4BCPB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Substituted 4-(Thiazol-5-Yl)-2-(Phenylamino)Pyrimidines are Highly Active Cdk9 Inhibitors: Synthesis, X-Ray Crystal Structure, Sar and Anti-Cancer Activities.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcpB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcpB02
5FGKB 2IW8B 5I5ZB 4F70B 2V22B 4CXAB 2C6TB 4BCMD 1UNLD 4CFWB 2W9ZA 4TTHA 1VOLA 3O0GD 2PHGA 4ELJA 5IDPB 4EOSB 4EC9B 2WXVB 2WPAB 3TNWB 3BLRB 4NSTB 5HBJB 5IDNB 1AD6A 2IW9B 1BU2A 2UZEB 3DDQB 5BNJB 2C4GB 3EOCB 2QDJA 1G3NC 2CJMB 1N4MA 2W99A 4EOPB 4CFNB 4F7NB 2BKZB 4EONB 4FX3B 4KRCB 4YC3B 3QHWB 1TFBA 2BPMB 2WEVB 1OI9B 1KXUA 4CFVB 1AISB 4CFUB 4EOKB 4Y72B 1XO2A 3EJ1B 1UNHD 1JSTB 4IMYB 4EC8B 5HQ0B 1OKWB 2UZDB 1OGUB 4CFMB 2W9FA 3TNIB 2C5NB 4CRLB 3MY1B 4EOOB 4EOIB 2IW6B 1O9KB 4F6WB 4II5B 1GH6B 1H4LD 5LQFB 3H4CA 3RGFB 1F5QB 1QMZB 1H1PB 2UZBB 4YOZA 3TNHB 4EOMB 1VINA 4YOSA 4F6SB 4CFUD 2UUEB 3F5XB 1H1SB 4BCQB 1GY3B 1OIUB 1VYWB 4EOJB 4F6UB 1E9HB 4G6LB 3DDPB 4EOQB 1OKVB 1PKDB 1UNGD 5EFQB 2CCHB 2PK9B 5HNBB 5HVYB 2W2HA 4BCHB 4EORB 5CYIB 1O9KA 1JKWA 1GUXB 1H1QB 4BCJB 5HBEB 4F7SB 4BCMB 1P5EB 3BLQB 4BCQD 1URCB 4YOOA 1D3UB 2F2CA 4BCGB 4F7JB 2G9XB 3M03A 3POMA 2C5VB 3MY5B 2CCIB 2X1NB 1JSUB 4UN0A 1FVVB 1H1RB 4BCPB 3MI9B 3MIAB 4BCOB 5ICPB 1OL1B 2PK2A 2WMBB 5LMKB 2C5OB 1OIYB 1OL2B 2IVXA 5HBHB 4OR5B 2B9RA 4BCNB 3QHRB 3BHVB 3G33B 4BCIB 1C9BA 1GUXA 3LQ5B 1H27B 4KRDB 4BCFB 5IF1B 1FINB 2R7GA 2I53A 2WIHB 3K7AM 2WMAB 3DOGB 3TN8B 4ROCA 3BLHB 3BHUB 1JOWA 1H25B 1H26B 2UZLB 2WFYB 4I3ZB 4BCKB 2EUFA 5CEIB 3EIDB 2WIPB 2JGZB 1H28B 3BHTB 2W96A 1H24B 2I40B 4CFXB 4F7LB 2PMIB 4EOLB 4ELLA 1W98B 4BCND 2C5XB 4ROEA 5ACBA 4RODA 4OGRB 2WHBB 5L2WB 1ZP2A
chains in the Genus database with same CATH superfamily
2V22B 2KR6A 1UNLD 4CFWB 3O0GD 2QF7A 5HBJB 1BU2A 4AI6A 4BY7X 4FM4B 2QDJA 1N4MA 4OB3B 4EONB 4ZGEB 3GTMS 3A8LB 5IHYA 1V29B 4HNUA 3EJ1B 1JSTB 4BBRM 4CRLB 3DL1A 5LQFB 2IN3A 4HLQA 1F5QB 1QMZB 1H1PB 4OB2B 4YOZA 4MIMA 3HO8A 4CFUD 3HB9A 1AHJB 4F6UB 2LW4A 3A8MB 4QSHA 4EOQB 2QGSA 3BG5A 2PK9B 5HNBB 5HVYB 3X20B 2W2HA 4BCHB 4EORB 3X28B 3TW7A 1O9KA 1GUXB 3QYGB 5HBEB 1P5EB 3BLQB 