1PKDB

The crystal structure of ucn-01 in complex with phospho-cdk2/cyclin a
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords Cell division protein kinase 2
publication title The Crystal Structure of UCN-01 in Complex with Phospho-CDK2/Cyclin A
rcsb
source organism Homo sapiens
total genus 94
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1pkdB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1pkdB02
4BCNB 1KXUA 4EOIB 4EOMB 3EIDB 5HNBB 4EOJB 5CEIB 4BCJB 4BCPB 4EORB 4EC9B 5LQFB 1JOWA 4OGRB 3QHWB 4EOSB 1JSTB 2PK9B 1OIYB 2IVXA 2WIHB 1H1QB 1W98B 4BCHB 1VOLA 2I53A 4FX3B 2PMIB 3H4CA 4CRLB 4EOKB 3EJ1B 4YOOA 2IW8B 2WPAB 2B9RA 2PK2A 1N4MA 1OL1B 5IF1B 1OL2B 4CFVB 5L2WB 1JKWA 2UZEB 4F7SB 1P5EB 1FVVB 1GUXB 4CXAB 5IDPB 5LMKB 3MIAB 4RODA 4YOZA 1H1RB 2C4GB 1H27B 2C5VB 1QMZB 3BLQB 2W2HA 1D3UB 1OI9B 1E9HB 2WXVB 5IDNB 3DDQB 2WFYB 1UNGD 1OKVB 4BCOB 3BHUB 3DOGB 3MY1B 4YOSA 5EFQB 3DDPB 1H1SB 2R7GA 3BHVB 1URCB 3G33B 4NSTB 4BCKB 2WIPB 4CFWB 1H28B 5BNJB 4F6WB 1OIUB 1PKDB 2F2CA 4IMYB 2BPMB 1UNLD 2WHBB 5ICPB 1O9KB 2W99A 1AISB 1ZP2A 2BKZB 2CCHB 5HBEB 4UN0A 4BCFB 2UZBB 1C9BA 2X1NB 1GUXA 4I3ZB 4KRCB 2V22B 4G6LB 4ROEA 2CJMB 3EOCB 4BCIB 3LQ5B 2UUEB 3O0GD 2W9FA 4CFNB 3MY5B 3RGFB 2IW6B 4ELLA 4F7NB 4EOLB 2IW9B 2WEVB 1H25B 4F7LB 2I40B 3TNHB 4EOQB 4F6SB 4KRDB 1TFBA 3BLHB 1GY3B 5HBJB 1VYWB 4CFXB 1F5QB 1BU2A 3QHRB 4YC3B 1H1PB 2C5OB 2G9XB 4CFUB 3TNIB 1H26B 1JSUB 1O9KA 3K7AM 4BCQD 4OR5B 3BLRB 1GH6B 2C6TB 4Y72B 3BHTB 5HQ0B 4F6UB 1H4LD 1OKWB 4F70B 5I5ZB 2UZLB 2WMBB 4II5B 3TN8B 4BCQB 4BCMD 4ELJA 2JGZB 2QDJA 3MI9B 5CYIB 1UNHD 1XO2A 1FINB 1VINA 4ROCA 4BCMB 4EC8B 2EUFA 2W96A 4CFMB 4TTHA 1AD6A 2CCIB 2W9ZA 3TNWB 4EONB 2PHGA 4CFUD 4BCGB 4F7JB 5HBHB 2WMAB 2UZDB 3M03A 4EOOB 4EOPB 5ACBA 2C5XB 4BCND 2C5NB 1G3NC 1OGUB 5FGKB 3F5XB 3POMA 5HVYB 1H24B
chains in the Genus database with same CATH superfamily
