3DJBA

Crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
188
Chain Sequence
TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADLNESEEAGMKKVSDWLEELHVEEEESKHVLHIIANMSIEGKLVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPRDPSLNHFYEKLLKLKDLMNTNAAKQEAEVRHRYMEQFIEQFMKEWNAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydrolase, HD family
publication title Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
rcsb
source organism Bacillus thuringiensis serovar konkukian
total genus 50
structure length 188
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3djbA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3djbA02
2PJQA 5DQVA 3DTOA 3B57A 2QGSA 5DQWA 5IHYA 3DJBA
chains in the Genus database with same CATH superfamily
2LW4A 4H9NC 2MTQA 1HNWT 3MK7C 2WSSV 3HKDE 1PKDB 2MPKA 2LSYA 3N9OA 3ZMSB 3PUXF 5JDFA 3FXDB 2UZDB 3JC6C 4MHCA 4EC9B 4JI8T 2PMIB 4PJLA 1HNXT 3AE7A 4BCGB 1XWMA 1UCUA 5AQUB 3VKHA 2C5OB 3CVRA 4ELLA 1YQ4A 4GKKT 2I53A 4CRLB 5AQTB 5ADXL 3J7Yq 2OLTA 5ABEA 5F5WA 2W63A 2PTFA 3BLRB 4FI5A 1JSTB 3LK42 4X20E 5ABFB 1H7CA 2XZEA 2X0LB 2IW9B 4DV3T 5KXJA 4YJ3E 2HHHT 3PJAJ 3A8LB 4BCFB 4UXNB 2V7LA 1BR4A 3SS1A 2DD4B 4U7YA 1D1AA 4YSXA 4UV8B 5AQKB 4DUYT 1R8IA 2C6TB 4EOSB 4PFOA 5HCJA 2CPTA 3FZHB 2WPAB 3RYCE 2M67A 4F70B 2EHOA 2E5VA 3CX7B 4YY3T 4X65T 1GUXB 4H9PC 3UUMA 2WM9A 1Y64B 1KXUA 4UF0B 5JR9A 4F6RC 2F2CA 2LKGA 4ROCA 5AQJB 2W61A 3FHNA 1SE7A 4X62T 3C64A 2XQ3A 1UNHD 5HWXA 3PUZF 4JI2T 4PJMA 2CA5A 1NEKA 2JJ9A 3AVRA 5HBJB 4BXXX 5H6QB 4OYJA 5GONE 2ZPGB 2VKOA 3OJAA 3MY1B 3Q5WA 2QDYB 1XMOT 4DR5T 3PTRB 2UUEB 1OXZA 2IMLA 4UVCB 1IBMT 1X79A 3EDVA 1L0VA 4KP3C 5LJNA 2WMBB 4L0RA 2QFZA 2WCAA 2KXPB 3ZT7A 4YOZA 5HNBB 3IBPA 3MJXA 2BBJA 4M6VA 2ZPEB 1D0ZA 1VCSA 2E9XA 5I5ZB 1XZYA 4YSZA 3K3NA 4HFBA 2VQET 3N9NA 1FMWA 3QYGB 2V22B 2XSBA 3MKDA 3ZMUB 1UGOA 2PBIA 2XSAA 3JAFA 3PURA 4DVDA 1GH6B 4GYRA 4YTNA 4HKAA 2LHNA 1OL1B 3CX8B 2BG9A 2A2FX 3TLTA 1FINB 3X1DA 4AQFC 3AVSA 2L3LA 4IGUA 3ZC1A 3RPUA 4CN4A 2A3DA 4DV6T 1OI9B 3ZSTA 4O4JE 5HEHA 3ONLC 5F3JA 1GQEA 2X0HA 2DMEA 3ZLIA 2VVSA 4HWHA 2X68A 4ZI2C 1XNQT 1T98A 1AJ3A 5AQFB 1J5ET 4AKHA 4JLEA 3LDQB 3DP7A 4TWDA 4O2BE 2JMHA 3I1AA 2RA1A 3SWHA 1MIWA 1OWAA 3Q9DA 4AQGA 4ADZA 3M65A 1T72A 3TNHB 4LF8T 3OYXA 2PK9B 1ENWA 5F8PA 5CA0E 3AXJB 3EHZA 4IE5A 4CFNB 3E22E 5FP3A 2XUEA 1O9KB 3M03A 1VYWB 3NDQA 3QZ5B 3AB3B 4LFBT 4A56A 4ZOLE 2YOEA 4ZHQE 4AKRB 3PE0A 1AISB 2XPKA 3P4RA 2E8IA 3RIUA 2H3RA 1JNZA 2IC9A 5E0OA 2XAFB 4E7ZA 3KV4A 4CXXA 2CJMB 2BKPA 3AAAB 1AHJB 3NRXA 1QUUA 2CLYC 3RQUA 3AECA 4FM4B 4HLQA 2R6GF 4P1NA 2VK9A 2KT9A 3ZYLA 3LSVA 2ZPIB 4BBRM 4KRDB 3ZSSA 4IL4A 3L09A 4G63A 2MAWA 5FY7A 4KHPT 4ISTA 2QF7A 4IDOA 3HI2A 5HEGA 4EIWA 2WIHB 3PJAA 1M62A 4DR2T 5FY1A 4F6WB 4PK4A 2DXCB 1ZKEA 5HXHA 3Q2MA 3D0TA 1VOLA 3HL6A 4F6SB 3UFGA 4H9OC 4EYUA 3OBVE 4CXAB 2NP9A 4QXCB 5KMGP 4EOLB 4YC3B 1VRBA 3AEFA 1BR0A 2X66A 1H25B 2CCHB 4BY1X 3JADA 3JCFA 2Q9QD 3WVEB 1WFDA 1VINA 3G06A 2UZEB 3JC6D 1OIUB 2BPMB 4EC8B 3CQXC 3NWIA 2UXXB 5J2UE 5HXSA 2ZPFB 4AKLA 3X25B 5L3GB 1UNGD 5IHYA 1KF6A 2JQ9A 2W99A 4QH5A 3WAJA 3BG5A 4TN7B 2Y6XA 2C4GB 2KR6A 3QHWB 2UUBT 3RHWA 4EAHA 2XAGB 4YHJA 3LQ5B 4Q25A 1J1JA 4AQYT 5J0ZA 3BHUB 4OR5B 1MMDA 3GN5A 4LMJA 5H6RB 2YINA 2WU5A 5EK3A 2W9ZA 2DPPB 1UURA 5JRCB 4O4IE 2F4VT 1H26B 4DR1T 3C4ZA 3P4QA 1UNLD 2JGZB 4F6UB 5FNVE 5LMKB 4IHJE 4Z90A 3A8OB 3BHVB 2Y8DA 4Z8XA 4EORB 2NW7A 4F8HA 2CWOA 3WAKA 4PAGA 1WCRA 1OEDA 5HCMA 2X0YA 1T7SA 5ETWA 4X5TA 3X20B 3RYIE 2PJQA 2QA7A 3GMIA 3FBLA 4C91A 3KVBA 4K0UA 2CXFA 5LGTB 2H89A 3A8HB 4O4HE 3SRZA 3CX6B 3ZJ2A 3ZMTB 5BNJB 3UU5A 3FZLB 3UU4A 2YK0A 3K8PC 4U3CA 4IE0A 1D1BA 2D2SA 4LMKA 4I3ZB 2VURA 1YW0A 2D0UA 4DV0T 4MIMA 4JI5T 4NIQA 2UU9T 2V6XA 2X9HA 4DV2T 1B7TA 3I0QA 4H9SE 2SPCA 2V6YA 1OEDC 1BR1A 3RC3A 2ZCFB 4JI1T 2LKHA 2C5XB 2JQHA 3KINB 4PK5A 3TLUA 1Y01A 4ILCA 1HNZT 3I9YA 3TLWA 4OK0A 2VL0A 2R7GA 4JV5T 2WMAB 4CI2B 3ZN1B 4U31A 4DIDB 3VYGB 1WRDA 3MACA 2OA5A 2NWBA 4ZI7E 2KMFA 2G9XB 3RYHE 3G33B 4IT4A 3QC9A 4IDZA 2W2UA 1FKMA 4ZGEB 5HEUA 3EIDB 3UUNA 1IBLT 1HF8A 2EUFA 3U3IA 2D5UA 2MOZA 5AQLB 3NBXX 1NAFA 2H88A 4NUVA 5AQRB 3VRAA 4X66T 2WIPB 3ANWB 2CLYB 3ETUA 3LJCA 2HN1A 2C5VB 5AQHB 3W15B 3ZPOA 3B57A 5FVLA 2XASB 4PK6A 4TX5A 5ABGA 2DI4A 5JDQA 5L3BB 1V29B 4EXTA 1YD8G 4EONB 4GK0E 3N9QA 1KNRA 2KWIB 2CBJA 4NXNT 2RP4A 2CZ0B 5DQWA 4IIJE 3PUWF 3PUAA 4KHZF 3QXEB 3UTKA 1UX4A 3AXJA 2WZIA 2Q9QA 2IAKA 2L9QA 1W0BA 3VR9A 4OX9T 2WU2A 4GOUA 5TAOA 3TW7A 1D1CA 3HA4A 4HEAA 4IE4A 4YHHT 5DQVA 2A72A 2HN2A 4MALA 4I50E 4ANJA 3P8CD 3P4PA 1QSDA 5AQSB 3KFWX 4U7IA 4EOKB 3IF8B 4AKGA 3FXEB 2VVNA 3RKGA 3CQGB 2LJLA 4CFVB 4PJJA 1XO2A 5LG3A 3KBUA 3ZCIA 3X26B 1WR6A 1UGSB 4MFEA 4TWFA 2V1DB 4TV8E 4ZI3D 3BQLA 3X28B 3AA6B 1KNZA 3UFEA 4TNWA 4IDNA 2WDVA 3EDUA 3N5LA 4G6LB 1LVKA 5EJCA 2V7IA 5LGUB 2QDJA 2FJEA 2UXBT 2HPJA 3K7AM 4O8SA 4JI3T 2LE8A 3NVOA 1LVFA 2X9XA 2ZM6T 4IL9A 4XAXB 1HR0T 3KV9A 1N4MA 1QMZB 2PG8A 3RYFE 3PV0F 2ZPBB 1UX5A 