1URCB 2F2CA 4F7JB 2CCIB 1FVVB 1OL2B 5HBHB 2CZ0B 3A8HB 2ZPHB 3BHVB 1C9BA 5EJCA 4BCFB 2R7GA 2I53A 3TN8B 3BLHB 2UZLB 4BCKB 5CEIB 4F7LB 4BCND 5ACBA 2WHBB 5L2WB 1ZP2A 4OB0B 2IW8B 2C6TB 4OB1B 2PHGA 5IDPB 1UGQB 2WPAB 3TNWB 1AD6A 2IW9B 3DDQB 3QYBA 4NC6A 1G3NC 1FKMA 4CFNB 4YC3B 4M6VA 1TFBA 4MFEA 2ZPFB 1KXUA 4Y72B 4JX5A 5DQWA 4IMYB 4EC8B 1OGUB 4F6WB 1O9KB 1H4LD 3H4CA 2DMEA 3QZ5B 3TW6A 3TNHB 4EOMB 1VINA 4YOSA 3BG3A 2UUEB 1H1SB 1OIUB 1OKVB 5EFQB 4ZGJB 2ZPGB 3A8GB 4AKGA 1JKWA 4BCQD 1D3UB 4BCGB 2G9XB 3M03A 2C5VB 2X1NB 4UN0A 2AHJB 3NDQA 3QZ9B 3MI9B 3MIAB 2PK2A 2WMBB 2BS4A 4MFDA 4OR5B 2B9RA 3QHRB 3VKGA 4KRDB 1FINB 3K7AM 3DOGB 1UGRB 3BHUB 4I3ZB 3EIDB 2CZ7B 2QDYB 4RODA 5FGKB 5I5ZB 4CXAB 2DD5B 3WVDB 2W9ZA 2QFZA 3QWLA 5BNJB 2C4GB 2CJMB 3VYGB 2W99A 4F7NB 2BKZB 2CYZB 4KRCB 3A8OB 4Z6YA 3QHWB 2WEVB 1IREB 4CFUB 3QYHB 3PO3S 5HQ0B 2UZDB 2W9FA 3TNIB 2C5NB 3MY1B 4EOOB 4EOIB 2IW6B 4II5B 1GH6B 3VYHB 2QQ8A 1TD6A 4HL4A 4BY1X 3HHTB 3F5XB 2ZPIB 1VYWB 4G6LB 3DDPB 2CCHB 2CZ1B 1UGSB 5CYIB 1H1QB 3DTOA 2WJ9A 1JSUB 1H1RB 2PJQA 5ICPB 2C5OB 2IVXA 2ZZDB 4BCNB 4LOCA 2KMGA 4BBSM 4BCIB 3VKHA 5IF1B 2D0QB 3QYEA 4ZGDB 2WMAB 4AKIA 4HNTA 4ROCA 2BS2A 2JGZB 1H28B 3BHTB 4CFXB 4ELLA 1W98B 2C5XB 4F70B 2G77A 4BCMD 5DQVA 4TTHA 1VOLA 2CZ6B 4ELJA 4EOSB 4EC9B 2WXVB 3BLRB 4NSTB 5IDNB 2UZEB 3EOCB 3X24B 4EOPB 4FX3B 2DPPB 2BPMB 1OI9B 1UGPB 4CFVB 1AISB 4EOKB 3QXEB 1XO2A 1UNHD 2DXCB 1E7PA 1OKWB 4CFMB 2ZCFB 3RGFB 2UZBB 2ZPBB 3WVEB 1QLBA 4F6SB 4BCQB 1GY3B 3DJBA 2DXBB 4EOJB 1E9HB 3KHIA 1PKDB 1UNGD 4BCJB 4F7SB 2DD4B 4BCMB 4JX4A 3B57A 2BS3A 4YOOA 2ZPEB 3POMA 3MY5B 4JX6A 4HNVA 4AKHA 4BCPB 1ENWA 4BCOB 1OL1B 5LMKB 3BG9A 1OIYB 3G33B 3HZJA 1GUXA 3LQ5B 1H27B 4BXXX 2WIHB 3X26B 1JOWA 1H26B 1H25B 2WFYB 2EUFA 2WIPB 2W96A 1H24B 2I40B 2PMIB 4EOLB 3HBLA 4ROEA 4OGRB 3X25B
chains in the Genus database with same CATH topology
