2QDYB

Crystal structure of fe-type nhase from rhodococcus erythropolis aj270
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title High resolution X-ray molecular structure of the nitrile hydratase from Rhodococcus erythropolis AJ270 reveals posttranslational oxidation of two cysteines into sulfinic acids and a novel biocatalytic nitrile hydration mechanism
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2qdyB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2qdyB02
3A8GB 1JB0E 4ZGJB 2DD4A 3X24B 2WSCE 1AHJB 2ZPBB 4RKUE 3HHTB 4Y28E 2CZ6B 1QP2A 1V29B 2DD4B 4XK8E 1UGPB 2WSEE 4L6V5 2PUOB 4OB2B 3WVEB 2WSFE 2ZPFB 2DPPB 2CZ0B 2ZPIB 2O01E 4ZGDB 3X28B 4ZGEB 3WVDB 3X26B 2AHJB 2PVGB 3A8MB 3A8OB 3QXEB 3X20B 3QZ9B 5L8RE 2ZPEB 2ZZDA 4KT0E 2DXBA 2CZ1B 3VYGA 1IREB 3A8LB 3QZ5B 2ZPGB 2ZZDB 2PUKB 2ZCFB 4OB0B 2DXBB 2QDYB 1PSFA 2CZ7B 4FM4B 4OB1B 3A8HB 4OB3B 3QYHB 2PVOB 2DXCA 1DJ7B 2D0QB 2PU9B 3VYHB 1UGQB 3X25B 2PVDB 2DD5A 1PSEA 3QYGB 1GXIE 2CYZB 1UGSB 1QP3A 2DXCB 3LW5E 1UGRB 2DD5B 2ZPHB 3VYGB
chains in the Genus database with same CATH superfamily
1E7OA 4II1A 4XTZA 3JCMc 1JXMA 3G1JA 3RNJA 2B8AA 5FRNA 2A0FB 4OGCA 4C5GA 2RK2A 4Z02A 5D6WA 1S72A 1E6HA 2Y90A 3MEUA 1LJOA 3NTHA 3JSCA 5HKCA 3EGXB 3I56T 3LWIA 2PTKA 3SB2A 1YWPA 2VXEA 4JUVA 2RPNA 3P8BB 2DA9A 3NTKA 4EOPB 3LH0A 3GNFB 3E2UA 1VIEA 2MYSA 5AYFA 4L6V5 2W9FA 3URGA 5D6XA 4EC8B 4K11A 1ZBXA 1KD1U 1YI2A 4DOWA 1QVPA 1TS9A 3PGGA 2CSIA 2ROLA 3O0GD 2MCNA 3VS2A 1OPKA 2AKKA 4M7AF 3CCJQ 3KXTA 4QQDA 4M7DB 1K76A 3OYMA 1K9MU 1WJRA 4EMKA 4FYYB 1ZA2B 1O9SA 4EPCA 2KYBA 1X2QA 3PMTA 4XTUA 1VQPQ 1ABQA 2GQIA 3LGLA 1BU2A 4NL3A 4F7LB 4X9CA 3LH5A 4Z88A 1MHNA 2WMAB 4F7UF 1ZBJA 1YIJA 1OX9A 2V26A 2MOXA 2RJDA 3RGFB 1K9MR 3HRTA 4EMKC 5GMKj 4LNPA 5A0GA 2DJQA 5D6YA 1VQ7Q 4FT4A 4PJOE 3DDQB 3JB9F 3V8LA 3M03A 2NUTA 3OSVA 1CKAA 4Z89A 2CCIB 4RTUA 4F70B 1KIKA 2MMPA 3EHRA 3V7RA 1N8RU 4BY7X 3UATA 1UFFA 3CC2A 2DTIA 4IIOA 3H9NA 1X6GA 4XU1A 4M78A 5CQXA 4DOVA 4JZ3A 2O31A 4FIBA 1MNEA 5LJ3g 3AT1B 1VOLA 2DO3A 4ATOA 1SF9A 4ZGJB 4FT2A 3M56A 5CQYA 1Y7XA 4BY6C 4N4HA 1TUCA 3JB9J 1N8RR 3CCRQ 1NYGA 2HAXA 2HEQA 5C0MA 1PCXA 2P4RA 1D3BB 2RHUA 4M78C 3I9QA 5KE3A 1V29B 1BIAA 3GOXA 1Q7YU 1F5QB 2EYYA 1G83A 1NG2A 5FU7B 1OIUB 1D09B 4M7AB 1W98B 4NS5A 2WSEE 1VQNA 1G3YA 1C1AA 3OYDA 4C8QA 3NDQA 3MO8A 2LTOA 2ZAEA 1IHVA 2GFAA 2XU8A 1IXDA 2FPEA 4HCKA 2WJ9A 2O01E 4FCYA 2RQWA 1TG0A 3CCEA 1D1CA 1Q7YR 1OL1B 4J9EA 4F7SB 4B6MA 3GF5A 1OOTA 4Z8AA 4F6UB 4F7UB 1ZUKA 2RI2A 3SHWA 1H3HA 2EQMA 4PJOD 3TCJA 3MP6A 2E3HA 5KYYB 2D1XA 3CPWP 3BG9A 4UC4A 3QUIA 2KRNA 2CCHB 2JTFA 1YN8A 2LP5A 1KHIA 1M3AA 2A08A 4M77G 4BCNB 3B57A 2B9RA 1WYXA 2LW4A 1BCOA 2BZYA 5LMKB 3PVLA 5I5ZB 3I56Q 4J9FA 2CZ7B 3TW7A 2M51A 2FB7A 5KE2A 3VS1A 2A3LA 3LWHA 1I5LA 4HVVA 2CP6A 1WHKA 4YOSA 1U1TA 2G6FX 4OMLA 2ROTA 3RERA 2COYA 1JKWA 1QVFA 3VU3C 1GBQA 3LW5E 2RHXA 1SSHA 5GAMg 3JRZA 5I11A 1Z9QA 4FW1A 3EGXA 1BB9A 2JN0A 3G4SA 1YJNA 3VKGA 3G33B 1GCPA 4J6WA 2CUDA 2D8JA 2K5LA 5KYXB 3GTMS 1ZLMA 3TVTA 4NSTB 4QQ6A 1YJ9A 2C4GB 3CCMA 1YITA 4DBFA 1QP2A 3QG1A 3FJPA 2QGSA 2BS4A 1RABB 2GNCA 2OAUA 3E9FA 3OYKA 1N9SA 2EJGA 2O88A 2YXYA 3A5ZB 4QQGA 2HQXA 2QTXA 2F69A 1UE9A 1D0YA 4OB2B 2K3XA 2XDBA 3M0SA 4G6LB 2BE7D 5FRMA 4M7DA 2MF2A 4AI6A 3PIOA 3TU4K 2YSQA 3MY5B 3M57A 3MKDA 1N27A 2RK1A 3Q1JA 1FINB 1X43A 4M77E 2EYQA 2RHZA 3NHNA 2K9GA 2IVWA 1QKWA 3I55T 2K2MA 1HSQA 3RESA 3A8MB 5CKHA 4BCFB 4JRPA 2LX7A 2QQBA 4PK4A 2BS3A 3CCUT 2LCCA 3MEAA 3EFOB 2QGGA 3EG9B 2M9UA 4ZTFA 4C5EA 3O5ZA 3PFSA 3LLRA 3TW6A 1W2BP 3CEYA 4AKGA 2LZ6B 2PNIA 5LJ3d 4DBHA 5I22A 2VYTA 3OA6A 1FVVB 4YC3B 2BKDN 3JAME 5M9OA 4KUDK 2DMOA 2DXBB 2QDLA 3C95A 2JNGA 4X34A 2JJ9A 5IXBA 4JJNK 3EHQA 4RCCA 3HFNA 1OGUB 1SHGA 2FHDA 3S3NA 3J7AF 3M53A 1UGQB 4AFSC 4IUQA 2EYXA 1D0ZA 4JDSA 2BZXA 4LD6A 2MPXC 2CYZB 3FLGA 2QA4A 2SEMA 1P5EB 1U06A 3ZBDA 2C5XB 1N5ZA 3VS5A 5GAN8 3QBYA 1WA7A 1MMDA 2QYZA 3INZA 3SWNB 1D3BA 1H1RB 1YCSB 4BCQD 2F1LA 3OYNA 5J3BA 1UUEA 4F7JB 1R0BG 4M7AA 2DBKA 1CKBA 1YP5A 2K4YA 5IHKA 3JCMb 3G71T 4LDUA 3GPLA 2E1HA 2C5OB 3V7CA 2ZGWA 1M2VB 1RACB 1VYUA 2XKOC 4BD3A 4M77D 3DDPB 5KYUA 2ESWA 1Z9ZA 2IIMA 5IH2A 1FXXA 2QK0A 4J9DA 5KCOA 3CCVQ 2RHIA 2RNAA 1KFZA 2RJFA 2CP5A 1JSUB 5FU7C 4M7AC 3M9QA 4F7UA 4XTXA 4OR5B 2C5NB 2HL5C 5KYYA 2FZKB 1QVFS 2F5TX 3JCMf 3CD6A 3LGFA 1WHGA 2DIQA 4JX5A 3TNWB 4XU3A 2HQEA 1C9BA 4O5VA 2XIDA 5I2SA 3ZEHA 2C5VB 3MI9B 3M4YA 4Q5WA 3POMA 2V8JA 2FRYA 2BPMB 5GAMd 1WJQA 2HKNA 1OZ2A 4DQ2A 1QLBA 1TH7A 2RQRA 1SG5A 2E64A 2QDYB 2AT1B 2YRCA 3MCAB 2RMOA 2X4WA 2KK4A 4QW2A 1RI9A 1X69A 1VYTA 1NZ9A 2KGTA 3JCMe 4LDWA 3EGDB 4A54A 2E12A 4DA4A 3RDVA 3EH2A 4PNOA 4N0AA 2FL7A 2OI3A 1GXIE 1QVGS 4C8QF 2YWWA 4BB7A 3NTIA 1EIFA 1K4US 1KQSP 2LQNA 3WXMB 1VQKT 1ZSZB 2COZA 3HTRA 2MIOA 2LT1A 5FU6C 2DD5B 5EFQB 3I55Q 2A36A 4YOZA 1IRXA 2FRWA 4BCHB 4LE9A 4A4FA 1GFDA 4N0AC 4AMCA 3VKIA 2MI6A 3CCUQ 1M1KC 1V1CA 3PT9A 1PNJA 2CH4W 1M90C 2KXCA 1AWJA 2MAMA 5L2WB 2R58A 4GLKA 4KGVB 2PK2A 1WXUA 2NUTB 1VQOA 5CKDA 2EKHA 4I3ZB 2B86A 4LD9K 1VQ9A 3UA6A 4BCMD 4C92D 3M54A 3CMAT 4PL6A 1M2OA 3EG2A 2OTJA 3RR6A 3KFVA 2QASA 3DLMA 2X35A 2RJCA 3IQLA 4JRQA 3EFOA 3EG9A 4ZGEB 2QEXT 3RBBB 1AWXA 2VWFA 5GANg 1D0XA 3G6EA 1VQ5T 2C06A 4AFUC 3OYAA 1VQ6T 3MP8A 2H3EB 2LDMA 2LJ3A 1G3NC 5CYIB 4RG8A 2M02A 4BE1A 2DYBA 4RTZA 1OPLA 2DXBA 2JZ2A 4EMHA 4LXCA 1FMWA 4LN2A 2GTOA 1TXQA 1WHMA 3QZ5B 1X6OA 4MZTA 4J9BA 1GCQA 3DOGB 1X75C 2GGRA 2L3SA 4IUUA 2KI7A 4BCJB 4AG2C 2ZZDB 4MZMA 2YUOA 1H92A 3G71Q 2O9VA 1OX8A 5LJ3h 1FX7A 4M6VA 2YLBA 3EGUA 4EORB 2FEIA 5GANf 1VQ8Q 6AT1B 4RODA 3PNWC 2RI5A 2UZDB 4CRIA 2GCXA 2C6TB 1VYWB 1S72T 1QMCA 3JCMX 2VB6A 3JCMd 4HCBA 1XJWB 3EFSA 1QCFA 2DZ9A 3QKJA 2XK0A 4E7ZA 1VQLA 4M7DF 3BY7A 3SWNA 3O8VA 3CCJA 1RAIB 4GY5A 1MV0B 2OTLT 2LJ0A 1G3SA 4MMLA 1VQMQ 3M59A 2UUEB 3L1AA 1AEYA 1M8MA 2VGMA 1TD6A 4AG1C 4CFUB 1WPYA 4F14A 4M75A 2KXDA 3HL8A 3A8GB 5CAIA 1JB0E 1YI2T 5GANe 1M3CA 1M2VA 1RAFB 1ZSGA 1VQPA 1YHQT 3C4SA 5HQ0B 4ELZC 4E7KA 3THKA 1M5Q1 4RKUE 3SWNC 3HRUA 3U23A 1RUWA 3OW2A 2PZ1A 3F70A 1MMAA 4BDYA 1T3SA 1WXTA 1UGPB 2VASA 4J9GA 1ZP2A 2GQVA 4UN0A 1VQ7A 1SRLA 2WIHB 2K3BA 2M0YA 1I1JA 3UT1A 2MWPA 3HZJA 3M5AA 1JJ2A 4QVCA 2NWMA 1H1QB 1YIJT 3TNHB 2E6ZA 2I40B 4KUIA 4HNVA 3M4GA 4M4ZA 2E65A 2IW9B 2PVGB 4OMQA 3QXEB 3META 2E41A 2AK5A 1JXOA 2QQAA 3T9NA 4CFMB 2L2PA 3EIDB 4EOSB 1R0CB 2CT3A 2I2LA 2J06A 2RH2A 3CC2T 2EQUA 3VYGA 3JCMQ 5CKBA 2D8HA 3V8JA 1N4MA 2QDJA 3EGDA 3CCQA 1LNXA 4JRIA 5GAMh 2WPAB 1W2BA 4OB0B 3BHVB 1M3BA 1ZUYA 2LQWA 9ATCB 2DRMA 1VYVA 1BI2A 1E7PA 2JMAA 4LDYA 1PC0A 1MUZA 2KY9A 2JOYA 3CCLQ 1ZSZA 1B34B 2EAYA 2DD5A 3OQ5A 1PSEA 2R5MA 4F7NB 4KRTA 2E5QA 2CP2A 3VS6A 3CMAQ 2D0NA 3MEVA 4A63B 2KYMA 3C94A 2LX9A 1VQNT 3PO3S 1WHLA 4BCPB 3HBLA 4L59A 5GMKm 2W2HA 1H1PB 2FVUA 2VVKA 3HKSA 3H0HA 4M78D 4EOMB 1ZSZC 1Q81U 1VQ5Q 1SHFA 5J26A 1VQ6Q 1BKBA 1KHCA 4TVRA 1X6BA 2E10A 3RKYA 4CFNB 5GANd 3VRZA 4E7SA 3L2QA 3H8ZA 1M1KU 3K7AM 3TN8B 4JLIA 1I0CA 1M90U 3I56A 2HD0A 4JX4A 3VJPA 2O4XB 3CC7A 2RA2A 1Q81R 4J5YA 5LJ3j 3BW1A 2E4HA 1VQ4T 5A2QE 2RM4A 3EG3A 3QO3A 