3DJBA

Crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
188
Chain Sequence
TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADLNESEEAGMKKVSDWLEELHVEEEESKHVLHIIANMSIEGKLVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPRDPSLNHFYEKLLKLKDLMNTNAAKQEAEVRHRYMEQFIEQFMKEWNAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Hydrolase
molecule keywords Hydrolase, HD family
total genus 50
structure length 188
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3djbA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3djbA02
3DJBA 3B57A 2QGSA 5DQWA 2PJQA 5DQVA 3DTOA 5IHYA
chains in the Genus database with same CATH superfamily
2DD5B 4ZGJB 1VCTA 1GY3B 1F5QB 5DQWA 4CFMB 2K48A 4P09A 4ERRA 1IAPA 3AE3A 1UGOA 3ZCJA 2WIPB 1LRZA 2DLRA 3ONXA 4IDQA 3F5XB 3PUGA 5FYMA 3DOGB 3KV4A 4BCNB 2K9AA 2WDVA 2UZEB 4COFA 4JI4T 4KRCB 2FJEA 2LW4A 2V7MA 4AISA 4EIWA 4F6UB 4ILCA 5CYIB 2WXVB 2V6YB 3QK6A 4IREA 2M67A 1G8XA 2XUEA 5C3JA 4DV2T 5AQIB 3FXDB 1SHZC 2W66A 1W0AA 2CBIA 2W0GA 4QH1A 3EDUA 1HCIA 2FJAA 4M1PA 1G73A 3LK3B 1X79A 2KR6A 3M03A 2UUCT 2YDRA 1JKWA 2UUEB 1D3UB 3JADA 4O4JE 2JMHA 3BHTB 5ICPB 3TN8B 5JDGA 3L39A 4H9NC 1AISB 4DVDA 3BG5A 2IC9A 3RKOA 5FKYA 2A9UA 1KNRA 3CMLA 3HB9A 1R8IA 1WCRA 1WYCA 4QH5A 3M3ZB 2BKOA 3BHVB 1IJ6A 3EVYA 2CZ1B 4BCJB 1YKHB 2D2SA 4UEMA 4XZCA 1YKEB 2KNDA 3K1SA 5AQRB 2EUFA 4TZ4C 4OX9T 2UUBT 3RGFB 5BNJB 4CN4A 3RHWA 1HNWT 3BK9A 2NOXA 3RQWA 3AB3B 4DV3T 2XPKA 1OL2B 3ZC0A 3C50A 3RYHE 3MKDA 2G0UA 4NUUA 4EC9B 5C8YE 3L8RA 5LG3A 1S35A 1MMAA 1QMZB 4MBQA 5JRCA 4I4TE 3ZMZB 5HXHA 3K3OA 2VKHA 3ONLC 3LDQB 4JI1T 4EOLB 3DJBA 4DR3T 5J2TE 2IW8B 1V9DA 2G77A 3AE7A 4ZS2A 2W9FA 3NZPA 1OWAA 1XMOT 2IW5B 4HGAA 1FKMA 1T8BA 4EZ4A 5AQJB 2K5BB 5LJMA 4UXNB 4IGUA 5L2WB 3I0QA 2E9XA 3A5XA 5L3DB 2HH7A 1U5PA 2LSYA 3NWIA 3GTMS 4DIDB 4KRDB 4FJOA 3WVDB 2MYSA 3AAIA 2IIUA 1WR6A 3CX8B 3OVUA 2SPCA 4AQFC 5AQHB 2IDOB 4DR7T 5LA6E 4WBOA 3NRYA 2NTXA 2V22B 2C0SA 1UNLD 3PURA 4ASKA 4U7IA 4H9QC 2W00A 5JH7E 3TW6A 2ZPGB 2NR4A 4NC6A 4G6LB 1H1QB 5KDMC 5L2LA 2RPAA 5KX5E 4TNWA 3QYHB 3L09A 3ZPOA 1JNZA 2LRKA 3AVRA 4Z6YA 4YSXA 3IF8B 3NKZA 2XAFB 5JR9A 3MIAB 4TNVA 5L3FB 2A3DA 2LOPA 4JI0T 3Q2MA 3FXEB 3P4QA 5JDQA 4E7ZA 5CB4E 4CXAB 5AQUB 4YJ3E 2BVLA 4HTEA 1D0ZA 3H3AA 1FMWA 2N2NA 4ADZA 4IL4A 5AQLB 4OB1B 1MNDA 1OGUB 3RQUA 3BLQB 4OHFA 4ILAA 3ABVA 4OK0A 1W09A 2OA5A 2X0LB 1IJ5A 2AXDS 4QXHB 3ZMVB 2YDSA 1VOLA 1HNZT 3A8HB 5AQMB 4CI2B 3AE8A 4X1KE 4X62T 4U74A 4U33A 3LK2B 2HPLA 4LF5T 2LRLA 4ILBA 3QOFA 2C5OB 4DO0A 2E9XC 3I9WA 1B7TA 4HLQA 4RODA 2XQ3A 3DP7A 3RYIE 1H28B 3BQLA 3AVSA 3P4WA 3V5SA 2B76A 4I50E 4WZXA 2FJDA 3MY1B 3LSVA 2WAUA 2DHRA 5EZYE 2ODVA 3ZYMA 3TNIB 2CM0A 4OB3B 5HCMA 3ZJ1A 5LMNT 4MLKA 4BCMD 3ETUA 5ACBA 4MALA 3EJ1B 4II5B 5FP3A 1MNEA 3PUAA 1HG5A 1FVVB 2K3WA 5FY1A 4A97A 5HEGA 1GUXB 4YT0A 2E9XB 2CHOA 4PK5A 5JVDE 2DI4A 4KBMB 4QXBB 4EOJB 1MIWA 1WFDA 2A72A 2LM9A 4CFUD 1FEWA 2J1DG 2X0HA 2CE7A 4Y72B 2Q9QB 4NUVA 4EZHA 4HWHA 2C5JA 2CXFA 1O9KB 1MMNA 2ZPHB 5AQNB 2NP9A 5HCJA 2AE9A 3MK7C 4ISSA 5GONE 4U31A 3SS1A 1UNHD 5FY7A 3N9QA 4Z90A 3PJAA 4YTPA 3I1AA 4GK0E 4BBSM 2WZIA 3W15B 3N9OA 1AJ3A 3RLFF 4CXXA 2X9YA 4OR5B 4B3MT 4GYRA 2VQFT 5L3EB 1UURA 3UT5E 2BBJA 5HNBB 2ZM6T 2MBGA 1OEDA 2WFYB 1J5ET 2I53A 2V1DB 4YXDA 4U72A 2I0MA 4LMKA 4LFAT 3ZN0B 2UXCT 4PW8A 3PUQA 4EEDA 4JX4A 3DDPB 3ZEFB 1XNQT 2DMEA 2UXDT 1OI9B 2VWAA 4BY7X 4EYUA 3AE5A 4IDOA 2LHNA 1IZNB 2WDQA 2ZPFB 3P7IA 1FJGT 4HFVA 3FBLA 2WBLA 4WYVA 3E22E 2DXCB 3GMIA 4F6WB 2WPAB 2IW9B 3O4XE 3SWHA 2IC6A 2ZPBB 4MIMA 5HXCA 3TLUA 2E5VA 4ZZCA 2C4GB 2X67A 4PFOA 4KP3C 1L0VA 2UXBT 3B13A 4EONB 4IIJE 5FXXA 1Y64B 4ZGDB 1N33T 4X1YE 3BQIA 5HYAA 3PUYF 4GK5E 1H24B 1YW0A 3O0GD 3FZFB 4KI0F 2J4GA 2XQYA 4CFNB 4UV8B 3IBPA 1T72A 3PUZF 4HFIA 3QC9A 2Y6XA 4NPPA 4DV0T 2F4VT 4AQGA 3KV6A 3PUXF 5CGMA 2LHRA 4BCQB 4GOUA 3PU3A 2KXPB 4F7LB 4G63A 1JNRA 4L9IA 2WS3A 3KV9A 1EZ3A 3QUJA 4HWCA 4DV7T 2JGZB 4JX5A 3RIUC 2VKJA 3ZLIA 4GIWA 1TD6A 4HE8A 2XASB 3N9PA 4HN9A 2QRXA 1V29B 2HN2A 3VRBA 4ZS3A 4HNVA 2DPPB 1H1SB 1E7PA 2W62A 1HS7A 5FL0A 2JJ9A 3N9LA 1QSDA 2CPTA 3GN5B 5ABHA 2LSIA 4QHOA 3Q5XA 1W0BA 4YOZA 3I9YA 3S4UA 3R84B 1XO2A 4HNUA 4IDZA 4DBQA 5CFBA 2X66A 3NRXA 4EXTA 5HEUA 4LF9T 4UN0A 1CUNA 2V7JA 3HKCE 4JX6A 2CWYA 2MOZA 3QNUA 2V6YA 2C5VB 3IHRA 3KFWX 2M6IA 4AKIA 2YU2A 2QQ8A 5HXEA 1KXUA 4JI7T 2CCQA 4OGRB 1YD8G 3K3NA 2X9HA 3AEEA 2LSGA 4B6XA 4FX3B 3QZ9B 2X51A 2CHNA 1YXRA 3ESLA 2IMLA 4DV6T 5C2TA 4AKGA 3AA6B 5FNVE 5AQQB 4KHPT 3TNWB 4C90A 3F31A 1H4LD 4B3TT 2MPKA 2YKSA 2NW9A 1MIYA 2LOSA 1JSTB 1N4MA 1UGQB 2J47A 2LEHA 3EIDB 5HXRA 2CBJA 2JQQA 4DR5T 3RI5A 1JOWA 5HBJB 2A2FX 2QF7A 3P4PA 4JI5T 4HWIB 4LF6T 2Y8DA 1D1CA 1T7SA 2KMFA 4YFSA 3E08A 1UNGD 5KXJA 2BPMB 4EB6E 2IHR1 2X9XA 5HEJA 3ETVA 4ZI3D 3EUHA 5FL1A 2V7KA 1UK5A 3JC6D 3SFDA 3ZJ2A 2E9XD 3PE0A 5HAXA 1LKXA 5J1GA 3ONJA 3CX7B 3RKGA 4X20E 4NXMT 4X1IE 4ELJA 2XQ4A 4QXCB 3AE1A 3KBUA 3QB5K 2XQ5A 4BCKB 4BCFB 3AA0B 4YHJA 1URCB 3TLWA 