3DJBA

Crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
188
Chain Sequence
TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADLNESEEAGMKKVSDWLEELHVEEEESKHVLHIIANMSIEGKLVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPRDPSLNHFYEKLLKLKDLMNTNAAKQEAEVRHRYMEQFIEQFMKEWNAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, HD family
publication title Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Hydrolase
total genus 50
structure length 188
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3djbA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3djbA02
3B57A 2QGSA 2PJQA 3DJBA 3DTOA 5DQWA 5IHYA 5DQVA
chains in the Genus database with same CATH superfamily
1OIYB 1AISB 4X1YE 3JAEA 1H28B 1UNLD 3BQKA 3UFEA 4IL9A 3FZKB 2WDRA 4BY7X 1VCSA 4CFXB 2QYWA 2UZEB 2CHNA 3X1DA 4YTPA 5HCMA 1MIWA 5JH7E 3I9WA 4YFSA 3F2EA 5IWAT 2EHOD 3UQ4A 2WMNA 2YK0A 4CZZB 5HBEB 4WNKA 1H1RB 2V1DB 2X0LB 3J9X1 5LYJE 4YHHT 3LQ5B 2G0UA 3T1HT 2KNDA 5ICPB 1JNZA 3T1YT 2X0HA 4MLKA 3FBLA 4TTHA 4IE5A 1ZEEA 3AXJA 1MMDA 4PFPA 4EOZB 5L3GB 3B5MA 2CCQA 4NPPA 3RKOA 5HXRA 3VRAA 4EYYR 3TW6A 5TAOA 3O9XA 2EHOA 2W62A 4LF6T 1IBMT 3HL6A 2XAFB 3QK6A 1WYBA 1LVFA 4WZXA 2WMBB 2CHOA 3ZEFB 4KI0F 1V29B 3QYEA 3DL1A 2ZLYA 3FZLB 4IHJE 5A1LA 4IMYB 1SUMB 3HKEE 2PFVA 3AA7B 2VK9A 1NAFA 3K1SA 3OKQA 5DABA 4OB3B 2XM2A 2LM2A 2LOPA 3QZ9B 3ZT7A 3ONXA 5I5ZB 3ZYMA 3J7Yq 4MALA 2UXDT 2ZPHB 2WU5A 4HNTA 2NW9A 3A8GB 2PBIA 2XQ4A 1IZNB 1QLBA 2PK2A 4ROCA 2CZ1B 1W0BA 2VVSA 4M1PA 4NUVA 5LG3A 2YOEA 4BCPB 3OBVE 1M7KA 1MMAA 3B13A 5KXJA 5FVLA 1FJGT 1H1PB 5L4HA 2IAKA 3ZYLA 1JSUB 2W63A 4J2CA 3AECA 3P4QA 1N33T 3KBTA 4CXWA 3AEGA 2IVXA 4H63H 2F2CA 5HXCA 3ANWB 1EZ3A 5HWYA 2JQQA 5EFQB 1AHJB 1XMOT 4KRDB 5CEIB 1IREB 3AA0B 1O9KA 3BG5A 1TFBA 3E0ZA 5J0ZA 1J5ET 2L9QA 3HKBE 3PUAA 3U78A 3AEAA 5DQVA 2V8SV 5FP3A 3UT5E 4HWIB 2W4XA 4KRCB 2UXBT 1S35A 1LVKA 3KVAA 4G2AA 1TD6A 2DD5B 2NTXA 3UFGA 4Z8XA 4PJJA 2A72A 1H26B 4ANJA 4HN9A 1H1SB 1KNZA 5AQVB 2XSBA 3HB9A 1HNZT 2J1DG 1BU2A 4ADZA 2A3DA 3TNHB 3LK2B 2CWOA 3FBZA 4F7LB 4AKLA 2C0SA 1UX4A 2R6GF 2WU2A 5JRCA 4DIDB 4JI0T 3BLRB 2WPAB 4YTMA 4IDZA 2OA5A 3HO8A 2IW5B 3GA8A 3OYZA 4HWHA 3ZLIA 3FZFB 3EI0A 5FY0A 4BCQD 3CWZB 3QC9A 5L47A 2BG9C 4CN4A 3KVBA 2LRLA 2KSRA 2WM9A 4ZZCA 3KBUA 1HR0T 3C98B 2AHJB 1E2AA 2ZZDB 5EJCA 3G06A 3ZT5A 4F6UB 2RA1A 5HXHA 3IBPA 5CFBA 1CHUA 3BHUB 1XDPA 3JADA 5FXXA 4UVCB 3TLTA 5IHYA 5FL1A 3P8CD 2W9ZA 2W61A 3ZMTB 4LF4T 1HG2A 2K3WA 4AKGA 3KV9A 3RGFB 2WJ9A 4G63A 2P9BA 4HE8A 2NWBA 3G33B 3N2GE 4ZGEB 5HNBB 4IE6A 2KINB 4CI3B 2YEVC 3MIAB 4BCGB 4UXNB 5HVYB 3N5LA 1GQEA 1H25B 3PUQA 4G6LB 2E9XC 1URCB 2VL8A 4NUUA 3PJAA 2ZMAA 4BCND 3O4XE 4FX3B 3NKZA 3NRYA 4LF8T 3CQCB 2DXCB 2LEHA 3RRWA 4X20E 5CYIB 2M67A 3L8RA 2BG9A 4JUYA 1XDOA 3HHTB 2QVAA 3UUMA 3CMLA 2DNXA 2FJEA 3VYGB 1XNRT 3FXEB 1LKXA 1H27B 2B1EA 2H3RA 3QXEB 4IDQA 3L09A 2C5JA 3AE5A 3DP7A 4CFNB 1OL1B 3NDQA 4QXHB 3W15B 4DBRA 2X9WA 2CPTA 4GK0E 4U72A 4NC6A 5BMVE 3GTMS 4IE0A 2C5OB 1BR1A 3RC3A 5HEHA 1DU2A 4A97A 1FMVA 5JVDE 3K3QC 2XQ9A 3O1HA 1ZV4X 4UV8B 2CLYB 4BCMB 1XWMA 5JREA 1HNWT 4HL4A 1MMGA 3E08A 3TLSA 4YT0A 2ACZA 4K0KT 1H1QB 5ABHA 4Z90A 3UU8A 4HFIA 2E9XA 3AE6A 3KV4A 3PU3A 2V7LA 5FGKB 4X1IE 2IHR1 3LJCA 1QUUA 3I9YA 2LJLA 1UGPB 5J1GA 4LFAT 4JX6A 3VR8A 2ZCFB 2JGZB 5JR9C 3X26B 2GK9A 2NTYA 4TZ4C 2JPFA 4BA9A 4EEDA 2X9XA 5LGNB 5C8YE 4JI7T 5HWXA 2LM9A 2W2HA 1FEWA 3N9LA 2Y48B 2WFYB 3VKGA 4ILAA 4IIJE 3KINB 2ES0A 4B3MT 2H7VC 3RIUC 1KFYA 3PU8A 1KNRA 2DL1A 2MOZA 4ERRA 3AE9A 4BJMA 2DI4A 4NIQA 4LF5T 1PKDB 5H6QB 5JDLA 3PUYF 2BPMB 3TN8B 2X68A 2E8IA 2MTQA 2XQYA 3FZMB 2QGSA 4MIMA 2F4VT 3BG9A 4TN7B 3RYHE 1AD6A 3RPUA 5F5WA 1ZHCA 5L3FB 5ACBA 4GKJT 5FVKA 4F70B 4BCHB 1YKHB 5KMGP 4JX4A 2FJBA 1Z8UA 4DR7T 5ETWA 4OGRB 1W98B 4YY3T 2BG9B 2A2FX 1GUXB 2G77A 1BR4A 5JR9A 4YLHA 3N9QA 1HF8A 2V6XA 2CCHB 4QH4A 4HLQA 4DNDA 4IGUA 4MHCA 4MFRA 5L3BB 5LNKA 4YOZA 2KT9A 4QSHA 4HFCA 3MZKB 3N9MA 1KK7A 3ZN0B 4EV6A 1J5WA 3N2OA 1C9BA 3P4WA 1E9HB 3X25B 4X64T 2UUBT 4JLEA 4PJNA 3ZSSA 1D0YA 3RIUA 2MBGA 3BQIA 2DWKA 5C3JA 1FMWA 4I0UA 3UU3A 1JNRA 1XZYA 3N9PA 2UUEB 4I55E 1Y64B 2IDOB 4AQYT 2CBJA 4LOCA 3C64A 5AQQB 3NVOA 5IDPB 1U5PA 4F7SB 3Q2MA 4IREA 2E9XB 2X51A 5AQRB 2UUCT 3EDVA 1IBLT 1JKWA 2HH7A 3PTRB 3R6NA 4COFA 5HBHB 2WWUA 2W0GA 3AVRA 4LF9T 2XSAA 3Q9DA 4DV5T 2XJ7A 4P0AA 5HQ0B 2XQ8A 4BCOB 4ELLA 4O8SA 1LRZA 1M62A 2B9RA 2BKNA 3ONJA 3MA9A 4EZ4A 4ZGDB 2V6YA 4KMCA 2M6IA 5JDMA 2DCFA 1W9RA 4EOSB 4P1NA 2J4GA 2WY2A 4OB2B 1X9BA 2DLRA 2DHRA 3H3MA 2CCIB 2WDVA 5IDNB 4B3TT 1I94T 2QDJA 4MFDA 4JI4T 1YD8G 4DR6T 2IN3A 5HBJB 3S4UA 5LB7B 5AQKB 4LMJA 4DO0A 4AKHA 2I0MA 3PO3S 2UZLB 4GIWA 4PK4A 2DWGA 3VRBA 4OB1B 2YDRA 4FI5A 5LP6E 2V5CA 1QSDA 3QYGB 1N32T 2XAHB 3BHVB 4MFEA 1MMNA 3JC6D 4UF0A 4HWCA 5EZYE 4HFBA 3VR9A 1T72A 2BBJA 5CJ5A 3PV0F 2L3LA 4HNVA 2LOSA 4WBOA 3ZSTA 3L39A 3K3OA 4ZI3C 4YJ2E 5AQMB 4A5XA 2LSJA 4PFOA 4X66T 3BHTB 4OX9T 3FXDB 3CQGB 4HTEA 2WMAB 4TNWA 5J2UE 1H7CA 