4BCPB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Substituted 4-(Thiazol-5-Yl)-2-(Phenylamino)Pyrimidines are Highly Active Cdk9 Inhibitors: Synthesis, X-Ray Crystal Structure, Sar and Anti-Cancer Activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 96
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcpB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcpB02
2I53A 4EOSB 4BCOB 1JSUB 1F5QB 2W99A 1XO2A 2BPMB 3RGFB 3BHTB 1VOLA 5HBJB 1OIUB 4CFUD 2W96A 4CFVB 1UNLD 4NSTB 4UN0A 1UNGD 2PHGA 5IF1B 4EOJB 3LQ5B 1PKDB 5LQFB 3MY5B 4EOLB 4YOOA 1C9BA 5IDNB 1ZP2A 2R7GA 2UUEB 4CFWB 4EOIB 4F6WB 4KRCB 2C5VB 4OGRB 1GY3B 2W9ZA 4BCMD 3BLQB 3BHUB 2B9RA 3EIDB 1KXUA 1GUXB 4YOZA 1JOWA 1BU2A 2UZBB 4II5B 2QDJA 4OR5B 2PK9B 3DDPB 2WIHB 1OKVB 2W9FA 2WMBB 1H26B 4YOSA 2UZEB 5BNJB 1AD6A 4F6UB 4CFUB 3MIAB 2UZLB 2C5XB 3K7AM 5ICPB 1TFBA 5HNBB 2CCHB 1JSTB 3MI9B 1H25B 1VYWB 2G9XB 4KRDB 4F7SB 5HBEB 5CYIB 1UNHD 4BCGB 5HQ0B 2C6TB 1H28B 1OKWB 5FGKB 1P5EB 2C5OB 4EOPB 1QMZB 5IDPB 2F2CA 2V22B 2WXVB 3DDQB 4RODA 1OGUB 4BCIB 4G6LB 4BCND 2EUFA 4BCMB 1H4LD 5CEIB 4CFXB 5LMKB 2CJMB 3TN8B 2IW6B 4BCQD 1URCB 4BCKB 1W98B 3O0GD 1GUXA 2WIPB 4F7NB 1OL2B 1H1QB 1H1SB 3POMA 1OL1B 4ELJA 4I3ZB 5EFQB 4F7JB 5I5ZB 2C5NB 1O9KB 2CCIB 2WHBB 3H4CA 4IMYB 3EOCB 1AISB 1JKWA 1H1RB 2PMIB 4F6SB 2WPAB 2X1NB 2PK2A 2W2HA 3QHRB 4EOQB 1OIYB 3TNHB 2WFYB 2IW9B 3TNIB 4EC8B 3EJ1B 1GH6B 4EOKB 2C4GB 4BCPB 4F7LB 3MY1B 1H27B 4EOMB 4Y72B 5HVYB 4BCNB 4BCFB 4EOOB 4EONB 1VINA 4BCJB 1OI9B 3BHVB 4EORB 5L2WB 2IVXA 2WMAB 1E9HB 4CFMB 4YC3B 2WEVB 1FVVB 3QHWB 4TTHA 1G3NC 4ROEA 2I40B 4BCQB 4BCHB 4CXAB 3DOGB 4EC9B 1D3UB 3BLHB 2UZDB 3G33B 3BLRB 3TNWB 3F5XB 4CFNB 1H1PB 1N4MA 4ROCA 2IW8B 2JGZB 4CRLB 4ELLA 1FINB 1H24B 1O9KA 4FX3B 5HBHB 5ACBA 2BKZB 3M03A 4F70B
chains in the Genus database with same CATH superfamily
2DD4B 2I53A 1JSUB 3WVEB 1F5QB 3RGFB 3HO8A 2BS2A 3LQ5B 1C9BA 4OGRB 4HNUA 3BHUB 4ZGDB 1GUXB 1BU2A 2UZBB 4II5B 4OB3B 3NDQA 1V29B 3X26B 4NC6A 3QZ9B 1H25B 1VYWB 4KRDB 4F7SB 2CZ0B 1UNHD 1H28B 1OKWB 5LMKB 1P5EB 4RODA 1OGUB 4BY7X 4MIMA 4BCND 2EUFA 5CEIB 3BG5A 3O0GD 1H1QB 4F7JB 5I5ZB 5EFQB 3H4CA 4JX5A 1AISB 2PMIB 3VKHA 2DXBB 2ZPBB 