5L4HA 4IDQA 2WS3A 4DV1T 3AE4A 5LHGB 3KBTA 4OB1B 3R84B 1E1HB 4I43B 1I94T 4HNUA 2WQYA 4DMWA 3PU8A 5EFQB 5CA1E 4OB2B 3HR0A 2ZM2A 5AQNB 1XDOA 3E08A 2FJDA 3KVAA 5AQIB 5JDMA 4ILUA 4DBRA 4CFXB 3O9XA 1HG2A 5HEJA 5AQQB 4DO0A 3CKDA 3RIFA 5HXEA 2V5DA 2XM1A 4HGAA 4BCPB 2PHGA 5ACBA 2CM0A 4M1PA 3CIRA 4LFAT 2EHOC 3ZCJA 3RQWA 4I0UA 3ZMVB 4Y72B 2CXDA 3DTOA 2P9BA 2FJBA 4EEDA 2C5NB 5AQPB 5JR9C 4QWNB 2LM9A 4F7JB 4AXPA 2GK9A 3MI9B 3A8YC 4ELJA 3N2OA 2CZ6B 1XNRT 1IAPA 2AHJB 4ERRA 3BLQB 2KLQA 2V26A 4ZS2A 1DU2A 2QVAA 2CZ7B 3KV6A 1Z0PA 4KUMB 2BS2A 4KX6A 1H1PB 4YJ2E 1D0YA 4WNKA 3QNUA 3UU8A 4EOOB 2UXDT 3K3QC 2LM2A 3SFEA 1FMVA 1IZNB 5LHHB 3FB2A 2D0TA 4HL4A 4ZS3A 2JPFA 1HCIA 1N34T 1MNEA 4KMCA 4LF9T 3H4CA 3BQKA 2KNDA 5M4YA 3RI5A 4WBNE 3MXZA 2W0GA 3NZQA 2W00A 2E9XC 2A9UA 1HFAA 4RODA 4JYAT 4CXWA 1H4LD 3J9X1 3EAMA 2VL8A 2IC6A 2W9FA 2VASA 3BQIA 3ZYMA 4JI4T 4TZ4C 2XAQB 5HXRA 2ZMAA 2BG9C 1LRZA 1WYBA 2IW5B 1H1RB 1H28B 1D3UB 4IMYB 4G2AA 2LOPA 1FIOA 2WFYB 2UXCT 4MFRA 3PUYF 3RX6A 3QOFA 2X9WA 3TLSA 4EOIB 5LOVE 1LKXA 3ANWA 4EZHA 1FEWA 2N2NA 3GTMS 3UUXB 4Z6YA 4P0AA 4HFHA 2YDSA 4XZCA 3LG7A 5JH7E 3ZMZB 2LSGA 4MBQA 1OKVB 3AA1B 4OFZA 2CWYA 5EZYE 4ILAA 3VRBA 1IBKT 2BBHA 5FYMA 1OIYB 2IDOB 3CQCB 5JVDE 2WY2A 2IW6B 4OGRB 2DNXA 4P09A 5FXWA 3VU7H 3UU3A 4H9RC 1SUMB 4HE8A 3QYEA 2QRXA 3MA9A 2QQ8A 3WI3A 3A5XA 2WMOA 4WZXA 4YTMA 3RIUC 5LGNB 4JI6T 4UN0A 4ZZBA 4B3RT 2CCIB 4X64T 1W9RA 2LHRA 4YFSA 1G3NC 3HB9A 3I0OA 2LT3A 3C4XA 3RGLA 2VKDA 3AE1A 4NPPA 3OPCA 3QYBA 4YOOA 5ABFA 1ZV4X 5CGMA 4BCMB 4FJOA 4NC6A 1NWMX 1E9HB 4F7NB 3AE3A 4QSHA 1MIYA 2WWVA 3JAEA 2JIWA 4QX7B 4DR6T 4QH4A 1QLBA 2YN6A 2V7KA 5JR9B 1U4QA 3VKGA 2W66A 3DDQB 4DV4T 4ROEA 2YKSA 4CXYA 4B3MT 1ZP2A 1GUXA 2E2AA 4EGWA 3CPZA 2WMNA 2HH7A 2PFVA 4YT0A 5HVYB 4CN6A 4LMLA 4QHOA 4UF0A 3DJBA 1X9BA 1BR2A 3UT5E 2WHBB 2V5CA 3RGFB 2CHOA 2W2HA 3ESLA 2X9YA 3PUGA 3H37A 3RLFF 2XM2A 1G73A 2BKZB 1GY3B 2XQAA 3A7MA 2ZM8A 4JEHB 5L2LA 1YKHB 4MLKA 4HWIB 4EOMB 3KHIA 1CUNA 3DL1A 2XTLA 1HG5A 1XMQT 5KX5E 2C5IT 2WBLA 3LK3B 3CK6A 3Q5EA 5LBMA 3QB5A 4HFDA 2E9XB 3AEGA 2XQ7A 2C5JA 2NTXA 5LHIB 2D9DA 5L4EA 4BCHB 2M6IA 1ZOYA 4UR9A 4JEUB 2ES0A 3AEAA 1Z8UA 1EZ3A 1ZHCA 2IIUA 3SOLA 2DCFA 3BG3A 1MNDA 3HBLA 2BS3A 4ASKA 5JDNA 2CEAA 2XQ8A 3PDYA 3Q5XA 1E2AA 4HFIA 5LB7B 2AE9A 4V1Av 5FL0A 3ZT6A 5HBEB 4QH1A 3UQ7A 2G77A 4A97A 4CI1B 1YKEB 3ONJA 3OTOT 5IUXA 4GYSA 4IE6A 2UUCT 1IJ6A 4AI6A 5FGKB 1HX1B 4U33A 2J47A 4JBWF 3AAIA 2J4GA 4TV9E 3LBXB 3HO8A 4CFMB 3N2GE 3HHTB 3QK6A 1FVVB 1H1QB 1G8XA 2V7MA 2KZ7B 5JDGA 2V8SV 4DUZT 1OEDE 4H63H 3DOGB 5J2TE 1C9BA 2VKJA 3A8MB 2YEVC 2LLYA 4GK5E 2NW9A 5EK4A 2DXBB 3TLVA 4I4TE 4EOZB 2XJ7A 4LF5T 4ZI2D 4WYVA 2DHRA 2MBGA 4MFDA 1JKWA 5IDPB 2WB5A 4PW8A 1O9KA 2BS4A 4IE7A 5KDMC 2BVMA 3HKCE 1UGRB 3BK9A 4UV9B 5FXXA 4PJNA 2ZPHB 1H27B 1IJ5A 4EOJB 2DD5B 4QKNA 4KBMB 5L3CB 4ZXLA 1H24B 5LQFB 2VWAA 3KDSE 2W67A 3FZKB 5FXZA 2CE7A 1HTJF 2HPLA 2ACZA 3O1JA 2NW8A 1VCTA 1FJGT 4BJMA 4A98A 3FBZA 3P4SA 1UGPB 3A8GB 4AIUA 3ETVA 4I55E 1OKWB 4JX4A 4PNIA 2IVXA 2LEHA 3BHTB 3S4UA 2UZLB 2Q9QC 1D0XA 5JDLA 4IREA 4YXDA 4L9IA 2LSJA 4HWDA 1NENA 4PFPA 2JRKA 3AE8A 4GKJT 4F7LB 3ONXA 2WEVB 2FJAA 5IF1B 4H9QC 2I59A 2DWKA 2YU1A 4TWHA 4JI0T 5HQ0B 1JOWA 4BAYB 2ZZDB 2CXLA 4BCOB 5CJ5A 4U2YA 4CN1A 1YXRA 2K3WA 5AQMB 5LG4A 4LF4T 4TNVA 2K5BB 2D0QB 5HWYA 2CYZB 4LOCA 3X24B 5CEIB 1N33T 2XAHB 4WW0A 3ZT5A 4WBOA 2XQ4A 4CFUB 4TTHA 4YSYA 1M7KA 3GN5B 4LF6T 2J62A 1P5EB 3C98B 5LJMA 4X1IE 3L8RA 3AE2A 5L2WB 2CBIA 4GIWA 3B13A 3C51A 3GA8A 3N9MA 5AFUL 2KMGA 4BCKB 5JQGE 1IREB 3HZJA 2I6HA 3IA3A 1H1SB 3RF1A 3EVYA 3ZC0A 2XHEB 1CHUA 5JRCA 3P7IA 1OEDB 4YOSA 2BKOA 3OYZA 2DL1A 4OB0B 4TUYE 2UXNB 1MIVA 2DWGA 2PK2A 1N36T 1JSUB 2K48A 3N9LA 3QHRB 4ZZCA 1KEYA 3QWLA 1KK7A 3IEEA 2XQ9A 1U5PA 3QYHB 2BDEA 4X1KE 3T8OA 3AEDA 4COFA 2Y48B 2JQKA 2LRLA 3UULA 4AQFA 2KWHA 2JMKA 5IYZE 3P50A 4JUYA 1YQ3A 3VYHB 4EOQB 3HKBE 5A1LA 5L47A 2QGSA 2LOSA 4CFUD 1WLXA 2V6YB 2BZBA 2UUAT 4DR7T 4JX5A 2ZLYA 2ACXA 3EUHA 3ZN0B 2KSRA 5BMVE 3CWZB 5ABHA 4NSTB 2V7JA 4QX8B 1TD6A 3RC8A 5LBQB 2B9RA 4EZ4A 1ZP0A 3K3OA 3FZMB 3TNWB 5L3FB 1S35A 1HX8A 2IW8B 5DJQC 2WAUA 1WYCA 5HAXA 5FXVA 4UVAB 3U78A 4HFEA 1W09A 4E7SA 2ODUA 1SHZC 3NZPA 2H7OA 2NR4A 1MMAA 3TN8B 3T1HT 1JNRA 2N9DA 3LBXA 2X51A 2YDRA 2G0UA 5AQVB 5BR8T 2W96A 4DR4T 3VHLA 5CFBA 4O4LE 4EB6E 3OVUA 3AA0B 5IWAT 2IN3A 5LXTE 2WDRA 4U74A 5C2TA 3EI0A 2FBWA 3V5SA 4J2CA 1HS7A 4UVBB 3RKOA 3QB5K 1OL2B 5HXCA 5AQOB 2Q9QB 2FUPA 3F5XB 2VKHA 3PUQA 3F2EA 3GWHA 1S94A 5HYAA 4BBSM 2BG9E 4ISSA 4II5B 4HNTA 1T8BA 2CZ1B 4BCQB 3AAEB 4ZI3C 4CI3B 4YTPA 3L3PA 3IHRA 1TFBA 3RIAA 3NKZA 3AEBA 3EJ1B 2BKNA 3TNIB 3C50A 2IHR1 3HKEE 2J1DG 5LMNT 3LFMA 1UK5A 3RRCA 2CHNA 2K24A 2W4XA 2N1GA 4A5XA 4BCNB 3DDPB 3CMLA 2WXVB 3C4WA 5FY0A 5JDHA 4B3TT 3MIAB 1V9DA 3H3MA 3I9WA 4NUUA 2NTYA 3FZFB 5JREA 5CB4E 4QXHB 4CQIA 2XQYA 5FMNA 5LMUT 3EABA 2YU2A 3AE6A 3VR8A 4K0KT 1XDPA 3M3ZB 2ODVA 3ZKRA 3Q5DA 4HTEA 4HWCA 4P0BA 5CYIB 5DABA 4CZZB 3QZ9B 2WJ9A 2EHOB 4EOPB 