1T7SA 5J2TE 2WZIA 3C4XA 4PK5A 2XQ6A 3QWLA 3P4SA 5C2TA 4GKKT 2OLTA 2K24A 1JOWA 4ELJA 4F6RC 2WDQA 3MI9B 4O4IE 2I40B 5AQGB 3AAAB 5CGMA 3ZN1B 2G9XB 4QHOA 4U31A 4M6VA 3C51A 3D0TA 1ENWA 5JDQA 4DR4T 2NP9A 4ZI3D 4DV3T 3SS1A 5ADXL 3ZCJA 1WCRA 4UEMA 4H9OC 4ZZBA 2KZ7B 2ZPGB 4AXPA 4JI1T 1YW0A 3CKDA 1ZP0A 1UNGD 3SFDA 2KLQA 3AEDA 1O3XA 4HWDA 2ODUA 3EVYA 3TLUA 3A8YC 3RX6A 2KMFA 5AQPB 3LK3B 3RLFF 3QYHB 3AXJB 2JQ9A 5FKYA 3PUXF 5LGTB 2R7GA 1UGSB 1KNPA 2V26A 3TW7A 2BVMA 2EHOB 4ISSA 1YKEB 1MIYA 5EK3A 2XAJB 2BKOA 3BLQB 3EAMA 3B57A 3LBXA 4O4HE 5FL0A 3ZJ2A 2IW8B 1VOMA 5F8PA 4CN6A 2CXDA 3K3NA 2ACXA 3ABVA 1N36T 4LFBT 3RYIE 4H9QC 3RC8A 3BQLA 4NXNT 3O0GD 2WMOA 2BBHA 3HI2A 3F57A 1VINA 4U2YA 5DQWA 4BXXX 2ZPIB 4CQIA 5KX5E 2EUFA 1US7B 3A8LB 4H9PC 2DD4B 3LFMA 5LMKB 4IDOA 2NW8A 2LHNA 3UUBA 4AKIA 1OEDC 1FVVB 2YN6A 2UXXB 3K8PC 5JDGA 1I6ZA 3RKGA 2HN1A 2V7MA 2JQKA 3JAFA 4JBWF 2WBLA 2Q9QD 3CIRA 3QYBA 3NBXX 3TNWB 3AB3B 3IA3A 4HGAA 1HX8A 3NZPA 1YQ4A 4HWFA 2BKZB 2PTFA 4HFVA 2LHRA 4Q25A 4EOMB 2I53A 4DV2T 5JDFA 4EOIB 4YSYA 1OIUB 1OKVB 2LSYA 3VU7H 3EIDB 2FJDA 4CXXA 2JQHA 3HZJA 5LBQB 3K7AM 4TV9E 4DUZT 1SA0E 1E1HB 4BCIB 5M4YA 4JI2T 1O9KB 1AJ3A 1H4LD 4I4TE 3RQUA 4DV6T 2KWIB 3QB5A 4A98A 1WFDA 1VCTA 4YJ3E 1KEYA 3HBLA 2JRKA 3MY1B 4EYUA 2XHEB 1OEDA 2MYSA 5IF1B 5HAXA 4ROEA 4PNIA 4KP3C 5BNJB 4JI8T 4H9RC 1HG5A 1UGOA 5E0OA 4U33A 3M03A 2VB6A 2H89A 3LDQB 3PDYA 4F7NB 5AQIB 3AEEA 3U3IA 4EOPB 4JYAT 3BLHB 1D0XA 4ZI7E 5H6RB 3BG3A 2LKHA 3ZC0A 4GYRA 1R8IA 4PJLA 4HKAA 5ABFA 3P4PA 5JRCB 1GY3B 5LMUT 2ZM8A 2LT3A 3EJ1B 2ZPBB 3UQ7A 3AE4A 2QF7A 3V5UA 1L0VA 2SPCA 4O4LE 3VHLA 4EZHA 1MIVA 1D1BA 4KX6A 2JIWA 3RHWA 5JTGA 4IE7A 4DBQA 2FBWA 3H4CA 3F31A 3N2KE 4OYJA 4JEHB 4FJOA 3UUNA 1G73A 2WWVA 4XZCA 4EGWA 2XQ3A 3ONLC 4TWHA 3AAIA 4JV5T 3WAJA 4H63V 1OEDE 2V7JA 4JI5T 3A5XA 2V7KA 4BCQB 3AE1A 5L4EA 4AI6A 4AQFC 2QQ8A 2B76A 2YU1A 2WAUA 3DDQB 2W96A 2K48A 3NZQA 1VYWB 3OPCA 4AQGA 4ZS2A 2HPJA 5EK2A 5LG4A 3RRCA 2BZBA 3MJXA 1KXUA 1U4QA 2LKGA 5IUXA 3AAEB 4XBFB 4KBMB 3KV6A 2CZ0B 2VKJA 5FY1A 4X62T 2YINA 3GWHA 3QHRB 4BCFB 2WCAA 1UURA 2E5LT 4DVDA 4KHZF 4CFUB 4V1Av 2PMIB 3NRXA 3M65A 5AQUB 4UN0A 1T98A 2VQET 2V5DA 4BBRM 3EABA 4DR2T 4O2BE 5FYMA 5DJQC 1W09A 4ZI2C 3AEBA 2HPLA 2UUAT 1GH6B 4XAXB 4EONB 2CRBA 4B3ST 2X67A 3EUHA 3M3ZB 2ZPEB 4YHJA 1OGUB 1HX1B 4O4JE 4EB6E 5AQNB 3PJAJ 2WSSV 4WBNE 1HFAA 4L5GA 4TNVA 3QNUA 2QFZA 4CN1A 4UV9B 3CPZA 5L3DB 3CX7B 3RI5A 2XAGB 3KHIA 3ZKRA 4L0RA 4DV1T 1NEKA 2LE8A 3RGLA 4PK6A 4IT4A 1D3UB 1HTJF 4JI3T 3N9OA 4AQFA 5ABFB 3WAKA 5LQFB 1X79A 4LMLA 1FIOA 4AISA 4QKNA 5AFUL 4HFEA 3QUJA 1WLXA 3I0OA 3IHRA 5JDHA 3LG7A 2W9FA 4ZI2D 2X9HA 4EOKB 4YOOA 3P50A 1G8XA 2W66A 2OV9A 4LFCT 4KHPT 4U7IA 3ZC1A 3HR0A 4F7JB 2UXCT 2WIPB 2VKOA 2PHGA 2Y8DA 3ANWA 1D0ZA 3C4ZA 2LSKA 2LLYA 2IC9A 3OTOT 3ESLA 3VYHB 2XTLA 1MNEA 2DPPB 2VKHA 3JC6C 3QZ5B 3P4RA 4JX5A 5FNVE 2C4GB 4ZGJB 2QDYB 3O1IA 2X66A 1JSTB 5JDNA 3I1AA 2Z6EA 4EEBA 2I59A 4KUMB 4BCKB 2VASA 2J47A 2W2UA 2E5VA 3UUXB 1UGQB 1IJ6A 2XASB 4X65T 4I43B 5EK4A 3RQWA 3OVUA 2L8KA 1J1JA 2W67A 2YKSA 2WB5A 3CVRA 3MKDA 3QB5K 3EHZA 3ZMUB 2C5KT 4EOJB 4CFMB 3I0QA 3IF8B 3OYXA 2M6BA 1ZOYA 5AQJB 1WR6A 3H3AA 4DUYT 4EC8B 2K5BB 1NWMX 4UIGA 4EAHA 2VL0A 5JR9B 4F8HA 3OJAA 1UNHD 1FINB 1WR0A 2KXPB 1YQ3A 4ILCA 2XUEA 5L3EB 1Z0PA 4N78D 5JQGE 3RIAA 4DV7T 1OL2B 3F5XB 2WQYA 5AQSB 2IW6B 4DV0T 4ZEYA 3HKDE 2WXVB 4P09A 3C4WA 4P0BA 4Z91A 4C91A 3A8HB 2XAQB 5ABEA 4YSXA 3NWIA 4NSTB 1ZKEA 4RODA 5LGUB 1VRBA 3AE2A 2C6TB 2ZM0A 3IEEA 4Z6YA 2ZPFB 3TKLB 2XM1A 4YXDA 1H24B 1OKWB 4H9NC 1N34T 3MACA 4YC3B 3WI3A 4B3RT 3PUGA 5F3JA 4TV8E 3ZT6A 4LMKA 2DXBB 4HFHA 1HNXT 2CLYC 2CEAA 2VWAA 3HKCE 1OXZA 1T8BA 4IDPA 1B7TA 3RYCE 4TUYE 1BR2A 4U2ZA 4CRLB 4OR5B 3X24B 4WYVA 1HS7A 4A56A 1YXRA 2NW7A 3JCFA 4DR1T 4TX5A 3TLVA 1IBKT 4O2AE 2V6YB 4DMVA 5CA0E 5AQOB 5HYAA 4ILUA 5HCJA 3SFEA 2CYZB 2D5UA 2D2SA 2CBIA 2D9DA 4BBSM 3GN5A 3ZMVB 3CX6B 3UU5A 4QXCB 4I3ZB 5L3CB 3A8OB 3X20B 1UK5A 5LHGB 4FM4B 2RPAA 4CI1B 2I6HA 3E22E 2CMRA 2VQFT 5FY7A 4BCMD 5AQHB 2Q9QC 3PE0A 5IYZE 4L9IA 3AA1B 2FUPA 4ZS3A 4PJMA 4JEUB 4BAYB 1UUSA 3VKHA 2KWHA 4QX7B 5LJNA 4YSZA 4CXYA 4UF0B 2IW9B 1CUNA 1SHZC 2V22B 5LHIB 3AA6B 4Y72B 3CK6A 3QOFA 4H9SE 3UU4A 4OYKA 3EOCB 2WEVB 2JMKA 4ZOLE 2PK9B 4EOQB 4ZXLA 4TWFA 4OB0B 3A7MA 2E2AA 3CQXC 4GYSA 1E7PA 1OWAA 4QXBB 5KDMC 3KFWX 1WRDA 2VURA 5FXZA 5HEJA 3FB2A 1XO2A 4EORB 2X1NB 1V9DA 4QX8B 2LSGA 2WS3A 3FZHB 5FXWA 3ETVA 3PURA 4DV4T 3SWHA 1UX5A 1UCUA 4ISTA 2LW4A 3UULA 2XQAA 1NENA 2BKPA 2IC6A 3Q5WA 3RF1A 5CA1E 2YDSA 3UTKA 4TWDA 4EOOB 2XY8B 5L2LA 4WW0A 2ODVA 3BK9A 4CFUD 4PW8A 4YOSA 2Q9QA 2NOXA 3PUVF 2BVLA 1N4MA 3LSVA 2MAWA 3WVDB 1IJ5A 2X9YA 1ZP2A 2C5IT 5AQTB 3FHNA 5HEUA 4CXAB 4CFWB 3GMIA 4E7ZA 2K9AA 5LCYA 3RH3A 2CXLA 4UVBB 3DDPB 2BS2A 4OFZA 2HHHT 4X1KE 3EDUA 3T8OA 4OHFA 3MXZA 5CB4E 2MPKA 5LA6E 2HN2A 3DJBA 3MY5B 4HFDA 3MK7C 4CI2B 5HXSA 4B6XA 2AXDS 3PUZF 4UR9A 3GN5B 2N2NA 2W99A 4IDNA 1GUXA 5BR8T 2CJMB 3ETUA 2JJ9A 1SE7A 3ZYKA 3LBXB 