1KXUA 5CEIB 4OB2B 3QYHB 2IVXA 1H1QB 4BCHB 2I53A 4CRLB 4EOKB 3EJ1B 3QYEA 4JX6A 2PK2A 1N4MA 1OL1B 5IF1B 4HLQA 2CZ6B 2DXBB 1QMZB 2IN3A 1D3UB 1IREB 3TW6A 4BCOB 1UNGD 3A8OB 4NSTB 3NDQA 1OIUB 2F2CA 5ICPB 5EJCA 3X24B 4HNUA 2PJQA 2BS2A 4BCFB 2BS4A 4KRCB 3EOCB 4CFNB 3MY5B 3RGFB 2IW9B 4EOQB 1AHJB 3TW7A 4CFXB 4ZGJB 1BU2A 4YC3B 2CZ7B 2QGSA 4CFUB 1O9KA 3BLRB 5HQ0B 1H4LD 2UZLB 2WMBB 4BCMD 3HHTB 4ELJA 2QDJA 3MI9B 1XO2A 1FINB 2W96A 4TTHA 1AD6A 3TNWB 3HBLA 5HBHB 3A8LB 3QZ9B 3F5XB 1UGPB 3X26B 4BCNB 4EOJB 4BCJB 4EC9B 1JOWA 1UGQB 2WIHB 1W98B 5DQWA 4FX3B 2PMIB 4YOOA 3A8HB 4OB1B 5L2WB 2UZEB 4F7SB 1P5EB 4MIMA 5IDPB 3VKGA 1H27B 2W2HA 1OI9B 1E9HB 2KR6A 3DOGB 5EFQB 3BHVB 3G33B 4F6WB 2DMEA 2BPMB 1UNLD 3GTMS 4AKGA 1O9KB 2ZPIB 1ZP2A 2BKZB 2CCHB 4UN0A 4QSHA 1GUXA 4I3ZB 3O0GD 2W9FA 4ELLA 2IW6B 1UGSB 3BG9A 4BBRM 3X20B 4F7LB 3TNHB 3WVEB 3BLHB 5HBJB 2QDYB 3VYGB 3A8MB 2G9XB 2C5OB 2KMGA 1H26B 4BXXX 1JSUB 4OR5B 4Y72B 3BHTB 2ZPHB 5CYIB 1UNHD 4AKHA 1VINA 4EONB 4AI6A 2WMAB 4EOPB 2C5XB 4BCND 1G3NC 4MFDA 4NC6A 3POMA 5HVYB 1H24B 4EOMB 3EIDB 4BCPB 4EOSB 2G77A 2PK9B 1VOLA 4HNVA 3H4CA 2IW8B 2D0QB 2WPAB 1OL2B 4CFVB 3HZJA 2DPPB 1GUXB 4CXAB 3MIAB 4RODA 1V29B 4YOZA 1H1RB 3BLQB 2WXVB 5IDNB 2WFYB 3BHUB 3DDPB 4M6VA 1URCB 4BCKB 4CFWB 3VKHA 4ZGEB 5BNJB 1AISB 3BG3A 2LW4A 5HBEB 2ZCFB 2UZBB 1C9BA 2X1NB 1FKMA 3HO8A 2V22B 4ROEA 4BCIB 2CJMB 3LQ5B 3B57A 4AKIA 4EOLB 1ENWA 4F6SB 4BY1X 1TFBA 1F5QB 4HNTA 3PO3S 3QHRB 1H1PB 3KHIA 4OB3B 3QYGB 1UGRB 4ZGDB 2QQ8A 4BCQB 4II5B 2QF7A 3QZ5B 4ROCA 4EC8B 2EUFA 4CFMB 2W9ZA 4CFUD 4F7JB 3M03A 4BY7X 5ACBA 5FGKB 1TD6A 1QLBA 4EOIB 5HNBB 4EORB 5LQFB 4OGRB 3QHWB 1JSTB 1OIYB 3QWLA 4JX5A 4HL4A 3A8GB 2DD4B 4LOCA 2B9RA 3QXEB 1JKWA 1FVVB 3DTOA 5IHYA 5LMKB 4BBSM 3X25B 2C4GB 2C5VB 3DDQB 1OKVB 3MY1B 4YOSA 1H1SB 2R7GA 3VYHB 2WIPB 1H28B 2WJ9A 2QFZA 1PKDB 4IMYB 2WHBB 2ZPBB 2W99A 2CYZB 2DD5B 3HB9A 4G6LB 1E7PA 3WVDB 2ZPFB 2UUEB 4F7NB 2CZ1B 2WEVB 1H25B 2I40B 4KRDB 3DJBA 1GY3B 1VYWB 3DL1A 2ZPGB 3TNIB 2AHJB 3K7AM 4BCQD 1GH6B 2BS3A 2C6TB 2ZPEB 4Z6YA 4F6UB 1OKWB 4F70B 5I5ZB 3TN8B 2JGZB 5DQVA 4JX4A 3BG5A 4BCMB 2CCIB 4OB0B 2PHGA 4BCGB 3X28B 4FM4B 2ZZDB 2UZDB 4MFEA 4EOOB 2C5NB 1OGUB 2CZ0B 3QYBA 2DXCB
chains in the Genus database with same CATH topology
