3DJBA

Crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
188
Chain Sequence
TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADLNESEEAGMKKVSDWLEELHVEEEESKHVLHIIANMSIEGKLVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPRDPSLNHFYEKLLKLKDLMNTNAAKQEAEVRHRYMEQFIEQFMKEWNAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, HD family
publication title Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Hydrolase
total genus 50
structure length 188
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3djbA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3djbA02
3DJBA 2QGSA 5IHYA 2PJQA 5DQWA 5DQVA 3DTOA 3B57A
chains in the Genus database with same CATH superfamily
5JH7E 4U3CA 2JPFA 4IE7A 4HWIB 4EZ4A 3AA1B 4UIGA 3FB2A 1HF8A 3QZ9B 2N1GA 4EONB 2XAFB 2XSAA 2IC6A 2PG8A 3C4XA 1HNWT 1H1RB 5JDFA 4OX9T 5AQTB 3PUGA 2XQ5A 4QKNA 3H4CA 4F8HA 5AQJB 1PKDB 1UGOA 2QYWA 1D0YA 2I59A 2JMHA 5L3DB 1BR1A 1IJ5A 2QRXA 3NVOA 4DV4T 2QA7A 4P1NA 2K48A 4B3MT 2PBIA 1UGSB 1FKMA 3A8YC 4OB2B 4HFHA 1W0AA 4YJ3E 2XQYA 4BXXX 5LQFB 4LMKA 4TTHA 3WVDB 3B13A 2BS2A 4CZZB 1NENA 3AE3A 2KWHA 2X68A 1W09A 4YY3T 4KUMB 4CXXA 3OYXA 3TLTA 4ZS3A 2X9YA 2EHOB 3LQ5B 3DJBA 5JRCA 5HEUA 1W0BA 4QX8B 5HXRA 3MKDA 2CXLA 2CPTA 3VU7H 4F70B 4CFVB 3P4SA 4BY1X 4EB6E 4E7ZA 5ABFB 1BU2A 1BR0A 3N2GE 4IHJE 3ZN1B 4LF8T 3BQKA 3LJCA 2Q9QA 4V1Av 2WBLA 1MMNA 4BCQB 4YSYA 4J2CA 3MJXA 2WP9A 2VKJA 2XSBA 2X1NB 4GKJT 3K7AM 2NOXA 3CQXC 4UEMA 4GKKT 3QYBA 3RYIE 4JX5A 4CFNB 3ZC0A 3QC9A 2BBHA 2V6XA 1VINA 5IDNB 5FY1A 2IW9B 4CN4A 1FEWA 1KNPA 2WMOA 2LHRA 3NZPA 4DBRA 3H3MA 2WJ9A 3WAJA 4YC3B 4IIJE 4AQGA 5I5ZB 2V6YB 2LJLA 3RRCA 3QB5A 3X25B 4JV5T 5L2LA 2QQ8A 4QXCB 5IDPB 5ABFA 2M67A 2J4GA 2LOPA 2WB5A 2CXFA 1J5WA 3I9YA 3ZCJA 2ZLYA 2PTFA 1UX4A 3Q5DA 3MY1B 1E7PA 4WBNE 2DLRA 3RHWA 4ISSA 3RGLA 3K3NA 1XWMA 4FI5A 5AQKB 1VOLA 4IGUA 4BCFB 3HBLA 1MMDA 2XQAA 1WYCA 2VWAA 1B7TA 5KXJA 1IREB 5HCMA 2Y8DA 4QSHA 4IDPA 5IWAT 4HLQA 2XAQB 3ZMTB 4TX5A 2V6YA 1UCUA 3DP7A 3TNWB 3E22E 2G77A 4AQYT 4P0AA 3AEBA 2FJDA 1NEKA 2YKSA 2YDSA 1HR0T 4JX4A 1P5EB 2CCQA 2Z6EA 5LMKB 5HXCA 5F8PA 3HA4A 4DMWA 5FYMA 1ZHCA 2LHNA 5L4HA 3OVUA 3QWLA 2QF7A 4HL4A 2K9AA 1X79A 3TLUA 1AD6A 1UNHD 3HR0A 2BDEA 4ELLA 3CX6B 3N9MA 5HBHB 4G2AA 5ABHA 3Q2MA 4BCKB 3I0QA 1LRZA 3RI5A 5CYIB 3GN5B 2XAHB 3UUNA 4X1KE 3L3PA 4ZS2A 5GONE 2DWKA 4PJJA 5A1LA 2NW7A 3WVEB 4I55E 2CLYC 3EVYA 3NKZA 3EDVA 5FKYA 4DV3T 3BG3A 2BBJA 2WU5A 4JI1T 2N9DA 3BQLA 2K3WA 4ELJA 2ACZA 3CWZB 1MIYA 5C8YE 2VB6A 4BJNA 2K24A 4EAHA 5ADXL 4GIWA 2WCAA 3RYHE 4PW8A 2C5KT 1E9HB 4QH1A 4IMYB 3FHNA 4L0RA 5BMVE 4EOSB 4CXYA 4IL9A 1OKVB 4X62T 4MBQA 3GN5A 3VKGA 1ZV4X 5IUXA 5J1GA 5LJNA 5E0OA 4AQFC 2X0YA 2R6GF 1ZP2A 3G33B 1UGQB 3EDUA 3N9NA 4TNVA 3QHWB 4AKLA 4NXNT 3H37A 4LFAT 4HEAA 1N34T 1FINB 3ZMSB 2V7JA 2M6BA 2VASA 3NBXX 2XAGB 1FVVB 2UUCT 5J2UE 4DV0T 2C5XB 3E0ZA 4U7YA 3K3OA 5AQLB 3AEAA 2HN1A 3BK9A 4X64T 5LGNB 2XY8B 2BZBA 2A3DA 2FBWA 4X65T 3TLVA 3UU8A 4JUYA 3GMIA 4O2AE 4ZHQE 3PJAA 4QH4A 5LGTB 4EOMB 1N32T 1W98B 3CQGB 3IF8B 3MI9B 2CLYB 4EOIB 2X0HA 3JADA 4HWFA 3M3ZB 3IA3A 1U5PA 4UF0A 4UR9A 3JAEA 3V5SA 3WAKA 4HKAA 4XAXB 4HFCA 4ROCA 4LMLA 3ZYMA 2IUBA 3AE5A 2LE8A 4LOCA 2YEVC 4DR5T 4YOSA 2L8KA 4LF5T 2KT9A 3FBLA 1JOWA 4ZI7E 4L9IA 4I3ZB 1Y64B 3EJ1B 4MLKA 3AEEA 2H7OA 4YLHA 4KMCA 2D0TA 4JI6T 3LFMA 1J5ET 1UK5A 2XUEA 5LG3A 2WMNA 1J1JA 3RKOA 3P4PA 3QNUA 1XO2A 2B9RA 2KMGA 2W4XA 2OA5A 1N33T 4CI2B 2QVAA 2WMBB 4H9RC 1OGUB 4OB3B 4EOKB 3AA6B 2BKNA 3C98B 3QYEA 1V29B 2JGZB 3HB9A 4BAYB 4CFXB 4I0UA 2ES0A 2H7VC 3ETUA 4YFSA 2LSJA 1Z0PA 3AVRA 2G9XB 3AEGA 3PUAA 4O2BE 4LF7T 3PU3A 2X9HA 5LBMA 3F5XB 1KF6A 1OEDC 2LRKA 4P0BA 3MA9A 1QUUA 2X0LB 3LDQB 2BVLA 3T1HT 2I40B 3AAIA 3I0OA 2IIUA 2Q9QD 2CZ0B 4ADZA 2FJAA 1GH6B 3SS1A 5J2TE 4IT4A 3C51A 2CBJA 4DUYT 5LYJE 4AQFA 3MZKB 4JI0T 4Z6YA 2JIWA 3PUSA 3KHIA 2HPLA 3RQWA 3EOCB 5AQFB 4BCMD 5FXXA 5LMUT 3NDQA 2XHEB 2WDQA 3KDSE 2XQ3A 4UVBB 4X20E 5L3EB 1D3UB 1XDOA 2QFZA 3KVAA 3N9OA 1ZEEA 1G8XA 4F6WB 3PV0F 3NZQA 4PNIA 5KMGP 1WFDA 4NIQA 2JJ9A 5HWYA 4AXPA 1WRDA 4ISTA 5ABGA 2BS4A 1T7SA 2C5VB 3ZT7A 4QXBB 4BCQD 4BCJB 1UUSA 3VR8A 3Q5EA 1QMZB 4HN9A 4ZGDB 3O4XE 3NRYA 4ZI2C 2ZM0A 5JRCB 3RIUC 3O1HA 4HNUA 2A2FX 1H27B 4ZZBA 5IHYA 4U33A 4EOQB 4DMVA 4EOLB 5FY7A 2XQ7A 4I50E 3OJAA 4EYUA 3OBVE 4ROEA 3H3AA 2H3RA 2JQQA 3AE1A 2YINA 4TV8E 2BG9E 2Q9QB 5HEOA 5IYZE 4CN6A 5CEIB 1E2AA 2C6TB 2KZ7B 3GWHA 4ZI3C 3QHRB 3ZMVB 5CB4E 2CHOA 3IBPA 1WLXA 2UXNB 4MHCA 2CA5A 1JNRA 5DABA 3AAEB 4A5XA 3ZSTA 3A7MA 4YSXA 2A9UA 5CGMA 3O1IA 3VKHA 1SA0E 3VYGB 5CA0E 3QK6A 3KV5A 2VL8A 3O9XA 2KSRA 4BCMB 4YXDA 4IE4A 2VK9A 3SWHA 4C91A 3PUVF 2DI4A 3JCFA 5FXZA 4QHOA 2NW9A 3QOFA 1MMAA 4IE5A 5HYAA 1HTJF 3W15B 3EHZA 3DL1A 3FZLB 3FXEB 3CX8B 2KNDA 1OEDA 3N9PA 4L5GA 2WAUA 5JDGA 3DOGB 2ZM6T 4DR7T 3OPCA 2WWVA 3ZSSA 4AKGA 3PUQA 5HEHA 4GK0E 4KBMB 2H89A 3ABVA 2UZEB 3ZJ1A 2QDYB 4GOUA 1YXRA 2CCHB 4HWDA 2JQKA 4Z91A 2UUBT 4PJNA 2BKPA 4IDNA 4LFCT 3PUYF 2K5BB 