1TU0B 4XU2A 1S72Q 2RN8A 1M1KR 4JJBA 1X27A 1M90R 2M1HA 3CCST 3CQTA 4D6WA 4JX6A 2FYKA 1LOJA 5GJVB 3A8OB 2YDLA 1FMKA 2OTLQ 2BKZB 3I35A 3BLQB 4AKIA 1NE8A 2ZZDA 5ACBA 5HK0A 2RJEA 5KYUB 4AFQC 1YHQQ 4BI8B 1ARKA 3OYCA 1WFWA 2KROA 1WQWA 1C6VX 4DEYA 2E5KA 1AD5A 2PUKB 5LJ5g 1NBEB 2K6DA 2NUZA 5EJCA 2NUPB 4C0GA 2CJMB 4KRDB 4FM4B 5GMKe 3OW2S 1QCOA 3UWNA 1D1BA 1YJNT 4C5HA 2PVOB 2G77A 4C8QC 2BUDA 4J9IA 2DILA 3QWXX 3X25B 2UZBB 3CCMT 1YITT 5FWBA 5KYWA 2DL8A 1D1AA 1IGQA 4F7UG 1PM3A 2IW8B 2DZCA 2DL3A 2RF0A 3VS7A 4HNTA 4BBSM 1JJ2S 5HBJB 3PTAA 5LJ5f 4MIMA 3AHUA 1BYMA 2HZYA 2GTJA 4LUDA 3JCMP 3REBB 1H25B 3JB9G 5ICPB 3RKWA 3CXCA 4C0ZA 4FYWB 2JMCA 3REAB 3UDCA 1YJWA 1OKVB 2UZEB 1E6GA 3I5RA 3KHIA 1PD1A 2AZVA 1TTHB 1I8FA 3MP1A 2CP3A 4RTTA 5HY6A 2CP7A 3P8HA 4EC9B 2MWOA 4RTVA 2L3RA 1AD6A 1OZ3A 5LJ5e 2X4XA 2PUOB 1TOVA 5GAMj 2ED0A 2DVEA 4E7JA 3NGPA 4HVUA 1UJ0A 2L89A 1UHCA 5KYNA 2WACA 4B9XA 1LCKA 3FC3A 1H28B 2W96A 2EYZA 3CC4T 4OGEA 3A98A 2M16A 1N6AA 1IHWA 1BI0A 2CS7A 3HFOA 1RAAB 4M75F 3OB9A 2D9TA 2RB6A 3M0TA 4JZ4A 3TSWA 5GAN4 3C12A 4ELJA 1JU5C 3J81E 4F7UE 1U5SA 3L2UA 3FEOA 1B34A 1X2KA 2DL4A 5AT1B 3CBOA 2X51A 3VV0A 8AT1B 5ECAA 2QQSA 5GAOn 3QHSA 1VINA 3CCVA 1WHJA 1WDXA 4PFPA 2PU9B 1TFBA 4M7DC 1O9KA 4BCKB 3MIAB 2DNUA 4IURA 2BS2A 1TUDA 1RL2A 4DEXA 1G3WA 1VQ4Q 1SEMA 1NYFA 2JW4A 4J6YA 3OS1A 2J05A 2W10A 4C92G 3OYLA 2EIFA 1HXDA 4HCZA 2KR3A 3CCSQ 5LQFB 1OU9A 2HSEB 4HA8A 4JS5A 3L2WA 2DETA 5KCHA 1B07A 2BE9B 1AHJB 5I21A 1XTDA 5KH6A 1Y96B 2O4XA 3P8DA 3CD6T 2EYWA 1UDLA 1VA7A 3HRSA 1FWZA 1UEBA 5GANh 4RTYA 2G9XB 4M7AD 2EJ9A 2EQKA 1PRMC 4IUPA 2F2VA 4ZTJA 4BUGA 2YRDA 5LJ5d 1OL2B 1YJNQ 1NEBA 2X4JA 4OP0A 4F04B 3VS4A 1QW1A 2CZ0B 4E6RA 4M75B 2KE9A 3H0FA 3JV3A 1AWOA 1NLPC 4HL4A 2A37A 2CT4A 3M0UA 1AZEA 4D8DA 5GMKi 3JCMg 4FW2A 1TSFA 3I55A 1OV3A 4WTOB 4MZPA 2JTMA 2NUPA 2RQVA 3ZL7C 3M0RA 4BI3A 3JB9D 4JRKA 5L23A 2OX7A 2K3YA 2EQIA 3LQ5B 2J6OA 3VUZA 4Y72B 4BY1X 3CXCS 2ZPGB 1K73R 3VUBA 3JB9I 4NOYA 2DXTA 1G5VA 2DE0X 4CFWB 3R6NA 1WHHA 3F5XB 4OB1B 4RG2A 4C92E 1Q86C 3QYHB 3H0IA 4EIKA 2V1RA 4WF2A 1W4SA 2YUPA 3RMQA 1XNIA 3CMET 2HMAA 1G8XA 2L3QA 2I0NA 2LC4A 1M8VA 1K9AA 1RI0A 1QQJA 3ASKA 4HCCA 4LDVA 4CRLB 1VQ9T 1P92A 3KUFA 1KG1A 3D7SB 1KK7A 4PFZA 2PHGA 2KVQG 3VYGB 2YT6A 3SDZA 3CC4Q 2V8IA 1I07A 2O2OA 1RLQC 3TEEA 1RAHB 2CGHA 3X24B 2CSQA 2WSCE 2OTJT 1NPPA 5CKFA 2UZLB 1JBMA 2J7IA 5EC7A 5LL6S 1OKWB 4Y28E 2YRVA 3G71A 3BG5A 4IUVA 3G6ET 2CREA 3BE3A 2GF7A 3A1PA 1SPKA 3EOCB 1UJYA 1VQ8A 4JPBW 4HLQA 4KBMB 4YOOA 1Q81C 5IHNA 3QJYA 2XD0A 1B3QA 5DLQE 3V7SA 2DK3A 5FW9A 4DBQA 5CEIB 1AT1B 3KBGA 5EG2A 4GLMA 1R77A 1OI9B 1IB8A 3ME9A 3DJBA 2P0KA 4IUTA 1VQMA 2CH4A 1XO2A 4LOCA 1UHFA 2DTOA 1ENWA 3RIRA 1D3UB 2QG9B 1KC8C 3VRYA 3G7ZA 2G3RA 1RAEB 2RO0A 4XU0A 1QVFP 2AKLA 4A4GA 4ANJA 4OGRB 1VQLT 5C6SA 2CZ1B 2H8HA 3CCJT 5GAN2 4F6WB 3A8LB 2BIVA 1M27C 4PJLA 5GJWB 2V22B 5HVYB 1M1FA 4M78G 1VQPT 2HQHA 1NLOC 4E7IA 4PJOF 3QHWB 2EPDA 3TQ7P 5GANj 1CSKA 3RKXA 3SFMA 3BLHB 2KRSA 3S3OA 2VKNA 3OSSC 4ZN3A 1I5OB 2EUFA 1JO8A 4J7IA 1UGSB 4QSHA 1NPRA 2Y4YA 3CPWA 4E47A 1OIYB 1R8OB 1Y0MA 1RLPC 4NL2A 5IAYA 1QVGP 4IMYB 4KGZB 2DTHA 2JGZB 1Y96A 1I81A 4FU6A 4JS4A 1XQHA 3JCMW 4II5B 4FYVB 3EG1A 1NM7A 1QLYA 1BU1A 3TNIB 2K2VA 2WMBB 3L2ZA 4C8QG 7AT1B 1PKTA 1C0MA 1GCQC 1WQ7A 2EWNA 2KMTA 2LQ8A 2CZ6B 1UNLD 3L42A 4ELLA 1Y57A 2XHCA 4PLIA 3VS3A 5BNJB 4A4HA 3CCLA 2EBPA 5KYWB 1U8RA 3H4CA 2DF6A 1BCMA 5DLOA 2HDAA 1QMZB 1W1FA 3CCQT 2EFIA 2BTTA 5LJ5h 3CMEQ 1OULA 1G2BA 1OI1A 4P5NA 1H3ZA 3WVDB 4CFXB 4KH0B 2AZSA 4ROEA 1XOVA 2V1QA 4M75C 2EQJA 2WEVB 4M78E 4XAXB 1VQ5A 1BIBA 1VQ6A 4KT0E 4LUEA 4GBQA 4PJOB 5CVIA 3OYHA 2P84A 3I5SA 2DYIA 4EDUA 2IW6B 4MFEA 4CC2A 4MDWA 3OS2A 3OBYA 5FLXE 2R7GA 4OMPA 1WZOA 1VQKQ 2VGNA 1QWFA 3A8HB 4QT7A 1HD3A 1H26B 4BXXX 4BDZA 3UF4A 3NFCA 1Q86U 2PK9B 2PVDB 2DM1A 3GBQA 3R6OA 3CCRA 3QIIA 4C8QE 2LCLA 5HBEB 1MMNA 4A53A 3CC7T 2EVRA 3MEWA 2OTLA 1M30A 5D7UA 1PG5B 2K5FA 1NJIC 1M9SA 3OYFA 1JQQA 1Q86R 3OS0A 1YHQA 4J83A 1VQLQ 4M7DG 3S6WA 3MHXA 1ZUUA 4HVWA 4D8KA 2YUQA 5IN1A 1B7TA 4EOIB 2F2XA 2DD4B 2KT8A 4XK8E 1O9KB 1O75A 1W6XA 1ABOA 4J9CA 2L5QA 3ER0A 2JT4A 2XICA 2QEXQ 5IHYA 1KQ1A 3QDRB 2WFYB 5IT9E 1KD1R 3FJ5A 1WLPB 4FYXB 2O9SA 2XG8D 3CCET 2EGEA 1FYNA 2QXFA 4M77F 3BDLA 3OYGA 2R57A 2QAZA 3QDFA 1VIFA 4QVDA 5HK3A 3DLLA 2WXVB 2COWA 4XTWA 3CPWS 4J6XA 3X20B 4F16A 1KC8U 1U1SA 4R56A 5L8RE 2ED1A 4EOQB 5FROA 3C0CA 2KNBB 1H4LD 2DBMA 1K73C 3TSZA 4PKCC 3M0QA 2FPFA 1QKXA 2FO0A 5HNBB 1UG1A 4E2FB 2KSSA 4C8QD 1T3LA 1YCYA 1SRMA 1HJDA 1JRIA 4OB3B 2GBQA 1KC8R 3GIBA 1JSTB 1YJWT 1ACMB 3OY9A 2RD1A 1YI2Q 1JOWA 4BACA 1GRIA 3QHRB 2KR6A 4M7DE 3CCQQ 2DXCB 4M7AG 3SEMA 4RTWA 4CFUD 2J6FA 5LJ3f 5LJ5j 3MPUB 5GAN5 3OMCA 3G4ST 5IDPB 2F5KA 1IO6A 4XQ3A 4BCOB 4C5IA 4BCQB 5GMKl 2PQWA 1YJ9T 2ZPBB 3BG3A 3MY1B 2H3JA 5GAN3 4BE0A 2LCSA 4N4IA 1YIJQ 3JCMh 3HB9A 2A7YA 1K8AC 1GFCA 3UPUA 4E7LA 3QWYA 4M77B 3QYEA 1KQSA 1V76A 2HNIA 3DB4A 2YHTA 2PMIB 4EOLB 4RMOA 1T0JA 4VUBA 5LJ3e 1YNZA 4KRCB 4PJMA 2JM9A 5IDNB 3DTOA 2J6KA 3OMGA 2K79A 1VQ4A 2F2CA 4C0DB 2DKGA 3CC2Q 4ZGDB 4KH1B 3CPFA 3ULRB 4AFZC 3HSBA 1YFNA 4PJOA 1BI3A 1AZGB 1AVZC 2X1NB 3CCVT 4C92F 4HT8A 3CCSA 4OMNA 4B9WA 3CC7Q 4Y91A 1W2BS 2WIPB 3M0PA 2DLPA 1SSFA 5FU6B 1IREB 3PIPA 2DRKA 1WXBA 1GY3B 4JJDA 3LYIA 4ESRA 3OYIA 3JB9H 2ZCFB 1AWWA 4PJOC 1URCB 2YUNA 4M7DD 4M7AE 2E70A 4TTHA 2IPOB 2NLUA 5CO7A 2L0AA 4OMOA 1WX6A 4EOOB 2DX1A 4RUGA 4OVAA 2Z0WA 2LMJA 4AKHA 3RMSA 2HSPA 1VQNQ 2DJZA 2I53A 1DJ7B 2ATCB 2IG0A 3OW2P 2DL7A 3BFMA 2D6FA 1BI1A 2QFZA 1HK9A 3QYGB 2P0QA 3PMIA 2QA4T 1F1BB 4L5GA 1KSWA 1J3TA 2VV5A 3FB9A 4RTXA 4IKFA 1K0XA 1RADB 3CCEQ 5GAMf 1PRLC 3BDUA 1A0NB 2E6NA 3FRNA 1PHTA 3OBWA 1OEBA 3JCMJ 1JJ2P 2KMGA 1QVGA 3UA7A 2X9HA 4X1VA 2RHYA 4F17A 2DD4A 3OYEA 4Y92A 2BZ8A 1NJIU 1MGQA 4PJNA 5A0LA 4LDXA 2QQ9A 2ECZA 1S1NA 3S3MA 1AISB 5GAOr 4PLLA 5IXFA 1E9HB 4R55A 4CC3A 4BI4A 5DQWA 5GAMe 1GUXB 2W99A 4BCMB 3WVEB 4C92B 5A0DA 5GAOm 5CCAA 2KRMA 2LNHB 5IF1B 1NJIR 1YJWQ 2DPPB 3DB3A 1M4ZA 3M58A 2JTEA 2ZPIB 3DL1A 1PKSA 2C0OA 2CP0A 4CC7A 2IVXA 3L2VA 4FSXA 2KDSA 3X26B 1MMGA 2HBWA 4EONB 1VOMA 4A4EA 3CC4A 1BK2A 3OYJA 3NPFA 1K0SA 5HBHB 5FGKB 1AOJA 1BBZA 1OU8A 2FZCB 2HBPA 2QGFB 3EJ1B 3G4SQ 1Q82C 1MNDA 2LT4A 2EGAA 1TUGB 4PFOA 2FZGB 3GNGA 4KULA 4HKEA 4OMMA 1OYXA 1K73U 1YJ9Q 2EJFA 2ENMA 3CCMQ 1GH6B 3EG0A 1YITQ 3HP9A 4ROCA 3SD4A 4Z6YA 2RQTA 1PKDB 4EOJB 1EZZB 5FWCA 2HKQB 2K7AA 2LVMA 2DXCA 3CBMA 1YBYA 2RQUA 3V8KA 4M75G 2DVJA 1KQSS 2QTVA 2PJQA 2JM8A 1Q95G 4R0KA 4ORZA 2AIRB 2JS2A 3MJXA 3CCUA 5CK9A 4BCND 1MV3A 4V2SA 2RI3A 1VQ8T 3NMZC 3E9GA 1X01A 1QWEA 2QI2A 1UGRB 1FMVA 8ATCB 1GBRA 2QQRA 1H1SB 1UTIA 2Y4XA 1KJWA 3BLRB 3H6ZA 3E19A 2QF7A 4HXJA 3BHUB 1I4K1 3E1SA 4WCIA 2VXFA 1ZA1B 4RCBA 1ZHIA 2C0TA 4M77A 4MDXA 5GAOl 4JJCA 3HHTB 1VQMT 4MMKA 4MFDA 1LVKA 1VQOT 2HCKA 4XTVA 1W70A 2CUBA 2X3XD 2KEAA 2DL5A 2HL3A 2X3WD 3HO8A 2DMEA 3DKMA 4M78F 1K8AU 2CDTA 2JS0A 4XTYA 2V8KA 1KD1C 2WSFE 1UGVA 4M77C 4HNUA 4QKUA 2EGCA 2KBTA 4ZN1A 1K9MC 1T0HA 2DEUA 2QA4Q 3X28B 3OS5A 2AHJB 2MK5A 2F2WA 2XMFA 3GLXA 4IIMA 1K8AR 4X9DA 1LPLA 1H8KA 4C0DC 