4BCNB 1KXUA 4EOIB 4EOMB 3EIDB 5HNBB 4EOJB 5CEIB 4BCJB 4BCPB 4EORB 4EC9B 5LQFB 1JOWA 4OGRB 3QHWB 4EOSB 1JSTB 2PK9B 1OIYB 2IVXA 2WIHB 1H1QB 1W98B 4BCHB 1VOLA 2I53A 4FX3B 2PMIB 3H4CA 4CRLB 4EOKB 3EJ1B 4YOOA 2IW8B 2WPAB 2B9RA 2PK2A 1N4MA 1OL1B 5IF1B 1OL2B 4CFVB 5L2WB 1JKWA 2UZEB 4F7SB 1P5EB 1FVVB 1GUXB 4CXAB 5IDPB 5LMKB 3MIAB 4RODA 4YOZA 1H1RB 2C4GB 1H27B 2C5VB 1QMZB 3BLQB 2W2HA 1D3UB 1OI9B 1E9HB 2WXVB 5IDNB 3DDQB 2WFYB 1UNGD 1OKVB 4BCOB 3BHUB 3DOGB 3MY1B 4YOSA 5EFQB 3DDPB 1H1SB 2R7GA 3BHVB 1URCB 3G33B 4NSTB 4BCKB 2WIPB 4CFWB 1H28B 5BNJB 4F6WB 1OIUB 1PKDB 2F2CA 4IMYB 2BPMB 1UNLD 2WHBB 5ICPB 1O9KB 2W99A 1AISB 1ZP2A 2BKZB 2CCHB 5HBEB 4UN0A 4BCFB 2UZBB 1C9BA 2X1NB 1GUXA 4I3ZB 4KRCB 2V22B 4G6LB 4ROEA 2CJMB 3EOCB 4BCIB 3LQ5B 2UUEB 3O0GD 2W9FA 4CFNB 3MY5B 3RGFB 2IW6B 4ELLA 4F7NB 4EOLB 2IW9B 2WEVB 1H25B 4F7LB 2I40B 3TNHB 4EOQB 4F6SB 4KRDB 1TFBA 3BLHB 1GY3B 5HBJB 1VYWB 4CFXB 1F5QB 1BU2A 3QHRB 4YC3B 1H1PB 2C5OB 2G9XB 4CFUB 3TNIB 1H26B 1JSUB 1O9KA 3K7AM 4BCQD 4OR5B 3BLRB 1GH6B 2C6TB 4Y72B 3BHTB 5HQ0B 4F6UB 1H4LD 1OKWB 4F70B 5I5ZB 2UZLB 2WMBB 4II5B 3TN8B 4BCQB 4BCMD 4ELJA 2JGZB 2QDJA 3MI9B 5CYIB 1UNHD 1XO2A 1FINB 1VINA 4ROCA 4BCMB 4EC8B 2EUFA 2W96A 4CFMB 4TTHA 1AD6A 2CCIB 2W9ZA 3TNWB 4EONB 2PHGA 4CFUD 4BCGB 4F7JB 5HBHB 2WMAB 2UZDB 3M03A 4EOOB 4EOPB 5ACBA 2C5XB 4BCND 2C5NB 1G3NC 1OGUB 5FGKB 3F5XB 3POMA 5HVYB 1H24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCN B;  1KXU A;  4EOI B;  4EOM B;  3EID B;  5HNB B;  4EOJ B;  5CEI B;  4BCJ B;  4BCP B;  4EOR B;  4EC9 B;  5LQF B;  1JOW A;  4OGR B;  3QHW B;  4EOS B;  1JST B;  2PK9 B;  1OIY B;  2IVX A;  2WIH B;  1H1Q B;  1W98 B;  4BCH B;  1VOL A;  2I53 A;  4FX3 B;  2PMI B;  3H4C A;  4CRL B;  4EOK B;  3EJ1 B;  4YOO A;  2IW8 B;  2WPA B;  2B9R A;  2PK2 A;  1N4M A;  1OL1 B;  5IF1 B;  1OL2 B;  4CFV B;  5L2W B;  1JKW A;  2UZE B;  4F7S B;  1P5E B;  1FVV B;  1GUX B;  4CXA B;  5IDP B;  5LMK B;  3MIA B;  4ROD A;  4YOZ A;  1H1R B;  2C4G B;  1H27 B;  2C5V B;  1QMZ B;  3BLQ B;  2W2H A;  1D3U B;  1OI9 B;  1E9H B;  2WXV B;  5IDN B;  3DDQ B;  2WFY B;  1UNG D;  1OKV B;  4BCO B;  3BHU B;  3DOG B;  3MY1 B;  4YOS A;  5EFQ B;  3DDP B;  1H1S B;  2R7G A;  3BHV B;  1URC B;  3G33 B;  4NST B;  4BCK B;  2WIP B;  4CFW B;  1H28 B;  5BNJ B;  4F6W B;  1OIU B;  1PKD B;  2F2C A;  4IMY B;  2BPM B;  1UNL D;  2WHB B;  5ICP B;  1O9K B;  2W99 A;  1AIS B;  1ZP2 A;  2BKZ B;  2CCH B;  5HBE B;  4UN0 A;  4BCF B;  