A;  5CCA A;  3HPW A;  2XDD A;  2ZPH B;  1M1F A;  1VQ5 A;  1VQL A;  3G4S A;  3FJP A;  2CZ0 B;  2LQ8 A;  2LX9 A;  2VGM A;  4QVD A;  1KC8 U;  2BS3 A;  2I2L A;  3OYC A;  4BE0 A;  1Y7X A;  3QZ9 B;  4M75 E;  4BY6 C;  3DB3 A;  3UDC A;  3OA6 A;  3M4G A;  3TW6 A;  4QVZ A;  2EJ9 A;  3CME A;  1KD1 C;  2QI2 A;  3RKW A;  3CXC S;  1NJI U;  4NS5 A;  5C6S A;  2XD0 A;  5LJ3 e;  2QEX A;  2QQR A;  2L3R A;  2M1H A;  2CZ1 B;  1U8R A;  4BUG A;  4C8Q A;  1M1K U;  5GAM d;  2HD0 A;  1FKM A;  2ZZD B;  3CCS T;  2LT4 A;  3E1S A;  4EDU A;  2E1H A;  4LD9 K;  2EWN A;  4C0G A;  3MCA B;  2KSS A;  3CC2 T;  4BAC A;  1VQM A;  4ZN3 A;  4JLG A;  5GAN 4;  5J26 A;  3ASK A;  2P4T A;  2PUK B;  1PSF A;  3DB4 A;  2E65 A;  2ZPG B;  4O5V A;  3VYG A;  3G7Z A;  2BKD N;  1W4S A;  2RK1 A;  1LOJ A;  4Z6Y A;  5DY9 A;  3CCS A;  3PGG A;  1K73 C;  4C92 E;  3QWL A;  4M7D G;  5FLX E;  1KQ2 A;  2VGN A;  3CEY A;  3OBY A;  3SB2 A;  2KVQ G;  2QDY B;  5GAM j;  3CC2 A;  3C95 A;  4HNT A;  5LJ3 j;  4R56 A;  3ZEH A;  2OTJ T;  3HRU A;  3QII A;  3I55 A;  4C92 D;  5CQX A;  5GAN d;  1N9R A;  3HO8 A;  1H64 1;  2B8A A;  4C8Q C;  2O4X A;  1YIT T;  1HXD A;  3H4C A;  3VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...