1BU2A 5JDNA 3NZQA 4ROEA 4BCMB 2ZM0A 3ZN1B 4BCHB 4U2ZA 1XZYA 5LGNB 5AQPB 3ZMUB 1N32T 5IYZE 3U3IA 3MY5B 5TAOA 3UU4A 2BS2A 1C9BA 2X0YA 4BJNA 5JRCB 4I3ZB 3P4SA 2KWIB 4H9OC 5HXSA 3AECA 2W2UA 3NVOA 5EK3A 2OLTA 3QYGB 4F8HA 2DXBB 4N78D 1XDPA 3VKHA 1ZKEA 4EYYR 1SA0E 3UU3A 2VB6A 4FI5A 4JI6T 3Q5EA 3SOLA 3EOCB 4X66T 5F3JA 2XHEB 3X28B 4IE7A 3C4ZA 3X25B 4F6SB 5ETWA 4JLEA 4MFDA 4WW0A 4J2CA 1M7KA 4U2YA 3F57A 5KMGP 4JEHB 4UF0A 4U7YA 2BG9A 2XQ9A 3ANWB 2L3LA 3FZHB 2H3RA 4AIUA 1M62A 1MIVA 2X1NB 1Z8UA 2VQET 1KF6A 3D0TA 4ZEYA 2UXNB 2PK9B 5CJ5A 2KSRA 2N9DA 2Q9QD 3T8OA 2H7VC 4NIQA 4NSTB 3MJXA 4EORB 4UF0B 4EV6A 4PNIA 5E0OA 3PV0F 5AQVB 4DR4T 3B5MA 4CXWA 1DU2A 2I40B 4M6VA 4F7JB 4X5TA 3JC6C 2V5CA 5IHYA 1HX8A 1NWMX 5FY0A 4I43B 3A8YC 4CFXB 5ABEA 3X20B 4ZI2D 3CQXC 3LBXA 2E5LT 1OKVB 3K7AM 3TKLB 4LF4T 4TX5A 5JDMA 4Q25A 2I6HA 3LG7A 2ODUA 2PHGA 2YU1A 5LBQB 4QX8B 4AKLA 5LHGB 2DWKA 2C5IT 4YHHT 3KVAA 1KK7A 2JIWA 2WU5A 4KUMB 5M4YA 4YTNA 5L4HA 3LBXB 3BLHB 2OV9A 2LE8A 2KMGA 3EABA 1X9BA 5FXZA 2HN1A 2XAJB 4V1Av 1W98B 2KLQA 2LJLA 3P8CD 3HKBE 4UR9A 5LG4A 3LJCA 2QYWA 4DV5T 1KNPA 3CQCB 3BQKA 3KHIA 2WY2A 4PAGA 4EAHA 4KHZF 4ZI2C 3RRCA 4OFZA 4PJMA 2W63A 4QKNA 5HBHB 2D9DA 1NAFA 3NDQA 4QH4A 1VYWB 4UV9B 3OYZA 1IBMT 2YINA 5EK2A 2NW8A 4BCOB 1SE7A 4CXYA 3VYHB 4JV5T 2W4XA 4IE6A 2ACXA 3JAFA 2WWVA 5ADXL 4ELLA 3KV5A 4UVAB 2ES0A 3P4RA 1BR4A 2W99A 4DMVA 1UGSB 2CA5A 3C51A 4OYJA 4ANJA 1ZHCA 2EHOA 3AAAB 1T98A 1BR2A 3RC3A 3AE9A 3RF1A 4U3CA 2VASA 4CI1B 4DBRA 2KZ7B 4L5GA 1HFAA 3OJAA 4DNDA 4HL4A 3RC8A 4EOPB 2I59A 5EJCA 2VURA 5I5ZB 4O2AE 2VL8A 4BBRM 3ZMTB 4PK6A 3VHLA 2CXLA 4YLHA 2CRBA 2NTYA 3LFMA 3UUMA 4F70B 3OTOT 5LNKA 5ABFA 3Q5WA 3CWZB 2V7LA 5FXWA 2WEVB 1VOMA 1D1BA 1XDOA 4GYSA 2ZLYA 4CN1A 2P9BA 4HKAA 5BR8T 2DWGA 2CZ6B 4YSYA 1AD6A 3QHWB 3T1YT 3K3QC 2PK2A 3HKDE 4DUYT 5H6QB 4PJJA 3VYGB 3KDSE 3T1HT 3J9X1 5JDLA 3ZC1A 1H25B 1OKWB 1HF8A 1Y01A 5IF1B 5DJQC 2WMBB 4AI6A 2FJBA 3AXJB 4ZHQE 3AA1B 5IWAT 4ZZBA 2CZ0B 2CCIB 3MI9B 4YOSA 3PUSA 3O1HA 2LSKA 3DL1A 3N5LA 3X24B 1SUMB 5IDNB 5J2UE 3EAMA 4QX7B 5FVKA 4JYAT 1N34T 2CCHB 3G06A 2V26A 1AHJB 2W9ZA 4BCQD 3RX6A 3UULA 5HBEB 5AQTB 1IBLT 3ZKRA 1D0YA 5L47A 2WMOA 4AKHA 4TN7B 3VR9A 2QGSA 1IBKT 1S94A 3PUWF 3ZSSA 3WAKA 2IUBA 4TWFA 4P1NA 3BG3A 4BCGB 2X68A 4JI8T 4AQFA 4K0UA 5LXTE 4WNKA 4YTMA 2ZZDB 4JI3T 4MHCA 2Z6EA 4QWNB 2E2AA 5HWXA 3QHRB 3U78A 1NEKA 3UFGA 3RIAA 3AEDA 3MA9A 3NBXX 2HPJA 1WYBA 5LMKB 2W2HA 2CZ7B 2WCAA 3OYXA 4TV8E 2XQAA 4ILUA 1QUUA 3EDVA 3IEEA 3AEBA 1ZP0A 5L3GB 1LVKA 5J0ZA 3L3PA 5LBMA 2R7GA 5LCYA 3AA7B 4IMYB 2LKHA 2V6XA 5LGTB 3A8OB 4G2AA 2BKZB 3WVEB 3N2KE 3E0ZA 2VKOA 3ZMSB 4HEAA 4TUYE 4ISTA 4X64T 4DMWA 4JBWF 4MFEA 3AE4A 3CK6A 4HWFA 2L9QA 2C5KT 3GN5A 1XMQT 2UZDB 3VR8A 3HI2A 1GUXA 5CA0E 5JR9B 2QDJA 3EHZA 2XQ8A 3ZCIA 2LKGA 4BY1X 4Z91A 2H88A 2H89A 2DNXA 1QLBA 1I6ZA 3OBVE 1OIYB 3QXEB 2CLYC 4O4LE 2BKPA 3AE6A 4BCND 3C4WA 3QYBA 2LLYA 2XAQB 4BCPB 2YDQA 2KT9A 1H7CA 1FMVA 3AEFA 2AHJB 4F7NB 5JREA 4DV1T 1FINB 3OKQA 3A7MA 1UGPB 4QSHA 1VINA 1W9RA 1VCSA 5L4EA 2C6TB 3RYFE 2H7OA 4HFCA 1D0XA 3CVRA 4AXPA 4BAYB 2JMKA 4LMJA 3A8GB 2XTLA 1O9KA 4HNTA 3FZKB 2M6BA 2XQ7A 2UU9T 5H6RB 4JUYA 4LFBT 2D0QB 1KEYA 5ABGA 2XSBA 2V7IA 1UX4A 1H1PB 3AXJA 3Q5DA 4EOZB 2PFVA 5JDFA 2ZMAA 3PU8A 4L0RA 3FZLB 1KNZA 1ENWA 2PMIB 2LM2A 5BMVE 2YK0A 3TW7A 1E1HB 3RIUA 2UZBB 3HO8A 5HEOA 3O1JA 2MTQA 5F8PA 1YQ3A 2MAWA 3RIFA 2PG8A 4UVCB 2IN3A 5F5WA 3J7Yq 1O3XA 1WLXA 3P50A 3WAJA 3AEGA 3LQ5B 2WSSV 1Z0PA 5LGUB 2WIHB 5LMUT 2WB5A 2QDYB 4OB2B 4H9RC 1HX1B 5FVLA 3UTKA 2D0TA 1NENA 4F6RC 1UX5A 2K24A 5FGKB 3C98B 4CFVB 3DTOA 3POMA 2EHOB 3UQ4A 2XQ6A 3SFEA 1OEDB 3PTRB 4DR2T 2BZBA 3HBLA 2N1GA 4CQIA 4XAXB 2J62A 1HNXT 4ZI7E 3RYCE 4DUZT 2WHBB 4EOOB 1UCUA 3C64A 2CXDA 3R6NA 2FBWA 2W61A 4YJ2E 2XY8B 3UUNA 1MMGA 2B1EA 4O8SA 1LVFA 5LOVE 4BCIB 3MACA 3UU8A 5HWYA 1VRBA 2V5DA 3GWHA 3A8LB 3PDYA 2LT3A 3BG9A 5EK4A 4EGWA 4LFCT 4OB0B 3KBTA 2VVSA 2VL0A 2WDRA 3I0OA 3BLRB 1KFYA 4P0BA 2C5NB 5AQGB 1WRDA 3CKDA 2IW6B 4Z8XA 3QWLA 2Q9QA 4JI2T 2YOEA 3HR0A 3ZSTA 4IE5A 1XWMA 2BKNA 3UUBA 4LMLA 2E8IA 4JEUB 2CYZB 2DD4B 2F2CA 2WWUA 4IDNA 4CFWB 3N9NA 4NXNT 3ZT6A 3AAEB 4KMCA 4EC8B 4TV9E 3PO3S 2W96A 3QZ5B 2L8KA 3VRAA 5JQGE 3A8MB 3FZMB 2CWOA 3MXZA 2JQHA 1BR1A 2PBIA 5IUXA 3VKGA 3KINB 2B9RA 2XAGB 1UGRB 5AQKB 4KX6A 3O9XA 5HQ0B 4LF7T 4UVBB 4BJMA 3HHTB 4YC3B 3GA8A 4XBFB 2RA1A 2WZHA 2BS4A 2EHOD 3UU6A 2R6GF 2DCFA 1FIOA 4CZZB 4EOSB 5HVYB 3EI0A 2CEAA 3QYEA 1OL1B 5FXVA 2BG9E 3IA3A 1H27B 3UFEA 3TNHB 1H1RB 1P5EB 3M65A 4UELA 4TWDA 5LHIB 2ZPEB 2BVMA 1US7B 4CN6A 4PFPA 5LHHB 2BG9B 3KVBA 4HFHA 4O2BE 1WR0A 2BBHA 3HL6A 5IDPB 4DR6T 1HR0T 2G9XB 1ZV4X 4WBNE 4E7SA 2C5XB 1TFBA 4ZXLA 4CI3B 5L3BB 1OEDE 2D5UA 5ABFB 2V8SV 5LQFB 4IE4A 2ZM8A 4PJLA 3LK42 3CIRA 4OYKA 5L3CB 3Q9DA 2QFZA 2D0UA 3X1DA 2IAKA 4O4HE 2EHOC 4EOMB 2XAHB 4EEBA 3FHNA 3F2EA 1YQ4A 3SRZA 1PKDB 2NW7A 5LJNA 3JAEA 2BDEA 2Y48B 1JSUB 3UQ7A 3TLSA 4YOOA 5FMNA 4I55E 4HFBA 4BXXX 4IHJE 4IE0A 4B3ST 1H26B 