2QQ8A 2C4GB 4F7LB 1H27B 1UGPB 4EOOB 1VINA 2IVXA 2WMAB 2QFZA 3QHWB 4TTHA 1G3NC 3DL1A 2I40B 2ZPHB 4CXAB 3DOGB 4EC9B 3BLHB 2UZDB 3G33B 4AKIA 2IW8B 3M03A 3A8MB 4EOSB 3BHTB 4OB1B 2QDYB 2ZPEB 3BG9A 4CFVB 3DJBA 1UNLD 4NSTB 4UN0A 3A8GB 5IF1B 1PKDB 1UGQB 4EOLB 2ZPFB 5EJCA 1ZP2A 2R7GA 4F6WB 4M6VA 4KRCB 4BY1X 3HHTB 5DQWA 2BS3A 1KXUA 2LW4A 4JX4A 1JOWA 3DTOA 3DDPB 1OKVB 5BNJB 4F6UB 2KMGA 4EOPB 1QMZB 2F2CA 4BCIB 3A8OB 4BCMB 2IW6B 4BCKB 1GUXA 4F7NB 1OL1B 1O9KB 3VKGA 1H1RB 3A8LB 4EOQB 3TNHB 2IW9B 3TNIB 1GH6B 3HBLA 4BCPB 4EOMB 1UGRB 4Y72B 5HVYB 4BCFB 1OI9B 3BHVB 5L2WB 1IREB 4YC3B 3WVDB 2WEVB 1FVVB 4ROEA 4BCHB 4ZGEB 4BCQB 5IHYA 4ROCA 2BPMB 1VOLA 5HBJB 2ZPGB 1OIUB 2W96A 1TD6A 3HB9A 4EOJB 2IN3A 4YOOA 5IDNB 3B57A 4EOIB 3GTMS 2C5VB 1GY3B 2CYZB 2W9ZA 4BCMD 2QGSA 2B9RA 4BXXX 3HZJA 2WIHB 2W9FA 2WMBB 2UZEB 4HNVA 4CFUB 3MIAB 5ICPB 1UGSB 2DXCB 3MI9B 2DMEA 3VYHB 4BBRM 4BCGB 5HQ0B 2C6TB 2V22B 2WXVB 3DDQB 4G6LB 4CFXB 4BCQD 1URCB 1W98B 3QWLA 2PJQA 2WIPB 1OL2B 4ELJA 1H1SB 3POMA 2C5NB 2CCIB 4IMYB 3TW7A 3EOCB 1JKWA 4F6SB 2CZ6B 4FM4B 1ENWA 2X1NB 2PK2A 2W2HA 1OIYB 2WFYB 2DPPB 3VYGB 4EC8B 3EJ1B 4EOKB 4JX6A 3MY1B 4EORB 4CFMB 4BBSM 4MFEA 1E7PA 3BLRB 1H1PB 1N4MA 3TW6A 4CRLB 2JGZB 1FINB 1O9KA 5ACBA 3QYEA 4F70B 4BCOB 2W99A 1XO2A 4CFUD 2ZCFB 1UNGD 2PHGA 5LQFB 3MY5B 3BG3A 4HLQA 2ZPIB 2UUEB 3X20B 4CFWB 2DD5B 2D0QB 3BLQB 3QYBA 3EIDB 3QXEB 4YOZA 3X28B 2QDJA 4OR5B 2PK9B 4AI6A 1H26B 3QYGB 3QZ5B 4LOCA 4YOSA 1AD6A 2BS4A 2UZLB 2C5XB 3K7AM 2CZ1B 1TFBA 5HNBB 2CCHB 1JSTB 4OB0B 2G77A 2G9XB 5HBEB 5CYIB 4Z6YA 5FGKB 2C5OB 5IDPB 3PO3S 3X25B 1H4LD 2CJMB 3TN8B 4QSHA 3X24B 4OB2B 3KHIA 2WJ9A 4I3ZB 4AKGA 2WHBB 2KR6A 3A8HB 2WPAB 4ZGJB 3QHRB 1FKMA 3QYHB 4AKHA 4MFDA 4HL4A 1QLBA 4BCNB 4EONB 4BCJB 2QF7A 1AHJB 1E9HB 2CZ7B 1D3UB 4HNTA 3TNWB 2AHJB 3F5XB 4CFNB 4ELLA 1H24B 5HBHB 4FX3B 2BKZB 5DQVA 2ZZDB
chains in the Genus database with same CATH topology
