1H28B

Cdk2/cyclina in complex with an 11-residue recruitment peptide from p107
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Specificity Determinants of Recruitment Peptides Bound to Phospho-Cdk2/Cyclin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle/transferase substrate
total genus 91
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h28B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h28B02
3MIAB 2WHBB 2PHGA 4CXAB 4BCOB 4CRLB 1JKWA 2EUFA 3BHTB 4CFVB 4EC8B 5HBEB 1G3NC 1OIUB 1O9KB 2G9XB 4FX3B 1GY3B 2PK9B 5HNBB 4F6SB 4F6WB 5ICPB 4BCPB 4F6UB 4EONB 1OL2B 4OR5B 1O9KA 4F7JB 1FINB 2C5NB 3EOCB 4ELJA 3BLRB 4BCMD 4OGRB 4UN0A 2C4GB 4CFMB 1OGUB 2PMIB 5HBHB 4BCJB 3LQ5B 4BCFB 4CFWB 2UUEB 4ROCA 2W9FA 4BCKB 5CYIB 2PK2A 2W99A 1F5QB 2CJMB 2IVXA 5CEIB 4F7NB 4EOOB 3K7AM 3MI9B 3TN8B 4CFUD 1H1RB 4CFUB 1H1PB 4BCHB 4TTHA 1TFBA 1OKVB 2UZDB 2W96A 2WXVB 2C5OB 4IMYB 4CFNB 4EOKB 4F70B 4YC3B 3DOGB 1UNGD 2F2CA 1H28B 5FGKB 1UNHD 4BCIB 3H4CA 1BU2A 4KRCB 4NSTB 3O0GD 1H25B 1UNLD 5IDPB 5I5ZB 1OI9B 2BKZB 3RGFB 4ELLA 1QMZB 4BCNB 4KRDB 4YOZA 5L2WB 3MY5B 4EORB 3QHWB 4EOQB 3DDPB 3POMA 5HQ0B 3TNIB 1VOLA 1OIYB 4I3ZB 4F7SB 2WFYB 2WMBB 2I53A 4II5B 5EFQB 3F5XB 3DDQB 1H4LD 2C6TB 2CCIB 4YOSA 2W2HA 4BCGB 1H24B 4EOMB 2WPAB 2C5VB 2WIHB 1OL1B 2QDJA 2B9RA 3G33B 5BNJB 4RODA 5ACBA 3TNHB 1GUXB 3BLQB 5HBJB 5IDNB 1VINA 1N4MA 1W98B 5LMKB 2IW9B 2IW8B 3BLHB 4EC9B 1ZP2A 2UZLB 2C5XB 4BCND 1KXUA 2IW6B 4F7LB 1AISB 2WMAB 3EJ1B 3BHUB 4Y72B 1JSUB 4BCQB 4BCQD 4EOSB 4ROEA 2BPMB 1H1SB 1H1QB 1OKWB 1JOWA 2CCHB 5HVYB 2WIPB 1H26B 1GH6B 2UZEB 1FVVB 2X1NB 1C9BA 1JSTB 3MY1B 5IF1B 4EOPB 2W9ZA 4EOJB 3TNWB 1D3UB 1P5EB 3BHVB 2R7GA 1H27B 3QHRB 1URCB 5LQFB 4BCMB 4G6LB 4EOIB 1PKDB 2JGZB 1E9HB 1GUXA 1VYWB 1AD6A 4YOOA 3EIDB 2WEVB 2V22B 4EOLB 4CFXB 2UZBB 3M03A 2I40B 1XO2A
chains in the Genus database with same CATH superfamily