3N9PA 3B5MA 3O1HA 3KV5A 3POMA 2CRBA 4XBFB 4KRCB 4OYKA 3ZEFB 4F7SB 4DR3T 4AISA 4NXMT 1SA0E 5C8YE 1W98B 5FL1A 3RH3A 4B6XA 4BCQD 4HFCA 4KI0F 2CMRA 2YDQA 3AE9A 4UEMA 3SFDA 4OB3B 4BA9A 1E7PA 3TW6A 3UQ4A 4OHFA 4DNDA 2L8KA 4IDPA 3ZJ1A 2AXDS 2W62A 5L3DB 2VB6A 3RRWA 4EV6A 2C5KT 4DBQA 2WZHA 4JI7T 5HEOA 4BCND 3PUVF 4X1YE 1AD6A 4U72A 4H63V 3E0ZA 2Z6EA 4N78D 5JTGA 2KINB 3N2KE 1UUSA 4HN9A 3AE5A 3AA7B 4ILBA 3F57A 2C0SA 4BCMD 4EYYR 4JX6A 2B1EA 4DV5T 2EHOD 2E5LT 5IDNB 2XQ5A 4DV7T 2WDQA 3L39A 2BVLA 1OGUB 5LCYA 4HWFA 4LFCT 5ICPB 5FKYA 1J5WA 5LA6E 4HNVA 1US7B 3F31A 4ZGDB 2H7VC 2JQQA 4QXBB 2BG9B 1W0AA 1UGQB 2OV9A 3O1IA 4DMVA 3H3AA 4C90A 1I6ZA 5LP6E 4CFWB 5J1GA 4U2ZA 3TKLB 1N32T 2K9AA 3ABVA 4UIGA 3O0GD 1MMGA 4UELA 5HBHB 3R6NA 1URCB 2DLRA 2M6BA 2X67A 2LRKA 3BG9A 2B76A 3WVDB 1KNPA 3QUJA 2UZBB 3ZYKA 2LSIA 5LYJE 3K1SA 3OKQA 4EEBA 2WP9A 5L3EB 3LK2B 2IUBA 3PU3A 3V5UA 3O4XE 1F5QB 3BLHB 4ZEYA 4L5GA 3P4WA 4BCJB 3AEEA 2E9XD 4BJNA 4BY7X 1O3XA 4O2AE 1KFYA 2WWUA 4YLHA 1ZEEA 4FX3B 1MMNA 3MZKB 4ZGJB 3PUSA 3NRYA 4HFVA 2QYWA 2XQ6A 1BU2A 2I40B 4BCIB 2XAJB 2CCQA 2MYSA 3T1YT 2XY8B 2NOXA 3MY5B 5FVKA 2X1NB 5LNKA 1WR0A 1VOMA 4LF7T 2LSKA 4B3ST 3EOCB 2I0MA 3UU6A 2VQFT 4AKIA 5EK2A 2ZM0A 3PO3S 2RPAA 5C3JA 3UUBA 5AQGB 4Z91A
chains in the Genus database with same CATH topology
4H9NC 3T8OA 5LGTB 2MTQA 4O4HE 3MA9A 3SRZA 4C91A 3CX6B 2Y48B 3ZJ2A 3ZMTB 3MK7C 2WSSV 3HKDE 3WI3A 2LSYA 3A5XA 3N9OA 2YK0A 3UULA 3ZMSB 4AQFA 2KWHA 3K8PC 5JDFA 2JMKA 5IYZE 4IE0A 1D1BA 4JUYA 3FXDB 2D2SA 2WMOA 3HKBE 3JC6C 5A1LA 1YW0A 4MHCA 2QGSA 2LOSA 1WLXA 2D0UA 4PJLA 5LGNB 2BZBA 1UCUA 2X9HA 3VKHA 3CVRA 1B7TA 3I0QA 4H9SE 2LHRA 2ZLYA 2SPCA 2ACXA 3EUHA 3ZN0B 5ADXL 1BR1A 3RC3A 5BMVE 3J7Yq 3CWZB 3KINB 4YFSA 4PK5A 2W63A 2V7JA 3I9YA 4FI5A 4OK0A 4QX8B 3RC8A 3I0OA 2LT3A 3LK42 4X20E 5LBQB 4CI2B 3C4XA 3ZN1B 2VKDA 4EZ4A 3K3OA 1H7CA 5L3FB 1S35A 2X0LB 1HX8A 1WRDA 5DJQC 3MACA 2WAUA 1WYCA 5HAXA 5FXVA 2OA5A 4UVAB 2NWBA 4ZI7E 1ZV4X 4YJ3E 2KMFA 3U78A 3RYHE 4UXNB 2V7LA 4FJOA 4E7SA 3QC9A 1NWMX 1BR4A 4IDZA 3SS1A 2ODUA 1D1AA 4UV8B 1MIYA 1SHZC 3NZPA 2H7OA 3UUNA 4PFOA 1HF8A 4QX7B 1MMAA 2D5UA 2M67A 2MOZA 3RYCE 2EHOA 3CX7B 3NBXX 3U3IA 1NAFA 4H9PC 2N9DA 2V7KA 1U4QA 3LBXA 4NUVA 5JR9B 3VKGA 2X51A 3ANWB 2CLYB 3ETUA 2G0UA 3LJCA 5JDNA 4CXYA 3UUMA 2WM9A 1Y64B 3W15B 4UF0B 3VHLA 5JR9A 3ZPOA 3B57A 4F6RC 2XASB 4O4LE 4EB6E 3CPZA 2WMNA 2HH7A 2PFVA 2W61A 4PK6A 4TX5A 3AA0B 3FHNA 2DI4A 5JDQA 4QHOA 3C64A 4UF0A 5LXTE 5L3BB 4U74A 3DJBA 3V5SA 4EXTA 4J2CA 1BR2A 1YD8G 1HS7A 4UVBB 5HWXA 4GK0E 3UT5E 3N9QA 3RKOA 2KWIB 4PJMA 2CA5A 3PUGA 3ESLA 2X9YA 5HXCA 2JJ9A 2Q9QB 2RP4A 3AVRA 5DQWA 4IIJE 3H37A 5H6QB 4OYJA 3PUAA 5GONE 2VKHA 3UTKA 1G73A 1UX4A 2VKOA 3PUQA 3OJAA 2Q9QA 3F2EA 3Q5WA 2IAKA 2ZM8A 3GWHA 1S94A 2L9QA 4JEHB 5HYAA 5L2LA 3PTRB 1OXZA 1YKHB 4GOUA 4MLKA 5TAOA 4UVCB 4ISSA 3HA4A 1D1CA 4HEAA 4IE4A 1X79A 3EDVA 5DQVA 2A72A 1CUNA 4I50E 4MALA 4ANJA 3P8CD 2XTLA 4KP3C 5LJNA 1HG5A 1QSDA 3AAEB 4L0RA 5KX5E 2C5IT 4ZI3C 4CI3B 3KFWX 2WBLA 2KXPB 3IF8B 3LK3B 3L3PA 3IHRA 4AKGA 3FXEB 3IBPA 4X1KE 5LBMA 3MJXA 3CQGB 2E9XB 2LJLA 4PJJA 2C5JA 3KBUA 3ZCIA 2NTXA 5LHIB 3C50A 1WR6A 3HKEE 1D0ZA 2J1DG 3LFMA 2V1DB 2E9XA 4JEUB 2ES0A 3K3NA 1EZ3A 3RRCA 1ZHCA 3N9NA 3SOLA 1FMWA 2DCFA 2K24A 1MNDA 4TV8E 2N1GA 4ZI3D 3BQLA 3AA6B 1KNZA 3UFEA 3CMLA 3MKDA 3ZMUB 3EDUA 2CEAA 2PBIA 3C4WA 3N5LA 5FY0A 1LVKA 3PDYA 4ASKA 5JDHA 3Q5XA 1V9DA 3PURA 2V7IA 4DVDA 5LGUB 3I9WA 4V1Av 4GYRA 4NUUA 2NTYA 4HKAA 2LHNA 2HPJA 5CB4E 5JREA 4QXHB 4CQIA 2XQYA 5FMNA 3CX8B 4O8SA 2LE8A 1LVFA 2A2FX 2X9XA 2YU2A 4CI1B 1YKEB 2ODVA 4GYSA 4IE6A 4AQFC 3AVSA 1IJ6A 4AI6A 4XAXB 2L3LA 4IGUA 4HTEA 3KV9A 4P0BA 3RPUA 3ZC1A 4CZZB 5DABA 2A3DA 3AAIA 4O4JE 2EHOB 4TV9E 3N9PA 2PG8A 3LBXB 3RYFE 5F3JA 3O1HA 3KV5A 3N2GE 1UX5A 4XBFB 3QK6A 3ZLIA 1G8XA 2X68A 4OYKA 5LHGB 3ZEFB 3KBTA 1T98A 4ZI2C 1AJ3A 2V7MA 2KZ7B 3R84B 5JDGA 1E1HB 4I43B 1SA0E 5C8YE 4DMWA 4JLEA 3RH3A 3PU8A 4AKHA 3DP7A 4H63H 4B6XA 4O2BE 5CA1E 2JMHA 5J2TE 3HR0A 2VKJA 2CMRA 3I1AA 2ZM2A 2RA1A 4UEMA 2YEVC 3SWHA 3E08A 4GK5E 2NW9A 1MIWA 1OWAA 3Q9DA 4AQGA 5EK4A 4BA9A 4ADZA 3M65A 4OHFA 3KVAA 4I4TE 4EOZB 5JDMA 4ILUA 4DNDA 4DBRA 3OYXA 3O9XA 2L8KA 4ZI2D 1HG2A 5F8PA 5CA0E 3ZJ1A 4DO0A 4IE5A 3E22E 5FP3A 2W62A 5L3DB 3CKDA 2VB6A 2XUEA 3RRWA 2DHRA 2MBGA 2C5KT 5HXEA 4DBQA 3AB3B 4HGAA 4A56A 4PW8A 4ZOLE 4ZHQE 4AKRB 2CM0A 4M1PA 4IE7A 2EHOC 3ZCJA 3PE0A 5KDMC 4X1YE 3ZMVB 2BVMA 4U72A 2CXDA 3HKCE 3DTOA 2E8IA 2H3RA 4H63V 3E0ZA 2P9BA 2Z6EA 3BK9A 4UV9B 5FXXA 2IC9A 4PJNA 5E0OA 2XAFB 4N78D 1IJ5A 3KV4A 4CXXA 4E7ZA 3AAAB 2KINB 3N2KE 4QKNA 5JR9C 4HN9A 4QWNB 3AA7B 4KBMB 3NRXA 5L3CB 2LM9A 1QUUA 2CLYC 2VWAA 3KDSE 4AXPA 2GK9A 3F57A 5FXZA 2CE7A 2VK9A 3N2OA 1HTJF 2HPLA 3O1JA 2KT9A 1IAPA 2NW8A 3ZYLA 2C0SA 4ERRA 4BJMA 4EYYR 3L09A 2B1EA 4G63A 2EHOD 3FBZA 5FY7A 4ISTA 3ETVA 2KLQA 2V26A 3HI2A 4ZS2A 4EIWA 4I55E 3KV6A 1Z0PA 4PNIA 4KUMB 2LEHA 3S4UA 5FY1A 4PK4A 4YJ2E 2BVLA 1D0YA 2Q9QC 1D0XA 5LCYA 4WNKA 1ZKEA 5JDLA 