3QZ9B 1Y71A 4BBRM 2ZPEB 4J7FA 1KQ2A 3QJ6A 1WI7A 1WIEA 3LX7A 1YWOA 3CBPA 4HT9A 2NYSA 3EAEA 4BCGB 4M75E 2KT1A 1ZQ1A 1EFNA 4EMKB 3M55A 3FDRA 3J80E 3VKHA 1UNHD 4NC6A 1PD0A 4QVZA 5KYXA 3H41A 3CXCP 1PSFA 2CKKA 3BHTB 2SRCA 1H27B 1ZX6A 2JVVA 4ELYC 1VUBA 2E3IA 1PWTA 1UNGD 4JLGA 4DBRA 2W0ZA 2LJ1A 5GAOp 1N8RC 2DFUA 2DAQA 5DQVA 2VUBA 4E7HA 2DIGA 2KQWA 2L8DA 1HYOA 4FL6A 1UB4A 3CMEA 1IZ6A 1QP3A 2K57A 1U3OA 3ZFJA 3EFRA 4CC4B 2LNVA 3CD6Q 3CCLT 4BY6B 4BCIB 5J39A 5CR2A 3HPWA 2FPDA 4BE2A 3OYBA 3PVQA 2YLCA 1UECA 4M78B 2OAWA 3FIFA 3RUXA 2DXUA 2FG0A 2P0PA 4C0FA 5GMKh 1Q7YC 1GUXA 4C92A 1JEGA 2LQKA 3JCMV 2K5IA 4A4KA 5CKEA 2IN3A 3GP8A 1VQ7T 2WHBB 1VQKA 1KXUA 2W9ZA 2P4TA 3QSUA 4OMFB 4J8OA 2A28A 4YTLA 1OQKA 2XI9A 2M0OA 4CFVB 2ZPFB 2JUFA 4ZNXA 1EX4A 3N5BB 4O6JA 2VC8A 4OF1A 4M75D 4PJJA 2XDDA 2GFUA 4FSSA 4C92C 3QPHA 5IHIA 1FKMA 1M1GA 2DEQA 4EMGA 4CI0C 2LRQA 4C8QB 2R5AA 5GAN6 1WJSA 1WNLA 1IGUA 4N4GA 3QYBA 2JXBA 1WGSA 2QQ8A 1GL5A 2DERA 3TREA 3QWLA 4F6SB 3CCRT 3L2RA 1NEGA 2OJ2A 1Q82U 5DY9A 3CMAA 3EH1A 5I2MA 4AT1B 1N9RA 5DM7R 4CXAB 1VQOQ 2ABLA 2QEXA 1SKUB 2EW3A 1VQ9Q 2L3PA 1Y07A 5GAN7 2X4YA 2XDPA 5CIUA 3VS0A 2D0QB 4FX3B 3VYHB 5HCKA 4ME7A 1QCNA 1H24B 1Q82R 3OYYA 2EKOA 1TWBA 4J9HA 1H641 2OTJQ 1K1ZA 2C0IA 1RAGB 4EOKB 4KGXB 1G3TA 2KAFA 2ZPHB 3PE0A 5GAOq 4PJOG 3G6EQ
chains in the Genus database with same CATH topology
3OMCA 4XTZA 4II1A 3JCMc 3G4ST 2F5KA 2B8AA 5FRNA 4XQ3A 4C5IA 4HA8A 5GMKl 2PQWA 4OGCA 4A4FA 4C5GA 4JS5A 3L2WA 4N0AC 5KCHA 3VKIA 2MI6A 2RK2A 4Z02A 1AHJB 5I21A 5D6WA 2ZPBB 3BG3A 1XTDA 1S72A 1M1KC 3PT9A 2H3JA 5KH6A 1Y96B 2O4XA 2Y90A 3MEUA 3P8DA 1LJOA 5GAN3 4BE0A 2MAMA 3NTHA 1M90C 3JSCA 5HKCA 2R58A 3CD6T 3I56T 3LWIA 3HRSA 4GLKA 2VXEA 4N4IA 1FWZA 3HB9A 1UEBA 4JUVA 3P8BB 2A7YA 3SB2A 3JCMh 5CKDA 3NTKA 5GANh 3LH0A 3UPUA 4E7LA 1K8AC 4M77B 4M7AD 3QYEA 2EJ9A 3GNFB 1KQSA 2EQKA 1VIEA 4LD9K 2HNIA 3DB4A 2YHTA 4IUPA 5AYFA 1VQ9A 4L6V5 4C92D 3M54A 4RMOA 3URGA 4VUBA 4BUGA 4ZTJA 5D6XA 5LJ3e 5LJ5d 3CMAT 1ZBXA 1KD1U 2X4JA 4OP0A 4DOWA 1YI2A 1QVPA 4PL6A 3PGGA 3OMGA 1VQ4A 1QW1A 2CZ0B 2OTJA 4M75B 4C0DB 2DKGA 4M7AF 4ZGDB 4HL4A 3DLMA 2X35A 2RJCA 3KXTA 4JRQA 4QQDA 3CPFA 4ZGEB 2QEXT 3HSBA 4M7DB 4PJOA 5GMKi 1BI3A 3OYMA 3CCVT 3JCMg 4C92F 1K9MU 4HT8A 5GANg 1WJRA 3G6EA 3CCSA 1VQ5T 4EMKA 2C06A 3I55A 4B9WA 3OYAA 1VQ6T 3MP8A 2LDMA 4Y91A 1O9SA 4EPCA 1W2BS 3PMTA 4RG8A 4BE1A 4XTUA 4MZPA 2DXBA 2JZ2A 2JTMA 4EMHA 4CI0C 1SSFA 3LGLA 4BI3A 3JB9D 4JRKA 1IREB 5FU6B 4NL3A 3PIPA 2K3YA 4X9CA 3QZ5B 1X6OA 4MZTA 3VUZA 3CXCS 2ZPGB 1MHNA 1X75C 3VUBA 4IUUA 3JB9I 4F7UF 3OYIA 2ZZDB 3LYIA 4NOYA 1YIJA 4MZMA 3JB9H 2ZCFB 2DXTA 4PJOC 1G5VA 4M7DD 4M7AE 2E70A 2NLUA 5LJ3h 5CO7A 2RJDA 1FX7A 4M6VA 2YLBA 3HRTA 4EMKC 5GMKj 5GANf 3PNWC 5A0GA 2RI5A 4OVAA 4RG2A 4OB1B 5D6YA 4AKHA 3RMSA 4C92E 1Q86C 3QYHB 2DJZA 4FT4A 4CRIA 3JB9F 3V8LA 2GCXA 4PJOE 1DJ7B 3OSVA 1W4SA 4WF2A 1S72T 2IG0A 3JCMX 3RMQA 3JCMd 3BFMA 4HCBA 2D6FA 1BI1A 1XNIA 2QFZA 3EFSA 1HK9A 2DZ9A 3QYGB 3QKJA 3CMET 2P0QA 2XK0A 2MMPA 3PMIA 3V7RA 1N8RU 1VQLA 2QA4T 4M7DF 2LC4A 3BY7A 3SWNA 3O8VA 4L5GA 3CC2A 1M8VA 2DTIA 2VV5A 3FB9A 3CCJA 1RI0A 4IKFA 4XU1A 3ASKA 4M78A 4LDVA 4HCCA 4GY5A 5CQXA 4DOVA 2OTLT 1G3SA 4MMLA 3M59A 1VQ9T 1P92A 3KUFA 5GAMf 1KG1A 3L1AA 3BDUA 2VGMA 4FIBA 2E6NA 3FRNA 3OBWA 1WPYA 2KVQG 3VYGB 4M75A 5LJ3g 3HL8A 3JCMJ 3SDZA 3A8GB 5CAIA 1JB0E 2V8IA 2DO3A 4ATOA 2KMGA 1YI2T 1QVGA 3TEEA 5GANe 2RHYA 1VQPA 1YHQT 4ZGJB 2CGHA 2DD4A 3C4SA 4FT2A 3X24B 2WSCE 3M56A 3OYEA 2OTJT 1NPPA 4ELZC 1MGQA 1NJIU 5CQYA 5A0LA 5CKFA 4E7KA 2QQ9A 1Y7XA 4BY6C 4LDXA 4N4HA 1JBMA 1M5Q1 3JB9J 4RKUE 3SWNC 5LL6S 2HAXA 3HRUA 5C0MA 3OW2A 3F70A 1D3BB 2RHUA 4M78C 4BDYA 4Y28E 3S3MA 2YRVA 3G71A 5KE3A 3BG5A 1V29B 4IUVA 3G6ET 5GAOr 1BIAA 4PLLA 3GOXA 2GF7A 1Q7YU 1UGPB 5FU7B 1VQ8A 4M7AB 4HLQA 4NS5A 4R55A 4KBMB 2WSEE 1Q81C 1VQNA 4BI4A 3QJYA 2GQVA 1VQ7A 5GAMe 1G3YA 5GAOm 3UT1A 3WVEB 2MWPA 4C92B 5A0DA 4C8QA 3OYDA 2XD0A 5DLQE 5LJ5j 3V7SA 3MO8A 5CCAA 3HZJA 2DK3A 3M5AA 2LTOA 1JJ2A 4QVCA 2GFAA 2XU8A 2DPPB 1YIJT 3KBGA 2E6ZA 2WJ9A 5EG2A 3DB3A 1M4ZA 3M58A 2ZPIB 3DL1A 2O01E 4KUIA 4HNVA 3M4GA 3ME9A 3CCEA 2P0KA 4IUTA 3L2VA 1VQMA 4FSXA 3X26B 2KDSA 3GF5A 4LOCA 2DTOA 2E65A 3RIRA 2PVGB 1KC8C 4A4EA 4F7UB 3G7ZA 2G3RA 3QXEB 3CC4A 2RO0A 3META 2E41A 2RI2A 3OYJA 4XU0A 4BD3A 2EQMA 2HBPA 4A4GA 2QQAA 3T9NA 4PJOD 3TCJA 3MP6A 1Q82C 1VQLT 5C6SA 2I2LA 2LT4A 2RH2A 3BG9A 2CZ1B 3CC2T 2EQUA 4UC4A 3GNGA 3VYGA 4KULA 3JCMQ 3CCJT 3QUIA 4HKEA 5GAN2 5CKBA 3V8JA 2JTFA 3A8LB 1KHIA 2QDJA 4M77G 1OYXA 2BIVA 1K73U 2EJFA 3CCQA 1LNXA 4JRIA 5GAMh 3HP9A 1W2BA 4OB0B 3SD4A 4Z6YA 2CZ7B 1BI2A 1M1FA 3TW7A 4M78G 1VQPT 4E7IA 2FB7A 1E7PA 4PJOF 4LDYA 5KE2A 2A3LA 2LVMA 2KY9A 2DXCA 2JOYA 3CBMA 1YBYA 3LWHA 5GANj 3RKXA 3V8KA 3SFMA 4M75G 1I5LA 1KQSS 3S3OA 1U1TA 1B34B 2EAYA 2DD5A 3OQ5A 3OSSC 1PSEA 2R5MA 3CCUA 3RERA 4ZN3A 2E5QA 1QVFA 3MEVA 5CK9A 3C94A 4J7IA 3VU3C 1UGSB 4V2SA 2RI3A 4QSHA 1NPRA 2Y4YA 3LW5E 3CPWA 1VQ8T 4E47A 2LX9A 1X01A 1R8OB 3E9GA 4NL2A 2QI2A 2RHXA 5IAYA 1VQNT 1UGRB 5GAMg 3HBLA 4L59A 5GMKm 2DTHA 2QQRA 3JRZA 2Y4XA 1Y96A 3H6ZA 3E19A 2QF7A 1I81A 2FVUA 1I4K1 1XQHA 3E1SA 3HKSA 4FU6A 4JS4A 3JCMW 2VXFA 4M78D 1Q81U 2JN0A 3G4SA 5J26A 1BKBA 1KHCA 4TVRA 3VKGA 4RCBA 1ZHIA 1YJNA 4J6WA 2K5LA 4M77A 2E10A 3RKYA 4MDXA 2K2VA 5GANd 5GAOl 3L2ZA 4C8QG 3HHTB 1VQMT 4MMKA 4QQ6A 3L2QA 4MFDA 1WQ7A 2EWNA 3H8ZA 4XTVA 1VQOT 3CCMA 1YJ9A 2KMTA 1M1KU 1YITA 2LQ8A 4JLIA 2CZ6B 1QP2A 3QG1A 1M90U 3FJPA 2BS4A 2OAUA 3E9FA 3OYKA 3I56A 1N9SA 3HO8A 2EJGA 3DKMA 3L42A 2HD0A 4M78F 4JX4A 3VJPA 1K8AU 3A5ZB 4QQGA 2HQXA 2QTXA 2F69A 2O4XB 2XHCA 4PLIA 4XTYA 2V8KA 3CC7A 2RA2A 4A4HA 1KD1C 3CCLA 4OB2B 2K3XA 2XDBA 4J5YA 5FRMA 1U8RA 3H4CA 5LJ3j 4M7DA 2WSFE 2MF2A 4AI6A 3BW1A 4M77C 5DLOA 3PIOA 5A2QE 2RM4A 3TU4K 1VQ4T 4HNUA 3QO3A 4XU2A 3CCQT 2EFIA 3M57A 1N27A 2RK1A 3Q1JA 5LJ5h 4ZN1A 4M77E 2EYQA 1K9MC 2RHZA 1OI1A 2IVWA 4P5NA 3X28B 2M1HA 1H3ZA 3WVDB 3CCST 3OS5A 4D6WA 3I55T 4JX6A 2FYKA 2AHJB 1LOJA 3RESA 3A8MB 3A8OB 5CKHA 3GLXA 1XOVA 4M75C 4X9DA 2EQJA 4AKIA 4C0DC 3QZ9B 1Y71A 4M78E 4XAXB 4BBRM 4JRPA 2ZPEB 1NE8A 2QQBA 1BIBA 2ZZDA 4J7FA 1VQ5A 2BS3A 3QJ6A 3CCUT 2LCCA 1KQ2A 1VQ6A 3MEAA 4ZTFA 4KT0E 2M9UA 3LX7A 3CBPA 5HK0A 4HT9A 3EAEA 4C5EA 4PJOB 3PFSA 4M75E 3LLRA 2RJEA 5CVIA 3OYHA 3TW6A 1ZQ1A 4BI8B 4EDUA 3CEYA 4AKGA 5LJ3d 4EMKB 3M55A 3OYCA 3FDRA 4MFEA 1WQWA 2VYTA 3J80E 4MDWA 3OA6A 3VKHA 3OS2A 4NC6A 3OBYA 2PUKB 5LJ5g 4QVZA 2BKDN 3JAME 5M9OA 4KUDK 2DXBB 5EJCA 3C95A 5FLXE 4C0GA 1PSFA 2JNGA 4X34A 2CKKA 4FM4B 5GMKe 4JJNK 3OW2S 2VGNA 4RCCA 3UWNA 2JVVA 4ELYC 3A8HB 3HFNA 1YJNT 1VUBA 2FHDA 3S3NA 4C5HA 3J7AF 2PVOB 2G77A 4JLGA 4BDZA 4C8QC 3NFCA 5GAOp 2BUDA 1Q86U 1N8RC 3M53A 1UGQB 2DAQA 3X25B 2PVDB 2VUBA 4IUQA 3R6OA 3CCMT 2DIGA 4E7HA 1YITT 4JDSA 2KQWA 2L8DA 4LD6A 3CCRA 2CYZB 3FLGA 3QIIA 1UB4A 2LCLA 4FL6A 1IZ6A 1QP3A 2K57A 4C8QE 4F7UG 2DZCA 3CMEA 4HNTA 4BBSM 4A53A 2QA4A 3PTAA 1JJ2S 5LJ5f 3ZFJA 4MIMA 3EFRA 3ZBDA 3CC7T 5GAN8 2LNVA 3MEWA 3QBYA 3CCLT 2OTLA 3AHUA 1BYMA 4BY6B 5J39A 5CR2A 3JCMP 3HPWA 2K5FA 3INZA 3SWNB 3JB9G 4BE2A 3OYBA 1D3BA 