5FGKB 2IW8B 5I5ZB 4F70B 2V22B 4CXAB 2C6TB 4BCMD 1UNLD 4CFWB 2W9ZA 4TTHA 1VOLA 3O0GD 2PHGA 4ELJA 5IDPB 4EOSB 4EC9B 2WXVB 2WPAB 3TNWB 3BLRB 4NSTB 5HBJB 5IDNB 1AD6A 2IW9B 1BU2A 2UZEB 3DDQB 5BNJB 2C4GB 3EOCB 2QDJA 1G3NC 2CJMB 1N4MA 2W99A 4EOPB 4CFNB 4F7NB 2BKZB 4EONB 4FX3B 4KRCB 4YC3B 3QHWB 1TFBA 2BPMB 2WEVB 1OI9B 1KXUA 4CFVB 1AISB 4CFUB 4EOKB 4Y72B 1XO2A 3EJ1B 1UNHD 1JSTB 4IMYB 4EC8B 5HQ0B 1OKWB 2UZDB 1OGUB 4CFMB 2W9FA 3TNIB 2C5NB 4CRLB 3MY1B 4EOOB 4EOIB 2IW6B 1O9KB 4F6WB 4II5B 1GH6B 1H4LD 5LQFB 3H4CA 3RGFB 1F5QB 1QMZB 1H1PB 2UZBB 4YOZA 3TNHB 4EOMB 1VINA 4YOSA 4F6SB 4CFUD 2UUEB 3F5XB 1H1SB 4BCQB 1GY3B 1OIUB 1VYWB 4EOJB 4F6UB 1E9HB 4G6LB 3DDPB 4EOQB 1OKVB 1PKDB 1UNGD 5EFQB 2CCHB 2PK9B 5HNBB 5HVYB 2W2HA 4BCHB 4EORB 5CYIB 1O9KA 1JKWA 1GUXB 1H1QB 4BCJB 5HBEB 4F7SB 4BCMB 1P5EB 3BLQB 4BCQD 1URCB 4YOOA 1D3UB 2F2CA 4BCGB 4F7JB 2G9XB 3M03A 3POMA 2C5VB 3MY5B 2CCIB 2X1NB 1JSUB 4UN0A 1FVVB 1H1RB 4BCPB 3MI9B 3MIAB 4BCOB 5ICPB 1OL1B 2PK2A 2WMBB 5LMKB 2C5OB 1OIYB 1OL2B 2IVXA 5HBHB 4OR5B 2B9RA 4BCNB 3QHRB 3BHVB 3G33B 4BCIB 1C9BA 1GUXA 3LQ5B 1H27B 4KRDB 4BCFB 5IF1B 1FINB 2R7GA 2I53A 2WIHB 3K7AM 2WMAB 3DOGB 3TN8B 4ROCA 3BLHB 3BHUB 1JOWA 1H25B 1H26B 2UZLB 2WFYB 4I3ZB 4BCKB 2EUFA 5CEIB 3EIDB 2WIPB 2JGZB 1H28B 3BHTB 2W96A 1H24B 2I40B 4CFXB 4F7LB 2PMIB 4EOLB 4ELLA 1W98B 4BCND 2C5XB 4ROEA 5ACBA 4RODA 4OGRB 2WHBB 5L2WB 1ZP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FGK B;  2IW8 B;  5I5Z B;  4F70 B;  2V22 B;  4CXA B;  2C6T B;  4BCM D;  1UNL D;  4CFW B;  2W9Z A;  4TTH A;  1VOL A;  3O0G D;  2PHG A;  4ELJ A;  5IDP B;  4EOS B;  4EC9 B;  2WXV B;  2WPA B;  3TNW B;  3BLR B;  4NST B;  5HBJ B;  5IDN B;  1AD6 A;  2IW9 B;  1BU2 A;  2UZE B;  3DDQ B;  5BNJ B;  2C4G B;  3EOC B;  2QDJ A;  1G3N C;  2CJM B;  1N4M A;  2W99 A;  4EOP B;  4CFN B;  4F7N B;  2BKZ B;  4EON B;  4FX3 B;  4KRC B;  4YC3 B;  3QHW B;  1TFB A;  2BPM B;  2WEV B;  1OI9 B;  1KXU A;  4CFV B;  1AIS B;  4CFU B;  4EOK B;  4Y72 B;  1XO2 A;  3EJ1 B;  1UNH D;  1JST B;  4IMY B;  4EC8 B;  5HQ0 B;  1OKW B;  2UZD B;  1OGU B;  4CFM B;  2W9F A;  3TNI B;  2C5N B;  4CRL B;  3MY1 B;  4EOO B;  4EOI B;  2IW6 B;  1O9K B;  4F6W B;  4II5 B;  1GH6 B;  1H4L D;  5LQF B;  3H4C A;  3RGF B;  1F5Q B;  1QMZ B;  1H1P B;  2UZB B;  4YOZ A;  3TNH B;  4EOM B;  1VIN A;  4YOS A;  4F6S B;  4CFU D;  2UUE B;  3F5X B;  1H1S B;  4BCQ B;  1GY3 B;  1OIU B;  1VYW B;  4EOJ B;  4F6U B;  1E9H B;  4G6L B;  3DDP B;  4EOQ B;  1OKV B;  1PKD B;  1UNG D;  5EFQ B;  