4CXAB 4HNUA 1JKWA 3BHTB 2DD5B 5HBEB 3DTOA 4FX3B 5ICPB 4EONB 4OR5B 1O9KA 2DMEA 4BCMD 4ZGEB 2C4GB 3A8OB 3HZJA 3LQ5B 4BCFB 4CFWB 2W9FA 2PK2A 2CZ6B 4CFUB 3K7AM 3MI9B 4CFUD 2ZPIB 4TTHA 2QF7A 1OKVB 2WXVB 2C5OB 2KR6A 1D3UB 4YC3B 1UNGD 2CYZB 2DPPB 4BY7X 3RGFB 5EJCA 4EORB 3POMA 2QFZA 5EFQB 3A8HB 2C6TB 3KHIA 5IHYA 4JX6A 2ZZDB 2QDJA 4RODA 5ACBA 5DQWA 3TNHB 3QZ5B 2KMGA 4NC6A 4EC9B 4F7LB 2WMAB 4Y72B 3QYBA 2UZEB 1FVVB 3HBLA 2X1NB 1C9BA 1JSTB 2ZCFB 3MY1B 3BHVB 1IREB 4MIMA 1ENWA 1E9HB 4YOOA 1XO2A 3HO8A 4BCOB 4CRLB 2D0QB 2EUFA 4CFVB 2CZ0B 3GTMS 1G3NC 1OIUB 1O9KB 1GY3B 2ZPFB 1OL2B 2C5NB 4CFMB 1OGUB 5HBHB 1UGSB 4BCKB 3QYGB 2W99A 4M6VA 1F5QB 5CEIB 3TN8B 1H1PB 1TFBA 4EOKB 4BCIB 2F2CA 4JX5A 1UNHD 4NSTB 1H25B 1OI9B 1QMZB 4BCNB 4KRDB 4EOQB 3QHWB 3TNIB 2WFYB 2I53A 2W2HA 1H4LD 2CCIB 1H24B 4HL4A 2WIHB 1OL1B 5BNJB 1GUXB 3X25B 4AKHA 5IDNB 5LMKB 4AKGA 4BBSM 3BLHB 4AKIA 1V29B 4ZGJB 1AISB 3BHUB 4OB3B 1JSUB 1H1SB 1JOWA 4HNVA 1GH6B 5IF1B 2W9ZA 1H27B 5LQFB 3X28B 1GUXA 3EIDB 2WEVB 2ZPGB 2R7GA 4HLQA 2PHGA 3QZ9B 4OB0B 3BG9A 2PK9B 5HNBB 4F6WB 4BCPB 2QDYB 1UGRB 2CZ7B 4F6UB 4F7JB 2QGSA 3BG3A 1FINB 3BLRB 4OGRB 4UN0A 1UGQB 3VKGA 4BCJB 3X20B 2QQ8A 4ROCA 3HB9A 2CJMB 2IVXA 4F7NB 2G77A 4EOOB 1H1RB 4CFNB 2BS2A 3DOGB 3H4CA 4KRCB 1UGPB 5IDPB 5DQVA 4ELLA 4YOZA 5L2WB 3MY5B 4II5B 4BCGB 2BS3A 2C5VB 3TW6A 2B9RA 3G33B 2WJ9A 3BLQB 2BS4A 3WVDB 1W98B 2IW9B 1ZP2A 2UZLB 2C5XB 4BCND 1KXUA 2IW6B 4OB2B 3EJ1B 4BCQB 4BCQD 4AI6A 4ROEA 1OKWB 4HNTA 2WIPB 2PJQA 4LOCA 4EOJB 1P5EB 3QHRB 3QYEA 3WVEB 4BCMB 4EOIB 2JGZB 4QSHA 3X26B 2V22B 3TW7A 4CFXB 4F7SB 4MFDA 3MIAB 2IN3A 2WHBB 3VYGB 3X24B 2ZPHB 4EC8B 3NDQA 2G9XB 4F6SB 3A8GB 3DL1A 2ZPBB 3QWLA 3EOCB 4ELJA 3VKHA 2PMIB 4OB1B 3B57A 2DD4B 2UUEB 4Z6YA 5CYIB 1FKMA 4BCHB 2UZDB 2W96A 4IMYB 4FM4B 4F70B 1TD6A 5FGKB 1H28B 4BXXX 1BU2A 4MFEA 3O0GD 1UNLD 5I5ZB 2BKZB 3VYHB 2LW4A 3DDPB 5HQ0B 1OIYB 4I3ZB 1VOLA 2WMBB 3QYHB 3F5XB 3DDQB 4YOSA 4BBRM 4EOMB 2WPAB 3A8LB 4BY1X 5HBJB 2ZPEB 1VINA 1N4MA 3PO3S 2IW8B 3A8MB 1QLBA 2CZ1B 3BG5A 2DXCB 4EOSB 2BPMB 2CCHB 1H1QB 1E7PA 5HVYB 2AHJB 1H26B 4EOPB 3TNWB 1URCB 4ZGDB 4G6LB 2DXBB 1PKDB 3QXEB 1VYWB 1AD6A 4JX4A 4EOLB 2UZBB 3HHTB 3M03A 3DJBA 2I40B 1AHJB
chains in the Genus database with same CATH topology
