3DJBA

Crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
213
structure length
188
Chain Sequence
b'TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADLNESEEAGMKKVSDWLEELHVEEEESKHVLHIIANMSIEGKLVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPRDPSLNHFYEKLLKLKDLMNTNAAKQEAEVRHRYMEQFIEQFMKEWNAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, HD family
molecule tags Hydrolase
source organism Bacillus thuringiensis serovar konkukian
publication title Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114
rcsb
total genus 50
structure length 188
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 3djbA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3djbA02
3DJBA 5DQVA 5IHYA 3DTOA 2QGSA 2PJQA 5DQWA 3B57A
chains in the Genus database with same CATH superfamily
1KNRA 2YK0A 4ADZA 4RODA 5HWXA 3M65A 3ZMUB 1IBKT 3FXEB 5LBMA 4JI3T 2UXDT 3T1HT 3AA6B 1MNDA 5HNBB 5H6QB 3PUYF 4K0UA 4DR2T 5EK2A 3OPCA 3IF8B 2X0HA 1N33T 3VRAA 1NENA 4X1IE 3N9QA 4QX7B 5AQKB 4LF7T 2PTFA 3RX6A 1U5PA 1EZ3A 4ZHQE 4NXMT 1I94T 2V5CA 4YSZA 2WHBB 4CXYA 2K9AA 2CJMB 5LHGB 2IW9B 5HXEA 5L47A 4PK6A 1VCSA 1T98A 2XQ8A 2CZ6B 4OYKA 4B3RT 1OEDB 1GY3B 1KFYA 4EOMB 2EHOA 1HR0T 3U3IA 4EOJB 2XAJB 2K48A 1X79A 1J5WA 4X64T 2M6IA 5IDPB 2WMOA 4F6UB 2IDOB 3PUXF 3O9XA 4NUVA 3RQWA 1V29B 4DUYT 2WS3A 3DDPB 3A5XA 5JDNA 2ZM8A 3RRWA 2KXPB 2FJDA 4WBNE 4TNVA 5AQLB 4F6WB 3TNWB 3HBLA 2DLRA 1KEYA 4KRDB 2LT3A 1UCUA 3KVAA 3EDUA 1OEDA 2ZPIB 1IBLT 4O4HE 1W9RA 1UNLD 3X20B 2QF7A 4X1YE 5AQPB 3OBVE 4AXPA 5F8PA 2WIHB 1BU2A 3AEEA 1S94A 4EOQB 3LSVA 1H24B 1M7KA 2X0YA 4OB2B 3RIUC 4JX4A 2I0MA 4YY3T 4P1NA 2LHNA 2W96A 3CQCB 2GK9A 5LHIB 1C9BA 4CFUB 2WMBB 2X9YA 3AECA 2PHGA 3ANWA 3ZJ1A 4DR3T 2CYZB 1YQ3A 2XQ6A 4B3MT 4II5B 3ZYKA 4Z6YA 2BG9C 4M1PA 3FXDB 2J4GA 5LJNA 2LOPA 2L3LA 2BDEA 1N34T 2V6YB 5LQFB 5CFBA 4EYUA 2IW5B 4MFRA 2R7GA 2CZ0B 1WCRA 1ZKEA 3QYBA 3CVRA 4KI0F 4I43B 2VK9A 1XMOT 2F4VT 3C64A 5EFQB 4DUZT 3K3QC 4QXBB 2E9XC 3GA8A 2MAWA 1WR0A 3BLQB 3PUVF 3Q5EA 4UVCB 3RIUA 1HF8A 4EC9B 2IC9A 2X0LB 5FXWA 3AA7B 1KNPA 4AKHA 2DL1A 3UU3A 3MJXA 2WPAB 4UVAB 2CBIA 2XUEA 2L9QA 2WY2A 2WU2A 2XTLA 4GYSA 5L3BB 3FZLB 5HEHA 2MOZA 3O1IA 2HHHT 4QH5A 2XAFB 4QX8B 2K3WA 1HG5A 4ZOLE 4PNIA 2XJ7A 3N2OA 4ZI3C 2K24A 2XQYA 5L2WB 1QSDA 4U72A 1H25B 2XQ9A 4F70B 3ZN0B 4LF4T 3UQ4A 3PUZF 4BCGB 4YHHT 3PDYA 3DL1A 3ZC0A 1UUSA 3JAEA 4YTPA 2JMKA 5C8YE 2UZEB 3N9PA 2WP9A 3BLRB 2KWHA 3ZC1A 2LHRA 2LSIA 5J2TE 1OXZA 4GKJT 3LFMA 2BPMB 1SHZC 4YJ3E 2JIWA 3X25B 3CMLA 1R8IA 3NDQA 4HFEA 3GN5A 4AQGA 2B76A 2W2HA 2EHOB 4IDZA 3RC8A 2V7LA 3I9YA 1VCTA 5A1LA 4JI1T 4IE4A 2G0UA 2EHOD 4UVBB 4YTNA 2XAQB 2JGZB 3RYIE 4OB1B 3EJ1B 4U2YA 2XAGB 5IDNB 4KHPT 2C5NB 3DP7A 5AQMB 3F5XB 5ABFB 2CWYA 1CHUA 4CZZB 5L3DB 1TFBA 3AEGA 4LF8T 3TLWA 1SE7A 5L3CB 3BQIA 1J1JA 2F2CA 2NR4A 3QNUA 4LMKA 3AVRA 1Z0PA 3QYHB 4GIWA 4LFBT 3BHTB 1YKEB 1QUUA 2CZ1B 4CI2B 1H28B 1W0BA 1Y01A 4A56A 4EEBA 3J9X1 4TZ4C 2MTQA 5JDGA 5LOVE 5HWYA 3PU8A 5M4YA 2CEAA 4YXDA 2CRBA 4EOKB 3AE6A 2JQHA 3P50A 3L39A 5C3JA 3PUWF 4O4JE 4DV5T 1BR0A 4H9QC 3WAJA 2A3DA 5CEIB 1MMAA 4HN9A 4BCMB 4DNDA 5L3EB 2I6HA 4BAYB 4UEMA 5JR9C 1U4QA 3CQXC 3VR9A 3AE7A 4ROCA 4WNKA 1O3XA 2ODUA 5JQGE 3X28B 3ETUA 2ZPGB 1ENWA 4CQIA 4BCNB 2JMHA 2QVAA 3NVOA 3ZMVB 2CBJA 2KR6A 2YU1A 4ISSA 2D9DA 2UZDB 2CE7A 4NIQA 3A8LB 5JDMA 4BJMA 3C50A 4TN7B 4U7YA 5HEJA 5JDQA 2C5VB 4DV0T 2D0UA 4H9RC 3ZKRA 4IE5A 3UT5E 4UR9A 3O4XE 3MA9A 5LP6E 3JCFA 2V6XA 3KV9A 3SS1A 4KBMB 5JRCA 2PMIB 3QHWB 2VKDA 4MIMA 5BNJB 3SRZA 2WU5A 4F7LB 1YD8G 2LM9A 4DVDA 5F3JA 2H89A 2LEHA 1W98B 1VOMA 4DR7T 3OVUA 1OIUB 4MALA 4IDQA 3AE1A 2WQYA 1H4LD 2DD4B 3ZLIA 3A8YC 3EAMA 2VKOA 2ZM2A 3OKQA 3F31A 3ZJ2A 3I0QA 4UIGA 5LG3A 4I55E 2IHR1 5JREA 2BBJA 2XZEA 3J7Yq 3CIRA 4HNVA 4DIDB 3QZ9B 1HNZT 4KUMB 5AQJB 2WXVB 4QSHA 1NWMX 3PJAJ 5IUXA 3HI2A 1XZYA 5LMKB 1UK5A 5HXCA 5FKYA 3QWLA 4U31A 3RIFA 3AEDA 3AE2A 5LA6E 2Q9QD 2WBLA 4BCFB 4QH4A 4TUYE 3AB3B 3Q5DA 4ASKA 4OHFA 5LMUT 4ERRA 3DDQB 4ZZBA 2JQ9A 5ICPB 1HNXT 4BCHB 4G2AA 4LF6T 2XAHB 4CFXB 3CQGB 3A8HB 1H27B 2WDRA 1YQ4A 3H37A 3AE3A 2W0GA 2BS4A 3MIAB 2SPCA 4IHJE 3P7IA 3P4WA 2YU2A 4H63V 2AE9A 3HZJA 3HKCE 4HEAA 2NWBA 1AISB 2WDVA 2KZ7B 4YLHA 2H88A 2E5LT 3TNHB 2UXCT 4O4LE 2V1DB 3HKBE 3RKGA 4MBQA 2X9HA 4LMLA 3B57A 2LKHA 3ANWB 3C98B 3AAIA 1JSUB 1ZP2A 2BVLA 2CXFA 4LF9T 2FJBA 3ZMTB 3N2KE 2M67A 3KINB 4QKNA 1N32T 4EONB 1D1CA 4UF0B 3SOLA 1GH6B 3ONXA 3UU4A 5HXHA 4QWNB 1E2AA 2YDQA 3LG7A 1WLXA 3V5UA 5AQIB 2DWKA 1G3NC 4EORB 5AQFB 3IA3A 2LKGA 1B7TA 2ZCFB 4G63A 1MIVA 3WAKA 1CUNA 3MI9B 4LF5T 4XAXB 2IUBA 4BA9A 2LRKA 5E0OA 4KRCB 4TV8E 5JH7E 3U78A 2CA5A 2CM0A 4IE6A 3C4ZA 3M3ZB 3HA4A 3AAAB 5DQVA 4ZXLA 3FBLA 4B3ST 3FZHB 2K5BB 1PKDB 4IT4A 4BY7X 1FVVB 1J5ET 4OR5B 4AKRB 2W4XA 3I0OA 4L0RA 2UUEB 4ELJA 3K3OA 3AE4A 4HE8A 4PJLA 2CCQA 4JX6A 4EEDA 2B1EA 2LLYA 5FXZA 5FVKA 3FZFB 2LSJA 4NC6A 3V5SA 3EOCB 2ZM0A 1D0XA 5LXTE 1H1RB 2LJLA 1IREB 2WWVA 4AQFA 3KDSE 4BCQB 4I4TE 4V1Av 3NWIA 4HGAA 