2LRLA 2IDOB 4YJ2E 2JQ9A 3TNHB 3U3IA 1HG5A 4IREA 4LF6T 3R84B 2CXDA 2D0UA 4DR6T 2XAJB 2RA1A 3A8HB 3BG5A 3QZ5B 3LK3B 2B1EA 5LMNT 3PUXF 2LSYA 3P50A 4PFPA 2DWGA 1CUNA 4OK0A 4Z8XA 2Y48B 3IHRA 1V9DA 1IZNB 4DUZT 4HNTA 4IE0A 2A72A 3FXDB 3PJAJ 1HS7A 3ONXA 4DV6T 5AQNB 3UUMA 3RIUA 4EGWA 5HXHA 1QSDA 1BR2A 3KBTA 5ABEA 3X28B 4HFEA 3QUJA 4YT0A 4BCPB 4UVCB 2CM0A 4DIDB 3BG9A 4YTMA 4F7JB 1C9BA 4ILBA 3TW6A 3PO3S 2ZPGB 1WR0A 3VR9A 2LSGA 4OHFA 1UX5A 4WYVA 5LOVE 2OV9A 4N78D 4AKHA 4XZCA 2H88A 4O4IE 1H26B 2ZCFB 3PUWF 2XQ4A 3OYZA 4TZ4C 2ZMAA 4G6LB 3TW7A 2DD4B 3CQCB 2PMIB 1SUMB 2ODVA 3UTKA 3KBUA 2UXDT 5LCYA 5FMNA 4ILUA 5HWXA 2D2SA 3S4UA 2GK9A 3A8GB 3TNIB 4OYKA 4IDZA 3ANWA 2WY2A 2JRKA 3FZKB 4EORB 4GYRA 5F3JA 2KINB 2XQ9A 3DDPB 3ZPOA 3MY5B 4UV8B 3RYCE 1D0XA 1WYBA 2UXCT 1AHJB 4YHHT 5EK2A 2VQET 2ZPHB 2LOSA 2WWUA 3U78A 4ANJA 3PU8A 2V7KA 4U2ZA 4EOJB 2HN2A 5H6RB 4EEBA 5JDHA 5FVKA 3ZT6A 2VVSA 2W62A 4A97A 2WHBB 4JYAT 2C5NB 1HCIA 1G3NC 2IMLA 4NSTB 3ESLA 2E9XC 4ZGJB 4ZZCA 3BHTB 3NRXA 5FL1A 5DQWA 2X67A 1TD6A 2W66A 2UUAT 1E1HB 4GYSA 4QXHB 4A56A 4FJOA 4BCOB 4EC9B 4BCGB 3JC6C 3AB3B 3JC6D 3X26B 1QLBA 2NTXA 4NUUA 4WW0A 3KFWX 1H28B 1N4MA 4OB1B 1YKHB 2V7MA 1HG2A 1OL2B 2V26A 3AE8A 5ETWA 5EK4A 2WDVA 3HKDE 4UF0B 5AQGB 3PDYA 2QDJA 2CJMB 4PK5A 2PK9B 4HFVA 4O8SA 4B3ST 3K1SA 2AHJB 2UXBT 4IE6A 4JI7T 4TV9E 2BKOA 2IW8B 4CFWB 3L09A 4DR1T 2DMEA 5EK3A 4EOOB 4DVDA 3HKEE 3PUZF 2WEVB 5L4EA 2CZ1B 3AEFA 2WSSV 2LSIA 3Q9DA 5LXTE 4WZXA 5LJMA 4E7SA 3CKDA 2NR4A 5FY0A 2W9ZA 2NP9A 1ENWA 1YQ4A 2IN3A 2YN6A 4EC8B 5AQRB 1MNDA 4HFIA 4UVAB 5FXVA 4DR4T 1NAFA 3EAMA 3ZYKA 1FMWA 1OWAA 1FJGT 4EZHA 1GUXA 2V8SV 5FVLA 3RX6A 2UZBB 3QYGB 5L3FB 1R8IA 4CFMB 5HXEA 4MIMA 5HXSA 2WFYB 4EIWA 3VHLA 2E5LT 1H1QB 5TAOA 1OKWB 3CX7B 3I9WA 4CN1A 2I6HA 2XJ7A 5JDLA 1Z8UA 2V22B 2XQ8A 2YDQA 3C4ZA 2DCFA 2MOZA 2J47A 2QGSA 4NXMT 3SRZA 3SFEA 4YTNA 5LNKA 2UXXB 3F31A 3MXZA 4BCND 2ODUA 1KXUA 2B76A 1H1SB 5LB7B 2N2NA 4EOPB 4DV5T 2WDRA 4EYYR 4PK6A 1I6ZA 2E9XA 2WZIA 3PURA 4OGRB 2WPAB 5JR9C 4KP3C 4WNKA 2D9DA 2DHRA 4DBQA 4OR5B 3HZJA 3UFGA 5HQ0B 4PFOA 1S35A 3AXJB 1LVKA 2E2AA 2X9WA 2IW5B 2C5JA 4FX3B 4OB0B 2WM9A 1UNLD 3AA7B 4KRCB 1D0ZA 1H1PB 2YU2A 4NUVA 1JKWA 3AE9A 4PJLA 5HCJA 5BR8T 3TLWA 2PK2A 5HBEB 5BNJB 1HFAA 2F4VT 3PTRB 3A5XA 4YTPA 3O1JA 2IAKA 3AAAB 1M7KA 4UELA 4DV7T 3N9QA 4DNDA 2X9XA 5LG4A 3RF1A 1D1CA 2ZPEB 4JI5T 2PHGA 4I43B 2CZ6B 3MIAB 2CBIA 4JI8T 4BCIB 1VCSA 3N2KE 5HAXA 3Q5WA 5L3BB 3UQ4A 3HHTB 2VL0A 5JDQA 5LHGB 3ZN0B 4FM4B 5LHHB 2VKOA 3AXJA 3A8LB 4JEUB 2EHOC 1AISB 2WS3A 1LVFA 4B3RT 3RC8A 3T8OA 4BCNB 3AA0B 2Y6XA 1URCB 3KV6A 5FXWA 2XZEA 2ZM2A 2UZDB 4ZGEB 4JBWF 1HX1B 4EXTA 4ZI2D 4JEHB 3AEDA 2ZM8A 5JR9B 1KNZA 4NC6A 3FZHB 3ZCIA 3EI0A 3N9LA 1OEDB 5JDMA 4COFA 1F5QB 5AFUL 2WU2A 3EUHA 2C5OB 3LBXA 1S94A 2AXDS 5J0ZA 4YSZA 4ZI3D 3GTMS 5AQHB 1HNXT 2W99A 2PJQA 3RIAA 2CYZB 3M65A 2M6IA 3VRBA 3L8RA 1CHUA 3VYHB 2X66A 1H4LD 3UU3A 1HNZT 4H9SE 2X51A 2UU9T 3FZFB 3CPZA 1OL1B 4X66T 3B57A 3N5LA 4H63V 4PAGA 4KRDB 5CA1E 3F57A 1GQEA 3TLSA 3R6NA 5FNVE 5JVDE 3GA8A 2R7GA 5JR9A 2W2HA 3C50A 2XQ6A 2LEHA 3ZMZB 2CWOA 4AKRB 3IEEA 3BHVB 4QWNB 4DR2T 2CEAA 3RIFA 4B3TT 4BA9A 2VURA 5AQIB 4YOZA 3P7IA 4NPPA 2NWBA 4BBSM 4JI4T 3LG7A 3QYHB 1TFBA 2XM1A 2YK0A 2XPKA 4EEDA 5L3CB 1M62A 5EJCA 4TWHA 5AQVB 4BCHB 3KINB 2BG9C 4Q25A 2UUEB 2BS3A 2ACXA 3NWIA 4HFBA 4H9PC 4DO0A 2WQYA 3ZLIA 3LK42 2C4GB 5LP6E 3CIRA 3FBZA 3KV9A 4MALA 2IC9A 3V5UA 1KFYA 1IAPA 3DTOA 2CRBA 4I4TE 3UFEA 4A98A 2DL1A 2YDRA 5HBJB 2YU1A 4F6UB 4KX6A 4H63H 3CK6A 4H9QC 5AQMB 3UUXB 1YD8G 3L39A 2WMAB 1N36T 2EHOA 3C4WA 5LGUB 1G73A 1O9KB 4O4JE 4M1PA 4F7NB 4H9OC 2W00A 1UGRB 4Z90A 4UN0A 2FJEA 1ZOYA 4TNWA 3JAFA 4U74A 2LT3A 2F2CA 1OXZA 2FUPA 2CWYA 3ZEFB 1T8BA 3POMA 3ANWB 3HO8A 4UV9B 5JREA 1IBMT 2D5UA 2V1DB 4P09A 4ERRA 3F2EA 2DNXA 4HE8A 4KHPT 1WR6A 4LMJA 2JMKA 1H25B 4ZXLA 4XBFB 2HHHT 1AJ3A 4TUYE 5AQOB 4HFDA 3ONJA 4LFBT 2BVMA 3G06A 1H24B 4TN7B 3RPUA 4MFEA 5C2TA 3K3QC 2LKGA 1Y01A 2BG9B 1UGPB 4YOOA 2ZZDB 2V7IA 4G63A 2AE9A 1O9KA 2L9QA 4ZEYA 5FGKB 4HTEA 1HX8A 1VCTA 4QH5A 4F7LB 1IJ6A 4F6RC 3P8CD 3HI2A 4X5TA 3AE7A 5L3GB 2WIHB 2L3LA 5L2WB 4JI2T 3ZMUB 2J1DG 1FIOA 3RGFB 2ZPFB 1VOMA 3BQIA 2RP4A 3UU5A 1O3XA 3AE6A 2KMFA 1D1AA 3ZKRA 5HNBB 5EZYE 3HKBE 2W2UA 3RRWA 3EIDB 2J62A 1ZP0A 4GK5E 2G0UA 4LF9T 2PFVA 2UZLB 1MIVA 3SOLA 3BHUB 3LK2B 5CFBA 1XNQT 2CCIB 4DV1T 4BJMA 4WBOA 4M6VA 3RH3A 4EOZB 2W0GA 2V5DA 4U31A 5HVYB 5HEGA 2BG9A 4CI3B 4AIUA 1H7CA 4QX7B 2NW8A 2ZPIB 2KLQA 1YKEB 2E9XD 4X1YE 2ZPBB 4BY7X 4LF4T 3AVSA 1UNGD 1U4QA 3UT5E 2D0QB 2DXBB 4Y72B 4B6XA 2W63A 3EABA 3BLHB 5FL0A 2JQHA 1KK7A 5DJQC 5EFQB 1NWMX 2P9BA 1IBKT 2RPAA 1JNZA 1ZKEA 2W61A 1FMVA 1VRBA 4KHZF 3J9X1 1BR4A 2CE7A 3CMLA 1T98A 2E5VA 2MBGA 2LW4A 1SHZC 2I53A 2LSKA 5AQPB 3AECA 3P4WA 2BPMB 4CRLB 4HGAA 3RYFE 5IF1B 2W9FA 4UXNB 1GUXB 1OI9B 4U72A 3OKQA 1W9RA 2DPPB 4ILAA 3DDQB 3ZC1A 4F6SB 4CI1B 5H6QB 3O0GD 5ACBA 4F7SB 1KNRA 4ILCA 4IDOA 4DR3T 2VKHA 2WZHA 4HWHA 4HNVA 4PK4A 4YHJA 