5HXHA 5LA6E 3K3QC 1US7B 3F31A 2H7VC 3D0TA 3Q2MA 2JQQA 4QXBB 4L9IA 1FMVA 2LSJA 3HL6A 3O1IA 1IZNB 5LHHB 4DMVA 3FB2A 3H3AA 4PFPA 2D0TA 4C90A 2JRKA 4H9OC 5LP6E 4EYUA 4ZS3A 3OBVE 2JPFA 2NP9A 1HCIA 4QXCB 5KMGP 1MNEA 3ONXA 5J1GA 1VRBA 1BR0A 4H9QC 2I59A 4KMCA 3TKLB 2DWKA 2YU1A 3BQKA 2X66A 2K9AA 4UIGA 4BAYB 2KNDA 1MMGA 5M4YA 4UELA 2CXLA 2Q9QD 3R6NA 4WBNE 3MXZA 2W0GA 3JC6D 3NZQA 3CQXC 2W00A 5LG4A 2E9XC 2UXXB 2DLRA 5J2UE 2K5BB 2X67A 5HXSA 5HWYA 1HFAA 4AKLA 4CXWA 3J9X1 3QUJA 5L3GB 5IHYA 2VL8A 2XAHB 2IC6A 4WW0A 3ZYKA 2LSIA 3WAJA 2VASA 3BQIA 5LYJE 4WBOA 3OKQA 4TN7B 3ZYMA 2Y6XA 4TZ4C 3GN5B 2XAQB 5L3EB 4EAHA 3LK2B 2XAGB 3PU3A 3V5UA 5HXRA 2ZMAA 4YHJA 3O4XE 3C98B 1LRZA 1WYBA 5LJMA 2IW5B 4L5GA 4X1IE 2E9XD 4GIWA 4G2AA 4BJNA 2LOPA 3GN5A 1FIOA 1MMDA 1O3XA 3B13A 5H6RB 2YINA 3C51A 4MFRA 4O2AE 5EK3A 3GA8A 3RX6A 3N9MA 2WWUA 4YLHA 5AFUL 1ZEEA 5JRCB 2X9WA 4O4IE 1MMNA 5JQGE 3MZKB 5LOVE 1LKXA 3ANWA 4EZHA 3C4ZA 1FEWA 2N2NA 3PUSA 3UUXB 4P0AA 3NRYA 3EVYA 3ZC0A 2XHEB 4HFVA 4XZCA 5JRCA 3LG7A 5JH7E 3ZMZB 2XAJB 2LSGA 3P7IA 4MBQA 2CCQA 5FNVE 2MYSA 3AA1B 4OFZA 2NOXA 4IHJE 2CWYA 2Y8DA 3OYZA 5EZYE 5LNKA 1VOMA 4TUYE 2UXNB 2LSKA 4Z8XA 2NW7A 2CWOA 5FYMA 3WAKA 4PAGA 1MIVA 2DWGA 4AKIA 5EK2A 2K48A 3CQCB 5JVDE 3N9LA 2ZM0A 5ETWA 2DNXA 1KK7A 3IEEA 4P09A 5FXWA 3VU7H 1U5PA 3RYIE 2PJQA 2QA7A 3GMIA 3FBLA 4H9RC 2BDEA 3KVBA 4K0UA 2CXFA 4HE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJQ A;  5DQV A;  3DTO A;  3B57 A;  2QGS A;  5DQW A;  5IHY A;  3DJB A; 
#chains in the Genus database with same CATH topology
 2LW4 A;  4H9N C;  2MTQ A;  1HNW T;  3MK7 C;  2WSS V;  3HKD E;  1PKD B;  2MPK A;  2LSY A;  3N9O A;  3ZMS B;  3PUX F;  5JDF A;  3FXD B;  2UZD B;  3JC6 C;  4MHC A;  4EC9 B;  4JI8 T;  2PMI B;  4PJL A;  1HNX T;  3AE7 A;  4BCG B;  1XWM A;  1UCU A;  5AQU B;  3VKH A;  2C5O B;  3CVR A;  4ELL A;  1YQ4 A;  4GKK T;  2I53 A;  4CRL B;  5AQT B;  5ADX L;  3J7Y q;  2OLT A;  5ABE A;  5F5W A;  2W63 A;  2PTF A;  3BLR B;  4FI5 A;  1JST B;  3LK4 2;  4X20 E;  5ABF B;  1H7C A;  2XZE A;  2X0L B;  2IW9 B;  4DV3 T;  5KXJ A;  4YJ3 E;  2HHH T;  3PJA J;  3A8L B;  4BCF B;  4UXN B;  2V7L A;  1BR4 A;  3SS1 A;  2DD4 B;  4U7Y A;  1D1A A;  4YSX A;  4UV8 B;  5AQK B;  4DUY T;  1R8I A;  2C6T B;  4EOS B;  4PFO A;  5HCJ A;  2CPT A;  3FZH B;  2WPA B;  3RYC E;  2M67 A;  4F70 B;  2EHO A;  2E5V A;  3CX7 B;  4YY3 T;  4X65 T;  1GUX B;  4H9P C;  3UUM A;  2WM9 A;  1Y64 B;  1KXU A;  4UF0 B;  5JR9 A;  4F6R C;  2F2C A;  2LKG A;  4ROC A;  5AQJ B;  2W61 A;  3FHN A;  1SE7 A;  4X62 T;  3C64 A;  2XQ3 A;  1UNH D;  5HWX A;  3PUZ F;  4JI2 T;  4PJM A;  2CA5 A;  1NEK A;  2JJ9 A;  3AVR A;  5HBJ B;  4BXX X;  5H6Q B;  4OYJ A;  5GON E;  2ZPG B;  2VKO A;  3OJA A;  3MY1 B;  3Q5W A;  2QDY B;  1XMO T;  4DR5 T;  3PTR B;  2UUE B;  1OXZ A;  2IML A;  4UVC B;  1IBM T;  1X79 A;  3EDV A;  1L0V A;  4KP3 C;  5LJN A;  2WMB B;  4L0R A;  2QFZ A;  2WCA A;  2KXP B;  3ZT7 A;  4YOZ A;  5HNB B;  3IBP A;  3MJX A;  2BBJ A;  4M6V A;  2ZPE B;  1D0Z A;  1VCS A;  2E9X A;  5I5Z B;  1XZY A;  4YSZ A;  3K3N A;  4HFB A;  2VQE T;  3N9N A;  1FMW A;  3QYG B;  2V22 B;  2XSB A;  3MKD A;  3ZMU B;  1UGO A;  2PBI A;  2XSA A;  3JAF A;  3PUR A;  4DVD A;  1GH6 B;  4GYR A;  4YTN A;  4HKA A;  2LHN A;  1OL1 B;  3CX8 B;  2BG9 A;  2A2F X;  3TLT A;  1FIN B;  3X1D A;  4AQF C;  3AVS A;  2L3L A;  4IGU A;  3ZC1 A;  3RPU A;  4CN4 A;  2A3D A;  4DV6 T;  1OI9 B;  3ZST A;  4O4J E;  5HEH A;  3ONL C;  5F3J A;  1GQE A;  2X0H A;  2DME A;  3ZLI A;  2VVS A;  4HWH A;  2X68 A;  4ZI2 C;  1XNQ T;  1T98 A;  1AJ3 A;  5AQF B;  1J5E T;  4AKH A;  4JLE A;  3LDQ B;  3DP7 A;  4TWD A;  4O2B E;  2JMH A;  3I1A A;  2RA1 A;  3SWH A;  1MIW A;  1OWA A;  3Q9D A;  4AQG A;  4ADZ A;  3M65 A;  1T72 A;  3TNH B;  4LF8 T;  3OYX A;  2PK9 B;  1ENW A;  5F8P A;  5CA0 E;  3AXJ B;  3EHZ A;  4IE5 A;  4CFN B;  3E22 E;  5FP3 A;  2XUE A;  1O9K B;  3M03 A;  1VYW B;  3NDQ A;  3QZ5 B;  3AB3 B;  4LFB T;  4A56 A;  4ZOL E;  2YOE A;  4ZHQ E;  4AKR B;  3PE0 A;  1AIS B;  2XPK A;  3P4R A;  2E8I A;  3RIU A;  2H3R A;  1JNZ A;  2IC9 A;  5E0O A;  2XAF B;  4E7Z A;  3KV4 A;  4CXX A;  2CJM B;  2BKP A;  3AAA B;  1AHJ B;  3NRX A;  1QUU A;  2CLY C;  3RQU A;  3AEC A;  4FM4 B;  4HLQ A;  2R6G F;  4P1N A;  2VK9 A;  2KT9 A;  3ZYL A;  3LSV A;  2ZPI B;  4BBR M;  4KRD B;  3ZSS A;  4IL4 A;  3L09 A;  4G63 A;  2MAW A;  5FY7 A;  4KHP T;  4IST A;  2QF7 A;  4IDO A;  3HI2 A;  5HEG A;  4EIW A;  2WIH B;  3PJA A;  1M62 A;  4DR2 T;  5FY1 A;  4F6W B;  4PK4 A;  2DXC B;  1ZKE A;  5HXH A;  3Q2M A;  3D0T A;  1VOL A;  3HL6 A;  4F6S B;  3UFG A;  4H9O C;  4EYU A;  3OBV E;  4CXA B;  2NP9 A;  4QXC B;  5KMG P;  4EOL B;  4YC3 B;  1VRB A;  3AEF A;  1BR0 A;  2X66 A;  1H25 B;  2CCH B;  4BY1 X;  3JAD A;  3JCF A;  2Q9Q D;  3WVE B;  1WFD A;  1VIN A;  3G06 A;  2UZE B;  3JC6 D;  1OIU B;  2BPM B;  4EC8 B;  3CQX C;  3NWI A;  2UXX B;  5J2U E;  5HXS A;  2ZPF B;  4AKL A;  