2UZB B;  1C9B A;  2X1N B;  1GUX A;  4I3Z B;  4KRC B;  2V22 B;  4G6L B;  4ROE A;  2CJM B;  3EOC B;  4BCI B;  3LQ5 B;  2UUE B;  3O0G D;  2W9F A;  4CFN B;  3MY5 B;  3RGF B;  2IW6 B;  4ELL A;  4F7N B;  4EOL B;  2IW9 B;  2WEV B;  1H25 B;  4F7L B;  2I40 B;  3TNH B;  4EOQ B;  4F6S B;  4KRD B;  1TFB A;  3BLH B;  1GY3 B;  5HBJ B;  1VYW B;  4CFX B;  1F5Q B;  1BU2 A;  3QHR B;  4YC3 B;  1H1P B;  2C5O B;  2G9X B;  4CFU B;  3TNI B;  1H26 B;  1JSU B;  1O9K A;  3K7A M;  4BCQ D;  4OR5 B;  3BLR B;  1GH6 B;  2C6T B;  4Y72 B;  3BHT B;  5HQ0 B;  4F6U B;  1H4L D;  1OKW B;  4F70 B;  5I5Z B;  2UZL B;  2WMB B;  4II5 B;  3TN8 B;  4BCQ B;  4BCM D;  4ELJ A;  2JGZ B;  2QDJ A;  3MI9 B;  5CYI B;  1UNH D;  1XO2 A;  1FIN B;  1VIN A;  4ROC A;  4BCM B;  4EC8 B;  2EUF A;  2W96 A;  4CFM B;  4TTH A;  1AD6 A;  2CCI B;  2W9Z A;  3TNW B;  4EON B;  2PHG A;  4CFU D;  4BCG B;  4F7J B;  5HBH B;  2WMA B;  2UZD B;  3M03 A;  4EOO B;  4EOP B;  5ACB A;  2C5X B;  4BCN D;  2C5N B;  1G3N C;  1OGU B;  5FGK B;  3F5X B;  3POM A;  5HVY B;  1H24 B; 
#chains in the Genus database with same CATH topology
 1KXU A;  5CEI B;  4OB2 B;  3QYH B;  2IVX A;  1H1Q B;  4BCH B;  2I53 A;  4CRL B;  4EOK B;  3EJ1 B;  3QYE A;  4JX6 A;  2PK2 A;  1N4M A;  1OL1 B;  5IF1 B;  4HLQ A;  2CZ6 B;  2DXB B;  1QMZ B;  2IN3 A;  1D3U B;  1IRE B;  3TW6 A;  4BCO B;  1UNG D;  3A8O B;  4NST B;  3NDQ A;  1OIU B;  2F2C A;  5ICP B;  5EJC A;  3X24 B;  4HNU A;  2PJQ A;  2BS2 A;  4BCF B;  2BS4 A;  4KRC B;  3EOC B;  4CFN B;  3MY5 B;  3RGF B;  2IW9 B;  4EOQ B;  1AHJ B;  3TW7 A;  4CFX B;  4ZGJ B;  1BU2 A;  4YC3 B;  2CZ7 B;  2QGS A;  4CFU B;  1O9K A;  3BLR B;  5HQ0 B;  1H4L D;  2UZL B;  2WMB B;  4BCM D;  3HHT B;  4ELJ A;  2QDJ A;  3MI9 B;  1XO2 A;  1FIN B;  2W96 A;  4TTH A;  1AD6 A;  3TNW B;  3HBL A;  5HBH B;  3A8L B;  3QZ9 B;  3F5X B;  1UGP B;  3X26 B;  4BCN B;  4EOJ B;  4BCJ B;  4EC9 B;  1JOW A;  1UGQ B;  2WIH B;  1W98 B;  5DQW A;  4FX3 B;  2PMI B;  4YOO A;  3A8H B;  4OB1 B;  5L2W B;  2UZE B;  4F7S B;  1P5E B;  4MIM A;  5IDP B;  3VKG A;  1H27 B;  2W2H A;  1OI9 B;  1E9H B;  2KR6 A;  3DOG B;  5EFQ B;  3BHV B;  3G33 B;  4F6W B;  2DME A;  2BPM B;  1UNL D;  