3RKGA 4CQIA 4OYJA 2V5CA 3VRAA 2VVNA 1JSTB 1XDPA 5C3JA 4MFRA 3AE2A 3PE0A 4U2YA 5JQGE 1VYWB 3RQUA 2KR6A 3BLRB 4K0KT 2C0SA 4AKIA 2DXCB 3ETVA 2IVXA 4O4LE 1GY3B 1MNEA 4H9NC 4C90A 1XZYA 4K0UA 3B5MA 3TN8B 3LSVA 5AQSB 3N2OA 4IL4A 5DQVA 3Q5XA 5AQUB 4BBRM 2E9XB 1EZ3A 2W67A 5LHIB 3UULA 1MMGA 4AISA 5KX5E 1OIUB 2KWIB 1XMOT 5JTGA 3OTOT 1XMQT 1UURA 1US7B 2W96A 5FP3A 2IW6B 3RC3A 3P4QA 2XM2A 4JLEA 3UU6A 2DD5B 2WIPB 1OEDE 4MFDA 3ZYLA 3A8OB 4CXAB 5JDNA 3UUBA 3UQ7A 4ASKA 4ZOLE 3WI3A 2MPKA 1X9BA 3M03A 1DU2A 4CFUD 2MAWA 4OFZA 3QB5K 3J7Yq 4JX6A 1SE7A 1IBLT 2YOEA 3ZJ2A 3C64A 4JI3T 3RLFF 4CXWA 1YQ3A 3TKLB 1L0VA 1MIWA 4O4HE 3BLQB 5HEJA 5ICPB 2MYSA 2VKDA 5LA6E 2CHNA 3I1AA 5F5WA 3D0TA 3SFDA 3X24B 3X1DA 1WCRA 2OLTA 3QXEB 4HWCA 5CJ5A 4II5B 4DV2T 2MTQA 1LKXA 3HL6A 3FZMB 5M4YA 2C5IT 2LLYA 2CZ7B 2E8IA 2XASB 3ONLC 3UU4A 3E08A 2WXVB 1OIYB 3AE4A 2LM2A 1XNRT 4TWDA 2HPJA 3ZT5A 2Q9QC 1I94T 4U7IA 4EV6A 2CMRA 1JSUB 2FJBA 2KXPB 3KV4A 1KEYA 2LM9A 2XTLA 5L47A 3X20B 2SPCA 5KDMC 3HKCE 3LBXB 4RODA 3T1YT 4IDQA 3CVRA 4AI6A 3A8MB 3MK7C 2V7LA 4KI0F 4PJMA 2VQFT 4TWFA 2NTYA 1YW0A 2BKZB 2EUFA 3KVBA 3K8PC 4CFUB 5LBQB 2IHR1 1T72A 2EHOD 2HH7A 3P4RA 3MACA 1D1BA 5AQQB 4X1IE 2I0MA 2LKHA
chains in the Genus database with same CATH topology
4I4TE 3UFEA 5JDHA 2YEVC 5JH7E 2JPFA 2L8KA 4IE7A 2W62A 4EZ4A 2YU1A 1HCIA 3AA1B 2KT9A 3FB2A 4UIGA 3FBLA 4ZI7E 4L9IA 4H63H 1Y64B 3ESLA 1HF8A 4H9QC 3UUXB 1YD8G 4MLKA 2N1GA 2XAFB 2H7OA 4YLHA 4KMCA 2IC6A 2PG8A 2EHOA 3C4WA 3C4XA 2D0TA 2E9XC 3LFMA 5LGUB 2XUEA 2WMNA 5JDFA 3RKOA 3NRXA 1G73A 5DQWA 2X67A 4O4JE 4M1PA 3PUGA 4QKNA 4H9OC 2W00A 1E1HB 4GYSA 4QXHB 4A56A 2OA5A 4FJOA 3JC6C 3AB3B 3JC6D 4CI2B 4U74A 1D0YA 2I59A 2LT3A 1OXZA 2NTXA 2CWYA 2JMHA 4H9RC 1BR1A 3KFWX 4NUUA 1IJ5A 4WW0A 3ZEFB 5L3DB 4UV9B 3ANWB 1YKHB 3AA6B 2V7MA 1HG2A 5JREA 3C98B 2V26A 2D5UA 2V1DB 4P09A 2QA7A 4BAYB 4ERRA 3F2EA 5ETWA 2DNXA 2K48A 4HE8A 5EK4A 2ES0A 2H7VC 3ETUA 4YFSA 2LSJA 2PBIA 1WR6A 1Z0PA 3HKDE 2JMKA 4UF0B 3AVRA 3PDYA 4PK5A 3PUAA 4O2BE 4XBFB 3PU3A 4HFVA 4YJ3E 2XQYA 1AJ3A 4TUYE 2X9HA 5LBMA 4O8SA 2BVMA 3B13A 4TN7B 3RPUA 4CZZB 4P0BA 4IE6A 2KWHA 3MA9A 1QUUA 3K3QC 2X0LB 2X68A 2BVLA 3AAIA 3I0OA 4TV9E 4KUMB 4CXXA 3OYXA 2Q9QD 3L09A 2V7IA 5EK3A 4G63A 4ADZA 4DVDA 4ZS3A 2X9YA 3HKEE 2EHOB 2L9QA 3DJBA 5JRCA 3SS1A 5J2TE 2WSSV 4QX8B 2LSIA 1HX8A 4HTEA 5HXRA 3MKDA 2CXLA 3C51A 1IJ6A 3Q9DA 4F6RC 3P8CD 3HI2A 3VU7H 5LXTE 5L3GB 5LJMA 4E7SA 2L3LA 3CKDA 5LYJE 3ZMUB 3MZKB 4AQFA 4EB6E 4E7ZA 5FY0A 2J1DG 1FIOA 2NP9A 3PUSA 1VOMA 2HPLA 3BQIA 1BR0A 3N2GE 4IHJE 2RP4A 3ZN1B 3BQKA 1O3XA 1MNDA 2KMFA 3LJCA 4UVAB 1D1AA 5FXXA 5FXVA 2Q9QA 1NAFA 4V1Av 2WBLA 3ZYKA 1MMNA 1FMWA 5EZYE 4J2CA 3HKBE 1OWAA 3RRWA 3MJXA 4EZHA 2XHEB 4GK5E 2G0UA 3KDSE 2VKJA 4UVBB 4X20E 3RX6A 2PFVA 5L3EB 2NOXA 3CQXC 1MIVA 4UEMA 3KVAA 3N9OA 3SOLA 5L3FB 1ZEEA 1G8XA 3LK2B 3RYIE 3NZQA 5HXEA 4PNIA 5KMGP 3ZC0A 3QC9A 5HXSA 2JJ9A 5HWYA 4AXPA 4BJMA 1WRDA 4ISTA 4WBOA 3RH3A 4EOZB 2W0GA 4EIWA 3VHLA 4CI3B 5FY1A 5TAOA 4QXBB 3CX7B 3I9WA 1FEWA 1H7CA 4QX7B 2WMOA 2LHRA 2NW8A 3NZPA 4DBRA 5JDLA 2KLQA 4HN9A 1YKEB 2E9XD 4X1YE 3WAJA 4IIJE 3O4XE 3C4ZA 3NRYA 4AQGA 4ZI2C 2ZM0A 3AVSA 2DCFA 2MOZA 2LJLA 5JRCB 1U4QA 3UT5E 3RRCA 3O1HA 2QGSA 4B6XA 2W63A 3SRZA 2A2FX 5L2LA 1KK7A 5DJQC 1NWMX 5IHYA 4QXCB 2P9BA 2M67A 4DMVA 2LOPA 1ZKEA 2W61A 2UXXB 1FMVA 3F31A 3MXZA 1VRBA 5LNKA 5FY7A 2CXFA 2ODUA 3I9YA 3J9X1 4I50E 1BR4A 2CE7A 3CMLA 3OJAA 3OBVE 1T98A 4EYUA 2MBGA 1SHZC 3ZCJA 2LSKA 2N2NA 3H3AA 2H3RA 2JQQA 2YINA 2ZLYA 4TV8E 2Q9QB 5IYZE 4EYYR 4PK6A 4HGAA 3RYFE 2E9XA 1UX4A 2KZ7B 3PURA 3GWHA 4ZI3C 4UXNB 5JR9C 3ZMVB 4KP3C 4WNKA 5CB4E 4U72A 3IBPA 4WBNE 1WLXA 2UXNB 3OKQA 4MHCA 2CA5A 2DHRA 5DABA 4DBQA 2DLRA 3ZC1A 3AAEB 4ISSA 4CI1B 5H6QB 3K3NA 4FI5A 4PFOA 4IGUA 3O1IA 1MMDA 1S35A 1WYCA 2VKHA 2VWAA 3VKHA 1LVKA 1SA0E 1B7TA 2Y8DA 5CA0E 2X9WA 3QK6A 3KV5A 2VL8A 3O9XA 2IW5B 2C5JA 4PK4A 2WM9A 4IE4A 4YHJA 2XAQB 3ZMTB 2VK9A 3AA7B 4TX5A 4CQIA 1D0ZA 4OYJA 3SWHA 2YU2A 4NUVA 4C91A 4PJLA 2DI4A 1UCUA 5FXZA 3DP7A 4QHOA 4MFRA 1HFAA 2NW9A 1MMAA 4IE5A 3PE0A 5HYAA 3PTRB 1HTJF 3W15B 3A5XA 3E22E 5JQGE 3FXEB 3CX8B 2KNDA 3O1JA 2IAKA 3AAAB 4P0AA 4UELA 2C0SA 3N9QA 4DNDA 4AKIA 3ETVA 3N9PA 4L5GA 2WAUA 2X9XA 5LG4A 5JDGA 4O4LE 1MNEA 4H9NC 4C90A 1D1CA 4K0UA 4AKGA 3PUQA 2CCQA 4GK0E 3N2OA 4KBMB 2Z6EA 5DQVA 4I43B 5HXCA 3Q5XA 3HA4A 5F8PA 4DMWA 5FYMA 2E9XB 3ZJ1A 1ZHCA 2LHNA 1EZ3A 4GOUA 5LHIB 3N2KE 5HAXA 3UULA 1MMGA 5KX5E 3Q5WA 5L3BB 2KWIB 4PJNA 2K9AA 5JDQA 1X79A 5LHGB 3ZN0B 5LHHB 1US7B 2VKOA 4JEUB 2BDEA 2EHOC 2K5BB 3CX6B 3HR0A 5FP3A 3RC3A 3N9MA 4YJ2E 1LVFA 4JLEA 3RC8A 3T8OA 4G2AA 3AA0B 3U3IA 3Q2MA 1HG5A 3ZYLA 3I0QA 2Y6XA 1LRZA 3GN5B 3R84B 3KV6A 2XAHB 5FXWA 2CXDA 2D0UA 2ZM2A 3UUNA 4X1KE 3L3PA 4ZS2A 4EXTA 2XAJB 4ZI2D 5JDNA 5GONE 4ASKA 2RA1A 2DWKA 4JEHB 4ZOLE 2ZM8A 4PJJA 3WI3A 5JR9B 3LK3B 1KNZA 2B1EA 2LSYA 5A1LA 2NW7A 3ZCIA 4PFPA 2DWGA 4I55E 2CLYC 3EVYA 4OFZA 1CUNA 3J7Yq 4OK0A 4Z8XA 2Y48B 3EDVA 3IHRA 1V9DA 1IZNB 