3X25 B;  5L3G B;  1UNG D;  5IHY A;  1KF6 A;  2JQ9 A;  2W99 A;  4QH5 A;  3WAJ A;  3BG5 A;  4TN7 B;  2Y6X A;  2C4G B;  2KR6 A;  3QHW B;  2UUB T;  3RHW A;  4EAH A;  2XAG B;  4YHJ A;  3LQ5 B;  4Q25 A;  1J1J A;  4AQY T;  5J0Z A;  3BHU B;  4OR5 B;  1MMD A;  3GN5 A;  4LMJ A;  5H6R B;  2YIN A;  2WU5 A;  5EK3 A;  2W9Z A;  2DPP B;  1UUR A;  5JRC B;  4O4I E;  2F4V T;  1H26 B;  4DR1 T;  3C4Z A;  3P4Q A;  1UNL D;  2JGZ B;  4F6U B;  5FNV E;  5LMK B;  4IHJ E;  4Z90 A;  3A8O B;  3BHV B;  2Y8D A;  4Z8X A;  4EOR B;  2NW7 A;  4F8H A;  2CWO A;  3WAK A;  4PAG A;  1WCR A;  1OED A;  5HCM A;  2X0Y A;  1T7S A;  5ETW A;  4X5T A;  3X20 B;  3RYI E;  2PJQ A;  2QA7 A;  3GMI A;  3FBL A;  4C91 A;  3KVB A;  4K0U A;  2CXF A;  5LGT B;  2H89 A;  3A8H B;  4O4H E;  3SRZ A;  3CX6 B;  3ZJ2 A;  3ZMT B;  5BNJ B;  3UU5 A;  3FZL B;  3UU4 A;  2YK0 A;  3K8P C;  4U3C A;  4IE0 A;  1D1B A;  2D2S A;  4LMK A;  4I3Z B;  2VUR A;  1YW0 A;  2D0U A;  4DV0 T;  4MIM A;  4JI5 T;  4NIQ A;  2UU9 T;  2V6X A;  2X9H A;  4DV2 T;  1B7T A;  3I0Q A;  4H9S E;  2SPC A;  2V6Y A;  1OED C;  1BR1 A;  3RC3 A;  2ZCF B;  4JI1 T;  2LKH A;  2C5X B;  2JQH A;  3KIN B;  4PK5 A;  3TLU A;  1Y01 A;  4ILC A;  1HNZ T;  3I9Y A;  3TLW A;  4OK0 A;  2VL0 A;  2R7G A;  4JV5 T;  2WMA B;  4CI2 B;  3ZN1 B;  4U31 A;  4DID B;  3VYG B;  1WRD A;  3MAC A;  2OA5 A;  2NWB A;  4ZI7 E;  2KMF A;  2G9X B;  3RYH E;  3G33 B;  4IT4 A;  3QC9 A;  4IDZ A;  2W2U A;  1FKM A;  4ZGE B;  5HEU A;  3EID B;  3UUN A;  1IBL T;  1HF8 A;  2EUF A;  3U3I A;  2D5U A;  2MOZ A;  5AQL B;  3NBX X;  1NAF A;  2H88 A;  4NUV A;  5AQR B;  3VRA A;  4X66 T;  2WIP B;  3ANW B;  2CLY B;  3ETU A;  3LJC A;  2HN1 A;  2C5V B;  5AQH B;  3W15 B;  3ZPO A;  3B57 A;  5FVL A;  2XAS B;  4PK6 A;  4TX5 A;  5ABG A;  2DI4 A;  5JDQ A;  5L3B B;  1V29 B;  4EXT A;  1YD8 G;  4EON B;  4GK0 E;  3N9Q A;  1KNR A;  2KWI B;  2CBJ A;  4NXN T;  2RP4 A;  2CZ0 B;  5DQW A;  4IIJ E;  3PUW F;  3PUA A;  4KHZ F;  3QXE B;  3UTK A;  1UX4 A;  3AXJ A;  2WZI A;  2Q9Q A;  2IAK A;  2L9Q A;  1W0B A;  3VR9 A;  4OX9 T;  2WU2 A;  4GOU A;  5TAO A;  3TW7 A;  1D1C A;  3HA4 A;  4HEA A;  4IE4 A;  4YHH T;  5DQV A;  2A72 A;  2HN2 A;  4MAL A;  4I50 E;  4ANJ A;  3P8C D;  3P4P A;  1QSD A;  5AQS B;  3KFW X;  4U7I A;  4EOK B;  3IF8 B;  4AKG A;  3FXE B;  2VVN A;  3RKG A;  3CQG B;  2LJL A;  4CFV B;  4PJJ A;  1XO2 A;  5LG3 A;  3KBU A;  3ZCI A;  3X26 B;  1WR6 A;  1UGS B;  4MFE A;  4TWF A;  2V1D B;  4TV8 E;  4ZI3 D;  3BQL A;  3X28 B;  3AA6 B;  1KNZ A;  3UFE A;  4TNW A;  4IDN A;  2WDV A;  3EDU A;  3N5L A;  4G6L B;  1LVK A;  5EJC A;  2V7I A;  5LGU B;  2QDJ A;  2FJE A;  2UXB T;  2HPJ A;  3K7A M;  4O8S A;  4JI3 T;  2LE8 A;  3NVO A;  1LVF A;  2X9X A;  2ZM6 T;  4IL9 A;  4XAX B;  1HR0 T;  3KV9 A;  1N4M A;  1QMZ B;  2PG8 A;  3RYF E;  3PV0 F;  2ZPB B;  1UX5 A;  5L4H A;  4IDQ A;  2WS3 A;  4DV1 T;  3AE4 A;  5LHG B;  3KBT A;  4OB1 B;  3R84 B;  1E1H B;  4I43 B;  1I94 T;  4HNU A;  2WQY A;  4DMW A;  3PU8 A;  5EFQ B;  5CA1 E;  4OB2 B;  3HR0 A;  2ZM2 A;  5AQN B;  1XDO A;  3E08 A;  2FJD A;  3KVA A;  5AQI B;  5JDM A;  4ILU A;  4DBR A;  4CFX B;  3O9X A;  1HG2 A;  5HEJ A;  5AQQ B;  4DO0 A;  3CKD A;  3RIF A;  5HXE A;  2V5D A;  2XM1 A;  4HGA A;  4BCP B;  2PHG A;  5ACB A;  2CM0 A;  4M1P A;  3CIR A;  4LFA T;  2EHO C;  3ZCJ A;  3RQW A;  4I0U A;  3ZMV B;  4Y72 B;  2CXD A;  3DTO A;  2P9B A;  2FJB A;  4EED A;  2C5N B;  5AQP B;  5JR9 C;  4QWN B;  2LM9 A;  4F7J B;  4AXP A;  2GK9 A;  3MI9 B;  3A8Y C;  4ELJ A;  3N2O A;  2CZ6 B;  1XNR T;  1IAP A;  2AHJ B;  4ERR A;  3BLQ B;  2KLQ A;  2V26 A;  4ZS2 A;  1DU2 A;  2QVA A;  2CZ7 B;  3KV6 A;  1Z0P A;  4KUM B;  2BS2 A;  4KX6 A;  1H1P B;  4YJ2 E;  1D0Y A;  4WNK A;  3QNU A;  3UU8 A;  4EOO B;  2UXD T;  3K3Q C;  2LM2 A;  3SFE A;  1FMV A;  1IZN B;  5LHH B;  3FB2 A;  2D0T A;  4HL4 A;  4ZS3 A;  2JPF A;  1HCI A;  1N34 T;  1MNE A;  4KMC A;  4LF9 T;  3H4C A;  3BQK A;  2KND A;  5M4Y A;  3RI5 A;  4WBN E;  3MXZ A;  2W0G A;  3NZQ A;  2W00 A;  2E9X C;  2A9U A;  1HFA A;  4ROD A;  4JYA T;  4CXW A;  1H4L D;  3J9X 1;  3EAM A;  2VL8 A;  2IC6 A;  2W9F A;  2VAS A;  3BQI A;  3ZYM A;  4JI4 T;  4TZ4 C;  2XAQ B;  5HXR A;  2ZMA A;  2BG9 C;  1LRZ A;  1WYB A;  2IW5 B;  1H1R B;  1H28 B;  1D3U B;  4IMY B;  4G2A A;  2LOP A;  1FIO A;  2WFY B;  2UXC T;  4MFR A;  3PUY F;  3RX6 A;  3QOF A;  2X9W A;  3TLS A;  4EOI B;  5LOV E;  1LKX A;  3ANW A;  4EZH A;  1FEW A;  2N2N A;  3GTM S;  3UUX B;  4Z6Y A;  4P0A A;  4HFH A;  2YDS A;  4XZC A;  3LG7 A;  5JH7 E;  3ZMZ B;  2LSG A;  4MBQ A;  1OKV B;  3AA1 B;  4OFZ A;  2CWY A;  5EZY E;  4ILA A;  3VRB A;  1IBK T;  2BBH A;  5FYM A;  1OIY B;  2IDO B;  3CQC B;  5JVD E;  2WY2 A;  2IW6 B;  4OGR B;  2DNX A;  4P09 A;  5FXW A;  3VU7 H;  3UU3 A;  4H9R C;  1SUM B;  4HE8 A;  3QYE A;  2QRX A;  3MA9 A;  2QQ8 A;  3WI3 A;  3A5X A;  2WMO A;  4WZX A;  4YTM A;  3RIU C;  5LGN B;  4JI6 T;  4UN0 A;  4ZZB A;  4B3R