2YLCA 1NJIC 3RKWA 1M9SA 3CXCA 4M78B 4C0ZA 3OYFA 3FIFA 3RUXA 2DXUA 5J3BA 3OYNA 3UDCA 2P0PA 1YJWA 3OS0A 1YHQA 4J83A 4M7AA 4C0FA 4M7DG 2K4YA 3S6WA 3MHXA 3JCMb 3G71T 3KHIA 4LDUA 5GMKh 1Q7YC 3GPLA 5IN1A 2E1HA 4C92A 2LQKA 3JCMV 2K5IA 2XKOC 1I8FA 2ZGWA 2DD4B 3MP1A 5CKEA 5HY6A 3V7CA 4M77D 4A4KA 4XK8E 3P8HA 1O75A 1VQ7T 3GP8A 2MWOA 1VQKA 3QSUA 2P4TA 2L3RA 4OMFB 1FXXA 1OZ3A 2L5QA 3ER0A 2X4XA 2XICA 4J8OA 5LJ5e 2PUOB 4YTLA 5KCOA 5GAMj 2DVEA 1KQ1A 2RHIA 2XI9A 4E7JA 3QDRB 2RJFA 5IT9E 2M0OA 5LJ3f 2ZPFB 5FU7C 4M7AC 2JUFA 3N5BB 4O6JA 1YJ9T 3M9QA 4F7UA 2VC8A 4OF1A 4M75D 2XG8D 3CCET 2XDDA 2GFUA 4XTXA 2QXFA 4M77F 1QVFS 4C92C 3BDLA 3OYGA 2R57A 3QPHA 1FKMA 1M1GA 2DEQA 2L89A 4EMGA 1VIFA 2WACA 2LRQA 4B9XA 4C8QB 2R5AA 4QVDA 5HK3A 5GAN6 5GAOq 3FC3A 3CC4T 1WJSA 2F5TX 1WNLA 3JCMf 4OGEA 3LGFA 2DIQA 4N4GA 3QYBA 3DLLA 3CD6A 4JX5A 1N6AA 2M16A 1WGSA 4XU3A 2QQ8A 2HQEA 1BI0A 4XTWA 3CPWS 4J6XA 3X20B 2XIDA 4O5VA 5I2SA 1U1SA 3ZEHA 4R56A 1KC8U 5L8RE 3QWLA 2CS7A 3HFOA 3TREA 4Q5WA 3M4YA 2V8JA 5FROA 4M75F 1VQOA 3CCRT 3OB9A 2D9TA 2RB6A 3L2RA 5GAMd 1WJQA 1K73C 1OZ2A 4PKCC 4DQ2A 1Q82U 1QLBA 1TH7A 5DY9A 5GAN4 3C12A 3CMAA 4ELJA 5I2MA 2E64A 1N9RA 2KSSA 4HCZA 4C8QD 4F7UE 5DM7R 3J81E 2QDYB 1B34A 3FEOA 3L2UA 3MCAB 1YCYA 3CBOA 3VV0A 2QEXA 2QQSA 2KK4A 2X4WA 1JRIA 4OB3B 3QHSA 4QW2A 5GAOn 3GIBA 3CCVA 1Y07A 5GAN7 1NZ9A 3JCMe 2X4YA 2XDPA 4LDWA 1YJWT 5CIUA 4A54A 2D0QB 2E12A 4DA4A 2PU9B 3OY9A 2RD1A 4M7DC 3VYHB 4IURA 4ME7A 2BS2A 4PNOA 4BACA 4N0AA 1RL2A 2FL7A 1GXIE 3OYYA 1QVGS 2EKOA 4C8QF 4BB7A 1G3WA 1EIFA 1H641 3NTIA 2KR6A 4M7DE 4J6YA 2DXCB 4M7AG 3WXMB 1VQKT 3OS1A 2LT1A 1G3TA 5FU6C 2DD5B 2KAFA 4C92G 3OYLA 2ZPHB 2EIFA 1HXDA 4PJOG 5GAN5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8G B;  1JB0 E;  4ZGJ B;  2DD4 A;  3X24 B;  2WSC E;  1AHJ B;  2ZPB B;  4RKU E;  3HHT B;  4Y28 E;  2CZ6 B;  1QP2 A;  1V29 B;  2DD4 B;  4XK8 E;  1UGP B;  2WSE E;  4L6V 5;  2PUO B;  4OB2 B;  3WVE B;  2WSF E;  2ZPF B;  2DPP B;  2CZ0 B;  2ZPI B;  2O01 E;  4ZGD B;  3X28 B;  4ZGE B;  3WVD B;  3X26 B;  2AHJ B;  2PVG B;  3A8M B;  3A8O B;  3QXE B;  3X20 B;  3QZ9 B;  5L8R E;  2ZPE B;  2ZZD A;  4KT0 E;  2DXB A;  2CZ1 B;  3VYG A;  1IRE B;  3A8L B;  3QZ5 B;  2ZPG B;  2ZZD B;  2PUK B;  2ZCF B;  4OB0 B;  2DXB B;  2QDY B;  1PSF A;  2CZ7 B;  4FM4 B;  4OB1 B;  3A8H B;  4OB3 B;  3QYH B;  2PVO B;  2DXC A;  1DJ7 B;  2D0Q B;  2PU9 B;  3VYH B;  1UGQ B;  3X25 B;  2PVD B;  2DD5 A;  1PSE A;  3QYG B;  1GXI E;  2CYZ B;  1UGS B;  1QP3 A;  2DXC B;  3LW5 E;  1UGR B;  2DD5 B;  2ZPH B;  3VYG B; 
#chains in the Genus database with same CATH topology
 1E7O A;  4II1 A;  4XTZ A;  3JCM c;  1JXM A;  3G1J A;  3RNJ A;  2B8A A;  5FRN A;  2A0F B;  4OGC A;  4C5G A;  2RK2 A;  4Z02 A;  5D6W A;  1S72 A;  1E6H A;  2Y90 A;  3MEU A;  1LJO A;  3NTH A;  3JSC A;  5HKC A;  3EGX B;  3I56 T;  3LWI A;  2PTK A;  3SB2 A;  1YWP A;  2VXE A;  4JUV A;  2RPN A;  3P8B B;  2DA9 A;  3NTK A;  4EOP B;  3LH0 A;  3GNF B;  3E2U A;  1VIE A;  2MYS A;  5AYF A;  4L6V 5;  2W9F A;  3URG A;  5D6X A;  4EC8 B;  4K11 A;  1ZBX A;  1KD1 U;  1YI2 A;  4DOW A;  1QVP A;  1TS9 A;  3PGG A;  2CSI A;  2ROL A;  3O0G D;  2MCN A;  3VS2 A;  1OPK A;  2AKK A;  4M7A F;  3CCJ Q;  3KXT A;  4QQD A;  4M7D B;  1K76 A;  3OYM A;  1K9M U;  1WJR A;  4EMK A;  4FYY B;  1ZA2 B;  1O9S A;  4EPC A;  2KYB A;  1X2Q A;  3PMT A;  4XTU A;  1VQP Q;  1ABQ A;  2GQI A;  3LGL A;  1BU2 A;  4NL3 A;  4F7L B;  4X9C A;  3LH5 A;  4Z88 A;  1MHN A;  2WMA B;  4F7U F;  1ZBJ A;  1YIJ A;  1OX9 A;  2V26 A;  2MOX A;  2RJD A;  3RGF B;  1K9M R;  3HRT A;  4EMK C;  5GMK j;  4LNP A;  5A0G A;  2DJQ A;  5D6Y A;  1VQ7 Q;  4FT4 A;  4PJO E;  3DDQ B;  3JB9 F;  3V8L A;  3M03 A;  2NUT A;  3OSV A;  1CKA A;  4Z89 A;  2CCI B;  4RTU A;  4F70 B;  1KIK A;  2MMP A;  3EHR A;  3V7R A;  1N8R U;  4BY7 X;  3UAT A;  1UFF A;  3CC2 A;  2DTI A;  4IIO A;  3H9N A;  1X6G A;  4XU1 A;  4M78 A;  5CQX A;  4DOV A;  4JZ3 A;  2O31 A;  4FIB A;  1MNE A;  5LJ3 g;  3AT1 B;  1VOL A;  2DO3 A;  4ATO A;  1SF9 A;  4ZGJ B;  4FT2 A;  3M56 A;  5CQY A;  1Y7X A;  4BY6 C;  4N4H A;  1TUC A;  3JB9 J;  1N8R R;  3CCR Q;  1NYG A;  2HAX A;  2HEQ A;  5C0M A;  1PCX A;  2P4R A;  1D3B B;  2RHU A;  4M78 C;  3I9Q A;  5KE3 A;  1V29 B;  1BIA A;  3GOX A;  1Q7Y U;  1F5Q B;  2EYY A;  1G83 A;  1NG2 A;  5FU7 B;  1OIU B;  1D09 B;  4M7A B;  1W98 B;  4NS5 A;  2WSE E;  1VQN A;  1G3Y A;  1C1A A;  3OYD A;  4C8Q A;  3NDQ A;  3MO8 A;  2LTO A;  2ZAE A;  1IHV A;  2GFA A;  2XU8 A;  1IXD A;  2FPE A;  4HCK A;  2WJ9 A;  2O01 E;  4FCY A;  2RQW A;  1TG0 A;  3CCE A;  1D1C A;  1Q7Y R;  1OL1 B;  4J9E A;  4F7S B;  4B6M A;  3GF5 A;  1OOT A;  4Z8A A;  4F6U B;  4F7U B;  1ZUK A;  2RI2 A;  3SHW A;  1H3H A;  2EQM A;  4PJO D;  3TCJ A;  3MP6 A;  2E3H A;  5KYY B;  2D1X A;  3CPW P;  3BG9 A;  4UC4 A;  3QUI A;  2KRN A;  2CCH B;  2JTF A;  1YN8 A;  2LP5 A;  1KHI A;  1M3A A;  2A08 A;  4M77 G;  4BCN B;  3B57 A;  2B9R A;  1WYX A;  2LW4 A;  1BCO A;  2BZY A;  5LMK B;  3PVL A;  5I5Z B;  3I56 Q;  4J9F A;  2CZ7 B;  3TW7 A;  2M51 A;  2FB7 A;  5KE2 A;  3VS1 A;  2A3L A;  3LWH A;  1I5L A;  4HVV A;  2CP6 A;  1WHK A;  4YOS A;  1U1T A;  2G6F X;  4OML A;  2ROT A;  3RER A;  2COY A;  1JKW A;  1QVF A;  3VU3 C;  1GBQ A;  3LW5 E;  2RHX A;  1SSH A;  5GAM g;  3JRZ A;  5I11 A;  1Z9Q A;  4FW1 A;  3EGX A;  1BB9 A;  2JN0 A;  3G4S A;  1YJN A;  3VKG A;  3G33 B;  1GCP A;  4J6W A;  2CUD A;  2D8J A;  2K5L A;  5KYX B;  3GTM S;  1ZLM A;  3TVT A;  4NST B;  4QQ6 A;  1YJ9 A;  2C4G B;  3CCM A;  1YIT A;  4DBF A;  1QP2 A;  3QG1 A;  3FJP A;  2QGS A;  2BS4 A;  1RAB B;  2GNC A;  2OAU A;  3E9F A;  3OYK A;  1N9S A;  2EJG A;  2O88 A;  2YXY A;  3A5Z B;  4QQG A;  2HQX A;  2QTX A;  2F69 A;  1UE9 A;  1D0Y A;  4OB2 B;  2K3X A;  2XDB A;  3M0S A;  4G6L B;  2BE7 D;  5FRM A;  4M7D A;  2MF2 A;  4AI6 A;  3PIO A;  3TU4 K;  2YSQ A;  3MY5 B;  3M57 A;  3MKD A;  1N27 A;  2RK1 A;  3Q1J A;  1FIN B;  1X43 A;  4M77 E;  2EYQ A;  2RHZ A;  3NHN A;  2K9G A;  2IVW A;  1QKW A;  3I55 T;  2K2M A;  1HSQ A;  3RES A;  3A8M B;  5CKH A;  4BCF B;  4JRP A;  2LX7 A;  2QQB A;  4PK4 A;  2BS3 A;  3CCU T;  2LCC A;  3MEA A;  3EFO B;  2QGG A;  3EG9 B;  2M9U A;  4ZTF A;  4C5E A;  3O5Z A;  3PFS A;  3LLR A;  3TW6 A;  1W2B P;  3CEY A;  4AKG A;  2LZ6 B;  2PNI A;  5LJ3 d;  4DBH A;  5I22 A;  2VYT A;  3OA6 A;  1FVV B;  4YC3 B;  2BKD N;  3JAM E;  5M9O A;  4KUD K;  2DMO A;  2DXB B;  2QDL A;  3C95 A;  2JNG A;  4X34 A;  2JJ9 A;  5IXB A;  4JJN K;  3EHQ A;  4RCC A;  3HFN A;  1OGU B;  1SHG A;  2FHD A;  3S3N A;  3J7A F;  3M53 A;  1UGQ B;  4AFS C;  4IUQ A;  2EYX A;  1D0Z A;  4JDS A;  2BZX A;  4LD6 A;  2MPX C;  2CYZ B;  3FLG A;  2QA4 A;  2SEM A;  1P5E B;  1U06 A;  3ZBD A;  2C5X B;  1N5Z A;  3VS5 A;  5GAN 8;  3QBY A;  1WA7 A;  1MMD A;  2QYZ A;  3INZ A;  3SWN B;  1D3B A;  1H1R B;  1YCS B;  4BCQ D;  2F1L A;  3OYN A;  5J3B A;  1UUE A;  4F7J B;  1R0B G;  4M7A A;  2DBK A;  1CKB A;  1YP5 A;  2K4Y A;  5IHK A;  3JCM b;  3G71 T;  4LDU A;  3GPL A;  2E1H A;  2C5O