3C4XA 3H3MA 4H63V 1UUSA 3FB2A 1CHUA 2WMAB 4EOIB 3WI3A 2FUPA 3H37A 4H63H 3RPUA 1ZEEA 3CQGB 2RP4A 2PTFA 5CA1E 4I0UA 3RH3A 1IREB 1ZOYA 3DDQB 2BS3A 2CJMB 4LOCA 4TWHA 5LB7B 4IL9A 3RGLA 3N2OA 3H4CA 4PK4A 3AEAA 4A5XA 4LF8T 1E2AA 4A98A 3QB5A 2ZM2A 4YSZA 3N9MA 3PUVF 4UIGA 4MFRA 2IVXA 4GKJT 2VVNA 4A56A 1E9HB 5DABA 4YY3T 3K8PC 3MZKB 2JRKA 3O1IA 3HZJA 1U4QA 1OXZA 4AKRB 4ROCA 1J5WA 5A1LA 2WJ9A 4HWDA 3BHUB 4ZOLE 4IT4A 4P0AA 2X9WA 4TTHA 2ZPIB 2VK9A 2YEVC 4F7SB 2QA7A 4PJNA 5LP6E 2NWBA 5AFUL 1MMDA 2XZEA 3ZT5A 3FBZA 3ZYKA 5LYJE 2XSAA 1OIUB 3OPCA 3CX6B 3HA4A 3TLTA 3PJAJ 4CFUB 1D1AA 2XM1A 2UZLB 5HEHA 4CRLB 1HG2A 3UUXB 2UXXB 2UUAT 3JCFA 1GQEA 4K0KT 1BR0A 1HTJF 4FM4B 4H9SE 4IDPA 5AQOB 3HKEE 5AQFB 2JQKA 4HFDA 2CLYB 1OEDC 4GKKT 2QVAA 1N36T 3RRWA 3UU5A 4BA9A 3V5UA 3VU7H 4HFEA 2Q9QC 1G3NC 5EFQB 4H9PC 4EOQB 2ZCFB 5JDHA 4X65T 2HHHT 2WQYA 2XJ7A 2BG9C 2YN6A 5JTGA 4ZGEB 1XNRT 2W67A 2GK9A 5DQVA 5CEIB 3CPZA 3TLVA 3B57A 1J1JA 3G33B 3ANWA 5AQSB 2JQ9A 2WMNA 4DV4T 4O4IE 2VKDA 2KWHA 2JPFA 4AQYT 1I94T 4C91A 5JR9C 2CMRA 4B3RT 2WU2A 2DL1A 4EOKB 3ZYLA 4ZI3C 2WM9A 2XM2A 2PJQA 3AE2A 3ZT7A 3X26B 4DR1T 1GH6B 2KINB 3N2GE 2ACZA 2WP9A 2LSJA 1ZP2A
chains in the Genus database with same CATH topology
2X9YA 4TX5A 3UTKA 2D0TA 5JDMA 4GYRA 3LG7A 4F6RC 1UX5A 2ODUA 5L3EB 2K24A 3UT5E 5DQWA 2YU1A 3C98B 2MBGA 3DTOA 2K48A 4P09A 4ERRA 1IAPA 5LBQB 2EHOB 3PTRB 2V1DB 4U72A 2BZBA 2N1GA 4QX8B 4XAXB 4CQIA 3ZCJA 4AKLA 5LHGB 4ZI7E 3RYCE 2DWKA 2C5IT 3ZN0B 1LRZA 2DLRA 3ONXA 3KVAA 1KK7A 4PW8A 3PUGA 3PUQA 5FYMA 4KUMB 1UCUA 3C64A 3KV4A 3ZEFB 2K9AA 5M4YA 2CXDA 3R6NA 2W61A 2VWAA 3LBXB 4YJ2E 2V7MA 3UUNA 4EYUA 2LE8A 1MMGA 2B1EA 4EIWA 4O8SA 2LHNA 5FXZA 1LVFA 2XAJB 5LOVE 4V1Av 3MACA 1IZNB 2KLQA 2LJLA 3P8CD 5HWYA 3P7IA 1VRBA 4HFVA 3HKBE 3GWHA 3FBLA 3QK6A 3PDYA 2LT3A 2WBLA 3E22E 5EK4A 5LG4A 3LJCA 2M67A 1G8XA 2XUEA 3CQCB 3GMIA 3BQKA 3KBTA 4PAGA 3FXDB 4EAHA 1SHZC 3I0OA 3O4XE 2W0GA 3SWHA 2IC6A 4OFZA 3RRCA 4ZI2C 4PJMA 2W63A 4QKNA 4P0BA 3EDUA 1HCIA 5HXCA 1WRDA 3CKDA 4M1PA 1NAFA 4Z8XA 1G73A 2X67A 3LK3B 2Q9QA 1X79A 4UV9B 3HR0A 4PFOA 4KP3C 3OYZA 4IE5A 3B13A 4IIJE 5FXXA 1Y64B 2YINA 5EK2A 2NW8A 2E8IA 4O4JE 4X1YE 4CXYA 4JEUB 3BQIA 5HYAA 2JMHA 4IE6A 4GK5E 2ACXA 1YW0A 5JDGA 4H9NC 2XQYA 4DVDA 5ADXL 2IC9A 4UV8B 3KV5A 4UVAB 3RKOA 2ES0A 3CMLA 3IBPA 2WWUA 1WYCA 3N9NA 1BR4A 1IJ6A 4DMVA 2CA5A 3QC9A 3C51A 2Y6XA 3AAEB 3EVYA 4OYJA 1ZHCA 4ANJA 4KMCA 2EHOA 3AAAB 1T98A 1BR2A 3RC3A 4AQGA 3KV6A 1YKHB 4TV9E 2LHRA 2D2SA 4UEMA 4XZCA 1YKEB 2KNDA 2VASA 2L8KA 4GOUA 5JQGE 3PU3A 4CI1B 4DBRA 2KXPB 2KZ7B 4L5GA 4TZ4C 4G63A 2CWOA 1HFAA 3OJAA 4DNDA 3MXZA 3RC8A 1BR1A 2I59A 4L9IA 3BK9A 2NOXA 2PBIA 4O2AE 3AB3B 3KV9A 2VL8A 3VKGA 3KINB 1EZ3A 3ZMTB 4PK6A 2XAGB 3VHLA 2CXLA 3ZC0A 3C50A 3QUJA 4YLHA 3RYHE 3MKDA 2G0UA 2NTYA 3LFMA 4NUUA 3UUMA 5C8YE 5LNKA 3O9XA 3Q5WA 4UVBB 3CWZB 2VKJA 3ZLIA 1S35A 4BJMA 1MMAA 2V7LA 4GIWA 4MBQA 5FXWA 4HE8A 5JRCA 1VOMA 2XASB 1D1BA 3GA8A 3N9PA 4I4TE 4HN9A 3ZMZB 5HXHA 4GYSA 2ZLYA 3K3OA 2VKHA 4XBFB 2P9BA 4HKAA 2RA1A 2DWGA 3DJBA 4ZS3A 2EHOD 2DCFA 1FIOA 5J2TE 2W62A 4CZZB 1HS7A 1V9DA 3K3QC 3HKDE 4ZS2A 5H6QB 4PJJA 3NZPA 1OWAA 2JJ9A 2CEAA 3N9LA 3KDSE 1QSDA 5FXVA 3J9X1 3GN5B 3UFEA 2IW5B 3ZC1A 5JDLA 2LSIA 4QHOA 1HF8A 3Q5XA 4HGAA 3M65A 4UELA 5DJQC 4EZ4A 5LJMA 2K5BB 3I9YA 4IGUA 4UXNB 5LHIB 3S4UA 3R84B 4AI6A 3I0QA 2E9XA 3A5XA 2BVMA 1US7B 4ZHQE 5L3DB 3AA1B 2HH7A 4PFPA 5LHHB 1U5PA 2LSYA 3KVBA 4O2BE 4IDZA 4DBQA 3HL6A 2X66A 3NRXA 4EXTA 3PUSA 4FJOA 3O1HA 1CUNA 1ZV4X 2LSKA 3N5LA 2MYSA 2V7JA 3AAIA 4WBNE 5J2UE 3HKCE 4E7SA 1WR6A 3CX8B 4QX7B 4CI3B 5L3BB 2V26A 2CWYA 2MOZA 2D5UA 3IHRA 2SPCA 3KFWX 4AQFC 3RX6A 4AKIA 2YU2A 5LA6E 3UULA 4WBOA 4IE4A 5HXEA 3NRYA 2ZM8A 2NTXA 4PJLA 2C0SA 2CCQA 3LK42 3PURA 4OYKA 1YD8G 3K3NA 1D0YA 4ASKA 5L3CB 2X9HA 3Q9DA 2LSGA 2WMOA 4B6XA 2D0UA 2X51A 2IAKA 4O4HE 2EHOC 2XAHB 4AKHA 4TN7B 4H9QC 2W00A 2QGSA 5JH7E 3FHNA 3F2EA 1S94A 3ESLA 3SRZA 2NW7A 5LJNA 3WAKA 5KDMC 2BDEA 2Y48B 5L2LA 4AKGA 3AA6B 2X68A 5KX5E 5FMNA 5FNVE 4I55E 3L09A 3ZPOA 4AQFA 4K0UA 5LXTE 3AVRA 4IHJE 4IE0A 4C90A 3F31A 3C4XA 4H63V 3IF8B 4WNKA 2XAFB 3FB2A 2NW9A 5JR9A 1MIYA 5L3FB 2LOSA 2A3DA 2LOPA 4MHCA 2LEHA 3WI3A 3H37A 2Z6EA 4H63H 4QWNB 5HXRA 3RPUA 1ZEEA 5HWXA 2JQQA 3CQGB 3U78A 2RP4A 5CA1E 3Q2MA 3RH3A 3FXEB 3MA9A 3NBXX 2HPJA 2A2FX 5JDQA 4E7ZA 5CB4E 4YJ3E 2Y8DA 1D1CA 1WYBA 2KMFA 4YFSA 2BVLA 4HTEA 3E08A 4TV8E 3OYXA 1D0ZA 3H3AA 4ILUA 3N2OA 1QUUA 1FMWA 2N2NA 4PK4A 4ADZA 4EB6E 3EDVA 3IEEA 5L3GB 1LVKA 2X9XA 3L3PA 1MNDA 5LBMA 5LCYA 2ZM2A 3AA7B 3ETVA 4ZI3D 3EUHA 3N9MA 2V7KA 4OHFA 5LGTB 4G2AA 4OK0A 4UIGA 3JC6D 3ZJ2A 4MFRA 2E9XD 3PE0A 3N2KE 5HAXA 1LKXA 5J1GA 4A56A 2OA5A 5DABA 3CX7B 2X0LB 1IJ5A 3K8PC 4X20E 4QXHB 3ZMVB 3MZKB 2JRKA 3O1IA 3E0ZA 2VKOA 4X1IE 3ZMSB 4HEAA 4TUYE 1U4QA 4ISTA 1OXZA 4QXCB 4AKRB 4DMWA 4CI2B 3KBUA 4X1KE 5A1LA 4U74A 2L9QA 3AA0B 4YHJA 2C5KT 3GN5A 3LK2B 4ZOLE 3HI2A 2HPLA 5JDNA 4P0AA 5CA0E 2X9WA 3NZQA 5JR9B 2ZM0A 3ZN1B 2VK9A 