T;  2CCI B;  4X64 T;  1W9R A;  2LHR A;  4YFS A;  1G3N C;  3HB9 A;  3I0O A;  2LT3 A;  3C4X A;  3RGL A;  2VKD A;  3AE1 A;  4NPP A;  3OPC A;  3QYB A;  4YOO A;  5ABF A;  1ZV4 X;  5CGM A;  4BCM B;  4FJO A;  4NC6 A;  1NWM X;  1E9H B;  4F7N B;  3AE3 A;  4QSH A;  1MIY A;  2WWV A;  3JAE A;  2JIW A;  4QX7 B;  4DR6 T;  4QH4 A;  1QLB A;  2YN6 A;  2V7K A;  5JR9 B;  1U4Q A;  3VKG A;  2W66 A;  3DDQ B;  4DV4 T;  4ROE A;  2YKS A;  4CXY A;  4B3M T;  1ZP2 A;  1GUX A;  2E2A A;  4EGW A;  3CPZ A;  2WMN A;  2HH7 A;  2PFV A;  4YT0 A;  5HVY B;  4CN6 A;  4LML A;  4QHO A;  4UF0 A;  3DJB A;  1X9B A;  1BR2 A;  3UT5 E;  2WHB B;  2V5C A;  3RGF B;  2CHO A;  2W2H A;  3ESL A;  2X9Y A;  3PUG A;  3H37 A;  3RLF F;  2XM2 A;  1G73 A;  2BKZ B;  1GY3 B;  2XQA A;  3A7M A;  2ZM8 A;  4JEH B;  5L2L A;  1YKH B;  4MLK A;  4HWI B;  4EOM B;  3KHI A;  1CUN A;  3DL1 A;  2XTL A;  1HG5 A;  1XMQ T;  5KX5 E;  2C5I T;  2WBL A;  3LK3 B;  3CK6 A;  3Q5E A;  5LBM A;  3QB5 A;  4HFD A;  2E9X B;  3AEG A;  2XQ7 A;  2C5J A;  2NTX A;  5LHI B;  2D9D A;  5L4E A;  4BCH B;  2M6I A;  1ZOY A;  4UR9 A;  4JEU B;  2ES0 A;  3AEA A;  1Z8U A;  1EZ3 A;  1ZHC A;  2IIU A;  3SOL A;  2DCF A;  3BG3 A;  1MND A;  3HBL A;  2BS3 A;  4ASK A;  5JDN A;  2CEA A;  2XQ8 A;  3PDY A;  3Q5X A;  1E2A A;  4HFI A;  5LB7 B;  2AE9 A;  4V1A v;  5FL0 A;  3ZT6 A;  5HBE B;  4QH1 A;  3UQ7 A;  2G77 A;  4A97 A;  4CI1 B;  1YKE B;  3ONJ A;  3OTO T;  5IUX A;  4GYS A;  4IE6 A;  2UUC T;  1IJ6 A;  4AI6 A;  5FGK B;  1HX1 B;  4U33 A;  2J47 A;  4JBW F;  3AAI A;  2J4G A;  4TV9 E;  3LBX B;  3HO8 A;  4CFM B;  3N2G E;  3HHT B;  3QK6 A;  1FVV B;  1H1Q B;  1G8X A;  2V7M A;  2KZ7 B;  5JDG A;  2V8S V;  4DUZ T;  1OED E;  4H63 H;  3DOG B;  5J2T E;  1C9B A;  2VKJ A;  3A8M B;  2YEV C;  2LLY A;  4GK5 E;  2NW9 A;  5EK4 A;  2DXB B;  3TLV A;  4I4T E;  4EOZ B;  2XJ7 A;  4LF5 T;  4ZI2 D;  4WYV A;  2DHR A;  2MBG A;  4MFD A;  1JKW A;  5IDP B;  2WB5 A;  4PW8 A;  1O9K A;  2BS4 A;  4IE7 A;  5KDM C;  2BVM A;  3HKC E;  1UGR B;  3BK9 A;  4UV9 B;  5FXX A;  4PJN A;  2ZPH B;  1H27 B;  1IJ5 A;  4EOJ B;  2DD5 B;  4QKN A;  4KBM B;  5L3C B;  4ZXL A;  1H24 B;  5LQF B;  2VWA A;  3KDS E;  2W67 A;  3FZK B;  5FXZ A;  2CE7 A;  1HTJ F;  2HPL A;  2ACZ A;  3O1J A;  2NW8 A;  1VCT A;  1FJG T;  4BJM A;  4A98 A;  3FBZ A;  3P4S A;  1UGP B;  3A8G B;  4AIU A;  3ETV A;  4I55 E;  1OKW B;  4JX4 A;  4PNI A;  2IVX A;  2LEH A;  3BHT B;  3S4U A;  2UZL B;  2Q9Q C;  1D0X A;  5JDL A;  4IRE A;  4YXD A;  4L9I A;  2LSJ A;  4HWD A;  1NEN A;  4PFP A;  2JRK A;  3AE8 A;  4GKJ T;  4F7L B;  3ONX A;  2WEV B;  2FJA A;  5IF1 B;  4H9Q C;  2I59 A;  2DWK A;  2YU1 A;  4TWH A;  4JI0 T;  5HQ0 B;  1JOW A;  4BAY B;  2ZZD B;  2CXL A;  4BCO B;  5CJ5 A;  4U2Y A;  4CN1 A;  1YXR A;  2K3W A;  5AQM B;  5LG4 A;  4LF4 T;  4TNV A;  2K5B B;  2D0Q B;  5HWY A;  2CYZ B;  4LOC A;  3X24 B;  5CEI B;  1N33 T;  2XAH B;  4WW0 A;  3ZT5 A;  4WBO A;  2XQ4 A;  4CFU B;  4TTH A;  4YSY A;  1M7K A;  3GN5 B;  4LF6 T;  2J62 A;  1P5E B;  3C98 B;  5LJM A;  4X1I E;  3L8R A;  3AE2 A;  5L2W B;  2CBI A;  4GIW A;  3B13 A;  3C51 A;  3GA8 A;  3N9M A;  5AFU L;  2KMG A;  4BCK B;  5JQG E;  1IRE B;  3HZJ A;  2I6H A;  3IA3 A;  1H1S B;  3RF1 A;  3EVY A;  3ZC0 A;  2XHE B;  1CHU A;  5JRC A;  3P7I A;  1OED B;  4YOS A;  2BKO A;  3OYZ A;  2DL1 A;  4OB0 B;  4TUY E;  2UXN B;  1MIV A;  2DWG A;  2PK2 A;  1N36 T;  1JSU B;  2K48 A;  3N9L A;  3QHR B;  4ZZC A;  1KEY A;  3QWL A;  1KK7 A;  3IEE A;  2XQ9 A;  1U5P A;  3QYH B;  2BDE A;  4X1K E;  3T8O A;  3AED A;  4COF A;  2Y48 B;  2JQK A;  2LRL A;  3UUL A;  4AQF A;  2KWH A;  2JMK A;  5IYZ E;  3P50 A;  4JUY A;  1YQ3 A;  3VYH B;  4EOQ B;  3HKB E;  5A1L A;  5L47 A;  2QGS A;  2LOS A;  4CFU D;  1WLX A;  2V6Y B;  2BZB A;  2UUA T;  4DR7 T;  4JX5 A;  2ZLY A;  2ACX A;  3EUH A;  3ZN0 B;  2KSR A;  5BMV E;  3CWZ B;  5ABH A;  4NST B;  2V7J A;  4QX8 B;  1TD6 A;  3RC8 A;  5LBQ B;  2B9R A;  4EZ4 A;  1ZP0 A;  3K3O A;  3FZM B;  3TNW B;  5L3F B;  1S35 A;  1HX8 A;  2IW8 B;  5DJQ C;  2WAU A;  1WYC A;  5HAX A;  5FXV A;  4UVA B;  3U78 A;  4HFE A;  1W09 A;  4E7S A;  2ODU A;  1SHZ C;  3NZP A;  2H7O A;  2NR4 A;  1MMA A;  3TN8 B;  3T1H T;  1JNR A;  2N9D A;  3LBX A;  2X51 A;  2YDR A;  2G0U A;  5AQV B;  5BR8 T;  2W96 A;  4DR4 T;  3VHL A;  5CFB A;  4O4L E;  4EB6 E;  3OVU A;  3AA0 B;  5IWA T;  2IN3 A;  5LXT E;  2WDR A;  4U74 A;  5C2T A;  3EI0 A;  2FBW A;  3V5S A;  4J2C A;  1HS7 A;  4UVB B;  3RKO A;  3QB5 K;  1OL2 B;  5HXC A;  5AQO B;  2Q9Q B;  2FUP A;  3F5X B;  2VKH A;  3PUQ A;  3F2E A;  3GWH A;  1S94 A;  5HYA A;  4BBS M;  2BG9 E;  4ISS A;  4II5 B;  4HNT A;  1T8B A;  2CZ1 B;  4BCQ B;  3AAE B;  4ZI3 C;  4CI3 B;  4YTP A;  3L3P A;  3IHR A;  1TFB A;  3RIA A;  3NKZ A;  3AEB A;  3EJ1 B;  2BKN A;  3TNI B;  3C50 A;  2IHR 1;  3HKE E;  2J1D G;  5LMN T;  3LFM A;  1UK5 A;  3RRC A;  2CHN A;  2K24 A;  2W4X A;  2N1G A;  4A5X A;  4BCN B;  3DDP B;  3CML