3MIAB 2WHBB 2PHGA 4CXAB 4BCOB 4CRLB 1JKWA 2EUFA 3BHTB 4CFVB 4EC8B 5HBEB 1G3NC 1OIUB 1O9KB 2G9XB 4FX3B 1GY3B 2PK9B 5HNBB 4F6SB 4F6WB 5ICPB 4BCPB 4F6UB 4EONB 1OL2B 4OR5B 1O9KA 4F7JB 1FINB 2C5NB 3EOCB 4ELJA 3BLRB 4BCMD 4OGRB 4UN0A 2C4GB 4CFMB 1OGUB 2PMIB 5HBHB 4BCJB 3LQ5B 4BCFB 4CFWB 2UUEB 4ROCA 2W9FA 4BCKB 5CYIB 2PK2A 2W99A 1F5QB 2CJMB 2IVXA 5CEIB 4F7NB 4EOOB 3K7AM 3MI9B 3TN8B 4CFUD 1H1RB 4CFUB 1H1PB 4BCHB 4TTHA 1TFBA 1OKVB 2UZDB 2W96A 2WXVB 2C5OB 4IMYB 4CFNB 4EOKB 4F70B 4YC3B 3DOGB 1UNGD 2F2CA 1H28B 5FGKB 1UNHD 4BCIB 3H4CA 1BU2A 4KRCB 4NSTB 3O0GD 1H25B 1UNLD 5IDPB 5I5ZB 1OI9B 2BKZB 3RGFB 4ELLA 1QMZB 4BCNB 4KRDB 4YOZA 5L2WB 3MY5B 4EORB 3QHWB 4EOQB 3DDPB 3POMA 5HQ0B 3TNIB 1VOLA 1OIYB 4I3ZB 4F7SB 2WFYB 2WMBB 2I53A 4II5B 5EFQB 3F5XB 3DDQB 1H4LD 2C6TB 2CCIB 4YOSA 2W2HA 4BCGB 1H24B 4EOMB 2WPAB 2C5VB 2WIHB 1OL1B 2QDJA 2B9RA 3G33B 5BNJB 4RODA 5ACBA 3TNHB 1GUXB 3BLQB 5HBJB 5IDNB 1VINA 1N4MA 1W98B 5LMKB 2IW9B 2IW8B 3BLHB 4EC9B 1ZP2A 2UZLB 2C5XB 4BCND 1KXUA 2IW6B 4F7LB 1AISB 2WMAB 3EJ1B 3BHUB 4Y72B 1JSUB 4BCQB 4BCQD 4EOSB 4ROEA 2BPMB 1H1SB 1H1QB 1OKWB 1JOWA 2CCHB 5HVYB 2WIPB 1H26B 1GH6B 2UZEB 1FVVB 2X1NB 1C9BA 1JSTB 3MY1B 5IF1B 4EOPB 2W9ZA 4EOJB 3TNWB 1D3UB 1P5EB 3BHVB 2R7GA 1H27B 3QHRB 1URCB 5LQFB 4BCMB 4G6LB 4EOIB 1PKDB 2JGZB 1E9HB 1GUXA 1VYWB 1AD6A 4YOOA 3EIDB 2WEVB 2V22B 4EOLB 4CFXB 2UZBB 3M03A 2I40B 1XO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MIA B;  2WHB B;  2PHG A;  4CXA B;  4BCO B;  4CRL B;  1JKW A;  2EUF A;  3BHT B;  4CFV B;  4EC8 B;  5HBE B;  1G3N C;  1OIU B;  1O9K B;  2G9X B;  4FX3 B;  1GY3 B;  2PK9 B;  5HNB B;  4F6S B;  4F6W B;  5ICP B;  4BCP B;  4F6U B;  4EON B;  1OL2 B;  4OR5 B;  1O9K A;  4F7J B;  1FIN B;  2C5N B;  3EOC B;  4ELJ A;  3BLR B;  4BCM D;  4OGR B;  4UN0 A;  2C4G B;  4CFM B;  1OGU B;  2PMI B;  5HBH B;  4BCJ B;  3LQ5 B;  4BCF B;  4CFW B;  2UUE B;  4ROC A;  2W9F A;  4BCK B;  5CYI B;  2PK2 A;  2W99 A;  1F5Q B;  2CJM B;  2IVX A;  5CEI B;  4F7N B;  4EOO B;  3K7A M;  3MI9 B;  3TN8 B;  4CFU D;  1H1R B;  4CFU B;  1H1P B;  4BCH B;  4TTH A;  1TFB A;  1OKV B;  2UZD B;  2W96 A;  2WXV B;  2C5O B;  4IMY B;  4CFN B;  4EOK B;  4F70 B;  4YC3 B;  3DOG B;  1UNG D;  2F2C A;  1H28 B;  5FGK B;  1UNH D;  4BCI B;  3H4C A;  1BU2 A;  4KRC B;  4NST B;  3O0G D;  1H25 B;  1UNL D;  5IDP B;  5I5Z B;  1OI9 B;  2BKZ B;  3RGF B;  4ELL A;  1QMZ B;  4BCN B;  4KRD B;  4YOZ A;  5L2W B;  3MY5 B;  4EOR B;  3QHW B;  