2BS2A 4EB6E 2G9XB 3LK3B 1H1SB 2YOEA 3IBPA 4CFUD 5JDFA 2OA5A 4IREA 2DD5B 2V7MA 4AQYT 3LK42 5FY1A 3L8RA 2ZLYA 4IDOA 1QLBA 1WYBA 2Y6XA 1N4MA 1HS7A 1YXRA 4ZI2D 3HHTB 1JKWA 5FL1A 2BZBA 4DV2T 3JADA 4L5GA 3P4PA 2KNDA 2FUPA 3HKDE 3UU5A 3BG5A 4EYYR 1WFDA 1FMWA 3KV6A 1UGQB 5CGMA 1HG2A 2ZMAA 4NUUA 3RYCE 4HFIA 4MLKA 3VKGA 3QHRB 2C5JA 5HVYB 5ACBA 2E9XB 2DNXA 4I3ZB 2L8KA 4JEHB 2BVMA 2C6TB 4H9SE 2X68A 3BQLA 3UUMA 4F7SB 3PO3S 3KBUA 4ZGDB 1BR1A 1OKWB 4CFWB 2IMLA 4KMCA 1ZOYA 4Z90A 3TW6A 2DPPB 5JR9A 3IEEA 3R84B 3HR0A 4AKLA 4UN0A 4YJ2E 3DJBA 5AQTB 3ZEFB 4IMYB 1G8XA 4N78D 2ZM6T 2RPAA 4TX5A 1D0ZA 3P4SA 1MNEA 3QB5K 1XMQT 4F8HA 2OV9A 2IC6A 2NP9A 4CXXA 3RI5A 2FJAA 4O2AE 4AI6A 2CMRA 5FNVE 2CCHB 3B5MA 3NKZA 2LOSA 5AQVB 4DV1T 3AA0B 1Y64B 2BG9B 3QUJA 1WRDA 4EGWA 4H9OC 5JDHA 1V9DA 1XWMA 4C91A 2XM1A 2C4GB 4DBQA 3AEFA 4TWDA 2IW6B 2PK2A 2UU9T 2X9XA 2LSKA 2E2AA 4PFPA 4EXTA 1YKHB 4OB0B 3RC3A 4OYJA 3KV4A 1OEDE 4EIWA 5LB7B 4F6RC 4X20E 1M62A 3VHLA 2H3RA 1KXUA 2C5OB 4DV7T 3OYXA 2BKZB 1LVKA 2KT9A 3C4XA 5L3FB 3EABA 5LGUB 5IF1B 3ZYLA 3K3NA 3VR8A 3RKOA 3FZMB 5FL0A 4WZXA 4ROEA 3QYEA 3UFGA 2CLYB 3EDVA 4I50E 5JR9B 3P8CD 2HPJA 2HN1A 3PJAA 2VL0A 5AQUB 4AIUA 2XSAA 3PURA 2YINA 2NW7A 2Q9QA 4P09A 1ZP0A 2VASA 4JI7T 4JYAT 3ONLC 4A5XA 3TN8B 4FI5A 2PJQA 3HB9A 3GWHA 1ZEEA 3TLTA 4CXWA 5ADXL 4H9PC 5EZYE 3VU7H 4E7SA 3VRBA 2E8IA 2WJ9A 3A8GB 1HFAA 5GONE 3AXJB 2UUBT 4EAHA 1OIYB 3QZ5B 1WYCA 3UTKA 4DMVA 2VQFT 1VINA 3AE9A 3TLVA 3RLFF 1E1HB 1UGRB 4JEUB 4UV9B 3QYGB 1ZHCA 2XM2A 4QHOA 2J1DG 4JX5A 4U33A 3QXEB 3TW7A 1NAFA 4WW0A 5FYMA 3OYZA 3T8OA 1H7CA 1P5EB 2XHEB 3S4UA 4EZ4A 1OL1B 2LM2A 2W63A 1KF6A 1FINB 3IHRA 4A98A 1JNRA 4BBRM 5LNKA 3KBTA 2OLTA 5EK4A 2XQ5A 5AQHB 2IVXA 5ABFA 4HLQA 3X26B 1HTJF 3ZT7A 3UU6A 2DCFA 1O9KB 4TWFA 2WWUA 1F5QB 2A2FX 2E5VA 2BBHA 2NOXA 3RF1A 3W15B 4LFAT 5L2LA 3G06A 3EIDB 2WZIA 5LGTB 2MPKA 1FEWA 2I53A 2KMGA 4DR4T 4YSXA 4HWCA 2YKSA 5BMVE 2Y8DA 3BG3A 1FKMA 1GQEA 3E08A 3MKDA 2D0QB 2QDYB 2WIPB 4TWHA 4ISTA 4JI2T 4JI6T 1NEKA 3CK6A 2BS3A 4BBSM 2ZPBB 3NZPA 3PTRB 2V8SV 1H1QB 2KMFA 2WAUA 3A8MB 5AQSB 2CXDA 3T1YT 2ODVA 1JOWA 3ETVA 3RRCA 4FM4B 4OK0A 5H6RB 4COFA 3E22E 1GUXB 1VOLA 1HCIA 2DXCB 3O1HA 3WVEB 3SFDA 3AE8A 1US7B 4IGUA 4BCOB 2CHNA 3FBZA 3Q5XA 2UUCT 4L9IA 5CYIB 1XNQT 2XQAA 4EZHA 3CWZB 2DI4A 4IL9A 3F57A 4CRLB 4HL4A 2W66A 1BR2A 1UNGD 1UX4A 2V5DA 1LKXA 2FBWA 3TNIB 5HEGA 4BCQD 3G33B 4EOPB 2XQ4A 3TKLB 3ZCJA 4HWIB 3AAEB 2DMEA 1JSTB 4GKKT 3GN5B 3X1DA 5FP3A 2CXLA 5FVLA 5ABGA 2NTXA 4IE0A 2BG9A 3EI0A 2XQ3A 4LOCA 1BR4A 5L4HA 4TV9E 4PK4A 3N9OA 4H9NC 3PUAA 1FMVA 4ZGJB 3UUBA 4ZGEB 3N9NA 2QA7A 2NW9A 4ANJA 4BXXX 2YEVC 4OB3B 2ZZDB 4HFCA 3AA1B 1KK7A 4Y72B 3L3PA 4BCJB 3RQUA 3N9MA 4J2CA 3O1JA 5HBHB 2WFYB 1UURA 5HBEB 3NZQA 4YOOA 1IBMT 3PUSA 2CCIB 2H7OA 2FJEA 4CFMB 1D3UB 3Q5WA 3H3MA 2VL8A 2VB6A 2VWAA 4JBWF 2I59A 4ZEYA 4Z8XA 3RHWA 3RH3A 5L4EA 3CX7B 5KX5E 4DV3T 1S35A 2WSSV 4HFDA 4NSTB 3RIAA 2CPTA 1D1AA 3H3AA 4JI0T 5ABEA 2EHOC 2A9UA 4ILAA 3LBXA 5HCMA 4OGRB 1UGPB 2A72A 2X1NB 2XASB 5FXVA 1OKVB 2WZHA 4NXNT 1LVFA 3H4CA 5I5ZB 4X62T 4ZZCA 5AQQB 2IW8B 5HXRA 4UV8B 1W09A 4CN4A 4ZS2A 4PAGA 4P0BA 5AFUL 2Z6EA 5LBQB 5J0ZA 2CLYC 2PG8A 2LW4A 3MACA 2UXNB 3N5LA 3ABVA 5HBJB 4U7IA 2ACZA 3BK9A 4YOSA 4X66T 4ZI2C 4CFVB 2AHJB 3VKHA 2PFVA 5CJ5A 4F6SB 2V22B 3LQ5B 3FZKB 3BQKA 2VQET 2QQ8A 5EJCA 3E0ZA 1JNZA 2DXBB 2D2SA 5HQ0B 2C5XB 5CB4E 2JJ9A 1T7SA 4TTHA 2X9WA 5HAXA 4ZI3D 4ILUA 5F5WA 1D0YA 4X65T 2VKHA 4GK5E 1XDOA 4JI5T 4HWHA 2D0TA 4DBRA 1T72A 4PW8A 1IJ5A 4CI3B 3I9WA 2W99A 3GTMS 2MBGA 2W62A 2J62A 4IDPA 3WVDB 2KSRA 1H1PB 4GOUA 2V7KA 3CPZA 2HH7A 3HKEE 3RYFE 1IZNB 3LJCA 4IDNA 3PE0A 2X66A 1WR6A 5HYAA 4EC8B 3CX6B 2WCAA 2W9ZA 4DR1T 4Q25A 4X5TA 4QXHB 3K1SA 4GYRA 1G73A 3EVYA 4EV6A 2N2NA 3ONJA 4JUYA 3F2EA 1XNRT 2J47A 4ILBA 5KXJA 2E9XA 2ACXA 5FXXA 2JPFA 3A8OB 5L3GB 4CXAB 2RP4A 2WB5A 2HPLA 2LE8A 3UU8A 2YDSA 5AQGB 3KHIA 3A7MA 3LDQB 2PBIA 2V7JA 5LG4A 3ZSSA 3VYGB 4UXNB 4MHCA 3K7AM 4G6LB 3TLUA 3AEAA 5LMNT 1FIOA 4HKAA 2YDRA 4EOLB 4F7JB 2V6YA 1OGUB 3QOFA 3C4WA 3ZT6A 1MMDA 4JI8T 3QK6A 2BKPA 3Q9DA 2YN6A 1AJ3A 3N9LA 2KLQA 4AISA 5IYZE 2ZPFB 1YW0A 3HL6A 3LK2B 5ETWA 2WDQA 5FMNA 3I1AA 1URCB 2DHRA 2CWOA 3QB5A 4B6XA 2V7IA 1UGOA 4E7ZA 3O0GD 4B3TT 1MMNA 1D1BA 2WM9A 4UELA 1AD6A 5FY7A 3AVSA 3BHVB 2RA1A 2ZPHB 4MFEA 5HEOA 4DR5T 3L09A 1VYWB 3UFEA 2LRLA 2UXBT 3ZPOA 4HFHA 3N2GE 1QMZB 3AE5A 1TD6A 4OFZA 4QXCB 4WBOA 4BCIB 2NW8A 3ESLA 3MK7C 4HNTA 1T8BA 2UZBB 2CZ7B 4NPPA 3GMIA 4YTMA 1AHJB 5JTGA 1H26B 4XBFB 3JC6D 4KP3C 2N9DA 2XY8B 2P9BA 2H7VC 2W2UA 4O4IE 4P0AA 3UQ7A 5AQNB 3K8PC 2QYWA 2ES0A 2XPKA 1IJ6A 2V26A 5HEUA 2AXDS 4K0KT 2W9FA 4UF0A 4O2BE 1FJGT 1ZV4X 2LSYA 4IE7A 4LFCT 5CA1E 2KWIB 5AQRB 5LYJE 2WMAB 5FY0A 4OX9T 2UUAT 5AQOB 1IAPA 4IIJE 3RGFB 2D5UA 3SFEA 5DABA 2JQQA 2I40B 4EOIB 1UGSB 4I0UA 4DV4T 5DJQC 4YHJA 2W67A 5LCYA 4CFNB 3B13A 2NTYA 1W0AA 1Z8UA 4DMWA 2QGSA 3RYHE 1MMGA 3PUGA 1UNHD 4YC3B 3RPUA 2Q9QC 3PU3A 3UUXB 4HFBA 5KMGP 4O8SA 3BG9A 4HNUA 1LRZA 1OL2B 