3ZJ2A 3N9LA 3C64A 4IE0A 2A72A 5JDMA 2N9DA 3BQLA 3FXDB 4CXWA 5AFUL 3EUHA 3LBXA 3CWZB 1S94A 3TKLB 1HS7A 1MIWA 1MIYA 3ONXA 4O4HE 5C8YE 2VB6A 4BJNA 3UUMA 4ZI3D 2K24A 2MYSA 2VKDA 5LA6E 2PJQA 4EAHA 3I1AA 5ADXL 3D0TA 4GIWA 3M65A 5HXHA 3RYHE 4PW8A 2C5KT 1QSDA 1BR2A 3KBTA 3QUJA 2X66A 3FHNA 4H9SE 2MTQA 1LKXA 3HL6A 4L0RA 2X51A 4UVCB 2CM0A 5BMVE 3CPZA 3B57A 4CXYA 3N5LA 5M4YA 2C5IT 4H63V 4MBQA 4PAGA 2E8IA 3GN5A 2XASB 3VKGA 1ZV4X 5CA1E 3F57A 5J1GA 3R6NA 5LJNA 5E0OA 4AQFC 5FNVE 5JVDE 3GA8A 2LSGA 3E08A 4OHFA 5JR9A 3C50A 3EDUA 3N9NA 1UX5A 2LEHA 4AKLA 5LOVE 3H37A 4HEAA 3ZMZB 4N78D 3ZMSB 2HPJA 2CWOA 2V7JA 4AKRB 2Q9QC 3IEEA 4QWNB 4XZCA 4AKHA 2VASA 4O4IE 2CEAA 3NBXX 4BA9A 2XAGB 3OYZA 2CMRA 2KXPB 4TZ4C 5J2UE 2ZMAA 3KV4A 3P7IA 3E0ZA 2NWBA 2LM9A 2XTLA 3K3OA 3CQCB 3BK9A 2SPCA 2ODVA 3LG7A 3UTKA 5KDMC 3KBUA 3HKCE 5LGNB 5LCYA 2YK0A 3LBXB 5FMNA 4ILUA 5HWXA 3CVRA 2BZBA 4AI6A 2D2SA 2A3DA 3S4UA 2GK9A 3MK7C 4OYKA 2V7LA 5L3CB 4IDZA 4JUYA 4PJMA 3ANWA 3GMIA 4O2AE 2NTYA 3KINB 2JRKA 1YW0A 4ZHQE 4GYRA 5F3JA 2ACXA 4DO0A 2KINB 4H9PC 5LGTB 3KVBA 3K8PC 3IF8B 3CQGB 3ZPOA 5LBQB 2CLYB 4UV8B 3RYCE 3ZLIA 1D0XA 2EHOD 1WYBA 3LK42 1U5PA 4UF0A 5LP6E 5EK2A 3V5SA 2HH7A 3WAKA 3FBZA 3KV9A 2LOSA 2WWUA 4HKAA 3MACA 4MALA 3PU8A 3U78A 4ANJA 1D1BA 2V7KA 4XAXB 2IC9A 3ZYMA 4X1IE 3V5UA 2LE8A 1IAPA 5H6RB 3DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJB A;  2QGS A;  5IHY A;  2PJQ A;  5DQW A;  5DQV A;  3DTO A;  3B57 A; 
#chains in the Genus database with same CATH topology
 5JH7 E;  4U3C A;  2JPF A;  4IE7 A;  4HWI B;  4EZ4 A;  3AA1 B;  4UIG A;  3FB2 A;  1HF8 A;  3QZ9 B;  2N1G A;  4EON B;  2XAF B;  2XSA A;  2IC6 A;  2PG8 A;  3C4X A;  1HNW T;  1H1R B;  5JDF A;  4OX9 T;  5AQT B;  3PUG A;  2XQ5 A;  4QKN A;  3H4C A;  4F8H A;  5AQJ B;  1PKD B;  1UGO A;  2QYW A;  1D0Y A;  2I59 A;  2JMH A;  5L3D B;  1BR1 A;  1IJ5 A;  2QRX A;  3NVO A;  4DV4 T;  2QA7 A;  4P1N A;  2K48 A;  4B3M T;  2PBI A;  1UGS B;  1FKM A;  3A8Y C;  4OB2 B;  4HFH A;  1W0A A;  4YJ3 E;  2XQY A;  4BXX X;  5LQF B;  4LMK A;  4TTH A;  3WVD B;  3B13 A;  2BS2 A;  4CZZ B;  1NEN A;  3AE3 A;  2KWH A;  2X68 A;  1W09 A;  4YY3 T;  4KUM B;  4CXX A;  3OYX A;  3TLT A;  4ZS3 A;  2X9Y A;  2EHO B;  3LQ5 B;  3DJB A;  5JRC A;  5HEU A;  1W0B A;  4QX8 B;  5HXR A;  3MKD A;  2CXL A;  2CPT A;  3VU7 H;  4F70 B;  4CFV B;  3P4S A;  4BY1 X;  4EB6 E;  4E7Z A;  5ABF B;  1BU2 A;  1BR0 A;  3N2G E;  4IHJ E;  3ZN1 B;  4LF8 T;  3BQK A;  3LJC A;  2Q9Q A;  4V1A v;  2WBL A;  1MMN A;  4BCQ B;  4YSY A;  4J2C A;  3MJX A;  2WP9 A;  2VKJ A;  2XSB A;  2X1N B;  4GKJ T;  3K7A M;  2NOX A;  3CQX C;  4UEM A;  4GKK T;  3QYB A;  3RYI E;  4JX5 A;  4CFN B;  3ZC0 A;  3QC9 A;  2BBH A;  2V6X A;  1VIN A;  5IDN B;  5FY1 A;  2IW9 B;  4CN4 A;  1FEW A;  1KNP A;  2WMO A;  2LHR A;  3NZP A;  4DBR A;  3H3M A;  2WJ9 A;  3WAJ A;  4YC3 B;  4IIJ E;  4AQG A;  5I5Z B;  2V6Y B;  2LJL A;  3RRC A;  3QB5 A;  3X25 B;  4JV5 T;  5L2L A;  2QQ8 A;  4QXC B;  5IDP B;  5ABF A;  2M67 A;  2J4G A;  2LOP A;  2WB5 A;  2CXF A;  1J5W A;  3I9Y A;  3ZCJ A;  2ZLY A;  2PTF A;  1UX4 A;  3Q5D A;  3MY1 B;  1E7P A;  4WBN E;  2DLR A;  3RHW A;  4ISS A;  3RGL A;  3K3N A;  1XWM A;  4FI5 A;  5AQK B;  1VOL A;  4IGU A;  4BCF B;  3HBL A;  1MMD A;  2XQA A;  1WYC A;  2VWA A;  1B7T A;  5KXJ A;  1IRE B;  5HCM A;  2Y8D A;  4QSH A;  4IDP A;  5IWA T;  4HLQ A;  2XAQ B;  3ZMT B;  4TX5 A;  2V6Y A;  1UCU A;  3DP7 A;  3TNW B;  3E22 E;  2G77 A;  4AQY T;  4P0A A;  3AEB A;  2FJD A;  1NEK A;  2YKS A;  2YDS A;  1HR0 T;  4JX4 A;  1P5E B;  2CCQ A;  2Z6E A;  5LMK B;  5HXC A;  5F8P A;  3HA4 A;  4DMW A;  5FYM A;  1ZHC A;  2LHN A;  5L4H A;  3OVU A;  3QWL A;  2QF7 A;  4HL4 A;  2K9A A;  1X79 A;  3TLU A;  1AD6 A;  1UNH D;  3HR0 A;  2BDE A;  4ELL A;  3CX6 B;  3N9M A;  5HBH B;  4G2A A;  5ABH A;  3Q2M A;  4BCK B;  3I0Q A;  1LRZ A;  3RI5 A;  5CYI B;  3GN5 B;  2XAH B;  3UUN A;  4X1K E;  3L3P A;  4ZS2 A;  5GON E;  2DWK A;  4PJJ A;  5A1L A;  2NW7 A;  3WVE B;  4I55 E;  2CLY C;  3EVY A;  3NKZ A;  3EDV A;  5FKY A;  4DV3 T;  3BG3 A;  2BBJ A;  2WU5 A;  4JI1 T;  2N9D A;  3BQL A;  2K3W A;  4ELJ A;  2ACZ A;  3CWZ B;  1MIY A;  5C8Y E;  2VB6 A;  4BJN A;  2K24 A;  4EAH A;  5ADX L;  4GIW A;  2WCA A;  3RYH E;  4PW8 A;  2C5K T;  1E9H B;  4QH1 A;  4IMY B;  3FHN A;  4L0R A;  5BMV E;  4EOS B;  4CXY A;  4IL9 A;  1OKV B;  4X62 T;  4MBQ A;  3GN5 A;  3VKG A;  1ZV4 X;  5IUX A;  5J1G A;  5LJN A;  5E0O A;  4AQF C;  2X0Y A;  2R6G F;  1ZP2 A;  3G33 B;  1UGQ B;  3EDU A;  3N9N A;  4TNV A;  3QHW B;  4AKL A;  4NXN T;  3H37 A;  4LFA T;  4HEA A;  1N34 T;  1FIN B;  3ZMS B;  2V7J A;  2M6B A;  2VAS A;  3NBX X;  2XAG B;  1FVV B;  2UUC T;  5J2U E;  4DV0 T;  2C5X B;  3E0Z A;  4U7Y A;  3K3O A;  5AQL B;  3AEA A;  2HN1 A;  3BK9 A;  4X64 T;  5LGN B;  2XY8 B;  2BZB A;  2A3D A;  2FBW A;  4X65 T;  3TLV A;  3UU8 A;  4JUY A;  3GMI A;  4O2A E;  4ZHQ E;  3PJA A;  4QH4 A;  5LGT