3DJBA

Crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
188
Chain Sequence
TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADLNESEEAGMKKVSDWLEELHVEEEESKHVLHIIANMSIEGKLVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPRDPSLNHFYEKLLKLKDLMNTNAAKQEAEVRHRYMEQFIEQFMKEWNAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Hydrolase
molecule keywords Hydrolase, HD family
total genus 50
structure length 188
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3djbA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3djbA02
3B57A 5IHYA 2QGSA 5DQWA 3DJBA 2PJQA 3DTOA 5DQVA
chains in the Genus database with same CATH superfamily
1H1QB 5BNJB 1VYWB 5ABHA 2DWKA 3ZCJA 2DPPB 4P0AA 2AHJB 2PHGA 4BCNB 1D0ZA 4AQYT 3EDVA 5AQUB 2NW8A 5HWXA 2UZLB 4JLEA 2UXNB 3QB5A 4NC6A 1CHUA 2Q9QC 5EJCA 2V7MA 2VL0A 4A97A 2IMLA 5HXEA 2WDRA 3AVSA 4ELLA 4I55E 3CX8B 2CXLA 3Q5DA 3HHTB 4IIJE 2IN3A 4HFDA 4BBSM 2LRKA 5ETWA 2ZM6T 2XUEA 1HCIA 4X65T 3UULA 4OB2B 1WYBA 4DBRA 1N32T 1SA0E 5LJNA 5AQGB 2BG9A 1UGOA 1UNLD 3RQWA 4LF8T 5L3GB 2CE7A 3AEGA 4NUVA 4BCND 4MFRA 4ISTA 4PFOA 1IBLT 1BR2A 2NW9A 1UCUA 1TD6A 2YKSA 3PUQA 4IDNA 4F6RC 4UV8B 3PU8A 4IE7A 3BG3A 2CJMB 2J4GA 2A9UA 4HTEA 4ERRA 4NIQA 5LMKB 4PAGA 4Y72B 4U33A 3UT5E 2XASB 2ZMAA 4EEBA 4ISSA 1J1JA 4NXMT 3WI3A 4ROEA 2UXXB 2LSJA 4BJMA 4EEDA 2XM2A 3JC6C 4KI0F 3EIDB 2CXDA 2MYSA 3BHTB 2I0MA 3EI0A 4IE6A 2DLRA 4YSYA 3A5XA 2LW4A 4PNIA 4YHHT 2JGZB 4LF4T 2OLTA 3LJCA 1QSDA 4OB3B 4Z91A 4U74A 1QMZB 2BBHA 3QZ5B 3KHIA 1HNZT 5FVKA 2QQ8A 2PMIB 4YOZA 3PU3A 3ZYLA 2VWAA 1N34T 2V26A 2EHOD 3P4SA 2H88A 5AQMB 3L8RA 2ZPFB 3RH3A 2NWBA 2WBLA 2VB6A 3QYBA 4GYRA 4LFBT 4YFSA 2VK9A 3C4WA 5KMGP 2XSBA 2XQ3A 4EOIB 2EHOC 4ZZCA 3A7MA 1PKDB 3HKCE 4CXYA 3RI5A 2W62A 2UUAT 2V6YA 4YJ3E 3HB9A 3D0TA 2XJ7A 2E5VA 2UZEB 3CWZB 4QXBB 3RRWA 3E22E 2E2AA 1HFAA 4PW8A 3DP7A 4DV2T 1GY3B 1G73A 1WLXA 1KNPA 2H89A 3H37A 4ZOLE 3ZMVB 4CN4A 4EV6A 5F3JA 5JR9B 2W96A 3UQ7A 5LG3A 4ZS3A 1CUNA 4MIMA 4AKHA 5DABA 3NKZA 3LK2B 2CZ7B 2XHEB 2XY8B 2JIWA 4IDPA 3RIFA 4UF0B 2ZPHB 3P8CD 3GTMS 3RPUA 5AQSB 1WR0A 4H9RC 1X9BA 4UVAB 2OA5A 2NR4A 2V8SV 1URCB 1IREB 3T1HT 3DTOA 3G06A 4GIWA 3OPCA 4BCKB 2CEAA 5LXTE 3HR0A 4XAXB 3N9NA 2HPLA 4YLHA 2Y8DA 4DO0A 3T8OA 4CRLB 1BR4A 5C3JA 4I4TE 2VKDA 4QH4A 3PUGA 1LVFA 1XNQT 1IAPA 3P4QA 1ZOYA 2LLYA 4O2BE 3QB5K 2ZCFB 4EOJB 3GN5A 4ZHQE 3ZMZB 4BCJB 4OYKA 2WWUA 4QXCB 1JKWA 3X28B 5IWAT 4U2ZA 3VYGB 4QH5A 4MALA 2C6TB 4FM4B 4M1PA 1YQ4A 4CXAB 4UVBB 4IREA 3A8HB 2WZIA 1LKXA 5TAOA 2WMBB 3ZC0A 5HWYA 4JV5T 1OL1B 5AQRB 1WRDA 3RLFF 3GA8A 5ADXL 5FYMA 4DUYT 4H9OC 4YTPA 2KWHA 3WVDB 1X79A 2IW6B 3TNWB 4WYVA 5L47A 2LHRA 1YKEB 3ZEFB 5LHIB 4AKGA 2C5NB 3ZSTA 1OEDB 3ONXA 4ILUA 4CFMB 3L3PA 3B13A 4EXTA 3PDYA 2LSIA 4G63A 1D0YA 3IF8B 2CXFA 2PBIA 3AB3B 3OKQA 2FJEA 1UURA 1ZHCA 4P0BA 4IL4A 5J0ZA 2MPKA 3KBTA 2DI4A 1E7PA 3MA9A 4NPPA 2IIUA 5JDHA 4YOSA 4J2CA 3I9YA 2LOPA 1AISB 2IC9A 1WYCA 2CPTA 2BG9E 1O9KB 1WCRA 3X20B 1H1PB 4ELJA 3AAEB 3LG7A 2CCIB 1M7KA 4A5XA 3VYHB 3EHZA 3K3NA 3RHWA 5L3FB 3ZKRA 2BS2A 3Q2MA 4UVCB 2CWOA 1UNHD 4IL9A 4M6VA 2G0UA 3AE6A 3ZMTB 5FXXA 2QRXA 3FZMB 2LEHA 4DMVA 3VKHA 4TWDA 1D0XA 4A56A 1IBKT 3NRYA 4IHJE 4YTNA 4X64T 2W63A 2PG8A 3PUAA 3QHWB 4EYUA 3A8LB 5LB7B 3TLWA 2E9XC 4LF9T 5BR8T 3O1IA 4HNUA 5IDPB 4LMKA 2XSAA 4H9QC 3P4PA 2KMFA 3OYZA 2MOZA 3MACA 1XNRT 2KXPB 1YXRA 1W98B 3KV6A 4OHFA 5CA1E 2VKHA 2W2HA 5JDFA 3BG5A 4JI4T 2K5BB 3K8PC 5HXHA 5AQLB 2XM1A 2XQ5A 2YDQA 2I40B 5L4EA 2WXVB 4Z6YA 2NOXA 3FZLB 3P4WA 4CXXA 3WVEB 3ZT7A 2JPFA 2RP4A 3B5MA 4CQIA 1N36T 3RKGA 5JDLA 3TKLB 3AE7A 2D5UA 3QC9A 2CLYC 2AXDS 4L5GA 2WU5A 3AE8A 3ZYMA 4GYSA 4CFVB 3I0OA 3TW7A 4U7YA 2UXBT 3IBPA 1LRZA 3UUMA 4YY3T 2QFZA 4JI3T 2N9DA 4TV9E 1UX4A 3JADA 3PUSA 1D1BA 3TW6A 2D9DA 5HEJA 2K24A 4E7ZA 4LMJA 2W99A 4HFVA 2NTXA 4KP3C 4JI6T 3L09A 3J9X1 5ABFB 2BVLA 5AQOB 2YDSA 3BQIA 2HHHT 1JNZA 4AQGA 4AKIA 4DV1T 1HF8A 3M3ZB 4EC8B 4ILCA 4LF5T 4GKJT 3F5XB 5CJ5A 4PK4A 5L2WB 4EZ4A 3ZMUB 1FVVB 2KT9A 2CMRA 1IBMT 5FY1A 3P50A 2CCQA 1JSTB 4DR5T 3RF1A 1ZV4X 3JC6D 4MBQA 3PE0A 2R7GA 2DHRA 4KRDB 5FXVA 3AE1A 3J7Yq 2L3LA 2JMHA 3LSVA 3ZJ2A 4GK5E 4DR2T 1XZYA 5L3EB 1ZP2A 3DDQB 2W67A 2JRKA 2BKPA 1F5QB 4EORB 2CWYA 4AI6A 2WB5A 3KINB 3LBXB 4UELA 4X5TA 4OR5B 4WBOA 2BS4A 1QUUA 3TLVA 1T98A 3HL6A 5LCYA 2M6IA 2QVAA 4E7SA 1OIYB 2WS3A 5FL0A 4LF6T 2WQYA 5H6QB 4TN7B 5HNBB 1E9HB 2K48A 1KEYA 3ZYKA 2KR6A 4AKLA 3UUNA 1W09A 3QXEB 5HEUA 1XMQT 3UQ4A 1US7B 2WDQA 4DNDA 3FBLA 2XQ7A 4YT0A 2A3DA 4EONB 3SS1A 2CZ6B 2G9XB 2X68A 5DJQC 3LDQB 2E9XA 2VVNA 2G77A 4YHJA 2M6BA 2DWGA 3K1SA 2Y6XA 1OIUB 2BG9B 2ZPGB 4EOPB 5HYAA 3B57A 1M62A 3AEDA 1NWMX 1W0AA 2KNDA 3K3QC 4U31A 1N33T 4BCIB 1ZKEA 4JI2T 4AISA 4FI5A 4COFA 2X67A 4N78D 4YC3B 1KNRA 2RA1A 3ZLIA 1Y64B 5LGUB 2HPJA 4O2AE 1VCTA 2V7KA 3UUBA 3AE3A 3ETUA 3ONJA 5EK3A 2H7VC 4OK0A 1D3UB 3FHNA 5L3DB 2C4GB 3KBUA 2LKGA 3CMLA 2X9XA 4IE0A 4TWFA 5IUXA 1XDOA 2WWVA 1LVKA 4LFAT 4HLQA 5EFQB 3JCFA 4UEMA 2ACZA 