3ZSTA 4HTEA 2C0SA 2JQKA 3JAFA 4YOZA 3KVBA 2G77A 3MY1B 4YSYA 3PV0F 4PJMA 2EUFA 4KX6A 2C5IT 2XQ7A 5CA0E 5HCJA 4EOZB 4HFVA 2UZLB 2CHOA 3MZKB 4ILCA 4QH1A 4TNWA 2ZPEB 3CKDA 5J1GA 4F7NB 4U2ZA 3CX8B 3ZCIA 2X67A 4DV6T 2IAKA 1HX1B 2C5KT 4IL4A 4ZI7E 2BKOA 2W00A 4LMJA 1N36T 2QFZA 4BY1X 2QRXA 5J2UE 2N1GA 3M03A 4H63H 3KV5A 5LGNB 4JV5T 2Q9QB 2X51A 3NRXA 3ZT5A 2R6GF 3ZYMA 3QC9A 3EUHA 4A97A 5JVDE 2VURA 2XSBA 3FHNA 3MXZA 3DOGB 1MIWA 4GK0E 3D0TA 2WMNA 3SWHA 4KHZF 2LSGA 5IWAT 4FX3B 1OWAA 4EOOB 2BG9E 3JC6C 4DO0A 1VRBA 4U74A 1X9BA 2PK9B 4X1KE 3P4QA 3Q2MA 3R6NA 4CN1A 1SUMB 4MFDA 3OJAA 2QDJA 2VVSA 3X24B 3EHZA 3DTOA 5BR8T 4BCND 5DQWA 4AQFC 4JLEA 1MIYA 5JRCB 2VKJA 3TLSA 2BKNA 5FGKB 4HWDA 5HXSA 2M6BA 5TAOA 3POMA 1HNWT 3P4RA 2IN3A 4WYVA 5ABHA 2VVNA 1O9KA 5LJMA 4PJNA 1XO2A 4CI1B 3HO8A 2IIUA 2KINB 2E9XD 4AKGA 3ZN1B 4ELLA 4U3CA 4PK5A 4M6VA 5JDLA 3OTOT 1DU2A 3BLHB 2JRKA 4DR6T 3LBXB 1GUXA 2UXXB 3BHUB 5EK3A 3VYHB 3PUQA 3NBXX 1E7PA 1SA0E 3WI3A 4PFOA 5LHHB 4Z91A 2B9RA 1I6ZA 4BCKB 2MYSA 3FB2A 1OI9B 2W61A 3ZMZB 3NRYA 4JI4T 4CN6A 3C51A 1UX5A 4EOSB 4AKIA 3AEBA 4YT0A 4YFSA 3AXJA 4BCPB 4HWFA 5KDMC 4FJOA 3MY5B 4BCMD 1OEDC 2WEVB 4PJJA 2DWGA 5C2TA 3UULA 2HN2A 1KNZA 1XDPA 4ZS3A 5IHYA 1E9HB 2Y48B 4XZCA 1L0VA 3KFWX 4C90A 3RGLA 1HX8A 3UUNA 3ZMSB 4BJNA
chains in the Genus database with same CATH topology
4X20E 3CX6B 5JDQA 2YK0A 3VHLA 2H3RA 4ADZA 5HWXA 3M65A 4QXHB 3ZMUB 3OYXA 2D0UA 3FXEB 4H9RC 4IE5A 4GYRA 3UT5E 1G73A 1LVKA 3EVYA 5LBMA 2KT9A 3C4XA 5L3FB 2N2NA 3O4XE 5LGUB 3AA6B 3MA9A 4JUYA 3F2EA 5LP6E 1MNDA 3KV9A 3SS1A 3ZYLA 4KBMB 5JRCA 3K3NA 3RKOA 2E9XA 2ACXA 2VKDA 5H6QB 5FXXA 3SRZA 2JPFA 5L3GB 1YD8G 2LM9A 2RP4A 4K0UA 4DVDA 2HPLA 2CLYB 5F3JA 2LE8A 3EDVA 4I50E 2LEHA 5EK2A 5JR9B 3P8CD 2HPJA 3IF8B 1VOMA 4MALA 4X1IE 3N9QA 4QX7B 3RX6A 1U5PA 2PBIA 2V7JA 3PURA 5LG4A 2YINA 2NW7A 1EZ3A 4ZHQE 3ZLIA 4UXNB 2Q9QA 4MHCA 4P09A 2VKOA 2ZM2A 2VASA 3OKQA 1FIOA 3F31A 4HKAA 4CXYA 2K9AA 3ZJ2A 3I0QA 4FI5A 2PJQA 5LHGB 4UIGA 5HXEA 4I55E 5JREA 3GWHA 4PK6A 1ZEEA 4CXWA 3J7Yq 5ADXL 4H9PC 5EZYE 3VU7H 4E7SA 3C4WA 1T98A 2E8IA 1MMDA 4KUMB 1HFAA 1NWMX 3QK6A 5GONE 4OYKA 3HI2A 4EAHA 3UTKA 1WYCA 3Q9DA 4DMVA 1E1HB 1AJ3A 5HXCA 4JEUB 3N9LA 2KLQA 4UV9B 2EHOA 1ZHCA 3U3IA 5IYZE 1YW0A 5LA6E 4QHOA 2J1DG 2Q9QD 3HL6A 2XAJB 2WBLA 1NAFA 2K48A 3LK2B 4WW0A 5FYMA 1X79A 4TUYE 3AB3B 3OYZA 5ETWA 4ASKA 3T8OA 5FMNA 4OHFA 2WMOA 3I1AA 1H7CA 2XHEB 2DHRA 3S4UA 2CWOA 4ERRA 4EZ4A 3O9XA 2W63A 4NUVA 4B6XA 2V7IA 4E7ZA 3IHRA 3A5XA 5JDNA 3KBTA 5LNKA 5EK4A 2ZM8A 4G2AA 3RRWA 2KXPB 1MMNA 2XAHB 4WBNE 1D1BA 2WM9A 4UELA 5FY7A 2DLRA 3AVSA 3CQGB 2RA1A 2LT3A 1UCUA 1HTJF 3KVAA 3EDUA 3L09A 3H37A 2DCFA 2W0GA 2WWUA 3UFEA 4O4HE 2SPCA 4IHJE 2A2FX 3P7IA 2NOXA 3ZPOA 2YU2A 4H63V 4X1YE 3W15B 3N2GE 3OBVE 5L2LA 4AXPA 3HKCE 4OFZA 5F8PA 5LGTB 4HEAA 1FEWA 4QXCB 2NWBA 4WBOA 1S94A 2KZ7B 4YLHA 2NW8A 3ESLA 3MK7C 5BMVE 4O4LE 2Y8DA 2V1DB 3HKBE 3E08A 3GMIA 4MBQA 2X9HA 3B57A 2LHNA 3ANWB 3CQCB 3MKDA 2GK9A 3C98B 5LHIB 3AAIA 2BVLA 2CXFA 2X9YA 4ISTA 4XBFB 3JC6D 3ANWA 4KP3C 2N9DA 3ZMTB 3ZJ1A 3N2KE 2M67A 2P9BA 2H7VC 3NZPA 3KINB 3PTRB 4O4IE 4P0AA 2KMFA 3ZYKA 2WAUA 4QKNA 1D1CA 4M1PA 4UF0B 3FXDB 3SOLA 3K8PC 3ONXA 5LJNA 2LOPA 2CXDA 2ES0A 2L3LA 5HXHA 2BDEA 1IJ6A 4QWNB 2ODVA 2V26A 3ETVA 3RRCA 3LG7A 1WLXA 3V5UA 2DWKA 4EYUA 2IW5B 4MFRA 4OK0A 4UF0A 4O2BE 1ZKEA 5H6RB 1ZV4X 2LSYA 1B7TA 3E22E 4IE7A 3CVRA 5CA1E 4G63A 1MIVA 2KWIB 1HCIA 3O1HA 3WAKA 1CUNA 5LYJE 4I43B 1US7B 5FY0A 2VK9A 3C64A 4IGUA 3K3QC 4QXBB 4XAXB 3FBZA 2E9XC 4BA9A 3GA8A 1IAPA 4IIJE 5E0OA 2D5UA 4TV8E 3Q5XA 4L9IA 5DABA 5JH7E 3U78A 2CA5A 2CM0A 2JQQA 4IE6A 4EZHA 3CWZB 3C4ZA 2DI4A 3F57A 1BR2A 1UX4A 3AAAB 3HA4A 5DQVA 5DJQC 1LKXA 3FBLA 4UVCB 1HF8A 4YHJA 2IC9A 2K5BB 2X0LB 5FXWA 5LCYA 3B13A 2NTYA 3AA7B 4DMWA 2QGSA 3RYHE 4AKHA 1MMGA 3PUGA 4AKRB 3I0OA 3MJXA 4L0RA 2Q9QC 3RPUA 3TKLB 3ZCJA 3PU3A 3UUXB 5KMGP 3K3OA 4UVAB 2XUEA 4HE8A 2L9QA 4PJLA 4O8SA 2XTLA 4GYSA 2CCQA 5L3BB 2MOZA 3AAEB 1LRZA 3O1IA 3GN5B 2B1EA 5FXZA 5FP3A 2CXLA 2LSJA 3V5SA 2XAFB 4HTEA 4QX8B 1HG5A 2C0SA 2NTXA 2ZM0A 4IE0A 4ZOLE 4PNIA 3KVBA 3N2OA 4ZI3C 1D0XA 5LXTE 1BR4A 4PJMA 2K24A 4TV9E 4PK4A 2C5IT 2XQYA 3N9OA 4H9NC 5CA0E 3PUAA 4EOZB 1FMVA 4HFVA 1QSDA 2LJLA 3N9NA 2QA7A 3MZKB 4U72A 2NW9A 4ANJA 2YEVC 3ZN0B 4AQFA 3KDSE 3PDYA 3AA1B 1KK7A 4I4TE 4V1Av 3ZC0A 3L3PA 3CKDA 4HGAA 5J1GA 4EB6E 3N9MA 4J2CA 2JMKA 3LK3B 3N9PA 3O1JA 5C8YE 3ZCIA 3CX8B 3IBPA 2X67A 2KWHA 3ZC1A 2IAKA 2LHRA 2LSIA 2C5KT 3NZQA 4ZI7E 5J2TE 1OXZA 5JDFA 2W00A 2OA5A 2H7OA 3LFMA 3PUSA 1SHZC 4YJ3E 2V7MA 3LK42 5J2UE 2N1GA 3CMLA 5FY1A 4H63H 3KV5A 3Q5WA 2ZLYA 3GN5A 5LGNB 2Q9QB 1WYBA 2VL8A 2X51A 2Y6XA 1HS7A 3NRXA 4ZI2D 4AQGA 2VB6A 3ZYMA 3QC9A 2VWAA 3EUHA 2BZBA 2I59A 2EHOB 4IDZA 3RC8A 2V7LA 3I9YA 4L5GA 5JVDE 4Z8XA 5A1LA 2KNDA 3RH3A 3FHNA 3HKDE 3MXZA 4IE4A 2G0UA 3CX7B 1MIWA 4GK0E 5KX5E 3D0TA 2EHOD 4UVBB 2WMNA 3SWHA 1S35A 2WSSV 3KV6A 1FMWA 4EYYR 2LSGA 2XAQB 3RYIE 1OWAA 2XAGB 3JC6C 4DO0A 1VRBA 1D1AA 4U74A 3DP7A 