4F6SB 4GOUA 2WIHB 2LRKA 1KF6A 5FMNA 2N1GA 5LJMA 4JI6T 4MBQA 2WZHA 3AE7A 2UU9T 3ZMSB 4EOLB 3A8MB 3ZPOA 1MNDA 4QWNB 2E9XD 2BS3A 3KDSE 2XQ7A 2H88A 1FKMA 3N9NA 2D0TA 2RP4A 3P7IA 1WYCA 4II5B 5HEOA 2PJQA 2KR6A 2IIUA 3AVSA 4BY1X 4UVAB 4X5TA 4EXTA 2ZM6T 4DMWA 3SOLA 2BDEA 2C5XB 4OK0A 4GK5E 2CZ6B 3QHWB 1OI9B 4BCJB 2UZDB 5LHHB 3AE8A 1S94A 3R84B 5GONE 4AIUA 4EC9B 4QH5A 2JMHA 2WP9A 2CM0A 2D0UA 3PUSA 4ILBA 2VVNA 3RYFE 4ASKA 4UELA 3ZJ1A 2Y6XA 2BG9E 4DR3T 3DOGB 2D0QB 2J62A 1XNQT 2W00A 4IL4A 5ABGA 3WVEB 2C5NB 3PUWF 3TNIB 2CZ7B 5HXEA 4CFVB 4HEAA 2FJAA 4DR5T 4I50E 3TLWA 2Q9QB 3POMA 3Q5DA 3LK42 3Q5XA 3Q5EA 1BR0A 4C90A 3UU6A 2KMGA 1IAPA 2N9DA 2IMLA 5AQLB 2UZBB 2CA5A 4ZHQE 5LXTE 3AE3A 3DTOA 5L2WB 3L3PA 2QRXA 3V5SA 4F6WB 4EIWA 2DMEA 4U7YA 1P5EB 2BS4A 2LSIA 2PG8A 2XZEA 3AEFA 3HA4A 3SRZA 1OEDB 5AQFB 3ZMZB 2ZM2A 2NR4A 4BCNB 3RIFA 2X0YA 4NXMT 4U3CA 1G3NC 2A9UA 1Y01A 2CE7A 4BJNA 4IE4A 5LBMA 4YTNA 1HCIA 2V7IA 3O1JA 2CXFA 2VKDA 3C50A 1D1CA 1VOLA 3KV5A 4QH1A 5FXVA 4U74A 5HEGA 2IUBA 4AKRB 3H37A 2H7OA 2QA7A 2XQ5A 1D1AA 2EHOC 2AE9A 1UGRB 2CWYA 5LOVE 2UXNB 2XPKA 2YDQA 1W0AA 4K0UA 3X28B 1XMQT 3ZCIA 5LMNT 1QMZB 1F5QB 4E7SA 3CX8B 4PAGA 4HNUA 2WHBB 2YU2A 2C5VB 4LF7T
chains in the Genus database with same CATH topology
3LJCA 1ZKEA 4X1YE 1QUUA 5LGUB 1VRBA 3I9YA 2ZM0A 3IEEA 2LJLA 2WBLA 2Q9QD 3BQKA 5J1GA 3NBXX 3UFEA 3TKLB 5JR9C 2GK9A 2NTYA 4H9NC 4TZ4C 2JPFA 4BA9A 2X9XA 3MACA 5LGNB 3WI3A 3AB3B 5C8YE 4HGAA 1HX8A 3PUGA 5F3JA 4TV8E 3NZPA 5HWXA 2LM9A 1FEWA 3N9LA 4HFVA 2LHRA 2CLYC 1MIWA 5JH7E 2Y48B 3I9WA 2CEAA 4YFSA 3F2EA 3VKGA 2VWAA 4IIJE 2EHOD 2WMNA 3KINB 2ES0A 3HKCE 1OXZA 5JDFA 2YK0A 4CZZB 1B7TA 4WNKA 2H7VC 2LSYA 2V1DB 2X0LB 3J9X1 4TUYE 3RYCE 5LYJE 1BR2A 3PU8A 2G0UA 3VU7H 1HS7A 2KNDA 4A56A 2MOZA 2NW7A 4CXXA 4ERRA 5LBQB 4TV9E 4BJMA 4TX5A 2DI4A 4O2AE 5CA0E 1SA0E 4MLKA 4DMVA 1E1HB 3FBLA 5HYAA 4ILUA 5M4YA 4IE5A 5H6QB 5JDLA 1AJ3A 1ZEEA 1MMDA 4I4TE 2X68A 4PFPA 2E8IA 4EOZB 2MTQA 2D5UA 2XQYA 2D2SA 5L3GB 2CCQA 2QGSA 2KWIB 3GN5A 3RKOA 3ZMVB 5HXRA 3CX6B 4EYYR 4QXCB 5TAOA 4TN7B 3RYHE 3O9XA 2EHOA 5L3CB 2W62A 4YJ3E 2JRKA 3HL6A 3RPUA 4EYUA 5LHGB 2XAFB 3QK6A 1WYBA 1LVFA 1ZHCA 2XHEB 4CI1B 5L3FB 2MYSA 3E22E 5HAXA 2CMRA 3ZEFB 1YKHB 4PNIA 5FY7A 4KP3C 5KMGP 4H9RC 2ZLYA 4IHJE 1HG5A 5A1LA 5E0OA 2Q9QC 3PE0A 3HKEE 5ETWA 2PFVA 5IYZE 2VB6A 3AA1B 4L9IA 3AA7B 2A2FX 3PDYA 4JEUB 4PJMA 2VK9A 4ZS3A 1NAFA 4BAYB 3OKQA 3U3IA 5DABA 3VKHA 4ZI7E 1D0XA 5H6RB 2KWHA 1BR4A 4QX7B 5JR9A 2LOPA 4YLHA 3ZC0A 3N9QA 5LJNA 4GYRA 1HF8A 4PJLA 4CXYA 3ONXA 4HKAA 4DNDA 4UF0B 4IGUA 4MHCA 4MFRA 5L3BB 5JRCB 5LNKA 1SHZC 1CUNA 3ZYMA 2KT9A 2ZM8A 3J7Yq 4MALA 2LT3A 3MZKB 3N9MA 5LHIB 2NW9A 3AA6B 1KK7A 3ZN0B 3V5UA 4H9SE 3VHLA 2SPCA 4O4LE 3N2OA 4OYKA 4EZHA 1MIVA 2PBIA 1D1BA 4JLEA 4PJNA 1D0YA 1IZNB 2MBGA 2JMKA 3BQIA 4ZOLE 4IE7A 2DWKA 4DBQA 4M1PA 1FMWA 4NUVA 3F31A 3N2KE 3CQXC 3OBVE 3N9PA 4GYSA 4OYJA 4JEHB 1OWAA 4FJOA 4I55E 4QXBB 1MMAA 5KDMC 1Y64B 3KFWX 3B13A 1WRDA 3UUNA 5FXZA 1G73A 3FB2A 1V9DA 2IAKA 3C64A 4QX8B 4XZCA 3ZYLA 2LSGA 1U5PA 3Q2MA 2E9XB 2W63A 2X51A 4J2CA 3EDVA 5FXWA 2HH7A 3ETVA 3KBTA 3AAIA 3PTRB 3PURA 3R6NA 3SWHA 4CXWA 2WWUA 1UX5A 1UCUA 2W0GA 3WAJA 3AVRA 4H63H 4H63V 4ISTA 3UULA 5HXCA 3ANWB 2IC6A 3Q5WA 1EZ3A 2V7JA 5CA1E 3A5XA 3Q9DA 5HWYA 2V7KA 3UTKA 4P0AA 5L2LA 2JQQA 4WW0A 2ODVA 4AQFC 4AI6A 3BK9A 4PW8A 2Q9QA 4O8SA 1LRZA 3MA9A 2YU1A 2WAUA 2NOXA 4EZ4A 2BVLA 2K48A 3NZQA 4AQGA 4ZS2A 3AA0B 2HPJA 5EK2A 4KMCA 5JDMA 1IJ5A 2X9YA 3E0ZA 2C5IT 2DCFA 5LG4A 3RRCA 3FHNA 2L9QA 2BZBA 3MJXA 3HKBE 1U4QA 3PUAA 3U78A 3GMIA 4E7ZA 3AAEB 4XBFB 2K9AA 4KBMB 5LCYA 3RH3A 5DQVA 2CXLA 4UVBB 4OFZA 3KV6A 5FP3A 2VKJA 5FY1A 3UT5E 2DLRA 2DHRA 4X1KE 3EDUA 3T8OA 2YINA 3GWHA 4OHFA 3MXZA 1S35A 5CB4E 4DVDA 1LVKA 5LA6E 3KVAA 4V1Av 1YD8G 4G2AA 3NRXA 3M65A 2NTXA 3DJBA 3S4UA 4CI2B 3MK7C 5HXSA 1T98A 4B6XA 4Z8XA 4PJJA 2A72A 3GN5B 4O2BE 2N2NA 5FYMA 5DJQC 4ZI2C 4ANJA 4DO0A 2HPLA 4HN9A 4AKHA 4XAXB 4GIWA 2X67A 3ETUA 1KNZA 2JJ9A 4PK4A 3EUHA 2DWGA 2J1DG 3ZYKA 3LBXB 4FI5A 4YHJA 4O4JE 4EB6E 5LP6E 1QSDA 4ADZA 4GOUA 2A3DA 2WSSV 2XAHB 3LK2B 5FMNA 2CWOA 3FBZA 4WBNE 3JC6D 1MMNA 2N1GA 4UF0A 5LJMA 1HFAA 5EZYE 4AKLA 2C0SA 1UX4A 4MBQA 5JRCA 4L5GA 4UV9B 3ZMSB 3CPZA 4IDZA 5L3DB 2L3LA 2OA5A 2LOSA 4WBOA 1MNDA 4QWNB 2E9XD 3CX7B 3ZPOA 2IW5B 3KDSE 2XAGB 3K3OA 3N9NA 3GA8A 3OYZA 4L0RA 4ZI3C 2D0TA 4YJ2E 2LE8A 4PK6A 2LSJA 2RP4A 3ZLIA 3P7IA 4PFOA 1HTJF 1WYCA 5FY0A 3N9OA 4AQFA 3FXDB 3WAKA 1X79A 3CWZB 2PJQA 1FIOA 3QC9A 3CQGB 4HTEA 4QKNA 5AFUL 3AVSA 3QUJA 4UVAB 5J2UE 3KVBA 1H7CA 5J2TE 3C4XA 1WLXA 2WM9A 3I0OA 3IHRA 4EXTA 5JDHA 3LG7A 4DMWA 3KBUA 4ZI2D 2X9HA 3SOLA 2BDEA 3C98B 4PK5A 4OK0A 1G8XA 4GK5E 2K24A 2RA1A 5HXHA 3ZC1A 3HR0A 3IBPA 5LHHB 4F6RC 1S94A 3R84B 5GONE 4O4IE 2VKOA 2Y8DA 2JMHA 3ANWA 3AAAB 5FXXA 3ZN1B 2CM0A 4QHOA 4UVCB 1D0ZA 5IHYA 3C4ZA 2D0UA 2LSKA 3P8CD 3PUSA 2W61A 3C51A 3D0TA 3RYFE 4UELA 4ASKA 5JDQA 3ZMTB 2IC9A 1HG2A 3ZJ1A 4AKGA 3KV9A 2NP9A 3ESLA 4ZI3D 2XTLA 2Y6XA 