5LJMA 4HFBA 4JEHB 3MJXA 3N9OA 2LSKA 3UTKA 5CA0E 1NEKA 4DV7T 4X1YE 1OL2B 3ETVA 5J2TE 2WIPB 3S4UA 3N9QA 2Q9QD 2I6HA 5DQVA 4H9PC 3HKEE 2B1EA 2XAHB 1H4LD 5JVDE 4DR3T 2I59A 2X0YA 3SFDA 2V7LA 3MI9B 1FJGT 1AJ3A 2FBWA 1HNWT 3ZSSA 4AQFC 1GQEA 3WAJA 5BMVE 3I1AA 4HKAA 5AQPB 2MBGA 4YSXA 3LQ5B 1QLBA 1WR6A 3EVYA 1MIVA 2K3WA 1XO2A 1U4QA 5LG4A 2LSGA 5KX5E 4HEAA 3CVRA 4BCOB 5AQHB 4TUYE 4QKNA 4X1IE 1MMGA 2DCFA 4F6SB 4DV6T 4I3ZB 3RRCA 2BKOA 2IAKA 4F7NB 4YSZA 2DD4B 3RYIE 3PJAJ 3F2EA 2CCHB 3NWIA 4RODA 2XPKA 2X0HA 4DUZT 3VR8A 1I94T 5F8PA 2WM9A 4O4HE 1Z8UA 1JOWA 5M4YA 3ZT6A 2LM2A 4Z90A 5ABGA 1IJ6A 2W9ZA 4LMLA 4CFWB 4ZGJB 1YKHB 2BDEA 2X51A 4JX4A 2QDJA 1TFBA 2WCAA 1W0BA 4G6LB 3KV5A 2W2UA 1BR1A 5AQVB 5C8YE 3FZFB 4ZI7E 3AAAB 1FKMA 1UUSA 1Y01A 4C90A 2WP9A 4O4LE 2CZ0B 2PK2A 4O4IE 3N9LA 4BCMB 1O3XA 5JDMA 2JJ9A 1H24B 5C2TA 4PJMA 2BKZB 2BVMA 1NAFA 5LA6E 2KMGA 3RX6A 5EK2A 4ZI3C 5LBQB 2WMNA 4IE4A 3AEBA 4EGWA 4EC9B 3G33B 3MKDA 4AXPA 2EUFA 4LFCT 2NP9A 2NTYA 2C5JA 2WU2A 3DJBA 2C5KT 1W9RA 3PV0F 3KDSE 1KK7A 3FBZA 3JAEA 4YTMA 4TTHA 4EOQB 4GOUA 2YU2A 3U3IA 2QF7A 2EHOA 1FINB 3H4CA 2ZZDB 4K0UA 1V9DA 3NRXA 1AD6A 5AQQB 5H6RB 3P7IA 2C5OB 3N9MA 4GK0E 2C0SA 2D0TA 4PJLA 1KFYA 1G3NC 3QK6A 3QUJA 3RC8A 2JQQA 3W15B 5AQTB 2W61A 4DV3T 4F7JB 2FJDA 1H26B 2V6YB 4NUUA 4X20E 4IE5A 2XAQB 4BBRM 4BCQD 4ZZBA 4JI7T 3IEEA 3NBXX 4XZCA 3OYXA 4NSTB 1ENWA 3RIAA 2PJQA 3HA4A 4HN9A 3POMA 1HG2A 3C51A 2P9BA 3N9PA 1GH6B 5JRCB 3T1YT 2LHNA 2R6GF 2IHR1 3PJAA 4KHPT 4I43B 5LMUT 4CI1B 2VVSA 4C91A 4QX7B 1OXZA 4JX5A 5IYZE 2WZHA 1YD8G 4H9NC 2LKHA 3A8YC 5I5ZB 3RIUA 3Q5EA 2ODUA 2XZEA 1ZP0A 2LSYA 4JI5T 4EOLB 2C5IT 4YJ2E 1FEWA 3E08A 3EDUA 5LGTB 2V5CA 3TNHB 3AEFA 4KUMB 4ZGEB 4DR6T 3WAKA 3E0ZA 1MMNA 4BCHB 2VQET 4TZ4C 4CI2B 4PFPA 1B7TA 5JRCA 4A98A 4O4JE 2XQ4A 1T7SA 3BLRB 3CX7B 4B3RT 5AQNB 2JMKA 5JQGE 3F57A 2BPMB 3CPZA 2YINA 3KVBA 2QGSA 5EZYE 3ZPOA 3Q5WA 4ANJA 4EOKB 3TLSA 5JDGA 3C64A 2XAFB 1HS7A 4L0RA 4HWCA 3AXJB 4GKKT 2JQ9A 3OJAA 3KV9A 3QYGB 5JREA 2UXDT 5HVYB 3FZKB 4AKRB 3FZHB 4JYAT 2A72A 3AVRA 3QYHB 2KLQA 3KVAA 2XAGB 4MFEA 4IT4A 3RC3A 2B9RA 4ROCA 4WNKA 2D0QB 3OVUA 3R6NA 2PK9B 1GUXB 3MIAB 2WJ9A 3BK9A 2IDOB 3DL1A 2VQFT 4JEUB 3ANWA 3HI2A 3VKGA 2V7JA 2CA5A 3AE2A 4PK5A 2KSRA 5CFBA 4F8HA 2KINB 2CBIA 3CQGB 4P09A 5ICPB 1D1AA 5HXRA 2DL1A 5IF1B 1MNDA 2UU9T 2WEVB 1KNZA 3ONLC 3MY1B 4PJJA 4CN1A 5E0OA 2V22B 5JDQA 1I6ZA 2WHBB 3FB2A 2XQYA 3A8OB 2XQAA 2X9HA 1IZNB 2E9XB 2DD5B 2OV9A 1UGSB 3DDPB 3QOFA 4HL4A 4P1NA 2WSSV 4HFHA 3O1JA 4Z8XA 4H9SE 2WIHB 3AA6B 3CQXC 5JDNA 2RPAA 2FJBA 4BY7X 2B76A 2NW7A 2IW5B 3RGFB 2EHOB 4EAHA 4B3MT 4EOZB 4DVDA 3A8MB 5L3CB 5FVLA 3AA0B 1MNEA 5FXZA 2W00A 3QYEA 5L3BB 2F4VT 3NVOA 5KXJA 4O8SA 3EOCB 5CYIB 3C98B 3X1DA 1D1CA 2BZBA 4OGRB 5FGKB 3UUXB 3UFEA 3KV4A 5HBEB 3PUVF 1HG5A 3O9XA 1H27B 2D0UA 4EYYR 2CYZB 4LF7T 2X0LB 3VRBA 5AQKB 4OB1B 3UU4A 3ZN1B 4PK6A 2WAUA 5FMNA 4JUYA 1HX8A 5FNVE 4KBMB 2E8IA 3LBXA 5CB4E 3SWHA 4JX6A 2CRBA 4ZEYA 1JSUB 1L0VA 5CGMA 2Q9QA 2PTFA 1NENA 3PTRB 5L2LA 3HKDE 3GWHA 2X9WA 4EOSB 2ES0A 4DMWA 2V6XA 3AEEA 3BHUB 3VU7H 3N2OA 4BXXX 5IHYA 4DR1T 3M03A 4TX5A 1FIOA 3BHVB 4OFZA 1SHZC 3AE9A 5LNKA 4HE8A 3HKBE 2IW9B 1XMOT 1J5ET 3N2GE 3Q9DA 4EIWA 1JNRA 2CHOA 2X66A 4BCPB 3UU8A 4V1Av 1HTJF 4CXWA 2LE8A 5HAXA 4JI1T 4EOMB 4QSHA 3AECA 2QYWA 1UGRB 2L8KA 5FP3A 3PUYF 4UN0A 2MTQA 5LP6E 2H7OA 2ODVA 2XTLA 2LRLA 3QNUA 3ZJ1A 3MK7C 5CEIB 1H1RB 2WPAB 4IDQA 3H3MA 2F2CA 1OI9B 4MLKA 4PJNA 4WBNE 3NZQA 4HGAA 3H3AA 1VOLA 2YOEA 2CZ1B 4H63V 3PUWF 3LK3B 4BCFB 4LOCA 4HWIB 4HFCA 3HBLA 2BS3A 2YU1A 1XWMA 4HWDA 3ANWB 2YEVC 3R84B 4DV5T 5JTGA 5FL1A 5AQJB 3OTOT 4IDOA 3CK6A 2LJLA 5L4HA 4KRCB 4KX6A 4ASKA 2K9AA 5ABFA 1V29B 3O0GD 2FUPA 4ADZA 2WFYB 3C50A 2UZBB 3MZKB 2YDRA 4ILAA 4B3ST 5ABEA 3I0QA 3EABA 4I50E 1E2AA 4QX8B 4DR4T 3RYCE 1OEDE 2V7IA 3K3OA 3PURA 2JQHA 4G2AA 3TNIB 1OEDC 5HXSA 2J1DG 2H3RA 3C4ZA 2M67A 3SRZA 1UK5A 1C9BA 2D2SA 4HNTA 3K7AM 1HX1B 4TNWA 3TLTA 4U3CA 2KZ7B 2ZM2A 5HEOA 1MIYA 5HQ0B 4B3TT 3ESLA 1ZEEA 5LOVE 3ZMSB 4OB0B 4HNVA 4X62T 3GN5B 5LBMA 2VL8A 2WMOA 3AE4A 4MFDA 2LOSA 3BQLA 3AA1B 4MHCA 4UR9A 1OWAA 3IA3A 1P5EB 4KHZF 4X66T 3RYHE 5J1GA 4IGUA 5ACBA 5KDMC 2CLYB 3N5LA 4WZXA 2WDVA 3U78A 3IHRA 4ILBA 2W66A 3PUZF 3RGLA 4TV8E 4BY1X 4UXNB 2XAJB 2Z6EA 3X26B 3NZPA 4JI0T 2XQ9A 4ZS2A 4UV9B 4HFIA 1BU2A 1E1HB 2FJAA 4BA9A 3LFMA 3AE5A 3FXDB 2HH7A 4OYJA 1IJ5A 4QXHB 1OEDA 3ZN0B 2DNXA 4X1KE 5AQIB 1VINA 2UUCT 4CZZB 1GUXA 4DV4T 5JR9C 4JI8T 5J2UE 5LYJE 1UGPB 2N2NA 2Q9QB 4IDZA 4DV0T 5LHGB 2CBJA 3AA7B 1XDPA 3MY5B 1MMAA 1YQ3A 3LK42 2DMEA 2W0GA 2BBJA 3PUXF 4HFEA 4EB6E 2W4XA 3V5UA 1T8BA 3ABVA 2YN6A 3VRAA 2YK0A 3AEAA 5LHHB 3FXEB 3AAIA 2I53A 2IVXA 4B6XA 1N4MA 4BJNA 3TLUA 4DIDB 3O4XE 2WY2A 3PO3S 4OX9T 2VKJA 1Z0PA 3KFWX 1HR0T 3AXJA 4II5B 1OKVB 3VHLA 4EZHA 1AHJB 1SE7A 1O9KA 5FKYA 5JR9A 5FXWA 2LT3A 3MXZA 2V5DA 1KF6A 3VR9A 4K0KT 3BG9A 4CI3B 3EAMA 4I0UA 2HN2A 1VRBA 1FMWA 2JQKA 1T72A 3F31A 5JH7E 4BCQB 4YOOA 3QHRB 4HWHA 4U7IA 5A1LA 