2ZMAA 1HG2A 2CWYA 4X1KE 3H3AA 4CZZB 4NUUA 3Q2MA 3R6NA 4MLKA 3RYCE 5L3DB 3VKGA 5L3CB 3BQIA 2C5JA 3OJAA 2EHOC 3LBXA 3AVRA 3DTOA 2A72A 2XASB 2E9XB 5DQWA 4AQFC 5FXVA 4JLEA 2DNXA 1MIYA 5JRCB 1Z0PA 2VKJA 1LVFA 2L8KA 4GIWA 4JEHB 2BVMA 5HXRA 1YKEB 4UV8B 5HXSA 4H9SE 1QUUA 5TAOA 2X68A 3BQLA 4ZS2A 4CI2B 4PAGA 4P0BA 3UUMA 3KBUA 5AFUL 1BR1A 2Z6EA 5LBQB 4A56A 3J9X1 5LJMA 4TZ4C 2MTQA 4PJNA 5JDGA 2CLYC 2PG8A 4CI1B 4KMCA 2KINB 2E9XD 3MACA 2UXNB 5LOVE 3ZN1B 5HWYA 4AKGA 3N5LA 3PU8A 5JR9A 5M4YA 3IEEA 4PK5A 3R84B 5JDLA 3HR0A 2CEAA 4AKLA 3BK9A 4ZI2C 2PFVA 3VKHA 4YJ2E 3DJBA 3BQKA 3E0ZA 2JRKA 3ZEFB 1G8XA 3LBXB 4N78D 2UXXB 1D0ZA 2D2SA 4TX5A 3PUQA 1MNEA 5EK3A 3NBXX 1SA0E 4O4JE 3WI3A 5CB4E 4PFOA 2JJ9A 5LHHB 1BR0A 4H9QC 2IC6A 3WAJA 2NP9A 2X9WA 2A3DA 1MMAA 5HAXA 4CXXA 4HN9A 2MYSA 4O2AE 4ZI3D 4ILUA 4DNDA 1D0YA 5L3EB 4AI6A 2CMRA 3FB2A 2VKHA 5FNVE 2W61A 3ZMZB 3NRYA 4BAYB 4UEMA 5JR9C 4GK5E 1U4QA 2LOSA 3CQXC 3C51A 1UX5A 2D0TA 4DBRA 4WNKA 5JQGE 1O3XA 2ODUA 4PW8A 1IJ5A 3ETUA 4AKIA 3AA0B 1Y64B 4CI3B 3I9WA 4YFSA 3QUJA 4CQIA 1WRDA 4H9OC 5JDHA 1V9DA 2JMHA 5KDMC 4FJOA 3ZMVB 4C91A 4DBQA 2MBGA 2W62A 4GOUA 4PJJA 2V7KA 3CPZA 2DWGA 2X9XA 2YU1A 2LSKA 4ISSA 2HH7A 3HKEE 3RYFE 3UULA 1IZNB 4PFPA 4EXTA 1YKHB 3LJCA 1KNZA 2CE7A 4ZS3A 5IHYA 3PE0A 3RC3A 4OYJA 4BJMA 5JDMA 2Y48B 3C50A 3KV4A 4XZCA 3KFWX 2X66A 4C90A 1WR6A 4TN7B 1HX8A 4EIWA 3UUNA 5HYAA 3ZMSB 4BJNA 4F6RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJB A;  5DQV A;  5IHY A;  3DTO A;  2QGS A;  2PJQ A;  5DQW A;  3B57 A; 
#chains in the Genus database with same CATH topology
 1KNR A;  2YK0 A;  4ADZ A;  4ROD A;  5HWX A;  3M65 A;  3ZMU B;  1IBK T;  3FXE B;  5LBM A;  4JI3 T;  2UXD T;  3T1H T;  3AA6 B;  1MND A;  5HNB B;  5H6Q B;  3PUY F;  4K0U A;  4DR2 T;  5EK2 A;  3OPC A;  3IF8 B;  2X0H A;  1N33 T;  3VRA A;  1NEN A;  4X1I E;  3N9Q A;  4QX7 B;  5AQK B;  4LF7 T;  2PTF A;  3RX6 A;  1U5P A;  1EZ3 A;  4ZHQ E;  4NXM T;  1I94 T;  2V5C A;  4YSZ A;  2WHB B;  4CXY A;  2K9A A;  2CJM B;  5LHG B;  2IW9 B;  5HXE A;  5L47 A;  4PK6 A;  1VCS A;  1T98 A;  2XQ8 A;  2CZ6 B;  4OYK A;  4B3R T;  1OED B;  1GY3 B;  1KFY A;  4EOM B;  2EHO A;  1HR0 T;  3U3I A;  4EOJ B;  2XAJ B;  2K48 A;  1X79 A;  1J5W A;  4X64 T;  2M6I A;  5IDP B;  2WMO A;  4F6U B;  2IDO B;  3PUX F;  3O9X A;  4NUV A;  3RQW A;  1V29 B;  4DUY T;  2WS3 A;  3DDP B;  3A5X A;  5JDN A;  2ZM8 A;  3RRW A;  2KXP B;  2FJD A;  4WBN E;  4TNV A;  5AQL B;  4F6W B;  3TNW B;  3HBL A;  2DLR A;  1KEY A;  4KRD B;  2LT3 A;  1UCU A;  3KVA A;  3EDU A;  1OED A;  2ZPI B;  1IBL T;  4O4H E;  1W9R A;  1UNL D;  3X20 B;  2QF7 A;  4X1Y E;  5AQP B;  3OBV E;  4AXP A;  5F8P A;  2WIH B;  1BU2 A;  3AEE A;  1S94 A;  4EOQ B;  3LSV A;  1H24 B;  1M7K A;  2X0Y A;  4OB2 B;  3RIU C;  4JX4 A;  2I0M A;  4YY3 T;  4P1N A;  2LHN A;  2W96 A;  3CQC B;  2GK9 A;  5LHI B;  1C9B A;  4CFU B;  2WMB B;  2X9Y A;  3AEC A;  2PHG A;  3ANW A;  3ZJ1 A;  4DR3 T;  2CYZ B;  1YQ3 A;  2XQ6 A;  4B3M T;  4II5 B;  3ZYK A;  4Z6Y A;  2BG9 C;  4M1P A;  3FXD B;  2J4G A;  5LJN A;  2LOP A;  2L3L A;  2BDE A;  1N34 T;  2V6Y B;  5LQF B;  5CFB A;  4EYU A;  2IW5 B;  4MFR A;  2R7G A;  2CZ0 B;  1WCR A;  1ZKE A;  3QYB A;  3CVR A;  4KI0 F;  4I43 B;  2VK9 A;  1XMO T;  2F4V T;  3C64 A;  5EFQ B;  4DUZ T;  3K3Q C;  4QXB B;  2E9X C;  3GA8 A;  2MAW A;  1WR0 A;  3BLQ B;  3PUV F;  3Q5E A;  4UVC B;  3RIU A;  1HF8 A;  4EC9 B;  2IC9 A;  2X0L B;  5FXW A;  3AA7 B;  1KNP A;  4AKH A;  2DL1 A;  3UU3 A;  3MJX A;  2WPA B;  4UVA B;  2CBI A;  2XUE A;  2L9Q A;  2WY2 A;  2WU2 A;  2XTL A;  4GYS A;  5L3B B;  3FZL B;  5HEH A;  2MOZ A;  3O1I A;  2HHH T;  4QH5 A;  2XAF B;  4QX8 B;  2K3W A;  1HG5 A;  4ZOL E;  4PNI A;  2XJ7 A;  3N2O A;  4ZI3 C;  2K24 A;  2XQY A;  5L2W B;  1QSD A;  4U72 A;  1H25 B;  2XQ9 A;  4F70 B;  3ZN0 B;  4LF4 T;  3UQ4 A;  3PUZ F;  4BCG B;  4YHH T;  3PDY A;  3DL1 A;  3ZC0 A;  1UUS A;  3JAE A;  4YTP A;  2JMK A;  5C8Y E;  2UZE B;  3N9P A;  2WP9 A;  3BLR B;  2KWH A;  3ZC1 A;  2LHR A;  2LSI A;  5J2T E;  1OXZ A;  4GKJ T;  3LFM A;  2BPM B;  1SHZ C;  4YJ3 E;  2JIW A;  3X25 B;  3CML A;  1R8I A;  3NDQ A;  4HFE A;  3GN5 A;  4AQG A;  2B76 A;  2W2H A;  2EHO B;  4IDZ A;  3RC8 A;  2V7L A;  3I9Y A;  1VCT A;  5A1L A;  4JI1 T;  4IE4 A;  2G0U A;  2EHO D;  4UVB B;  4YTN A;  2XAQ B;  2JGZ B;  3RYI E;  4OB1 B;  3EJ1 B;  4U2Y A;  2XAG B;  5IDN B;  4KHP T;  2C5N B;  3DP7 A;  5AQM B;  3F5X B;  5ABF B;  2CWY A;  1CHU A;  4CZZ B;  5L3D B;  1TFB A;  3AEG A;  4LF8 T;  3TLW A;  1SE7 A;  5L3C B;  3BQI A;  1J1J A;  2F2C A;  2NR4 A;  3QNU A;  4LMK A;  3AVR A;  1Z0P A;  3QYH B;  4GIW A;  4LFB T;  3BHT B;  1YKE B;  1QUU A;  2CZ1 B;  4CI2 B;  1H28 B;  1W0B A;  1Y01 A;  4A56 A;  4EEB A;  3J9X 1;  4TZ4 C;  2MTQ A;  5JDG A;  5LOV E;  5HWY A;  3PU8 A;  5M4Y A;  2CEA A;  4YXD A;  2CRB A;  4EOK B;  3AE6 A;  2JQH A;  3P50 A;  3L39 A;  5C3J A;  3PUW F;  4O4J E;  4DV5 T;  1BR0 A;  4H9Q C;  3WAJ A;  2A3D A;  5CEI B;  1MMA A;  4HN9 A;  4BCM B;  4DND A;  5L3E B;  2I6H A;  4BAY B;  4UEM A;  5JR9 C;  1U4Q A;  3CQX C;  3VR9 A;  3AE7 A;  4ROC A;  4WNK A;  1O3X A;  2ODU A;  5JQG E;  3X28 B;  3ETU A;  2ZPG B;  1ENW A;  4CQI A;  4BCN B;  2JMH A;  2QVA A;  3NVO A;  3ZMV B;  2CBJ A;  2KR6 A;  2YU1 A;  4ISS A;  2D9D A;  2UZD B;  2CE7 A;  4NIQ A;  3A8L B;  5JDM A;  4BJM A;  3C50 A;  4TN7 B;  4U7Y A;  5HEJ A;  5JDQ A;  2C5V B;  4DV0 T;  2D0U A;  4H9R C;  3ZKR A;  4IE5 A;  3UT5 E;  4UR9 A;  3O4X E;  3MA9 A;  5LP6 E;  3JCF A;  2V6X A;  3KV9 A;  3SS1 A;  4KBM B;  5JRC A;  2PMI B;  3QHW B;  2VKD A;  4MIM A;  5BNJ B;  3SRZ A;  2WU5 A;  4F7L B;  1YD8 G;  2LM9 A;  4DVD A;  5F3J A;  2H89 A;  2LEH A;  1W98 B;  1VOM A;  4DR7 T;  3OVU A;  1OIU B;  4MAL A;  4IDQ A;  3AE1 A;  2WQY A;  1H4L D;  2DD4 B;  3ZLI A;  3A8Y C;  3EAM A;  2VKO A;  2ZM2 A;  3OKQ A;  3F31 A;  3ZJ2 A;  3I0Q A;  4UIG A;  5LG3 A;  4I55 E;  2IHR 1;  5JRE A;  2BBJ A;  2XZE A;  3J7Y q;  3CIR A;  4HNV A;  4DID B;  3QZ9 B;  1HNZ T;  4KUM B;  5AQJ B;  2WXV B;  4QSH A;  1NWM X;  3PJA J;  5IUX A;  3HI2 A;  1XZY A;  5LMK B;  1UK5 A;  5HXC A;  5FKY A;  3QWL A;  4U31 A;  3RIF A;  3AED A;  3AE2 A;  5LA6 E;  2Q9Q D;  2WBL A;  4BCF B;  4QH4 A;  4TUY E;  3AB3 B;  3Q5D A;  4ASK A;  4OHF A;  5LMU T;  4ERR A;  3DDQ B;  4ZZB A;  2JQ9 A;  5ICP B;  1HNX T;  4BCH B;  4G2A A;  4LF6 T;  2XAH B;  4CFX B;  3CQG B;  3A8H B;  1H27 B;  2WDR A;  1YQ4 A;  3H37 A;  3AE3 A;  2W0G A;  2BS4 A;  3MIA B;  2SPC A;  4IHJ E;  3P7I A;  3P4W A;  2YU2 A;  4H63 V;  2AE9 A;  3HZJ A;  3HKC E;  4HEA A;  2NWB A;  1AIS B;  2WDV A;  2KZ7 B;  4YLH A;  2H88 A;  2E5L T;  3TNH B;  2UXC T;  4O4L E;  2V1D B;  3HKB E;  3RKG A;  4MBQ A;  2X9H A;  4LML A;  3B57 A;  2LKH A;  3ANW B;  3C98 B;  3AAI A;  1JSU B;  1ZP2 A;  2BVL A;  2CXF A;  4LF9 T;  2FJB A;  3ZMT B;  3N2K E;  2M67 A;  3KIN B;  4QKN A;  1N32 T;  4EON B;  1D1C A;  4UF0 B;  3SOL A;  1GH6 B;  3ONX A;  3UU4 A;  5HXH A;  4QWN B;  1E2A A;  2YDQ A;  3LG7 A;  1WLX A;  3V5U A;  5AQI B;  2DWK A;  1G3N C;  4EOR B;  5AQF B;  3IA3 A;  2LKG A;  1B7T A;  2ZCF B;  4G63 A;  1MIV A;  3WAK A;  1CUN A;  3MI9 B;  4LF5 T;  4XAX B;  2IUB A;  4BA9 A;  2LRK A;  5E0O A;  4KRC B;  4TV8 E;  5JH7 E;  3U78 A;  2CA5 A;  2CM0 A;  4IE6 A;  3C4Z A;  3M3Z B;  3HA4 A;  3AAA B;  5DQV A;  4ZXL A;  3FBL A;  4B3S T;  3FZH B;  2K5B B;  1PKD B;  4IT4 A;  4BY7 X;  1FVV B;  1J5E T;  4OR5 B;  4AKR B;  2W4X A;  3I0O A;  4L0R A;  2UUE B;  4ELJ A;  3K3O A;  3AE4 A;  4HE8 A;  4PJL A;  2CCQ A;  4JX6 A;  4EED A;  2B1E A;  2LLY A;  5FXZ A;  5FVK A;  3FZF B;  2LSJ A;  4NC6 A;  3V5S A;  3EOC B;  2ZM0 A;  1D0X A;  5LXT E;  1H1R B;  2LJL A;  1IRE B;  2WWV A;  4AQF A;  3KDS E;  4BCQ B;  4I4T E;  4V1A v;  3NWI A;  4HGA A;  2BS2 A;  4EB6 E;  2G9X B;  3LK3 B;  1H1S B;  2YOE A;  3IBP A;  4CFU D;  5JDF A;  2OA5 A;  4IRE A;  2DD5 B;  2V7M A;  4AQY T;  3LK4 2;  5FY1 A;  3L8R A;  2ZLY A;  4IDO A;  1QLB A;  1WYB A;  2Y6X A;  1N4M A;  1HS7 A;  1YXR A;  4ZI2 D;  3HHT B;  1JKW A;  5FL1 A;  2BZB A;  4DV2 T;  3JAD A;  4L5G A;  3P4P A;  2KND A;  2FUP A;  3HKD E;  3UU5 A;  3BG5 A;  4EYY R;  1WFD A;  1FMW A;  3KV6 A;  1UGQ B;  5CGM A;  1HG2 A;  2ZMA A;  4NUU A;  3RYC E;  4HFI A;  4MLK A;  3VKG A;  3QHR B;  2C5J A;  5HVY B;  5ACB A;  2E9X B;  2DNX A;  4I3Z B;  2L8K A;  4JEH B;  2BVM A;  2C6T B;  4H9S E;  2X68 A;  3BQL A;  3UUM A;  4F7S B;  3PO3 S;  3KBU A;  4ZGD B;  1BR1 A;  1OKW B;  4CFW B;  2IML A;  4KMC A;  1ZOY A;  4Z90 A;  3TW6 A;  2DPP B;  5JR9 A;  3IEE A;  3R84 B;  3HR0 A;  4AKL A;  4UN0 A;  4YJ2 E;  3DJB A;  5AQT B;  3ZEF B;  4IMY B;  1G8X A;  4N78 D;  2ZM6 T;  2RPA A;  4TX5 A;  1D0Z A;  3P4S A;  1MNE A;  3QB5 K;  1XMQ T;  4F8H A;  2OV9 A;  2IC6 A;  2NP9 A;  4CXX A;  3RI5 A;  2FJA A;  4O2A E;  4AI6 A;  2CMR A;  5FNV E;  2CCH B;  3B5M A;  3NKZ A;  2LOS A;  5AQV B;  4DV1 T;  3AA0 B;  1Y64 B;  2BG9 B;  3QUJ A;  1WRD A;  4EGW A;  4H9O C;  5JDH A;  1V9D A;  1XWM A;  4C91 A;  2XM1 A;  2C4G B;  4DBQ A;  3AEF A;  4TWD A;  2IW6 B;  2PK2 A;  2UU9 T;  2X9X A;  2LSK A;  2E2A A;  4PFP A;  4EXT A;  1YKH B;  4OB0 B;  3RC3 A;  4OYJ A;  3KV4 A;  1OED E;  4EIW A;  5LB7 B;  4F6R C;  4X20 E;  1M62 A;  3VHL A;  2H3R A;  1KXU A;  2C5O B;  4DV7 T;  3OYX A;  2BKZ B;  1LVK A;  2KT9 A;  3C4X A;  5L3F B;  3EAB A;  5LGU B;  5IF1 B;  3ZYL A;  3K3N A;  3VR8 A;  3RKO A;  3FZM B;  5FL0 A;  4WZX A;  4ROE A;  3QYE A;  3UFG A;  2CLY B;  3EDV A;  4I50 E;  5JR9 B;  3P8C D;  2HPJ A;  2HN1 A;  3PJA A;  2VL0 A;  5AQU B;  4AIU A;  2XSA A;  3PUR A;  2YIN A;  2NW7 A;  2Q9Q A;  4P09 A;  1ZP0 A;  2VAS A;  4JI7 T;  4JYA T;  3ONL C;  4A5X A;  3TN8 B;  4FI5 A;  2PJQ A;  3HB9 A;  3GWH A;  1ZEE A;  3TLT A;  4CXW A;  5ADX L;  4H9P C;  5EZY E;  3VU7 H;  4E7S A;  3VRB A;  2E8I A;  2WJ9 A;  3A8G B;  1HFA A;  5GON E;  3AXJ B;  2UUB T;  4EAH A;  1OIY B;  3QZ5 B;  1WYC A;  