4BCPB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Substituted 4-(Thiazol-5-Yl)-2-(Phenylamino)Pyrimidines are Highly Active Cdk9 Inhibitors: Synthesis, X-Ray Crystal Structure, Sar and Anti-Cancer Activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 96
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcpB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcpB02
3K7AM 4BCIB 4EOPB 1GH6B 5HQ0B 1G3NC 2W9FA 2BPMB 1H24B 1QMZB 2W99A 4YC3B 4CFNB 3TNIB 4BCNB 3BLRB 3TN8B 5HBEB 2C5XB 3MI9B 3POMA 4EORB 5HVYB 3MIAB 2WMBB 5L2WB 5CEIB 4F7LB 2WIHB 2CCHB 4KRCB 1BU2A 3BHVB 4IMYB 3QHRB 5EFQB 4BCGB 1OGUB 3M03A 3O0GD 4EOQB 5BNJB 2G9XB 4BCMD 4EOMB 1AISB 3G33B 2R7GA 4F7SB 4EC8B 5ACBA 1H25B 2C5VB 1OIUB 1OKVB 1W98B 4EOKB 5CYIB 4BCQB 4EC9B 1OKWB 2PK2A 1UNGD 2F2CA 1E9HB 2WMAB 4UN0A 2W9ZA 3BHTB 3DDPB 1H27B 3TNWB 2V22B 2UUEB 2IW8B 2JGZB 2UZEB 3LQ5B 5IF1B 1FINB 4EOSB 4YOSA 1H1RB 2CCIB 1JOWA 2IW9B 4CFUD 4CRLB 1GUXB 3EJ1B 2WPAB 3EOCB 2I53A 2UZDB 3MY5B 2IVXA 3MY1B 3DOGB 4F70B 3F5XB 4EOOB 3TNHB 2W2HA 2IW6B 4YOOA 5HBJB 4BCKB 1JSTB 2PHGA 4II5B 1F5QB 1TFBA 5I5ZB 4BCMB 4BCJB 3BLHB 1H4LD 1JSUB 4I3ZB 4EOJB 4CFVB 1VINA 4ELJA 2WXVB 4BCQD 4EONB 5HBHB 4BCPB 2C5NB 1H1PB 5IDNB 4CFMB 2I40B 2C5OB 1H1SB 1O9KB 2WFYB 1D3UB 4CFXB 5LQFB 1GUXA 1JKWA 3RGFB 4BCND 2UZBB 2CJMB 2EUFA 1H1QB 1P5EB 3EIDB 4G6LB 4BCHB 1N4MA 1UNHD 2PMIB 2W96A 1C9BA 1ZP2A 1H28B 2B9RA 3QHWB 1OIYB 2BKZB 4OGRB 2WEVB 3BHUB 5HNBB 1OL1B 2WHBB 4BCFB 4ELLA 4BCOB 1XO2A 5ICPB 5IDPB 4KRDB 4ROEA 4CFUB 4CFWB 4EOLB 2WIPB 2X1NB 3DDQB 1URCB 4F6WB 1FVVB 1UNLD 1GY3B 1O9KA 2C6TB 2UZLB 4Y72B 2PK9B 4OR5B 4CXAB 4EOIB 4F7JB 4RODA 1OI9B 4F6SB 4NSTB 2QDJA 4TTHA 4FX3B 3BLQB 5LMKB 1AD6A 1KXUA 5FGKB 2C4GB 4ROCA 1VYWB 1H26B 4F6UB 4YOZA 1VOLA 4F7NB 1OL2B 3H4CA 1PKDB
chains in the Genus database with same CATH superfamily
1H24B 3TN8B 2C5XB 3MI9B 5IHYA 2QQ8A 4BBRM 4MIMA 2WIHB 1BU2A 5EFQB 2G9XB 4BCMD 2R7GA 4F7SB 5ACBA 5CYIB 2QGSA 2F2CA 1E9HB 4UN0A 3QYHB 2DMEA 3TNWB 2UUEB 4AKHA 2CZ7B 3BG5A 4EOSB 4HNVA 2CCIB 2IW9B 3X28B 4CRLB 3VKGA 4JX4A 5DQVA 2I53A 3MY5B 2IVXA 1V29B 4II5B 3BLHB 4ELJA 5HBHB 5IDNB 3PO3S 1H1QB 1P5EB 3EIDB 3HO8A 1N4MA 2PMIB 3QZ9B 