2I53A 4EOSB 4BCOB 1JSUB 1F5QB 2W99A 1XO2A 2BPMB 3RGFB 3BHTB 1VOLA 5HBJB 1OIUB 4CFUD 2W96A 4CFVB 1UNLD 4NSTB 4UN0A 1UNGD 2PHGA 5IF1B 4EOJB 3LQ5B 1PKDB 5LQFB 3MY5B 4EOLB 4YOOA 1C9BA 5IDNB 1ZP2A 2R7GA 2UUEB 4CFWB 4EOIB 4F6WB 4KRCB 2C5VB 4OGRB 1GY3B 2W9ZA 4BCMD 3BLQB 3BHUB 2B9RA 3EIDB 1KXUA 1GUXB 4YOZA 1JOWA 1BU2A 2UZBB 4II5B 2QDJA 4OR5B 2PK9B 3DDPB 2WIHB 1OKVB 2W9FA 2WMBB 1H26B 4YOSA 2UZEB 5BNJB 1AD6A 4F6UB 4CFUB 3MIAB 2UZLB 2C5XB 3K7AM 5ICPB 1TFBA 5HNBB 2CCHB 1JSTB 3MI9B 1H25B 1VYWB 2G9XB 4KRDB 4F7SB 5HBEB 5CYIB 1UNHD 4BCGB 5HQ0B 2C6TB 1H28B 1OKWB 5FGKB 1P5EB 2C5OB 4EOPB 1QMZB 5IDPB 2F2CA 2V22B 2WXVB 3DDQB 4RODA 1OGUB 4BCIB 4G6LB 4BCND 2EUFA 4BCMB 1H4LD 5CEIB 4CFXB 5LMKB 2CJMB 3TN8B 2IW6B 4BCQD 1URCB 4BCKB 1W98B 3O0GD 1GUXA 2WIPB 4F7NB 1OL2B 1H1QB 1H1SB 3POMA 1OL1B 4ELJA 4I3ZB 5EFQB 4F7JB 5I5ZB 2C5NB 1O9KB 2CCIB 2WHBB 3H4CA 4IMYB 3EOCB 1AISB 1JKWA 1H1RB 2PMIB 4F6SB 2WPAB 2X1NB 2PK2A 2W2HA 3QHRB 4EOQB 1OIYB 3TNHB 2WFYB 2IW9B 3TNIB 4EC8B 3EJ1B 1GH6B 4EOKB 2C4GB 4BCPB 4F7LB 3MY1B 1H27B 4EOMB 4Y72B 5HVYB 4BCNB 4BCFB 4EOOB 4EONB 1VINA 4BCJB 1OI9B 3BHVB 4EORB 5L2WB 2IVXA 2WMAB 1E9HB 4CFMB 4YC3B 2WEVB 1FVVB 3QHWB 4TTHA 1G3NC 4ROEA 2I40B 4BCQB 4BCHB 4CXAB 3DOGB 4EC9B 1D3UB 3BLHB 2UZDB 3G33B 3BLRB 3TNWB 3F5XB 4CFNB 1H1PB 1N4MA 4ROCA 2IW8B 2JGZB 4CRLB 4ELLA 1FINB 1H24B 1O9KA 4FX3B 5HBHB 5ACBA 2BKZB 3M03A 4F70B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I53 A;  4EOS B;  4BCO B;  1JSU B;  1F5Q B;  2W99 A;  1XO2 A;  2BPM B;  3RGF B;  3BHT B;  1VOL A;  5HBJ B;  1OIU B;  4CFU D;  2W96 A;  4CFV B;  1UNL D;  4NST B;  4UN0 A;  1UNG D;  2PHG A;  5IF1 B;  4EOJ B;  3LQ5 B;  1PKD B;  5LQF B;  3MY5 B;  4EOL B;  4YOO A;  1C9B A;  5IDN B;  1ZP2 A;  2R7G A;  2UUE B;  4CFW B;  4EOI B;  4F6W B;  4KRC B;  2C5V B;  4OGR B;  1GY3 B;  2W9Z A;  4BCM D;  3BLQ B;  3BHU B;  2B9R A;  3EID B;  1KXU A;  1GUX B;  4YOZ A;  1JOW A;  1BU2 A;  2UZB B;  4II5 B;  2QDJ A;  4OR5 B;  2PK9 B;  3DDP B;  2WIH B;  1OKV B;  2W9F A;  2WMB B;  1H26 B;  4YOS A;  2UZE B;  5BNJ B;  1AD6 A;  4F6U B;  4CFU B;  3MIA B;  2UZL B;  2C5X B;  3K7A M;  5ICP B;  1TFB A;  5HNB B;  2CCH B;  1JST B;  3MI9 B;  1H25 B;  1VYW B;  2G9X B;  4KRD B;  4F7S B;  5HBE B;  5CYI B;  1UNH D;  4BCG B;  5HQ0 B;  2C6T B;  1H28 B;  1OKW B;  5FGK B;  1P5E B;  2C5O B;  4EOP B;  1QMZ B;  5IDP B;  2F2C A;  2V22 B;  2WXV B;  3DDQ B;  4ROD A;  1OGU B;  4BCI B;  4G6L B;  4BCN D;  2EUF A;  4BCM B;  1H4L D;  