3UTK A;  4DMV A;  2VQF T;  1VIN A;  3AE9 A;  3TLV A;  3RLF F;  1E1H B;  1UGR B;  4JEU B;  4UV9 B;  3QYG B;  1ZHC A;  2XM2 A;  4QHO A;  2J1D G;  4JX5 A;  4U33 A;  3QXE B;  3TW7 A;  1NAF A;  4WW0 A;  5FYM A;  3OYZ A;  3T8O A;  1H7C A;  1P5E B;  2XHE B;  3S4U A;  4EZ4 A;  1OL1 B;  2LM2 A;  2W63 A;  1KF6 A;  1FIN B;  3IHR A;  4A98 A;  1JNR A;  4BBR M;  5LNK A;  3KBT A;  2OLT A;  5EK4 A;  2XQ5 A;  5AQH B;  2IVX A;  5ABF A;  4HLQ A;  3X26 B;  1HTJ F;  3ZT7 A;  3UU6 A;  2DCF A;  1O9K B;  4TWF A;  2WWU A;  1F5Q B;  2A2F X;  2E5V A;  2BBH A;  2NOX A;  3RF1 A;  3W15 B;  4LFA T;  5L2L A;  3G06 A;  3EID B;  2WZI A;  5LGT B;  2MPK A;  1FEW A;  2I53 A;  2KMG A;  4DR4 T;  4YSX A;  4HWC A;  2YKS A;  5BMV E;  2Y8D A;  3BG3 A;  1FKM A;  1GQE A;  3E08 A;  3MKD A;  2D0Q B;  2QDY B;  2WIP B;  4TWH A;  4IST A;  4JI2 T;  4JI6 T;  1NEK A;  3CK6 A;  2BS3 A;  4BBS M;  2ZPB B;  3NZP A;  3PTR B;  2V8S V;  1H1Q B;  2KMF A;  2WAU A;  3A8M B;  5AQS B;  2CXD A;  3T1Y T;  2ODV A;  1JOW A;  3ETV A;  3RRC A;  4FM4 B;  4OK0 A;  5H6R B;  4COF A;  3E22 E;  1GUX B;  1VOL A;  1HCI A;  2DXC B;  3O1H A;  3WVE B;  3SFD A;  3AE8 A;  1US7 B;  4IGU A;  4BCO B;  2CHN A;  3FBZ A;  3Q5X A;  2UUC T;  4L9I A;  5CYI B;  1XNQ T;  2XQA A;  4EZH A;  3CWZ B;  2DI4 A;  4IL9 A;  3F57 A;  4CRL B;  4HL4 A;  2W66 A;  1BR2 A;  1UNG D;  1UX4 A;  2V5D A;  1LKX A;  2FBW A;  3TNI B;  5HEG A;  4BCQ D;  3G33 B;  4EOP B;  2XQ4 A;  3TKL B;  3ZCJ A;  4HWI B;  3AAE B;  2DME A;  1JST B;  4GKK T;  3GN5 B;  3X1D A;  5FP3 A;  2CXL A;  5FVL A;  5ABG A;  2NTX A;  4IE0 A;  2BG9 A;  3EI0 A;  2XQ3 A;  4LOC A;  1BR4 A;  5L4H A;  4TV9 E;  4PK4 A;  3N9O A;  4H9N C;  3PUA A;  1FMV A;  4ZGJ B;  3UUB A;  4ZGE B;  3N9N A;  2QA7 A;  2NW9 A;  4ANJ A;  4BXX X;  2YEV C;  4OB3 B;  2ZZD B;  4HFC A;  3AA1 B;  1KK7 A;  4Y72 B;  3L3P A;  4BCJ B;  3RQU A;  3N9M A;  4J2C A;  3O1J A;  5HBH B;  2WFY B;  1UUR A;  5HBE B;  3NZQ A;  4YOO A;  1IBM T;  3PUS A;  2CCI B;  2H7O A;  2FJE A;  4CFM B;  1D3U B;  3Q5W A;  3H3M A;  2VL8 A;  2VB6 A;  2VWA A;  4JBW F;  2I59 A;  4ZEY A;  4Z8X A;  3RHW A;  3RH3 A;  5L4E A;  3CX7 B;  5KX5 E;  4DV3 T;  1S35 A;  2WSS V;  4HFD A;  4NST B;  3RIA A;  2CPT A;  1D1A A;  3H3A A;  4JI0 T;  5ABE A;  2EHO C;  2A9U A;  4ILA A;  3LBX A;  5HCM A;  4OGR B;  1UGP B;  2A72 A;  2X1N B;  2XAS B;  5FXV A;  1OKV B;  2WZH A;  4NXN T;  1LVF A;  3H4C A;  5I5Z B;  4X62 T;  4ZZC A;  5AQQ B;  2IW8 B;  5HXR A;  4UV8 B;  1W09 A;  4CN4 A;  4ZS2 A;  4PAG A;  4P0B A;  5AFU L;  2Z6E A;  5LBQ B;  5J0Z A;  2CLY C;  2PG8 A;  2LW4 A;  3MAC A;  2UXN B;  3N5L A;  3ABV A;  5HBJ B;  4U7I A;  2ACZ A;  3BK9 A;  4YOS A;  4X66 T;  4ZI2 C;  4CFV B;  2AHJ B;  3VKH A;  2PFV A;  5CJ5 A;  4F6S B;  2V22 B;  3LQ5 B;  3FZK B;  3BQK A;  2VQE T;  2QQ8 A;  5EJC A;  3E0Z A;  1JNZ A;  2DXB B;  2D2S A;  5HQ0 B;  2C5X B;  5CB4 E;  2JJ9 A;  1T7S A;  4TTH A;  2X9W A;  5HAX A;  4ZI3 D;  4ILU A;  5F5W A;  1D0Y A;  4X65 T;  2VKH A;  4GK5 E;  1XDO A;  4JI5 T;  4HWH A;  2D0T A;  4DBR A;  1T72 A;  4PW8 A;  1IJ5 A;  4CI3 B;  3I9W A;  2W99 A;  3GTM S;  2MBG A;  2W62 A;  2J62 A;  4IDP A;  3WVD B;  2KSR A;  1H1P B;  4GOU A;  2V7K A;  3CPZ A;  2HH7 A;  3HKE E;  3RYF E;  1IZN B;  3LJC A;  4IDN A;  3PE0 A;  2X66 A;  1WR6 A;  5HYA A;  4EC8 B;  3CX6 B;  2WCA A;  2W9Z A;  4DR1 T;  4Q25 A;  4X5T A;  4QXH B;  3K1S A;  4GYR A;  1G73 A;  3EVY A;  4EV6 A;  2N2N A;  3ONJ A;  4JUY A;  3F2E A;  1XNR T;  2J47 A;  4ILB A;  5KXJ A;  2E9X A;  2ACX A;  5FXX A;  2JPF A;  3A8O B;  5L3G B;  4CXA B;  2RP4 A;  2WB5 A;  2HPL A;  2LE8 A;  3UU8 A;  2YDS A;  5AQG B;  3KHI A;  3A7M A;  3LDQ B;  2PBI A;  2V7J A;  5LG4 A;  3ZSS A;  3VYG B;  4UXN B;  4MHC A;  3K7A M;  4G6L B;  3TLU A;  3AEA A;  5LMN T;  1FIO A;  4HKA A;  2YDR A;  4EOL B;  4F7J B;  2V6Y A;  1OGU B;  3QOF A;  3C4W A;  3ZT6 A;  1MMD A;  4JI8 T;  3QK6 A;  2BKP A;  3Q9D A;  2YN6 A;  1AJ3 A;  3N9L A;  2KLQ A;  4AIS A;  5IYZ E;  2ZPF B;  1YW0 A;  3HL6 A;  3LK2 B;  5ETW A;  2WDQ A;  5FMN A;  3I1A A;  1URC B;  2DHR A;  2CWO A;  3QB5 A;  4B6X A;  2V7I A;  1UGO A;  4E7Z A;  3O0G D;  4B3T T;  1MMN A;  1D1B A;  2WM9 A;  4UEL A;  1AD6 A;  5FY7 A;  3AVS A;  3BHV B;  2RA1 A;  2ZPH B;  4MFE A;  5HEO A;  4DR5 T;  3L09 A;  1VYW B;  3UFE A;  2LRL A;  2UXB T;  3ZPO A;  4HFH A;  3N2G E;  1QMZ B;  3AE5 A;  1TD6 A;  4OFZ A;  4QXC B;  4WBO A;  4BCI B;  2NW8 A;  3ESL A;  3MK7 C;  4HNT A;  1T8B A;  2UZB B;  2CZ7 B;  4NPP A;  3GMI A;  4YTM A;  1AHJ B;  5JTG A;  1H26 B;  4XBF B;  3JC6 D;  4KP3 C;  2N9D A;  2XY8 B;  2P9B A;  2H7V C;  2W2U A;  4O4I E;  4P0A A;  3UQ7 A;  5AQN B;  3K8P C;  2QYW A;  2ES0 A;  2XPK A;  1IJ6 A;  2V26 A;  5HEU A;  2AXD S;  4K0K T;  2W9F A;  4UF0 A;  4O2B E;  1FJG T;  1ZV4 X;  2LSY A;  4IE7 A;  4LFC T;  5CA1 E;  2KWI B;  5AQR B;  5LYJ E;  2WMA B;  5FY0 A;  4OX9 T;  2UUA T;  5AQO B;  1IAP A;  4IIJ E;  3RGF B;  