3SS1A 1MNEA 4G63A 5ADXL 2P9BA 2W00A 4HE8A 3ZCJA 2NWBA 4UEMA 4H9OC 2VKHA 3N2GE 3JC6C 2KZ7B 4IE6A 5HXEA 4AXPA 1YW0A 2KINB 3CKDA 4HEAA 2YEVC 5FNVE 4CI3B 4UXNB 3N5LA 3O1IA 3PUQA 2E9XC 2KLQA 4I50E 1O3XA 2VL8A 4NUUA 2X66A 2Q9QB 2ODUA 2ZMAA 3EVYA 3LK42 3Q5XA 5JDNA 3I1AA 2Z6EA 1BR0A 3RX6A 2I59A 4C90A 3O4XE 4KUMB 1IAPA 2VASA 2KMFA 2N9DA 3LK3B 3NRYA 2CA5A 3UUXB 3CQCB 2LEHA 3RRWA 4ZHQE 5LXTE 4X20E 3DTOA 5LGTB 1IJ6A 2M67A 3L3PA 2XASB 2V26A 2BVMA 3V5SA 2EHOB 4JUYA 4ISSA 4EIWA 1YKEB 4I43B 5EK4A 1MIYA 2L8KA 2XAJB 5EK3A 3B57A 3LBXA 4O4HE 2LSIA 2PG8A 3HA4A 3SRZA 3CVRA 3UUMA 3CMLA 3ZJ2A 3MKDA 2DNXA 5F8PA 1VOMA 3ZMZB 2ZM2A 2CXDA 3FXEB 3ZMUB 3K3NA 2ACXA 2C5KT 1LKXA 3RYIE 3I0QA 3IF8B 2B1EA 3OYXA 4H9QC 2H3RA 3BQLA 3RC8A 2CE7A 4BJNA 4IE4A 5LBMA 1HCIA 1WR6A 2WMOA 3H3AA 3HI2A 2V7IA 3F57A 3O1JA 2CXFA 3L09A 2C5JA 3DP7A 5DQWA 2K5BB 2VKDA 1NWMX 3C50A 1D1CA 4UIGA 4EAHA 4QXHB 3KV5A 3W15B 4DBRA 2X9WA 4CQIA 5FXVA 5KX5E 4GK0E 4U74A 4U72A 5BMVE 5JR9B 1US7B 4AKRB 4IE0A 1BR1A 3H37A 3OJAA 2H7OA 3RC3A 2KXPB 2QA7A 1FMVA 5JVDE 2XUEA 3K3QC 5L3EB 1D1AA 1Z0PA 2EHOC 4H9PC 4N78D 5JQGE 3O1HA 3LFMA 2CWYA 5LOVE 2NW8A 2UXNB 1ZV4X 2LHNA 4UV8B 2CLYB 5JREA 4K0UA 1MMGA 4AKIA 3E08A 3ZCIA 3HKDE 4P09A 3C4WA 4P0BA 4E7SA 3CX8B 4PAGA 4C91A 2E9XA 2UXXB 2XAQB 3K8PC 5JDGA 3KV4A 3PU3A 2YU2A 2V7LA 4X1IE 2V7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B57 A;  2QGS A;  2PJQ A;  3DJB A;  3DTO A;  5DQW A;  5IHY A;  5DQV A; 
#chains in the Genus database with same CATH topology
 1OIY B;  1AIS B;  4X1Y E;  3JAE A;  1H28 B;  1UNL D;  3BQK A;  3UFE A;  4IL9 A;  3FZK B;  2WDR A;  4BY7 X;  1VCS A;  4CFX B;  2QYW A;  2UZE B;  2CHN A;  3X1D A;  4YTP A;  5HCM A;  1MIW A;  5JH7 E;  3I9W A;  4YFS A;  3F2E A;  5IWA T;  2EHO D;  3UQ4 A;  2WMN A;  2YK0 A;  4CZZ B;  5HBE B;  4WNK A;  1H1R B;  2V1D B;  2X0L B;  3J9X 1;  5LYJ E;  4YHH T;  3LQ5 B;  2G0U A;  3T1H T;  2KND A;  5ICP B;  1JNZ A;  3T1Y T;  2X0H A;  4MLK A;  3FBL A;  4TTH A;  4IE5 A;  1ZEE A;  3AXJ A;  1MMD A;  4PFP A;  4EOZ B;  5L3G B;  3B5M A;  2CCQ A;  4NPP A;  3RKO A;  5HXR A;  3VRA A;  4EYY R;  3TW6 A;  5TAO A;  3O9X A;  2EHO A;  2W62 A;  4LF6 T;  1IBM T;  3HL6 A;  2XAF B;  3QK6 A;  1WYB A;  1LVF A;  4WZX A;  2WMB B;  2CHO A;  3ZEF B;  4KI0 F;  1V29 B;  3QYE A;  3DL1 A;  2ZLY A;  3FZL B;  4IHJ E;  5A1L A;  4IMY B;  1SUM B;  3HKE E;  2PFV A;  3AA7 B;  2VK9 A;  1NAF A;  3K1S A;  3OKQ A;  5DAB A;  4OB3 B;  2XM2 A;  2LM2 A;  2LOP A;  3QZ9 B;  3ZT7 A;  3ONX A;  5I5Z B;  3ZYM A;  3J7Y q;  4MAL A;  2UXD T;  2ZPH B;  2WU5 A;  4HNT A;  2NW9 A;  3A8G B;  2PBI A;  2XQ4 A;  1IZN B;  1QLB A;  2PK2 A;  4ROC A;  2CZ1 B;  1W0B A;  2VVS A;  4M1P A;  4NUV A;  5LG3 A;  2YOE A;  4BCP B;  3OBV E;  1M7K A;  1MMA A;  3B13 A;  5KXJ A;  5FVL A;  1FJG T;  1H1P B;  5L4H A;  2IAK A;  3ZYL A;  1JSU B;  2W63 A;  4J2C A;  3AEC A;  3P4Q A;  1N33 T;  3KBT A;  4CXW A;  3AEG A;  2IVX A;  4H63 H;  2F2C A;  5HXC A;  3ANW B;  1EZ3 A;  5HWY A;  2JQQ A;  5EFQ B;  1AHJ B;  1XMO T;  4KRD B;  5CEI B;  1IRE B;  3AA0 B;  1O9K A;  3BG5 A;  1TFB A;  3E0Z A;  5J0Z A;  1J5E T;  2L9Q A;  3HKB E;  3PUA A;  3U78 A;  3AEA A;  5DQV A;  2V8S V;  5FP3 A;  3UT5 E;  4HWI B;  2W4X A;  4KRC B;  2UXB T;  1S35 A;  1LVK A;  3KVA A;  4G2A A;  1TD6 A;  2DD5 B;  2NTX A;  3UFG A;  4Z8X A;  4PJJ A;  2A72 A;  1H26 B;  4ANJ A;  4HN9 A;  1H1S B;  1KNZ A;  5AQV B;  2XSB A;  3HB9 A;  1HNZ T;  2J1D G;  1BU2 A;  4ADZ A;  2A3D A;  3TNH B;  3LK2 B;  2CWO A;  3FBZ A;  4F7L B;  4AKL A;  2C0S A;  1UX4 A;  2R6G F;  2WU2 A;  5JRC A;  4DID B;  4JI0 T;  3BLR B;  2WPA B;  4YTM A;  4IDZ A;  2OA5 A;  3HO8 A;  2IW5 B;  3GA8 A;  3OYZ A;  4HWH A;  3ZLI A;  3FZF B;  3EI0 A;  5FY0 A;  4BCQ D;  3CWZ B;  3QC9 A;  5L47 A;  2BG9 C;  4CN4 A;  3KVB A;  2LRL A;  2KSR A;  2WM9 A;  4ZZC A;  3KBU A;  1HR0 T;  3C98 B;  2AHJ B;  1E2A A;  2ZZD B;  5EJC A;  3G06 A;  3ZT5 A;  4F6U B;  2RA1 A;  5HXH A;  3IBP A;  5CFB A;  1CHU A;  3BHU B;  1XDP A;  3JAD A;  5FXX A;  4UVC B;  3TLT A;  5IHY A;  5FL1 A;  3P8C D;  2W9Z A;  2W61 A;  3ZMT B;  4LF4 T;  1HG2 A;  2K3W A;  4AKG A;  3KV9 A;  3RGF B;  2WJ9 A;  4G63 A;  2P9B A;  4HE8 A;  2NWB A;  3G33 B;  3N2G E;  4ZGE B;  5HNB B;  4IE6 A;  2KIN B;  4CI3 B;  2YEV C;  3MIA B;  4BCG B;  4UXN B;  5HVY B;  3N5L A;  1GQE A;  1H25 B;  3PUQ A;  4G6L B;  2E9X C;  1URC B;  2VL8 A;  4NUU A;  3PJA A;  2ZMA A;  4BCN D;  3O4X E;  4FX3 B;  3NKZ A;  3NRY A;  4LF8 T;  3CQC B;  2DXC B;  2LEH A;  3RRW A;  4X20 E;  5CYI B;  2M67 A;  3L8R A;  2BG9 A;  4JUY A;  1XDO A;  3HHT B;  2QVA A;  3UUM A;  3CML A;  2DNX A;  2FJE A;  3VYG B;  1XNR T;  3FXE B;  1LKX A;  1H27 B;  2B1E A;  2H3R A;  3QXE B;  4IDQ A;  3L09 A;  2C5J A;  3AE5 A;  3DP7 A;  4CFN B;  1OL1 B;  3NDQ A;  4QXH B;  3W15 B;  4DBR A;  2X9W A;  2CPT A;  4GK0 E;  4U72 A;  4NC6 A;  5BMV E;  3GTM S;  4IE0 A;  2C5O B;  1BR1 A;  3RC3 A;  5HEH