3GTM S;  4AKG A;  1O9K B;  2ZPI B;  1ZP2 A;  2BKZ B;  2CCH B;  4UN0 A;  4QSH A;  1GUX A;  4I3Z B;  3O0G D;  2W9F A;  4ELL A;  2IW6 B;  1UGS B;  3BG9 A;  4BBR M;  3X20 B;  4F7L B;  3TNH B;  3WVE B;  3BLH B;  5HBJ B;  2QDY B;  3VYG B;  3A8M B;  2G9X B;  2C5O B;  2KMG A;  1H26 B;  4BXX X;  1JSU B;  4OR5 B;  4Y72 B;  3BHT B;  2ZPH B;  5CYI B;  1UNH D;  4AKH A;  1VIN A;  4EON B;  4AI6 A;  2WMA B;  4EOP B;  2C5X B;  4BCN D;  1G3N C;  4MFD A;  4NC6 A;  3POM A;  5HVY B;  1H24 B;  4EOM B;  3EID B;  4BCP B;  4EOS B;  2G77 A;  2PK9 B;  1VOL A;  4HNV A;  3H4C A;  2IW8 B;  2D0Q B;  2WPA B;  1OL2 B;  4CFV B;  3HZJ A;  2DPP B;  1GUX B;  4CXA B;  3MIA B;  4ROD A;  1V29 B;  4YOZ A;  1H1R B;  3BLQ B;  2WXV B;  5IDN B;  2WFY B;  3BHU B;  3DDP B;  4M6V A;  1URC B;  4BCK B;  4CFW B;  3VKH A;  4ZGE B;  5BNJ B;  1AIS B;  3BG3 A;  2LW4 A;  5HBE B;  2ZCF B;  2UZB B;  1C9B A;  2X1N B;  1FKM A;  3HO8 A;  2V22 B;  4ROE A;  4BCI B;  2CJM B;  3LQ5 B;  3B57 A;  4AKI A;  4EOL B;  1ENW A;  4F6S B;  4BY1 X;  1TFB A;  1F5Q B;  4HNT A;  3PO3 S;  3QHR B;  1H1P B;  3KHI A;  4OB3 B;  3QYG B;  1UGR B;  4ZGD B;  2QQ8 A;  4BCQ B;  4II5 B;  2QF7 A;  3QZ5 B;  4ROC A;  4EC8 B;  2EUF A;  4CFM B;  2W9Z A;  4CFU D;  4F7J B;  3M03 A;  4BY7 X;  5ACB A;  5FGK B;  1TD6 A;  1QLB A;  4EOI B;  5HNB B;  4EOR B;  5LQF B;  4OGR B;  3QHW B;  1JST B;  1OIY B;  3QWL A;  4JX5 A;  4HL4 A;  3A8G B;  2DD4 B;  4LOC A;  2B9R A;  3QXE B;  1JKW A;  1FVV B;  3DTO A;  5IHY A;  5LMK B;  4BBS M;  3X25 B;  2C4G B;  2C5V B;  3DDQ B;  1OKV B;  3MY1 B;  4YOS A;  1H1S B;  2R7G A;  3VYH B;  2WIP B;  1H28 B;  2WJ9 A;  2QFZ A;  1PKD B;  4IMY B;  2WHB B;  2ZPB B;  2W99 A;  2CYZ B;  2DD5 B;  3HB9 A;  4G6L B;  1E7P A;  3WVD B;  2ZPF B;  2UUE B;  4F7N B;  2CZ1 B;  2WEV B;  1H25 B;  2I40 B;  4KRD B;  3DJB A;  1GY3 B;  1VYW B;  3DL1 A;  2ZPG B;  3TNI B;  2AHJ B;  3K7A M;  4BCQ D;  1GH6 B;  2BS3 A;  2C6T B;  2ZPE B;  4Z6Y A;  4F6U B;  1OKW B;  4F70 B;  5I5Z B;  3TN8 B;  2JGZ B;  5DQV A;  4JX4 A;  3BG5 A;  4BCM B;  2CCI B;  4OB0 B;  2PHG A;  4BCG B;  3X28 B;  4FM4 B;  2ZZD B;  2UZD B;  4MFE A;  4EOO B;  2C5N B;  1OGU B;  2CZ0 B;  3QYB A;  2DXC B; 