2D5U A;  3SFE A;  5DAB A;  2JQQ A;  2I40 B;  4EOI B;  1UGS B;  4I0U A;  4DV4 T;  5DJQ C;  4YHJ A;  2W67 A;  5LCY A;  4CFN B;  3B13 A;  2NTY A;  1W0A A;  1Z8U A;  4DMW A;  2QGS A;  3RYH E;  1MMG A;  3PUG A;  1UNH D;  4YC3 B;  3RPU A;  2Q9Q C;  3PU3 A;  3UUX B;  4HFB A;  5KMG P;  4O8S A;  3BG9 A;  4HNU A;  1LRZ A;  1OL2 B;  3ZST A;  4HTE A;  2C0S A;  2JQK A;  3JAF A;  4YOZ A;  3KVB A;  2G77 A;  3MY1 B;  4YSY A;  3PV0 F;  4PJM A;  2EUF A;  4KX6 A;  2C5I T;  2XQ7 A;  5CA0 E;  5HCJ A;  4EOZ B;  4HFV A;  2UZL B;  2CHO A;  3MZK B;  4ILC A;  4QH1 A;  4TNW A;  2ZPE B;  3CKD A;  5J1G A;  4F7N B;  4U2Z A;  3CX8 B;  3ZCI A;  2X67 A;  4DV6 T;  2IAK A;  1HX1 B;  2C5K T;  4IL4 A;  4ZI7 E;  2BKO A;  2W00 A;  4LMJ A;  1N36 T;  2QFZ A;  4BY1 X;  2QRX A;  5J2U E;  2N1G A;  3M03 A;  4H63 H;  3KV5 A;  5LGN B;  4JV5 T;  2Q9Q B;  2X51 A;  3NRX A;  3ZT5 A;  2R6G F;  3ZYM A;  3QC9 A;  3EUH A;  4A97 A;  5JVD E;  2VUR A;  2XSB A;  3FHN A;  3MXZ A;  3DOG B;  1MIW A;  4GK0 E;  3D0T A;  2WMN A;  3SWH A;  4KHZ F;  2LSG A;  5IWA T;  4FX3 B;  1OWA A;  4EOO B;  2BG9 E;  3JC6 C;  4DO0 A;  1VRB A;  4U74 A;  1X9B A;  2PK9 B;  4X1K E;  3P4Q A;  3Q2M A;  3R6N A;  4CN1 A;  1SUM B;  4MFD A;  3OJA A;  2QDJ A;  2VVS A;  3X24 B;  3EHZ A;  3DTO A;  5BR8 T;  4BCN D;  5DQW A;  4AQF C;  4JLE A;  1MIY A;  5JRC B;  2VKJ A;  3TLS A;  2BKN A;  5FGK B;  4HWD A;  5HXS A;  2M6B A;  5TAO A;  3POM A;  1HNW T;  3P4R A;  2IN3 A;  4WYV A;  5ABH A;  2VVN A;  1O9K A;  5LJM A;  4PJN A;  1XO2 A;  4CI1 B;  3HO8 A;  2IIU A;  2KIN B;  2E9X D;  4AKG A;  3ZN1 B;  4ELL A;  4U3C A;  4PK5 A;  4M6V A;  5JDL A;  3OTO T;  1DU2 A;  3BLH B;  2JRK A;  4DR6 T;  3LBX B;  1GUX A;  2UXX B;  3BHU B;  5EK3 A;  3VYH B;  3PUQ A;  3NBX X;  1E7P A;  1SA0 E;  3WI3 A;  4PFO A;  5LHH B;  4Z91 A;  2B9R A;  1I6Z A;  4BCK B;  2MYS A;  3FB2 A;  1OI9 B;  2W61 A;  3ZMZ B;  3NRY A;  4JI4 T;  4CN6 A;  3C51 A;  1UX5 A;  4EOS B;  4AKI A;  3AEB A;  4YT0 A;  4YFS A;  3AXJ A;  4BCP B;  4HWF A;  5KDM C;  4FJO A;  3MY5 B;  4BCM D;  1OED C;  2WEV B;  4PJJ A;  2DWG A;  5C2T A;  3UUL A;  2HN2 A;  1KNZ A;  1XDP A;  4ZS3 A;  5IHY A;  1E9H B;  2Y48 B;  4XZC A;  1L0V A;  3KFW X;  4C90 A;  3RGL A;  1HX8 A;  3UUN A;  3ZMS B;  4BJN A; 
#chains in the Genus database with same CATH homology
 4X20 E;  3CX6 B;  5JDQ A;  2YK0 A;  3VHL A;  2H3R A;  4ADZ A;  5HWX A;  3M65 A;  4QXH B;  3ZMU B;  3OYX A;  2D0U A;  3FXE B;  4H9R C;  4IE5 A;  4GYR A;  3UT5 E;  1G73 A;  1LVK A;  3EVY A;  5LBM A;  2KT9 A;  3C4X A;  5L3F B;  2N2N A;  3O4X E;  5LGU B;  3AA6 B;  3MA9 A;  4JUY A;  3F2E A;  5LP6 E;  1MND A;  3KV9 A;  3SS1 A;  3ZYL A;  4KBM B;  5JRC A;  3K3N A;  3RKO A;  2E9X A;  2ACX A;  2VKD A;  5H6Q B;  5FXX A;  3SRZ A;  2JPF A;  5L3G B;  1YD8 G;  2LM9 A;  2RP4 A;  4K0U A;  4DVD A;  2HPL A;  2CLY B;  5F3J A;  2LE8 A;  3EDV A;  4I50 E;  2LEH A;  5EK2 A;  5JR9 B;  3P8C D;  2HPJ A;  3IF8 B;  1VOM A;  4MAL A;  4X1I E;  3N9Q A;  4QX7 B;  3RX6 A;  1U5P A;  2PBI A;  2V7J A;  3PUR A;  5LG4 A;  2YIN A;  2NW7 A;  1EZ3 A;  4ZHQ E;  3ZLI A;  4UXN B;  2Q9Q A;  4MHC A;  4P09 A;  2VKO A;  2ZM2 A;  2VAS A;  3OKQ A;  1FIO A;  3F31 A;  4HKA A;  4CXY A;  2K9A A;  3ZJ2 A;  3I0Q A;  4FI5 A;  2PJQ A;  5LHG B;  4UIG A;  5HXE A;  4I55 E;  5JRE A;  3GWH A;  4PK6 A;  1ZEE A;  4CXW A;  3J7Y q;  5ADX L;  4H9P C;  5EZY E;  3VU7 H;  4E7S A;  3C4W A;  1T98 A;  2E8I A;  1MMD A;  4KUM B;  1HFA A;  1NWM X;  3QK6 A;  5GON E;  4OYK A;  3HI2 A;  4EAH A;  3UTK A;  1WYC A;  3Q9D A;  4DMV A;  1E1H B;  1AJ3 A;  5HXC A;  4JEU B;  3N9L A;  2KLQ A;  4UV9 B;  2EHO A;  1ZHC A;  3U3I A;  5IYZ E;  1YW0 A;  5LA6 E;  4QHO A;  2J1D G;  2Q9Q D;  3HL6 A;  2XAJ B;  2WBL A;  1NAF A;  2K48 A;  3LK2 B;  4WW0 A;  5FYM A;  1X79 A;  4TUY E;  3AB3 B;  3OYZ A;  5ETW A;  4ASK A;  3T8O A;  5FMN A;  4OHF A;  2WMO A;  3I1A A;  1H7C A;  2XHE B;  2DHR A;  3S4U A;  2CWO A;  4ERR A;  4EZ4 A;  3O9X A;  2W63 A;  4NUV A;  4B6X A;  2V7I A;  4E7Z A;  3IHR A;  3A5X A;  5JDN A;  3KBT A;  5LNK A;  5EK4 A;  2ZM8 A;  4G2A A;  3RRW A;  2KXP B;  1MMN A;  2XAH B;  4WBN E;  1D1B A;  2WM9 A;  4UEL A;  5FY7 A;  2DLR A;  3AVS A;  3CQG B;  2RA1 A;  2LT3 A;  1UCU A;  1HTJ F;  3KVA A;  3EDU A;  3L09 A;  3H37 A;  2DCF A;  2W0G A;  2WWU A;  3UFE A;  4O4H E;  2SPC A;  4IHJ E;  2A2F X;  3P7I A;  2NOX A;  3ZPO A;  2YU2 A;  4H63 V;  4X1Y E;  3W15 B;  3N2G E;  3OBV E;  5L2L A;  4AXP A;  3HKC E;  4OFZ A;  5F8P A;  5LGT B;  4HEA A;  1FEW A;  4QXC B;  2NWB A;  4WBO A;  1S94 A;  2KZ7 B;  4YLH A;  2NW8 A;  3ESL A;  3MK7 C;  5BMV E;  4O4L E;  2Y8D A;  2V1D B;  3HKB E;  3E08 A;  3GMI A;  4MBQ A;  2X9H A;  3B57 A;  2LHN A;  3ANW B;  3CQC B;  3MKD A;  2GK9 A;  3C98 B;  5LHI B;  3AAI A;  2BVL A;  2CXF A;  2X9Y A;  4IST A;  4XBF B;  3JC6 D;  3ANW A;  4KP3 C;  2N9D A;  3ZMT B;  3ZJ1 A;  3N2K E;  2M67 A;  2P9B A;  2H7V C;  3NZP A;  3KIN B;  3PTR