3HZJA 1OL1B 4HNTA 5ICPB 4EOLB 4F6WB 1UNLD 2UZLB 4OR5B 2BS3A 2QDJA 2ZZDB 4FX3B 1KXUA 2CZ6B 1H26B 3WVEB 4F7NB 3A8MB 3KHIA 1G3NC 4MFEA 3TNIB 4BCNB 3BLRB 5HBEB 4EORB 5HVYB 4M6VA 4OB3B 4IMYB 3QHRB 4BCGB 1OGUB 3O0GD 3G33B 3QWLA 4EC8B 2C5VB 1W98B 4EC9B 2IN3A 3TW6A 5DQWA 2UZEB 3LQ5B 2QF7A 1UGSB 1FINB 3WVDB 4LOCA 1FKMA 2ZPEB 4QSHA 3EJ1B 2ZPIB 3EOCB 2UZDB 3BG9A 4F70B 2W2HA 2IW6B 2AHJB 4BCKB 1JSTB 4AI6A 3X24B 1F5QB 1TFBA 2DXCB 3QYGB 3A8OB 1H4LD 1JSUB 4I3ZB 4CFVB 1VINA 3A8HB 4BCPB 2C5NB 1H1PB 4CFMB 2ZCFB 2C5OB 1H1SB 2WFYB 3QZ5B 1D3UB 4BCND 2UZBB 2EUFA 4BBSM 3VYGB 2KMGA 1C9BA 1ZP2A 1H28B 4OGRB 1UGRB 2CZ1B 2WHBB 2DD5B 3QXEB 4KRDB 3QYBA 3HHTB 1FVVB 1ENWA 4EOIB 3DL1A 4ZGEB 2CZ0B 4TTHA 3BLQB 5LMKB 3GTMS 4ROCA 1IREB 4F6UB 1PKDB 4BCIB 4EOPB 4HNUA 1GH6B 4CFNB 2W9FA 4ZGJB 4HL4A 3TW7A 3POMA 2WMBB 2WJ9A 5CEIB 5L2WB 3BHVB 5EJCA 3NDQA 1TD6A 2ZPFB 3HBLA 3M03A 4EOQB 2BS2A 3VKHA 1OKVB 1OKWB 2PK2A 3QYEA 1UNGD 2W9ZA 2QFZA 2V22B 4AKIA 1UGQB 2IW8B 2JGZB 4BY1X 2DD4B 1H1RB 4NC6A 3X20B 4OB1B 1QLBA 3F5XB 5HBJB 2PHGA 2PJQA 5I5ZB 3BG3A 3X26B 4BCQD 4EONB 3DJBA 2DXBB 2I40B 4CFXB 1GUXA 2CJMB 3VYHB 2QDYB 4BCHB 4ZGDB 2B9RA 3QHWB 2BKZB 2G77A 2KR6A 4AKGA 4ELLA 4BCFB 2ZPBB 1XO2A 5IDPB 4CFUB 4BY7X 2WIPB 2X1NB 3DDQB 1URCB 1GY3B 1O9KA 4F7JB 4RODA 3A8GB 4NSTB 1AHJB 1UGPB 5FGKB 3DTOA 2C4GB 1VYWB 1VOLA 1OL2B 3H4CA 3K7AM 4JX5A 3X25B 5HQ0B 1E7PA 4YC3B 2BPMB 1QMZB 2W99A 2ZPHB 4Z6YA 3MIAB 4HLQA 4MFDA 4F7LB 2CCHB 4KRCB 5BNJB 1AISB 4EOMB 1H25B 1OIUB 4EOKB 4BCQB 2CYZB 2WMAB 3BHTB 2DPPB 3DDPB 1H27B 4OB0B 5IF1B 4YOSA 1JOWA 3HB9A 4CFUD 1GUXB 2WPAB 3A8LB 3MY1B 3DOGB 4EOOB 3TNHB 4YOOA 4OB2B 4BCMB 4BCJB 4EOJB 2WXVB 2D0QB 1O9KB 5LQFB 1JKWA 3RGFB 4G6LB 2LW4A 1UNHD 2W96A 2ZPGB 4BXXX 2BS4A 1OIYB 2WEVB 3BHUB 5HNBB 4BCOB 4ROEA 4CFWB 2C6TB 4FM4B 3B57A 4Y72B 2PK9B 4CXAB 1OI9B 4F6SB 4JX6A 1AD6A 4YOZA
chains in the Genus database with same CATH topology