A;  2WXV B;  3C4W A;  5FY0 A;  5JDH A;  4B3T T;  3MIA B;  1V9D A;  3H3M A;  3I9W A;  4NUU A;  2NTY A;  3FZF B;  5JRE A;  5CB4 E;  4QXH B;  4CQI A;  2XQY A;  5FMN A;  5LMU T;  3EAB A;  2YU2 A;  3AE6 A;  3VR8 A;  4K0K T;  1XDP A;  3M3Z B;  2ODV A;  3ZKR A;  3Q5D A;  4HTE A;  4HWC A;  4P0B A;  5CYI B;  5DAB A;  4CZZ B;  3QZ9 B;  2WJ9 A;  2EHO B;  4EOP B;  3N9P A;  3B5M A;  3O1H A;  3KV5 A;  3POM A;  2CRB A;  4XBF B;  4KRC B;  4OYK A;  3ZEF B;  4F7S B;  4DR3 T;  4AIS A;  4NXM T;  1SA0 E;  5C8Y E;  1W98 B;  5FL1 A;  3RH3 A;  4B6X A;  4BCQ D;  4HFC A;  4KI0 F;  2CMR A;  2YDQ A;  3AE9 A;  4UEM A;  3SFD A;  4OB3 B;  4BA9 A;  1E7P A;  3TW6 A;  3UQ4 A;  4OHF A;  4DND A;  2L8K A;  4IDP A;  3ZJ1 A;  2AXD S;  2W62 A;  5L3D B;  2VB6 A;  3RRW A;  4EV6 A;  2C5K T;  4DBQ A;  2WZH A;  4JI7 T;  5HEO A;  4BCN D;  3PUV F;  4X1Y E;  1AD6 A;  4U72 A;  4H63 V;  3E0Z A;  2Z6E A;  4N78 D;  5JTG A;  2KIN B;  3N2K E;  1UUS A;  4HN9 A;  3AE5 A;  3AA7 B;  4ILB A;  3F57 A;  2C0S A;  4BCM D;  4EYY R;  4JX6 A;  2B1E A;  4DV5 T;  2EHO D;  2E5L T;  5IDN B;  2XQ5 A;  4DV7 T;  2WDQ A;  3L39 A;  2BVL A;  1OGU B;  5LCY A;  4HWF A;  4LFC T;  5ICP B;  5FKY A;  1J5W A;  5LA6 E;  4HNV A;  1US7 B;  3F31 A;  4ZGD B;  2H7V C;  2JQQ A;  4QXB B;  2BG9 B;  1W0A A;  1UGQ B;  2OV9 A;  3O1I A;  4DMV A;  3H3A A;  4C90 A;  1I6Z A;  5LP6 E;  4CFW B;  5J1G A;  4U2Z A;  3TKL B;  1N32 T;  2K9A A;  3ABV A;  4UIG A;  3O0G D;  1MMG A;  4UEL A;  5HBH B;  3R6N A;  1URC B;  2DLR A;  2M6B A;  2X67 A;  2LRK A;  3BG9 A;  2B76 A;  3WVD B;  1KNP A;  3QUJ A;  2UZB B;  3ZYK A;  2LSI A;  5LYJ E;  3K1S A;  3OKQ A;  4EEB A;  2WP9 A;  5L3E B;  3LK2 B;  2IUB A;  3PU3 A;  3V5U A;  3O4X E;  1F5Q B;  3BLH B;  4ZEY A;  4L5G A;  3P4W A;  4BCJ B;  3AEE A;  2E9X D;  4BJN A;  4BY7 X;  1O3X A;  4O2A E;  1KFY A;  2WWU A;  4YLH A;  1ZEE A;  4FX3 B;  1MMN A;  3MZK B;  4ZGJ B;  3PUS A;  3NRY A;  4HFV A;  2QYW A;  2XQ6 A;  1BU2 A;  2I40 B;  4BCI B;  2XAJ B;  2CCQ A;  2MYS A;  3T1Y T;  2XY8 B;  2NOX A;  3MY5 B;  5FVK A;  2X1N B;  5LNK A;  1WR0 A;  1VOM A;  4LF7 T;  2LSK A;  4B3S T;  3EOC B;  2I0M A;  3UU6 A;  2VQF T;  4AKI A;  5EK2 A;  2ZM0 A;  3PO3 S;  2RPA A;  5C3J A;  3UUB A;  5AQG B;  4Z91 A; 
#chains in the Genus database with same CATH homology
 4H9N C;  3T8O A;  5LGT B;  2MTQ A;  4O4H E;  3MA9 A;  3SRZ A;  4C91 A;  3CX6 B;  2Y48 B;  3ZJ2 A;  3ZMT B;  3MK7 C;  2WSS V;  3HKD E;  3WI3 A;  2LSY A;  3A5X A;  3N9O A;  2YK0 A;  3UUL A;  3ZMS B;  4AQF A;  2KWH A;  3K8P C;  5JDF A;  2JMK A;  5IYZ E;  4IE0 A;  1D1B A;  4JUY A;  3FXD B;  2D2S A;  2WMO A;  3HKB E;  3JC6 C;  5A1L A;  1YW0 A;  4MHC A;  2QGS A;  2LOS A;  1WLX A;  2D0U A;  4PJL A;  5LGN B;  2BZB A;  1UCU A;  2X9H A;  3VKH A;  3CVR A;  1B7T A;  3I0Q A;  4H9S E;  2LHR A;  2ZLY A;  2SPC A;  2ACX A;  3EUH A;  3ZN0 B;  5ADX L;  1BR1 A;  3RC3 A;  5BMV E;  3J7Y q;  3CWZ B;  3KIN B;  4YFS A;  4PK5 A;  2W63 A;  2V7J A;  3I9Y A;  4FI5 A;  4OK0 A;  4QX8 B;  3RC8 A;  3I0O A;  2LT3 A;  3LK4 2;  4X20 E;  5LBQ B;  4CI2 B;  3C4X A;  3ZN1 B;  2VKD A;  4EZ4 A;  3K3O A;  1H7C A;  5L3F B;  1S35 A;  2X0L B;  1HX8 A;  1WRD A;  5DJQ C;  3MAC A;  2WAU A;  1WYC A;  5HAX A;  5FXV A;  2OA5 A;  4UVA B;  2NWB A;  4ZI7 E;  1ZV4 X;  4YJ3 E;  2KMF A;  3U78 A;  3RYH E;  4UXN B;  2V7L A;  4FJO A;  4E7S A;  3QC9 A;  1NWM X;  1BR4 A;  4IDZ A;  3SS1 A;  2ODU A;  1D1A A;  4UV8 B;  1MIY A;  1SHZ C;  3NZP A;  2H7O A;  3UUN A;  4PFO A;  1HF8 A;  4QX7 B;  1MMA A;  2D5U A;  2M67 A;  2MOZ A;  3RYC E;  2EHO A;  3CX7 B;  3NBX X;  3U3I A;  1NAF A;  4H9P C;  2N9D A;  2V7K A;  1U4Q A;  3LBX A;  4NUV A;  5JR9 B;  3VKG A;  2X51 A;  3ANW B;  2CLY B;  3ETU A;  2G0U A;  3LJC A;  5JDN A;  4CXY A;  3UUM A;  2WM9 A;  1Y64 B;  3W15 B;  4UF0 B;  3VHL A;  5JR9 A;  3ZPO A;  3B57 A;  4F6R C;  2XAS B;  4O4L E;  4EB6 E;  3CPZ A;  2WMN A;  2HH7 A;  2PFV A;  2W61 A;  4PK6 A;  4TX5 A;  3AA0 B;  3FHN A;  2DI4 A;  5JDQ A;  4QHO A;  3C64 A;  4UF0 A;  5LXT E;  5L3B B;  4U74 A;  3DJB A;  3V5S A;  4EXT A;  4J2C A;  1BR2 A;  1YD8 G;  1HS7 A;  4UVB B;  5HWX A;  4GK0 E;  3UT5 E;  3N9Q A;  3RKO A;  2KWI B;  4PJM A;  2CA5 A;  3PUG A;  3ESL A;  2X9Y A;  5HXC A;  2JJ9 A;  2Q9Q B;  2RP4 A;  3AVR A;  5DQW A;  4IIJ E;  3H37 A;  5H6Q B;  4OYJ A;  3PUA A;  5GON E;  2VKH A;  3UTK A;  1G73 A;  1UX4 A;  2VKO A;  3PUQ A;  3OJA A;  2Q9Q A;  3F2E A;  3Q5W A;  2IAK A;  2ZM8 A;  3GWH A;  1S94 A;  2L9Q A;  4JEH B;  5HYA A;  5L2L A;  3PTR B;  1OXZ A;  1YKH B;  4GOU A;  4MLK A;  5TAO A;  4UVC B;  4ISS A;  3HA4 A;  1D1C A;  4HEA A;  4IE4 A;  1X79 A;  3EDV A;  5DQV A;  2A72 A;  1CUN A;  4I50 E;  4MAL A;  4ANJ A;  3P8C D;  2XTL A;  4KP3 C;  5LJN A;  1HG5 A;  1QSD A;  3AAE B;  4L0R A;  5KX5 E;  2C5I T;  4ZI3 C;  4CI3 B;  3KFW X;  2WBL A;  2KXP B;  3IF8 B;  3LK3 B;  3L3P A;  3IHR A;  4AKG A;  3FXE B;  3IBP A;  4X1K E;  5LBM A;  