A;  1DU2 A;  4A97 A;  1FMV A;  5JVD E;  3K3Q C;  2XQ9 A;  3O1H A;  1ZV4 X;  4UV8 B;  2CLY B;  4BCM B;  1XWM A;  5JRE A;  1HNW T;  4HL4 A;  1MMG A;  3E08 A;  3TLS A;  4YT0 A;  2ACZ A;  4K0K T;  1H1Q B;  5ABH A;  4Z90 A;  3UU8 A;  4HFI A;  2E9X A;  3AE6 A;  3KV4 A;  3PU3 A;  2V7L A;  5FGK B;  4X1I E;  2IHR 1;  3LJC A;  1QUU A;  3I9Y A;  2LJL A;  1UGP B;  5J1G A;  4LFA T;  4JX6 A;  3VR8 A;  2ZCF B;  2JGZ B;  5JR9 C;  3X26 B;  2GK9 A;  2NTY A;  4TZ4 C;  2JPF A;  4BA9 A;  4EED A;  2X9X A;  5LGN B;  5C8Y E;  4JI7 T;  5HWX A;  2LM9 A;  2W2H A;  1FEW A;  3N9L A;  2Y48 B;  2WFY B;  3VKG A;  4ILA A;  4IIJ E;  3KIN B;  2ES0 A;  4B3M T;  2H7V C;  3RIU C;  1KFY A;  3PU8 A;  1KNR A;  2DL1 A;  2MOZ A;  4ERR A;  3AE9 A;  4BJM A;  2DI4 A;  4NIQ A;  4LF5 T;  1PKD B;  5H6Q B;  5JDL A;  3PUY F;  2BPM B;  3TN8 B;  2X68 A;  2E8I A;  2MTQ A;  2XQY A;  3FZM B;  2QGS A;  4MIM A;  2F4V T;  3BG9 A;  4TN7 B;  3RYH E;  1AD6 A;  3RPU A;  5F5W A;  1ZHC A;  5L3F B;  5ACB A;  4GKJ T;  5FVK A;  4F70 B;  4BCH B;  1YKH B;  5KMG P;  4JX4 A;  2FJB A;  1Z8U A;  4DR7 T;  5ETW A;  4OGR B;  1W98 B;  4YY3 T;  2BG9 B;  2A2F X;  1GUX B;  2G77 A;  1BR4 A;  5JR9 A;  4YLH A;  3N9Q A;  1HF8 A;  2V6X A;  2CCH B;  4QH4 A;  4HLQ A;  4DND A;  4IGU A;  4MHC A;  4MFR A;  5L3B B;  5LNK A;  4YOZ A;  2KT9 A;  4QSH A;  4HFC A;  3MZK B;  3N9M A;  1KK7 A;  3ZN0 B;  4EV6 A;  1J5W A;  3N2O A;  1C9B A;  3P4W A;  1E9H B;  3X25 B;  4X64 T;  2UUB T;  4JLE A;  4PJN A;  3ZSS A;  1D0Y A;  3RIU A;  2MBG A;  3BQI A;  2DWK A;  5C3J A;  1FMW A;  4I0U A;  3UU3 A;  1JNR A;  1XZY A;  3N9P A;  2UUE B;  4I55 E;  1Y64 B;  2IDO B;  4AQY T;  2CBJ A;  4LOC A;  3C64 A;  5AQQ B;  3NVO A;  5IDP B;  1U5P A;  4F7S B;  3Q2M A;  4IRE A;  2E9X B;  2X51 A;  5AQR B;  2UUC T;  3EDV A;  1IBL T;  1JKW A;  2HH7 A;  3PTR B;  3R6N A;  4COF A;  5HBH B;  2WWU A;  2W0G A;  3AVR A;  4LF9 T;  2XSA A;  3Q9D A;  4DV5 T;  2XJ7 A;  4P0A A;  5HQ0 B;  2XQ8 A;  4BCO B;  4ELL A;  4O8S A;  1LRZ A;  1M62 A;  2B9R A;  2BKN A;  3ONJ A;  3MA9 A;  4EZ4 A;  4ZGD B;  2V6Y A;  4KMC A;  2M6I A;  5JDM A;  2DCF A;  1W9R A;  4EOS B;  4P1N A;  2J4G A;  2WY2 A;  4OB2 B;  1X9B A;  2DLR A;  2DHR A;  3H3M A;  2CCI B;  2WDV A;  5IDN B;  4B3T T;  1I94 T;  2QDJ A;  4MFD A;  4JI4 T;  1YD8 G;  4DR6 T;  2IN3 A;  5HBJ B;  3S4U A;  5LB7 B;  5AQK B;  4LMJ A;  4DO0 A;  4AKH A;  2I0M A;  3PO3 S;  2UZL B;  4GIW A;  4PK4 A;  2DWG A;  3VRB A;  4OB1 B;  2YDR A;  4FI5 A;  5LP6 E;  2V5C A;  1QSD A;  3QYG B;  1N32 T;  2XAH B;  3BHV B;  4MFE A;  1MMN A;  3JC6 D;  4UF0 A;  4HWC A;  5EZY E;  4HFB A;  3VR9 A;  1T72 A;  2BBJ A;  5CJ5 A;  3PV0 F;  2L3L A;  4HNV A;  2LOS A;  4WBO A;  3ZST A;  3L39 A;  3K3O A;  4ZI3 C;  4YJ2 E;  5AQM B;  4A5X A;  2LSJ A;  4PFO A;  4X66 T;  3BHT B;  4OX9 T;  3FXD B;  3CQG B;  4HTE A;  2WMA B;  4TNW A;  5J2U E;  1H7C A;  1T7S A;  5J2T E;  2WZI A;  3C4X A;  4PK5 A;  2XQ6 A;  3QWL A;  3P4S A;  5C2T A;  4GKK T;  2OLT A;  2K24 A;  1JOW A;  4ELJ A;  4F6R C;  2WDQ A;  3MI9 B;  4O4I E;  2I40 B;  5AQG B;  3AAA B;  5CGM A;  3ZN1 B;  2G9X B;  4QHO A;  4U31 A;  4M6V A;  3C51 A;  3D0T A;  1ENW A;  5JDQ A;  4DR4 T;  2NP9 A;  4ZI3 D;  4DV3 T;  3SS1 A;  5ADX L;  3ZCJ A;  1WCR A;  4UEM A;  4H9O C;  4ZZB A;  2KZ7 B;  2ZPG B;  4AXP A;  4JI1 T;  1YW0 A;  3CKD A;  1ZP0 A;  1UNG D;  3SFD A;  2KLQ A;  3AED A;  1O3X A;  4HWD A;  2ODU A;  3EVY A;  3TLU A;  3A8Y C;  3RX6 A;  2KMF A;  5AQP B;  3LK3 B;  3RLF F;  3QYH B;  3AXJ B;  2JQ9 A;  5FKY A;  3PUX F;  5LGT B;  2R7G A;  1UGS B;  1KNP A;  2V26 A;  3TW7 A;  2BVM A;  2EHO B;  4ISS A;  1YKE B;  1MIY A;  5EK3 A;  2XAJ B;  2BKO A;  3BLQ B;  3EAM A;  3B57 A;  3LBX A;  4O4H E;  5FL0 A;  3ZJ2 A;  2IW8 B;  1VOM A;  5F8P A;  4CN6 A;  2CXD A;  3K3N A;  2ACX A;  3ABV A;  1N36 T;  4LFB T;  3RYI E;  4H9Q C;  3RC8 A;  3BQL A;  4NXN T;  3O0G D;  2WMO A;  2BBH A;  3HI2 A;  3F57 A;  1VIN A;  4U2Y A;  5DQW A;  4BXX X;  2ZPI B;  4CQI A;  5KX5 E;  2EUF A;  1US7 B;  3A8L B;  4H9P C;  2DD4 B;  3LFM A;  5LMK B;  4IDO A;  2NW8 A;  2LHN A;  3UUB A;  4AKI A;  1OED C;  1FVV B;  2YN6 A;  2UXX B;  3K8P C;  5JDG A;  1I6Z A;  3RKG A;  2HN1 A;  2V7M A;  2JQK A;  3JAF A;  4JBW F;  2WBL A;  2Q9Q D;  3CIR A;  3QYB A;  3NBX X;  3TNW B;  3AB3 B;  3IA3 A;  4HGA A;  1HX8 A;  3NZP A;  1YQ4 A;  4HWF A;  2BKZ B;  2PTF A;  4HFV A;  2LHR A;  4Q25 A;  4EOM B;  2I53 A;  4DV2 T;  5JDF A;  4EOI B;  4YSY A;  1OIU B;  1OKV B;  2LSY A;  3VU7 H;  3EID B;  2FJD A;  4CXX A;  2JQH A;  3HZJ A;  5LBQ B;  3K7A M;  4TV9 E;  4DUZ T;  1SA0 E;  1E1H B;  4BCI B;  5M4Y A;  4JI2 T;  1O9K B;  1AJ3 A;  1H4L D;  4I4T E;  3RQU A;  4DV6 T;  2KWI B;  3QB5 A;  4A98 A;  1WFD A;  1VCT A;  4YJ3 E;  1KEY A;  3HBL A;  2JRK A;  3MY1 B;  4EYU A;  2XHE B;  1OED A;  2MYS A;  5IF1 B;  5HAX A;  4ROE A;  4PNI A;  4KP3 C;  5BNJ B;  4JI8 T;  4H9R C;  1HG5 A;  1UGO A;  