3K7AM 4BCIB 4EOPB 1GH6B 5HQ0B 1G3NC 2W9FA 2BPMB 1H24B 1QMZB 2W99A 4YC3B 4CFNB 3TNIB 4BCNB 3BLRB 3TN8B 5HBEB 2C5XB 3MI9B 3POMA 4EORB 5HVYB 3MIAB 2WMBB 5L2WB 5CEIB 4F7LB 2WIHB 2CCHB 4KRCB 1BU2A 3BHVB 4IMYB 3QHRB 5EFQB 4BCGB 1OGUB 3M03A 3O0GD 4EOQB 5BNJB 2G9XB 4BCMD 4EOMB 1AISB 3G33B 2R7GA 4F7SB 4EC8B 5ACBA 1H25B 2C5VB 1OIUB 1OKVB 1W98B 4EOKB 5CYIB 4BCQB 4EC9B 1OKWB 2PK2A 1UNGD 2F2CA 1E9HB 2WMAB 4UN0A 2W9ZA 3BHTB 3DDPB 1H27B 3TNWB 2V22B 2UUEB 2IW8B 2JGZB 2UZEB 3LQ5B 5IF1B 1FINB 4EOSB 4YOSA 1H1RB 2CCIB 1JOWA 2IW9B 4CFUD 4CRLB 1GUXB 3EJ1B 2WPAB 3EOCB 2I53A 2UZDB 3MY5B 2IVXA 3MY1B 3DOGB 4F70B 3F5XB 4EOOB 3TNHB 2W2HA 2IW6B 4YOOA 5HBJB 4BCKB 1JSTB 2PHGA 4II5B 1F5QB 1TFBA 5I5ZB 4BCMB 4BCJB 3BLHB 1H4LD 1JSUB 4I3ZB 4EOJB 4CFVB 1VINA 4ELJA 2WXVB 4BCQD 4EONB 5HBHB 4BCPB 2C5NB 1H1PB 5IDNB 4CFMB 2I40B 2C5OB 1H1SB 1O9KB 2WFYB 1D3UB 4CFXB 5LQFB 1GUXA 1JKWA 3RGFB 4BCND 2UZBB 2CJMB 2EUFA 1H1QB 1P5EB 3EIDB 4G6LB 4BCHB 1N4MA 1UNHD 2PMIB 2W96A 1C9BA 1ZP2A 1H28B 2B9RA 3QHWB 1OIYB 2BKZB 4OGRB 2WEVB 3BHUB 5HNBB 1OL1B 2WHBB 4BCFB 4ELLA 4BCOB 1XO2A 5ICPB 5IDPB 4KRDB 4ROEA 4CFUB 4CFWB 4EOLB 2WIPB 2X1NB 3DDQB 1URCB 4F6WB 1FVVB 1UNLD 1GY3B 1O9KA 2C6TB 2UZLB 4Y72B 2PK9B 4OR5B 4CXAB 4EOIB 4F7JB 4RODA 1OI9B 4F6SB 4NSTB 2QDJA 4TTHA 4FX3B 3BLQB 5LMKB 1AD6A 1KXUA 5FGKB 2C4GB 4ROCA 1VYWB 1H26B 4F6UB 4YOZA 1VOLA 4F7NB 1OL2B 3H4CA 1PKDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A M;  4BCI B;  4EOP B;  1GH6 B;  5HQ0 B;  1G3N C;  2W9F A;  2BPM B;  1H24 B;  1QMZ B;  2W99 A;  4YC3 B;  4CFN B;  3TNI B;  4BCN B;  3BLR B;  3TN8 B;  5HBE B;  2C5X B;  3MI9 B;  3POM A;  4EOR B;  5HVY B;  3MIA B;  2WMB B;  5L2W B;  5CEI B;  4F7L B;  2WIH B;  2CCH B;  4KRC B;  1BU2 A;  3BHV B;  4IMY B;  3QHR B;  5EFQ B;  4BCG B;  1OGU B;  3M03 A;  3O0G D;  4EOQ B;  5BNJ B;  2G9X B;  4BCM D;  4EOM B;  1AIS B;  3G33 B;  2R7G A;  4F7S B;  4EC8 B;  5ACB A;  1H25 B;  2C5V B;  1OIU B;  1OKV B;  1W98 B;  4EOK B;  5CYI B;  4BCQ B;  4EC9 B;  1OKW B;  2PK2 A;  1UNG D;  2F2C A;  1E9H B;  2WMA B;  4UN0 A;  2W9Z A;  3BHT B;  3DDP B;  1H27 B;  3TNW B;  2V22 B;  2UUE B;  2IW8 B;  2JGZ B;  2UZE B;  3LQ5 B;  5IF1 B;  1FIN B;  4EOS B;  4YOS A;  1H1R B;  2CCI B;  1JOW A;  2IW9 B;  4CFU D;  4CRL B;  1GUX B;  3EJ1 B;  2WPA B;  3EOC B;  2I53 A;  2UZD B;  3MY5 B;  2IVX A;  3MY1 B;  3DOG B;  4F70 B;  3F5X B;  4EOO B;  3TNH B;  2W2H A;  2IW6 B;  4YOO A;  5HBJ B;  4BCK B;  1JST B;  2PHG A;  4II5 B;  