B;  4EOM B;  1N32 T;  1W98 B;  3CQG B;  3IF8 B;  3MI9 B;  2CLY B;  4EOI B;  2X0H A;  3JAD A;  4HWF A;  3M3Z B;  3IA3 A;  1U5P A;  4UF0 A;  4UR9 A;  3JAE A;  3V5S A;  3WAK A;  4HKA A;  4XAX B;  4HFC A;  4ROC A;  4LML A;  3ZYM A;  2IUB A;  3AE5 A;  2LE8 A;  4LOC A;  2YEV C;  4DR5 T;  4YOS A;  2L8K A;  4LF5 T;  2KT9 A;  3FBL A;  1JOW A;  4ZI7 E;  4L9I A;  4I3Z B;  1Y64 B;  3EJ1 B;  4MLK A;  3AEE A;  2H7O A;  4YLH A;  4KMC A;  2D0T A;  4JI6 T;  3LFM A;  1J5E T;  1UK5 A;  2XUE A;  5LG3 A;  2WMN A;  1J1J A;  3RKO A;  3P4P A;  3QNU A;  1XO2 A;  2B9R A;  2KMG A;  2W4X A;  2OA5 A;  1N33 T;  4CI2 B;  2QVA A;  2WMB B;  4H9R C;  1OGU B;  4OB3 B;  4EOK B;  3AA6 B;  2BKN A;  3C98 B;  3QYE A;  1V29 B;  2JGZ B;  3HB9 A;  4BAY B;  4CFX B;  4I0U A;  2ES0 A;  2H7V C;  3ETU A;  4YFS A;  2LSJ A;  1Z0P A;  3AVR A;  2G9X B;  3AEG A;  3PUA A;  4O2B E;  4LF7 T;  3PU3 A;  2X9H A;  5LBM A;  3F5X B;  1KF6 A;  1OED C;  2LRK A;  4P0B A;  3MA9 A;  1QUU A;  2X0L B;  3LDQ B;  2BVL A;  3T1H T;  2I40 B;  3AAI A;  3I0O A;  2IIU A;  2Q9Q D;  2CZ0 B;  4ADZ A;  2FJA A;  1GH6 B;  3SS1 A;  5J2T E;  4IT4 A;  3C51 A;  2CBJ A;  4DUY T;  5LYJ E;  4AQF A;  3MZK B;  4JI0 T;  4Z6Y A;  2JIW A;  3PUS A;  3KHI A;  2HPL A;  3RQW A;  3EOC B;  5AQF B;  4BCM D;  5FXX A;  5LMU T;  3NDQ A;  2XHE B;  2WDQ A;  3KDS E;  2XQ3 A;  4UVB B;  4X20 E;  5L3E B;  1D3U B;  1XDO A;  2QFZ A;  3KVA A;  3N9O A;  1ZEE A;  1G8X A;  4F6W B;  3PV0 F;  3NZQ A;  4PNI A;  5KMG P;  1WFD A;  4NIQ A;  2JJ9 A;  5HWY A;  4AXP A;  1WRD A;  4IST A;  5ABG A;  2BS4 A;  1T7S A;  2C5V B;  3ZT7 A;  4QXB B;  4BCQ D;  4BCJ B;  1UUS A;  3VR8 A;  3Q5E A;  1QMZ B;  4HN9 A;  4ZGD B;  3O4X E;  3NRY A;  4ZI2 C;  2ZM0 A;  5JRC B;  3RIU C;  3O1H A;  4HNU A;  2A2F X;  1H27 B;  4ZZB A;  5IHY A;  4U33 A;  4EOQ B;  4DMV A;  4EOL B;  5FY7 A;  2XQ7 A;  4I50 E;  3OJA A;  4EYU A;  3OBV E;  4ROE A;  3H3A A;  2H3R A;  2JQQ A;  3AE1 A;  2YIN A;  4TV8 E;  2BG9 E;  2Q9Q B;  5HEO A;  5IYZ E;  4CN6 A;  5CEI B;  1E2A A;  2C6T B;  2KZ7 B;  3GWH A;  4ZI3 C;  3QHR B;  3ZMV B;  5CB4 E;  2CHO A;  3IBP A;  1WLX A;  2UXN B;  4MHC A;  2CA5 A;  1JNR A;  5DAB A;  3AAE B;  4A5X A;  3ZST A;  3A7M A;  4YSX A;  2A9U A;  5CGM A;  3O1I A;  3VKH A;  1SA0 E;  3VYG B;  5CA0 E;  3QK6 A;  3KV5 A;  2VL8 A;  3O9X A;  2KSR A;  4BCM B;  4YXD A;  4IE4 A;  2VK9 A;  3SWH A;  4C91 A;  3PUV F;  2DI4 A;  3JCF A;  5FXZ A;  4QHO A;  2NW9 A;  3QOF A;  1MMA A;  4IE5 A;  5HYA A;  1HTJ F;  3W15 B;  3EHZ A;  3DL1 A;  3FZL B;  3FXE B;  3CX8 B;  2KND A;  1OED A;  3N9P A;  4L5G A;  2WAU A;  5JDG A;  3DOG B;  2ZM6 T;  4DR7 T;  3OPC A;  2WWV A;  3ZSS A;  4AKG A;  3PUQ A;  5HEH A;  4GK0 E;  4KBM B;  2H89 A;  3ABV A;  2UZE B;  3ZJ1 A;  2QDY B;  4GOU A;  1YXR A;  2CCH B;  4HWD A;  2JQK A;  4Z91 A;  2UUB T;  4PJN A;  2BKP A;  4IDN A;  4LFC T;  3PUY F;  2K5B B;  2LRL A;  2IDO B;  4YJ2 E;  2JQ9 A;  3TNH B;  3U3I A;  1HG5 A;  4IRE A;  4LF6 T;  3R84 B;  2CXD A;  2D0U A;  4DR6 T;  2XAJ B;  2RA1 A;  3A8H B;  3BG5 A;  3QZ5 B;  3LK3 B;  2B1E A;  5LMN T;  3PUX F;  2LSY A;  3P50 A;  4PFP A;  2DWG A;  1CUN A;  4OK0 A;  4Z8X A;  2Y48 B;  3IHR A;  1V9D A;  1IZN B;  4DUZ T;  4HNT A;  4IE0 A;  2A72 A;  3FXD B;  3PJA J;  1HS7 A;  3ONX A;  4DV6 T;  5AQN B;  3UUM A;  3RIU A;  4EGW A;  5HXH A;  1QSD A;  1BR2 A;  3KBT A;  5ABE A;  3X28 B;  4HFE A;  3QUJ A;  4YT0 A;  4BCP B;  4UVC B;  2CM0 A;  4DID B;  3BG9 A;  4YTM A;  4F7J B;  1C9B A;  4ILB A;  3TW6 A;  3PO3 S;  2ZPG B;  1WR0 A;  3VR9 A;  2LSG A;  4OHF A;  1UX5 A;  4WYV A;  5LOV E;  2OV9 A;  4N78 D;  4AKH A;  4XZC A;  2H88 A;  4O4I E;  1H26 B;  2ZCF B;  3PUW F;  2XQ4 A;  3OYZ A;  4TZ4 C;  2ZMA A;  4G6L B;  3TW7 A;  2DD4 B;  3CQC B;  2PMI B;  1SUM B;  2ODV A;  3UTK A;  3KBU A;  2UXD T;  5LCY A;  5FMN A;  4ILU A;  5HWX A;  2D2S A;  3S4U A;  2GK9 A;  3A8G B;  3TNI B;  4OYK A;  4IDZ A;  3ANW A;  2WY2 A;  2JRK A;  3FZK B;  4EOR B;  4GYR A;  5F3J A;  2KIN B;  2XQ9 A;  3DDP B;  3ZPO A;  3MY5 B;  4UV8 B;  3RYC E;  1D0X A;  1WYB A;  2UXC T;  1AHJ B;  4YHH T;  5EK2 A;  2VQE T;  2ZPH B;  2LOS A;  2WWU A;  3U78 A;  4ANJ A;  3PU8 A;  2V7K A;  4U2Z A;  4EOJ B;  2HN2 A;  5H6R B;  4EEB A;  5JDH A;  5FVK A;  3ZT6 A;  2VVS A;  2W62 A;  4A97 A;  2WHB B;  4JYA T;  2C5N B;  1HCI A;  1G3N C;  2IML A;  4NST B;  3ESL A;  2E9X C;  4ZGJ B;  4ZZC A;  3BHT B;  3NRX A;  5FL1 A;  5DQW A;  2X67 A;  1TD6 A;  2W66 A;  2UUA T;  1E1H B;  4GYS A;  4QXH B;  4A56 A;  4FJO A;  4BCO B;  4EC9 B;  4BCG B;  3JC6 C;  3AB3 B;  3JC6 D;  3X26 B;  1QLB A;  2NTX A;  4NUU A;  4WW0 A;  3KFW X;  1H28 B;  1N4M A;  4OB1 B;  1YKH B;  2V7M A;  1HG2 A;  1OL2 B;  2V26 A;  3AE8 A;  5ETW A;  5EK4 A;  2WDV A;  3HKD E;  4UF0 B;  5AQG B;  3PDY A;  2QDJ A;  2CJM B;  4PK5 A;  2PK9 B;  4HFV A;  4O8S A;  4B3S T;  3K1S A;  2AHJ B;  2UXB T;  4IE6 A;  4JI7 T;  4TV9 E;  2BKO A;  2IW8 B;  