5E0O A;  4U33 A;  3M03 A;  2VB6 A;  2H89 A;  3LDQ B;  3PDY A;  4F7N B;  5AQI B;  3AEE A;  3U3I A;  4EOP B;  4JYA T;  3BLH B;  1D0X A;  4ZI7 E;  5H6R B;  3BG3 A;  2LKH A;  3ZC0 A;  4GYR A;  1R8I A;  4PJL A;  4HKA A;  5ABF A;  3P4P A;  5JRC B;  1GY3 B;  5LMU T;  2ZM8 A;  2LT3 A;  3EJ1 B;  2ZPB B;  3UQ7 A;  3AE4 A;  2QF7 A;  3V5U A;  1L0V A;  2SPC A;  4O4L E;  3VHL A;  4EZH A;  1MIV A;  1D1B A;  4KX6 A;  2JIW A;  3RHW A;  5JTG A;  4IE7 A;  4DBQ A;  2FBW A;  3H4C A;  3F31 A;  3N2K E;  4OYJ A;  4JEH B;  4FJO A;  3UUN A;  1G73 A;  2WWV A;  4XZC A;  4EGW A;  2XQ3 A;  3ONL C;  4TWH A;  3AAI A;  4JV5 T;  3WAJ A;  4H63 V;  1OED E;  2V7J A;  4JI5 T;  3A5X A;  2V7K A;  4BCQ B;  3AE1 A;  5L4E A;  4AI6 A;  4AQF C;  2QQ8 A;  2B76 A;  2YU1 A;  2WAU A;  3DDQ B;  2W96 A;  2K48 A;  3NZQ A;  1VYW B;  3OPC A;  4AQG A;  4ZS2 A;  2HPJ A;  5EK2 A;  5LG4 A;  3RRC A;  2BZB A;  3MJX A;  1KXU A;  1U4Q A;  2LKG A;  5IUX A;  3AAE B;  4XBF B;  4KBM B;  3KV6 A;  2CZ0 B;  2VKJ A;  5FY1 A;  4X62 T;  2YIN A;  3GWH A;  3QHR B;  4BCF B;  2WCA A;  1UUR A;  2E5L T;  4DVD A;  4KHZ F;  4CFU B;  4V1A v;  2PMI B;  3NRX A;  3M65 A;  5AQU B;  4UN0 A;  1T98 A;  2VQE T;  2V5D A;  4BBR M;  3EAB A;  4DR2 T;  4O2B E;  5FYM A;  5DJQ C;  1W09 A;  4ZI2 C;  3AEB A;  2HPL A;  2UUA T;  1GH6 B;  4XAX B;  4EON B;  2CRB A;  4B3S T;  2X67 A;  3EUH A;  3M3Z B;  2ZPE B;  4YHJ A;  1OGU B;  1HX1 B;  4O4J E;  4EB6 E;  5AQN B;  3PJA J;  2WSS V;  4WBN E;  1HFA A;  4L5G A;  4TNV A;  3QNU A;  2QFZ A;  4CN1 A;  4UV9 B;  3CPZ A;  5L3D B;  3CX7 B;  3RI5 A;  2XAG B;  3KHI A;  3ZKR A;  4L0R A;  4DV1 T;  1NEK A;  2LE8 A;  3RGL A;  4PK6 A;  4IT4 A;  1D3U B;  1HTJ F;  4JI3 T;  3N9O A;  4AQF A;  5ABF B;  3WAK A;  5LQF B;  1X79 A;  4LML A;  1FIO A;  4AIS A;  4QKN A;  5AFU L;  4HFE A;  3QUJ A;  1WLX A;  3I0O A;  3IHR A;  5JDH A;  3LG7 A;  2W9F A;  4ZI2 D;  2X9H A;  4EOK B;  4YOO A;  3P50 A;  1G8X A;  2W66 A;  2OV9 A;  4LFC T;  4KHP T;  4U7I A;  3ZC1 A;  3HR0 A;  4F7J B;  2UXC T;  2WIP B;  2VKO A;  2PHG A;  2Y8D A;  3ANW A;  1D0Z A;  3C4Z A;  2LSK A;  2LLY A;  2IC9 A;  3OTO T;  3ESL A;  3VYH B;  2XTL A;  1MNE A;  2DPP B;  2VKH A;  3JC6 C;  3QZ5 B;  3P4R A;  4JX5 A;  5FNV E;  2C4G B;  4ZGJ B;  2QDY B;  3O1I A;  2X66 A;  1JST B;  5JDN A;  3I1A A;  2Z6E A;  4EEB A;  2I59 A;  4KUM B;  4BCK B;  2VAS A;  2J47 A;  2W2U A;  2E5V A;  3UUX B;  1UGQ B;  1IJ6 A;  2XAS B;  4X65 T;  4I43 B;  5EK4 A;  3RQW A;  3OVU A;  2L8K A;  1J1J A;  2W67 A;  2YKS A;  2WB5 A;  3CVR A;  3MKD A;  3QB5 K;  3EHZ A;  3ZMU B;  2C5K T;  4EOJ B;  4CFM B;  3I0Q A;  3IF8 B;  3OYX A;  2M6B A;  1ZOY A;  5AQJ B;  1WR6 A;  3H3A A;  4DUY T;  4EC8 B;  2K5B B;  1NWM X;  4UIG A;  4EAH A;  2VL0 A;  5JR9 B;  4F8H A;  3OJA A;  1UNH D;  1FIN B;  1WR0 A;  2KXP B;  1YQ3 A;  4ILC A;  2XUE A;  5L3E B;  1Z0P A;  4N78 D;  5JQG E;  3RIA A;  4DV7 T;  1OL2 B;  3F5X B;  2WQY A;  5AQS B;  2IW6 B;  4DV0 T;  4ZEY A;  3HKD E;  2WXV B;  4P09 A;  3C4W A;  4P0B A;  4Z91 A;  4C91 A;  3A8H B;  2XAQ B;  5ABE A;  4YSX A;  3NWI A;  4NST B;  1ZKE A;  4ROD A;  5LGU B;  1VRB A;  3AE2 A;  2C6T B;  2ZM0 A;  3IEE A;  4Z6Y A;  2ZPF B;  3TKL B;  2XM1 A;  4YXD A;  1H24 B;  1OKW B;  4H9N C;  1N34 T;  3MAC A;  4YC3 B;  3WI3 A;  4B3R T;  3PUG A;  5F3J A;  4TV8 E;  3ZT6 A;  4LMK A;  2DXB B;  4HFH A;  1HNX T;  2CLY C;  2CEA A;  2VWA A;  3HKC E;  1OXZ A;  1T8B A;  4IDP A;  1B7T A;  3RYC E;  4TUY E;  1BR2 A;  4U2Z A;  4CRL B;  4OR5 B;  3X24 B;  4WYV A;  1HS7 A;  4A56 A;  1YXR A;  2NW7 A;  3JCF A;  4DR1 T;  4TX5 A;  3TLV A;  1IBK T;  4O2A E;  2V6Y B;  4DMV A;  5CA0 E;  5AQO B;  5HYA A;  4ILU A;  5HCJ A;  3SFE A;  2CYZ B;  2D5U A;  2D2S A;  2CBI A;  2D9D A;  4BBS M;  3GN5 A;  3ZMV B;  3CX6 B;  3UU5 A;  4QXC B;  4I3Z B;  5L3C B;  3A8O B;  3X20 B;  1UK5 A;  5LHG B;  4FM4 B;  2RPA A;  4CI1 B;  2I6H A;  3E22 E;  2CMR A;  2VQF T;  5FY7 A;  4BCM D;  5AQH B;  2Q9Q C;  3PE0 A;  5IYZ E;  4L9I A;  3AA1 B;  2FUP A;  4ZS3 A;  4PJM A;  4JEU B;  4BAY B;  1UUS A;  3VKH A;  2KWH A;  4QX7 B;  5LJN A;  4YSZ A;  4CXY A;  4UF0 B;  2IW9 B;  1CUN A;  1SHZ C;  2V22 B;  5LHI B;  3AA6 B;  4Y72 B;  3CK6 A;  3QOF A;  4H9S E;  3UU4 A;  4OYK A;  3EOC B;  2WEV B;  2JMK A;  4ZOL E;  2PK9 B;  4EOQ B;  4ZXL A;  4TWF A;  4OB0 B;  3A7M A;  2E2A A;  3CQX C;  4GYS A;  1E7P A;  1OWA A;  4QXB B;  5KDM C;  3KFW X;  1WRD A;  2VUR A;  5FXZ A;  5HEJ A;  3FB2 A;  1XO2 A;  4EOR B;  2X1N B;  1V9D A;  4QX8 B;  2LSG A;  2WS3 A;  3FZH B;  5FXW A;  3ETV A;  3PUR A;  4DV4 T;  3SWH A;  1UX5 A;  1UCU A;  4IST A;  2LW4 A;  3UUL A;  2XQA A;  1NEN A;  2BKP A;  2IC6 A;  3Q5W A;  3RF1 A;  5CA1 E;  2YDS A;  3UTK A;  4TWD A;  4EOO B;  2XY8 B;  5L2L A;  4WW0 A;  2ODV A;  3BK9 A;  4CFU D;  4PW8 A;  4YOS A;  2Q9Q A;  2NOX A;  3PUV F;  2BVL A;  1N4M A;  3LSV A;  2MAW A;  3WVD B;  1IJ5 A;  2X9Y A;  1ZP2 A;  2C5I T;  5AQT B;  