3OBVE 1S94A 2CM0A 3CQCB 2VKOA 2QDYB 2XQ8A 4H63H 5FY7A 3EJ1B 1VOMA 3L39A 1J5WA 4YXDA 2IC6A 3TN8B 1UX5A 2X1NB 5IDNB 1H25B 4TWHA 2E9XD 2BG9C 3RKOA 2GK9A 4DBQA 3EUHA 4CFXB 1OGUB 5DQWA 5LGNB 3X24B 2WMAB 3HZJA 2A2FX 2IW8B 4ZXLA 5HBHB 3NDQA 1YW0A 2DXCB 4QHOA 4L9IA 3ZCIA 2UZDB 2X9YA 3BLQB 4TNVA 5HEHA 4F6WB 5LQFB 3CX6B 5EK4A 2LM9A 4CN6A 4Q25A 3SOLA 4BCGB 2VURA 3JAFA 1R8IA 4BCMD 1WFDA 3DOGB 2ZM0A 2UXCT 3C4XA 3HO8A 3X25B 1SUMB 4KMCA 4CFUB 4ZI3D 3Q5XA 2AE9A 3SFEA 5F5WA 2PFVA 3UU5A 4ZI2D 2ZPIB 4U72A 4F70B 4HWFA 5FY0A 4F7SB 4IMYB 4XBFB 5HEGA 5HXCA 2UUEB 5LMNT 1UNGD 3P4RA 3QWLA 4DR7T 3ZC1A 3O1HA 3M65A 3UU3A 2ZM8A 4EOOB 1S35A 2C5XB 2BKNA 2XQ6A 3UFGA 2Y48B 4AQFA 1DU2A 2DXBB 4JBWF 2L9QA 5HCMA 2CHNA 1EZ3A 1BR0A 3RIUC 2VASA 1HNXT 4FJOA 4WW0A 3V5SA 1FMVA 4ZGDB 1MIWA 3QZ9B 3RQUA 3CKDA 3I9WA 1KXUA 1OKWB 2V1DB 3CIRA 3N2KE 4AIUA 4BAYB 3BLHB 2QA7A 4FX3B 3UU6A 2N1GA 4QWNB 4CFUD 2KWIB 4U2YA 3RYFE 2ZPEB 5AQFB 1H28B 2W9FA 1MMDA 1H1SB 2MAWA 2C5VB 1UGQB 4F7LB 2UUBT 2HN1A 5AFUL 2E5LT 4UF0A 5GONE 1U5PA 5HBJB 2SPCA 2J62A 1VCSA 2J47A 4NXNT 2ACXA 3A8GB 3BQKA 4F6UB 5HCJA 4UIGA 4ZI2C 1G8XA 2ZPBB 4QH1A 2IUBA 1H7CA 4CFNB 2ZLYA 3ZT5A 3GMIA
chains in the Genus database with same CATH topology
4WBNE 3NZQA 3MKDA 2KMFA 3OYZA 4HGAA 4AXPA 3H3AA 2MOZA 2DWKA 2NP9A 3MACA 4H63V 2NTYA 2KXPB 3LK3B 3ZCJA 2C5JA 3DJBA 2C5KT 4P0AA 3KV6A 4OHFA 5CA1E 2VKHA 1D0ZA 3EDVA 5JDFA 2NW8A 2K5BB 3K8PC 5HWXA 2YU1A 3KDSE 1KK7A 3FBZA 3ANWB 2YEVC 3R84B 5HXHA 4JLEA 4GOUA 2UXNB 2YU2A 3U3IA 2Q9QC 2EHOA 2V7MA 2NOXA 4CXXA 2LJLA 5HXEA 2JPFA 2RP4A 4K0UA 4ASKA 1V9DA 3NRXA 4CQIA 2K9AA 3AVSA 5H6RB 3P7IA 4I55E 3CX8B 5JDLA 3N9MA 2CXLA 4GK0E 3TKLB 4IIJE 2C0SA 4ADZA 2D0TA 3C50A 4PJLA 2D5UA 3MZKB 3QC9A 2CLYC 3I0QA 3QK6A 4I50E 3QUJA 4L5GA 3RC8A 2JQQA 4QX8B 5ETWA 3RYCE 2V7IA 2XUEA 3K3OA 3PURA 3W15B 1HCIA 3ZYMA 4G2AA 2W61A 4GYSA 3UULA 3I0OA 5HXSA 2J1DG 2H3RA 1WYBA 3C4ZA 2M67A 4DBRA 3SRZA 1SA0E 4NUUA 5LJNA 2D2SA 4X20E 4IE5A 3IBPA 2XAQB 1LRZA 3UUMA 3IEEA 5L3GB 2CE7A 2N9DA 2KZ7B 4TV9E 1UX4A 2ZM2A 3NBXX 4NUVA 3PUSA 1MIYA 3OYXA 4XZCA 2PJQA 1D1BA 3HA4A 4HN9A 4MFRA 1HG2A 3C51A 3ESLA 4ISTA 1ZEEA 5LOVE 3ZMSB 4PFOA 1BR2A 2K24A 2P9BA 3N9PA 2NW9A 4E7ZA 5JRCB 4HFVA 1UCUA 2NTXA 4KP3C 2LHNA 3PUQA 3GN5B 4F6RC 5LBMA 3L09A 4UV8B 2VL8A 2WMOA 3PU8A 3J9X1 2BVLA 2LOSA 3BQLA 3AA1B 4MHCA 4I43B 4CI1B 1OWAA 4C91A 4QX7B 1OXZA 3BQIA 5IYZE 3RYHE 4IE7A 5J1GA 4IGUA 1YD8G 4H9NC 5KDMC 2CLYB 4AQGA 3N5LA 4AKIA 4HTEA 2ODUA 4ERRA 1HF8A 3U78A 4PAGA 3IHRA 2LSYA 3UT5E 4TV8E 2XASB 2ZMAA 4UXNB 2C5IT 4YJ2E 1FEWA 4ISSA 2XAJB 2Z6EA 3E08A 3NZPA 3WI3A 3EDUA 5LGTB 4PK4A 2UXXB 2LSJA 4BJMA 4ZS2A 4EZ4A 4UV9B 3ZMUB 4KUMB 3JC6C 2KT9A 2CMRA 5FY1A 2CXDA 3E0ZA 3WAKA 1MMNA 2CCQA 2MYSA 1E1HB 4BA9A 4TZ4C 1ZV4X 4CI2B 3JC6D 2DLRA 4IE6A 3A5XA 4PNIA 4MBQA 4PFPA 1B7TA 5JRCA 3PE0A 3LFMA 3FXDB 2DHRA 4O4JE 2HH7A 4OYJA 3CX7B 1IJ5A 4QXHB 3LJCA 1QSDA 5FXVA 3J7Yq 3ZN0B 2DNXA 2L3LA 4U74A 2JMHA 2JMKA 3ZJ2A 5JQGE 4GK5E 3F57A 4X1KE 3CPZA 2YINA 4CZZB 3KVBA 3PU3A 2QGSA 2VWAA 5EZYE 2V26A 2EHOD 3Q5WA 3ZYLA 3ZPOA 4ANJA 5L3EB 2JRKA 5JR9C 3KINB 2CWYA 3LBXB 4UELA 4AI6A 5J2UE 3RH3A 4WBOA 2NWBA 5JDGA 2WBLA 2VB6A 3C64A 2XAFB 4GYRA 1HS7A 4L0RA 1QUUA 5LYJE 2N2NA 1T98A 3HL6A 2Q9QB 4IDZA 4YFSA 5LHGB 2VK9A 5LCYA 3AA7B 3C4WA 5KMGP 4E7SA 2EHOC 1MMAA 3LK42 3HKCE 4CXYA 2W62A 2W0GA 3OJAA 4YJ3E 3KV9A 4EB6E 5JREA 3V5UA 4AKRB 5H6QB 2A72A 3AVRA 3D0TA 4TN7B 2KLQA 2YK0A 3KVAA 2K48A 2XAGB 3ZYKA 5LHHB 3CWZB 3FXEB 3AAIA 4QXBB 4AKLA 3UUNA 3RC3A 3RRWA 3E22E 4B6XA 1HFAA 4PW8A 4BJNA 3DP7A 4WNKA 3R6NA 3O4XE 1US7B 4DNDA 3FBLA 3BK9A 1G73A 1WLXA 2VKJA 1Z0PA 3KFWX 2A3DA 4JEUB 3H37A 3ANWA 3SS1A 3HI2A 4ZOLE 3ZMVB 5F3JA 2X68A 3VKGA 5JR9B 2V7JA 2CA5A 5DJQC 2E9XA 4ZS3A 1CUNA 4YHJA 2DWGA 4AKHA 2Y6XA 5DABA 4PK5A 3LK2B 3VHLA 2XHEB 4EZHA 4UF0B 2KINB 5HYAA 3B57A 5JR9A 5FXWA 2LT3A 3MXZA 3CQGB 4P09A 1NWMX 3P8CD 3RPUA 1D1AA 5HXRA 4CI3B 2KNDA 3K3QC 4H9RC 1MNDA 1VRBA 1FMWA 4UVAB 2OA5A 1ZKEA 3F31A 1KNZA 5JH7E 4PJJA 5E0OA 4FI5A 2X67A 5A1LA 3OBVE 1S94A 5JDQA 2CM0A 3CQCB 3FB2A 2VKOA 4N78D 3DTOA 2XQYA 4GIWA 2RA1A 3ZLIA 4H63H 2CEAA 5FY7A 1Y64B 5LGUB 5LXTE 3HR0A 4XAXB 3N9NA 2HPLA 2HPJA 2X9HA 2Y8DA 4O2AE 4YLHA 2V7KA 1IZNB 4DO0A 1VOMA 3ETUA 2E9XB 3T8OA 5EK3A 2IC6A 1BR4A 2H7VC 4OK0A 4I4TE 2VKDA 1UX5A 3FHNA 3PUGA 5L3DB 1LVFA 2WSSV 3KBUA 1IAPA 2E9XD 3O1JA 4Z8XA 3CMLA 2GK9A 2X9XA 4H9SE 4IE0A 3RKOA 3EUHA 4O2BE 4DBQA 3GN5A 5DQWA 1LVKA 3AA6B 4ZHQE 3CQXC 5JDNA 4UEMA 5LGNB 3ZMZB 4OYKA 5LJMA 2WWUA 4QXCB 4JEHB 2NW7A 2A2FX 3MJXA 2IW5B 3N9OA 2LSKA 2EHOB 3UTKA 5CA0E 1YW0A 4MALA 4QHOA 4EAHA 4L9IA 3ZCIA 4X1YE 2X9YA 3ETVA 4EOZB 5J2TE 4M1PA 4DVDA 5L3CB 3S4UA 3N9QA 2Q9QD 3CX6B 5EK4A 4UVBB 3AA0B 5DQVA 1MNEA 2LM9A 4H9PC 5FXZA 2W00A 3SOLA 1LKXA 5TAOA 3HKEE 2B1EA 2XAHB 5L3BB 3ZC0A 5HWYA 4O8SA 5JVDE 2I59A 3C98B 1WRDA 2ZM0A 3GA8A 1D1CA 2V7LA 5ADXL 2BZBA 1AJ3A 5FYMA 3UUXB 3UFEA 3KV4A 4AQFC 4H9OC 3WAJA 3C4XA 2KWHA 1HG5A 5BMVE 3I1AA 3O9XA 1X79A 4HKAA 2MBGA 4KMCA 2D0UA 4EYYR 2LHRA 1WR6A 3EVYA 1YKEB 3ZEFB 5LHIB 1MIVA 4AKGA 2X0LB 5LG4A 1U4QA 3ONXA 4ZI3D 2LSGA 4ILUA 3Q5XA 5KX5E 4HEAA 3L3PA 3CVRA 2PFVA 3B13A 4EXTA 3ZN1B 4PK6A 2WAUA 4TUYE 4QKNA 5FMNA 4JUYA 4X1IE 1HX8A 1MMGA 2DCFA 5FNVE 4ZI2D 3PDYA 4KBMB 4U72A 2E8IA 2LSIA 4G63A 5FY0A 3RRCA 3LBXA 5CB4E 4XBFB 1D0YA 3IF8B 3SWHA 2IAKA 5HXCA 2CXFA 2PBIA 3RYIE 3AB3B 3OKQA 3F2EA 3ZC1A 3O1HA 1ZHCA 2Q9QA 3M65A 4P0BA 2ZM8A 1S35A 3KBTA 2DI4A 5F8PA 3MA9A 2WM9A 2Y48B 4O4HE 3PTRB 4AQFA 5JDHA 5L2LA 3HKDE 2L9QA 4J2CA 3GWHA 1EZ3A 3I9YA 2X9WA 5M4YA 1BR0A 2ES0A 2LOPA 4DMWA 2IC9A 2VASA 1WYCA 4FJOA 3VU7H 1IJ6A 3N2OA 4WW0A 3V5SA 1FMVA 5IHYA 4TX5A 1MIWA 1FIOA 1YKHB 3AAEB 3CKDA 3I9WA 3LG7A 2V1DB 2BDEA 1SHZC 2X51A 4OFZA 5LNKA 4HE8A 3N2KE 3K3NA 3HKBE 5L3FB 3N2GE 3Q9DA 4BAYB 2QA7A 3Q2MA 3KV5A 4EIWA 2N1GA 4QWNB 1BR1A 2X66A 2CWOA 4UVCB 5C8YE 2KWIB 4V1Av 3RYFE 1HTJF 4ZI7E 3AAAB 4CXWA 4C90A 3ZMTB 2G0UA 2LE8A 5HAXA 1MMDA 5FXXA 2LEHA 4DMVA 4A56A 3VKHA 1D0XA 5AFUL 2L8KA 3NRYA 5FP3A 4IHJE 1U5PA 4O4LE 4UF0A 2SPCA 2MTQA 4O4IE 5GONE 5LP6E 2H7OA 3N9LA 2ACXA 1O3XA 5JDMA 2ODVA 2W63A 3BQKA 2PG8A 2XTLA 2JJ9A 3PUAA 4UIGA 4EYUA 4ZI2C 4PJMA 1G8XA 2BVMA 3ZJ1A 1NAFA 3MK7C 5LA6E 2E9XC 3RX6A 5EK2A 1H7CA 3O1IA 2ZLYA 4ZI3C 5LBQB 2WMNA 4IE4A 4MLKA 4PJNA 3GMIA 4H9QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B57 A;  5IHY A;  2QGS A;  5DQW A;  3DJB A;  2PJQ A;  3DTO A;  5DQV A; 
#chains in the Genus database with same CATH topology
 1H1Q B;  5BNJ B;  1VYW B;  5ABH A;  2DWK A;  3ZCJ A;  2DPP B;  4P0A A;  2AHJ B;  2PHG A;  4BCN B;  1D0Z A;  4AQY T;  3EDV A;  5AQU B;  2NW8 A;  5HWX A;  2UZL B;  4JLE A;  2UXN B;  3QB5 A;  4NC6 A;  1CHU A;  2Q9Q C;  5EJC A;  2V7M A;  2VL0 A;  4A97 A;  2IML A;  5HXE A;  2WDR A;  3AVS A;  4ELL A;  4I55 E;  3CX8 B;  2CXL A;  3Q5D A;  3HHT B;  4IIJ E;  2IN3 A;  4HFD A;  4BBS M;  2LRK A;  5ETW A;  2ZM6 T;  2XUE A;  1HCI A;  4X65 T;  3UUL A;  4OB2 B;  1WYB A;  4DBR A;  1N32 T;  1SA0 E;  5LJN A;  5AQG B;  2BG9 A;  1UGO A;  1UNL D;  3RQW A;  4LF8 T;  5L3G B;  2CE7 A;  3AEG A;  4NUV A;  4BCN D;  4MFR A;  4IST A;  4PFO A;  1IBL T;  1BR2 A;  2NW9 A;  1UCU A;  1TD6 A;  2YKS A;  3PUQ A;  4IDN A;  4F6R C;  4UV8 B;  3PU8 A;  4IE7 A;  3BG3 A;  2CJM B;  2J4G A;  2A9U A;  4HTE A;  4ERR A;  4NIQ A;  5LMK B;  4PAG A;  4Y72 B;  4U33 A;  3UT5 E;  2XAS B;  2ZMA A;  4EEB A;  4ISS A;  1J1J A;  4NXM T;  3WI3 A;  4ROE A;  2UXX B;  2LSJ A;  4BJM A;  4EED A;  2XM2 A;  3JC6 C;  4KI0 F;  3EID B;  2CXD A;  2MYS A;  3BHT B;  2I0M A;  3EI0 A;  4IE6 A;  2DLR A;  4YSY A;  3A5X A;  2LW4 A;  4PNI A;  4YHH T;  2JGZ B;  4LF4 T;  2OLT A;  3LJC A;  1QSD A;  4OB3 B;  4Z91 A;  4U74 A;  1QMZ B;  2BBH A;  3QZ5 B;  3KHI A;  1HNZ T;  5FVK A;  2QQ8 A;  2PMI B;  4YOZ A;  3PU3 A;  3ZYL A;  2VWA A;  1N34 T;  2V26 A;  2EHO D;  3P4S A;  2H88 A;  5AQM B;  3L8R A;  2ZPF B;  3RH3 A;  2NWB A;  2WBL A;  2VB6 A;  3QYB A;  4GYR A;  4LFB T;  4YFS A;  2VK9 A;  3C4W A;  5KMG P;  2XSB A;  2XQ3 A;  4EOI B;  2EHO C;  4ZZC A;  3A7M A;  1PKD B;  3HKC E;  4CXY A;  3RI5 A;  2W62 A;  2UUA T;  2V6Y A;  4YJ3 E;  3HB9 A;  3D0T A;  2XJ7 A;  2E5V A;  2UZE B;  3CWZ B;  4QXB B;  3RRW A;  3E22 E;  2E2A A;  1HFA A;  4PW8 A;  3DP7 A;  4DV2 T;  1GY3 B;  1G73 A;  1WLX A;  1KNP A;  2H89 A;  3H37 A;  4ZOL E;  3ZMV B;  4CN4 A;  4EV6 A;  5F3J A;  5JR9 B;  2W96 A;  3UQ7 A;  5LG3 A;  4ZS3 A;  1CUN A;  4MIM A;  4AKH A;  5DAB A;  3NKZ A;  3LK2 B;  2CZ7 B;  2XHE B;  2XY8 B;  2JIW A;  4IDP A;  3RIF A;  4UF0 B;  2ZPH B;  3P8C D;  3GTM S;  3RPU A;  5AQS B;  1WR0 A;  4H9R C;  1X9B A;  4UVA B;  2OA5 A;  2NR4 A;  2V8S V;  1URC B;  1IRE B;  3T1H T;  3DTO A;  3G06 A;  4GIW A;  3OPC A;  4BCK B;  2CEA A;  5LXT E;  3HR0 A;  4XAX B;  3N9N A;  2HPL A;  4YLH A;  2Y8D A;  4DO0 A;  3T8O A;  4CRL B;  1BR4 A;  5C3J A;  4I4T E;  2VKD A;  4QH4 A;  3PUG A;  1LVF A;  1XNQ T;  1IAP A;  3P4Q A;  1ZOY A;  2LLY A;  4O2B E;  3QB5 K;  2ZCF B;  4EOJ B;  3GN5 A;  4ZHQ E;  3ZMZ B;  4BCJ B;  4OYK A;  2WWU A;  4QXC B;  1JKW A;  3X28 B;  5IWA T;  4U2Z A;  3VYG B;  4QH5 A;  4MAL A;  2C6T B;  4FM4 B;  4M1P A;  1YQ4 A;  4CXA B;  4UVB B;  4IRE A;  3A8H B;  2WZI A;  1LKX A;  5TAO A;  2WMB B;  3ZC0 A;  5HWY A;  4JV5 T;  1OL1 B;  5AQR B;  1WRD A;  3RLF F;  3GA8 A;  5ADX L;  5FYM A;  4DUY T;  4H9O C;  4YTP A;  2KWH A;  3WVD B;  1X79 A;  2IW6 B;  3TNW B;  4WYV A;  5L47 A;  2LHR A;  1YKE B;  3ZEF B;  5LHI B;  4AKG A;  2C5N B;  3ZST A;  1OED B;  3ONX A;  4ILU A;  4CFM B;  3L3P A;  3B13 A;  4EXT A;  3PDY A;  2LSI A;  4G63 A;  1D0Y A;  3IF8 B;  2CXF A;  2PBI A;  3AB3 B;  3OKQ A;  2FJE A;  1UUR A;  1ZHC A;  4P0B A;  4IL4 A;  5J0Z A;  2MPK A;  3KBT A;  2DI4 A;  1E7P A;  3MA9 A;  4NPP A;  2IIU A;  5JDH A;  4YOS A;  4J2C A;  3I9Y A;  2LOP A;  1AIS B;  2IC9 A;  1WYC A;  2CPT A;  2BG9 E;  1O9K B;  1WCR A;  3X20 B;  1H1P B;  4ELJ A;  3AAE