4EOQ B;  3DDP B;  3POM A;  5HQ0 B;  3TNI B;  1VOL A;  1OIY B;  4I3Z B;  4F7S B;  2WFY B;  2WMB B;  2I53 A;  4II5 B;  5EFQ B;  3F5X B;  3DDQ B;  1H4L D;  2C6T B;  2CCI B;  4YOS A;  2W2H A;  4BCG B;  1H24 B;  4EOM B;  2WPA B;  2C5V B;  2WIH B;  1OL1 B;  2QDJ A;  2B9R A;  3G33 B;  5BNJ B;  4ROD A;  5ACB A;  3TNH B;  1GUX B;  3BLQ B;  5HBJ B;  5IDN B;  1VIN A;  1N4M A;  1W98 B;  5LMK B;  2IW9 B;  2IW8 B;  3BLH B;  4EC9 B;  1ZP2 A;  2UZL B;  2C5X B;  4BCN D;  1KXU A;  2IW6 B;  4F7L B;  1AIS B;  2WMA B;  3EJ1 B;  3BHU B;  4Y72 B;  1JSU B;  4BCQ B;  4BCQ D;  4EOS B;  4ROE A;  2BPM B;  1H1S B;  1H1Q B;  1OKW B;  1JOW A;  2CCH B;  5HVY B;  2WIP B;  1H26 B;  1GH6 B;  2UZE B;  1FVV B;  2X1N B;  1C9B A;  1JST B;  3MY1 B;  5IF1 B;  4EOP B;  2W9Z A;  4EOJ B;  3TNW B;  1D3U B;  1P5E B;  3BHV B;  2R7G A;  1H27 B;  3QHR B;  1URC B;  5LQF B;  4BCM B;  4G6L B;  4EOI B;  1PKD B;  2JGZ B;  1E9H B;  1GUX A;  1VYW B;  1AD6 A;  4YOO A;  3EID B;  2WEV B;  2V22 B;  4EOL B;  4CFX B;  2UZB B;  3M03 A;  2I40 B;  1XO2 A; 
#chains in the Genus database with same CATH topology
 4CXA B;  4HNU A;  1JKW A;  3BHT B;  2DD5 B;  5HBE B;  3DTO A;  4FX3 B;  5ICP B;  4EON B;  4OR5 B;  1O9K A;  2DME A;  4BCM D;  4ZGE B;  2C4G B;  3A8O B;  3HZJ A;  3LQ5 B;  4BCF B;  4CFW B;  2W9F A;  2PK2 A;  2CZ6 B;  4CFU B;  3K7A M;  3MI9 B;  4CFU D;  2ZPI B;  4TTH A;  2QF7 A;  1OKV B;  2WXV B;  2C5O B;  2KR6 A;  1D3U B;  4YC3 B;  1UNG D;  2CYZ B;  2DPP B;  4BY7 X;  3RGF B;  5EJC A;  4EOR B;  3POM A;  2QFZ A;  5EFQ B;  3A8H B;  2C6T B;  3KHI A;  5IHY A;  4JX6 A;  2ZZD B;  2QDJ A;  4ROD A;  5ACB A;  5DQW A;  3TNH B;  3QZ5 B;  2KMG A;  4NC6 A;  4EC9 B;  4F7L B;  2WMA B;  4Y72 B;  3QYB A;  2UZE B;  1FVV B;  3HBL A;  2X1N B;  1C9B A;  1JST B;  2ZCF B;  3MY1 B;  3BHV B;  1IRE B;  4MIM A;  1ENW A;  1E9H B;  4YOO A;  1XO2 A;  3HO8 A;  4BCO B;  4CRL B;  2D0Q B;  2EUF A;  4CFV B;  2CZ0 B;  3GTM S;  1G3N C;  1OIU B;  1O9K B;  1GY3 B;  2ZPF B;  1OL2 B;  2C5N B;  4CFM B;  1OGU B;  5HBH B;  1UGS B;  4BCK B;  3QYG B;  2W99 A;  4M6V A;  1F5Q B;  5CEI B;  3TN8 B;  1H1P B;  1TFB A;  4EOK B;  4BCI B;  2F2C A;  4JX5 A;  1UNH D;  