3FHN A;  5HEU A;  4CXA B;  4CFW B;  3GMI A;  4E7Z A;  2K9A A;  5LCY A;  3RH3 A;  2CXL A;  4UVB B;  3DDP B;  2BS2 A;  4OFZ A;  2HHH T;  4X1K E;  3EDU A;  3T8O A;  4OHF A;  3MXZ A;  5CB4 E;  2MPK A;  5LA6 E;  2HN2 A;  3DJB A;  3MY5 B;  4HFD A;  3MK7 C;  4CI2 B;  5HXS A;  4B6X A;  2AXD S;  3PUZ F;  4UR9 A;  3GN5 B;  2N2N A;  2W99 A;  4IDN A;  1GUX A;  5BR8 T;  2CJM B;  3ETU A;  2JJ9 A;  1SE7 A;  3ZYK A;  3LBX B;  4F6S B;  4GOU A;  2WIH B;  2LRK A;  1KF6 A;  5FMN A;  2N1G A;  5LJM A;  4JI6 T;  4MBQ A;  2WZH A;  3AE7 A;  2UU9 T;  3ZMS B;  4EOL B;  3A8M B;  3ZPO A;  1MND A;  4QWN B;  2E9X D;  2BS3 A;  3KDS E;  2XQ7 A;  2H88 A;  1FKM A;  3N9N A;  2D0T A;  2RP4 A;  3P7I A;  1WYC A;  4II5 B;  5HEO A;  2PJQ A;  2KR6 A;  2IIU A;  3AVS A;  4BY1 X;  4UVA B;  4X5T A;  4EXT A;  2ZM6 T;  4DMW A;  3SOL A;  2BDE A;  2C5X B;  4OK0 A;  4GK5 E;  2CZ6 B;  3QHW B;  1OI9 B;  4BCJ B;  2UZD B;  5LHH B;  3AE8 A;  1S94 A;  3R84 B;  5GON E;  4AIU A;  4EC9 B;  4QH5 A;  2JMH A;  2WP9 A;  2CM0 A;  2D0U A;  3PUS A;  4ILB A;  2VVN A;  3RYF E;  4ASK A;  4UEL A;  3ZJ1 A;  2Y6X A;  2BG9 E;  4DR3 T;  3DOG B;  2D0Q B;  2J62 A;  1XNQ T;  2W00 A;  4IL4 A;  5ABG A;  3WVE B;  2C5N B;  3PUW F;  3TNI B;  2CZ7 B;  5HXE A;  4CFV B;  4HEA A;  2FJA A;  4DR5 T;  4I50 E;  3TLW A;  2Q9Q B;  3POM A;  3Q5D A;  3LK4 2;  3Q5X A;  3Q5E A;  1BR0 A;  4C90 A;  3UU6 A;  2KMG A;  1IAP A;  2N9D A;  2IML A;  5AQL B;  2UZB B;  2CA5 A;  4ZHQ E;  5LXT E;  3AE3 A;  3DTO A;  5L2W B;  3L3P A;  2QRX A;  3V5S A;  4F6W B;  4EIW A;  2DME A;  4U7Y A;  1P5E B;  2BS4 A;  2LSI A;  2PG8 A;  2XZE A;  3AEF A;  3HA4 A;  3SRZ A;  1OED B;  5AQF B;  3ZMZ B;  2ZM2 A;  2NR4 A;  4BCN B;  3RIF A;  2X0Y A;  4NXM T;  4U3C A;  1G3N C;  2A9U A;  1Y01 A;  2CE7 A;  4BJN A;  4IE4 A;  5LBM A;  4YTN A;  1HCI A;  2V7I A;  3O1J A;  2CXF A;  2VKD A;  3C50 A;  1D1C A;  1VOL A;  3KV5 A;  4QH1 A;  5FXV A;  4U74 A;  5HEG A;  2IUB A;  4AKR B;  3H37 A;  2H7O A;  2QA7 A;  2XQ5 A;  1D1A A;  2EHO C;  2AE9 A;  1UGR B;  2CWY A;  5LOV E;  2UXN B;  2XPK A;  2YDQ A;  1W0A A;  4K0U A;  3X28 B;  1XMQ T;  3ZCI A;  5LMN T;  1QMZ B;  1F5Q B;  4E7S A;  3CX8 B;  4PAG A;  4HNU A;  2WHB B;  2YU2 A;  2C5V B;  4LF7 T; 
#chains in the Genus database with same CATH homology
 3LJC A;  1ZKE A;  4X1Y E;  1QUU A;  5LGU B;  1VRB A;  3I9Y A;  2ZM0 A;  3IEE A;  2LJL A;  2WBL A;  2Q9Q D;  3BQK A;  5J1G A;  3NBX X;  3UFE A;  3TKL B;  5JR9 C;  2GK9 A;  2NTY A;  4H9N C;  4TZ4 C;  2JPF A;  4BA9 A;  2X9X A;  3MAC A;  5LGN B;  3WI3 A;  3AB3 B;  5C8Y E;  4HGA A;  1HX8 A;  3PUG A;  5F3J A;  4TV8 E;  3NZP A;  5HWX A;  2LM9 A;  1FEW A;  3N9L A;  4HFV A;  2LHR A;  2CLY C;  1MIW A;  5JH7 E;  2Y48 B;  3I9W A;  2CEA A;  4YFS A;  3F2E A;  3VKG A;  2VWA A;  4IIJ E;  2EHO D;  2WMN A;  3KIN B;  2ES0 A;  3HKC E;  1OXZ A;  5JDF A;  2YK0 A;  4CZZ B;  1B7T A;  4WNK A;  2H7V C;  2LSY A;  2V1D B;  2X0L B;  3J9X 1;  4TUY E;  3RYC E;  5LYJ E;  1BR2 A;  3PU8 A;  2G0U A;  3VU7 H;  1HS7 A;  2KND A;  4A56 A;  2MOZ A;  2NW7 A;  4CXX A;  4ERR A;  5LBQ B;  4TV9 E;  4BJM A;  4TX5 A;  2DI4 A;  4O2A E;  5CA0 E;  1SA0 E;  4MLK A;  4DMV A;  1E1H B;  3FBL A;  5HYA A;  4ILU A;  5M4Y A;  4IE5 A;  5H6Q B;  5JDL A;  1AJ3 A;  1ZEE A;  1MMD A;  4I4T E;  2X68 A;  4PFP A;  2E8I A;  4EOZ B;  2MTQ A;  2D5U A;  2XQY A;  2D2S A;  5L3G B;  2CCQ A;  2QGS A;  2KWI B;  3GN5 A;  3RKO A;  3ZMV B;  5HXR A;  3CX6 B;  4EYY R;  4QXC B;  5TAO A;  4TN7 B;  3RYH E;  3O9X A;  2EHO A;  5L3C B;  2W62 A;  4YJ3 E;  2JRK A;  3HL6 A;  3RPU A;  4EYU A;  5LHG B;  2XAF B;  3QK6 A;  1WYB A;  1LVF A;  1ZHC A;  2XHE B;  4CI1 B;  5L3F B;  2MYS A;  3E22 E;  5HAX A;  2CMR A;  3ZEF B;  1YKH B;  4PNI A;  5FY7 A;  4KP3 C;  5KMG P;  4H9R C;  2ZLY A;  4IHJ E;  1HG5 A;  5A1L A;  5E0O A;  2Q9Q C;  3PE0 A;  3HKE E;  5ETW A;  2PFV A;  5IYZ E;  2VB6 A;  3AA1 B;  4L9I A;  3AA7 B;  2A2F X;  3PDY A;  4JEU B;  4PJM A;  2VK9 A;  4ZS3 A;  1NAF A;  4BAY B;  3OKQ A;  3U3I A;  5DAB A;  3VKH A;  4ZI7 E;  1D0X A;  5H6R B;  2KWH A;  1BR4 A;  4QX7 B;  5JR9 A;  2LOP A;  4YLH A;  3ZC0 A;  3N9Q A;  5LJN A;  4GYR A;  1HF8 A;  4PJL A;  4CXY A;  3ONX A;  4HKA A;  4DND A;  4UF0 B;  4IGU A;  4MHC A;  4MFR A;  5L3B B;  5JRC B;  5LNK A;  1SHZ C;  1CUN A;  3ZYM A;  2KT9 A;  2ZM8 A;  3J7Y q;  4MAL A;  2LT3 A;  3MZK B;  3N9M A;  5LHI B;  2NW9 A;  3AA6 B;  1KK7 A;  3ZN0 B;  3V5U A;  4H9S E;  3VHL A;  2SPC A;  4O4L E;  3N2O A;  4OYK A;  4EZH A;  1MIV A;  2PBI A;  1D1B A;  4JLE A;  4PJN A;  1D0Y A;  1IZN B;  2MBG A;  2JMK A;  3BQI A;  4ZOL E;  4IE7 A;  2DWK A;  4DBQ A;  4M1P A;  1FMW A;  4NUV A;  3F31 A;  3N2K E;  3CQX C;  3OBV E;  3N9P A;  4GYS A;  4OYJ A;  4JEH B;  1OWA A;  4FJO A;  4I55 E;  4QXB B;  1MMA A;  5KDM C;  1Y64 B;  3KFW X;  3B13 A;  1WRD A;  3UUN A;  5FXZ A;  1G73 A;  3FB2 A;  1V9D A;  2IAK A;  3C64 A;  4QX8 B;  4XZC A;  3ZYL