B;  3LG7 A;  2CCI B;  1M7K A;  4A5X A;  3VYH B;  3EHZ A;  3K3N A;  3RHW A;  5L3F B;  3ZKR A;  2BS2 A;  3Q2M A;  4UVC B;  2CWO A;  1UNH D;  4IL9 A;  4M6V A;  2G0U A;  3AE6 A;  3ZMT B;  5FXX A;  2QRX A;  3FZM B;  2LEH A;  4DMV A;  3VKH A;  4TWD A;  1D0X A;  4A56 A;  1IBK T;  3NRY A;  4IHJ E;  4YTN A;  4X64 T;  2W63 A;  2PG8 A;  3PUA A;  3QHW B;  4EYU A;  3A8L B;  5LB7 B;  3TLW A;  2E9X C;  4LF9 T;  5BR8 T;  3O1I A;  4HNU A;  5IDP B;  4LMK A;  2XSA A;  4H9Q C;  3P4P A;  2KMF A;  3OYZ A;  2MOZ A;  3MAC A;  1XNR T;  2KXP B;  1YXR A;  1W98 B;  3KV6 A;  4OHF A;  5CA1 E;  2VKH A;  2W2H A;  5JDF A;  3BG5 A;  4JI4 T;  2K5B B;  3K8P C;  5HXH A;  5AQL B;  2XM1 A;  2XQ5 A;  2YDQ A;  2I40 B;  5L4E A;  2WXV B;  4Z6Y A;  2NOX A;  3FZL B;  3P4W A;  4CXX A;  3WVE B;  3ZT7 A;  2JPF A;  2RP4 A;  3B5M A;  4CQI A;  1N36 T;  3RKG A;  5JDL A;  3TKL B;  3AE7 A;  2D5U A;  3QC9 A;  2CLY C;  2AXD S;  4L5G A;  2WU5 A;  3AE8 A;  3ZYM A;  4GYS A;  4CFV B;  3I0O A;  3TW7 A;  4U7Y A;  2UXB T;  3IBP A;  1LRZ A;  3UUM A;  4YY3 T;  2QFZ A;  4JI3 T;  2N9D A;  4TV9 E;  1UX4 A;  3JAD A;  3PUS A;  1D1B A;  3TW6 A;  2D9D A;  5HEJ A;  2K24 A;  4E7Z A;  4LMJ A;  2W99 A;  4HFV A;  2NTX A;  4KP3 C;  4JI6 T;  3L09 A;  3J9X 1;  5ABF B;  2BVL A;  5AQO B;  2YDS A;  3BQI A;  2HHH T;  1JNZ A;  4AQG A;  4AKI A;  4DV1 T;  1HF8 A;  3M3Z B;  4EC8 B;  4ILC A;  4LF5 T;  4GKJ T;  3F5X B;  5CJ5 A;  4PK4 A;  5L2W B;  4EZ4 A;  3ZMU B;  1FVV B;  2KT9 A;  2CMR A;  1IBM T;  5FY1 A;  3P50 A;  2CCQ A;  1JST B;  4DR5 T;  3RF1 A;  1ZV4 X;  3JC6 D;  4MBQ A;  3PE0 A;  2R7G A;  2DHR A;  4KRD B;  5FXV A;  3AE1 A;  3J7Y q;  2L3L A;  2JMH A;  3LSV A;  3ZJ2 A;  4GK5 E;  4DR2 T;  1XZY A;  5L3E B;  1ZP2 A;  3DDQ B;  2W67 A;  2JRK A;  2BKP A;  1F5Q B;  4EOR B;  2CWY A;  4AI6 A;  2WB5 A;  3KIN B;  3LBX B;  4UEL A;  4X5T A;  4OR5 B;  4WBO A;  2BS4 A;  1QUU A;  3TLV A;  1T98 A;  3HL6 A;  5LCY A;  2M6I A;  2QVA A;  4E7S A;  1OIY B;  2WS3 A;  5FL0 A;  4LF6 T;  2WQY A;  5H6Q B;  4TN7 B;  5HNB B;  1E9H B;  2K48 A;  1KEY A;  3ZYK A;  2KR6 A;  4AKL A;  3UUN A;  1W09 A;  3QXE B;  5HEU A;  1XMQ T;  3UQ4 A;  1US7 B;  2WDQ A;  4DND A;  3FBL A;  2XQ7 A;  4YT0 A;  2A3D A;  4EON B;  3SS1 A;  2CZ6 B;  2G9X B;  2X68 A;  5DJQ C;  3LDQ B;  2E9X A;  2VVN A;  2G77 A;  4YHJ A;  2M6B A;  2DWG A;  3K1S A;  2Y6X A;  1OIU B;  2BG9 B;  2ZPG B;  4EOP B;  5HYA A;  3B57 A;  1M62 A;  3AED A;  1NWM X;  1W0A A;  2KND A;  3K3Q C;  4U31 A;  1N33 T;  4BCI B;  1ZKE A;  4JI2 T;  4AIS A;  4FI5 A;  4COF A;  2X67 A;  4N78 D;  4YC3 B;  1KNR A;  2RA1 A;  3ZLI A;  1Y64 B;  5LGU B;  2HPJ A;  4O2A E;  1VCT A;  2V7K A;  3UUB A;  3AE3 A;  3ETU A;  3ONJ A;  5EK3 A;  2H7V C;  4OK0 A;  1D3U B;  3FHN A;  5L3D B;  2C4G B;  3KBU A;  2LKG A;  3CML A;  2X9X A;  4IE0 A;  4TWF A;  5IUX A;  1XDO A;  2WWV A;  1LVK A;  4LFA T;  4HLQ A;  5EFQ B;  3JCF A;  4UEM A;  2ACZ A;  5LJM A;  4HFB A;  4JEH B;  3MJX A;  3N9O A;  2LSK A;  3UTK A;  5CA0 E;  1NEK A;  4DV7 T;  4X1Y E;  1OL2 B;  3ETV A;  5J2T E;  2WIP B;  3S4U A;  3N9Q A;  2Q9Q D;  2I6H A;  5DQV A;  4H9P C;  3HKE E;  2B1E A;  2XAH B;  1H4L D;  5JVD E;  4DR3 T;  2I59 A;  2X0Y A;  3SFD A;  2V7L A;  3MI9 B;  1FJG T;  1AJ3 A;  2FBW A;  1HNW T;  3ZSS A;  4AQF C;  1GQE A;  3WAJ A;  5BMV E;  3I1A A;  4HKA A;  5AQP B;  2MBG A;  4YSX A;  3LQ5 B;  1QLB A;  1WR6 A;  3EVY A;  1MIV A;  2K3W A;  1XO2 A;  1U4Q A;  5LG4 A;  2LSG A;  5KX5 E;  4HEA A;  3CVR A;  4BCO B;  5AQH B;  4TUY E;  4QKN A;  4X1I E;  1MMG A;  2DCF A;  4F6S B;  4DV6 T;  4I3Z B;  3RRC A;  2BKO A;  2IAK A;  4F7N B;  4YSZ A;  2DD4 B;  3RYI E;  3PJA J;  3F2E A;  2CCH B;  3NWI A;  4ROD A;  2XPK A;  2X0H A;  4DUZ T;  3VR8 A;  1I94 T;  5F8P A;  2WM9 A;  4O4H E;  1Z8U A;  1JOW A;  5M4Y A;  3ZT6 A;  2LM2 A;  4Z90 A;  5ABG A;  1IJ6 A;  2W9Z A;  4LML A;  4CFW B;  4ZGJ B;  1YKH B;  2BDE A;  2X51 A;  4JX4 A;  2QDJ A;  1TFB A;  2WCA A;  1W0B A;  4G6L B;  3KV5 A;  2W2U A;  1BR1 A;  5AQV B;  5C8Y E;  3FZF B;  4ZI7 E;  3AAA B;  1FKM A;  1UUS A;  1Y01 A;  4C90 A;  2WP9 A;  4O4L E;  2CZ0 B;  2PK2 A;  4O4I E;  3N9L A;  4BCM B;  1O3X A;  5JDM A;  2JJ9 A;  1H24 B;  5C2T A;  4PJM A;  2BKZ B;  2BVM A;  1NAF A;  5LA6 E;  2KMG A;  3RX6 A;  5EK2 A;  4ZI3 C;  5LBQ B;  2WMN A;  4IE4 A;  3AEB A;  4EGW A;  4EC9 B;  3G33 B;  3MKD A;  4AXP A;  2EUF A;  4LFC T;  2NP9 A;  2NTY A;  2C5J A;  2WU2 A;  3DJB A;  2C5K T;  1W9R A;  3PV0 F;  3KDS E;  1KK7 A;  3FBZ A;  3JAE A;  4YTM A;  4TTH A;  4EOQ B;  4GOU A;  2YU2 A;  3U3I A;  2QF7 A;  2EHO A;  1FIN B;  3H4C A;  2ZZD B;  4K0U A;  1V9D A;  3NRX A;  1AD6 A;  5AQQ B;  5H6R B;  3P7I A;  2C5O B;  3N9M A;  4GK0 E;  2C0S A;  2D0T A;  4PJL A;  1KFY A;  1G3N C;  3QK6 A;  3QUJ A;  3RC8 A;  2JQQ A;  3W15 B;  5AQT B;  2W61 A;  4DV3 T;  4F7J B;  2FJD A;  1H26 B;  2V6Y B;  4NUU A;  4X20 E;  4IE5 A;  2XAQ B;  4BBR M;  4BCQ D;  