2CCH B;  2PK9 B;  5HNB B;  5HVY B;  2W2H A;  4BCH B;  4EOR B;  5CYI B;  1O9K A;  1JKW A;  1GUX B;  1H1Q B;  4BCJ B;  5HBE B;  4F7S B;  4BCM B;  1P5E B;  3BLQ B;  4BCQ D;  1URC B;  4YOO A;  1D3U B;  2F2C A;  4BCG B;  4F7J B;  2G9X B;  3M03 A;  3POM A;  2C5V B;  3MY5 B;  2CCI B;  2X1N B;  1JSU B;  4UN0 A;  1FVV B;  1H1R B;  4BCP B;  3MI9 B;  3MIA B;  4BCO B;  5ICP B;  1OL1 B;  2PK2 A;  2WMB B;  5LMK B;  2C5O B;  1OIY B;  1OL2 B;  2IVX A;  5HBH B;  4OR5 B;  2B9R A;  4BCN B;  3QHR B;  3BHV B;  3G33 B;  4BCI B;  1C9B A;  1GUX A;  3LQ5 B;  1H27 B;  4KRD B;  4BCF B;  5IF1 B;  1FIN B;  2R7G A;  2I53 A;  2WIH B;  3K7A M;  2WMA B;  3DOG B;  3TN8 B;  4ROC A;  3BLH B;  3BHU B;  1JOW A;  1H25 B;  1H26 B;  2UZL B;  2WFY B;  4I3Z B;  4BCK B;  2EUF A;  5CEI B;  3EID B;  2WIP B;  2JGZ B;  1H28 B;  3BHT B;  2W96 A;  1H24 B;  2I40 B;  4CFX B;  4F7L B;  2PMI B;  4EOL B;  4ELL A;  1W98 B;  4BCN D;  2C5X B;  4ROE A;  5ACB A;  4ROD A;  4OGR B;  2WHB B;  5L2W B;  1ZP2 A; 
#chains in the Genus database with same CATH topology
 2V22 B;  2KR6 A;  1UNL D;  4CFW B;  3O0G D;  2QF7 A;  5HBJ B;  1BU2 A;  4AI6 A;  4BY7 X;  4FM4 B;  2QDJ A;  1N4M A;  4OB3 B;  4EON B;  4ZGE B;  3GTM S;  3A8L B;  5IHY A;  1V29 B;  4HNU A;  3EJ1 B;  1JST B;  4BBR M;  4CRL B;  3DL1 A;  5LQF B;  2IN3 A;  4HLQ A;  1F5Q B;  1QMZ B;  1H1P B;  4OB2 B;  4YOZ A;  4MIM A;  3HO8 A;  4CFU D;  3HB9 A;  1AHJ B;  4F6U B;  2LW4 A;  3A8M B;  4QSH A;  4EOQ B;  2QGS A;  3BG5 A;  2PK9 B;  5HNB B;  5HVY B;  3X20 B;  2W2H A;  4BCH B;  4EOR B;  3X28 B;  3TW7 A;  1O9K A;  1GUX B;  3QYG B;  5HBE B;  1P5E B;  3BLQ B;  1URC B;  2F2C A;  4F7J B;  2CCI B;  1FVV B;  1OL2 B;  5HBH B;  2CZ0 B;  3A8H B;  2ZPH B;  3BHV B;  1C9B A;  5EJC A;  4BCF B;  2R7G A;  2I53 A;  3TN8 B;  3BLH B;  2UZL B;  4BCK B;  5CEI B;  4F7L B;  4BCN D;  5ACB A;  2WHB B;  5L2W B;  1ZP2 A;  4OB0 B;  2IW8 B;  2C6T B;  4OB1 B;  2PHG A;  5IDP B;  1UGQ B;  2WPA B;  3TNW B;  1AD6 A;  2IW9 B;  3DDQ B;  3QYB A;  4NC6 A;  1G3N C;  1FKM A;  4CFN B;  4YC3 B;  4M6V A;  1TFB A;  4MFE A;  2ZPF B;  1KXU A;  4Y72 B;  4JX5 A;  5DQW A;  4IMY B;  4EC8 B;  1OGU B;  4F6W