B;  3V7C A;  2ZGW A;  1M2V B;  1RAC B;  1VYU A;  2XKO C;  4BD3 A;  4M77 D;  3DDP B;  5KYU A;  2ESW A;  1Z9Z A;  2IIM A;  5IH2 A;  1FXX A;  2QK0 A;  4J9D A;  5KCO A;  3CCV Q;  2RHI A;  2RNA A;  1KFZ A;  2RJF A;  2CP5 A;  1JSU B;  5FU7 C;  4M7A C;  3M9Q A;  4F7U A;  4XTX A;  4OR5 B;  2C5N B;  2HL5 C;  5KYY A;  2FZK B;  1QVF S;  2F5T X;  3JCM f;  3CD6 A;  3LGF A;  1WHG A;  2DIQ A;  4JX5 A;  3TNW B;  4XU3 A;  2HQE A;  1C9B A;  4O5V A;  2XID A;  5I2S A;  3ZEH A;  2C5V B;  3MI9 B;  3M4Y A;  4Q5W A;  3POM A;  2V8J A;  2FRY A;  2BPM B;  5GAM d;  1WJQ A;  2HKN A;  1OZ2 A;  4DQ2 A;  1QLB A;  1TH7 A;  2RQR A;  1SG5 A;  2E64 A;  2QDY B;  2AT1 B;  2YRC A;  3MCA B;  2RMO A;  2X4W A;  2KK4 A;  4QW2 A;  1RI9 A;  1X69 A;  1VYT A;  1NZ9 A;  2KGT A;  3JCM e;  4LDW A;  3EGD B;  4A54 A;  2E12 A;  4DA4 A;  3RDV A;  3EH2 A;  4PNO A;  4N0A A;  2FL7 A;  2OI3 A;  1GXI E;  1QVG S;  4C8Q F;  2YWW A;  4BB7 A;  3NTI A;  1EIF A;  1K4U S;  1KQS P;  2LQN A;  3WXM B;  1VQK T;  1ZSZ B;  2COZ A;  3HTR A;  2MIO A;  2LT1 A;  5FU6 C;  2DD5 B;  5EFQ B;  3I55 Q;  2A36 A;  4YOZ A;  1IRX A;  2FRW A;  4BCH B;  4LE9 A;  4A4F A;  1GFD A;  4N0A C;  4AMC A;  3VKI A;  2MI6 A;  3CCU Q;  1M1K C;  1V1C A;  3PT9 A;  1PNJ A;  2CH4 W;  1M90 C;  2KXC A;  1AWJ A;  2MAM A;  5L2W B;  2R58 A;  4GLK A;  4KGV B;  2PK2 A;  1WXU A;  2NUT B;  1VQO A;  5CKD A;  2EKH A;  4I3Z B;  2B86 A;  4LD9 K;  1VQ9 A;  3UA6 A;  4BCM D;  4C92 D;  3M54 A;  3CMA T;  4PL6 A;  1M2O A;  3EG2 A;  2OTJ A;  3RR6 A;  3KFV A;  2QAS A;  3DLM A;  2X35 A;  2RJC A;  3IQL A;  4JRQ A;  3EFO A;  3EG9 A;  4ZGE B;  2QEX T;  3RBB B;  1AWX A;  2VWF A;  5GAN g;  1D0X A;  3G6E A;  1VQ5 T;  2C06 A;  4AFU C;  3OYA A;  1VQ6 T;  3MP8 A;  2H3E B;  2LDM A;  2LJ3 A;  1G3N C;  5CYI B;  4RG8 A;  2M02 A;  4BE1 A;  2DYB A;  4RTZ A;  1OPL A;  2DXB A;  2JZ2 A;  4EMH A;  4LXC A;  1FMW A;  4LN2 A;  2GTO A;  1TXQ A;  1WHM A;  3QZ5 B;  1X6O A;  4MZT A;  4J9B A;  1GCQ A;  3DOG B;  1X75 C;  2GGR A;  2L3S A;  4IUU A;  2KI7 A;  4BCJ B;  4AG2 C;  2ZZD B;  4MZM A;  2YUO A;  1H92 A;  3G71 Q;  2O9V A;  1OX8 A;  5LJ3 h;  1FX7 A;  4M6V A;  2YLB A;  3EGU A;  4EOR B;  2FEI A;  5GAN f;  1VQ8 Q;  6AT1 B;  4ROD A;  3PNW C;  2RI5 A;  2UZD B;  4CRI A;  2GCX A;  2C6T B;  1VYW B;  1S72 T;  1QMC A;  3JCM X;  2VB6 A;  3JCM d;  4HCB A;  1XJW B;  3EFS A;  1QCF A;  2DZ9 A;  3QKJ A;  2XK0 A;  4E7Z A;  1VQL A;  4M7D F;  3BY7 A;  3SWN A;  3O8V A;  3CCJ A;  1RAI B;  4GY5 A;  1MV0 B;  2OTL T;  2LJ0 A;  1G3S A;  4MML A;  1VQM Q;  3M59 A;  2UUE B;  3L1A A;  1AEY A;  1M8M A;  2VGM A;  1TD6 A;  4AG1 C;  4CFU B;  1WPY A;  4F14 A;  4M75 A;  2KXD A;  3HL8 A;  3A8G B;  5CAI A;  1JB0 E;  1YI2 T;  5GAN e;  1M3C A;  1M2V A;  1RAF B;  1ZSG A;  1VQP A;  1YHQ T;  3C4S A;  5HQ0 B;  4ELZ C;  4E7K A;  3THK A;  1M5Q 1;  4RKU E;  3SWN C;  3HRU A;  3U23 A;  1RUW A;  3OW2 A;  2PZ1 A;  3F70 A;  1MMA A;  4BDY A;  1T3S A;  1WXT A;  1UGP B;  2VAS A;  4J9G A;  1ZP2 A;  2GQV A;  4UN0 A;  1VQ7 A;  1SRL A;  2WIH B;  2K3B A;  2M0Y A;  1I1J A;  3UT1 A;  2MWP A;  3HZJ A;  3M5A A;  1JJ2 A;  4QVC A;  2NWM A;  1H1Q B;  1YIJ T;  3TNH B;  2E6Z A;  2I40 B;  4KUI A;  4HNV A;  3M4G A;  4M4Z A;  2E65 A;  2IW9 B;  2PVG B;  4OMQ A;  3QXE B;  3MET A;  2E41 A;  2AK5 A;  1JXO A;  2QQA A;  3T9N A;  4CFM B;  2L2P A;  3EID B;  4EOS B;  1R0C B;  2CT3 A;  2I2L A;  2J06 A;  2RH2 A;  3CC2 T;  2EQU A;  3VYG A;  3JCM Q;  5CKB A;  2D8H A;  3V8J A;  1N4M A;  2QDJ A;  3EGD A;  3CCQ A;  1LNX A;  4JRI A;  5GAM h;  2WPA B;  1W2B A;  4OB0 B;  3BHV B;  1M3B A;  1ZUY A;  2LQW A;  9ATC B;  2DRM A;  1VYV A;  1BI2 A;  1E7P A;  2JMA A;  4LDY A;  1PC0 A;  1MUZ A;  2KY9 A;  2JOY A;  3CCL Q;  1ZSZ A;  1B34 B;  2EAY A;  2DD5 A;  3OQ5 A;  1PSE A;  2R5M A;  4F7N B;  4KRT A;  2E5Q A;  2CP2 A;  3VS6 A;  3CMA Q;  2D0N A;  3MEV A;  4A63 B;  2KYM A;  3C94 A;  2LX9 A;  1VQN T;  3PO3 S;  1WHL A;  4BCP B;  3HBL A;  4L59 A;  5GMK m;  2W2H A;  1H1P B;  2FVU A;  2VVK A;  3HKS A;  3H0H A;  4M78 D;  4EOM B;  1ZSZ C;  1Q81 U;  1VQ5 Q;  1SHF A;  5J26 A;  1VQ6 Q;  1BKB A;  1KHC A;  4TVR A;  1X6B A;  2E10 A;  3RKY A;  4CFN B;  5GAN d;  3VRZ A;  4E7S A;  3L2Q A;  3H8Z A;  1M1K U;  3K7A M;  3TN8 B;  4JLI A;  1I0C A;  1M90 U;  3I56 A;  2HD0 A;  4JX4 A;  3VJP A;  2O4X B;  3CC7 A;  2RA2 A;  1Q81 R;  4J5Y A;  5LJ3 j;  3BW1 A;  2E4H A;  1VQ4 T;  5A2Q E;  2RM4 A;  3EG3 A;  3QO3 A;  1TU0 B;  4XU2 A;  1S72 Q;  2RN8 A;  1M1K R;  4JJB A;  1X27 A;  1M90 R;  2M1H A;  3CCS T;  3CQT A;  4D6W A;  4JX6 A;  2FYK A;  1LOJ A;  5GJV B;  3A8O B;  2YDL A;  1FMK A;  2OTL Q;  2BKZ B;  3I35 A;  3BLQ B;  4AKI A;  1NE8 A;  2ZZD A;  5ACB A;  5HK0 A;  2RJE A;  5KYU B;  4AFQ C;  1YHQ Q;  4BI8 B;  1ARK A;  3OYC A;  1WFW A;  2KRO A;  1WQW A;  1C6V X;  4DEY A;  2E5K A;  1AD5 A;  2PUK B;  5LJ5 g;  1NBE B;  2K6D A;  2NUZ A;  5EJC A;  2NUP B;  4C0G A;  2CJM B;  4KRD B;  4FM4 B;  5GMK e;  3OW2 S;  1QCO A;  3UWN A;  1D1B A;  1YJN T;  4C5H A;  2PVO B;  2G77 A;  4C8Q C;  2BUD A;  4J9I A;  2DIL A;  3QWX X;  3X25 B;  2UZB B;  3CCM T;  1YIT T;  5FWB A;  5KYW A;  2DL8 A;  1D1A A;  1IGQ A;  4F7U G;  1PM3 A;  2IW8 B;  2DZC A;  2DL3 A;  2RF0 A;  3VS7 A;  4HNT A;  4BBS M;  1JJ2 S;  5HBJ B;  3PTA A;  5LJ5 f;  4MIM A;  3AHU A;  1BYM A;  2HZY A;  2GTJ A;  4LUD A;  3JCM P;  3REB B;  1H25 B;  3JB9 G;  5ICP B;  3RKW A;  3CXC A;  4C0Z A;  4FYW B;  2JMC A;  3REA B;  3UDC A;  1YJW A;  1OKV B;  2UZE B;  1E6G A;  3I5R A;  3KHI A;  1PD1 A;  2AZV A;  1TTH B;  1I8F A;  3MP1 A;  2CP3 A;  4RTT A;  5HY6 A;  2CP7 A;  3P8H A;  4EC9 B;  2MWO A;  4RTV A;  2L3R A;  1AD6 A;  1OZ3 A;  5LJ5 e;  2X4X A;  2PUO B;  1TOV A;  5GAM j;  2ED0 A;  2DVE A;  4E7J A;  3NGP A;  4HVU A;  1UJ0 A;  2L89 A;  1UHC A;  5KYN A;  2WAC A;  4B9X A;  1LCK A;  3FC3 A;  1H28 B;  2W96 A;  2EYZ A;  3CC4 T;  4OGE A;  3A98 A;  2M16 A;  1N6A A;  1IHW A;  1BI0 A;  2CS7 A;  3HFO A;  1RAA B;  4M75 F;  3OB9 A;  2D9T A;  2RB6 A;  3M0T A;  4JZ4 A;  3TSW A;  5GAN 4;  3C12 A;  4ELJ A;  1JU5 C;  3J81 E;  4F7U E;  1U5S A;  3L2U A;  3FEO A;  1B34 A;  1X2K A;  2DL4 A;  5AT1 B;  3CBO A;  2X51 A;  3VV0 A;  8AT1 B;  5ECA A;  2QQS A;  5GAO n;  3QHS A;  1VIN A;  3CCV A;  1WHJ A;  1WDX A;  4PFP A;  2PU9 B;  1TFB A;  4M7D C;  1O9K A;  4BCK B;  3MIA B;  2DNU A;  4IUR A;  2BS2 A;  1TUD A;  1RL2 A;  4DEX A;  1G3W A;  1VQ4 Q;  1SEM A;  1NYF A;  2JW4 A;  4J6Y A;  3OS1 A;  2J05 A;  2W10 A;  4C92 G;  3OYL A;  2EIF A;  1HXD A;  4HCZ A;  2KR3 A;  3CCS Q;  5LQF B;  1OU9 A;  2HSE B;  4HA8 A;  4JS5 A;  3L2W A;  2DET A;  5KCH A;  1B07 A;  2BE9 B;  1AHJ B;  5I21 A;  1XTD A;  5KH6 A;  1Y96 B;  2O4X A;  3P8D A;  3CD6 T;  2EYW A;  1UDL A;  1VA7 A;  3HRS A;  1FWZ A;  1UEB A;  5GAN h;  4RTY A;  2G9X B;  4M7A D;  2EJ9 A;  2EQK A;  1PRM C;  4IUP A;  2F2V A;  4ZTJ A;  4BUG A;  2YRD A;  5LJ5 d;  1OL2 B;  1YJN Q;  1NEB A;  2X4J A;  4OP0 A;  4F04 B;  3VS4 A;  1QW1 A;  2CZ0 B;  4E6R A;  4M75 B;  2KE9 A;  3H0F