1F5Q B;  1TFB A;  5I5Z B;  4BCM B;  4BCJ B;  3BLH B;  1H4L D;  1JSU B;  4I3Z B;  4EOJ B;  4CFV B;  1VIN A;  4ELJ A;  2WXV B;  4BCQ D;  4EON B;  5HBH B;  4BCP B;  2C5N B;  1H1P B;  5IDN B;  4CFM B;  2I40 B;  2C5O B;  1H1S B;  1O9K B;  2WFY B;  1D3U B;  4CFX B;  5LQF B;  1GUX A;  1JKW A;  3RGF B;  4BCN D;  2UZB B;  2CJM B;  2EUF A;  1H1Q B;  1P5E B;  3EID B;  4G6L B;  4BCH B;  1N4M A;  1UNH D;  2PMI B;  2W96 A;  1C9B A;  1ZP2 A;  1H28 B;  2B9R A;  3QHW B;  1OIY B;  2BKZ B;  4OGR B;  2WEV B;  3BHU B;  5HNB B;  1OL1 B;  2WHB B;  4BCF B;  4ELL A;  4BCO B;  1XO2 A;  5ICP B;  5IDP B;  4KRD B;  4ROE A;  4CFU B;  4CFW B;  4EOL B;  2WIP B;  2X1N B;  3DDQ B;  1URC B;  4F6W B;  1FVV B;  1UNL D;  1GY3 B;  1O9K A;  2C6T B;  2UZL B;  4Y72 B;  2PK9 B;  4OR5 B;  4CXA B;  4EOI B;  4F7J B;  4ROD A;  1OI9 B;  4F6S B;  4NST B;  2QDJ A;  4TTH A;  4FX3 B;  3BLQ B;  5LMK B;  1AD6 A;  1KXU A;  5FGK B;  2C4G B;  4ROC A;  1VYW B;  1H26 B;  4F6U B;  4YOZ A;  1VOL A;  4F7N B;  1OL2 B;  3H4C A;  1PKD B; 
#chains in the Genus database with same CATH topology
 1H24 B;  3TN8 B;  2C5X B;  3MI9 B;  5IHY A;  2QQ8 A;  4BBR M;  4MIM A;  2WIH B;  1BU2 A;  5EFQ B;  2G9X B;  4BCM D;  2R7G A;  4F7S B;  5ACB A;  5CYI B;  2QGS A;  2F2C A;  1E9H B;  4UN0 A;  3QYH B;  2DME A;  3TNW B;  2UUE B;  4AKH A;  2CZ7 B;  3BG5 A;  4EOS B;  4HNV A;  2CCI B;  2IW9 B;  3X28 B;  4CRL B;  3VKG A;  4JX4 A;  5DQV A;  2I53 A;  3MY5 B;  2IVX A;  1V29 B;  4II5 B;  3BLH B;  4ELJ A;  5HBH B;  5IDN B;  3PO3 S;  1H1Q B;  1P5E B;  3EID B;  3HO8 A;  1N4M A;  2PMI B;  3QZ9 B;  3HZJ A;  1OL1 B;  4HNT A;  5ICP B;  4EOL B;  4F6W B;  1UNL D;  2UZL B;  4OR5 B;  2BS3 A;  2QDJ A;  2ZZD B;  4FX3 B;  1KXU A;  2CZ6 B;  1H26 B;  3WVE B;  4F7N B;  3A8M B;  3KHI A;  1G3N C;  4MFE A;  3TNI B;  4BCN B;  3BLR B;  5HBE B;  4EOR B;  5HVY B;  4M6V A;  4OB3 B;  4IMY B;  3QHR B;  4BCG B;  1OGU B;  3O0G D;  3G33 B;  3QWL A;  4EC8 B;  2C5V B;  1W98 B;  4EC9 B;  2IN3 A;  3TW6 A;  5DQW A;  2UZE B;  3LQ5 B;  2QF7 A;  1UGS B;  1FIN B;  3WVD B;  4LOC A;  1FKM A;  2ZPE B;  4QSH A;  3EJ1 B;  2ZPI B;  3EOC B;  2UZD B;  3BG9 A;  4F70 B;  2W2H A;  2IW6 