5CEI B;  4CFX B;  5LMK B;  2CJM B;  3TN8 B;  2IW6 B;  4BCQ D;  1URC B;  4BCK B;  1W98 B;  3O0G D;  1GUX A;  2WIP B;  4F7N B;  1OL2 B;  1H1Q B;  1H1S B;  3POM A;  1OL1 B;  4ELJ A;  4I3Z B;  5EFQ B;  4F7J B;  5I5Z B;  2C5N B;  1O9K B;  2CCI B;  2WHB B;  3H4C A;  4IMY B;  3EOC B;  1AIS B;  1JKW A;  1H1R B;  2PMI B;  4F6S B;  2WPA B;  2X1N B;  2PK2 A;  2W2H A;  3QHR B;  4EOQ B;  1OIY B;  3TNH B;  2WFY B;  2IW9 B;  3TNI B;  4EC8 B;  3EJ1 B;  1GH6 B;  4EOK B;  2C4G B;  4BCP B;  4F7L B;  3MY1 B;  1H27 B;  4EOM B;  4Y72 B;  5HVY B;  4BCN B;  4BCF B;  4EOO B;  4EON B;  1VIN A;  4BCJ B;  1OI9 B;  3BHV B;  4EOR B;  5L2W B;  2IVX A;  2WMA B;  1E9H B;  4CFM B;  4YC3 B;  2WEV B;  1FVV B;  3QHW B;  4TTH A;  1G3N C;  4ROE A;  2I40 B;  4BCQ B;  4BCH B;  4CXA B;  3DOG B;  4EC9 B;  1D3U B;  3BLH B;  2UZD B;  3G33 B;  3BLR B;  3TNW B;  3F5X B;  4CFN B;  1H1P B;  1N4M A;  4ROC A;  2IW8 B;  2JGZ B;  4CRL B;  4ELL A;  1FIN B;  1H24 B;  1O9K A;  4FX3 B;  5HBH B;  5ACB A;  2BKZ B;  3M03 A;  4F70 B; 
#chains in the Genus database with same CATH topology
 2DD4 B;  2I53 A;  1JSU B;  3WVE B;  1F5Q B;  3RGF B;  3HO8 A;  2BS2 A;  3LQ5 B;  1C9B A;  4OGR B;  4HNU A;  3BHU B;  4ZGD B;  1GUX B;  1BU2 A;  2UZB B;  4II5 B;  4OB3 B;  3NDQ A;  1V29 B;  3X26 B;  4NC6 A;  3QZ9 B;  1H25 B;  1VYW B;  4KRD B;  4F7S B;  2CZ0 B;  1UNH D;  1H28 B;  1OKW B;  5LMK B;  1P5E B;  4ROD A;  1OGU B;  4BY7 X;  4MIM A;  4BCN D;  2EUF A;  5CEI B;  3BG5 A;  3O0G D;  1H1Q B;  4F7J B;  5I5Z B;  5EFQ B;  3H4C A;  4JX5 A;  1AIS B;  2PMI B;  3VKH A;  2DXB B;  2ZPB B;  2QQ8 A;  2C4G B;  4F7L B;  1H27 B;  1UGP B;  4EOO B;  1VIN A;  2IVX A;  2WMA B;  2QFZ A;  3QHW B;  4TTH A;  1G3N C;  3DL1 A;  2I40 B;  2ZPH B;  4CXA B;  3DOG B;  4EC9 B;  3BLH B;  2UZD B;  3G33 B;  4AKI A;  2IW8 B;  3M03 A;  3A8M B;  4EOS B;  3BHT B;  4OB1 B;  2QDY B;  2ZPE B;  3BG9 A;  4CFV B;  3DJB A;  1UNL D;  4NST B;  4UN0 A;  3A8G B;  5IF1 B;  1PKD B;  1UGQ B;  4EOL B;  2ZPF B;  5EJC A;  1ZP2 A;  2R7G A;  4F6W B;  4M6V A;  4KRC B;  4BY1 X;  3HHT B;  5DQW A;  2BS3 A;  1KXU A;  2LW4 A;  4JX4 A;  1JOW A;  3DTO A;  3DDP B;  1OKV B;  5BNJ B;  4F6U