3ZCIA 2YEVC 4DO0A 2E9XC 2QA7A 4PJNA 5LP6E 3I9WA 1B7TA 5LGNB 2DNXA 2NWBA 5AFUL 1MMDA 3OBVE 3ZMUB 3FBZA 3ZYKA 4O4LE 2CLYC 3DP7A 5LYJE 5IYZE 3RYIE 3U3IA 5TAOA 3CX6B 3C4WA 3HA4A 3BQLA 4BJNA 3AVSA 5JRCB 2XAQB 1D1AA 2KWIB 4H9OC 5HXSA 1HG2A 3V5SA 3UUXB 5EK3A 2UXXB 4I50E 2KT9A 1H7CA 1FMVA 2WAUA 1BR0A 2DHRA 5EZYE 1HTJF 5JREA 2ODVA 4N78D 3ZYMA 3VKHA 1ZKEA 4EYYR 2CM0A 4H9SE 3OKQA 3HKEE 3ZJ1A 1SA0E 2VB6A 4FI5A 2CLYB 3SOLA 3RYFE 2H7OA 4MLKA 3RRWA 5F3JA 3ETUA 2XHEB 1D0XA 3CVRA 4AXPA 4MALA 4IE7A 3C4ZA 4BA9A 3V5UA 2JMKA 5ETWA 4BAYB 4JLEA 3VU7H 5FP3A 2Q9QC 4WW0A 2XTLA 4J2CA 4H9PC 3F57A 5JDHA 1MNEA 5KMGP 4JEHB 5H6RB 4UF0A 3PUAA 4JUYA 1HG5A 2V7IA 1UX4A 3ANWB 2L3LA 5FY1A 2H3RA 2E9XB 1MIVA 4PK5A 4EOZB 5JVDE 2DI4A 2PFVA 5JDFA 4KBMB 4QXBB 3D0TA 2GK9A 2ZMAA 3PU8A 1MIWA 5DQVA 2UXNB 2A72A 3CPZA 4L0RA 2LM9A 1KNZA 3B57A 1FEWA 2N9DA 3ANWA 2J1DG 2Q9QD 3T8OA 2H7VC 5BMVE 2YK0A 2CE7A 3MJXA 1E1HB 4UF0B 4PNIA 2Q9QB 4NUVA 4EZHA 2WMNA 5E0OA 2C5JA 2CXFA 4O4IE 2VKDA 2KWHA 1MMNA 3O1JA 2MTQA 2NP9A 4CXWA 5F8PA 2JPFA 2PG8A 4UVCB 4C91A 2CMRA 5JR9C 3J7Yq 3JC6C 3MK7C 1O3XA 3ZYLA 5IHYA 2WM9A 4ZI3C 4ISSA 5GONE 1WLXA 3SS1A 1HX8A 5FY7A 3WAJA 1NWMX 5FY0A 3N9QA 4I43B 2PJQA 2WSSV 3I1AA 1Z0PA 4GK0E 5LGUB 4ZI2D 3CQXC 3W15B 3LBXA 3N9OA 2KINB 3N2GE 4H9RC 1AJ3A 2LSJA 4CXXA 3TKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJB A;  3B57 A;  2QGS A;  5DQW A;  2PJQ A;  5DQV A;  3DTO A;  5IHY A; 
#chains in the Genus database with same CATH topology
 2DD5 B;  4ZGJ B;  1VCT A;  1GY3 B;  1F5Q B;  5DQW A;  4CFM B;  2K48 A;  4P09 A;  4ERR A;  1IAP A;  3AE3 A;  1UGO A;  3ZCJ A;  2WIP B;  1LRZ A;  2DLR A;  3ONX A;  4IDQ A;  3F5X B;  3PUG A;  5FYM A;  3DOG B;  3KV4 A;  4BCN B;  2K9A A;  2WDV A;  2UZE B;  4COF A;  4JI4 T;  4KRC B;  2FJE A;  2LW4 A;  2V7M A;  4AIS A;  4EIW A;  4F6U B;  4ILC A;  5CYI B;  2WXV B;  2V6Y B;  3QK6 A;  4IRE A;  2M67 A;  1G8X A;  2XUE A;  5C3J A;  4DV2 T;  5AQI B;  3FXD B;  1SHZ C;  2W66 A;  1W0A A;  2CBI A;  2W0G A;  4QH1 A;  3EDU A;  1HCI A;  2FJA A;  4M1P A;  1G73 A;  3LK3 B;  1X79 A;  2KR6 A;  3M03 A;  2UUC T;  2YDR A;  1JKW A;  2UUE B;  1D3U B;  3JAD A;  4O4J E;  2JMH A;  3BHT B;  5ICP B;  3TN8 B;  5JDG A;  3L39 A;  4H9N C;  1AIS B;  4DVD A;  3BG5 A;  2IC9 A;  3RKO A;  5FKY A;  2A9U A;  1KNR A;  3CML A;  3HB9 A;  1R8I A;  1WCR A;  1WYC A;  4QH5 A;  3M3Z B;  2BKO A;  3BHV B;  1IJ6 A;  3EVY A;  2CZ1 B;  4BCJ B;  1YKH B;  2D2S A;  4UEM A;  4XZC A;  1YKE B;  2KND A;  3K1S A;  5AQR B;  2EUF A;  4TZ4 C;  4OX9 T;  2UUB T;  3RGF B;  5BNJ B;  4CN4 A;  3RHW A;  1HNW T;  3BK9 A;  2NOX A;  3RQW A;  3AB3 B;  4DV3 T;  2XPK A;  1OL2 B;  3ZC0 A;  3C50 A;  3RYH E;  3MKD A;  2G0U A;  4NUU A;  4EC9 B;  5C8Y E;  3L8R A;  5LG3 A;  1S35 A;  1MMA A;  1QMZ B;  4MBQ A;  5JRC A;  4I4T E;  3ZMZ B;  5HXH A;  3K3O A;  2VKH A;  3ONL C;  3LDQ B;  4JI1 T;  4EOL B;  3DJB A;  4DR3 T;  5J2T E;  2IW8 B;  1V9D A;  2G77 A;  3AE7 A;  4ZS2 A;  2W9F A;  3NZP A;  1OWA A;  1XMO T;  2IW5 B;  4HGA A;  1FKM A;  1T8B A;  4EZ4 A;  5AQJ B;  2K5B B;  5LJM A;  4UXN B;  4IGU A;  5L2W B;  3I0Q A;  2E9X A;  3A5X A;  5L3D B;  2HH7 A;  1U5P A;  2LSY A;  3NWI A;  3GTM S;  4DID B;  4KRD B;  4FJO A;  3WVD B;  2MYS A;  3AAI A;  2IIU A;  1WR6 A;  3CX8 B;  3OVU A;  2SPC A;  4AQF C;  5AQH B;  2IDO B;  4DR7 T;  5LA6 E;  4WBO A;  3NRY A;  2NTX A;  2V22 B;  2C0S A;  1UNL D;  3PUR A;  4ASK A;  4U7I A;  4H9Q C;  2W00 A;  5JH7 E;  3TW6 A;  2ZPG B;  2NR4 A;  4NC6 A;  4G6L B;  1H1Q B;  5KDM C;  5L2L A;  2RPA A;  5KX5 E;  4TNW A;  3QYH B;  3L09 A;  3ZPO A;  1JNZ A;  2LRK A;  3AVR A;  4Z6Y A;  4YSX A;  3IF8 B;  3NKZ A;  2XAF B;  5JR9 A;  3MIA B;  4TNV A;  5L3F B;  2A3D A;  2LOP A;  4JI0 T;  3Q2M A;  3FXE B;  3P4Q A;  5JDQ A;  4E7Z A;  5CB4 E;  4CXA B;  5AQU B;  4YJ3 E;  2BVL A;  4HTE A;  1D0Z A;  3H3A A;  1FMW A;  2N2N A;  4ADZ A;  4IL4 A;  5AQL B;  4OB1 B;  1MND A;  1OGU B;  3RQU A;  3BLQ B;  4OHF A;  4ILA A;  3ABV A;  4OK0 A;  1W09 A;  2OA5 A;  2X0L B;  1IJ5 A;  2AXD S;  4QXH B;  3ZMV B;  2YDS A;  1VOL A;  1HNZ T;  3A8H B;  5AQM B;  4CI2 B;  3AE8 A;  4X1K E;  4X62 T;  4U74 A;  4U33 A;  3LK2 B;  2HPL A;  4LF5 T;  2LRL A;  4ILB A;  3QOF A;  2C5O B;  4DO0 A;  2E9X C;  3I9W A;  1B7T A;  4HLQ A;  4ROD A;  2XQ3 A;  3DP7 A;  3RYI E;  1H28 B;  3BQL A;  3AVS A;  3P4W A;  3V5S A;  2B76 A;  4I50 E;  4WZX A;  2FJD A;  3MY1 B;  3LSV A;  2WAU A;  2DHR A;  5EZY E;  2ODV A;  3ZYM A;  3TNI B;  2CM0 A;  4OB3 B;  5HCM A;  3ZJ1 A;  5LMN T;  4MLK A;  4BCM D;  3ETU A;  5ACB A;  4MAL A;  3EJ1 B;  4II5 B;  5FP3 A;  1MNE A;  3PUA A;  1HG5 A;  1FVV B;  2K3W A;  5FY1 A;  4A97 A;  5HEG A;  1GUX B;  4YT0 A;  2E9X B;  2CHO A;  4PK5 A;  5JVD E;  2DI4 A;  4KBM B;  4QXB B;  4EOJ B;  1MIW A;  1WFD A;  2A72 A;  2LM9 A;  4CFU D;  1FEW A;  2J1D G;  2X0H A;  2CE7 A;  4Y72 B;  2Q9Q B;  4NUV A;  4EZH A;  4HWH A;  2C5J A;  2CXF A;  