4NST B;  1H25 B;  1OI9 B;  1QMZ B;  4BCN B;  4KRD B;  4EOQ B;  3QHW B;  3TNI B;  2WFY B;  2I53 A;  2W2H A;  1H4L D;  2CCI B;  1H24 B;  4HL4 A;  2WIH B;  1OL1 B;  5BNJ B;  1GUX B;  3X25 B;  4AKH A;  5IDN B;  5LMK B;  4AKG A;  4BBS M;  3BLH B;  4AKI A;  1V29 B;  4ZGJ B;  1AIS B;  3BHU B;  4OB3 B;  1JSU B;  1H1S B;  1JOW A;  4HNV A;  1GH6 B;  5IF1 B;  2W9Z A;  1H27 B;  5LQF B;  3X28 B;  1GUX A;  3EID B;  2WEV B;  2ZPG B;  2R7G A;  4HLQ A;  2PHG A;  3QZ9 B;  4OB0 B;  3BG9 A;  2PK9 B;  5HNB B;  4F6W B;  4BCP B;  2QDY B;  1UGR B;  2CZ7 B;  4F6U B;  4F7J B;  2QGS A;  3BG3 A;  1FIN B;  3BLR B;  4OGR B;  4UN0 A;  1UGQ B;  3VKG A;  4BCJ B;  3X20 B;  2QQ8 A;  4ROC A;  3HB9 A;  2CJM B;  2IVX A;  4F7N B;  2G77 A;  4EOO B;  1H1R B;  4CFN B;  2BS2 A;  3DOG B;  3H4C A;  4KRC B;  1UGP B;  5IDP B;  5DQV A;  4ELL A;  4YOZ A;  5L2W B;  3MY5 B;  4II5 B;  4BCG B;  2BS3 A;  2C5V B;  3TW6 A;  2B9R A;  3G33 B;  2WJ9 A;  3BLQ B;  2BS4 A;  3WVD B;  1W98 B;  2IW9 B;  1ZP2 A;  2UZL B;  2C5X B;  4BCN D;  1KXU A;  2IW6 B;  4OB2 B;  3EJ1 B;  4BCQ B;  4BCQ D;  4AI6 A;  4ROE A;  1OKW B;  4HNT A;  2WIP B;  2PJQ A;  4LOC A;  4EOJ B;  1P5E B;  3QHR B;  3QYE A;  3WVE B;  4BCM B;  4EOI B;  2JGZ B;  4QSH A;  3X26 B;  2V22 B;  3TW7 A;  4CFX B;  4F7S B;  4MFD A;  3MIA B;  2IN3 A;  2WHB B;  3VYG B;  3X24 B;  2ZPH B;  4EC8 B;  3NDQ A;  2G9X B;  4F6S B;  3A8G B;  3DL1 A;  2ZPB B;  3QWL A;  3EOC B;  4ELJ A;  3VKH A;  2PMI B;  4OB1 B;  3B57 A;  2DD4 B;  2UUE B;  4Z6Y A;  5CYI B;  1FKM A;  4BCH B;  2UZD B;  2W96 A;  4IMY B;  4FM4 B;  4F70 B;  1TD6 A;  5FGK B;  1H28 B;  4BXX X;  1BU2 A;  4MFE A;  3O0G D;  1UNL D;  5I5Z B;  2BKZ B;  3VYH B;  2LW4 A;  3DDP B;  5HQ0 B;  1OIY B;  4I3Z B;  1VOL A;  2WMB B;  3QYH B;  3F5X B;  3DDQ B;  4YOS A;  4BBR M;  4EOM B;  2WPA B;  3A8L B;  4BY1 X;  5HBJ B;  2ZPE B;  1VIN A;  1N4M A;  3PO3 S;  2IW8 B;  3A8M B;  1QLB A;  2CZ1 B;  3BG5 A;  2DXC B;  4EOS B;  2BPM B;  2CCH B;  1H1Q B;  1E7P A;  5HVY B;  2AHJ B;  1H26 B;  4EOP B;  3TNW B;  1URC B;  4ZGD B;  4G6L B;  2DXB B;  1PKD B;  3QXE B;  1VYW B;  1AD6 A;  4JX4 A;  4EOL B;  2UZB B;  3HHT B;  3M03 A;  3DJB A;  2I40 B;  1AHJ B; 