4CFW B;  3L09 A;  4DR1 T;  2DME A;  5EK3 A;  4EOO B;  4DVD A;  3HKE E;  3PUZ F;  2WEV B;  5L4E A;  2CZ1 B;  3AEF A;  2WSS V;  2LSI A;  3Q9D A;  5LXT E;  4WZX A;  5LJM A;  4E7S A;  3CKD A;  2NR4 A;  5FY0 A;  2W9Z A;  2NP9 A;  1ENW A;  1YQ4 A;  2IN3 A;  2YN6 A;  4EC8 B;  5AQR B;  1MND A;  4HFI A;  4UVA B;  5FXV A;  4DR4 T;  1NAF A;  3EAM A;  3ZYK A;  1FMW A;  1OWA A;  1FJG T;  4EZH A;  1GUX A;  2V8S V;  5FVL A;  3RX6 A;  2UZB B;  3QYG B;  5L3F B;  1R8I A;  4CFM B;  5HXE A;  4MIM A;  5HXS A;  2WFY B;  4EIW A;  3VHL A;  2E5L T;  1H1Q B;  5TAO A;  1OKW B;  3CX7 B;  3I9W A;  4CN1 A;  2I6H A;  2XJ7 A;  5JDL A;  1Z8U A;  2V22 B;  2XQ8 A;  2YDQ A;  3C4Z A;  2DCF A;  2MOZ A;  2J47 A;  2QGS A;  4NXM T;  3SRZ A;  3SFE A;  4YTN A;  5LNK A;  2UXX B;  3F31 A;  3MXZ A;  4BCN D;  2ODU A;  1KXU A;  2B76 A;  1H1S B;  5LB7 B;  2N2N A;  4EOP B;  4DV5 T;  2WDR A;  4EYY R;  4PK6 A;  1I6Z A;  2E9X A;  2WZI A;  3PUR A;  4OGR B;  2WPA B;  5JR9 C;  4KP3 C;  4WNK A;  2D9D A;  2DHR A;  4DBQ A;  4OR5 B;  3HZJ A;  3UFG A;  5HQ0 B;  4PFO A;  1S35 A;  3AXJ B;  1LVK A;  2E2A A;  2X9W A;  2IW5 B;  2C5J A;  4FX3 B;  4OB0 B;  2WM9 A;  1UNL D;  3AA7 B;  4KRC B;  1D0Z A;  1H1P B;  2YU2 A;  4NUV A;  1JKW A;  3AE9 A;  4PJL A;  5HCJ A;  5BR8 T;  3TLW A;  2PK2 A;  5HBE B;  5BNJ B;  1HFA A;  2F4V T;  3PTR B;  3A5X A;  4YTP A;  3O1J A;  2IAK A;  3AAA B;  1M7K A;  4UEL A;  4DV7 T;  3N9Q A;  4DND A;  2X9X A;  5LG4 A;  3RF1 A;  1D1C A;  2ZPE B;  4JI5 T;  2PHG A;  4I43 B;  2CZ6 B;  3MIA B;  2CBI A;  4JI8 T;  4BCI B;  1VCS A;  3N2K E;  5HAX A;  3Q5W A;  5L3B B;  3UQ4 A;  3HHT B;  2VL0 A;  5JDQ A;  5LHG B;  3ZN0 B;  4FM4 B;  5LHH B;  2VKO A;  3AXJ A;  3A8L B;  4JEU B;  2EHO C;  1AIS B;  2WS3 A;  1LVF A;  4B3R T;  3RC8 A;  3T8O A;  4BCN B;  3AA0 B;  2Y6X A;  1URC B;  3KV6 A;  5FXW A;  2XZE A;  2ZM2 A;  2UZD B;  4ZGE B;  4JBW F;  1HX1 B;  4EXT A;  4ZI2 D;  4JEH B;  3AED A;  2ZM8 A;  5JR9 B;  1KNZ A;  4NC6 A;  3FZH B;  3ZCI A;  3EI0 A;  3N9L A;  1OED B;  5JDM A;  4COF A;  1F5Q B;  5AFU L;  2WU2 A;  3EUH A;  2C5O B;  3LBX A;  1S94 A;  2AXD S;  5J0Z A;  4YSZ A;  4ZI3 D;  3GTM S;  5AQH B;  1HNX T;  2W99 A;  2PJQ A;  3RIA A;  2CYZ B;  3M65 A;  2M6I A;  3VRB A;  3L8R A;  1CHU A;  3VYH B;  2X66 A;  1H4L D;  3UU3 A;  1HNZ T;  4H9S E;  2X51 A;  2UU9 T;  3FZF B;  3CPZ A;  1OL1 B;  4X66 T;  3B57 A;  3N5L A;  4H63 V;  4PAG A;  4KRD B;  5CA1 E;  3F57 A;  1GQE A;  3TLS A;  3R6N A;  5FNV E;  5JVD E;  3GA8 A;  2R7G A;  5JR9 A;  2W2H A;  3C50 A;  2XQ6 A;  2LEH A;  3ZMZ B;  2CWO A;  4AKR B;  3IEE A;  3BHV B;  4QWN B;  4DR2 T;  2CEA A;  3RIF A;  4B3T T;  4BA9 A;  2VUR A;  5AQI B;  4YOZ A;  3P7I A;  4NPP A;  2NWB A;  4BBS M;  4JI4 T;  3LG7 A;  3QYH B;  1TFB A;  2XM1 A;  2YK0 A;  2XPK A;  4EED A;  5L3C B;  1M62 A;  5EJC A;  4TWH A;  5AQV B;  4BCH B;  3KIN B;  2BG9 C;  4Q25 A;  2UUE B;  2BS3 A;  2ACX A;  3NWI A;  4HFB A;  4H9P C;  4DO0 A;  2WQY A;  3ZLI A;  3LK4 2;  2C4G B;  5LP6 E;  3CIR A;  3FBZ A;  3KV9 A;  4MAL A;  2IC9 A;  3V5U A;  1KFY A;  1IAP A;  3DTO A;  2CRB A;  4I4T E;  3UFE A;  4A98 A;  2DL1 A;  2YDR A;  5HBJ B;  2YU1 A;  4F6U B;  4KX6 A;  4H63 H;  3CK6 A;  4H9Q C;  5AQM B;  3UUX B;  1YD8 G;  3L39 A;  2WMA B;  1N36 T;  2EHO A;  3C4W A;  5LGU B;  1G73 A;  1O9K B;  4O4J E;  4M1P A;  4F7N B;  4H9O C;  2W00 A;  1UGR B;  4Z90 A;  4UN0 A;  2FJE A;  1ZOY A;  4TNW A;  3JAF A;  4U74 A;  2LT3 A;  2F2C A;  1OXZ A;  2FUP A;  2CWY A;  3ZEF B;  1T8B A;  3POM A;  3ANW B;  3HO8 A;  4UV9 B;  5JRE A;  1IBM T;  2D5U A;  2V1D B;  4P09 A;  4ERR A;  3F2E A;  2DNX A;  4HE8 A;  4KHP T;  1WR6 A;  4LMJ A;  2JMK A;  1H25 B;  4ZXL A;  4XBF B;  2HHH T;  1AJ3 A;  4TUY E;  5AQO B;  4HFD A;  3ONJ A;  4LFB T;  2BVM A;  3G06 A;  1H24 B;  4TN7 B;  3RPU A;  4MFE A;  5C2T A;  3K3Q C;  2LKG A;  1Y01 A;  2BG9 B;  1UGP B;  4YOO A;  2ZZD B;  2V7I A;  4G63 A;  2AE9 A;  1O9K A;  2L9Q A;  4ZEY A;  5FGK B;  4HTE A;  1HX8 A;  1VCT A;  4QH5 A;  4F7L B;  1IJ6 A;  4F6R C;  3P8C D;  3HI2 A;  4X5T A;  3AE7 A;  5L3G B;  2WIH B;  2L3L A;  5L2W B;  4JI2 T;  3ZMU B;  2J1D G;  1FIO A;  3RGF B;  2ZPF B;  1VOM A;  3BQI A;  2RP4 A;  3UU5 A;  1O3X A;  3AE6 A;  2KMF A;  1D1A A;  3ZKR A;  5HNB B;  5EZY E;  3HKB E;  2W2U A;  3RRW A;  3EID B;  2J62 A;  1ZP0 A;  4GK5 E;  2G0U A;  4LF9 T;  2PFV A;  2UZL B;  1MIV A;  3SOL A;  3BHU B;  3LK2 B;  5CFB A;  1XNQ T;  2CCI B;  4DV1 T;  4BJM A;  4WBO A;  4M6V A;  3RH3 A;  4EOZ B;  2W0G A;  2V5D A;  4U31 A;  5HVY B;  5HEG A;  2BG9 A;  4CI3 B;  4AIU A;  1H7C A;  4QX7 B;  2NW8 A;  2ZPI B;  2KLQ A;  1YKE B;  2E9X D;  4X1Y E;  2ZPB B;  4BY7 X;  4LF4 T;  3AVS A;  1UNG D;  1U4Q A;  3UT5 E;  2D0Q B;  2DXB B;  4Y72 B;  4B6X A;  2W63 A;  3EAB A;  3BLH B;  5FL0 A;  2JQH A;  1KK7 A;  5DJQ C;  5EFQ B;  1NWM X;  2P9B A;  1IBK T;  2RPA A;  1JNZ A;  1ZKE A;  2W61 A;  1FMV A;  1VRB A;  4KHZ F;  