1O9K B;  1MMN A;  2ZPH B;  5AQN B;  2NP9 A;  5HCJ A;  2AE9 A;  3MK7 C;  4ISS A;  5GON E;  4U31 A;  3SS1 A;  1UNH D;  5FY7 A;  3N9Q A;  4Z90 A;  3PJA A;  4YTP A;  3I1A A;  4GK0 E;  4BBS M;  2WZI A;  3W15 B;  3N9O A;  1AJ3 A;  3RLF F;  4CXX A;  2X9Y A;  4OR5 B;  4B3M T;  4GYR A;  2VQF T;  5L3E B;  1UUR A;  3UT5 E;  2BBJ A;  5HNB B;  2ZM6 T;  2MBG A;  1OED A;  2WFY B;  1J5E T;  2I53 A;  2V1D B;  4YXD A;  4U72 A;  2I0M A;  4LMK A;  4LFA T;  3ZN0 B;  2UXC T;  4PW8 A;  3PUQ A;  4EED A;  4JX4 A;  3DDP B;  3ZEF B;  1XNQ T;  2DME A;  2UXD T;  1OI9 B;  2VWA A;  4BY7 X;  4EYU A;  3AE5 A;  4IDO A;  2LHN A;  1IZN B;  2WDQ A;  2ZPF B;  3P7I A;  1FJG T;  4HFV A;  3FBL A;  2WBL A;  4WYV A;  3E22 E;  2DXC B;  3GMI A;  4F6W B;  2WPA B;  2IW9 B;  3O4X E;  3SWH A;  2IC6 A;  2ZPB B;  4MIM A;  5HXC A;  3TLU A;  2E5V A;  4ZZC A;  2C4G B;  2X67 A;  4PFO A;  4KP3 C;  1L0V A;  2UXB T;  3B13 A;  4EON B;  4IIJ E;  5FXX A;  1Y64 B;  4ZGD B;  1N33 T;  4X1Y E;  3BQI A;  5HYA A;  3PUY F;  4GK5 E;  1H24 B;  1YW0 A;  3O0G D;  3FZF B;  4KI0 F;  2J4G A;  2XQY A;  4CFN B;  4UV8 B;  3IBP A;  1T72 A;  3PUZ F;  4HFI A;  3QC9 A;  2Y6X A;  4NPP A;  4DV0 T;  2F4V T;  4AQG A;  3KV6 A;  3PUX F;  5CGM A;  2LHR A;  4BCQ B;  4GOU A;  3PU3 A;  2KXP B;  4F7L B;  4G63 A;  1JNR A;  4L9I A;  2WS3 A;  3KV9 A;  1EZ3 A;  3QUJ A;  4HWC A;  4DV7 T;  2JGZ B;  4JX5 A;  3RIU C;  2VKJ A;  3ZLI A;  4GIW A;  1TD6 A;  4HE8 A;  2XAS B;  3N9P A;  4HN9 A;  2QRX A;  1V29 B;  2HN2 A;  3VRB A;  4ZS3 A;  4HNV A;  2DPP B;  1H1S B;  1E7P A;  2W62 A;  1HS7 A;  5FL0 A;  2JJ9 A;  3N9L A;  1QSD A;  2CPT A;  3GN5 B;  5ABH A;  2LSI A;  4QHO A;  3Q5X A;  1W0B A;  4YOZ A;  3I9Y A;  3S4U A;  3R84 B;  1XO2 A;  4HNU A;  4IDZ A;  4DBQ A;  5CFB A;  2X66 A;  3NRX A;  4EXT A;  5HEU A;  4LF9 T;  4UN0 A;  1CUN A;  2V7J A;  3HKC E;  4JX6 A;  2CWY A;  2MOZ A;  3QNU A;  2V6Y A;  2C5V B;  3IHR A;  3KFW X;  2M6I A;  4AKI A;  2YU2 A;  2QQ8 A;  5HXE A;  1KXU A;  4JI7 T;  2CCQ A;  4OGR B;  1YD8 G;  3K3N A;  2X9H A;  3AEE A;  2LSG A;  4B6X A;  4FX3 B;  3QZ9 B;  2X51 A;  2CHN A;  1YXR A;  3ESL A;  2IML A;  4DV6 T;  5C2T A;  4AKG A;  3AA6 B;  5FNV E;  5AQQ B;  4KHP T;  3TNW B;  4C90 A;  3F31 A;  1H4L D;  4B3T T;  2MPK A;  2YKS A;  2NW9 A;  1MIY A;  2LOS A;  1JST B;  1N4M A;  1UGQ B;  2J47 A;  2LEH A;  3EID B;  5HXR A;  2CBJ A;  2JQQ A;  4DR5 T;  3RI5 A;  1JOW A;  5HBJ B;  2A2F X;  2QF7 A;  3P4P A;  4JI5 T;  4HWI B;  4LF6 T;  2Y8D A;  1D1C A;  1T7S A;  2KMF A;  4YFS A;  3E08 A;  1UNG D;  5KXJ A;  2BPM B;  4EB6 E;  2IHR 1;  2X9X A;  5HEJ A;  3ETV A;  4ZI3 D;  3EUH A;  5FL1 A;  2V7K A;  1UK5 A;  3JC6 D;  3SFD A;  3ZJ2 A;  2E9X D;  3PE0 A;  5HAX A;  1LKX A;  5J1G A;  3ONJ A;  3CX7 B;  3RKG A;  4X20 E;  4NXM T;  4X1I E;  4ELJ A;  2XQ4 A;  4QXC B;  3AE1 A;  3KBU A;  3QB5 K;  2XQ5 A;  4BCK B;  4BCF B;  3AA0 B;  4YHJ A;  1URC B;  3TLW A;  1BU2 A;  5JDN A;  3NZQ A;  4ROE A;  4BCM B;  2ZM0 A;  3ZN1 B;  4BCH B;  4U2Z A;  1XZY A;  5LGN B;  5AQP B;  3ZMU B;  1N32 T;  5IYZ E;  3U3I A;  3MY5 B;  5TAO A;  3UU4 A;  2BS2 A;  1C9B A;  2X0Y A;  4BJN A;  5JRC B;  4I3Z B;  3P4S A;  2KWI B;  4H9O C;  5HXS A;  3AEC A;  2W2U A;  3NVO A;  5EK3 A;  2OLT A;  3QYG B;  4F8H A;  2DXB B;  4N78 D;  1XDP A;  3VKH A;  1ZKE A;  4EYY R;  1SA0 E;  3UU3 A;  2VB6 A;  4FI5 A;  4JI6 T;  3Q5E A;  3SOL A;  3EOC B;  4X66 T;  5F3J A;  2XHE B;  3X28 B;  4IE7 A;  3C4Z A;  3X25 B;  4F6S B;  5ETW A;  4JLE A;  4MFD A;  4WW0 A;  4J2C A;  1M7K A;  4U2Y A;  3F57 A;  5KMG P;  4JEH B;  4UF0 A;  4U7Y A;  2BG9 A;  2XQ9 A;  3ANW B;  2L3L A;  3FZH B;  2H3R A;  4AIU A;  1M62 A;  1MIV A;  2X1N B;  1Z8U A;  2VQE T;  1KF6 A;  3D0T A;  4ZEY A;  2UXN B;  2PK9 B;  5CJ5 A;  2KSR A;  2N9D A;  2Q9Q D;  3T8O A;  2H7V C;  4NIQ A;  4NST B;  3MJX A;  4EOR B;  4UF0 B;  4EV6 A;  4PNI A;  5E0O A;  3PV0 F;  5AQV B;  4DR4 T;  3B5M A;  4CXW A;  1DU2 A;  2I40 B;  4M6V A;  4F7J B;  4X5T A;  3JC6 C;  2V5C A;  5IHY A;  1HX8 A;  1NWM X;  5FY0 A;  4I43 B;  3A8Y C;  4CFX B;  5ABE A;  3X20 B;  4ZI2 D;  3CQX C;  3LBX A;  2E5L T;  1OKV B;  3K7A M;  3TKL B;  4LF4 T;  4TX5 A;  5JDM A;  4Q25 A;  2I6H A;  3LG7 A;  2ODU A;  2PHG A;  2YU1 A;  5LBQ B;  4QX8 B;  4AKL A;  5LHG B;  2DWK A;  2C5I T;  4YHH T;  3KVA A;  1KK7 A;  2JIW A;  2WU5 A;  4KUM B;  5M4Y A;  4YTN A;  5L4H A;  3LBX B;  3BLH B;  2OV9 A;  2LE8 A;  2KMG A;  3EAB A;  1X9B A;  5FXZ A;  2HN1 A;  2XAJ B;  4V1A v;  1W98 B;  2KLQ A;  2LJL A;  3P8C D;  3HKB E;  4UR9 A;  5LG4 A;  3LJC A;  2QYW A;  4DV5 T;  1KNP A;  3CQC B;  3BQK A;  3KHI A;  2WY2 A;  4PAG A;  4EAH A;  4KHZ F;  4ZI2 C;  3RRC A;  4OFZ A;  4PJM A;  2W63 A;  4QKN A;  5HBH B;  2D9D A;  1NAF A;  3NDQ A;  4QH4 A;  1VYW B;  4UV9 B;  3OYZ A;  1IBM T;  2YIN A;  5EK2 A;  2NW8 A;  4BCO B;  1SE7 A;  4CXY A;  3VYH B;  4JV5 T;  2W4X A;  4IE6 A;  2ACX A;  3JAF A;  2WWV A;  