B;  2AHJ B;  4BCK B;  1JST B;  4AI6 A;  3X24 B;  1F5Q B;  1TFB A;  2DXC B;  3QYG B;  3A8O B;  1H4L D;  1JSU B;  4I3Z B;  4CFV B;  1VIN A;  3A8H B;  4BCP B;  2C5N B;  1H1P B;  4CFM B;  2ZCF B;  2C5O B;  1H1S B;  2WFY B;  3QZ5 B;  1D3U B;  4BCN D;  2UZB B;  2EUF A;  4BBS M;  3VYG B;  2KMG A;  1C9B A;  1ZP2 A;  1H28 B;  4OGR B;  1UGR B;  2CZ1 B;  2WHB B;  2DD5 B;  3QXE B;  4KRD B;  3QYB A;  3HHT B;  1FVV B;  1ENW A;  4EOI B;  3DL1 A;  4ZGE B;  2CZ0 B;  4TTH A;  3BLQ B;  5LMK B;  3GTM S;  4ROC A;  1IRE B;  4F6U B;  1PKD B;  4BCI B;  4EOP B;  4HNU A;  1GH6 B;  4CFN B;  2W9F A;  4ZGJ B;  4HL4 A;  3TW7 A;  3POM A;  2WMB B;  2WJ9 A;  5CEI B;  5L2W B;  3BHV B;  5EJC A;  3NDQ A;  1TD6 A;  2ZPF B;  3HBL A;  3M03 A;  4EOQ B;  2BS2 A;  3VKH A;  1OKV B;  1OKW B;  2PK2 A;  3QYE A;  1UNG D;  2W9Z A;  2QFZ A;  2V22 B;  4AKI A;  1UGQ B;  2IW8 B;  2JGZ B;  4BY1 X;  2DD4 B;  1H1R B;  4NC6 A;  3X20 B;  4OB1 B;  1QLB A;  3F5X B;  5HBJ B;  2PHG A;  2PJQ A;  5I5Z B;  3BG3 A;  3X26 B;  4BCQ D;  4EON B;  3DJB A;  2DXB B;  2I40 B;  4CFX B;  1GUX A;  2CJM B;  3VYH B;  2QDY B;  4BCH B;  4ZGD B;  2B9R A;  3QHW B;  2BKZ B;  2G77 A;  2KR6 A;  4AKG A;  4ELL A;  4BCF B;  2ZPB B;  1XO2 A;  5IDP B;  4CFU B;  4BY7 X;  2WIP B;  2X1N B;  3DDQ B;  1URC B;  1GY3 B;  1O9K A;  4F7J B;  4ROD A;  3A8G B;  4NST B;  1AHJ B;  1UGP B;  5FGK B;  3DTO A;  2C4G B;  1VYW B;  1VOL A;  1OL2 B;  3H4C A;  3K7A M;  4JX5 A;  3X25 B;  5HQ0 B;  1E7P A;  4YC3 B;  2BPM B;  1QMZ B;  2W99 A;  2ZPH B;  4Z6Y A;  3MIA B;  4HLQ A;  4MFD A;  4F7L B;  2CCH B;  4KRC B;  5BNJ B;  1AIS B;  4EOM B;  1H25 B;  1OIU B;  4EOK B;  4BCQ B;  2CYZ B;  2WMA B;  3BHT B;  2DPP B;  3DDP B;  1H27 B;  4OB0 B;  5IF1 B;  4YOS A;  1JOW A;  3HB9 A;  4CFU D;  1GUX B;  2WPA B;  3A8L B;  3MY1 B;  3DOG B;  4EOO B;  3TNH B;  4YOO A;  4OB2 B;  4BCM B;  4BCJ B;  4EOJ B;  2WXV B;  2D0Q B;  1O9K B;  5LQF B;  1JKW A;  3RGF B;  4G6L B;  2LW4 A;  1UNH D;  2W96 A;  2ZPG B;  4BXX X;  2BS4 A;  1OIY B;  2WEV B;  3BHU B;  5HNB B;  4BCO B;  4ROE A;  4CFW B;  2C6T B;  4FM4 B;  3B57 A;  4Y72 B;  2PK9 B;  4CXA B;  1OI9 B;  4F6S B;  4JX6 A;  1AD6 A;  4YOZ A; 