B;  1O9K B;  1H4L D;  3H4C A;  2DME A;  3QZ5 B;  3TW6 A;  3TNH B;  4EOM B;  1VIN A;  4YOS A;  3BG3 A;  2UUE B;  1H1S B;  1OIU B;  1OKV B;  5EFQ B;  4ZGJ B;  2ZPG B;  3A8G B;  4AKG A;  1JKW A;  4BCQ D;  1D3U B;  4BCG B;  2G9X B;  3M03 A;  2C5V B;  2X1N B;  4UN0 A;  2AHJ B;  3NDQ A;  3QZ9 B;  3MI9 B;  3MIA B;  2PK2 A;  2WMB B;  2BS4 A;  4MFD A;  4OR5 B;  2B9R A;  3QHR B;  3VKG A;  4KRD B;  1FIN B;  3K7A M;  3DOG B;  1UGR B;  3BHU B;  4I3Z B;  3EID B;  2CZ7 B;  2QDY B;  4ROD A;  5FGK B;  5I5Z B;  4CXA B;  2DD5 B;  3WVD B;  2W9Z A;  2QFZ A;  3QWL A;  5BNJ B;  2C4G B;  2CJM B;  3VYG B;  2W99 A;  4F7N B;  2BKZ B;  2CYZ B;  4KRC B;  3A8O B;  4Z6Y A;  3QHW B;  2WEV B;  1IRE B;  4CFU B;  3QYH B;  3PO3 S;  5HQ0 B;  2UZD B;  2W9F A;  3TNI B;  2C5N B;  3MY1 B;  4EOO B;  4EOI B;  2IW6 B;  4II5 B;  1GH6 B;  3VYH B;  2QQ8 A;  1TD6 A;  4HL4 A;  4BY1 X;  3HHT B;  3F5X B;  2ZPI B;  1VYW B;  4G6L B;  3DDP B;  2CCH B;  2CZ1 B;  1UGS B;  5CYI B;  1H1Q B;  3DTO A;  2WJ9 A;  1JSU B;  1H1R B;  2PJQ A;  5ICP B;  2C5O B;  2IVX A;  2ZZD B;  4BCN B;  4LOC A;  2KMG A;  4BBS M;  4BCI B;  3VKH A;  5IF1 B;  2D0Q B;  3QYE A;  4ZGD B;  2WMA B;  4AKI A;  4HNT A;  4ROC A;  2BS2 A;  2JGZ B;  1H28 B;  3BHT B;  4CFX B;  4ELL A;  1W98 B;  2C5X B;  4F70 B;  2G77 A;  4BCM D;  5DQV A;  4TTH A;  1VOL A;  2CZ6 B;  4ELJ A;  4EOS B;  4EC9 B;  2WXV B;  3BLR B;  4NST B;  5IDN B;  2UZE B;  3EOC B;  3X24 B;  4EOP B;  4FX3 B;  2DPP B;  2BPM B;  1OI9 B;  1UGP B;  4CFV B;  1AIS B;  4EOK B;  3QXE B;  1XO2 A;  1UNH D;  2DXC B;  1E7P A;  1OKW B;  4CFM B;  2ZCF B;  3RGF B;  2UZB B;  2ZPB B;  3WVE B;  1QLB A;  4F6S B;  4BCQ B;  1GY3 B;  3DJB A;  2DXB B;  4EOJ B;  1E9H B;  3KHI A;  1PKD B;  1UNG D;  4BCJ B;  4F7S B;  2DD4 B;  4BCM B;  4JX4 A;  3B57 A;  2BS3 A;  4YOO A;  2ZPE B;  3POM A;  3MY5 B;  4JX6 A;  4HNV A;  4AKH A;  4BCP B;  1ENW A;  4BCO B;  1OL1 B;  5LMK B;  3BG9 A;  1OIY B;  3G33 B;  3HZJ A;  1GUX A;  3LQ5 B;  1H27 B;  4BXX X;  2WIH B;  3X26 B;  1JOW A;  1H26 B;  1H25 B;  2WFY B;  2EUF A;  2WIP B;  2W96 A;  1H24 B;  2I40 B;  2PMI B;  4EOL B;  3HBL A;  4ROE A;  4OGR B;  3X25 B; 