5ADX L;  4ELL A;  3KV5 A;  4UVA B;  2ES0 A;  3P4R A;  1BR4 A;  2W99 A;  4DMV A;  1UGS B;  2CA5 A;  3C51 A;  4OYJ A;  4ANJ A;  1ZHC A;  2EHO A;  3AAA B;  1T98 A;  1BR2 A;  3RC3 A;  3AE9 A;  3RF1 A;  4U3C A;  2VAS A;  4CI1 B;  4DBR A;  2KZ7 B;  4L5G A;  1HFA A;  3OJA A;  4DND A;  4HL4 A;  3RC8 A;  4EOP B;  2I59 A;  5EJC A;  2VUR A;  5I5Z B;  4O2A E;  2VL8 A;  4BBR M;  3ZMT B;  4PK6 A;  3VHL A;  2CXL A;  4YLH A;  2CRB A;  2NTY A;  3LFM A;  3UUM A;  4F70 B;  3OTO T;  5LNK A;  5ABF A;  3Q5W A;  3CWZ B;  2V7L A;  5FXW A;  2WEV B;  1VOM A;  1D1B A;  1XDO A;  4GYS A;  2ZLY A;  4CN1 A;  2P9B A;  4HKA A;  5BR8 T;  2DWG A;  2CZ6 B;  4YSY A;  1AD6 A;  3QHW B;  3T1Y T;  3K3Q C;  2PK2 A;  3HKD E;  4DUY T;  5H6Q B;  4PJJ A;  3VYG B;  3KDS E;  3T1H T;  3J9X 1;  5JDL A;  3ZC1 A;  1H25 B;  1OKW B;  1HF8 A;  1Y01 A;  5IF1 B;  5DJQ C;  2WMB B;  4AI6 A;  2FJB A;  3AXJ B;  4ZHQ E;  3AA1 B;  5IWA T;  4ZZB A;  2CZ0 B;  2CCI B;  3MI9 B;  4YOS A;  3PUS A;  3O1H A;  2LSK A;  3DL1 A;  3N5L A;  3X24 B;  1SUM B;  5IDN B;  5J2U E;  3EAM A;  4QX7 B;  5FVK A;  4JYA T;  1N34 T;  2CCH B;  3G06 A;  2V26 A;  1AHJ B;  2W9Z A;  4BCQ D;  3RX6 A;  3UUL A;  5HBE B;  5AQT B;  1IBL T;  3ZKR A;  1D0Y A;  5L47 A;  2WMO A;  4AKH A;  4TN7 B;  3VR9 A;  2QGS A;  1IBK T;  1S94 A;  3PUW F;  3ZSS A;  3WAK A;  2IUB A;  4TWF A;  4P1N A;  3BG3 A;  4BCG B;  2X68 A;  4JI8 T;  4AQF A;  4K0U A;  5LXT E;  4WNK A;  4YTM A;  2ZZD B;  4JI3 T;  4MHC A;  2Z6E A;  4QWN B;  2E2A A;  5HWX A;  3QHR B;  3U78 A;  1NEK A;  3UFG A;  3RIA A;  3AED A;  3MA9 A;  3NBX X;  2HPJ A;  1WYB A;  5LMK B;  2W2H A;  2CZ7 B;  2WCA A;  3OYX A;  4TV8 E;  2XQA A;  4ILU A;  1QUU A;  3EDV A;  3IEE A;  3AEB A;  1ZP0 A;  5L3G B;  1LVK A;  5J0Z A;  3L3P A;  5LBM A;  2R7G A;  5LCY A;  3AA7 B;  4IMY B;  2LKH A;  2V6X A;  5LGT B;  3A8O B;  4G2A A;  2BKZ B;  3WVE B;  3N2K E;  3E0Z A;  2VKO A;  3ZMS B;  4HEA A;  4TUY E;  4IST A;  4X64 T;  4DMW A;  4JBW F;  4MFE A;  3AE4 A;  3CK6 A;  4HWF A;  2L9Q A;  2C5K T;  3GN5 A;  1XMQ T;  2UZD B;  3VR8 A;  3HI2 A;  1GUX A;  5CA0 E;  5JR9 B;  2QDJ A;  3EHZ A;  2XQ8 A;  3ZCI A;  2LKG A;  4BY1 X;  4Z91 A;  2H88 A;  2H89 A;  2DNX A;  1QLB A;  1I6Z A;  3OBV E;  1OIY B;  3QXE B;  2CLY C;  4O4L E;  2BKP A;  3AE6 A;  4BCN D;  3C4W A;  3QYB A;  2LLY A;  2XAQ B;  4BCP B;  2YDQ A;  2KT9 A;  1H7C A;  1FMV A;  3AEF A;  2AHJ B;  4F7N B;  5JRE A;  4DV1 T;  1FIN B;  3OKQ A;  3A7M A;  1UGP B;  4QSH A;  1VIN A;  1W9R A;  1VCS A;  5L4E A;  2C6T B;  3RYF E;  2H7O A;  4HFC A;  1D0X A;  3CVR A;  4AXP A;  4BAY B;  2JMK A;  4LMJ A;  3A8G B;  2XTL A;  1O9K A;  4HNT A;  3FZK B;  2M6B A;  2XQ7 A;  2UU9 T;  5H6R B;  4JUY A;  4LFB T;  2D0Q B;  1KEY A;  5ABG A;  2XSB A;  2V7I A;  1UX4 A;  1H1P B;  3AXJ A;  3Q5D A;  4EOZ B;  2PFV A;  5JDF A;  2ZMA A;  3PU8 A;  4L0R A;  3FZL B;  1KNZ A;  1ENW A;  2PMI B;  2LM2 A;  5BMV E;  2YK0 A;  3TW7 A;  1E1H B;  3RIU A;  2UZB B;  3HO8 A;  5HEO A;  3O1J A;  2MTQ A;  5F8P A;  1YQ3 A;  2MAW A;  3RIF A;  2PG8 A;  4UVC B;  2IN3 A;  5F5W A;  3J7Y q;  1O3X A;  1WLX A;  3P50 A;  3WAJ A;  3AEG A;  3LQ5 B;  2WSS V;  1Z0P A;  5LGU B;  2WIH B;  5LMU T;  2WB5 A;  2QDY B;  4OB2 B;  4H9R C;  1HX1 B;  5FVL A;  3UTK A;  2D0T A;  1NEN A;  4F6R C;  1UX5 A;  2K24 A;  5FGK B;  3C98 B;  4CFV B;  3DTO A;  3POM A;  2EHO B;  3UQ4 A;  2XQ6 A;  3SFE A;  1OED B;  3PTR B;  4DR2 T;  2BZB A;  3HBL A;  2N1G A;  4CQI A;  4XAX B;  2J62 A;  1HNX T;  4ZI7 E;  3RYC E;  4DUZ T;  2WHB B;  4EOO B;  1UCU A;  3C64 A;  2CXD A;  3R6N A;  2FBW A;  2W61 A;  4YJ2 E;  2XY8 B;  3UUN A;  1MMG A;  2B1E A;  4O8S A;  1LVF A;  5LOV E;  4BCI B;  3MAC A;  3UU8 A;  5HWY A;  1VRB A;  2V5D A;  3GWH A;  3A8L B;  3PDY A;  2LT3 A;  3BG9 A;  5EK4 A;  4EGW A;  4LFC T;  4OB0 B;  3KBT A;  2VVS A;  2VL0 A;  2WDR A;  3I0O A;  3BLR B;  1KFY A;  4P0B A;  2C5N B;  5AQG B;  1WRD A;  3CKD A;  2IW6 B;  4Z8X A;  3QWL A;  2Q9Q A;  4JI2 T;  2YOE A;  3HR0 A;  3ZST A;  4IE5 A;  1XWM A;  2BKN A;  3UUB A;  4LML A;  2E8I A;  4JEU B;  2CYZ B;  2DD4 B;  2F2C A;  2WWU A;  4IDN A;  4CFW B;  3N9N A;  4NXN T;  3ZT6 A;  3AAE B;  4KMC A;  4EC8 B;  4TV9 E;  3PO3 S;  2W96 A;  3QZ5 B;  2L8K A;  3VRA A;  5JQG E;  3A8M B;  3FZM B;  2CWO A;  3MXZ A;  2JQH A;  1BR1 A;  2PBI A;  5IUX A;  3VKG A;  3KIN B;  2B9R A;  2XAG B;  1UGR B;  5AQK B;  4KX6 A;  3O9X A;  5HQ0 B;  4LF7 T;  4UVB B;  4BJM A;  3HHT B;  4YC3 B;  3GA8 A;  4XBF B;  2RA1 A;  2WZH A;  2BS4 A;  2EHO D;  3UU6 A;  2R6G F;  2DCF A;  1FIO A;  4CZZ B;  4EOS B;  5HVY B;  3EI0 A;  2CEA A;  3QYE A;  1OL1 B;  5FXV A;  2BG9 E;  3IA3 A;  1H27 B;  3UFE A;  3TNH B;  1H1R B;  1P5E B;  3M65 A;  4UEL A;  4TWD A;  5LHI B;  2ZPE B;  2BVM A;  1US7 B;  4CN6 A;  4PFP A;  5LHH B;  2BG9 B;  3KVB A;  4HFH A;  4O2B E;  1WR0 A;  2BBH A;  3HL6 A;  5IDP B;  4DR6 T;  1HR0 T;  2G9X B;  1ZV4 X;  4WBN E;  