A;  3JV3 A;  1AWO A;  1NLP C;  4HL4 A;  2A37 A;  2CT4 A;  3M0U A;  1AZE A;  4D8D A;  5GMK i;  3JCM g;  4FW2 A;  1TSF A;  3I55 A;  1OV3 A;  4WTO B;  4MZP A;  2JTM A;  2NUP A;  2RQV A;  3ZL7 C;  3M0R A;  4BI3 A;  3JB9 D;  4JRK A;  5L23 A;  2OX7 A;  2K3Y A;  2EQI A;  3LQ5 B;  2J6O A;  3VUZ A;  4Y72 B;  4BY1 X;  3CXC S;  2ZPG B;  1K73 R;  3VUB A;  3JB9 I;  4NOY A;  2DXT A;  1G5V A;  2DE0 X;  4CFW B;  3R6N A;  1WHH A;  3F5X B;  4OB1 B;  4RG2 A;  4C92 E;  1Q86 C;  3QYH B;  3H0I A;  4EIK A;  2V1R A;  4WF2 A;  1W4S A;  2YUP A;  3RMQ A;  1XNI A;  3CME T;  2HMA A;  1G8X A;  2L3Q A;  2I0N A;  2LC4 A;  1M8V A;  1K9A A;  1RI0 A;  1QQJ A;  3ASK A;  4HCC A;  4LDV A;  4CRL B;  1VQ9 T;  1P92 A;  3KUF A;  1KG1 A;  3D7S B;  1KK7 A;  4PFZ A;  2PHG A;  2KVQ G;  3VYG B;  2YT6 A;  3SDZ A;  3CC4 Q;  2V8I A;  1I07 A;  2O2O A;  1RLQ C;  3TEE A;  1RAH B;  2CGH A;  3X24 B;  2CSQ A;  2WSC E;  2OTJ T;  1NPP A;  5CKF A;  2UZL B;  1JBM A;  2J7I A;  5EC7 A;  5LL6 S;  1OKW B;  4Y28 E;  2YRV A;  3G71 A;  3BG5 A;  4IUV A;  3G6E T;  2CRE A;  3BE3 A;  2GF7 A;  3A1P A;  1SPK A;  3EOC B;  1UJY A;  1VQ8 A;  4JPB W;  4HLQ A;  4KBM B;  4YOO A;  1Q81 C;  5IHN A;  3QJY A;  2XD0 A;  1B3Q A;  5DLQ E;  3V7S A;  2DK3 A;  5FW9 A;  4DBQ A;  5CEI B;  1AT1 B;  3KBG A;  5EG2 A;  4GLM A;  1R77 A;  1OI9 B;  1IB8 A;  3ME9 A;  3DJB A;  2P0K A;  4IUT A;  1VQM A;  2CH4 A;  1XO2 A;  4LOC A;  1UHF A;  2DTO A;  1ENW A;  3RIR A;  1D3U B;  2QG9 B;  1KC8 C;  3VRY A;  3G7Z A;  2G3R A;  1RAE B;  2RO0 A;  4XU0 A;  1QVF P;  2AKL A;  4A4G A;  4ANJ A;  4OGR B;  1VQL T;  5C6S A;  2CZ1 B;  2H8H A;  3CCJ T;  5GAN 2;  4F6W B;  3A8L B;  2BIV A;  1M27 C;  4PJL A;  5GJW B;  2V22 B;  5HVY B;  1M1F A;  4M78 G;  1VQP T;  2HQH A;  1NLO C;  4E7I A;  4PJO F;  3QHW B;  2EPD A;  3TQ7 P;  5GAN j;  1CSK A;  3RKX A;  3SFM A;  3BLH B;  2KRS A;  3S3O A;  2VKN A;  3OSS C;  4ZN3 A;  1I5O B;  2EUF A;  1JO8 A;  4J7I A;  1UGS B;  4QSH A;  1NPR A;  2Y4Y A;  3CPW A;  4E47 A;  1OIY B;  1R8O B;  1Y0M A;  1RLP C;  4NL2 A;  5IAY A;  1QVG P;  4IMY B;  4KGZ B;  2DTH A;  2JGZ B;  1Y96 A;  1I81 A;  4FU6 A;  4JS4 A;  1XQH A;  3JCM W;  4II5 B;  4FYV B;  3EG1 A;  1NM7 A;  1QLY A;  1BU1 A;  3TNI B;  2K2V A;  2WMB B;  3L2Z A;  4C8Q G;  7AT1 B;  1PKT A;  1C0M A;  1GCQ C;  1WQ7 A;  2EWN A;  2KMT A;  2LQ8 A;  2CZ6 B;  1UNL D;  3L42 A;  4ELL A;  1Y57 A;  2XHC A;  4PLI A;  3VS3 A;  5BNJ B;  4A4H A;  3CCL A;  2EBP A;  5KYW B;  1U8R A;  3H4C A;  2DF6 A;  1BCM A;  5DLO A;  2HDA A;  1QMZ B;  1W1F A;  3CCQ T;  2EFI A;  2BTT A;  5LJ5 h;  3CME Q;  1OUL A;  1G2B A;  1OI1 A;  4P5N A;  1H3Z A;  3WVD B;  4CFX B;  4KH0 B;  2AZS A;  4ROE A;  1XOV A;  2V1Q A;  4M75 C;  2EQJ A;  2WEV B;  4M78 E;  4XAX B;  1VQ5 A;  1BIB A;  1VQ6 A;  4KT0 E;  4LUE A;  4GBQ A;  4PJO B;  5CVI A;  3OYH A;  2P84 A;  3I5S A;  2DYI A;  4EDU A;  2IW6 B;  4MFE A;  4CC2 A;  4MDW A;  3OS2 A;  3OBY A;  5FLX E;  2R7G A;  4OMP A;  1WZO A;  1VQK Q;  2VGN A;  1QWF A;  3A8H B;  4QT7 A;  1HD3 A;  1H26 B;  4BXX X;  4BDZ A;  3UF4 A;  3NFC A;  1Q86 U;  2PK9 B;  2PVD B;  2DM1 A;  3GBQ A;  3R6O A;  3CCR A;  3QII A;  4C8Q E;  2LCL A;  5HBE B;  1MMN A;  4A53 A;  3CC7 T;  2EVR A;  3MEW A;  2OTL A;  1M30 A;  5D7U A;  1PG5 B;  2K5F A;  1NJI C;  1M9S A;  3OYF A;  1JQQ A;  1Q86 R;  3OS0 A;  1YHQ A;  4J83 A;  1VQL Q;  4M7D G;  3S6W A;  3MHX A;  1ZUU A;  4HVW A;  4D8K A;  2YUQ A;  5IN1 A;  1B7T A;  4EOI B;  2F2X A;  2DD4 B;  2KT8 A;  4XK8 E;  1O9K B;  1O75 A;  1W6X A;  1ABO A;  4J9C A;  2L5Q A;  3ER0 A;  2JT4 A;  2XIC A;  2QEX Q;  5IHY A;  1KQ1 A;  3QDR B;  2WFY B;  5IT9 E;  1KD1 R;  3FJ5 A;  1WLP B;  4FYX B;  2O9S A;  2XG8 D;  3CCE T;  2EGE A;  1FYN A;  2QXF A;  4M77 F;  3BDL A;  3OYG A;  2R57 A;  2QAZ A;  3QDF A;  1VIF A;  4QVD A;  5HK3 A;  3DLL A;  2WXV B;  2COW A;  4XTW A;  3CPW S;  4J6X A;  3X20 B;  4F16 A;  1KC8 U;  1U1S A;  4R56 A;  5L8R E;  2ED1 A;  4EOQ B;  5FRO A;  3C0C A;  2KNB B;  1H4L D;  2DBM A;  1K73 C;  3TSZ A;  4PKC C;  3M0Q A;  2FPF A;  1QKX A;  2FO0 A;  5HNB B;  1UG1 A;  4E2F B;  2KSS A;  4C8Q D;  1T3L A;  1YCY A;  1SRM A;  1HJD A;  1JRI A;  4OB3 B;  2GBQ A;  1KC8 R;  3GIB A;  1JST B;  1YJW T;  1ACM B;  3OY9 A;  2RD1 A;  1YI2 Q;  1JOW A;  4BAC A;  1GRI A;  3QHR B;  2KR6 A;  4M7D E;  3CCQ Q;  2DXC B;  4M7A G;  3SEM A;  4RTW A;  4CFU D;  2J6F A;  5LJ3 f;  5LJ5 j;  3MPU B;  5GAN 5;  3OMC A;  3G4S T;  5IDP B;  2F5K A;  1IO6 A;  4XQ3 A;  4BCO B;  4C5I A;  4BCQ B;  5GMK l;  2PQW A;  1YJ9 T;  2ZPB B;  3BG3 A;  3MY1 B;  2H3J A;  5GAN 3;  4BE0 A;  2LCS A;  4N4I A;  1YIJ Q;  3JCM h;  3HB9 A;  2A7Y A;  1K8A C;  1GFC A;  3UPU A;  4E7L A;  3QWY A;  4M77 B;  3QYE A;  1KQS A;  1V76 A;  2HNI A;  3DB4 A;  2YHT A;  2PMI B;  4EOL B;  4RMO A;  1T0J A;  4VUB A;  5LJ3 e;  1YNZ A;  4KRC B;  4PJM A;  2JM9 A;  5IDN B;  3DTO A;  2J6K A;  3OMG A;  2K79 A;  1VQ4 A;  2F2C A;  4C0D B;  2DKG A;  3CC2 Q;  4ZGD B;  4KH1 B;  3CPF A;  3ULR B;  4AFZ C;  3HSB A;  1YFN A;  4PJO A;  1BI3 A;  1AZG B;  1AVZ C;  2X1N B;  3CCV T;  4C92 F;  4HT8 A;  3CCS A;  4OMN A;  4B9W A;  3CC7 Q;  4Y91 A;  1W2B S;  2WIP B;  3M0P A;  2DLP A;  1SSF A;  5FU6 B;  1IRE B;  3PIP A;  2DRK A;  1WXB A;  1GY3 B;  4JJD A;  3LYI A;  4ESR A;  3OYI A;  3JB9 H;  2ZCF B;  1AWW A;  4PJO C;  1URC B;  2YUN A;  4M7D D;  4M7A E;  2E70 A;  4TTH A;  2IPO B;  2NLU A;  5CO7 A;  2L0A A;  4OMO A;  1WX6 A;  4EOO B;  2DX1 A;  4RUG A;  4OVA A;  2Z0W A;  2LMJ A;  4AKH A;  3RMS A;  2HSP A;  1VQN Q;  2DJZ A;  2I53 A;  1DJ7 B;  2ATC B;  2IG0 A;  3OW2 P;  2DL7 A;  3BFM A;  2D6F A;  1BI1 A;  2QFZ A;  1HK9 A;  3QYG B;  2P0Q A;  3PMI A;  2QA4 T;  1F1B B;  4L5G A;  1KSW A;  1J3T A;  2VV5 A;  3FB9 A;  4RTX A;  4IKF A;  1K0X A;  1RAD B;  3CCE Q;  5GAM f;  1PRL C;  3BDU A;  1A0N B;  2E6N A;  3FRN A;  1PHT A;  3OBW A;  1OEB A;  3JCM J;  1JJ2 P;  2KMG A;  1QVG A;  3UA7 A;  2X9H A;  4X1V A;  2RHY A;  4F17 A;  2DD4 A;  3OYE A;  4Y92 A;  2BZ8 A;  1NJI U;  1MGQ A;  4PJN A;  5A0L A;  4LDX A;  2QQ9 A;  2ECZ A;  1S1N A;  3S3M A;  1AIS B;  5GAO r;  4PLL A;  5IXF A;  1E9H B;  4R55 A;  4CC3 A;  4BI4 A;  5DQW A;  5GAM e;  1GUX B;  2W99 A;  4BCM B;  3WVE B;  4C92 B;  5A0D A;  5GAO m;  5CCA A;  2KRM A;  2LNH B;  5IF1 B;  1NJI R;  1YJW Q;  2DPP B;  3DB3 A;  1M4Z A;  3M58 A;  2JTE A;  2ZPI B;  3DL1 A;  1PKS A;  2C0O A;  2CP0 A;  4CC7 A;  2IVX A;  3L2V A;  4FSX A;  2KDS A;  3X26 B;  1MMG A;  2HBW A;  4EON B;  1VOM A;  4A4E A;  3CC4 A;  1BK2 A;  3OYJ A;  3NPF A;  1K0S A;  5HBH B;  5FGK B;  1AOJ A;  1BBZ A;  1OU8 A;  2FZC B;  2HBP A;  2QGF B;  3EJ1 B;  3G4S Q;  1Q82 C;  1MND A;  2LT4 A;  2EGA A;  1TUG B;  4PFO A;  2FZG B;  3GNG A;  4KUL A;  4HKE A;  4OMM A;  1OYX A;  1K73 U;  1YJ9 Q;  2EJF A;  2ENM A;  3CCM Q;  1GH6 B;  3EG0 A;  1YIT Q;  3HP9 A;  4ROC A;  3SD4 A;  4Z6Y A;  2RQT A;  1PKD B;  4EOJ B;  1EZZ B;  5FWC A;  2HKQ B;  2K7A A;  2LVM A;  2DXC A;  3CBM A;  1YBY A;  2RQU A;  3V8K A;  4M75 G;  