#chains in the Genus database with same CATH homology
 5FGK B;  2IW8 B;  5I5Z B;  4F70 B;  2V22 B;  4CXA B;  2C6T B;  4BCM D;  1UNL D;  4CFW B;  2W9Z A;  4TTH A;  1VOL A;  3O0G D;  2PHG A;  4ELJ A;  5IDP B;  4EOS B;  4EC9 B;  2WXV B;  2WPA B;  3TNW B;  3BLR B;  4NST B;  5HBJ B;  5IDN B;  1AD6 A;  2IW9 B;  1BU2 A;  2UZE B;  3DDQ B;  5BNJ B;  2C4G B;  3EOC B;  2QDJ A;  1G3N C;  2CJM B;  1N4M A;  2W99 A;  4EOP B;  4CFN B;  4F7N B;  2BKZ B;  4EON B;  4FX3 B;  4KRC B;  4YC3 B;  3QHW B;  1TFB A;  2BPM B;  2WEV B;  1OI9 B;  1KXU A;  4CFV B;  1AIS B;  4CFU B;  4EOK B;  4Y72 B;  1XO2 A;  3EJ1 B;  1UNH D;  1JST B;  4IMY B;  4EC8 B;  5HQ0 B;  1OKW B;  2UZD B;  1OGU B;  4CFM B;  2W9F A;  3TNI B;  2C5N B;  4CRL B;  3MY1 B;  4EOO B;  4EOI B;  2IW6 B;  1O9K B;  4F6W B;  4II5 B;  1GH6 B;  1H4L D;  5LQF B;  3H4C A;  3RGF B;  1F5Q B;  1QMZ B;  1H1P B;  2UZB B;  4YOZ A;  3TNH B;  4EOM B;  1VIN A;  4YOS A;  4F6S B;  4CFU D;  2UUE B;  3F5X B;  1H1S B;  4BCQ B;  1GY3 B;  1OIU B;  1VYW B;  4EOJ B;  4F6U B;  1E9H B;  4G6L B;  3DDP B;  4EOQ B;  1OKV B;  1PKD B;  1UNG D;  5EFQ B;  2CCH B;  2PK9 B;  5HNB B;  5HVY B;  2W2H A;  4BCH B;  4EOR B;  5CYI B;  1O9K A;  1JKW A;  1GUX B;  1H1Q B;  4BCJ B;  5HBE B;  4F7S B;  4BCM B;  1P5E B;  3BLQ B;  4BCQ D;  1URC B;  4YOO A;  1D3U B;  2F2C A;  4BCG B;  4F7J B;  2G9X B;  3M03 A;  3POM A;  2C5V B;  3MY5 B;  2CCI B;  2X1N B;  1JSU B;  4UN0 A;  1FVV B;  1H1R B;  4BCP B;  3MI9 B;  3MIA B;  4BCO B;  5ICP B;  1OL1 B;  2PK2 A;  2WMB B;  5LMK B;  2C5O B;  1OIY B;  1OL2 B;  2IVX A;  5HBH B;  4OR5 B;  2B9R A;  4BCN B;  3QHR B;  3BHV B;  3G33 B;  4BCI B;  1C9B A;  1GUX A;  3LQ5 B;  1H27 B;  4KRD B;  4BCF B;  5IF1 B;  1FIN B;  2R7G A;  2I53 A;  2WIH B;  3K7A M;  2WMA B;  3DOG B;  3TN8 B;  4ROC A;  3BLH B;  3BHU B;  1JOW A;  1H25 B;  1H26 B;  2UZL B;  2WFY B;  4I3Z B;  4BCK B;  2EUF A;  5CEI B;  3EID B;  2WIP B;  2JGZ B;  1H28 B;  3BHT B;  2W96 A;  1H24 B;  2I40 B;  4CFX B;  4F7L B;  2PMI B;  4EOL B;  4ELL A;  1W98 B;  4BCN D;  2C5X B;  4ROE A;  5ACB A;  4ROD A;  4OGR B;  2WHB B;  5L2W B;  1ZP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...