4E7S A;  2C5X B;  1TFB A;  4ZXL A;  4CI3 B;  5L3B B;  1OED E;  2D5U A;  5ABF B;  2V8S V;  5LQF B;  4IE4 A;  2ZM8 A;  4PJL A;  3LK4 2;  3CIR A;  4OYK A;  5L3C B;  3Q9D A;  2QFZ A;  2D0U A;  3X1D A;  2IAK A;  4O4H E;  2EHO C;  4EOM B;  2XAH B;  4EEB A;  3FHN A;  3F2E A;  1YQ4 A;  3SRZ A;  1PKD B;  2NW7 A;  5LJN A;  3JAE A;  2BDE A;  2Y48 B;  1JSU B;  3UQ7 A;  3TLS A;  4YOO A;  5FMN A;  4I55 E;  4HFB A;  4BXX X;  4IHJ E;  4IE0 A;  4B3S T;  1H26 B;  3C4X A;  3H3M A;  4H63 V;  1UUS A;  3FB2 A;  1CHU A;  2WMA B;  4EOI B;  3WI3 A;  2FUP A;  3H37 A;  4H63 H;  3RPU A;  1ZEE A;  3CQG B;  2RP4 A;  2PTF A;  5CA1 E;  4I0U A;  3RH3 A;  1IRE B;  1ZOY A;  3DDQ B;  2BS3 A;  2CJM B;  4LOC A;  4TWH A;  5LB7 B;  4IL9 A;  3RGL A;  3N2O A;  3H4C A;  4PK4 A;  3AEA A;  4A5X A;  4LF8 T;  1E2A A;  4A98 A;  3QB5 A;  2ZM2 A;  4YSZ A;  3N9M A;  3PUV F;  4UIG A;  4MFR A;  2IVX A;  4GKJ T;  2VVN A;  4A56 A;  1E9H B;  5DAB A;  4YY3 T;  3K8P C;  3MZK B;  2JRK A;  3O1I A;  3HZJ A;  1U4Q A;  1OXZ A;  4AKR B;  4ROC A;  1J5W A;  5A1L A;  2WJ9 A;  4HWD A;  3BHU B;  4ZOL E;  4IT4 A;  4P0A A;  2X9W A;  4TTH A;  2ZPI B;  2VK9 A;  2YEV C;  4F7S B;  2QA7 A;  4PJN A;  5LP6 E;  2NWB A;  5AFU L;  1MMD A;  2XZE A;  3ZT5 A;  3FBZ A;  3ZYK A;  5LYJ E;  2XSA A;  1OIU B;  3OPC A;  3CX6 B;  3HA4 A;  3TLT A;  3PJA J;  4CFU B;  1D1A A;  2XM1 A;  2UZL B;  5HEH A;  4CRL B;  1HG2 A;  3UUX B;  2UXX B;  2UUA T;  3JCF A;  1GQE A;  4K0K T;  1BR0 A;  1HTJ F;  4FM4 B;  4H9S E;  4IDP A;  5AQO B;  3HKE E;  5AQF B;  2JQK A;  4HFD A;  2CLY B;  1OED C;  4GKK T;  2QVA A;  1N36 T;  3RRW A;  3UU5 A;  4BA9 A;  3V5U A;  3VU7 H;  4HFE A;  2Q9Q C;  1G3N C;  5EFQ B;  4H9P C;  4EOQ B;  2ZCF B;  5JDH A;  4X65 T;  2HHH T;  2WQY A;  2XJ7 A;  2BG9 C;  2YN6 A;  5JTG A;  4ZGE B;  1XNR T;  2W67 A;  2GK9 A;  5DQV A;  5CEI B;  3CPZ A;  3TLV A;  3B57 A;  1J1J A;  3G33 B;  3ANW A;  5AQS B;  2JQ9 A;  2WMN A;  4DV4 T;  4O4I E;  2VKD A;  2KWH A;  2JPF A;  4AQY T;  1I94 T;  4C91 A;  5JR9 C;  2CMR A;  4B3R T;  2WU2 A;  2DL1 A;  4EOK B;  3ZYL A;  4ZI3 C;  2WM9 A;  2XM2 A;  2PJQ A;  3AE2 A;  3ZT7 A;  3X26 B;  4DR1 T;  1GH6 B;  2KIN B;  3N2G E;  2ACZ A;  2WP9 A;  2LSJ A;  1ZP2 A; 
#chains in the Genus database with same CATH homology
 2X9Y A;  4TX5 A;  3UTK A;  2D0T A;  5JDM A;  4GYR A;  3LG7 A;  4F6R C;  1UX5 A;  2ODU A;  5L3E B;  2K24 A;  3UT5 E;  5DQW A;  2YU1 A;  3C98 B;  2MBG A;  3DTO A;  2K48 A;  4P09 A;  4ERR A;  1IAP A;  5LBQ B;  2EHO B;  3PTR B;  2V1D B;  4U72 A;  2BZB A;  2N1G A;  4QX8 B;  4XAX B;  4CQI A;  3ZCJ A;  4AKL A;  5LHG B;  4ZI7 E;  3RYC E;  2DWK A;  2C5I T;  3ZN0 B;  1LRZ A;  2DLR A;  3ONX A;  3KVA A;  1KK7 A;  4PW8 A;  3PUG A;  3PUQ A;  5FYM A;  4KUM B;  1UCU A;  3C64 A;  3KV4 A;  3ZEF B;  2K9A A;  5M4Y A;  2CXD A;  3R6N A;  2W61 A;  2VWA A;  3LBX B;  4YJ2 E;  2V7M A;  3UUN A;  4EYU A;  2LE8 A;  1MMG A;  2B1E A;  4EIW A;  4O8S A;  2LHN A;  5FXZ A;  1LVF A;  2XAJ B;  5LOV E;  4V1A v;  3MAC A;  1IZN B;  2KLQ A;  2LJL A;  3P8C D;  5HWY A;  3P7I A;  1VRB A;  4HFV A;  3HKB E;  3GWH A;  3FBL A;  3QK6 A;  3PDY A;  2LT3 A;  2WBL A;  3E22 E;  5EK4 A;  5LG4 A;  3LJC A;  2M67 A;  1G8X A;  2XUE A;  3CQC B;  3GMI A;  3BQK A;  3KBT A;  4PAG A;  3FXD B;  4EAH A;  1SHZ C;  3I0O A;  3O4X E;  2W0G A;  3SWH A;  2IC6 A;  4OFZ A;  3RRC A;  4ZI2 C;  4PJM A;  2W63 A;  4QKN A;  4P0B A;  3EDU A;  1HCI A;  5HXC A;  1WRD A;  3CKD A;  4M1P A;  1NAF A;  4Z8X A;  1G73 A;  2X67 A;  3LK3 B;  2Q9Q A;  1X79 A;  4UV9 B;  3HR0 A;  4PFO A;  4KP3 C;  3OYZ A;  4IE5 A;  3B13 A;  4IIJ E;  5FXX A;  1Y64 B;  2YIN A;  5EK2 A;  2NW8 A;  2E8I A;  4O4J E;  4X1Y E;  4CXY A;  4JEU B;  3BQI A;  5HYA A;  2JMH A;  4IE6 A;  4GK5 E;  2ACX A;  1YW0 A;  5JDG A;  4H9N C;  2XQY A;  4DVD A;  5ADX L;  2IC9 A;  4UV8 B;  3KV5 A;  4UVA B;  3RKO A;  2ES0 A;  3CML A;  3IBP A;  2WWU A;  1WYC A;  3N9N A;  1BR4 A;  1IJ6 A;  4DMV A;  2CA5 A;  3QC9 A;  3C51 A;  2Y6X A;  3AAE B;  3EVY A;  4OYJ A;  1ZHC A;  4ANJ A;  4KMC A;  2EHO A;  3AAA B;  1T98 A;  1BR2 A;  3RC3 A;  4AQG A;  3KV6 A;  1YKH B;  4TV9 E;  2LHR A;  2D2S A;  4UEM A;  4XZC A;  1YKE B;  2KND A;  2VAS A;  2L8K A;  4GOU A;  5JQG E;  3PU3 A;  4CI1 B;  4DBR A;  2KXP B;  2KZ7 B;  4L5G A;  4TZ4 C;  4G63 A;  2CWO A;  1HFA A;  3OJA A;  4DND A;  3MXZ A;  3RC8 A;  1BR1 A;  2I59 A;  4L9I A;  3BK9 A;  2NOX A;  2PBI A;  4O2A E;  3AB3 B;  3KV9 A;  2VL8 A;  3VKG A;  3KIN B;  1EZ3 A;  3ZMT B;  4PK6 A;  2XAG B;  3VHL A;  2CXL A;  3ZC0 A;  3C50 A;  3QUJ A;  4YLH A;  3RYH E;  3MKD A;  2G0U A;  2NTY A;  3LFM A;  4NUU A;  3UUM A;  5C8Y E;  5LNK A;  3O9X A;  3Q5W A;  4UVB B;  3CWZ B;  2VKJ A;  3ZLI A;  1S35 A;  4BJM A;  1MMA A;  2V7L A;  4GIW A;  4MBQ A;  5FXW A;  4HE8 A;  5JRC A;  1VOM A;  2XAS B;  1D1B A;  3GA8 A;  3N9P A;  4I4T E;  4HN9 A;  3ZMZ B;  5HXH A;  4GYS A;  2ZLY A;  3K3O A;  2VKH