#chains in the Genus database with same CATH homology
 3MIA B;  2WHB B;  2PHG A;  4CXA B;  4BCO B;  4CRL B;  1JKW A;  2EUF A;  3BHT B;  4CFV B;  4EC8 B;  5HBE B;  1G3N C;  1OIU B;  1O9K B;  2G9X B;  4FX3 B;  1GY3 B;  2PK9 B;  5HNB B;  4F6S B;  4F6W B;  5ICP B;  4BCP B;  4F6U B;  4EON B;  1OL2 B;  4OR5 B;  1O9K A;  4F7J B;  1FIN B;  2C5N B;  3EOC B;  4ELJ A;  3BLR B;  4BCM D;  4OGR B;  4UN0 A;  2C4G B;  4CFM B;  1OGU B;  2PMI B;  5HBH B;  4BCJ B;  3LQ5 B;  4BCF B;  4CFW B;  2UUE B;  4ROC A;  2W9F A;  4BCK B;  5CYI B;  2PK2 A;  2W99 A;  1F5Q B;  2CJM B;  2IVX A;  5CEI B;  4F7N B;  4EOO B;  3K7A M;  3MI9 B;  3TN8 B;  4CFU D;  1H1R B;  4CFU B;  1H1P B;  4BCH B;  4TTH A;  1TFB A;  1OKV B;  2UZD B;  2W96 A;  2WXV B;  2C5O B;  4IMY B;  4CFN B;  4EOK B;  4F70 B;  4YC3 B;  3DOG B;  1UNG D;  2F2C A;  1H28 B;  5FGK B;  1UNH D;  4BCI B;  3H4C A;  1BU2 A;  4KRC B;  4NST B;  3O0G D;  1H25 B;  1UNL D;  5IDP B;  5I5Z B;  1OI9 B;  2BKZ B;  3RGF B;  4ELL A;  1QMZ B;  4BCN B;  4KRD B;  4YOZ A;  5L2W B;  3MY5 B;  4EOR B;  3QHW B;  4EOQ B;  3DDP B;  3POM A;  5HQ0 B;  3TNI B;  1VOL A;  1OIY B;  4I3Z B;  4F7S B;  2WFY B;  2WMB B;  2I53 A;  4II5 B;  5EFQ B;  3F5X B;  3DDQ B;  1H4L D;  2C6T B;  2CCI B;  4YOS A;  2W2H A;  4BCG B;  1H24 B;  4EOM B;  2WPA B;  2C5V B;  2WIH B;  1OL1 B;  2QDJ A;  2B9R A;  3G33 B;  5BNJ B;  4ROD A;  5ACB A;  3TNH B;  1GUX B;  3BLQ B;  5HBJ B;  5IDN B;  1VIN A;  1N4M A;  1W98 B;  5LMK B;  2IW9 B;  2IW8 B;  3BLH B;  4EC9 B;  1ZP2 A;  2UZL B;  2C5X B;  4BCN D;  1KXU A;  2IW6 B;  4F7L B;  1AIS B;  2WMA B;  3EJ1 B;  3BHU B;  4Y72 B;  1JSU B;  4BCQ B;  4BCQ D;  4EOS B;  4ROE A;  2BPM B;  1H1S B;  1H1Q B;  1OKW B;  1JOW A;  2CCH B;  5HVY B;  2WIP B;  1H26 B;  1GH6 B;  2UZE B;  1FVV B;  2X1N B;  1C9B A;  1JST B;  3MY1 B;  5IF1 B;  4EOP B;  2W9Z A;  4EOJ B;  3TNW B;  1D3U B;  1P5E B;  3BHV B;  2R7G A;  1H27 B;  3QHR B;  1URC B;  5LQF B;  4BCM B;  4G6L B;  4EOI B;  1PKD B;  2JGZ B;  1E9H B;  1GUX A;  1VYW B;  1AD6 A;  4YOO A;  3EID B;  2WEV B;  2V22 B;  4EOL B;  4CFX B;  2UZB B;  3M03 A;  2I40 B;  1XO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...