3MJX A;  3CQG B;  2E9X B;  2LJL A;  4PJJ A;  2C5J A;  3KBU A;  3ZCI A;  2NTX A;  5LHI B;  3C50 A;  1WR6 A;  3HKE E;  1D0Z A;  2J1D G;  3LFM A;  2V1D B;  2E9X A;  4JEU B;  2ES0 A;  3K3N A;  1EZ3 A;  3RRC A;  1ZHC A;  3N9N A;  3SOL A;  1FMW A;  2DCF A;  2K24 A;  1MND A;  4TV8 E;  2N1G A;  4ZI3 D;  3BQL A;  3AA6 B;  1KNZ A;  3UFE A;  3CML A;  3MKD A;  3ZMU B;  3EDU A;  2CEA A;  2PBI A;  3C4W A;  3N5L A;  5FY0 A;  1LVK A;  3PDY A;  4ASK A;  5JDH A;  3Q5X A;  1V9D A;  3PUR A;  2V7I A;  4DVD A;  5LGU B;  3I9W A;  4V1A v;  4GYR A;  4NUU A;  2NTY A;  4HKA A;  2LHN A;  2HPJ A;  5CB4 E;  5JRE A;  4QXH B;  4CQI A;  2XQY A;  5FMN A;  3CX8 B;  4O8S A;  2LE8 A;  1LVF A;  2A2F X;  2X9X A;  2YU2 A;  4CI1 B;  1YKE B;  2ODV A;  4GYS A;  4IE6 A;  4AQF C;  3AVS A;  1IJ6 A;  4AI6 A;  4XAX B;  2L3L A;  4IGU A;  4HTE A;  3KV9 A;  4P0B A;  3RPU A;  3ZC1 A;  4CZZ B;  5DAB A;  2A3D A;  3AAI A;  4O4J E;  2EHO B;  4TV9 E;  3N9P A;  2PG8 A;  3LBX B;  3RYF E;  5F3J A;  3O1H A;  3KV5 A;  3N2G E;  1UX5 A;  4XBF B;  3QK6 A;  3ZLI A;  1G8X A;  2X68 A;  4OYK A;  5LHG B;  3ZEF B;  3KBT A;  1T98 A;  4ZI2 C;  1AJ3 A;  2V7M A;  2KZ7 B;  3R84 B;  5JDG A;  1E1H B;  4I43 B;  1SA0 E;  5C8Y E;  4DMW A;  4JLE A;  3RH3 A;  3PU8 A;  4AKH A;  3DP7 A;  4H63 H;  4B6X A;  4O2B E;  5CA1 E;  2JMH A;  5J2T E;  3HR0 A;  2VKJ A;  2CMR A;  3I1A A;  2ZM2 A;  2RA1 A;  4UEM A;  2YEV C;  3SWH A;  3E08 A;  4GK5 E;  2NW9 A;  1MIW A;  1OWA A;  3Q9D A;  4AQG A;  5EK4 A;  4BA9 A;  4ADZ A;  3M65 A;  4OHF A;  3KVA A;  4I4T E;  4EOZ B;  5JDM A;  4ILU A;  4DND A;  4DBR A;  3OYX A;  3O9X A;  2L8K A;  4ZI2 D;  1HG2 A;  5F8P A;  5CA0 E;  3ZJ1 A;  4DO0 A;  4IE5 A;  3E22 E;  5FP3 A;  2W62 A;  5L3D B;  3CKD A;  2VB6 A;  2XUE A;  3RRW A;  2DHR A;  2MBG A;  2C5K T;  5HXE A;  4DBQ A;  3AB3 B;  4HGA A;  4A56 A;  4PW8 A;  4ZOL E;  4ZHQ E;  4AKR B;  2CM0 A;  4M1P A;  4IE7 A;  2EHO C;  3ZCJ A;  3PE0 A;  5KDM C;  4X1Y E;  3ZMV B;  2BVM A;  4U72 A;  2CXD A;  3HKC E;  3DTO A;  2E8I A;  2H3R A;  4H63 V;  3E0Z A;  2P9B A;  2Z6E A;  3BK9 A;  4UV9 B;  5FXX A;  2IC9 A;  4PJN A;  5E0O A;  2XAF B;  4N78 D;  1IJ5 A;  3KV4 A;  4CXX A;  4E7Z A;  3AAA B;  2KIN B;  3N2K E;  4QKN A;  5JR9 C;  4HN9 A;  4QWN B;  3AA7 B;  4KBM B;  3NRX A;  5L3C B;  2LM9 A;  1QUU A;  2CLY C;  2VWA A;  3KDS E;  4AXP A;  2GK9 A;  3F57 A;  5FXZ A;  2CE7 A;  2VK9 A;  3N2O A;  1HTJ F;  2HPL A;  3O1J A;  2KT9 A;  1IAP A;  2NW8 A;  3ZYL A;  2C0S A;  4ERR A;  4BJM A;  4EYY R;  3L09 A;  2B1E A;  4G63 A;  2EHO D;  3FBZ A;  5FY7 A;  4IST A;  3ETV A;  2KLQ A;  2V26 A;  3HI2 A;  4ZS2 A;  4EIW A;  4I55 E;  3KV6 A;  1Z0P A;  4PNI A;  4KUM B;  2LEH A;  3S4U A;  5FY1 A;  4PK4 A;  4YJ2 E;  2BVL A;  1D0Y A;  2Q9Q C;  1D0X A;  5LCY A;  4WNK A;  1ZKE A;  5JDL A;  5HXH A;  5LA6 E;  3K3Q C;  1US7 B;  3F31 A;  2H7V C;  3D0T A;  3Q2M A;  2JQQ A;  4QXB B;  4L9I A;  1FMV A;  2LSJ A;  3HL6 A;  3O1I A;  1IZN B;  5LHH B;  4DMV A;  3FB2 A;  3H3A A;  4PFP A;  2D0T A;  4C90 A;  2JRK A;  4H9O C;  5LP6 E;  4EYU A;  4ZS3 A;  3OBV E;  2JPF A;  2NP9 A;  1HCI A;  4QXC B;  5KMG P;  1MNE A;  3ONX A;  5J1G A;  1VRB A;  1BR0 A;  4H9Q C;  2I59 A;  4KMC A;  3TKL B;  2DWK A;  2YU1 A;  3BQK A;  2X66 A;  2K9A A;  4UIG A;  4BAY B;  2KND A;  1MMG A;  5M4Y A;  4UEL A;  2CXL A;  2Q9Q D;  3R6N A;  4WBN E;  3MXZ A;  2W0G A;  3JC6 D;  3NZQ A;  3CQX C;  2W00 A;  5LG4 A;  2E9X C;  2UXX B;  2DLR A;  5J2U E;  2K5B B;  2X67 A;  5HXS A;  5HWY A;  1HFA A;  4AKL A;  4CXW A;  3J9X 1;  3QUJ A;  5L3G B;  5IHY A;  2VL8 A;  2XAH B;  2IC6 A;  4WW0 A;  3ZYK A;  2LSI A;  3WAJ A;  2VAS A;  3BQI A;  5LYJ E;  4WBO A;  3OKQ A;  4TN7 B;  3ZYM A;  2Y6X A;  4TZ4 C;  3GN5 B;  2XAQ B;  5L3E B;  4EAH A;  3LK2 B;  2XAG B;  3PU3 A;  3V5U A;  5HXR A;  2ZMA A;  4YHJ A;  3O4X E;  3C98 B;  1LRZ A;  1WYB A;  5LJM A;  2IW5 B;  4L5G A;  4X1I E;  2E9X D;  4GIW A;  4G2A A;  4BJN A;  2LOP A;  3GN5 A;  1FIO A;  1MMD A;  1O3X A;  3B13 A;  5H6R B;  2YIN A;  3C51 A;  4MFR A;  4O2A E;  5EK3 A;  3GA8 A;  3RX6 A;  3N9M A;  2WWU A;  4YLH A;  5AFU L;  1ZEE A;  5JRC B;  2X9W A;  4O4I E;  1MMN A;  5JQG E;  3MZK B;  5LOV E;  1LKX A;  3ANW A;  4EZH A;  3C4Z A;  1FEW A;  2N2N A;  3PUS A;  3UUX B;  4P0A A;  3NRY A;  3EVY A;  3ZC0 A;  2XHE B;  4HFV A;  4XZC A;  5JRC A;  3LG7 A;  5JH7 E;  3ZMZ B;  2XAJ B;  2LSG A;  3P7I A;  4MBQ A;  2CCQ A;  5FNV E;  2MYS A;  3AA1 B;  4OFZ A;  2NOX A;  4IHJ E;  2CWY A;  2Y8D A;  3OYZ A;  5EZY E;  5LNK A;  1VOM A;  4TUY E;  2UXN B;  2LSK A;  4Z8X A;  2NW7 A;  2CWO A;  5FYM A;  3WAK A;  4PAG A;  1MIV A;  2DWG A;  4AKI A;  5EK2 A;  2K48 A;  3CQC B;  5JVD E;  3N9L A;  2ZM0 A;  5ETW A;  2DNX A;  1KK7 A;  3IEE A;  4P09 A;  5FXW A;  3VU7 H;  1U5P A;  3RYI E;  2PJQ A;  2QA7 A;  3GMI A;  3FBL A;  4H9R C;  2BDE A;  3KVB A;  4K0U A;  2CXF A;  4HE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...