A;  4XBF B;  2P9B A;  4HKA A;  2RA1 A;  2DWG A;  3DJB A;  4ZS3 A;  2EHO D;  2DCF A;  1FIO A;  5J2T E;  2W62 A;  4CZZ B;  1HS7 A;  1V9D A;  3K3Q C;  3HKD E;  4ZS2 A;  5H6Q B;  4PJJ A;  3NZP A;  1OWA A;  2JJ9 A;  2CEA A;  3N9L A;  3KDS E;  1QSD A;  5FXV A;  3J9X 1;  3GN5 B;  3UFE A;  2IW5 B;  3ZC1 A;  5JDL A;  2LSI A;  4QHO A;  1HF8 A;  3Q5X A;  4HGA A;  3M65 A;  4UEL A;  5DJQ C;  4EZ4 A;  5LJM A;  2K5B B;  3I9Y A;  4IGU A;  4UXN B;  5LHI B;  3S4U A;  3R84 B;  4AI6 A;  3I0Q A;  2E9X A;  3A5X A;  2BVM A;  1US7 B;  4ZHQ E;  5L3D B;  3AA1 B;  2HH7 A;  4PFP A;  5LHH B;  1U5P A;  2LSY A;  3KVB A;  4O2B E;  4IDZ A;  4DBQ A;  3HL6 A;  2X66 A;  3NRX A;  4EXT A;  3PUS A;  4FJO A;  3O1H A;  1CUN A;  1ZV4 X;  2LSK A;  3N5L A;  2MYS A;  2V7J A;  3AAI A;  4WBN E;  5J2U E;  3HKC E;  4E7S A;  1WR6 A;  3CX8 B;  4QX7 B;  4CI3 B;  5L3B B;  2V26 A;  2CWY A;  2MOZ A;  2D5U A;  3IHR A;  2SPC A;  3KFW X;  4AQF C;  3RX6 A;  4AKI A;  2YU2 A;  5LA6 E;  3UUL A;  4WBO A;  4IE4 A;  5HXE A;  3NRY A;  2ZM8 A;  2NTX A;  4PJL A;  2C0S A;  2CCQ A;  3LK4 2;  3PUR A;  4OYK A;  1YD8 G;  3K3N A;  1D0Y A;  4ASK A;  5L3C B;  2X9H A;  3Q9D A;  2LSG A;  2WMO A;  4B6X A;  2D0U A;  2X51 A;  2IAK A;  4O4H E;  2EHO C;  2XAH B;  4AKH A;  4TN7 B;  4H9Q C;  2W00 A;  2QGS A;  5JH7 E;  3FHN A;  3F2E A;  1S94 A;  3ESL A;  3SRZ A;  2NW7 A;  5LJN A;  3WAK A;  5KDM C;  2BDE A;  2Y48 B;  5L2L A;  4AKG A;  3AA6 B;  2X68 A;  5KX5 E;  5FMN A;  5FNV E;  4I55 E;  3L09 A;  3ZPO A;  4AQF A;  4K0U A;  5LXT E;  3AVR A;  4IHJ E;  4IE0 A;  4C90 A;  3F31 A;  3C4X A;  4H63 V;  3IF8 B;  4WNK A;  2XAF B;  3FB2 A;  2NW9 A;  5JR9 A;  1MIY A;  5L3F B;  2LOS A;  2A3D A;  2LOP A;  4MHC A;  2LEH A;  3WI3 A;  3H37 A;  2Z6E A;  4H63 H;  4QWN B;  5HXR A;  3RPU A;  1ZEE A;  5HWX A;  2JQQ A;  3CQG B;  3U78 A;  2RP4 A;  5CA1 E;  3Q2M A;  3RH3 A;  3FXE B;  3MA9 A;  3NBX X;  2HPJ A;  2A2F X;  5JDQ A;  4E7Z A;  5CB4 E;  4YJ3 E;  2Y8D A;  1D1C A;  1WYB A;  2KMF A;  4YFS A;  2BVL A;  4HTE A;  3E08 A;  4TV8 E;  3OYX A;  1D0Z A;  3H3A A;  4ILU A;  3N2O A;  1QUU A;  1FMW A;  2N2N A;  4PK4 A;  4ADZ A;  4EB6 E;  3EDV A;  3IEE A;  5L3G B;  1LVK A;  2X9X A;  3L3P A;  1MND A;  5LBM A;  5LCY A;  2ZM2 A;  3AA7 B;  3ETV A;  4ZI3 D;  3EUH A;  3N9M A;  2V7K A;  4OHF A;  5LGT B;  4G2A A;  4OK0 A;  4UIG A;  3JC6 D;  3ZJ2 A;  4MFR A;  2E9X D;  3PE0 A;  3N2K E;  5HAX A;  1LKX A;  5J1G A;  4A56 A;  2OA5 A;  5DAB A;  3CX7 B;  2X0L B;  1IJ5 A;  3K8P C;  4X20 E;  4QXH B;  3ZMV B;  3MZK B;  2JRK A;  3O1I A;  3E0Z A;  2VKO A;  4X1I E;  3ZMS B;  4HEA A;  4TUY E;  1U4Q A;  4IST A;  1OXZ A;  4QXC B;  4AKR B;  4DMW A;  4CI2 B;  3KBU A;  4X1K E;  5A1L A;  4U74 A;  2L9Q A;  3AA0 B;  4YHJ A;  2C5K T;  3GN5 A;  3LK2 B;  4ZOL E;  3HI2 A;  2HPL A;  5JDN A;  4P0A A;  5CA0 E;  2X9W A;  3NZQ A;  5JR9 B;  2ZM0 A;  3ZN1 B;  2VK9 A;  3ZCI A;  2YEV C;  4DO0 A;  2E9X C;  2QA7 A;  4PJN A;  5LP6 E;  3I9W A;  1B7T A;  5LGN B;  2DNX A;  2NWB A;  5AFU L;  1MMD A;  3OBV E;  3ZMU B;  3FBZ A;  3ZYK A;  4O4L E;  2CLY C;  3DP7 A;  5LYJ E;  5IYZ E;  3RYI E;  3U3I A;  5TAO A;  3CX6 B;  3C4W A;  3HA4 A;  3BQL A;  4BJN A;  3AVS A;  5JRC B;  2XAQ B;  1D1A A;  2KWI B;  4H9O C;  5HXS A;  1HG2 A;  3V5S A;  3UUX B;  5EK3 A;  2UXX B;  4I50 E;  2KT9 A;  1H7C A;  1FMV A;  2WAU A;  1BR0 A;  2DHR A;  5EZY E;  1HTJ F;  5JRE A;  2ODV A;  4N78 D;  3ZYM A;  3VKH A;  1ZKE A;  4EYY R;  2CM0 A;  4H9S E;  3OKQ A;  3HKE E;  3ZJ1 A;  1SA0 E;  2VB6 A;  4FI5 A;  2CLY B;  3SOL A;  3RYF E;  2H7O A;  4MLK A;  3RRW A;  5F3J A;  3ETU A;  2XHE B;  1D0X A;  3CVR A;  4AXP A;  4MAL A;  4IE7 A;  3C4Z A;  4BA9 A;  3V5U A;  2JMK A;  5ETW A;  4BAY B;  4JLE A;  3VU7 H;  5FP3 A;  2Q9Q C;  4WW0 A;  2XTL A;  4J2C A;  4H9P C;  3F57 A;  5JDH A;  1MNE A;  5KMG P;  4JEH B;  5H6R B;  4UF0 A;  3PUA A;  4JUY A;  1HG5 A;  2V7I A;  1UX4 A;  3ANW B;  2L3L A;  5FY1 A;  2H3R A;  2E9X B;  1MIV A;  4PK5 A;  4EOZ B;  5JVD E;  2DI4 A;  2PFV A;  5JDF A;  4KBM B;  4QXB B;  3D0T A;  2GK9 A;  2ZMA A;  3PU8 A;  1MIW A;  5DQV A;  2UXN B;  2A72 A;  3CPZ A;  4L0R A;  2LM9 A;  1KNZ A;  3B57 A;  1FEW A;  2N9D A;  3ANW A;  2J1D G;  2Q9Q D;  3T8O A;  2H7V C;  5BMV E;  2YK0 A;  2CE7 A;  3MJX A;  1E1H B;  4UF0 B;  4PNI A;  2Q9Q B;  4NUV A;  4EZH A;  2WMN A;  5E0O A;  2C5J A;  2CXF A;  4O4I E;  2VKD A;  2KWH A;  1MMN A;  3O1J A;  2MTQ A;  2NP9 A;  4CXW A;  5F8P A;  2JPF A;  2PG8 A;  4UVC B;  4C91 A;  2CMR A;  5JR9 C;  3J7Y q;  3JC6 C;  3MK7 C;  1O3X A;  3ZYL A;  5IHY A;  2WM9 A;  4ZI3 C;  4ISS A;  5GON E;  1WLX A;  3SS1 A;  1HX8 A;  5FY7 A;  3WAJ A;  1NWM X;  5FY0 A;  3N9Q A;  4I43 B;  2PJQ A;  2WSS V;  3I1A A;  1Z0P A;  4GK0 E;  5LGU B;  4ZI2 D;  3CQX C;  3W15 B;  3LBX A;  3N9O A;  2KIN B;  3N2G E;  4H9R C;  1AJ3 A;  2LSJ A;  4CXX A;  3TKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...