B;  2KMG A;  4EOP B;  1QMZ B;  2F2C A;  4BCI B;  3A8O B;  4BCM B;  2IW6 B;  4BCK B;  1GUX A;  4F7N B;  1OL1 B;  1O9K B;  3VKG A;  1H1R B;  3A8L B;  4EOQ B;  3TNH B;  2IW9 B;  3TNI B;  1GH6 B;  3HBL A;  4BCP B;  4EOM B;  1UGR B;  4Y72 B;  5HVY B;  4BCF B;  1OI9 B;  3BHV B;  5L2W B;  1IRE B;  4YC3 B;  3WVD B;  2WEV B;  1FVV B;  4ROE A;  4BCH B;  4ZGE B;  4BCQ B;  5IHY A;  4ROC A;  2BPM B;  1VOL A;  5HBJ B;  2ZPG B;  1OIU B;  2W96 A;  1TD6 A;  3HB9 A;  4EOJ B;  2IN3 A;  4YOO A;  5IDN B;  3B57 A;  4EOI B;  3GTM S;  2C5V B;  1GY3 B;  2CYZ B;  2W9Z A;  4BCM D;  2QGS A;  2B9R A;  4BXX X;  3HZJ A;  2WIH B;  2W9F A;  2WMB B;  2UZE B;  4HNV A;  4CFU B;  3MIA B;  5ICP B;  1UGS B;  2DXC B;  3MI9 B;  2DME A;  3VYH B;  4BBR M;  4BCG B;  5HQ0 B;  2C6T B;  2V22 B;  2WXV B;  3DDQ B;  4G6L B;  4CFX B;  4BCQ D;  1URC B;  1W98 B;  3QWL A;  2PJQ A;  2WIP B;  1OL2 B;  4ELJ A;  1H1S B;  3POM A;  2C5N B;  2CCI B;  4IMY B;  3TW7 A;  3EOC B;  1JKW A;  4F6S B;  2CZ6 B;  4FM4 B;  1ENW A;  2X1N B;  2PK2 A;  2W2H A;  1OIY B;  2WFY B;  2DPP B;  3VYG B;  4EC8 B;  3EJ1 B;  4EOK B;  4JX6 A;  3MY1 B;  4EOR B;  4CFM B;  4BBS M;  4MFE A;  1E7P A;  3BLR B;  1H1P B;  1N4M A;  3TW6 A;  4CRL B;  2JGZ B;  1FIN B;  1O9K A;  5ACB A;  3QYE A;  4F70 B;  4BCO B;  2W99 A;  1XO2 A;  4CFU D;  2ZCF B;  1UNG D;  2PHG A;  5LQF B;  3MY5 B;  3BG3 A;  4HLQ A;  2ZPI B;  2UUE B;  3X20 B;  4CFW B;  2DD5 B;  2D0Q B;  3BLQ B;  3QYB A;  3EID B;  3QXE B;  4YOZ A;  3X28 B;  2QDJ A;  4OR5 B;  2PK9 B;  4AI6 A;  1H26 B;  3QYG B;  3QZ5 B;  4LOC A;  4YOS A;  1AD6 A;  2BS4 A;  2UZL B;  2C5X B;  3K7A M;  2CZ1 B;  1TFB A;  5HNB B;  2CCH B;  1JST B;  4OB0 B;  2G77 A;  2G9X B;  5HBE B;  5CYI B;  4Z6Y A;  5FGK B;  2C5O B;  5IDP B;  3PO3 S;  3X25 B;  1H4L D;  2CJM B;  3TN8 B;  4QSH A;  3X24 B;  4OB2 B;  3KHI A;  2WJ9 A;  4I3Z B;  4AKG A;  2WHB B;  2KR6 A;  3A8H B;  2WPA B;  4ZGJ B;  3QHR B;  1FKM A;  3QYH B;  4AKH A;  4MFD A;  4HL4 A;  1QLB A;  4BCN B;  4EON B;  4BCJ B;  2QF7 A;  1AHJ B;  1E9H B;  2CZ7 B;  1D3U B;  4HNT A;  3TNW B;  2AHJ B;  3F5X B;  4CFN B;  4ELL A;  1H24 B;  5HBH B;  4FX3 B;  2BKZ B;  5DQV A;  2ZZD B; 