4ZZB A;  4JI7 T;  3IEE A;  3NBX X;  4XZC A;  3OYX A;  4NST B;  1ENW A;  3RIA A;  2PJQ A;  3HA4 A;  4HN9 A;  3POM A;  1HG2 A;  3C51 A;  2P9B A;  3N9P A;  1GH6 B;  5JRC B;  3T1Y T;  2LHN A;  2R6G F;  2IHR 1;  3PJA A;  4KHP T;  4I43 B;  5LMU T;  4CI1 B;  2VVS A;  4C91 A;  4QX7 B;  1OXZ A;  4JX5 A;  5IYZ E;  2WZH A;  1YD8 G;  4H9N C;  2LKH A;  3A8Y C;  5I5Z B;  3RIU A;  3Q5E A;  2ODU A;  2XZE A;  1ZP0 A;  2LSY A;  4JI5 T;  4EOL B;  2C5I T;  4YJ2 E;  1FEW A;  3E08 A;  3EDU A;  5LGT B;  2V5C A;  3TNH B;  3AEF A;  4KUM B;  4ZGE B;  4DR6 T;  3WAK A;  3E0Z A;  1MMN A;  4BCH B;  2VQE T;  4TZ4 C;  4CI2 B;  4PFP A;  1B7T A;  5JRC A;  4A98 A;  4O4J E;  2XQ4 A;  1T7S A;  3BLR B;  3CX7 B;  4B3R T;  5AQN B;  2JMK A;  5JQG E;  3F57 A;  2BPM B;  3CPZ A;  2YIN A;  3KVB A;  2QGS A;  5EZY E;  3ZPO A;  3Q5W A;  4ANJ A;  4EOK B;  3TLS A;  5JDG A;  3C64 A;  2XAF B;  1HS7 A;  4L0R A;  4HWC A;  3AXJ B;  4GKK T;  2JQ9 A;  3OJA A;  3KV9 A;  3QYG B;  5JRE A;  2UXD T;  5HVY B;  3FZK B;  4AKR B;  3FZH B;  4JYA T;  2A72 A;  3AVR A;  3QYH B;  2KLQ A;  3KVA A;  2XAG B;  4MFE A;  4IT4 A;  3RC3 A;  2B9R A;  4ROC A;  4WNK A;  2D0Q B;  3OVU A;  3R6N A;  2PK9 B;  1GUX B;  3MIA B;  2WJ9 A;  3BK9 A;  2IDO B;  3DL1 A;  2VQF T;  4JEU B;  3ANW A;  3HI2 A;  3VKG A;  2V7J A;  2CA5 A;  3AE2 A;  4PK5 A;  2KSR A;  5CFB A;  4F8H A;  2KIN B;  2CBI A;  3CQG B;  4P09 A;  5ICP B;  1D1A A;  5HXR A;  2DL1 A;  5IF1 B;  1MND A;  2UU9 T;  2WEV B;  1KNZ A;  3ONL C;  3MY1 B;  4PJJ A;  4CN1 A;  5E0O A;  2V22 B;  5JDQ A;  1I6Z A;  2WHB B;  3FB2 A;  2XQY A;  3A8O B;  2XQA A;  2X9H A;  1IZN B;  2E9X B;  2DD5 B;  2OV9 A;  1UGS B;  3DDP B;  3QOF A;  4HL4 A;  4P1N A;  2WSS V;  4HFH A;  3O1J A;  4Z8X A;  4H9S E;  2WIH B;  3AA6 B;  3CQX C;  5JDN A;  2RPA A;  2FJB A;  4BY7 X;  2B76 A;  2NW7 A;  2IW5 B;  3RGF B;  2EHO B;  4EAH A;  4B3M T;  4EOZ B;  4DVD A;  3A8M B;  5L3C B;  5FVL A;  3AA0 B;  1MNE A;  5FXZ A;  2W00 A;  3QYE A;  5L3B B;  2F4V T;  3NVO A;  5KXJ A;  4O8S A;  3EOC B;  5CYI B;  3C98 B;  3X1D A;  1D1C A;  2BZB A;  4OGR B;  5FGK B;  3UUX B;  3UFE A;  3KV4 A;  5HBE B;  3PUV F;  1HG5 A;  3O9X A;  1H27 B;  2D0U A;  4EYY R;  2CYZ B;  4LF7 T;  2X0L B;  3VRB A;  5AQK B;  4OB1 B;  3UU4 A;  3ZN1 B;  4PK6 A;  2WAU A;  5FMN A;  4JUY A;  1HX8 A;  5FNV E;  4KBM B;  2E8I A;  3LBX A;  5CB4 E;  3SWH A;  4JX6 A;  2CRB A;  4ZEY A;  1JSU B;  1L0V A;  5CGM A;  2Q9Q A;  2PTF A;  1NEN A;  3PTR B;  5L2L A;  3HKD E;  3GWH A;  2X9W A;  4EOS B;  2ES0 A;  4DMW A;  2V6X A;  3AEE A;  3BHU B;  3VU7 H;  3N2O A;  4BXX X;  5IHY A;  4DR1 T;  3M03 A;  4TX5 A;  1FIO A;  3BHV B;  4OFZ A;  1SHZ C;  3AE9 A;  5LNK A;  4HE8 A;  3HKB E;  2IW9 B;  1XMO T;  1J5E T;  3N2G E;  3Q9D A;  4EIW A;  1JNR A;  2CHO A;  2X66 A;  4BCP B;  3UU8 A;  4V1A v;  1HTJ F;  4CXW A;  2LE8 A;  5HAX A;  4JI1 T;  4EOM B;  4QSH A;  3AEC A;  2QYW A;  1UGR B;  2L8K A;  5FP3 A;  3PUY F;  4UN0 A;  2MTQ A;  5LP6 E;  2H7O A;  2ODV A;  2XTL A;  2LRL A;  3QNU A;  3ZJ1 A;  3MK7 C;  5CEI B;  1H1R B;  2WPA B;  4IDQ A;  3H3M A;  2F2C A;  1OI9 B;  4MLK A;  4PJN A;  4WBN E;  3NZQ A;  4HGA A;  3H3A A;  1VOL A;  2YOE A;  2CZ1 B;  4H63 V;  3PUW F;  3LK3 B;  4BCF B;  4LOC A;  4HWI B;  4HFC A;  3HBL A;  2BS3 A;  2YU1 A;  1XWM A;  4HWD A;  3ANW B;  2YEV C;  3R84 B;  4DV5 T;  5JTG A;  5FL1 A;  5AQJ B;  3OTO T;  4IDO A;  3CK6 A;  2LJL A;  5L4H A;  4KRC B;  4KX6 A;  4ASK A;  2K9A A;  5ABF A;  1V29 B;  3O0G D;  2FUP A;  4ADZ A;  2WFY B;  3C50 A;  2UZB B;  3MZK B;  2YDR A;  4ILA A;  4B3S T;  5ABE A;  3I0Q A;  3EAB A;  4I50 E;  1E2A A;  4QX8 B;  4DR4 T;  3RYC E;  1OED E;  2V7I A;  3K3O A;  3PUR A;  2JQH A;  4G2A A;  3TNI B;  1OED C;  5HXS A;  2J1D G;  2H3R A;  3C4Z A;  2M67 A;  3SRZ A;  1UK5 A;  1C9B A;  2D2S A;  4HNT A;  3K7A M;  1HX1 B;  4TNW A;  3TLT A;  4U3C A;  2KZ7 B;  2ZM2 A;  5HEO A;  1MIY A;  5HQ0 B;  4B3T T;  3ESL A;  1ZEE A;  5LOV E;  3ZMS B;  4OB0 B;  4HNV A;  4X62 T;  3GN5 B;  5LBM A;  2VL8 A;  2WMO A;  3AE4 A;  4MFD A;  2LOS A;  3BQL A;  3AA1 B;  4MHC A;  4UR9 A;  1OWA A;  3IA3 A;  1P5E B;  4KHZ F;  4X66 T;  3RYH E;  5J1G A;  4IGU A;  5ACB A;  5KDM C;  2CLY B;  3N5L A;  4WZX A;  2WDV A;  3U78 A;  3IHR A;  4ILB A;  2W66 A;  3PUZ F;  3RGL A;  4TV8 E;  4BY1 X;  4UXN B;  2XAJ B;  2Z6E A;  3X26 B;  3NZP A;  4JI0 T;  2XQ9 A;  4ZS2 A;  4UV9 B;  4HFI A;  1BU2 A;  1E1H B;  2FJA A;  4BA9 A;  3LFM A;  3AE5 A;  3FXD B;  2HH7 A;  4OYJ A;  1IJ5 A;  4QXH B;  1OED A;  3ZN0 B;  2DNX A;  4X1K E;  5AQI B;  1VIN A;  2UUC T;  4CZZ B;  1GUX A;  4DV4 T;  5JR9 C;  4JI8 T;  5J2U E;  5LYJ E;  1UGP B;  2N2N A;  2Q9Q B;  4IDZ A;  4DV0 T;  5LHG B;  2CBJ A;  3AA7 B;  1XDP A;  3MY5 B;  1MMA A;  1YQ3 A;  3LK4 2;  2DME A;  2W0G A;  2BBJ A;  3PUX F;  4HFE A;  4EB6 E;  2W4X A;  3V5U A;  1T8B A;  3ABV A;  2YN6 A;  3VRA A;  2YK0 A;  3AEA A;  5LHH B;  3FXE B;  