#chains in the Genus database with same CATH homology
 3K7A M;  4BCI B;  4EOP B;  1GH6 B;  5HQ0 B;  1G3N C;  2W9F A;  2BPM B;  1H24 B;  1QMZ B;  2W99 A;  4YC3 B;  4CFN B;  3TNI B;  4BCN B;  3BLR B;  3TN8 B;  5HBE B;  2C5X B;  3MI9 B;  3POM A;  4EOR B;  5HVY B;  3MIA B;  2WMB B;  5L2W B;  5CEI B;  4F7L B;  2WIH B;  2CCH B;  4KRC B;  1BU2 A;  3BHV B;  4IMY B;  3QHR B;  5EFQ B;  4BCG B;  1OGU B;  3M03 A;  3O0G D;  4EOQ B;  5BNJ B;  2G9X B;  4BCM D;  4EOM B;  1AIS B;  3G33 B;  2R7G A;  4F7S B;  4EC8 B;  5ACB A;  1H25 B;  2C5V B;  1OIU B;  1OKV B;  1W98 B;  4EOK B;  5CYI B;  4BCQ B;  4EC9 B;  1OKW B;  2PK2 A;  1UNG D;  2F2C A;  1E9H B;  2WMA B;  4UN0 A;  2W9Z A;  3BHT B;  3DDP B;  1H27 B;  3TNW B;  2V22 B;  2UUE B;  2IW8 B;  2JGZ B;  2UZE B;  3LQ5 B;  5IF1 B;  1FIN B;  4EOS B;  4YOS A;  1H1R B;  2CCI B;  1JOW A;  2IW9 B;  4CFU D;  4CRL B;  1GUX B;  3EJ1 B;  2WPA B;  3EOC B;  2I53 A;  2UZD B;  3MY5 B;  2IVX A;  3MY1 B;  3DOG B;  4F70 B;  3F5X B;  4EOO B;  3TNH B;  2W2H A;  2IW6 B;  4YOO A;  5HBJ B;  4BCK B;  1JST B;  2PHG A;  4II5 B;  1F5Q B;  1TFB A;  5I5Z B;  4BCM B;  4BCJ B;  3BLH B;  1H4L D;  1JSU B;  4I3Z B;  4EOJ B;  4CFV B;  1VIN A;  4ELJ A;  2WXV B;  4BCQ D;  4EON B;  5HBH B;  4BCP B;  2C5N B;  1H1P B;  5IDN B;  4CFM B;  2I40 B;  2C5O B;  1H1S B;  1O9K B;  2WFY B;  1D3U B;  4CFX B;  5LQF B;  1GUX A;  1JKW A;  3RGF B;  4BCN D;  2UZB B;  2CJM B;  2EUF A;  1H1Q B;  1P5E B;  3EID B;  4G6L B;  4BCH B;  1N4M A;  1UNH D;  2PMI B;  2W96 A;  1C9B A;  1ZP2 A;  1H28 B;  2B9R A;  3QHW B;  1OIY B;  2BKZ B;  4OGR B;  2WEV B;  3BHU B;  5HNB B;  1OL1 B;  2WHB B;  4BCF B;  4ELL A;  4BCO B;  1XO2 A;  5ICP B;  5IDP B;  4KRD B;  4ROE A;  4CFU B;  4CFW B;  4EOL B;  2WIP B;  2X1N B;  3DDQ B;  1URC B;  4F6W B;  1FVV B;  1UNL D;  1GY3 B;  1O9K A;  2C6T B;  2UZL B;  4Y72 B;  2PK9 B;  4OR5 B;  4CXA B;  4EOI B;  4F7J B;  4ROD A;  1OI9 B;  4F6S B;  4NST B;  2QDJ A;  4TTH A;  4FX3 B;  3BLQ B;  5LMK B;  1AD6 A;  1KXU A;  5FGK B;  2C4G B;  4ROC A;  1VYW B;  1H26 B;  4F6U B;  4YOZ A;  1VOL A;  4F7N B;  1OL2 B;  3H4C A;  1PKD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...