3J9X 1;  1BR4 A;  2CE7 A;  3CML A;  1T98 A;  2E5V A;  2MBG A;  2LW4 A;  1SHZ C;  2I53 A;  2LSK A;  5AQP B;  3AEC A;  3P4W A;  2BPM B;  4CRL B;  4HGA A;  3RYF E;  5IF1 B;  2W9F A;  4UXN B;  1GUX B;  1OI9 B;  4U72 A;  3OKQ A;  1W9R A;  2DPP B;  4ILA A;  3DDQ B;  3ZC1 A;  4F6S B;  4CI1 B;  5H6Q B;  3O0G D;  5ACB A;  4F7S B;  1KNR A;  4ILC A;  4IDO A;  4DR3 T;  2VKH A;  2WZH A;  4HWH A;  4HNV A;  4PK4 A;  4YHJ A;  3RKG A;  4CQI A;  4OYJ A;  2V5C A;  3VRA A;  2VVN A;  1JST B;  1XDP A;  5C3J A;  4MFR A;  3AE2 A;  3PE0 A;  4U2Y A;  5JQG E;  1VYW B;  3RQU A;  2KR6 A;  3BLR B;  4K0K T;  2C0S A;  4AKI A;  2DXC B;  3ETV A;  2IVX A;  4O4L E;  1GY3 B;  1MNE A;  4H9N C;  4C90 A;  1XZY A;  4K0U A;  3B5M A;  3TN8 B;  3LSV A;  5AQS B;  3N2O A;  4IL4 A;  5DQV A;  3Q5X A;  5AQU B;  4BBR M;  2E9X B;  1EZ3 A;  2W67 A;  5LHI B;  3UUL A;  1MMG A;  4AIS A;  5KX5 E;  1OIU B;  2KWI B;  1XMO T;  5JTG A;  3OTO T;  1XMQ T;  1UUR A;  1US7 B;  2W96 A;  5FP3 A;  2IW6 B;  3RC3 A;  3P4Q A;  2XM2 A;  4JLE A;  3UU6 A;  2DD5 B;  2WIP B;  1OED E;  4MFD A;  3ZYL A;  3A8O B;  4CXA B;  5JDN A;  3UUB A;  3UQ7 A;  4ASK A;  4ZOL E;  3WI3 A;  2MPK A;  1X9B A;  3M03 A;  1DU2 A;  4CFU D;  2MAW A;  4OFZ A;  3QB5 K;  3J7Y q;  4JX6 A;  1SE7 A;  1IBL T;  2YOE A;  3ZJ2 A;  3C64 A;  4JI3 T;  3RLF F;  4CXW A;  1YQ3 A;  3TKL B;  1L0V A;  1MIW A;  4O4H E;  3BLQ B;  5HEJ A;  5ICP B;  2MYS A;  2VKD A;  5LA6 E;  2CHN A;  3I1A A;  5F5W A;  3D0T A;  3SFD A;  3X24 B;  3X1D A;  1WCR A;  2OLT A;  3QXE B;  4HWC A;  5CJ5 A;  4II5 B;  4DV2 T;  2MTQ A;  1LKX A;  3HL6 A;  3FZM B;  5M4Y A;  2C5I T;  2LLY A;  2CZ7 B;  2E8I A;  2XAS B;  3ONL C;  3UU4 A;  3E08 A;  2WXV B;  1OIY B;  3AE4 A;  2LM2 A;  1XNR T;  4TWD A;  2HPJ A;  3ZT5 A;  2Q9Q C;  1I94 T;  4U7I A;  4EV6 A;  2CMR A;  1JSU B;  2FJB A;  2KXP B;  3KV4 A;  1KEY A;  2LM9 A;  2XTL A;  5L47 A;  3X20 B;  2SPC A;  5KDM C;  3HKC E;  3LBX B;  4ROD A;  3T1Y T;  4IDQ A;  3CVR A;  4AI6 A;  3A8M B;  3MK7 C;  2V7L A;  4KI0 F;  4PJM A;  2VQF T;  4TWF A;  2NTY A;  1YW0 A;  2BKZ B;  2EUF A;  3KVB A;  3K8P C;  4CFU B;  5LBQ B;  2IHR 1;  1T72 A;  2EHO D;  2HH7 A;  3P4R A;  3MAC A;  1D1B A;  5AQQ B;  4X1I E;  2I0M A;  2LKH A; 
#chains in the Genus database with same CATH homology
 4I4T E;  3UFE A;  5JDH A;  2YEV C;  5JH7 E;  2JPF A;  2L8K A;  4IE7 A;  2W62 A;  4EZ4 A;  2YU1 A;  1HCI A;  3AA1 B;  2KT9 A;  3FB2 A;  4UIG A;  3FBL A;  4ZI7 E;  4L9I A;  4H63 H;  1Y64 B;  3ESL A;  1HF8 A;  4H9Q C;  3UUX B;  1YD8 G;  4MLK A;  2N1G A;  2XAF B;  2H7O A;  4YLH A;  4KMC A;  2IC6 A;  2PG8 A;  2EHO A;  3C4W A;  3C4X A;  2D0T A;  2E9X C;  3LFM A;  5LGU B;  2XUE A;  2WMN A;  5JDF A;  3RKO A;  3NRX A;  1G73 A;  5DQW A;  2X67 A;  4O4J E;  4M1P A;  3PUG A;  4QKN A;  4H9O C;  2W00 A;  1E1H B;  4GYS A;  4QXH B;  4A56 A;  2OA5 A;  4FJO A;  3JC6 C;  3AB3 B;  3JC6 D;  4CI2 B;  4U74 A;  1D0Y A;  2I59 A;  2LT3 A;  1OXZ A;  2NTX A;  2CWY A;  2JMH A;  4H9R C;  1BR1 A;  3KFW X;  4NUU A;  1IJ5 A;  4WW0 A;  3ZEF B;  5L3D B;  4UV9 B;  3ANW B;  1YKH B;  3AA6 B;  2V7M A;  1HG2 A;  5JRE A;  3C98 B;  2V26 A;  2D5U A;  2V1D B;  4P09 A;  2QA7 A;  4BAY B;  4ERR A;  3F2E A;  5ETW A;  2DNX A;  2K48 A;  4HE8 A;  5EK4 A;  2ES0 A;  2H7V C;  3ETU A;  4YFS A;  2LSJ A;  2PBI A;  1WR6 A;  1Z0P A;  3HKD E;  2JMK A;  4UF0 B;  3AVR A;  3PDY A;  4PK5 A;  3PUA A;  4O2B E;  4XBF B;  3PU3 A;  4HFV A;  4YJ3 E;  2XQY A;  1AJ3 A;  4TUY E;  2X9H A;  5LBM A;  4O8S A;  2BVM A;  3B13 A;  4TN7 B;  3RPU A;  4CZZ B;  4P0B A;  4IE6 A;  2KWH A;  3MA9 A;  1QUU A;  3K3Q C;  2X0L B;  2X68 A;  2BVL A;  3AAI A;  3I0O A;  4TV9 E;  4KUM B;  4CXX A;  3OYX A;  2Q9Q D;  3L09 A;  2V7I A;  5EK3 A;  4G63 A;  4ADZ A;  4DVD A;  4ZS3 A;  2X9Y A;  3HKE E;  2EHO B;  2L9Q A;  3DJB A;  5JRC A;  3SS1 A;  5J2T E;  2WSS V;  4QX8 B;  2LSI A;  1HX8 A;  4HTE A;  5HXR A;  3MKD A;  2CXL A;  3C51 A;  1IJ6 A;  3Q9D A;  4F6R C;  3P8C D;  3HI2 A;  3VU7 H;  5LXT E;  5L3G B;  5LJM A;  4E7S A;  2L3L A;  3CKD A;  5LYJ E;  3ZMU B;  3MZK B;  4AQF A;  4EB6 E;  4E7Z A;  5FY0 A;  2J1D G;  1FIO A;  2NP9 A;  3PUS A;  1VOM A;  2HPL A;  3BQI A;  1BR0 A;  3N2G E;  4IHJ E;  2RP4 A;  3ZN1 B;  3BQK A;  1O3X A;  1MND A;  2KMF A;  3LJC A;  4UVA B;  1D1A A;  5FXX A;  5FXV A;  2Q9Q A;  1NAF A;  4V1A v;  2WBL A;  3ZYK A;  1MMN A;  1FMW A;  5EZY E;  4J2C A;  3HKB E;  1OWA A;  3RRW A;  3MJX A;  4EZH A;  2XHE B;  4GK5 E;  2G0U A;  3KDS E;  2VKJ A;  4UVB B;  4X20 E;  3RX6 A;  2PFV A;  5L3E B;  2NOX A;  3CQX C;  1MIV A;  4UEM A;  3KVA A;  3N9O A;  3SOL A;  5L3F B;  1ZEE A;  1G8X A;  3LK2 B;  3RYI E;  3NZQ A;  5HXE A;  4PNI A;  5KMG P;  3ZC0 A;  3QC9 A;  5HXS A;  2JJ9 A;  5HWY A;  4AXP A;  4BJM A;  1WRD A;  4IST A;  4WBO A;  3RH3 A;  4EOZ B;  2W0G A;  4EIW A;  3VHL A;  4CI3 B;  5FY1 A;  5TAO A;  4QXB B;  3CX7 B;  3I9W A;  1FEW A;  1H7C A;  4QX7 B;  2WMO A;  2LHR A;  2NW8 A;  3NZP A;  4DBR A;  5JDL A;  2KLQ A;  4HN9 A;  1YKE B;  2E9X D;  4X1Y E;  3WAJ A;  4IIJ E;  3O4X E;  3C4Z A;  3NRY A;  4AQG A;  4ZI2 C;  2ZM0 A;  3AVS A;  2DCF A;  2MOZ A;  2LJL A;  5JRC B;  1U4Q A;  3UT5 E;  3RRC A;  3O1H A;  2QGS A;  4B6X A;  2W63 A;  3SRZ A;  2A2F X;  5L2L A;  1KK7 A;  5DJQ C;  1NWM X;  5IHY A;  4QXC B;  2P9B A;  2M67 A;  4DMV A;  2LOP A;  1ZKE A;  2W61 A;  2UXX B;  1FMV A;  3F31 A;  3MXZ A;  1VRB A;  5LNK A;  5FY7 A;  2CXF A;  2ODU A;  3I9Y A;  3J9X 1;  4I50 E;  1BR4 A;  2CE7 A;  3CML A;  3OJA A;  3OBV E;  1T98 A;  4EYU A;  2MBG A;  1SHZ C;  3ZCJ A;  2LSK A;  2N2N A;  3H3A A;  2H3R A;  2JQQ A;  2YIN A;  2ZLY A;  4TV8 E;  2Q9Q B;  5IYZ E;  4EYY R;  4PK6 A;  4HGA A;  3RYF E;  2E9X A;  1UX4 A;  2KZ7 B;  3PUR A;  3GWH A;  4ZI3 C;  4UXN B;  5JR9 C;  3ZMV B;  4KP3 C;  4WNK A;  5CB4 E;  4U72 A;  3IBP A;  4WBN E;  1WLX A;  2UXN B;  3OKQ A;  4MHC A;  2CA5 A;  2DHR A;  5DAB A;  4DBQ A;  2DLR A;  3ZC1 A;  3AAE B;  4ISS A;  4CI1 B;  5H6Q B;  3K3N A;  4FI5 A;  4PFO A;  4IGU A;  3O1I A;  1MMD A;  1S35 A;  1WYC A;  2VKH A;  2VWA A;  3VKH A;  1LVK A;  1SA0 E;  1B7T A;  2Y8D A;  5CA0 E;  2X9W A;  3QK6 A;  3KV5 A;  2VL8 A;  3O9X A;  2IW5 B;  2C5J A;  4PK4 A;  2WM9 A;  4IE4 A;  4YHJ A;  2XAQ B;  3ZMT B;  2VK9 A;  3AA7 B;  4TX5 A;  4CQI A;  1D0Z A;  4OYJ A;  3SWH A;  2YU2 A;  4NUV A;  4C91 A;  4PJL A;  2DI4 A;  1UCU A;  5FXZ A;  3DP7 A;  4QHO A;  4MFR A;  1HFA A;  2NW9 A;  1MMA A;  4IE5 A;  3PE0 A;  5HYA A;  3PTR B;  1HTJ F;  3W15 B;  3A5X A;  3E22 E;  5JQG E;  3FXE B;  3CX8 B;  2KND A;  3O1J A;  2IAK A;  3AAA B;  4P0A A;  4UEL A;  2C0S A;  3N9Q A;  4DND A;  4AKI A;  3ETV A;  3N9P A;  4L5G A;  2WAU A;  2X9X A;  5LG4 A;  5JDG A;  4O4L E;  1MNE A;  4H9N C;  4C90 A;  1D1C A;  4K0U A;  4AKG A;  3PUQ A;  2CCQ A;  4GK0 E;  3N2O A;  4KBM B;  2Z6E A;  5DQV A;  4I43 B;  5HXC A;  3Q5X A;  3HA4 A;  5F8P A;  4DMW A;  5FYM A;  2E9X B;  3ZJ1 A;  1ZHC A;  2LHN A;  1EZ3 A;  4GOU A;  5LHI B;  3N2K E;  5HAX A;  3UUL A;  1MMG A;  5KX5 E;  3Q5W A;  5L3B B;  2KWI B;  4PJN A;  2K9A A;  5JDQ A;  1X79 A;  5LHG B;  3ZN0 B;  5LHH B;  1US7 B;  2VKO A;  4JEU B;  2BDE A;  2EHO C;  2K5B B;  3CX6 B;  3HR0 A;  5FP3 A;  3RC3 A;  3N9M A;  4YJ2 E;  1LVF A;  4JLE A;  3RC8 A;  3T8O A;  4G2A A;  3AA0 B;  3U3I A;  3Q2M A;  1HG5 A;  3ZYL A;  3I0Q A;  2Y6X A;  1LRZ A;  3GN5 B;  3R84 B;  3KV6 A;  2XAH B;  5FXW A;  2CXD A;  2D0U A;  2ZM2 A;  3UUN A;  4X1K E;  3L3P A;  4ZS2 A;  4EXT A;  2XAJ B;  4ZI2 D;  5JDN A;  5GON E;  4ASK A;  2RA1 A;  2DWK A;  4JEH B;  4ZOL E;  2ZM8 A;  4PJJ A;  3WI3 A;  5JR9 B;  3LK3 B;  1KNZ A;  2B1E A;  2LSY A;  5A1L A;  2NW7 A;  3ZCI A;  4PFP A;  2DWG A;  4I55 E;  2CLY C;  3EVY A;  4OFZ A;  1CUN A;  3J7Y q;  4OK0 A;  4Z8X A;  2Y48 B;  3EDV A;  3IHR A;  1V9D A;  1IZN B;  3ZJ2 A;  3N9L A;  3C64 A;  4IE0 A;  2A72 A;  5JDM A;  2N9D A;  3BQL A;  3FXD B;  4CXW A;  5AFU L;  3EUH A;  3LBX A;  3CWZ B;  1S94 A;  3TKL B;  1HS7 A;  1MIW A;  1MIY A;  3ONX A;  4O4H E;  5C8Y E;  2VB6 A;  4BJN A;  3UUM A;  4ZI3 D;  2K24 A;  2MYS A;  2VKD A;  5LA6 E;  2PJQ A;  4EAH A;  3I1A A;  5ADX L;  3D0T A;  4GIW A;  3M65 A;  5HXH A;  3RYH E;  4PW8 A;  2C5K T;  1QSD A;  1BR2 A;  3KBT A;  3QUJ A;  2X66 A;  3FHN A;  4H9S E;  2MTQ A;  1LKX A;  3HL6 A;  4L0R A;  2X51 A;  4UVC B;  2CM0 A;  5BMV E;  3CPZ A;  3B57 A;  4CXY A;  3N5L A;  5M4Y A;  2C5I T;  4H63 V;  4MBQ A;  4PAG A;  2E8I A;  3GN5 A;  2XAS B;  3VKG A;  1ZV4 X;  5CA1 E;  3F57 A;  5J1G A;  3R6N A;  5LJN A;  5E0O A;  4AQF C;  5FNV E;  5JVD E;  3GA8 A;  2LSG A;  3E08 A;  4OHF A;  5JR9 A;  3C50 A;  3EDU A;  3N9N A;  1UX5 A;  2LEH A;  4AKL A;  5LOV E;  3H37 A;  4HEA A;  3ZMZ B;  4N78 D;  3ZMS B;  2HPJ A;  2CWO A;  2V7J A;  4AKR B;  2Q9Q C;  3IEE A;  4QWN B;  4XZC A;  4AKH A;  2VAS A;  4O4I E;  2CEA A;  3NBX X;  4BA9 A;  2XAG B;  3OYZ A;  2CMR A;  2KXP B;  4TZ4 C;  5J2U E;  2ZMA A;  3KV4 A;  3P7I A;  3E0Z A;  2NWB A;  2LM9 A;  2XTL A;  3K3O A;  3CQC B;  3BK9 A;  2SPC A;  2ODV A;  3LG7 A;  3UTK A;  5KDM C;  3KBU A;  3HKC E;  5LGN B;  5LCY A;  2YK0 A;  3LBX B;  5FMN A;  4ILU A;  5HWX A;  3CVR A;  2BZB A;  4AI6 A;  2D2S A;  2A3D A;  3S4U A;  2GK9 A;  3MK7 C;  4OYK A;  2V7L A;  5L3C B;  4IDZ A;  4JUY A;  4PJM A;  3ANW A;  3GMI A;  4O2A E;  2NTY A;  3KIN B;  2JRK A;  1YW0 A;  4ZHQ E;  4GYR A;  5F3J A;  2ACX A;  4DO0 A;  2KIN B;  4H9P C;  5LGT B;  3KVB A;  3K8P C;  3IF8 B;  3CQG B;  3ZPO A;  5LBQ B;  2CLY B;  4UV8 B;  3RYC E;  3ZLI A;  1D0X A;  2EHO D;  1WYB A;  3LK4 2;  1U5P A;  4UF0 A;  5LP6 E;  5EK2 A;  3V5S A;  2HH7 A;  3WAK A;  3FBZ A;  3KV9 A;  2LOS A;  2WWU A;  4HKA A;  3MAC A;  4MAL A;  3PU8 A;  3U78 A;  4ANJ A;  1D1B A;  2V7K A;  4XAX B;  2IC9 A;  3ZYM A;  4X1I E;  3V5U A;  2LE8 A;  1IAP A;  5H6R B;  3DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...