A;  2LSG A;  1U5P A;  3Q2M A;  2E9X B;  2W63 A;  2X51 A;  4J2C A;  3EDV A;  5FXW A;  2HH7 A;  3ETV A;  3KBT A;  3AAI A;  3PTR B;  3PUR A;  3R6N A;  3SWH A;  4CXW A;  2WWU A;  1UX5 A;  1UCU A;  2W0G A;  3WAJ A;  3AVR A;  4H63 H;  4H63 V;  4IST A;  3UUL A;  5HXC A;  3ANW B;  2IC6 A;  3Q5W A;  1EZ3 A;  2V7J A;  5CA1 E;  3A5X A;  3Q9D A;  5HWY A;  2V7K A;  3UTK A;  4P0A A;  5L2L A;  2JQQ A;  4WW0 A;  2ODV A;  4AQF C;  4AI6 A;  3BK9 A;  4PW8 A;  2Q9Q A;  4O8S A;  1LRZ A;  3MA9 A;  2YU1 A;  2WAU A;  2NOX A;  4EZ4 A;  2BVL A;  2K48 A;  3NZQ A;  4AQG A;  4ZS2 A;  3AA0 B;  2HPJ A;  5EK2 A;  4KMC A;  5JDM A;  1IJ5 A;  2X9Y A;  3E0Z A;  2C5I T;  2DCF A;  5LG4 A;  3RRC A;  3FHN A;  2L9Q A;  2BZB A;  3MJX A;  3HKB E;  1U4Q A;  3PUA A;  3U78 A;  3GMI A;  4E7Z A;  3AAE B;  4XBF B;  2K9A A;  4KBM B;  5LCY A;  3RH3 A;  5DQV A;  2CXL A;  4UVB B;  4OFZ A;  3KV6 A;  5FP3 A;  2VKJ A;  5FY1 A;  3UT5 E;  2DLR A;  2DHR A;  4X1K E;  3EDU A;  3T8O A;  2YIN A;  3GWH A;  4OHF A;  3MXZ A;  1S35 A;  5CB4 E;  4DVD A;  1LVK A;  5LA6 E;  3KVA A;  4V1A v;  1YD8 G;  4G2A A;  3NRX A;  3M65 A;  2NTX A;  3DJB A;  3S4U A;  4CI2 B;  3MK7 C;  5HXS A;  1T98 A;  4B6X A;  4Z8X A;  4PJJ A;  2A72 A;  3GN5 B;  4O2B E;  2N2N A;  5FYM A;  5DJQ C;  4ZI2 C;  4ANJ A;  4DO0 A;  2HPL A;  4HN9 A;  4AKH A;  4XAX B;  4GIW A;  2X67 A;  3ETU A;  1KNZ A;  2JJ9 A;  4PK4 A;  3EUH A;  2DWG A;  2J1D G;  3ZYK A;  3LBX B;  4FI5 A;  4YHJ A;  4O4J E;  4EB6 E;  5LP6 E;  1QSD A;  4ADZ A;  4GOU A;  2A3D A;  2WSS V;  2XAH B;  3LK2 B;  5FMN A;  2CWO A;  3FBZ A;  4WBN E;  3JC6 D;  1MMN A;  2N1G A;  4UF0 A;  5LJM A;  1HFA A;  5EZY E;  4AKL A;  2C0S A;  1UX4 A;  4MBQ A;  5JRC A;  4L5G A;  4UV9 B;  3ZMS B;  3CPZ A;  4IDZ A;  5L3D B;  2L3L A;  2OA5 A;  2LOS A;  4WBO A;  1MND A;  4QWN B;  2E9X D;  3CX7 B;  3ZPO A;  2IW5 B;  3KDS E;  2XAG B;  3K3O A;  3N9N A;  3GA8 A;  3OYZ A;  4L0R A;  4ZI3 C;  2D0T A;  4YJ2 E;  2LE8 A;  4PK6 A;  2LSJ A;  2RP4 A;  3ZLI A;  3P7I A;  4PFO A;  1HTJ F;  1WYC A;  5FY0 A;  3N9O A;  4AQF A;  3FXD B;  3WAK A;  1X79 A;  3CWZ B;  2PJQ A;  1FIO A;  3QC9 A;  3CQG B;  4HTE A;  4QKN A;  5AFU L;  3AVS A;  3QUJ A;  4UVA B;  5J2U E;  3KVB A;  1H7C A;  5J2T E;  3C4X A;  1WLX A;  2WM9 A;  3I0O A;  3IHR A;  4EXT A;  5JDH A;  3LG7 A;  4DMW A;  3KBU A;  4ZI2 D;  2X9H A;  3SOL A;  2BDE A;  3C98 B;  4PK5 A;  4OK0 A;  1G8X A;  4GK5 E;  2K24 A;  2RA1 A;  5HXH A;  3ZC1 A;  3HR0 A;  3IBP A;  5LHH B;  4F6R C;  1S94 A;  3R84 B;  5GON E;  4O4I E;  2VKO A;  2Y8D A;  2JMH A;  3ANW A;  3AAA B;  5FXX A;  3ZN1 B;  2CM0 A;  4QHO A;  4UVC B;  1D0Z A;  5IHY A;  3C4Z A;  2D0U A;  2LSK A;  3P8C D;  3PUS A;  2W61 A;  3C51 A;  3D0T A;  3RYF E;  4UEL A;  4ASK A;  5JDQ A;  3ZMT B;  2IC9 A;  1HG2 A;  3ZJ1 A;  4AKG A;  3KV9 A;  2NP9 A;  3ESL A;  4ZI3 D;  2XTL A;  2Y6X A;  3SS1 A;  1MNE A;  4G63 A;  5ADX L;  2P9B A;  2W00 A;  4HE8 A;  3ZCJ A;  2NWB A;  4UEM A;  4H9O C;  2VKH A;  3N2G E;  3JC6 C;  2KZ7 B;  4IE6 A;  5HXE A;  4AXP A;  1YW0 A;  2KIN B;  3CKD A;  4HEA A;  2YEV C;  5FNV E;  4CI3 B;  4UXN B;  3N5L A;  3O1I A;  3PUQ A;  2E9X C;  2KLQ A;  4I50 E;  1O3X A;  2VL8 A;  4NUU A;  2X66 A;  2Q9Q B;  2ODU A;  2ZMA A;  3EVY A;  3LK4 2;  3Q5X A;  5JDN A;  3I1A A;  2Z6E A;  1BR0 A;  3RX6 A;  2I59 A;  4C90 A;  3O4X E;  4KUM B;  1IAP A;  2VAS A;  2KMF A;  2N9D A;  3LK3 B;  3NRY A;  2CA5 A;  3UUX B;  3CQC B;  2LEH A;  3RRW A;  4ZHQ E;  5LXT E;  4X20 E;  3DTO A;  5LGT B;  1IJ6 A;  2M67 A;  3L3P A;  2XAS B;  2V26 A;  2BVM A;  3V5S A;  2EHO B;  4JUY A;  4ISS A;  4EIW A;  1YKE B;  4I43 B;  5EK4 A;  1MIY A;  2L8K A;  2XAJ B;  5EK3 A;  3B57 A;  3LBX A;  4O4H E;  2LSI A;  2PG8 A;  3HA4 A;  3SRZ A;  3CVR A;  3UUM A;  3CML A;  3ZJ2 A;  3MKD A;  2DNX A;  5F8P A;  1VOM A;  3ZMZ B;  2ZM2 A;  2CXD A;  3FXE B;  3ZMU B;  3K3N A;  2ACX A;  2C5K T;  1LKX A;  3RYI E;  3I0Q A;  3IF8 B;  2B1E A;  3OYX A;  4H9Q C;  2H3R A;  3BQL A;  3RC8 A;  2CE7 A;  4BJN A;  4IE4 A;  5LBM A;  1HCI A;  1WR6 A;  2WMO A;  3H3A A;  3HI2 A;  2V7I A;  3F57 A;  3O1J A;  2CXF A;  3L09 A;  2C5J A;  3DP7 A;  5DQW A;  2K5B B;  2VKD A;  1NWM X;  3C50 A;  1D1C A;  4UIG A;  4EAH A;  4QXH B;  3KV5 A;  3W15 B;  4DBR A;  2X9W A;  4CQI A;  5FXV A;  5KX5 E;  4GK0 E;  4U74 A;  4U72 A;  5BMV E;  5JR9 B;  1US7 B;  4AKR B;  4IE0 A;  1BR1 A;  3H37 A;  3OJA A;  2H7O A;  3RC3 A;  2KXP B;  2QA7 A;  1FMV A;  5JVD E;  2XUE A;  3K3Q C;  5L3E B;  1D1A A;  1Z0P A;  2EHO C;  4H9P C;  4N78 D;  5JQG E;  3O1H A;  3LFM A;  2CWY A;  5LOV E;  2NW8 A;  2UXN B;  1ZV4 X;  2LHN A;  4UV8 B;  2CLY B;  5JRE A;  4K0U A;  1MMG A;  4AKI A;  3E08 A;  3ZCI A;  3HKD E;  4P09 A;  3C4W A;  4P0B A;  4E7S A;  3CX8 B;  4PAG A;  4C91 A;  2E9X A;  2UXX B;  2XAQ B;  3K8P C;  5JDG A;  3KV4 A;  3PU3 A;  2YU2 A;  2V7L A;  4X1I E;  2V7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...