2DVJ A;  1KQS S;  2QTV A;  2PJQ A;  2JM8 A;  1Q95 G;  4R0K A;  4ORZ A;  2AIR B;  2JS2 A;  3MJX A;  3CCU A;  5CK9 A;  4BCN D;  1MV3 A;  4V2S A;  2RI3 A;  1VQ8 T;  3NMZ C;  3E9G A;  1X01 A;  1QWE A;  2QI2 A;  1UGR B;  1FMV A;  8ATC B;  1GBR A;  2QQR A;  1H1S B;  1UTI A;  2Y4X A;  1KJW A;  3BLR B;  3H6Z A;  3E19 A;  2QF7 A;  4HXJ A;  3BHU B;  1I4K 1;  3E1S A;  4WCI A;  2VXF A;  1ZA1 B;  4RCB A;  1ZHI A;  2C0T A;  4M77 A;  4MDX A;  5GAO l;  4JJC A;  3HHT B;  1VQM T;  4MMK A;  4MFD A;  1LVK A;  1VQO T;  2HCK A;  4XTV A;  1W70 A;  2CUB A;  2X3X D;  2KEA A;  2DL5 A;  2HL3 A;  2X3W D;  3HO8 A;  2DME A;  3DKM A;  4M78 F;  1K8A U;  2CDT A;  2JS0 A;  4XTY A;  2V8K A;  1KD1 C;  2WSF E;  1UGV A;  4M77 C;  4HNU A;  4QKU A;  2EGC A;  2KBT A;  4ZN1 A;  1K9M C;  1T0H A;  2DEU A;  2QA4 Q;  3X28 B;  3OS5 A;  2AHJ B;  2MK5 A;  2F2W A;  2XMF A;  3GLX A;  4IIM A;  1K8A R;  4X9D A;  1LPL A;  1H8K A;  4C0D C;  3QZ9 B;  1Y71 A;  4BBR M;  2ZPE B;  4J7F A;  1KQ2 A;  3QJ6 A;  1WI7 A;  1WIE A;  3LX7 A;  1YWO A;  3CBP A;  4HT9 A;  2NYS A;  3EAE A;  4BCG B;  4M75 E;  2KT1 A;  1ZQ1 A;  1EFN A;  4EMK B;  3M55 A;  3FDR A;  3J80 E;  3VKH A;  1UNH D;  4NC6 A;  1PD0 A;  4QVZ A;  5KYX A;  3H41 A;  3CXC P;  1PSF A;  2CKK A;  3BHT B;  2SRC A;  1H27 B;  1ZX6 A;  2JVV A;  4ELY C;  1VUB A;  2E3I A;  1PWT A;  1UNG D;  4JLG A;  4DBR A;  2W0Z A;  2LJ1 A;  5GAO p;  1N8R C;  2DFU A;  2DAQ A;  5DQV A;  2VUB A;  4E7H A;  2DIG A;  2KQW A;  2L8D A;  1HYO A;  4FL6 A;  1UB4 A;  3CME A;  1IZ6 A;  1QP3 A;  2K57 A;  1U3O A;  3ZFJ A;  3EFR A;  4CC4 B;  2LNV A;  3CD6 Q;  3CCL T;  4BY6 B;  4BCI B;  5J39 A;  5CR2 A;  3HPW A;  2FPD A;  4BE2 A;  3OYB A;  3PVQ A;  2YLC A;  1UEC A;  4M78 B;  2OAW A;  3FIF A;  3RUX A;  2DXU A;  2FG0 A;  2P0P A;  4C0F A;  5GMK h;  1Q7Y C;  1GUX A;  4C92 A;  1JEG A;  2LQK A;  3JCM V;  2K5I A;  4A4K A;  5CKE A;  2IN3 A;  3GP8 A;  1VQ7 T;  2WHB B;  1VQK A;  1KXU A;  2W9Z A;  2P4T A;  3QSU A;  4OMF B;  4J8O A;  2A28 A;  4YTL A;  1OQK A;  2XI9 A;  2M0O A;  4CFV B;  2ZPF B;  2JUF A;  4ZNX A;  1EX4 A;  3N5B B;  4O6J A;  2VC8 A;  4OF1 A;  4M75 D;  4PJJ A;  2XDD A;  2GFU A;  4FSS A;  4C92 C;  3QPH A;  5IHI A;  1FKM A;  1M1G A;  2DEQ A;  4EMG A;  4CI0 C;  2LRQ A;  4C8Q B;  2R5A A;  5GAN 6;  1WJS A;  1WNL A;  1IGU A;  4N4G A;  3QYB A;  2JXB A;  1WGS A;  2QQ8 A;  1GL5 A;  2DER A;  3TRE A;  3QWL A;  4F6S B;  3CCR T;  3L2R A;  1NEG A;  2OJ2 A;  1Q82 U;  5DY9 A;  3CMA A;  3EH1 A;  5I2M A;  4AT1 B;  1N9R A;  5DM7 R;  4CXA B;  1VQO Q;  2ABL A;  2QEX A;  1SKU B;  2EW3 A;  1VQ9 Q;  2L3P A;  1Y07 A;  5GAN 7;  2X4Y A;  2XDP A;  5CIU A;  3VS0 A;  2D0Q B;  4FX3 B;  3VYH B;  5HCK A;  4ME7 A;  1QCN A;  1H24 B;  1Q82 R;  3OYY A;  2EKO A;  1TWB A;  4J9H A;  1H64 1;  2OTJ Q;  1K1Z A;  2C0I A;  1RAG B;  4EOK B;  4KGX B;  1G3T A;  2KAF A;  2ZPH B;  3PE0 A;  5GAO q;  4PJO G;  3G6E Q; 
#chains in the Genus database with same CATH homology
 3OMC A;  4XTZ A;  4II1 A;  3JCM c;  3G4S T;  2F5K A;  2B8A A;  5FRN A;  4XQ3 A;  4C5I A;  4HA8 A;  5GMK l;  2PQW A;  4OGC A;  4A4F A;  4C5G A;  4JS5 A;  3L2W A;  4N0A C;  5KCH A;  3VKI A;  2MI6 A;  2RK2 A;  4Z02 A;  1AHJ B;  5I21 A;  5D6W A;  2ZPB B;  3BG3 A;  1XTD A;  1S72 A;  1M1K C;  3PT9 A;  2H3J A;  5KH6 A;  1Y96 B;  2O4X A;  2Y90 A;  3MEU A;  3P8D A;  1LJO A;  5GAN 3;  4BE0 A;  2MAM A;  3NTH A;  1M90 C;  3JSC A;  5HKC A;  2R58 A;  3CD6 T;  3I56 T;  3LWI A;  3HRS A;  4GLK A;  2VXE A;  4N4I A;  1FWZ A;  3HB9 A;  1UEB A;  4JUV A;  3P8B B;  2A7Y A;  3SB2 A;  3JCM h;  5CKD A;  3NTK A;  5GAN h;  3LH0 A;  3UPU A;  4E7L A;  1K8A C;  4M77 B;  4M7A D;  3QYE A;  2EJ9 A;  3GNF B;  1KQS A;  2EQK A;  1VIE A;  4LD9 K;  2HNI A;  3DB4 A;  2YHT A;  4IUP A;  5AYF A;  1VQ9 A;  4L6V 5;  4C92 D;  3M54 A;  4RMO A;  3URG A;  4VUB A;  4BUG A;  4ZTJ A;  5D6X A;  5LJ3 e;  5LJ5 d;  3CMA T;  1ZBX A;  1KD1 U;  2X4J A;  4OP0 A;  4DOW A;  1YI2 A;  1QVP A;  4PL6 A;  3PGG A;  3OMG A;  1VQ4 A;  1QW1 A;  2CZ0 B;  2OTJ A;  4M75 B;  4C0D B;  2DKG A;  4M7A F;  4ZGD B;  4HL4 A;  3DLM A;  2X35 A;  2RJC A;  3KXT A;  4JRQ A;  4QQD A;  3CPF A;  4ZGE B;  2QEX T;  3HSB A;  4M7D B;  4PJO A;  5GMK i;  1BI3 A;  3OYM A;  3CCV T;  3JCM g;  4C92 F;  1K9M U;  4HT8 A;  5GAN g;  1WJR A;  3G6E A;  3CCS A;  1VQ5 T;  4EMK A;  2C06 A;  3I55 A;  4B9W A;  3OYA A;  1VQ6 T;  3MP8 A;  2LDM A;  4Y91 A;  1O9S A;  4EPC A;  1W2B S;  3PMT A;  4RG8 A;  4BE1 A;  4XTU A;  4MZP A;  2DXB A;  2JZ2 A;  2JTM A;  4EMH A;  4CI0 C;  1SSF A;  3LGL A;  4BI3 A;  3JB9 D;  4JRK A;  1IRE B;  5FU6 B;  4NL3 A;  3PIP A;  2K3Y A;  4X9C A;  3QZ5 B;  1X6O A;  4MZT A;  3VUZ A;  3CXC S;  2ZPG B;  1MHN A;  1X75 C;  3VUB A;  4IUU A;  3JB9 I;  4F7U F;  3OYI A;  2ZZD B;  3LYI A;  4NOY A;  1YIJ A;  4MZM A;  3JB9 H;  2ZCF B;  2DXT A;  4PJO C;  1G5V A;  4M7D D;  4M7A E;  2E70 A;  2NLU A;  5LJ3 h;  5CO7 A;  2RJD A;  1FX7 A;  4M6V A;  2YLB A;  3HRT A;  4EMK C;  5GMK j;  5GAN f;  3PNW C;  5A0G A;  2RI5 A;  4OVA A;  4RG2 A;  4OB1 B;  5D6Y A;  4AKH A;  3RMS A;  4C92 E;  1Q86 C;  3QYH B;  2DJZ A;  4FT4 A;  4CRI A;  3JB9 F;  3V8L A;  2GCX A;  4PJO E;  1DJ7 B;  3OSV A;  1W4S A;  4WF2 A;  1S72 T;  2IG0 A;  3JCM X;  3RMQ A;  3JCM d;  3BFM A;  4HCB A;  2D6F A;  1BI1 A;  1XNI A;  2QFZ A;  3EFS A;  1HK9 A;  2DZ9 A;  3QYG B;  3QKJ A;  3CME T;  2P0Q A;  2XK0 A;  2MMP A;  3PMI A;  3V7R A;  1N8R U;  1VQL A;  2QA4 T;  4M7D F;  2LC4 A;  3BY7 A;  3SWN A;  3O8V A;  4L5G A;  3CC2 A;  1M8V A;  2DTI A;  2VV5 A;  3FB9 A;  3CCJ A;  1RI0 A;  4IKF A;  4XU1 A;  3ASK A;  4M78 A;  4LDV A;  4HCC A;  4GY5 A;  5CQX A;  4DOV A;  2OTL T;  1G3S A;  4MML A;  3M59 A;  1VQ9 T;  1P92 A;  3KUF A;  5GAM f;  1KG1 A;  3L1A A;  3BDU A;  2VGM A;  4FIB A;  2E6N A;  3FRN A;  3OBW A;  1WPY A;  2KVQ G;  3VYG B;  4M75 A;  5LJ3 g;  3HL8 A;  3JCM J;  3SDZ A;  3A8G B;  5CAI A;  1JB0 E;  2V8I A;  2DO3 A;  4ATO A;  2KMG A;  1YI2 T;  1QVG A;  3TEE A;  5GAN e;  2RHY A;  1VQP A;  1YHQ T;  4ZGJ B;  2CGH A;  2DD4 A;  3C4S A;  4FT2 A;  3X24 B;  2WSC E;  3M56 A;  3OYE A;  2OTJ T;  1NPP A;  4ELZ C;  1MGQ A;  1NJI U;  5CQY A;  5A0L A;  5CKF A;  4E7K A;  2QQ9 A;  1Y7X A;  4BY6 C;  4LDX A;  4N4H A;  1JBM A;  1M5Q 1;  3JB9 J;  4RKU E;  3SWN C;  5LL6 S;  2HAX A;  3HRU A;  5C0M A;  3OW2 A;  3F70 A;  1D3B B;  2RHU A;  4M78 C;  4BDY A;  4Y28 E;  3S3M A;  2YRV A;  3G71 A;  5KE3 A;  3BG5 A;  1V29 B;  4IUV A;  3G6E T;  5GAO r;  1BIA A;  4PLL A;  3GOX A;  2GF7 A;  1Q7Y U;  1UGP B;  5FU7 B;  1VQ8 A;  4M7A B;  4HLQ A;  4NS5 A;  4R55 A;  4KBM B;  2WSE E;  1Q81 C;  1VQN A;  4BI4 A;  3QJY A;  2GQV A;  1VQ7 A;  5GAM e;  1G3Y A;  5GAO m;  3UT1 A;  3WVE B;  2MWP A;  4C92 B;  5A0D A;  4C8Q A;  3OYD A;  2XD0 A;  5DLQ E;  5LJ5 j;  3V7S A;  3MO8 A;  5CCA A;  3HZJ A;  2DK3 A;  3M5A A;  2LTO A;  1JJ2 A;  4QVC A;  2GFA A;  2XU8 A;  2DPP B;  1YIJ T;  3KBG A;  2E6Z A;  2WJ9 A;  5EG2 A;  3DB3 A;  1M4Z A;  3M58 A;  2ZPI B;  3DL1 A;  2O01 E;  