3AAI A;  2I53 A;  2IVX A;  4B6X A;  1N4M A;  4BJN A;  3TLU A;  4DID B;  3O4X E;  2WY2 A;  3PO3 S;  4OX9 T;  2VKJ A;  1Z0P A;  3KFW X;  1HR0 T;  3AXJ A;  4II5 B;  1OKV B;  3VHL A;  4EZH A;  1AHJ B;  1SE7 A;  1O9K A;  5FKY A;  5JR9 A;  5FXW A;  2LT3 A;  3MXZ A;  2V5D A;  1KF6 A;  3VR9 A;  4K0K T;  3BG9 A;  4CI3 B;  3EAM A;  4I0U A;  2HN2 A;  1VRB A;  1FMW A;  2JQK A;  1T72 A;  3F31 A;  5JH7 E;  4BCQ B;  4YOO A;  3QHR B;  4HWH A;  4U7I A;  5A1L A;  3OBV E;  1S94 A;  2CM0 A;  3CQC B;  2VKO A;  2QDY B;  2XQ8 A;  4H63 H;  5FY7 A;  3EJ1 B;  1VOM A;  3L39 A;  1J5W A;  4YXD A;  2IC6 A;  3TN8 B;  1UX5 A;  2X1N B;  5IDN B;  1H25 B;  4TWH A;  2E9X D;  2BG9 C;  3RKO A;  2GK9 A;  4DBQ A;  3EUH A;  4CFX B;  1OGU B;  5DQW A;  5LGN B;  3X24 B;  2WMA B;  3HZJ A;  2A2F X;  2IW8 B;  4ZXL A;  5HBH B;  3NDQ A;  1YW0 A;  2DXC B;  4QHO A;  4L9I A;  3ZCI A;  2UZD B;  2X9Y A;  3BLQ B;  4TNV A;  5HEH A;  4F6W B;  5LQF B;  3CX6 B;  5EK4 A;  2LM9 A;  4CN6 A;  4Q25 A;  3SOL A;  4BCG B;  2VUR A;  3JAF A;  1R8I A;  4BCM D;  1WFD A;  3DOG B;  2ZM0 A;  2UXC T;  3C4X A;  3HO8 A;  3X25 B;  1SUM B;  4KMC A;  4CFU B;  4ZI3 D;  3Q5X A;  2AE9 A;  3SFE A;  5F5W A;  2PFV A;  3UU5 A;  4ZI2 D;  2ZPI B;  4U72 A;  4F70 B;  4HWF A;  5FY0 A;  4F7S B;  4IMY B;  4XBF B;  5HEG A;  5HXC A;  2UUE B;  5LMN T;  1UNG D;  3P4R A;  3QWL A;  4DR7 T;  3ZC1 A;  3O1H A;  3M65 A;  3UU3 A;  2ZM8 A;  4EOO B;  1S35 A;  2C5X B;  2BKN A;  2XQ6 A;  3UFG A;  2Y48 B;  4AQF A;  1DU2 A;  2DXB B;  4JBW F;  2L9Q A;  5HCM A;  2CHN A;  1EZ3 A;  1BR0 A;  3RIU C;  2VAS A;  1HNX T;  4FJO A;  4WW0 A;  3V5S A;  1FMV A;  4ZGD B;  1MIW A;  3QZ9 B;  3RQU A;  3CKD A;  3I9W A;  1KXU A;  1OKW B;  2V1D B;  3CIR A;  3N2K E;  4AIU A;  4BAY B;  3BLH B;  2QA7 A;  4FX3 B;  3UU6 A;  2N1G A;  4QWN B;  4CFU D;  2KWI B;  4U2Y A;  3RYF E;  2ZPE B;  5AQF B;  1H28 B;  2W9F A;  1MMD A;  1H1S B;  2MAW A;  2C5V B;  1UGQ B;  4F7L B;  2UUB T;  2HN1 A;  5AFU L;  2E5L T;  4UF0 A;  5GON E;  1U5P A;  5HBJ B;  2SPC A;  2J62 A;  1VCS A;  2J47 A;  4NXN T;  2ACX A;  3A8G B;  3BQK A;  4F6U B;  5HCJ A;  4UIG A;  4ZI2 C;  1G8X A;  2ZPB B;  4QH1 A;  2IUB A;  1H7C A;  4CFN B;  2ZLY A;  3ZT5 A;  3GMI A; 
#chains in the Genus database with same CATH homology
 4WBN E;  3NZQ A;  3MKD A;  2KMF A;  3OYZ A;  4HGA A;  4AXP A;  3H3A A;  2MOZ A;  2DWK A;  2NP9 A;  3MAC A;  4H63 V;  2NTY A;  2KXP B;  3LK3 B;  3ZCJ A;  2C5J A;  3DJB A;  2C5K T;  4P0A A;  3KV6 A;  4OHF A;  5CA1 E;  2VKH A;  1D0Z A;  3EDV A;  5JDF A;  2NW8 A;  2K5B B;  3K8P C;  5HWX A;  2YU1 A;  3KDS E;  1KK7 A;  3FBZ A;  3ANW B;  2YEV C;  3R84 B;  5HXH A;  4JLE A;  4GOU A;  2UXN B;  2YU2 A;  3U3I A;  2Q9Q C;  2EHO A;  2V7M A;  2NOX A;  4CXX A;  2LJL A;  5HXE A;  2JPF A;  2RP4 A;  4K0U A;  4ASK A;  1V9D A;  3NRX A;  4CQI A;  2K9A A;  3AVS A;  5H6R B;  3P7I A;  4I55 E;  3CX8 B;  5JDL A;  3N9M A;  2CXL A;  4GK0 E;  3TKL B;  4IIJ E;  2C0S A;  4ADZ A;  2D0T A;  3C50 A;  4PJL A;  2D5U A;  3MZK B;  3QC9 A;  2CLY C;  3I0Q A;  3QK6 A;  4I50 E;  3QUJ A;  4L5G A;  3RC8 A;  2JQQ A;  4QX8 B;  5ETW A;  3RYC E;  2V7I A;  2XUE A;  3K3O A;  3PUR A;  3W15 B;  1HCI A;  3ZYM A;  4G2A A;  2W61 A;  4GYS A;  3UUL A;  3I0O A;  5HXS A;  2J1D G;  2H3R A;  1WYB A;  3C4Z A;  2M67 A;  4DBR A;  3SRZ A;  1SA0 E;  4NUU A;  5LJN A;  2D2S A;  4X20 E;  4IE5 A;  3IBP A;  2XAQ B;  1LRZ A;  3UUM A;  3IEE A;  5L3G B;  2CE7 A;  2N9D A;  2KZ7 B;  4TV9 E;  1UX4 A;  2ZM2 A;  3NBX X;  4NUV A;  3PUS A;  1MIY A;  3OYX A;  4XZC A;  2PJQ A;  1D1B A;  3HA4 A;  4HN9 A;  4MFR A;  1HG2 A;  3C51 A;  3ESL A;  4IST A;  1ZEE A;  5LOV E;  3ZMS B;  4PFO A;  1BR2 A;  2K24 A;  2P9B A;  3N9P A;  2NW9 A;  4E7Z A;  5JRC B;  4HFV A;  1UCU A;  2NTX A;  4KP3 C;  2LHN A;  3PUQ A;  3GN5 B;  4F6R C;  5LBM A;  3L09 A;  4UV8 B;  2VL8 A;  2WMO A;  3PU8 A;  3J9X 1;  2BVL A;  2LOS A;  3BQL A;  3AA1 B;  4MHC A;  4I43 B;  4CI1 B;  1OWA A;  4C91 A;  4QX7 B;  1OXZ A;  3BQI A;  5IYZ E;  3RYH E;  4IE7 A;  5J1G A;  4IGU A;  1YD8 G;  4H9N C;  5KDM C;  2CLY B;  4AQG A;  3N5L A;  4AKI A;  4HTE A;  2ODU A;  4ERR A;  1HF8 A;  3U78 A;  4PAG A;  3IHR A;  2LSY A;  3UT5 E;  4TV8 E;  2XAS B;  2ZMA A;  4UXN B;  2C5I T;  4YJ2 E;  1FEW A;  4ISS A;  2XAJ B;  2Z6E A;  3E08 A;  3NZP A;  3WI3 A;  3EDU A;  5LGT B;  4PK4 A;  2UXX B;  2LSJ A;  4BJM A;  4ZS2 A;  4EZ4 A;  4UV9 B;  3ZMU B;  4KUM B;  3JC6 C;  2KT9 A;  2CMR A;  5FY1 A;  2CXD A;  3E0Z A;  3WAK A;  1MMN A;  2CCQ A;  2MYS A;  1E1H B;  4BA9 A;  4TZ4 C;  1ZV4 X;  4CI2 B;  3JC6 D;  2DLR A;  4IE6 A;  3A5X A;  4PNI A;  4MBQ A;  4PFP A;  1B7T A;  5JRC A;  3PE0 A;  3LFM A;  3FXD B;  2DHR A;  4O4J E;  2HH7 A;  4OYJ A;  3CX7 B;  1IJ5 A;  4QXH B;  3LJC A;  1QSD A;  5FXV A;  3J7Y q;  3ZN0 B;  2DNX A;  2L3L A;  4U74 A;  2JMH A;  2JMK A;  3ZJ2 A;  5JQG E;  4GK5 E;  3F57 A;  4X1K E;  3CPZ A;  2YIN A;  4CZZ B;  3KVB A;  3PU3 A;  2QGS A;  2VWA A;  5EZY E;  2V26 A;  2EHO D;  3Q5W A;  3ZYL A;  3ZPO A;  4ANJ A;  5L3E B;  2JRK A;  5JR9 C;  3KIN B;  2CWY A;  3LBX B;  4UEL A;  4AI6 A;  5J2U E;  3RH3 A;  4WBO A;  2NWB A;  5JDG A;  2WBL A;  2VB6 A;  3C64 A;  2XAF B;  4GYR A;  1HS7 A;  4L0R A;  1QUU A;  5LYJ E;  2N2N A;  1T98 A;  3HL6 A;  2Q9Q B;  4IDZ A;  4YFS A;  5LHG B;  2VK9 A;  5LCY A;  3AA7 B;  3C4W A;  5KMG P;  4E7S A;  2EHO C;  1MMA A;  3LK4 2;  3HKC E;  4CXY A;  2W62 A;  2W0G A;  3OJA A;  4YJ3 E;  3KV9 A;  4EB6 E;  5JRE A;  3V5U A;  4AKR B;  5H6Q B;  2A72 A;  3AVR A;  3D0T A;  4TN7 B;  2KLQ A;  2YK0 A;  3KVA A;  2K48 A;  2XAG B;  3ZYK A;  5LHH B;  3CWZ B;  3FXE B;  3AAI A;  4QXB B;  4AKL A;  3UUN A;  3RC3 A;  3RRW A;  3E22 E;  4B6X A;  1HFA A;  4PW8 A;  4BJN A;  3DP7 A;  4WNK A;  3R6N A;  3O4X E;  1US7 B;  4DND A;  3FBL A;  3BK9 A;  1G73 A;  1WLX A;  2VKJ A;  1Z0P A;  3KFW X;  2A3D A;  4JEU B;  3H37 A;  3ANW A;  3SS1 A;  3HI2 A;  4ZOL E;  3ZMV B;  5F3J A;  2X68 A;  3VKG A;  5JR9 B;  2V7J A;  2CA5 A;  5DJQ C;  2E9X A;  4ZS3 A;  1CUN A;  4YHJ A;  2DWG A;  4AKH A;  2Y6X A;  5DAB A;  4PK5 A;  3LK2 B;  3VHL A;  2XHE B;  4EZH A;  4UF0 B;  2KIN B;  5HYA A;  3B57 A;  5JR9 A;  5FXW A;  2LT3 A;  3MXZ A;  3CQG B;  4P09 A;  1NWM X;  3P8C D;  3RPU A;  1D1A A;  5HXR A;  4CI3 B;  2KND A;  3K3Q C;  4H9R C;  1MND A;  1VRB A;  1FMW A;  4UVA B;  2OA5 A;  1ZKE A;  3F31 A;  1KNZ A;  5JH7 E;  4PJJ A;  5E0O A;  4FI5 A;  2X67 A;  5A1L A;  3OBV E;  1S94 A;  5JDQ A;  2CM0 A;  3CQC B;  3FB2 A;  2VKO A;  4N78 D;  3DTO A;  2XQY A;  4GIW A;  2RA1 A;  3ZLI A;  4H63 H;  2CEA A;  5FY7 A;  1Y64 B;  5LGU B;  5LXT E;  3HR0 A;  4XAX B;  3N9N A;  2HPL A;  2HPJ A;  2X9H A;  2Y8D A;  4O2A E;  4YLH A;  2V7K A;  1IZN B;  4DO0 A;  1VOM A;  3ETU A;  2E9X B;  3T8O A;  5EK3 A;  2IC6 A;  1BR4 A;  2H7V C;  4OK0 A;  4I4T E;  2VKD A;  1UX5 A;  3FHN A;  3PUG A;  5L3D B;  1LVF A;  2WSS V;  3KBU A;  1IAP A;  2E9X D;  3O1J A;  4Z8X A;  3CML A;  2GK9 A;  2X9X A;  4H9S E;  4IE0 A;  3RKO A;  3EUH A;  4O2B E;  4DBQ A;  3GN5 A;  5DQW A;  1LVK A;  3AA6 B;  4ZHQ E;  3CQX C;  5JDN A;  4UEM A;  5LGN B;  3ZMZ B;  4OYK A;  5LJM A;  2WWU A;  4QXC B;  4JEH B;  2NW7 A;  2A2F X;  3MJX A;  2IW5 B;  3N9O A;  2LSK A;  2EHO B;  3UTK A;  5CA0 E;  1YW0 A;  4MAL A;  4QHO A;  4EAH A;  4L9I A;  3ZCI A;  4X1Y E;  2X9Y A;  3ETV A;  4EOZ B;  5J2T E;  4M1P A;  4DVD A;  5L3C B;  3S4U A;  3N9Q A;  2Q9Q D;  3CX6 B;  5EK4 A;  4UVB B;  3AA0 B;  5DQV A;  1MNE A;  2LM9 A;  4H9P C;  5FXZ A;  2W00 A;  3SOL A;  1LKX A;  5TAO A;  3HKE E;  2B1E A;  2XAH B;  5L3B B;  3ZC0 A;  5HWY A;  4O8S A;  5JVD E;  2I59 A;  3C98 B;  1WRD A;  2ZM0 A;  3GA8 A;  1D1C A;  2V7L A;  5ADX L;  2BZB A;  1AJ3 A;  5FYM A;  3UUX B;  3UFE A;  3KV4 A;  4AQF C;  4H9O C;  3WAJ A;  3C4X A;  2KWH A;  1HG5 A;  5BMV E;  3I1A A;  3O9X A;  1X79 A;  4HKA A;  2MBG A;  4KMC A;  2D0U A;  4EYY R;  2LHR A;  1WR6 A;  3EVY A;  1YKE B;  3ZEF B;  5LHI B;  1MIV A;  4AKG A;  2X0L B;  5LG4 A;  1U4Q A;  3ONX A;  4ZI3 D;  2LSG A;  4ILU A;  3Q5X A;  5KX5 E;  4HEA A;  3L3P A;  3CVR A;  2PFV A;  3B13 A;  4EXT A;  3ZN1 B;  4PK6 A;  2WAU A;  4TUY E;  4QKN A;  5FMN A;  4JUY A;  4X1I E;  1HX8 A;  1MMG A;  2DCF A;  5FNV E;  4ZI2 D;  3PDY A;  4KBM B;  4U72 A;  2E8I A;  2LSI A;  4G63 A;  5FY0 A;  3RRC A;  3LBX A;  5CB4 E;  4XBF B;  1D0Y A;  3IF8 B;  3SWH A;  2IAK A;  5HXC A;  2CXF A;  2PBI A;  3RYI E;  3AB3 B;  3OKQ A;  3F2E A;  3ZC1 A;  3O1H A;  1ZHC A;  2Q9Q A;  3M65 A;  4P0B A;  2ZM8 A;  1S35 A;  3KBT A;  2DI4 A;  5F8P A;  3MA9 A;  2WM9 A;  2Y48 B;  4O4H E;  3PTR B;  4AQF A;  5JDH A;  5L2L A;  3HKD E;  2L9Q A;  4J2C A;  3GWH A;  1EZ3 A;  3I9Y A;  2X9W A;  5M4Y A;  1BR0 A;  2ES0 A;  2LOP A;  4DMW A;  2IC9 A;  2VAS A;  1WYC A;  4FJO A;  3VU7 H;  1IJ6 A;  3N2O A;  4WW0 A;  3V5S A;  1FMV A;  5IHY A;  4TX5 A;  1MIW A;  1FIO A;  1YKH B;  3AAE B;  3CKD A;  3I9W A;  3LG7 A;  2V1D B;  2BDE A;  1SHZ C;  2X51 A;  4OFZ A;  5LNK A;  4HE8 A;  3N2K E;  3K3N A;  3HKB E;  5L3F B;  3N2G E;  3Q9D A;  4BAY B;  2QA7 A;  3Q2M A;  3KV5 A;  4EIW A;  2N1G A;  4QWN B;  1BR1 A;  2X66 A;  2CWO A;  4UVC B;  5C8Y E;  2KWI B;  4V1A v;  3RYF E;  1HTJ F;  4ZI7 E;  3AAA B;  4CXW A;  4C90 A;  3ZMT B;  2G0U A;  2LE8 A;  5HAX A;  1MMD A;  5FXX A;  2LEH A;  4DMV A;  4A56 A;  3VKH A;  1D0X A;  5AFU L;  2L8K A;  3NRY A;  5FP3 A;  4IHJ E;  1U5P A;  4O4L E;  4UF0 A;  2SPC A;  2MTQ A;  4O4I E;  5GON E;  5LP6 E;  2H7O A;  3N9L A;  2ACX A;  1O3X A;  5JDM A;  2ODV A;  2W63 A;  3BQK A;  2PG8 A;  2XTL A;  2JJ9 A;  3PUA A;  4UIG A;  4EYU A;  4ZI2 C;  4PJM A;  1G8X A;  2BVM A;  3ZJ1 A;  1NAF A;  3MK7 C;  5LA6 E;  2E9X C;  3RX6 A;  5EK2 A;  1H7C A;  3O1I A;  2ZLY A;  4ZI3 C;  5LBQ B;  2WMN A;  4IE4 A;  4MLK A;  4PJN A;  3GMI A;  4H9Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...