#chains in the Genus database with same CATH homology
 2I53 A;  4EOS B;  4BCO B;  1JSU B;  1F5Q B;  2W99 A;  1XO2 A;  2BPM B;  3RGF B;  3BHT B;  1VOL A;  5HBJ B;  1OIU B;  4CFU D;  2W96 A;  4CFV B;  1UNL D;  4NST B;  4UN0 A;  1UNG D;  2PHG A;  5IF1 B;  4EOJ B;  3LQ5 B;  1PKD B;  5LQF B;  3MY5 B;  4EOL B;  4YOO A;  1C9B A;  5IDN B;  1ZP2 A;  2R7G A;  2UUE B;  4CFW B;  4EOI B;  4F6W B;  4KRC B;  2C5V B;  4OGR B;  1GY3 B;  2W9Z A;  4BCM D;  3BLQ B;  3BHU B;  2B9R A;  3EID B;  1KXU A;  1GUX B;  4YOZ A;  1JOW A;  1BU2 A;  2UZB B;  4II5 B;  2QDJ A;  4OR5 B;  2PK9 B;  3DDP B;  2WIH B;  1OKV B;  2W9F A;  2WMB B;  1H26 B;  4YOS A;  2UZE B;  5BNJ B;  1AD6 A;  4F6U B;  4CFU B;  3MIA B;  2UZL B;  2C5X B;  3K7A M;  5ICP B;  1TFB A;  5HNB B;  2CCH B;  1JST B;  3MI9 B;  1H25 B;  1VYW B;  2G9X B;  4KRD B;  4F7S B;  5HBE B;  5CYI B;  1UNH D;  4BCG B;  5HQ0 B;  2C6T B;  1H28 B;  1OKW B;  5FGK B;  1P5E B;  2C5O B;  4EOP B;  1QMZ B;  5IDP B;  2F2C A;  2V22 B;  2WXV B;  3DDQ B;  4ROD A;  1OGU B;  4BCI B;  4G6L B;  4BCN D;  2EUF A;  4BCM B;  1H4L D;  5CEI B;  4CFX B;  5LMK B;  2CJM B;  3TN8 B;  2IW6 B;  4BCQ D;  1URC B;  4BCK B;  1W98 B;  3O0G D;  1GUX A;  2WIP B;  4F7N B;  1OL2 B;  1H1Q B;  1H1S B;  3POM A;  1OL1 B;  4ELJ A;  4I3Z B;  5EFQ B;  4F7J B;  5I5Z B;  2C5N B;  1O9K B;  2CCI B;  2WHB B;  3H4C A;  4IMY B;  3EOC B;  1AIS B;  1JKW A;  1H1R B;  2PMI B;  4F6S B;  2WPA B;  2X1N B;  2PK2 A;  2W2H A;  3QHR B;  4EOQ B;  1OIY B;  3TNH B;  2WFY B;  2IW9 B;  3TNI B;  4EC8 B;  3EJ1 B;  1GH6 B;  4EOK B;  2C4G B;  4BCP B;  4F7L B;  3MY1 B;  1H27 B;  4EOM B;  4Y72 B;  5HVY B;  4BCN B;  4BCF B;  4EOO B;  4EON B;  1VIN A;  4BCJ B;  1OI9 B;  3BHV B;  4EOR B;  5L2W B;  2IVX A;  2WMA B;  1E9H B;  4CFM B;  4YC3 B;  2WEV B;  1FVV B;  3QHW B;  4TTH A;  1G3N C;  4ROE A;  2I40 B;  4BCQ B;  4BCH B;  4CXA B;  3DOG B;  4EC9 B;  1D3U B;  3BLH B;  2UZD B;  3G33 B;  3BLR B;  3TNW B;  3F5X B;  4CFN B;  1H1P B;  1N4M A;  4ROC A;  2IW8 B;  2JGZ B;  4CRL B;  4ELL A;  1FIN B;  1H24 B;  1O9K A;  4FX3 B;  5HBH B;  5ACB A;  2BKZ B;  3M03 A;  4F70 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...