4KUI A;  4HNV A;  3M4G A;  3ME9 A;  3CCE A;  2P0K A;  4IUT A;  3L2V A;  1VQM A;  4FSX A;  3X26 B;  2KDS A;  3GF5 A;  4LOC A;  2DTO A;  2E65 A;  3RIR A;  2PVG B;  1KC8 C;  4A4E A;  4F7U B;  3G7Z A;  2G3R A;  3QXE B;  3CC4 A;  2RO0 A;  3MET A;  2E41 A;  2RI2 A;  3OYJ A;  4XU0 A;  4BD3 A;  2EQM A;  2HBP A;  4A4G A;  2QQA A;  3T9N A;  4PJO D;  3TCJ A;  3MP6 A;  1Q82 C;  1VQL T;  5C6S A;  2I2L A;  2LT4 A;  2RH2 A;  3BG9 A;  2CZ1 B;  3CC2 T;  2EQU A;  4UC4 A;  3GNG A;  3VYG A;  4KUL A;  3JCM Q;  3CCJ T;  3QUI A;  4HKE A;  5GAN 2;  5CKB A;  3V8J A;  2JTF A;  3A8L B;  1KHI A;  2QDJ A;  4M77 G;  1OYX A;  2BIV A;  1K73 U;  2EJF A;  3CCQ A;  1LNX A;  4JRI A;  5GAM h;  3HP9 A;  1W2B A;  4OB0 B;  3SD4 A;  4Z6Y A;  2CZ7 B;  1BI2 A;  1M1F A;  3TW7 A;  4M78 G;  1VQP T;  4E7I A;  2FB7 A;  1E7P A;  4PJO F;  4LDY A;  5KE2 A;  2A3L A;  2LVM A;  2KY9 A;  2DXC A;  2JOY A;  3CBM A;  1YBY A;  3LWH A;  5GAN j;  3RKX A;  3V8K A;  3SFM A;  4M75 G;  1I5L A;  1KQS S;  3S3O A;  1U1T A;  1B34 B;  2EAY A;  2DD5 A;  3OQ5 A;  3OSS C;  1PSE A;  2R5M A;  3CCU A;  3RER A;  4ZN3 A;  2E5Q A;  1QVF A;  3MEV A;  5CK9 A;  3C94 A;  4J7I A;  3VU3 C;  1UGS B;  4V2S A;  2RI3 A;  4QSH A;  1NPR A;  2Y4Y A;  3LW5 E;  3CPW A;  1VQ8 T;  4E47 A;  2LX9 A;  1X01 A;  1R8O B;  3E9G A;  4NL2 A;  2QI2 A;  2RHX A;  5IAY A;  1VQN T;  1UGR B;  5GAM g;  3HBL A;  4L59 A;  5GMK m;  2DTH A;  2QQR A;  3JRZ A;  2Y4X A;  1Y96 A;  3H6Z A;  3E19 A;  2QF7 A;  1I81 A;  2FVU A;  1I4K 1;  1XQH A;  3E1S A;  3HKS A;  4FU6 A;  4JS4 A;  3JCM W;  2VXF A;  4M78 D;  1Q81 U;  2JN0 A;  3G4S A;  5J26 A;  1BKB A;  1KHC A;  4TVR A;  3VKG A;  4RCB A;  1ZHI A;  1YJN A;  4J6W A;  2K5L A;  4M77 A;  2E10 A;  3RKY A;  4MDX A;  2K2V A;  5GAN d;  5GAO l;  3L2Z A;  4C8Q G;  3HHT B;  1VQM T;  4MMK A;  4QQ6 A;  3L2Q A;  4MFD A;  1WQ7 A;  2EWN A;  3H8Z A;  4XTV A;  1VQO T;  3CCM A;  1YJ9 A;  2KMT A;  1M1K U;  1YIT A;  2LQ8 A;  4JLI A;  2CZ6 B;  1QP2 A;  3QG1 A;  1M90 U;  3FJP A;  2BS4 A;  2OAU A;  3E9F A;  3OYK A;  3I56 A;  1N9S A;  3HO8 A;  2EJG A;  3DKM A;  3L42 A;  2HD0 A;  4M78 F;  4JX4 A;  3VJP A;  1K8A U;  3A5Z B;  4QQG A;  2HQX A;  2QTX A;  2F69 A;  2O4X B;  2XHC A;  4PLI A;  4XTY A;  2V8K A;  3CC7 A;  2RA2 A;  4A4H A;  1KD1 C;  3CCL A;  4OB2 B;  2K3X A;  2XDB A;  4J5Y A;  5FRM A;  1U8R A;  3H4C A;  5LJ3 j;  4M7D A;  2WSF E;  2MF2 A;  4AI6 A;  3BW1 A;  4M77 C;  5DLO A;  3PIO A;  5A2Q E;  2RM4 A;  3TU4 K;  1VQ4 T;  4HNU A;  3QO3 A;  4XU2 A;  3CCQ T;  2EFI A;  3M57 A;  1N27 A;  2RK1 A;  3Q1J A;  5LJ5 h;  4ZN1 A;  4M77 E;  2EYQ A;  1K9M C;  2RHZ A;  1OI1 A;  2IVW A;  4P5N A;  3X28 B;  2M1H A;  1H3Z A;  3WVD B;  3CCS T;  3OS5 A;  4D6W A;  3I55 T;  4JX6 A;  2FYK A;  2AHJ B;  1LOJ A;  3RES A;  3A8M B;  3A8O B;  5CKH A;  3GLX A;  1XOV A;  4M75 C;  4X9D A;  2EQJ A;  4AKI A;  4C0D C;  3QZ9 B;  1Y71 A;  4M78 E;  4XAX B;  4BBR M;  4JRP A;  2ZPE B;  1NE8 A;  2QQB A;  1BIB A;  2ZZD A;  4J7F A;  1VQ5 A;  2BS3 A;  3QJ6 A;  3CCU T;  2LCC A;  1KQ2 A;  1VQ6 A;  3MEA A;  4ZTF A;  4KT0 E;  2M9U A;  3LX7 A;  3CBP A;  5HK0 A;  4HT9 A;  3EAE A;  4C5E A;  4PJO B;  3PFS A;  4M75 E;  3LLR A;  2RJE A;  5CVI A;  3OYH A;  3TW6 A;  1ZQ1 A;  4BI8 B;  4EDU A;  3CEY A;  4AKG A;  5LJ3 d;  4EMK B;  3M55 A;  3OYC A;  3FDR A;  4MFE A;  1WQW A;  2VYT A;  3J80 E;  4MDW A;  3OA6 A;  3VKH A;  3OS2 A;  4NC6 A;  3OBY A;  2PUK B;  5LJ5 g;  4QVZ A;  2BKD N;  3JAM E;  5M9O A;  4KUD K;  2DXB B;  5EJC A;  3C95 A;  5FLX E;  4C0G A;  1PSF A;  2JNG A;  4X34 A;  2CKK A;  4FM4 B;  5GMK e;  4JJN K;  3OW2 S;  2VGN A;  4RCC A;  3UWN A;  2JVV A;  4ELY C;  3A8H B;  3HFN A;  1YJN T;  1VUB A;  2FHD A;  3S3N A;  4C5H A;  3J7A F;  2PVO B;  2G77 A;  4JLG A;  4BDZ A;  4C8Q C;  3NFC A;  5GAO p;  2BUD A;  1Q86 U;  1N8R C;  3M53 A;  1UGQ B;  2DAQ A;  3X25 B;  2PVD B;  2VUB A;  4IUQ A;  3R6O A;  3CCM T;  2DIG A;  4E7H A;  1YIT T;  4JDS A;  2KQW A;  2L8D A;  4LD6 A;  3CCR A;  2CYZ B;  3FLG A;  3QII A;  1UB4 A;  2LCL A;  4FL6 A;  1IZ6 A;  1QP3 A;  2K57 A;  4C8Q E;  4F7U G;  2DZC A;  3CME A;  4HNT A;  4BBS M;  4A53 A;  2QA4 A;  3PTA A;  1JJ2 S;  5LJ5 f;  3ZFJ A;  4MIM A;  3EFR A;  3ZBD A;  3CC7 T;  5GAN 8;  2LNV A;  3MEW A;  3QBY A;  3CCL T;  2OTL A;  3AHU A;  1BYM A;  4BY6 B;  5J39 A;  5CR2 A;  3JCM P;  3HPW A;  2K5F A;  3INZ A;  3SWN B;  3JB9 G;  4BE2 A;  3OYB A;  1D3B A;  2YLC A;  1NJI C;  3RKW A;  1M9S A;  3CXC A;  4M78 B;  4C0Z A;  3OYF A;  3FIF A;  3RUX A;  2DXU A;  5J3B A;  3OYN A;  3UDC A;  2P0P A;  1YJW A;  3OS0 A;  1YHQ A;  4J83 A;  4M7A A;  4C0F A;  4M7D G;  2K4Y A;  3S6W A;  3MHX A;  3JCM b;  3G71 T;  3KHI A;  4LDU A;  5GMK h;  1Q7Y C;  3GPL A;  5IN1 A;  2E1H A;  4C92 A;  2LQK A;  3JCM V;  2K5I A;  2XKO C;  1I8F A;  2ZGW A;  2DD4 B;  3MP1 A;  5CKE A;  5HY6 A;  3V7C A;  4M77 D;  4A4K A;  4XK8 E;  3P8H A;  1O75 A;  1VQ7 T;  3GP8 A;  2MWO A;  1VQK A;  3QSU A;  2P4T A;  2L3R A;  4OMF B;  1FXX A;  1OZ3 A;  2L5Q A;  3ER0 A;  2X4X A;  2XIC A;  4J8O A;  5LJ5 e;  2PUO B;  4YTL A;  5KCO A;  5GAM j;  2DVE A;  1KQ1 A;  2RHI A;  2XI9 A;  4E7J A;  3QDR B;  2RJF A;  5IT9 E;  2M0O A;  5LJ3 f;  2ZPF B;  5FU7 C;  4M7A C;  2JUF A;  3N5B B;  4O6J A;  1YJ9 T;  3M9Q A;  4F7U A;  2VC8 A;  4OF1 A;  4M75 D;  2XG8 D;  3CCE T;  2XDD A;  2GFU A;  4XTX A;  2QXF A;  4M77 F;  1QVF S;  4C92 C;  3BDL A;  3OYG A;  2R57 A;  3QPH A;  1FKM A;  1M1G A;  2DEQ A;  2L89 A;  4EMG A;  1VIF A;  2WAC A;  2LRQ A;  4B9X A;  4C8Q B;  2R5A A;  4QVD A;  5HK3 A;  5GAN 6;  5GAO q;  3FC3 A;  3CC4 T;  1WJS A;  2F5T X;  1WNL A;  3JCM f;  4OGE A;  3LGF A;  2DIQ A;  4N4G A;  3QYB A;  3DLL A;  3CD6 A;  4JX5 A;  1N6A A;  2M16 A;  1WGS A;  4XU3 A;  2QQ8 A;  2HQE A;  1BI0 A;  4XTW A;  3CPW S;  4J6X A;  3X20 B;  2XID A;  4O5V A;  5I2S A;  1U1S A;  3ZEH A;  4R56 A;  1KC8 U;  5L8R E;  3QWL A;  2CS7 A;  3HFO A;  3TRE A;  4Q5W A;  3M4Y A;  2V8J A;  5FRO A;  4M75 F;  1VQO A;  3CCR T;  3OB9 A;  2D9T A;  2RB6 A;  3L2R A;  5GAM d;  1WJQ A;  1K73 C;  1OZ2 A;  4PKC C;  4DQ2 A;  1Q82 U;  1QLB A;  1TH7 A;  5DY9 A;  5GAN 4;  3C12 A;  3CMA A;  4ELJ A;  5I2M A;  2E64 A;  1N9R A;  2KSS A;  4HCZ A;  4C8Q D;  4F7U E;  5DM7 R;  3J81 E;  2QDY B;  1B34 A;  3FEO A;  3L2U A;  3MCA B;  1YCY A;  3CBO A;  3VV0 A;  2QEX A;  2QQS A;  2KK4 A;  2X4W A;  1JRI A;  4OB3 B;  3QHS A;  4QW2 A;  5GAO n;  3GIB A;  3CCV A;  1Y07 A;  5GAN 7;  1NZ9 A;  3JCM e;  2X4Y A;  2XDP A;  4LDW A;  1YJW T;  5CIU A;  4A54 A;  2D0Q B;  2E12 A;  4DA4 A;  2PU9 B;  3OY9 A;  2RD1 A;  4M7D C;  3VYH B;  4IUR A;  4ME7 A;  2BS2 A;  4PNO A;  4BAC A;  4N0A A;  1RL2 A;  2FL7 A;  1GXI E;  3OYY A;  1QVG S;  2EKO A;  4C8Q F;  4BB7 A;  1G3W A;  1EIF A;  1H64 1;  3NTI A;  2KR6 A;  4M7D E;  4J6Y A;  2DXC B;  4M7A G;  3WXM B;  1VQK T;  3OS1 A;  2LT1 A;  1G3T A;  5FU6 C;  2DD5 B;  2KAF A;  4C92 G;  3OYL A;  2ZPH B;  2EIF A;  1HXD A;  4PJO G;  5GAN 5; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...