#chains in the Genus database with same CATH homology
 4BCN B;  1KXU A;  4EOI B;  4EOM B;  3EID B;  5HNB B;  4EOJ B;  5CEI B;  4BCJ B;  4BCP B;  4EOR B;  4EC9 B;  5LQF B;  1JOW A;  4OGR B;  3QHW B;  4EOS B;  1JST B;  2PK9 B;  1OIY B;  2IVX A;  2WIH B;  1H1Q B;  1W98 B;  4BCH B;  1VOL A;  2I53 A;  4FX3 B;  2PMI B;  3H4C A;  4CRL B;  4EOK B;  3EJ1 B;  4YOO A;  2IW8 B;  2WPA B;  2B9R A;  2PK2 A;  1N4M A;  1OL1 B;  5IF1 B;  1OL2 B;  4CFV B;  5L2W B;  1JKW A;  2UZE B;  4F7S B;  1P5E B;  1FVV B;  1GUX B;  4CXA B;  5IDP B;  5LMK B;  3MIA B;  4ROD A;  4YOZ A;  1H1R B;  2C4G B;  1H27 B;  2C5V B;  1QMZ B;  3BLQ B;  2W2H A;  1D3U B;  1OI9 B;  1E9H B;  2WXV B;  5IDN B;  3DDQ B;  2WFY B;  1UNG D;  1OKV B;  4BCO B;  3BHU B;  3DOG B;  3MY1 B;  4YOS A;  5EFQ B;  3DDP B;  1H1S B;  2R7G A;  3BHV B;  1URC B;  3G33 B;  4NST B;  4BCK B;  2WIP B;  4CFW B;  1H28 B;  5BNJ B;  4F6W B;  1OIU B;  1PKD B;  2F2C A;  4IMY B;  2BPM B;  1UNL D;  2WHB B;  5ICP B;  1O9K B;  2W99 A;  1AIS B;  1ZP2 A;  2BKZ B;  2CCH B;  5HBE B;  4UN0 A;  4BCF B;  2UZB B;  1C9B A;  2X1N B;  1GUX A;  4I3Z B;  4KRC B;  2V22 B;  4G6L B;  4ROE A;  2CJM B;  3EOC B;  4BCI B;  3LQ5 B;  2UUE B;  3O0G D;  2W9F A;  4CFN B;  3MY5 B;  3RGF B;  2IW6 B;  4ELL A;  4F7N B;  4EOL B;  2IW9 B;  2WEV B;  1H25 B;  4F7L B;  2I40 B;  3TNH B;  4EOQ B;  4F6S B;  4KRD B;  1TFB A;  3BLH B;  1GY3 B;  5HBJ B;  1VYW B;  4CFX B;  1F5Q B;  1BU2 A;  3QHR B;  4YC3 B;  1H1P B;  2C5O B;  2G9X B;  4CFU B;  3TNI B;  1H26 B;  1JSU B;  1O9K A;  3K7A M;  4BCQ D;  4OR5 B;  3BLR B;  1GH6 B;  2C6T B;  4Y72 B;  3BHT B;  5HQ0 B;  4F6U B;  1H4L D;  1OKW B;  4F70 B;  5I5Z B;  2UZL B;  2WMB B;  4II5 B;  3TN8 B;  4BCQ B;  4BCM D;  4ELJ A;  2JGZ B;  2QDJ A;  3MI9 B;  5CYI B;  1UNH D;  1XO2 A;  1FIN B;  1VIN A;  4ROC A;  4BCM B;  4EC8 B;  2EUF A;  2W96 A;  4CFM B;  4TTH A;  1AD6 A;  2CCI B;  2W9Z A;  3TNW B;  4EON B;  2PHG A;  4CFU D;  4BCG B;  4F7J B;  5HBH B;  2WMA B;  2UZD B;  3M03 A;  4EOO B;  4EOP B;  5ACB A;  2C5X B;  4BCN D;  2C5N B;  1G3N C;  1OGU B;  5FGK B;  3F5X B;  3POM A;  5HVY B;  1H24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...