B;  4O4I E;  4P0A A;  2KMF A;  3ZYK A;  2WAU A;  4QKN A;  1D1C A;  4M1P A;  4UF0 B;  3FXD B;  3SOL A;  3K8P C;  3ONX A;  5LJN A;  2LOP A;  2CXD A;  2ES0 A;  2L3L A;  5HXH A;  2BDE A;  1IJ6 A;  4QWN B;  2ODV A;  2V26 A;  3ETV A;  3RRC A;  3LG7 A;  1WLX A;  3V5U A;  2DWK A;  4EYU A;  2IW5 B;  4MFR A;  4OK0 A;  4UF0 A;  4O2B E;  1ZKE A;  5H6R B;  1ZV4 X;  2LSY A;  1B7T A;  3E22 E;  4IE7 A;  3CVR A;  5CA1 E;  4G63 A;  1MIV A;  2KWI B;  1HCI A;  3O1H A;  3WAK A;  1CUN A;  5LYJ E;  4I43 B;  1US7 B;  5FY0 A;  2VK9 A;  3C64 A;  4IGU A;  3K3Q C;  4QXB B;  4XAX B;  3FBZ A;  2E9X C;  4BA9 A;  3GA8 A;  1IAP A;  4IIJ E;  5E0O A;  2D5U A;  4TV8 E;  3Q5X A;  4L9I A;  5DAB A;  5JH7 E;  3U78 A;  2CA5 A;  2CM0 A;  2JQQ A;  4IE6 A;  4EZH A;  3CWZ B;  3C4Z A;  2DI4 A;  3F57 A;  1BR2 A;  1UX4 A;  3AAA B;  3HA4 A;  5DQV A;  5DJQ C;  1LKX A;  3FBL A;  4UVC B;  1HF8 A;  4YHJ A;  2IC9 A;  2K5B B;  2X0L B;  5FXW A;  5LCY A;  3B13 A;  2NTY A;  3AA7 B;  4DMW A;  2QGS A;  3RYH E;  4AKH A;  1MMG A;  3PUG A;  4AKR B;  3I0O A;  3MJX A;  4L0R A;  2Q9Q C;  3RPU A;  3TKL B;  3ZCJ A;  3PU3 A;  3UUX B;  5KMG P;  3K3O A;  4UVA B;  2XUE A;  4HE8 A;  2L9Q A;  4PJL A;  4O8S A;  2XTL A;  4GYS A;  2CCQ A;  5L3B B;  2MOZ A;  3AAE B;  1LRZ A;  3O1I A;  3GN5 B;  2B1E A;  5FXZ A;  5FP3 A;  2CXL A;  2LSJ A;  3V5S A;  2XAF B;  4HTE A;  4QX8 B;  1HG5 A;  2C0S A;  2NTX A;  2ZM0 A;  4IE0 A;  4ZOL E;  4PNI A;  3KVB A;  3N2O A;  4ZI3 C;  1D0X A;  5LXT E;  1BR4 A;  4PJM A;  2K24 A;  4TV9 E;  4PK4 A;  2C5I T;  2XQY A;  3N9O A;  4H9N C;  5CA0 E;  3PUA A;  4EOZ B;  1FMV A;  4HFV A;  1QSD A;  2LJL A;  3N9N A;  2QA7 A;  3MZK B;  4U72 A;  2NW9 A;  4ANJ A;  2YEV C;  3ZN0 B;  4AQF A;  3KDS E;  3PDY A;  3AA1 B;  1KK7 A;  4I4T E;  4V1A v;  3ZC0 A;  3L3P A;  3CKD A;  4HGA A;  5J1G A;  4EB6 E;  3N9M A;  4J2C A;  2JMK A;  3LK3 B;  3N9P A;  3O1J A;  5C8Y E;  3ZCI A;  3CX8 B;  3IBP A;  2X67 A;  2KWH A;  3ZC1 A;  2IAK A;  2LHR A;  2LSI A;  2C5K T;  3NZQ A;  4ZI7 E;  5J2T E;  1OXZ A;  5JDF A;  2W00 A;  2OA5 A;  2H7O A;  3LFM A;  3PUS A;  1SHZ C;  4YJ3 E;  2V7M A;  3LK4 2;  5J2U E;  2N1G A;  3CML A;  5FY1 A;  4H63 H;  3KV5 A;  3Q5W A;  2ZLY A;  3GN5 A;  5LGN B;  2Q9Q B;  1WYB A;  2VL8 A;  2X51 A;  2Y6X A;  1HS7 A;  3NRX A;  4ZI2 D;  4AQG A;  2VB6 A;  3ZYM A;  3QC9 A;  2VWA A;  3EUH A;  2BZB A;  2I59 A;  2EHO B;  4IDZ A;  3RC8 A;  2V7L A;  3I9Y A;  4L5G A;  5JVD E;  4Z8X A;  5A1L A;  2KND A;  3RH3 A;  3FHN A;  3HKD E;  3MXZ A;  4IE4 A;  2G0U A;  3CX7 B;  1MIW A;  4GK0 E;  5KX5 E;  3D0T A;  2EHO D;  4UVB B;  2WMN A;  3SWH A;  1S35 A;  2WSS V;  3KV6 A;  1FMW A;  4EYY R;  2LSG A;  2XAQ B;  3RYI E;  1OWA A;  2XAG B;  3JC6 C;  4DO0 A;  1VRB A;  1D1A A;  4U74 A;  3DP7 A;  2ZMA A;  1HG2 A;  2CWY A;  4X1K E;  3H3A A;  4CZZ B;  4NUU A;  3Q2M A;  3R6N A;  4MLK A;  3RYC E;  5L3D B;  3VKG A;  5L3C B;  3BQI A;  2C5J A;  3OJA A;  2EHO C;  3LBX A;  3AVR A;  3DTO A;  2A72 A;  2XAS B;  2E9X B;  5DQW A;  4AQF C;  5FXV A;  4JLE A;  2DNX A;  1MIY A;  5JRC B;  1Z0P A;  2VKJ A;  1LVF A;  2L8K A;  4GIW A;  4JEH B;  2BVM A;  5HXR A;  1YKE B;  4UV8 B;  5HXS A;  4H9S E;  1QUU A;  5TAO A;  2X68 A;  3BQL A;  4ZS2 A;  4CI2 B;  4PAG A;  4P0B A;  3UUM A;  3KBU A;  5AFU L;  1BR1 A;  2Z6E A;  5LBQ B;  4A56 A;  3J9X 1;  5LJM A;  4TZ4 C;  2MTQ A;  4PJN A;  5JDG A;  2CLY C;  2PG8 A;  4CI1 B;  4KMC A;  2KIN B;  2E9X D;  3MAC A;  2UXN B;  5LOV E;  3ZN1 B;  5HWY A;  4AKG A;  3N5L A;  3PU8 A;  5JR9 A;  5M4Y A;  3IEE A;  4PK5 A;  3R84 B;  5JDL A;  3HR0 A;  2CEA A;  4AKL A;  3BK9 A;  4ZI2 C;  2PFV A;  3VKH A;  4YJ2 E;  3DJB A;  3BQK A;  3E0Z A;  2JRK A;  3ZEF B;  1G8X A;  3LBX B;  4N78 D;  2UXX B;  1D0Z A;  2D2S A;  4TX5 A;  3PUQ A;  1MNE A;  5EK3 A;  3NBX X;  1SA0 E;  4O4J E;  3WI3 A;  5CB4 E;  4PFO A;  2JJ9 A;  5LHH B;  1BR0 A;  4H9Q C;  2IC6 A;  3WAJ A;  2NP9 A;  2X9W A;  2A3D A;  1MMA A;  5HAX A;  4CXX A;  4HN9 A;  2MYS A;  4O2A E;  4ZI3 D;  4ILU A;  4DND A;  1D0Y A;  5L3E B;  4AI6 A;  2CMR A;  3FB2 A;  2VKH A;  5FNV E;  2W61 A;  3ZMZ B;  3NRY A;  4BAY B;  4UEM A;  5JR9 C;  4GK5 E;  1U4Q A;  2LOS A;  3CQX C;  3C51 A;  1UX5 A;  2D0T A;  4DBR A;  4WNK A;  5JQG E;  1O3X A;  2ODU A;  4PW8 A;  1IJ5 A;  3ETU A;  4AKI A;  3AA0 B;  1Y64 B;  4CI3 B;  3I9W A;  4YFS A;  3QUJ A;  4CQI A;  1WRD A;  4H9O C;  5JDH A;  1V9D A;  2JMH A;  5KDM C;  4FJO A;  3ZMV B;  4C91 A;  4DBQ A;  2MBG A;  2W62 A;  4GOU A;  4PJJ A;  2V7K A;  3CPZ A;  2DWG A;  2X9X A;  2YU1 A;  2LSK A;  4ISS A;  2HH7 A;  3HKE E;  3RYF E;  3UUL A;  1IZN B;  4PFP A;  4EXT A;  1YKH B;  3LJC A;  1KNZ A;  2CE7 A;  4ZS3 A;  5IHY A;  3PE0 A;  3RC3 A;  4OYJ A;  4BJM A;  5JDM A;  2Y48 B;  3C50 A;  3KV4 A;  4XZC A;  3KFW X;  2X66 A;  4C90 A;  1WR6 A;  4TN7 B;  1HX8 A;  4EIW A;  3UUN A;  5HYA A;  3ZMS B;  4BJN A;  4F6R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...